data_5ONG
# 
_entry.id   5ONG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5ONG         
WWPDB D_1200006072 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        'related x-ray structure' 
_pdbx_database_related.db_id          5OMX 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5ONG 
_pdbx_database_status.recvd_initial_deposition_date   2017-08-03 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Frouws, T.D.'   1 ? 
'Barth, P.D.'    2 ? 
'Richmond, T.J.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Mol. Biol.' 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            430 
_citation.language                  ? 
_citation.page_first                45 
_citation.page_last                 57 
_citation.title                     'Site-Specific Disulfide Crosslinked Nucleosomes with Enhanced Stability.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2017.10.029 
_citation.pdbx_database_id_PubMed   29113904 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Frouws, T.D.'   1 
primary 'Barth, P.D.'    2 
primary 'Richmond, T.J.' 3 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5ONG 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     106.240 
_cell.length_a_esd                 ? 
_cell.length_b                     183.130 
_cell.length_b_esd                 ? 
_cell.length_c                     109.490 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5ONG 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA (147-MER)'      45430.148 1  ? ?             ? ? 
2 polymer     man 'DNA (147-MER)'      45421.133 1  ? ?             ? ? 
3 polymer     man 'Histone H3.2'       15217.812 2  ? 'C110A, R40C' ? ? 
4 polymer     man 'Histone H4'         11394.426 2  ? ?             ? ? 
5 polymer     man 'Histone H2A'        13978.241 2  ? ?             ? ? 
6 polymer     man 'Histone H2B 1.1'    13524.752 2  ? ?             ? ? 
7 non-polymer syn 'MANGANESE (II) ION' 54.938    20 ? ?             ? ? 
8 non-polymer nat 'CHLORIDE ION'       35.453    4  ? ?             ? ? 
9 water       nat water                18.015    87 ? ?             ? ? 
# 
_entity_name_com.entity_id   6 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no yes 
;(DA)(DT)(DC)(DC)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DG)(DT)(DC)(DC)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DA)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DG)(DG)(DA)(DC)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(G47)(DG)(DA)(DT)
;
;ATCCATATCCACCTGGTCCTACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGAATCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTAGGACCAGGTGGATATGGAT
;
I   ? 
2 polydeoxyribonucleotide no yes 
;(DA)(DT)(DC)(DC)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DG)(DT)(DC)(DC)(DT)
(DA)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)(DG)
(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)(DC)
(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DG)(DG)(DA)(DT)(DT)(DC)(DC)(DA)(DG)(DC)
(DT)(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)
(DG)(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)
(DT)(DG)(DG)(DT)(DA)(DG)(DT)(DA)(DG)(DG)(DA)(DC)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)
(DT)(DA)(DT)(G47)(DG)(DA)(DT)
;
;ATCCATATCCACCTGGTCCTACTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTGGATTCCAGC
TGAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGTAGGACCAGGTGGATATGGAT
;
J   ? 
3 'polypeptide(L)'        no no  
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHCYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHCYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
4 'polypeptide(L)'        no no  
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
5 'polypeptide(L)'        no no  
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
C,G ? 
6 'polypeptide(L)'        no no  
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DC  n 
1 4   DC  n 
1 5   DA  n 
1 6   DT  n 
1 7   DA  n 
1 8   DT  n 
1 9   DC  n 
1 10  DC  n 
1 11  DA  n 
1 12  DC  n 
1 13  DC  n 
1 14  DT  n 
1 15  DG  n 
1 16  DG  n 
1 17  DT  n 
1 18  DC  n 
1 19  DC  n 
1 20  DT  n 
1 21  DA  n 
1 22  DC  n 
1 23  DT  n 
1 24  DA  n 
1 25  DC  n 
1 26  DC  n 
1 27  DA  n 
1 28  DA  n 
1 29  DA  n 
1 30  DA  n 
1 31  DG  n 
1 32  DT  n 
1 33  DG  n 
1 34  DT  n 
1 35  DA  n 
1 36  DT  n 
1 37  DT  n 
1 38  DT  n 
1 39  DG  n 
1 40  DG  n 
1 41  DA  n 
1 42  DA  n 
1 43  DA  n 
1 44  DC  n 
1 45  DT  n 
1 46  DG  n 
1 47  DC  n 
1 48  DT  n 
1 49  DC  n 
1 50  DC  n 
1 51  DA  n 
1 52  DT  n 
1 53  DC  n 
1 54  DA  n 
1 55  DA  n 
1 56  DA  n 
1 57  DA  n 
1 58  DG  n 
1 59  DG  n 
1 60  DC  n 
1 61  DA  n 
1 62  DT  n 
1 63  DG  n 
1 64  DT  n 
1 65  DT  n 
1 66  DC  n 
1 67  DA  n 
1 68  DG  n 
1 69  DC  n 
1 70  DT  n 
1 71  DG  n 
1 72  DG  n 
1 73  DA  n 
1 74  DA  n 
1 75  DT  n 
1 76  DC  n 
1 77  DC  n 
1 78  DA  n 
1 79  DG  n 
1 80  DC  n 
1 81  DT  n 
1 82  DG  n 
1 83  DA  n 
1 84  DA  n 
1 85  DC  n 
1 86  DA  n 
1 87  DT  n 
1 88  DG  n 
1 89  DC  n 
1 90  DC  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DT  n 
1 95  DG  n 
1 96  DA  n 
1 97  DT  n 
1 98  DG  n 
1 99  DG  n 
1 100 DA  n 
1 101 DG  n 
1 102 DC  n 
1 103 DA  n 
1 104 DG  n 
1 105 DT  n 
1 106 DT  n 
1 107 DT  n 
1 108 DC  n 
1 109 DC  n 
1 110 DA  n 
1 111 DA  n 
1 112 DA  n 
1 113 DT  n 
1 114 DA  n 
1 115 DC  n 
1 116 DA  n 
1 117 DC  n 
1 118 DT  n 
1 119 DT  n 
1 120 DT  n 
1 121 DT  n 
1 122 DG  n 
1 123 DG  n 
1 124 DT  n 
1 125 DA  n 
1 126 DG  n 
1 127 DT  n 
1 128 DA  n 
1 129 DG  n 
1 130 DG  n 
1 131 DA  n 
1 132 DC  n 
1 133 DC  n 
1 134 DA  n 
1 135 DG  n 
1 136 DG  n 
1 137 DT  n 
1 138 DG  n 
1 139 DG  n 
1 140 DA  n 
1 141 DT  n 
1 142 DA  n 
1 143 DT  n 
1 144 G47 n 
1 145 DG  n 
1 146 DA  n 
1 147 DT  n 
2 1   DA  n 
2 2   DT  n 
2 3   DC  n 
2 4   DC  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DA  n 
2 12  DC  n 
2 13  DC  n 
2 14  DT  n 
2 15  DG  n 
2 16  DG  n 
2 17  DT  n 
2 18  DC  n 
2 19  DC  n 
2 20  DT  n 
2 21  DA  n 
2 22  DC  n 
2 23  DT  n 
2 24  DA  n 
2 25  DC  n 
2 26  DC  n 
2 27  DA  n 
2 28  DA  n 
2 29  DA  n 
2 30  DA  n 
2 31  DG  n 
2 32  DT  n 
2 33  DG  n 
2 34  DT  n 
2 35  DA  n 
2 36  DT  n 
2 37  DT  n 
2 38  DT  n 
2 39  DG  n 
2 40  DG  n 
2 41  DA  n 
2 42  DA  n 
2 43  DA  n 
2 44  DC  n 
2 45  DT  n 
2 46  DG  n 
2 47  DC  n 
2 48  DT  n 
2 49  DC  n 
2 50  DC  n 
2 51  DA  n 
2 52  DT  n 
2 53  DC  n 
2 54  DA  n 
2 55  DA  n 
2 56  DA  n 
2 57  DA  n 
2 58  DG  n 
2 59  DG  n 
2 60  DC  n 
2 61  DA  n 
2 62  DT  n 
2 63  DG  n 
2 64  DT  n 
2 65  DT  n 
2 66  DC  n 
2 67  DA  n 
2 68  DG  n 
2 69  DC  n 
2 70  DT  n 
2 71  DG  n 
2 72  DG  n 
2 73  DA  n 
2 74  DT  n 
2 75  DT  n 
2 76  DC  n 
2 77  DC  n 
2 78  DA  n 
2 79  DG  n 
2 80  DC  n 
2 81  DT  n 
2 82  DG  n 
2 83  DA  n 
2 84  DA  n 
2 85  DC  n 
2 86  DA  n 
2 87  DT  n 
2 88  DG  n 
2 89  DC  n 
2 90  DC  n 
2 91  DT  n 
2 92  DT  n 
2 93  DT  n 
2 94  DT  n 
2 95  DG  n 
2 96  DA  n 
2 97  DT  n 
2 98  DG  n 
2 99  DG  n 
2 100 DA  n 
2 101 DG  n 
2 102 DC  n 
2 103 DA  n 
2 104 DG  n 
2 105 DT  n 
2 106 DT  n 
2 107 DT  n 
2 108 DC  n 
2 109 DC  n 
2 110 DA  n 
2 111 DA  n 
2 112 DA  n 
2 113 DT  n 
2 114 DA  n 
2 115 DC  n 
2 116 DA  n 
2 117 DC  n 
2 118 DT  n 
2 119 DT  n 
2 120 DT  n 
2 121 DT  n 
2 122 DG  n 
2 123 DG  n 
2 124 DT  n 
2 125 DA  n 
2 126 DG  n 
2 127 DT  n 
2 128 DA  n 
2 129 DG  n 
2 130 DG  n 
2 131 DA  n 
2 132 DC  n 
2 133 DC  n 
2 134 DA  n 
2 135 DG  n 
2 136 DG  n 
2 137 DT  n 
2 138 DG  n 
2 139 DG  n 
2 140 DA  n 
2 141 DT  n 
2 142 DA  n 
2 143 DT  n 
2 144 G47 n 
2 145 DG  n 
2 146 DA  n 
2 147 DT  n 
3 1   ALA n 
3 2   ARG n 
3 3   THR n 
3 4   LYS n 
3 5   GLN n 
3 6   THR n 
3 7   ALA n 
3 8   ARG n 
3 9   LYS n 
3 10  SER n 
3 11  THR n 
3 12  GLY n 
3 13  GLY n 
3 14  LYS n 
3 15  ALA n 
3 16  PRO n 
3 17  ARG n 
3 18  LYS n 
3 19  GLN n 
3 20  LEU n 
3 21  ALA n 
3 22  THR n 
3 23  LYS n 
3 24  ALA n 
3 25  ALA n 
3 26  ARG n 
3 27  LYS n 
3 28  SER n 
3 29  ALA n 
3 30  PRO n 
3 31  ALA n 
3 32  THR n 
3 33  GLY n 
3 34  GLY n 
3 35  VAL n 
3 36  LYS n 
3 37  LYS n 
3 38  PRO n 
3 39  HIS n 
3 40  CYS n 
3 41  TYR n 
3 42  ARG n 
3 43  PRO n 
3 44  GLY n 
3 45  THR n 
3 46  VAL n 
3 47  ALA n 
3 48  LEU n 
3 49  ARG n 
3 50  GLU n 
3 51  ILE n 
3 52  ARG n 
3 53  ARG n 
3 54  TYR n 
3 55  GLN n 
3 56  LYS n 
3 57  SER n 
3 58  THR n 
3 59  GLU n 
3 60  LEU n 
3 61  LEU n 
3 62  ILE n 
3 63  ARG n 
3 64  LYS n 
3 65  LEU n 
3 66  PRO n 
3 67  PHE n 
3 68  GLN n 
3 69  ARG n 
3 70  LEU n 
3 71  VAL n 
3 72  ARG n 
3 73  GLU n 
3 74  ILE n 
3 75  ALA n 
3 76  GLN n 
3 77  ASP n 
3 78  PHE n 
3 79  LYS n 
3 80  THR n 
3 81  ASP n 
3 82  LEU n 
3 83  ARG n 
3 84  PHE n 
3 85  GLN n 
3 86  SER n 
3 87  SER n 
3 88  ALA n 
3 89  VAL n 
3 90  MET n 
3 91  ALA n 
3 92  LEU n 
3 93  GLN n 
3 94  GLU n 
3 95  ALA n 
3 96  SER n 
3 97  GLU n 
3 98  ALA n 
3 99  TYR n 
3 100 LEU n 
3 101 VAL n 
3 102 ALA n 
3 103 LEU n 
3 104 PHE n 
3 105 GLU n 
3 106 ASP n 
3 107 THR n 
3 108 ASN n 
3 109 LEU n 
3 110 ALA n 
3 111 ALA n 
3 112 ILE n 
3 113 HIS n 
3 114 ALA n 
3 115 LYS n 
3 116 ARG n 
3 117 VAL n 
3 118 THR n 
3 119 ILE n 
3 120 MET n 
3 121 PRO n 
3 122 LYS n 
3 123 ASP n 
3 124 ILE n 
3 125 GLN n 
3 126 LEU n 
3 127 ALA n 
3 128 ARG n 
3 129 ARG n 
3 130 ILE n 
3 131 ARG n 
3 132 GLY n 
3 133 GLU n 
3 134 ARG n 
3 135 ALA n 
4 1   MET n 
4 2   SER n 
4 3   GLY n 
4 4   ARG n 
4 5   GLY n 
4 6   LYS n 
4 7   GLY n 
4 8   GLY n 
4 9   LYS n 
4 10  GLY n 
4 11  LEU n 
4 12  GLY n 
4 13  LYS n 
4 14  GLY n 
4 15  GLY n 
4 16  ALA n 
4 17  LYS n 
4 18  ARG n 
4 19  HIS n 
4 20  ARG n 
4 21  LYS n 
4 22  VAL n 
4 23  LEU n 
4 24  ARG n 
4 25  ASP n 
4 26  ASN n 
4 27  ILE n 
4 28  GLN n 
4 29  GLY n 
4 30  ILE n 
4 31  THR n 
4 32  LYS n 
4 33  PRO n 
4 34  ALA n 
4 35  ILE n 
4 36  ARG n 
4 37  ARG n 
4 38  LEU n 
4 39  ALA n 
4 40  ARG n 
4 41  ARG n 
4 42  GLY n 
4 43  GLY n 
4 44  VAL n 
4 45  LYS n 
4 46  ARG n 
4 47  ILE n 
4 48  SER n 
4 49  GLY n 
4 50  LEU n 
4 51  ILE n 
4 52  TYR n 
4 53  GLU n 
4 54  GLU n 
4 55  THR n 
4 56  ARG n 
4 57  GLY n 
4 58  VAL n 
4 59  LEU n 
4 60  LYS n 
4 61  VAL n 
4 62  PHE n 
4 63  LEU n 
4 64  GLU n 
4 65  ASN n 
4 66  VAL n 
4 67  ILE n 
4 68  ARG n 
4 69  ASP n 
4 70  ALA n 
4 71  VAL n 
4 72  THR n 
4 73  TYR n 
4 74  THR n 
4 75  GLU n 
4 76  HIS n 
4 77  ALA n 
4 78  LYS n 
4 79  ARG n 
4 80  LYS n 
4 81  THR n 
4 82  VAL n 
4 83  THR n 
4 84  ALA n 
4 85  MET n 
4 86  ASP n 
4 87  VAL n 
4 88  VAL n 
4 89  TYR n 
4 90  ALA n 
4 91  LEU n 
4 92  LYS n 
4 93  ARG n 
4 94  GLN n 
4 95  GLY n 
4 96  ARG n 
4 97  THR n 
4 98  LEU n 
4 99  TYR n 
4 100 GLY n 
4 101 PHE n 
4 102 GLY n 
4 103 GLY n 
5 1   SER n 
5 2   GLY n 
5 3   ARG n 
5 4   GLY n 
5 5   LYS n 
5 6   GLN n 
5 7   GLY n 
5 8   GLY n 
5 9   LYS n 
5 10  THR n 
5 11  ARG n 
5 12  ALA n 
5 13  LYS n 
5 14  ALA n 
5 15  LYS n 
5 16  THR n 
5 17  ARG n 
5 18  SER n 
5 19  SER n 
5 20  ARG n 
5 21  ALA n 
5 22  GLY n 
5 23  LEU n 
5 24  GLN n 
5 25  PHE n 
5 26  PRO n 
5 27  VAL n 
5 28  GLY n 
5 29  ARG n 
5 30  VAL n 
5 31  HIS n 
5 32  ARG n 
5 33  LEU n 
5 34  LEU n 
5 35  ARG n 
5 36  LYS n 
5 37  GLY n 
5 38  ASN n 
5 39  TYR n 
5 40  ALA n 
5 41  GLU n 
5 42  ARG n 
5 43  VAL n 
5 44  GLY n 
5 45  ALA n 
5 46  GLY n 
5 47  ALA n 
5 48  PRO n 
5 49  VAL n 
5 50  TYR n 
5 51  LEU n 
5 52  ALA n 
5 53  ALA n 
5 54  VAL n 
5 55  LEU n 
5 56  GLU n 
5 57  TYR n 
5 58  LEU n 
5 59  THR n 
5 60  ALA n 
5 61  GLU n 
5 62  ILE n 
5 63  LEU n 
5 64  GLU n 
5 65  LEU n 
5 66  ALA n 
5 67  GLY n 
5 68  ASN n 
5 69  ALA n 
5 70  ALA n 
5 71  ARG n 
5 72  ASP n 
5 73  ASN n 
5 74  LYS n 
5 75  LYS n 
5 76  THR n 
5 77  ARG n 
5 78  ILE n 
5 79  ILE n 
5 80  PRO n 
5 81  ARG n 
5 82  HIS n 
5 83  LEU n 
5 84  GLN n 
5 85  LEU n 
5 86  ALA n 
5 87  VAL n 
5 88  ARG n 
5 89  ASN n 
5 90  ASP n 
5 91  GLU n 
5 92  GLU n 
5 93  LEU n 
5 94  ASN n 
5 95  LYS n 
5 96  LEU n 
5 97  LEU n 
5 98  GLY n 
5 99  ARG n 
5 100 VAL n 
5 101 THR n 
5 102 ILE n 
5 103 ALA n 
5 104 GLN n 
5 105 GLY n 
5 106 GLY n 
5 107 VAL n 
5 108 LEU n 
5 109 PRO n 
5 110 ASN n 
5 111 ILE n 
5 112 GLN n 
5 113 SER n 
5 114 VAL n 
5 115 LEU n 
5 116 LEU n 
5 117 PRO n 
5 118 LYS n 
5 119 LYS n 
5 120 THR n 
5 121 GLU n 
5 122 SER n 
5 123 SER n 
5 124 LYS n 
5 125 SER n 
5 126 ALA n 
5 127 LYS n 
5 128 SER n 
5 129 LYS n 
6 1   ALA n 
6 2   LYS n 
6 3   SER n 
6 4   ALA n 
6 5   PRO n 
6 6   ALA n 
6 7   PRO n 
6 8   LYS n 
6 9   LYS n 
6 10  GLY n 
6 11  SER n 
6 12  LYS n 
6 13  LYS n 
6 14  ALA n 
6 15  VAL n 
6 16  THR n 
6 17  LYS n 
6 18  THR n 
6 19  GLN n 
6 20  LYS n 
6 21  LYS n 
6 22  ASP n 
6 23  GLY n 
6 24  LYS n 
6 25  LYS n 
6 26  ARG n 
6 27  ARG n 
6 28  LYS n 
6 29  THR n 
6 30  ARG n 
6 31  LYS n 
6 32  GLU n 
6 33  SER n 
6 34  TYR n 
6 35  ALA n 
6 36  ILE n 
6 37  TYR n 
6 38  VAL n 
6 39  TYR n 
6 40  LYS n 
6 41  VAL n 
6 42  LEU n 
6 43  LYS n 
6 44  GLN n 
6 45  VAL n 
6 46  HIS n 
6 47  PRO n 
6 48  ASP n 
6 49  THR n 
6 50  GLY n 
6 51  ILE n 
6 52  SER n 
6 53  SER n 
6 54  LYS n 
6 55  ALA n 
6 56  MET n 
6 57  SER n 
6 58  ILE n 
6 59  MET n 
6 60  ASN n 
6 61  SER n 
6 62  PHE n 
6 63  VAL n 
6 64  ASN n 
6 65  ASP n 
6 66  VAL n 
6 67  PHE n 
6 68  GLU n 
6 69  ARG n 
6 70  ILE n 
6 71  ALA n 
6 72  GLY n 
6 73  GLU n 
6 74  ALA n 
6 75  SER n 
6 76  ARG n 
6 77  LEU n 
6 78  ALA n 
6 79  HIS n 
6 80  TYR n 
6 81  ASN n 
6 82  LYS n 
6 83  ARG n 
6 84  SER n 
6 85  THR n 
6 86  ILE n 
6 87  THR n 
6 88  SER n 
6 89  ARG n 
6 90  GLU n 
6 91  ILE n 
6 92  GLN n 
6 93  THR n 
6 94  ALA n 
6 95  VAL n 
6 96  ARG n 
6 97  LEU n 
6 98  LEU n 
6 99  LEU n 
6 100 PRO n 
6 101 GLY n 
6 102 GLU n 
6 103 LEU n 
6 104 ALA n 
6 105 LYS n 
6 106 HIS n 
6 107 ALA n 
6 108 VAL n 
6 109 SER n 
6 110 GLU n 
6 111 GLY n 
6 112 THR n 
6 113 LYS n 
6 114 ALA n 
6 115 VAL n 
6 116 THR n 
6 117 LYS n 
6 118 TYR n 
6 119 THR n 
6 120 SER n 
6 121 ALA n 
6 122 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 147 Human                 ? ?                      ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? 
? ? ? 'Escherichia coli'           562    ? ? ? ? ? ? ? DH10B ? ? ? ? ? ? Plasmid pUC57 ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 147 Human                 ? ?                      ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? ? 
? ? ? 'Escherichia coli'           562    ? ? ? ? ? ? ? DH10B ? ? ? ? ? ? Plasmid pUC57 ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? Plasmid pET3a ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 103 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? Plasmid pET3a ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 129 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? Plasmid pET3a ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 122 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? ? 
? ? ? 'Escherichia coli BL21(DE3)' 469008 ? ? ? ? ? ? ? pLysS ? ? ? ? ? ? Plasmid pET3a ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5ONG         5ONG   ? 1 ? 1 
2 PDB 5ONG         5ONG   ? 2 ? 1 
3 UNP H32_XENLA    P84233 ? 3 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
4 UNP H4_XENLA     P62799 ? 4 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1 
5 UNP Q6AZJ8_XENLA Q6AZJ8 ? 5 
;SGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIP
RHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
2 
6 UNP H2B11_XENLA  P02281 ? 6 
;AKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHY
NKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
5 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5ONG I 1 ? 147 ? 5ONG   -73 ? 73  ? -73 73  
2  2 5ONG J 1 ? 147 ? 5ONG   -73 ? 73  ? -73 73  
3  3 5ONG A 1 ? 135 ? P84233 2   ? 136 ? 1   135 
4  4 5ONG B 1 ? 103 ? P62799 1   ? 103 ? 0   102 
5  5 5ONG C 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
6  6 5ONG D 1 ? 122 ? P02281 5   ? 126 ? 1   122 
7  3 5ONG E 1 ? 135 ? P84233 2   ? 136 ? 1   135 
8  4 5ONG F 1 ? 103 ? P62799 1   ? 103 ? 0   102 
9  5 5ONG G 1 ? 129 ? Q6AZJ8 2   ? 130 ? 1   129 
10 6 5ONG H 1 ? 122 ? P02281 5   ? 126 ? 1   122 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3  5ONG CYS A 40  ? UNP P84233 ARG 41  'engineered mutation' 40  1 
3  5ONG ALA A 102 ? UNP P84233 GLY 103 conflict              102 2 
3  5ONG ALA A 110 ? UNP P84233 CYS 111 'engineered mutation' 110 3 
6  5ONG THR D 29  ? UNP P02281 SER 33  conflict              29  4 
7  5ONG CYS E 40  ? UNP P84233 ARG 41  'engineered mutation' 40  5 
7  5ONG ALA E 102 ? UNP P84233 GLY 103 conflict              102 6 
7  5ONG ALA E 110 ? UNP P84233 CYS 111 'engineered mutation' 110 7 
10 5ONG THR H 29  ? UNP P02281 SER 33  conflict              29  8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                      ? 'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                                       ? 'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                 ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                         ? 'C10 H15 N2 O8 P'   322.208 
G47 'DNA linking'       n "N2-ETHANETHIOL-2'-DEOXY-GUANOSINE-5'-MONOPHOSPHATE" ? 'C12 H18 N5 O7 P S' 407.339 
GLN 'L-peptide linking' y GLUTAMINE                                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                            ? 'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                ? 'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                           ? 'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                 ? 'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                            ? 'C4 H9 N O3'        119.119 
TYR 'L-peptide linking' y TYROSINE                                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5ONG 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.01 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.09 
_exptl_crystal.description                 'hollow hexagonal rods' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Sample was mixed in a 1:1 ratio with 10 mM Na-cacodylate, pH 6.0, 130-180 mM MnCl2, 100-160 mM KCl and equilibrated against a 1:4 dilution of the same solution
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           90 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-09-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5ONG 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.797 
_reflns.d_resolution_low                 29.54 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       47952 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             90.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.3 
_reflns.pdbx_Rmerge_I_obs                0.084 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.797 
_reflns_shell.d_res_low                   2.95 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        68 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.231 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5ONG 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.797 
_refine.ls_d_res_low                             29.499 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     47779 
_refine.ls_number_reflns_R_free                  4812 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    89.43 
_refine.ls_percent_reflns_R_free                 10.07 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2098 
_refine.ls_R_factor_R_free                       0.2468 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2057 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1KX5 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.76 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.35 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5973 
_refine_hist.pdbx_number_atoms_nucleic_acid   6027 
_refine_hist.pdbx_number_atoms_ligand         24 
_refine_hist.number_atoms_solvent             87 
_refine_hist.number_atoms_total               12111 
_refine_hist.d_res_high                       2.797 
_refine_hist.d_res_low                        29.499 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 12813 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.597  ? 18563 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 26.102 ? 6679  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.036  ? 2109  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.024  ? 1473  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7973 2.8291  . . 97  822  52.00 . . . 0.4036 . 0.3838 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8291 2.8623  . . 118 1076 69.00 . . . 0.4231 . 0.3508 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8623 2.8972  . . 135 1145 72.00 . . . 0.3384 . 0.3028 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8972 2.9339  . . 130 1096 70.00 . . . 0.3339 . 0.2771 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9339 2.9724  . . 149 1289 82.00 . . . 0.3258 . 0.2772 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9724 3.0131  . . 164 1450 92.00 . . . 0.3088 . 0.2629 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0131 3.0561  . . 141 1483 92.00 . . . 0.3014 . 0.2430 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0561 3.1017  . . 163 1446 92.00 . . . 0.2910 . 0.2528 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1017 3.1501  . . 170 1431 91.00 . . . 0.2869 . 0.2406 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1501 3.2017  . . 143 1518 94.00 . . . 0.2714 . 0.2427 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2017 3.2568  . . 166 1521 96.00 . . . 0.2920 . 0.2703 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2568 3.3160  . . 164 1528 95.00 . . . 0.2828 . 0.2519 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3160 3.3797  . . 151 1496 95.00 . . . 0.3054 . 0.2726 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3797 3.4485  . . 186 1464 93.00 . . . 0.2998 . 0.2746 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4485 3.5234  . . 169 1488 94.00 . . . 0.2672 . 0.2464 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5234 3.6052  . . 156 1478 94.00 . . . 0.2854 . 0.2124 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6052 3.6952  . . 173 1510 95.00 . . . 0.2571 . 0.2231 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6952 3.7949  . . 194 1525 95.00 . . . 0.2452 . 0.2127 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7949 3.9064  . . 170 1528 96.00 . . . 0.2453 . 0.1960 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9064 4.0321  . . 184 1492 95.00 . . . 0.2204 . 0.1911 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0321 4.1759  . . 174 1500 94.00 . . . 0.2336 . 0.1820 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.1759 4.3426  . . 150 1529 93.00 . . . 0.2223 . 0.1744 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3426 4.5395  . . 164 1480 92.00 . . . 0.2190 . 0.1756 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5395 4.7779  . . 166 1522 94.00 . . . 0.2018 . 0.1688 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7779 5.0759  . . 176 1512 94.00 . . . 0.2076 . 0.1722 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0759 5.4655  . . 188 1508 94.00 . . . 0.2157 . 0.1803 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4655 6.0113  . . 165 1515 93.00 . . . 0.2386 . 0.1943 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.0113 6.8716  . . 171 1497 91.00 . . . 0.2500 . 0.2040 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.8716 8.6215  . . 170 1533 92.00 . . . 0.2270 . 0.1700 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.6215 29.5008 . . 165 1585 90.00 . . . 0.2045 . 0.1725 . . . . . . . . . . 
# 
_struct.entry_id                     5ONG 
_struct.title                        
'X-Ray crystal structure of a nucleosome core particle with its DNA site-specifically crosslinked to the histone octamer' 
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A, Histone H2B 1.1/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5ONG 
_struct_keywords.text            'Nucleosome Core Particle, Histones, Disulfide, Convertible Nucleotide, DNA, DNA binding protein' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 5 ? 
F  N N 6 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 6 ? 
K  N N 7 ? 
L  N N 7 ? 
M  N N 7 ? 
N  N N 7 ? 
O  N N 7 ? 
P  N N 7 ? 
Q  N N 7 ? 
R  N N 7 ? 
S  N N 7 ? 
T  N N 7 ? 
U  N N 7 ? 
V  N N 7 ? 
W  N N 7 ? 
X  N N 7 ? 
Y  N N 7 ? 
Z  N N 7 ? 
AA N N 7 ? 
BA N N 7 ? 
CA N N 7 ? 
DA N N 8 ? 
EA N N 8 ? 
FA N N 7 ? 
GA N N 8 ? 
HA N N 8 ? 
IA N N 9 ? 
JA N N 9 ? 
KA N N 9 ? 
LA N N 9 ? 
MA N N 9 ? 
NA N N 9 ? 
OA N N 9 ? 
PA N N 9 ? 
QA N N 9 ? 
RA N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY C 44  ? SER C 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG C 63  ? ASP C 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P3  AA3 GLN C 85  ? ALA C 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET C 120 ? ARG C 131 ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASN D 26  ? ILE D 30  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR D 31  ? GLY D 42  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU D 50  ? ALA D 77  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR D 83  ? GLN D 94  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 THR E 16  ? GLY E 22  ? THR C 16  GLY C 22  1 ? 7  
HELX_P HELX_P10 AB1 PRO E 26  ? GLY E 37  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 ALA E 45  ? ASN E 73  ? ALA C 45  ASN C 73  1 ? 29 
HELX_P HELX_P12 AB3 ILE E 79  ? ASP E 90  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P13 AB4 ASP E 90  ? LEU E 97  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN E 112 ? LEU E 116 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR F 34  ? HIS F 46  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER F 52  ? ASN F 81  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR F 87  ? LEU F 99  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO F 100 ? SER F 120 ? PRO D 100 SER D 120 1 ? 21 
HELX_P HELX_P19 AC1 GLY G 44  ? SER G 57  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG G 63  ? LYS G 79  ? ARG E 63  LYS E 79  1 ? 17 
HELX_P HELX_P21 AC3 GLN G 85  ? ALA G 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET G 120 ? ARG G 131 ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASP H 25  ? ILE H 30  ? ASP F 24  ILE F 29  5 ? 6  
HELX_P HELX_P24 AC6 THR H 31  ? GLY H 42  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU H 50  ? ALA H 77  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR H 83  ? GLN H 94  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR I 16  ? ALA I 21  ? THR G 16  ALA G 21  1 ? 6  
HELX_P HELX_P28 AD1 PRO I 26  ? GLY I 37  ? PRO G 26  GLY G 37  1 ? 12 
HELX_P HELX_P29 AD2 GLY I 46  ? ASN I 73  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P30 AD3 ILE I 79  ? ASP I 90  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P31 AD4 ASP I 90  ? LEU I 97  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN I 112 ? LEU I 116 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR J 34  ? HIS J 46  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER J 52  ? ASN J 81  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR J 87  ? LEU J 99  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO J 100 ? SER J 120 ? PRO H 100 SER H 120 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ?    ? A  DG  16  O6    ? ? ? 1_555 L  MN  .   MN ? ? I DG  -58 I MN  102 1_555 ? ? ? ? ? ? ? 2.278 ? 
metalc2   metalc ?    ? A  DG  39  N7    ? ? ? 1_555 T  MN  .   MN ? ? I DG  -35 I MN  110 1_555 ? ? ? ? ? ? ? 2.711 ? 
metalc3   metalc ?    ? A  DG  40  O6    ? ? ? 1_555 T  MN  .   MN ? ? I DG  -34 I MN  110 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc4   metalc ?    ? A  DG  79  O6    ? ? ? 1_555 R  MN  .   MN ? ? I DG  5   I MN  108 1_555 ? ? ? ? ? ? ? 2.160 ? 
metalc5   metalc ?    ? A  DG  101 N7    ? ? ? 1_555 Q  MN  .   MN ? ? I DG  27  I MN  107 1_555 ? ? ? ? ? ? ? 2.689 ? 
metalc6   metalc ?    ? A  DG  122 N7    ? ? ? 1_555 O  MN  .   MN ? ? I DG  48  I MN  105 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc7   metalc ?    ? A  DG  129 N7    ? ? ? 1_555 M  MN  .   MN ? ? I DG  55  I MN  103 1_555 ? ? ? ? ? ? ? 2.557 ? 
metalc8   metalc ?    ? A  DG  130 N7    ? ? ? 1_555 M  MN  .   MN ? ? I DG  56  I MN  103 1_555 ? ? ? ? ? ? ? 2.458 ? 
covale1   covale both ? A  DT  143 "O3'" ? ? ? 1_555 A  G47 144 P  ? ? I DT  69  I G47 70  1_555 ? ? ? ? ? ? ? 1.607 ? 
covale2   covale one  ? A  G47 144 "O3'" ? ? ? 1_555 A  DG  145 P  ? ? I G47 70  I DG  71  1_555 ? ? ? ? ? ? ? 1.605 ? 
covale3   covale none ? A  G47 144 SG    ? ? ? 1_555 C  CYS 40  SG ? ? I G47 70  A CYS 40  1_555 ? ? ? ? ? ? ? 2.085 ? 
metalc9   metalc ?    ? A  DG  145 O6    ? ? ? 1_555 K  MN  .   MN ? ? I DG  71  I MN  101 1_555 ? ? ? ? ? ? ? 2.109 ? 
metalc10  metalc ?    ? B  DG  39  N7    ? ? ? 1_555 W  MN  .   MN ? ? J DG  -35 J MN  103 1_555 ? ? ? ? ? ? ? 2.477 ? 
metalc11  metalc ?    ? B  DG  40  O6    ? ? ? 1_555 W  MN  .   MN ? ? J DG  -34 J MN  103 1_555 ? ? ? ? ? ? ? 2.363 ? 
metalc12  metalc ?    ? B  DG  71  N7    ? ? ? 1_555 BA MN  .   MN ? ? J DG  -3  J MN  108 1_555 ? ? ? ? ? ? ? 2.530 ? 
metalc13  metalc ?    ? B  DG  101 N7    ? ? ? 1_555 AA MN  .   MN ? ? J DG  27  J MN  107 1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc14  metalc ?    ? B  DG  135 N7    ? ? ? 1_555 Z  MN  .   MN ? ? J DG  61  J MN  106 1_555 ? ? ? ? ? ? ? 2.714 ? 
covale4   covale both ? B  DT  143 "O3'" ? ? ? 1_555 B  G47 144 P  ? ? J DT  69  J G47 70  1_555 ? ? ? ? ? ? ? 1.608 ? 
covale5   covale one  ? B  G47 144 "O3'" ? ? ? 1_555 B  DG  145 P  ? ? J G47 70  J DG  71  1_555 ? ? ? ? ? ? ? 1.607 ? 
metalc15  metalc ?    ? B  G47 144 N7    ? ? ? 1_555 X  MN  .   MN ? ? J G47 70  J MN  104 1_555 ? ? ? ? ? ? ? 2.534 ? 
covale6   covale none ? B  G47 144 SG    ? ? ? 1_555 G  CYS 40  SG ? ? J G47 70  E CYS 40  1_555 ? ? ? ? ? ? ? 2.082 ? 
metalc16  metalc ?    ? B  DG  145 O6    ? ? ? 1_555 X  MN  .   MN ? ? J DG  71  J MN  104 1_555 ? ? ? ? ? ? ? 1.839 ? 
metalc17  metalc ?    ? G  ASP 77  OD1   ? ? ? 1_555 FA MN  .   MN ? ? E ASP 77  E MN  201 1_555 ? ? ? ? ? ? ? 2.341 ? 
metalc18  metalc ?    ? Q  MN  .   MN    ? ? ? 1_555 JA HOH .   O  ? ? I MN  107 J HOH 208 1_555 ? ? ? ? ? ? ? 2.511 ? 
metalc19  metalc ?    ? CA MN  .   MN    ? ? ? 1_555 JA HOH .   O  ? ? J MN  109 J HOH 204 1_555 ? ? ? ? ? ? ? 2.589 ? 
metalc20  metalc ?    ? CA MN  .   MN    ? ? ? 1_555 JA HOH .   O  ? ? J MN  109 J HOH 203 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc21  metalc ?    ? FA MN  .   MN    ? ? ? 1_555 PA HOH .   O  ? ? E MN  201 F HOH 206 1_555 ? ? ? ? ? ? ? 1.981 ? 
metalc22  metalc ?    ? F  VAL 45  O     ? ? ? 1_555 FA MN  .   MN ? ? D VAL 45  E MN  201 2_565 ? ? ? ? ? ? ? 2.365 ? 
metalc23  metalc ?    ? FA MN  .   MN    ? ? ? 1_555 NA HOH .   O  ? ? E MN  201 D HOH 301 2_564 ? ? ? ? ? ? ? 2.104 ? 
hydrog1   hydrog ?    ? A  DA  1   N1    ? ? ? 1_555 B  DT  147 N3 ? ? I DA  -73 J DT  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ?    ? A  DA  1   N6    ? ? ? 1_555 B  DT  147 O4 ? ? I DA  -73 J DT  73  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ?    ? A  DT  2   N3    ? ? ? 1_555 B  DA  146 N1 ? ? I DT  -72 J DA  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ?    ? A  DT  2   O4    ? ? ? 1_555 B  DA  146 N6 ? ? I DT  -72 J DA  72  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ?    ? A  DC  3   N3    ? ? ? 1_555 B  DG  145 N2 ? ? I DC  -71 J DG  71  1_555 ? ? ? ? ? ? 'DC-DG PAIR' ?     ? 
hydrog6   hydrog ?    ? A  DC  4   N3    ? ? ? 1_555 B  G47 144 N1 ? ? I DC  -70 J G47 70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ?    ? A  DC  4   N4    ? ? ? 1_555 B  G47 144 O6 ? ? I DC  -70 J G47 70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ?    ? A  DC  4   O2    ? ? ? 1_555 B  G47 144 N2 ? ? I DC  -70 J G47 70  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ?    ? A  DA  5   N1    ? ? ? 1_555 B  DT  143 N3 ? ? I DA  -69 J DT  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ?    ? A  DA  5   N6    ? ? ? 1_555 B  DT  143 O4 ? ? I DA  -69 J DT  69  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ?    ? A  DT  6   N3    ? ? ? 1_555 B  DA  142 N1 ? ? I DT  -68 J DA  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ?    ? A  DT  6   O4    ? ? ? 1_555 B  DA  142 N6 ? ? I DT  -68 J DA  68  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ?    ? A  DA  7   N1    ? ? ? 1_555 B  DT  141 N3 ? ? I DA  -67 J DT  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ?    ? A  DA  7   N6    ? ? ? 1_555 B  DT  141 O4 ? ? I DA  -67 J DT  67  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ?    ? A  DT  8   N3    ? ? ? 1_555 B  DA  140 N1 ? ? I DT  -66 J DA  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ?    ? A  DT  8   O4    ? ? ? 1_555 B  DA  140 N6 ? ? I DT  -66 J DA  66  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ?    ? A  DC  9   N3    ? ? ? 1_555 B  DG  139 N1 ? ? I DC  -65 J DG  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ?    ? A  DC  9   N4    ? ? ? 1_555 B  DG  139 O6 ? ? I DC  -65 J DG  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ?    ? A  DC  9   O2    ? ? ? 1_555 B  DG  139 N2 ? ? I DC  -65 J DG  65  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ?    ? A  DC  10  N3    ? ? ? 1_555 B  DG  138 N1 ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ?    ? A  DC  10  N4    ? ? ? 1_555 B  DG  138 O6 ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ?    ? A  DC  10  O2    ? ? ? 1_555 B  DG  138 N2 ? ? I DC  -64 J DG  64  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ?    ? A  DA  11  N1    ? ? ? 1_555 B  DT  137 N3 ? ? I DA  -63 J DT  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ?    ? A  DA  11  N6    ? ? ? 1_555 B  DT  137 O4 ? ? I DA  -63 J DT  63  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ?    ? A  DC  12  N3    ? ? ? 1_555 B  DG  136 N1 ? ? I DC  -62 J DG  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ?    ? A  DC  12  N4    ? ? ? 1_555 B  DG  136 O6 ? ? I DC  -62 J DG  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ?    ? A  DC  12  O2    ? ? ? 1_555 B  DG  136 N2 ? ? I DC  -62 J DG  62  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ?    ? A  DC  13  N3    ? ? ? 1_555 B  DG  135 N1 ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ?    ? A  DC  13  N4    ? ? ? 1_555 B  DG  135 O6 ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ?    ? A  DC  13  O2    ? ? ? 1_555 B  DG  135 N2 ? ? I DC  -61 J DG  61  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ?    ? A  DT  14  N3    ? ? ? 1_555 B  DA  134 N1 ? ? I DT  -60 J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ?    ? A  DT  14  O4    ? ? ? 1_555 B  DA  134 N6 ? ? I DT  -60 J DA  60  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ?    ? A  DG  15  N1    ? ? ? 1_555 B  DC  133 N3 ? ? I DG  -59 J DC  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ?    ? A  DG  15  N2    ? ? ? 1_555 B  DC  133 O2 ? ? I DG  -59 J DC  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ?    ? A  DG  15  O6    ? ? ? 1_555 B  DC  133 N4 ? ? I DG  -59 J DC  59  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ?    ? A  DG  16  N2    ? ? ? 1_555 B  DC  132 N3 ? ? I DG  -58 J DC  58  1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog37  hydrog ?    ? A  DT  17  N3    ? ? ? 1_555 B  DA  131 N1 ? ? I DT  -57 J DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ?    ? A  DT  17  O4    ? ? ? 1_555 B  DA  131 N6 ? ? I DT  -57 J DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ?    ? A  DC  18  N3    ? ? ? 1_555 B  DG  130 N1 ? ? I DC  -56 J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ?    ? A  DC  18  N4    ? ? ? 1_555 B  DG  130 O6 ? ? I DC  -56 J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ?    ? A  DC  18  O2    ? ? ? 1_555 B  DG  130 N2 ? ? I DC  -56 J DG  56  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ?    ? A  DC  19  N3    ? ? ? 1_555 B  DG  129 N1 ? ? I DC  -55 J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ?    ? A  DC  19  N4    ? ? ? 1_555 B  DG  129 O6 ? ? I DC  -55 J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ?    ? A  DC  19  O2    ? ? ? 1_555 B  DG  129 N2 ? ? I DC  -55 J DG  55  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ?    ? A  DT  20  N3    ? ? ? 1_555 B  DA  128 N1 ? ? I DT  -54 J DA  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ?    ? A  DT  20  O4    ? ? ? 1_555 B  DA  128 N6 ? ? I DT  -54 J DA  54  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ?    ? A  DA  21  N1    ? ? ? 1_555 B  DT  127 N3 ? ? I DA  -53 J DT  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ?    ? A  DA  21  N6    ? ? ? 1_555 B  DT  127 O4 ? ? I DA  -53 J DT  53  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ?    ? A  DC  22  N3    ? ? ? 1_555 B  DG  126 N1 ? ? I DC  -52 J DG  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ?    ? A  DC  22  N4    ? ? ? 1_555 B  DG  126 O6 ? ? I DC  -52 J DG  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ?    ? A  DC  22  O2    ? ? ? 1_555 B  DG  126 N2 ? ? I DC  -52 J DG  52  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ?    ? A  DT  23  N3    ? ? ? 1_555 B  DA  125 N1 ? ? I DT  -51 J DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ?    ? A  DT  23  O4    ? ? ? 1_555 B  DA  125 N6 ? ? I DT  -51 J DA  51  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ?    ? A  DA  24  N1    ? ? ? 1_555 B  DT  124 N3 ? ? I DA  -50 J DT  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ?    ? A  DA  24  N6    ? ? ? 1_555 B  DT  124 O4 ? ? I DA  -50 J DT  50  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ?    ? A  DC  25  N3    ? ? ? 1_555 B  DG  123 N1 ? ? I DC  -49 J DG  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ?    ? A  DC  25  N4    ? ? ? 1_555 B  DG  123 O6 ? ? I DC  -49 J DG  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ?    ? A  DC  25  O2    ? ? ? 1_555 B  DG  123 N2 ? ? I DC  -49 J DG  49  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ?    ? A  DC  26  N3    ? ? ? 1_555 B  DG  122 N1 ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ?    ? A  DC  26  N4    ? ? ? 1_555 B  DG  122 O6 ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ?    ? A  DC  26  O2    ? ? ? 1_555 B  DG  122 N2 ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ?    ? A  DA  27  N1    ? ? ? 1_555 B  DT  121 N3 ? ? I DA  -47 J DT  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ?    ? A  DA  27  N6    ? ? ? 1_555 B  DT  121 O4 ? ? I DA  -47 J DT  47  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ?    ? A  DA  28  N1    ? ? ? 1_555 B  DT  120 N3 ? ? I DA  -46 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ?    ? A  DA  28  N6    ? ? ? 1_555 B  DT  120 O4 ? ? I DA  -46 J DT  46  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ?    ? A  DA  29  N1    ? ? ? 1_555 B  DT  119 N3 ? ? I DA  -45 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ?    ? A  DA  29  N6    ? ? ? 1_555 B  DT  119 O4 ? ? I DA  -45 J DT  45  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ?    ? A  DA  30  N1    ? ? ? 1_555 B  DT  118 N3 ? ? I DA  -44 J DT  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ?    ? A  DA  30  N6    ? ? ? 1_555 B  DT  118 O4 ? ? I DA  -44 J DT  44  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ?    ? A  DG  31  N1    ? ? ? 1_555 B  DC  117 N3 ? ? I DG  -43 J DC  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ?    ? A  DG  31  N2    ? ? ? 1_555 B  DC  117 O2 ? ? I DG  -43 J DC  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ?    ? A  DG  31  O6    ? ? ? 1_555 B  DC  117 N4 ? ? I DG  -43 J DC  43  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ?    ? A  DT  32  N3    ? ? ? 1_555 B  DA  116 N1 ? ? I DT  -42 J DA  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ?    ? A  DT  32  O4    ? ? ? 1_555 B  DA  116 N6 ? ? I DT  -42 J DA  42  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ?    ? A  DG  33  N1    ? ? ? 1_555 B  DC  115 N3 ? ? I DG  -41 J DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ?    ? A  DG  33  N2    ? ? ? 1_555 B  DC  115 O2 ? ? I DG  -41 J DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ?    ? A  DG  33  O6    ? ? ? 1_555 B  DC  115 N4 ? ? I DG  -41 J DC  41  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ?    ? A  DT  34  N3    ? ? ? 1_555 B  DA  114 N1 ? ? I DT  -40 J DA  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ?    ? A  DT  34  O4    ? ? ? 1_555 B  DA  114 N6 ? ? I DT  -40 J DA  40  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ?    ? A  DA  35  N1    ? ? ? 1_555 B  DT  113 N3 ? ? I DA  -39 J DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ?    ? A  DA  35  N6    ? ? ? 1_555 B  DT  113 O4 ? ? I DA  -39 J DT  39  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ?    ? A  DT  36  N3    ? ? ? 1_555 B  DA  112 N1 ? ? I DT  -38 J DA  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ?    ? A  DT  36  O4    ? ? ? 1_555 B  DA  112 N6 ? ? I DT  -38 J DA  38  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ?    ? A  DT  37  N3    ? ? ? 1_555 B  DA  111 N1 ? ? I DT  -37 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ?    ? A  DT  37  O4    ? ? ? 1_555 B  DA  111 N6 ? ? I DT  -37 J DA  37  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ?    ? A  DT  38  N3    ? ? ? 1_555 B  DA  110 N1 ? ? I DT  -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ?    ? A  DT  38  O4    ? ? ? 1_555 B  DA  110 N6 ? ? I DT  -36 J DA  36  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ?    ? A  DG  39  N1    ? ? ? 1_555 B  DC  109 N3 ? ? I DG  -35 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ?    ? A  DG  39  N2    ? ? ? 1_555 B  DC  109 O2 ? ? I DG  -35 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ?    ? A  DG  39  O6    ? ? ? 1_555 B  DC  109 N4 ? ? I DG  -35 J DC  35  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ?    ? A  DG  40  N1    ? ? ? 1_555 B  DC  108 N3 ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ?    ? A  DG  40  N2    ? ? ? 1_555 B  DC  108 O2 ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ?    ? A  DG  40  O6    ? ? ? 1_555 B  DC  108 N4 ? ? I DG  -34 J DC  34  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ?    ? A  DA  41  N1    ? ? ? 1_555 B  DT  107 N3 ? ? I DA  -33 J DT  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ?    ? A  DA  41  N6    ? ? ? 1_555 B  DT  107 O4 ? ? I DA  -33 J DT  33  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ?    ? A  DA  42  N1    ? ? ? 1_555 B  DT  106 N3 ? ? I DA  -32 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ?    ? A  DA  42  N6    ? ? ? 1_555 B  DT  106 O4 ? ? I DA  -32 J DT  32  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ?    ? A  DA  43  N1    ? ? ? 1_555 B  DT  105 N3 ? ? I DA  -31 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ?    ? A  DA  43  N6    ? ? ? 1_555 B  DT  105 O4 ? ? I DA  -31 J DT  31  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ?    ? A  DC  44  N3    ? ? ? 1_555 B  DG  104 N1 ? ? I DC  -30 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ?    ? A  DC  44  N4    ? ? ? 1_555 B  DG  104 O6 ? ? I DC  -30 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ?    ? A  DC  44  O2    ? ? ? 1_555 B  DG  104 N2 ? ? I DC  -30 J DG  30  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ?    ? A  DT  45  N3    ? ? ? 1_555 B  DA  103 N1 ? ? I DT  -29 J DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ?    ? A  DT  45  O4    ? ? ? 1_555 B  DA  103 N6 ? ? I DT  -29 J DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ?    ? A  DG  46  N1    ? ? ? 1_555 B  DC  102 N3 ? ? I DG  -28 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ?    ? A  DG  46  N2    ? ? ? 1_555 B  DC  102 O2 ? ? I DG  -28 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ?    ? A  DG  46  O6    ? ? ? 1_555 B  DC  102 N4 ? ? I DG  -28 J DC  28  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ?    ? A  DC  47  N3    ? ? ? 1_555 B  DG  101 N1 ? ? I DC  -27 J DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ?    ? A  DC  47  N4    ? ? ? 1_555 B  DG  101 O6 ? ? I DC  -27 J DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ?    ? A  DC  47  O2    ? ? ? 1_555 B  DG  101 N2 ? ? I DC  -27 J DG  27  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ?    ? A  DT  48  N3    ? ? ? 1_555 B  DA  100 N1 ? ? I DT  -26 J DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ?    ? A  DT  48  O4    ? ? ? 1_555 B  DA  100 N6 ? ? I DT  -26 J DA  26  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ?    ? A  DC  49  N3    ? ? ? 1_555 B  DG  99  N1 ? ? I DC  -25 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ?    ? A  DC  49  N4    ? ? ? 1_555 B  DG  99  O6 ? ? I DC  -25 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ?    ? A  DC  49  O2    ? ? ? 1_555 B  DG  99  N2 ? ? I DC  -25 J DG  25  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ?    ? A  DC  50  N3    ? ? ? 1_555 B  DG  98  N1 ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ?    ? A  DC  50  N4    ? ? ? 1_555 B  DG  98  O6 ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ?    ? A  DC  50  O2    ? ? ? 1_555 B  DG  98  N2 ? ? I DC  -24 J DG  24  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ?    ? A  DA  51  N1    ? ? ? 1_555 B  DT  97  N3 ? ? I DA  -23 J DT  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ?    ? A  DA  51  N6    ? ? ? 1_555 B  DT  97  O4 ? ? I DA  -23 J DT  23  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ?    ? A  DT  52  N3    ? ? ? 1_555 B  DA  96  N1 ? ? I DT  -22 J DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ?    ? A  DT  52  O4    ? ? ? 1_555 B  DA  96  N6 ? ? I DT  -22 J DA  22  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ?    ? A  DC  53  N3    ? ? ? 1_555 B  DG  95  N1 ? ? I DC  -21 J DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ?    ? A  DC  53  N4    ? ? ? 1_555 B  DG  95  O6 ? ? I DC  -21 J DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ?    ? A  DC  53  O2    ? ? ? 1_555 B  DG  95  N2 ? ? I DC  -21 J DG  21  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ?    ? A  DA  54  N1    ? ? ? 1_555 B  DT  94  N3 ? ? I DA  -20 J DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ?    ? A  DA  54  N6    ? ? ? 1_555 B  DT  94  O4 ? ? I DA  -20 J DT  20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ?    ? A  DA  55  N1    ? ? ? 1_555 B  DT  93  N3 ? ? I DA  -19 J DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ?    ? A  DA  55  N6    ? ? ? 1_555 B  DT  93  O4 ? ? I DA  -19 J DT  19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ?    ? A  DA  56  N1    ? ? ? 1_555 B  DT  92  N3 ? ? I DA  -18 J DT  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ?    ? A  DA  56  N6    ? ? ? 1_555 B  DT  92  O4 ? ? I DA  -18 J DT  18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ?    ? A  DA  57  N1    ? ? ? 1_555 B  DT  91  N3 ? ? I DA  -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ?    ? A  DA  57  N6    ? ? ? 1_555 B  DT  91  O4 ? ? I DA  -17 J DT  17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ?    ? A  DG  58  N1    ? ? ? 1_555 B  DC  90  N3 ? ? I DG  -16 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ?    ? A  DG  58  N2    ? ? ? 1_555 B  DC  90  O2 ? ? I DG  -16 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ?    ? A  DG  58  O6    ? ? ? 1_555 B  DC  90  N4 ? ? I DG  -16 J DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ?    ? A  DG  59  N1    ? ? ? 1_555 B  DC  89  N3 ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ?    ? A  DG  59  N2    ? ? ? 1_555 B  DC  89  O2 ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ?    ? A  DG  59  O6    ? ? ? 1_555 B  DC  89  N4 ? ? I DG  -15 J DC  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ?    ? A  DC  60  N3    ? ? ? 1_555 B  DG  88  N1 ? ? I DC  -14 J DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ?    ? A  DC  60  N4    ? ? ? 1_555 B  DG  88  O6 ? ? I DC  -14 J DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ?    ? A  DC  60  O2    ? ? ? 1_555 B  DG  88  N2 ? ? I DC  -14 J DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ?    ? A  DA  61  N1    ? ? ? 1_555 B  DT  87  N3 ? ? I DA  -13 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ?    ? A  DA  61  N6    ? ? ? 1_555 B  DT  87  O4 ? ? I DA  -13 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ?    ? A  DT  62  N3    ? ? ? 1_555 B  DA  86  N1 ? ? I DT  -12 J DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ?    ? A  DT  62  O4    ? ? ? 1_555 B  DA  86  N6 ? ? I DT  -12 J DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ?    ? A  DG  63  N1    ? ? ? 1_555 B  DC  85  N3 ? ? I DG  -11 J DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ?    ? A  DG  63  N2    ? ? ? 1_555 B  DC  85  O2 ? ? I DG  -11 J DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ?    ? A  DG  63  O6    ? ? ? 1_555 B  DC  85  N4 ? ? I DG  -11 J DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ?    ? A  DT  64  N3    ? ? ? 1_555 B  DA  84  N1 ? ? I DT  -10 J DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ?    ? A  DT  64  O4    ? ? ? 1_555 B  DA  84  N6 ? ? I DT  -10 J DA  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ?    ? A  DT  65  N3    ? ? ? 1_555 B  DA  83  N1 ? ? I DT  -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ?    ? A  DT  65  O4    ? ? ? 1_555 B  DA  83  N6 ? ? I DT  -9  J DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ?    ? A  DC  66  N3    ? ? ? 1_555 B  DG  82  N1 ? ? I DC  -8  J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ?    ? A  DC  66  N4    ? ? ? 1_555 B  DG  82  O6 ? ? I DC  -8  J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ?    ? A  DC  66  O2    ? ? ? 1_555 B  DG  82  N2 ? ? I DC  -8  J DG  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ?    ? A  DA  67  N1    ? ? ? 1_555 B  DT  81  N3 ? ? I DA  -7  J DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ?    ? A  DA  67  N6    ? ? ? 1_555 B  DT  81  O4 ? ? I DA  -7  J DT  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ?    ? A  DG  68  N1    ? ? ? 1_555 B  DC  80  N3 ? ? I DG  -6  J DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ?    ? A  DG  68  N2    ? ? ? 1_555 B  DC  80  O2 ? ? I DG  -6  J DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ?    ? A  DG  68  O6    ? ? ? 1_555 B  DC  80  N4 ? ? I DG  -6  J DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ?    ? A  DC  69  N3    ? ? ? 1_555 B  DG  79  N1 ? ? I DC  -5  J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ?    ? A  DC  69  N4    ? ? ? 1_555 B  DG  79  O6 ? ? I DC  -5  J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ?    ? A  DC  69  O2    ? ? ? 1_555 B  DG  79  N2 ? ? I DC  -5  J DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ?    ? A  DT  70  N3    ? ? ? 1_555 B  DA  78  N1 ? ? I DT  -4  J DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ?    ? A  DT  70  O4    ? ? ? 1_555 B  DA  78  N6 ? ? I DT  -4  J DA  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ?    ? A  DG  71  N1    ? ? ? 1_555 B  DC  77  N3 ? ? I DG  -3  J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ?    ? A  DG  71  N2    ? ? ? 1_555 B  DC  77  O2 ? ? I DG  -3  J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ?    ? A  DG  71  O6    ? ? ? 1_555 B  DC  77  N4 ? ? I DG  -3  J DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ?    ? A  DG  72  N1    ? ? ? 1_555 B  DC  76  N3 ? ? I DG  -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ?    ? A  DG  72  N2    ? ? ? 1_555 B  DC  76  O2 ? ? I DG  -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ?    ? A  DG  72  O6    ? ? ? 1_555 B  DC  76  N4 ? ? I DG  -2  J DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ?    ? A  DA  73  N1    ? ? ? 1_555 B  DT  75  N3 ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ?    ? A  DA  73  N6    ? ? ? 1_555 B  DT  75  O4 ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ?    ? A  DA  74  N1    ? ? ? 1_555 B  DT  74  N3 ? ? I DA  0   J DT  0   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ?    ? A  DA  74  N6    ? ? ? 1_555 B  DT  74  O4 ? ? I DA  0   J DT  0   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ?    ? A  DT  75  N3    ? ? ? 1_555 B  DA  73  N1 ? ? I DT  1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ?    ? A  DT  75  O4    ? ? ? 1_555 B  DA  73  N6 ? ? I DT  1   J DA  -1  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ?    ? A  DC  76  N3    ? ? ? 1_555 B  DG  72  N1 ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ?    ? A  DC  76  N4    ? ? ? 1_555 B  DG  72  O6 ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ?    ? A  DC  76  O2    ? ? ? 1_555 B  DG  72  N2 ? ? I DC  2   J DG  -2  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ?    ? A  DC  77  N3    ? ? ? 1_555 B  DG  71  N1 ? ? I DC  3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ?    ? A  DC  77  N4    ? ? ? 1_555 B  DG  71  O6 ? ? I DC  3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ?    ? A  DC  77  O2    ? ? ? 1_555 B  DG  71  N2 ? ? I DC  3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ?    ? A  DA  78  N1    ? ? ? 1_555 B  DT  70  N3 ? ? I DA  4   J DT  -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ?    ? A  DA  78  N6    ? ? ? 1_555 B  DT  70  O4 ? ? I DA  4   J DT  -4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ?    ? A  DG  79  N1    ? ? ? 1_555 B  DC  69  N3 ? ? I DG  5   J DC  -5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ?    ? A  DG  79  N2    ? ? ? 1_555 B  DC  69  O2 ? ? I DG  5   J DC  -5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ?    ? A  DG  79  O6    ? ? ? 1_555 B  DC  69  N4 ? ? I DG  5   J DC  -5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ?    ? A  DC  80  N3    ? ? ? 1_555 B  DG  68  N1 ? ? I DC  6   J DG  -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ?    ? A  DC  80  N4    ? ? ? 1_555 B  DG  68  O6 ? ? I DC  6   J DG  -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ?    ? A  DC  80  O2    ? ? ? 1_555 B  DG  68  N2 ? ? I DC  6   J DG  -6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ?    ? A  DT  81  N3    ? ? ? 1_555 B  DA  67  N1 ? ? I DT  7   J DA  -7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ?    ? A  DT  81  O4    ? ? ? 1_555 B  DA  67  N6 ? ? I DT  7   J DA  -7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ?    ? A  DG  82  N1    ? ? ? 1_555 B  DC  66  N3 ? ? I DG  8   J DC  -8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ?    ? A  DG  82  N2    ? ? ? 1_555 B  DC  66  O2 ? ? I DG  8   J DC  -8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ?    ? A  DG  82  O6    ? ? ? 1_555 B  DC  66  N4 ? ? I DG  8   J DC  -8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ?    ? A  DA  83  N1    ? ? ? 1_555 B  DT  65  N3 ? ? I DA  9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ?    ? A  DA  83  N6    ? ? ? 1_555 B  DT  65  O4 ? ? I DA  9   J DT  -9  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ?    ? A  DA  84  N1    ? ? ? 1_555 B  DT  64  N3 ? ? I DA  10  J DT  -10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ?    ? A  DA  84  N6    ? ? ? 1_555 B  DT  64  O4 ? ? I DA  10  J DT  -10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ?    ? A  DC  85  N3    ? ? ? 1_555 B  DG  63  N1 ? ? I DC  11  J DG  -11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ?    ? A  DC  85  N4    ? ? ? 1_555 B  DG  63  O6 ? ? I DC  11  J DG  -11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ?    ? A  DC  85  O2    ? ? ? 1_555 B  DG  63  N2 ? ? I DC  11  J DG  -11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog205 hydrog ?    ? A  DA  86  N1    ? ? ? 1_555 B  DT  62  N3 ? ? I DA  12  J DT  -12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog206 hydrog ?    ? A  DA  86  N6    ? ? ? 1_555 B  DT  62  O4 ? ? I DA  12  J DT  -12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog207 hydrog ?    ? A  DT  87  N3    ? ? ? 1_555 B  DA  61  N1 ? ? I DT  13  J DA  -13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog208 hydrog ?    ? A  DT  87  O4    ? ? ? 1_555 B  DA  61  N6 ? ? I DT  13  J DA  -13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog209 hydrog ?    ? A  DG  88  N1    ? ? ? 1_555 B  DC  60  N3 ? ? I DG  14  J DC  -14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog210 hydrog ?    ? A  DG  88  N2    ? ? ? 1_555 B  DC  60  O2 ? ? I DG  14  J DC  -14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog211 hydrog ?    ? A  DG  88  O6    ? ? ? 1_555 B  DC  60  N4 ? ? I DG  14  J DC  -14 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog212 hydrog ?    ? A  DC  89  N3    ? ? ? 1_555 B  DG  59  N1 ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog213 hydrog ?    ? A  DC  89  N4    ? ? ? 1_555 B  DG  59  O6 ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog214 hydrog ?    ? A  DC  89  O2    ? ? ? 1_555 B  DG  59  N2 ? ? I DC  15  J DG  -15 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog215 hydrog ?    ? A  DC  90  N3    ? ? ? 1_555 B  DG  58  N1 ? ? I DC  16  J DG  -16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog216 hydrog ?    ? A  DC  90  N4    ? ? ? 1_555 B  DG  58  O6 ? ? I DC  16  J DG  -16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog217 hydrog ?    ? A  DC  90  O2    ? ? ? 1_555 B  DG  58  N2 ? ? I DC  16  J DG  -16 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog218 hydrog ?    ? A  DT  91  N3    ? ? ? 1_555 B  DA  57  N1 ? ? I DT  17  J DA  -17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog219 hydrog ?    ? A  DT  91  O4    ? ? ? 1_555 B  DA  57  N6 ? ? I DT  17  J DA  -17 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog220 hydrog ?    ? A  DT  92  N3    ? ? ? 1_555 B  DA  56  N1 ? ? I DT  18  J DA  -18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog221 hydrog ?    ? A  DT  92  O4    ? ? ? 1_555 B  DA  56  N6 ? ? I DT  18  J DA  -18 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog222 hydrog ?    ? A  DT  93  N3    ? ? ? 1_555 B  DA  55  N1 ? ? I DT  19  J DA  -19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog223 hydrog ?    ? A  DT  93  O4    ? ? ? 1_555 B  DA  55  N6 ? ? I DT  19  J DA  -19 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog224 hydrog ?    ? A  DT  94  N3    ? ? ? 1_555 B  DA  54  N1 ? ? I DT  20  J DA  -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog225 hydrog ?    ? A  DT  94  O4    ? ? ? 1_555 B  DA  54  N6 ? ? I DT  20  J DA  -20 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog226 hydrog ?    ? A  DG  95  N1    ? ? ? 1_555 B  DC  53  N3 ? ? I DG  21  J DC  -21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog227 hydrog ?    ? A  DG  95  N2    ? ? ? 1_555 B  DC  53  O2 ? ? I DG  21  J DC  -21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog228 hydrog ?    ? A  DG  95  O6    ? ? ? 1_555 B  DC  53  N4 ? ? I DG  21  J DC  -21 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog229 hydrog ?    ? A  DA  96  N1    ? ? ? 1_555 B  DT  52  N3 ? ? I DA  22  J DT  -22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog230 hydrog ?    ? A  DA  96  N6    ? ? ? 1_555 B  DT  52  O4 ? ? I DA  22  J DT  -22 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog231 hydrog ?    ? A  DT  97  N3    ? ? ? 1_555 B  DA  51  N1 ? ? I DT  23  J DA  -23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog232 hydrog ?    ? A  DT  97  O4    ? ? ? 1_555 B  DA  51  N6 ? ? I DT  23  J DA  -23 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog233 hydrog ?    ? A  DG  98  N1    ? ? ? 1_555 B  DC  50  N3 ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog234 hydrog ?    ? A  DG  98  N2    ? ? ? 1_555 B  DC  50  O2 ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog235 hydrog ?    ? A  DG  98  O6    ? ? ? 1_555 B  DC  50  N4 ? ? I DG  24  J DC  -24 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog236 hydrog ?    ? A  DG  99  N1    ? ? ? 1_555 B  DC  49  N3 ? ? I DG  25  J DC  -25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog237 hydrog ?    ? A  DG  99  N2    ? ? ? 1_555 B  DC  49  O2 ? ? I DG  25  J DC  -25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog238 hydrog ?    ? A  DG  99  O6    ? ? ? 1_555 B  DC  49  N4 ? ? I DG  25  J DC  -25 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog239 hydrog ?    ? A  DA  100 N1    ? ? ? 1_555 B  DT  48  N3 ? ? I DA  26  J DT  -26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog240 hydrog ?    ? A  DA  100 N6    ? ? ? 1_555 B  DT  48  O4 ? ? I DA  26  J DT  -26 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog241 hydrog ?    ? A  DG  101 N1    ? ? ? 1_555 B  DC  47  N3 ? ? I DG  27  J DC  -27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog242 hydrog ?    ? A  DG  101 N2    ? ? ? 1_555 B  DC  47  O2 ? ? I DG  27  J DC  -27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog243 hydrog ?    ? A  DG  101 O6    ? ? ? 1_555 B  DC  47  N4 ? ? I DG  27  J DC  -27 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog244 hydrog ?    ? A  DC  102 N3    ? ? ? 1_555 B  DG  46  N1 ? ? I DC  28  J DG  -28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog245 hydrog ?    ? A  DC  102 N4    ? ? ? 1_555 B  DG  46  O6 ? ? I DC  28  J DG  -28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog246 hydrog ?    ? A  DC  102 O2    ? ? ? 1_555 B  DG  46  N2 ? ? I DC  28  J DG  -28 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog247 hydrog ?    ? A  DA  103 N1    ? ? ? 1_555 B  DT  45  N3 ? ? I DA  29  J DT  -29 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog248 hydrog ?    ? A  DA  103 N6    ? ? ? 1_555 B  DT  45  O4 ? ? I DA  29  J DT  -29 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog249 hydrog ?    ? A  DG  104 N1    ? ? ? 1_555 B  DC  44  N3 ? ? I DG  30  J DC  -30 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog250 hydrog ?    ? A  DG  104 N2    ? ? ? 1_555 B  DC  44  O2 ? ? I DG  30  J DC  -30 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog251 hydrog ?    ? A  DG  104 O6    ? ? ? 1_555 B  DC  44  N4 ? ? I DG  30  J DC  -30 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog252 hydrog ?    ? A  DT  105 N3    ? ? ? 1_555 B  DA  43  N1 ? ? I DT  31  J DA  -31 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog253 hydrog ?    ? A  DT  105 O4    ? ? ? 1_555 B  DA  43  N6 ? ? I DT  31  J DA  -31 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog254 hydrog ?    ? A  DT  106 N3    ? ? ? 1_555 B  DA  42  N1 ? ? I DT  32  J DA  -32 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog255 hydrog ?    ? A  DT  106 O4    ? ? ? 1_555 B  DA  42  N6 ? ? I DT  32  J DA  -32 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog256 hydrog ?    ? A  DT  107 N3    ? ? ? 1_555 B  DA  41  N1 ? ? I DT  33  J DA  -33 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog257 hydrog ?    ? A  DT  107 O4    ? ? ? 1_555 B  DA  41  N6 ? ? I DT  33  J DA  -33 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog258 hydrog ?    ? A  DC  108 N3    ? ? ? 1_555 B  DG  40  N1 ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog259 hydrog ?    ? A  DC  108 N4    ? ? ? 1_555 B  DG  40  O6 ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog260 hydrog ?    ? A  DC  108 O2    ? ? ? 1_555 B  DG  40  N2 ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog261 hydrog ?    ? A  DC  109 N3    ? ? ? 1_555 B  DG  39  N1 ? ? I DC  35  J DG  -35 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog262 hydrog ?    ? A  DC  109 N4    ? ? ? 1_555 B  DG  39  O6 ? ? I DC  35  J DG  -35 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog263 hydrog ?    ? A  DC  109 O2    ? ? ? 1_555 B  DG  39  N2 ? ? I DC  35  J DG  -35 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog264 hydrog ?    ? A  DA  110 N1    ? ? ? 1_555 B  DT  38  N3 ? ? I DA  36  J DT  -36 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog265 hydrog ?    ? A  DA  110 N6    ? ? ? 1_555 B  DT  38  O4 ? ? I DA  36  J DT  -36 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog266 hydrog ?    ? A  DA  111 N1    ? ? ? 1_555 B  DT  37  N3 ? ? I DA  37  J DT  -37 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog267 hydrog ?    ? A  DA  111 N6    ? ? ? 1_555 B  DT  37  O4 ? ? I DA  37  J DT  -37 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog268 hydrog ?    ? A  DA  112 N1    ? ? ? 1_555 B  DT  36  N3 ? ? I DA  38  J DT  -38 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog269 hydrog ?    ? A  DA  112 N6    ? ? ? 1_555 B  DT  36  O4 ? ? I DA  38  J DT  -38 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog270 hydrog ?    ? A  DT  113 N3    ? ? ? 1_555 B  DA  35  N1 ? ? I DT  39  J DA  -39 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog271 hydrog ?    ? A  DT  113 O4    ? ? ? 1_555 B  DA  35  N6 ? ? I DT  39  J DA  -39 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog272 hydrog ?    ? A  DA  114 N1    ? ? ? 1_555 B  DT  34  N3 ? ? I DA  40  J DT  -40 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog273 hydrog ?    ? A  DA  114 N6    ? ? ? 1_555 B  DT  34  O4 ? ? I DA  40  J DT  -40 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog274 hydrog ?    ? A  DC  115 N3    ? ? ? 1_555 B  DG  33  N1 ? ? I DC  41  J DG  -41 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog275 hydrog ?    ? A  DC  115 N4    ? ? ? 1_555 B  DG  33  O6 ? ? I DC  41  J DG  -41 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog276 hydrog ?    ? A  DC  115 O2    ? ? ? 1_555 B  DG  33  N2 ? ? I DC  41  J DG  -41 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog277 hydrog ?    ? A  DA  116 N1    ? ? ? 1_555 B  DT  32  N3 ? ? I DA  42  J DT  -42 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog278 hydrog ?    ? A  DA  116 N6    ? ? ? 1_555 B  DT  32  O4 ? ? I DA  42  J DT  -42 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog279 hydrog ?    ? A  DC  117 N3    ? ? ? 1_555 B  DG  31  N1 ? ? I DC  43  J DG  -43 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog280 hydrog ?    ? A  DC  117 N4    ? ? ? 1_555 B  DG  31  O6 ? ? I DC  43  J DG  -43 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog281 hydrog ?    ? A  DC  117 O2    ? ? ? 1_555 B  DG  31  N2 ? ? I DC  43  J DG  -43 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog282 hydrog ?    ? A  DT  118 N3    ? ? ? 1_555 B  DA  30  N1 ? ? I DT  44  J DA  -44 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog283 hydrog ?    ? A  DT  118 O4    ? ? ? 1_555 B  DA  30  N6 ? ? I DT  44  J DA  -44 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog284 hydrog ?    ? A  DT  119 N3    ? ? ? 1_555 B  DA  29  N1 ? ? I DT  45  J DA  -45 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog285 hydrog ?    ? A  DT  119 O4    ? ? ? 1_555 B  DA  29  N6 ? ? I DT  45  J DA  -45 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog286 hydrog ?    ? A  DT  120 N3    ? ? ? 1_555 B  DA  28  N1 ? ? I DT  46  J DA  -46 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog287 hydrog ?    ? A  DT  120 O4    ? ? ? 1_555 B  DA  28  N6 ? ? I DT  46  J DA  -46 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog288 hydrog ?    ? A  DT  121 N3    ? ? ? 1_555 B  DA  27  N1 ? ? I DT  47  J DA  -47 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog289 hydrog ?    ? A  DT  121 O4    ? ? ? 1_555 B  DA  27  N6 ? ? I DT  47  J DA  -47 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog290 hydrog ?    ? A  DG  122 N1    ? ? ? 1_555 B  DC  26  N3 ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog291 hydrog ?    ? A  DG  122 N2    ? ? ? 1_555 B  DC  26  O2 ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog292 hydrog ?    ? A  DG  122 O6    ? ? ? 1_555 B  DC  26  N4 ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog293 hydrog ?    ? A  DG  123 N1    ? ? ? 1_555 B  DC  25  N3 ? ? I DG  49  J DC  -49 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog294 hydrog ?    ? A  DG  123 N2    ? ? ? 1_555 B  DC  25  O2 ? ? I DG  49  J DC  -49 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog295 hydrog ?    ? A  DG  123 O6    ? ? ? 1_555 B  DC  25  N4 ? ? I DG  49  J DC  -49 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog296 hydrog ?    ? A  DT  124 N3    ? ? ? 1_555 B  DA  24  N1 ? ? I DT  50  J DA  -50 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog297 hydrog ?    ? A  DT  124 O4    ? ? ? 1_555 B  DA  24  N6 ? ? I DT  50  J DA  -50 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog298 hydrog ?    ? A  DA  125 N1    ? ? ? 1_555 B  DT  23  N3 ? ? I DA  51  J DT  -51 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog299 hydrog ?    ? A  DA  125 N6    ? ? ? 1_555 B  DT  23  O4 ? ? I DA  51  J DT  -51 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog300 hydrog ?    ? A  DG  126 N1    ? ? ? 1_555 B  DC  22  N3 ? ? I DG  52  J DC  -52 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog301 hydrog ?    ? A  DG  126 N2    ? ? ? 1_555 B  DC  22  O2 ? ? I DG  52  J DC  -52 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog302 hydrog ?    ? A  DG  126 O6    ? ? ? 1_555 B  DC  22  N4 ? ? I DG  52  J DC  -52 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog303 hydrog ?    ? A  DG  129 N1    ? ? ? 1_555 B  DC  19  N3 ? ? I DG  55  J DC  -55 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog304 hydrog ?    ? A  DG  129 N2    ? ? ? 1_555 B  DC  19  O2 ? ? I DG  55  J DC  -55 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog305 hydrog ?    ? A  DG  129 O6    ? ? ? 1_555 B  DC  19  N4 ? ? I DG  55  J DC  -55 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog306 hydrog ?    ? A  DG  130 N1    ? ? ? 1_555 B  DC  18  O2 ? ? I DG  56  J DC  -56 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog307 hydrog ?    ? A  DG  130 N2    ? ? ? 1_555 B  DC  18  N3 ? ? I DG  56  J DC  -56 1_555 ? ? ? ? ? ? 
'REVERSED WATSON-CRICK' ?     ? 
hydrog308 hydrog ?    ? A  DA  131 N1    ? ? ? 1_555 B  DT  17  N3 ? ? I DA  57  J DT  -57 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog309 hydrog ?    ? A  DA  131 N6    ? ? ? 1_555 B  DT  17  O4 ? ? I DA  57  J DT  -57 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog310 hydrog ?    ? A  DC  132 N3    ? ? ? 1_555 B  DG  16  N1 ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog311 hydrog ?    ? A  DC  132 N4    ? ? ? 1_555 B  DG  16  O6 ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog312 hydrog ?    ? A  DC  132 O2    ? ? ? 1_555 B  DG  16  N2 ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog313 hydrog ?    ? A  DC  133 N3    ? ? ? 1_555 B  DG  15  N1 ? ? I DC  59  J DG  -59 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog314 hydrog ?    ? A  DC  133 N4    ? ? ? 1_555 B  DG  15  O6 ? ? I DC  59  J DG  -59 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog315 hydrog ?    ? A  DC  133 O2    ? ? ? 1_555 B  DG  15  N2 ? ? I DC  59  J DG  -59 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog316 hydrog ?    ? A  DA  134 N1    ? ? ? 1_555 B  DT  14  N3 ? ? I DA  60  J DT  -60 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog317 hydrog ?    ? A  DA  134 N6    ? ? ? 1_555 B  DT  14  O4 ? ? I DA  60  J DT  -60 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog318 hydrog ?    ? A  DG  135 N1    ? ? ? 1_555 B  DC  13  N3 ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog319 hydrog ?    ? A  DG  135 N2    ? ? ? 1_555 B  DC  13  O2 ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog320 hydrog ?    ? A  DG  135 O6    ? ? ? 1_555 B  DC  13  N4 ? ? I DG  61  J DC  -61 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog321 hydrog ?    ? A  DG  136 N1    ? ? ? 1_555 B  DC  12  N3 ? ? I DG  62  J DC  -62 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog322 hydrog ?    ? A  DG  136 N2    ? ? ? 1_555 B  DC  12  O2 ? ? I DG  62  J DC  -62 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog323 hydrog ?    ? A  DG  136 O6    ? ? ? 1_555 B  DC  12  N4 ? ? I DG  62  J DC  -62 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog324 hydrog ?    ? A  DT  137 N3    ? ? ? 1_555 B  DA  11  N1 ? ? I DT  63  J DA  -63 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog325 hydrog ?    ? A  DT  137 O4    ? ? ? 1_555 B  DA  11  N6 ? ? I DT  63  J DA  -63 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog326 hydrog ?    ? A  DG  138 N1    ? ? ? 1_555 B  DC  10  N3 ? ? I DG  64  J DC  -64 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog327 hydrog ?    ? A  DG  138 N2    ? ? ? 1_555 B  DC  10  O2 ? ? I DG  64  J DC  -64 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog328 hydrog ?    ? A  DG  138 O6    ? ? ? 1_555 B  DC  10  N4 ? ? I DG  64  J DC  -64 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog329 hydrog ?    ? A  DG  139 N1    ? ? ? 1_555 B  DC  9   N3 ? ? I DG  65  J DC  -65 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog330 hydrog ?    ? A  DG  139 N2    ? ? ? 1_555 B  DC  9   O2 ? ? I DG  65  J DC  -65 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog331 hydrog ?    ? A  DG  139 O6    ? ? ? 1_555 B  DC  9   N4 ? ? I DG  65  J DC  -65 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog332 hydrog ?    ? A  DA  140 N1    ? ? ? 1_555 B  DT  8   N3 ? ? I DA  66  J DT  -66 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog333 hydrog ?    ? A  DA  140 N6    ? ? ? 1_555 B  DT  8   O4 ? ? I DA  66  J DT  -66 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog334 hydrog ?    ? A  DT  141 N3    ? ? ? 1_555 B  DA  7   N1 ? ? I DT  67  J DA  -67 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog335 hydrog ?    ? A  DT  141 O4    ? ? ? 1_555 B  DA  7   N6 ? ? I DT  67  J DA  -67 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog336 hydrog ?    ? A  DA  142 N1    ? ? ? 1_555 B  DT  6   N3 ? ? I DA  68  J DT  -68 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog337 hydrog ?    ? A  DA  142 N6    ? ? ? 1_555 B  DT  6   O4 ? ? I DA  68  J DT  -68 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog338 hydrog ?    ? A  DT  143 N3    ? ? ? 1_555 B  DA  5   N1 ? ? I DT  69  J DA  -69 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog339 hydrog ?    ? A  DT  143 O4    ? ? ? 1_555 B  DA  5   N6 ? ? I DT  69  J DA  -69 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog340 hydrog ?    ? A  G47 144 N1    ? ? ? 1_555 B  DC  4   N3 ? ? I G47 70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog341 hydrog ?    ? A  G47 144 N2    ? ? ? 1_555 B  DC  4   O2 ? ? I G47 70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog342 hydrog ?    ? A  G47 144 O6    ? ? ? 1_555 B  DC  4   N4 ? ? I G47 70  J DC  -70 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog343 hydrog ?    ? A  DG  145 N1    ? ? ? 1_555 B  DC  3   N3 ? ? I DG  71  J DC  -71 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog344 hydrog ?    ? A  DG  145 N2    ? ? ? 1_555 B  DC  3   O2 ? ? I DG  71  J DC  -71 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog345 hydrog ?    ? A  DG  145 O6    ? ? ? 1_555 B  DC  3   N4 ? ? I DG  71  J DC  -71 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog346 hydrog ?    ? A  DA  146 N1    ? ? ? 1_555 B  DT  2   N3 ? ? I DA  72  J DT  -72 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog347 hydrog ?    ? A  DA  146 N6    ? ? ? 1_555 B  DT  2   O4 ? ? I DA  72  J DT  -72 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog348 hydrog ?    ? A  DT  147 N3    ? ? ? 1_555 B  DA  1   N1 ? ? I DT  73  J DA  -73 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog349 hydrog ?    ? A  DT  147 O4    ? ? ? 1_555 B  DA  1   N6 ? ? I DT  73  J DA  -73 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG C 83  ? PHE C 84  ? ARG A 83  PHE A 84  
AA1 2 THR D 81  ? VAL D 82  ? THR B 80  VAL B 81  
AA2 1 THR C 118 ? ILE C 119 ? THR A 118 ILE A 119 
AA2 2 ARG D 46  ? ILE D 47  ? ARG B 45  ILE B 46  
AA3 1 THR D 97  ? TYR D 99  ? THR B 96  TYR B 98  
AA3 2 VAL I 100 ? ILE I 102 ? VAL G 100 ILE G 102 
AA4 1 ARG E 42  ? VAL E 43  ? ARG C 42  VAL C 43  
AA4 2 THR F 85  ? ILE F 86  ? THR D 85  ILE D 86  
AA5 1 ARG E 77  ? ILE E 78  ? ARG C 77  ILE C 78  
AA5 2 GLY F 50  ? ILE F 51  ? GLY D 50  ILE D 51  
AA6 1 VAL E 100 ? ILE E 102 ? VAL C 100 ILE C 102 
AA6 2 THR H 97  ? TYR H 99  ? THR F 96  TYR F 98  
AA7 1 ARG G 83  ? PHE G 84  ? ARG E 83  PHE E 84  
AA7 2 THR H 81  ? VAL H 82  ? THR F 80  VAL F 81  
AA8 1 THR G 118 ? ILE G 119 ? THR E 118 ILE E 119 
AA8 2 ARG H 46  ? ILE H 47  ? ARG F 45  ILE F 46  
AA9 1 ARG I 42  ? VAL I 43  ? ARG G 42  VAL G 43  
AA9 2 THR J 85  ? ILE J 86  ? THR H 85  ILE H 86  
AB1 1 ARG I 77  ? ILE I 78  ? ARG G 77  ILE G 78  
AB1 2 GLY J 50  ? ILE J 51  ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG C 83  ? N ARG A 83  O VAL D 82  ? O VAL B 81  
AA2 1 2 N ILE C 119 ? N ILE A 119 O ARG D 46  ? O ARG B 45  
AA3 1 2 N TYR D 99  ? N TYR B 98  O THR I 101 ? O THR G 101 
AA4 1 2 N ARG E 42  ? N ARG C 42  O ILE F 86  ? O ILE D 86  
AA5 1 2 N ILE E 78  ? N ILE C 78  O GLY F 50  ? O GLY D 50  
AA6 1 2 N THR E 101 ? N THR C 101 O TYR H 99  ? O TYR F 98  
AA7 1 2 N ARG G 83  ? N ARG E 83  O VAL H 82  ? O VAL F 81  
AA8 1 2 N ILE G 119 ? N ILE E 119 O ARG H 46  ? O ARG F 45  
AA9 1 2 N ARG I 42  ? N ARG G 42  O ILE J 86  ? O ILE H 86  
AB1 1 2 N ILE I 78  ? N ILE G 78  O GLY J 50  ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software I MN  101 ? 2  'binding site for residue MN I 101'                 
AC2 Software I MN  102 ? 2  'binding site for residue MN I 102'                 
AC3 Software I MN  103 ? 2  'binding site for residue MN I 103'                 
AC4 Software I MN  105 ? 2  'binding site for residue MN I 105'                 
AC5 Software I MN  106 ? 1  'binding site for residue MN I 106'                 
AC6 Software I MN  107 ? 2  'binding site for residue MN I 107'                 
AC7 Software I MN  108 ? 1  'binding site for residue MN I 108'                 
AC8 Software I MN  109 ? 2  'binding site for residue MN I 109'                 
AC9 Software I MN  110 ? 2  'binding site for residue MN I 110'                 
AD1 Software J MN  101 ? 1  'binding site for residue MN J 101'                 
AD2 Software J MN  102 ? 1  'binding site for residue MN J 102'                 
AD3 Software J MN  103 ? 2  'binding site for residue MN J 103'                 
AD4 Software J MN  104 ? 2  'binding site for residue MN J 104'                 
AD5 Software J MN  106 ? 1  'binding site for residue MN J 106'                 
AD6 Software J MN  107 ? 1  'binding site for residue MN J 107'                 
AD7 Software J MN  108 ? 1  'binding site for residue MN J 108'                 
AD8 Software J MN  109 ? 3  'binding site for residue MN J 109'                 
AD9 Software A CL  201 ? 2  'binding site for residue CL A 201'                 
AE1 Software D CL  201 ? 3  'binding site for residue CL D 201'                 
AE2 Software E MN  201 ? 4  'binding site for residue MN E 201'                 
AE3 Software E CL  202 ? 2  'binding site for residue CL E 202'                 
AE4 Software G CL  201 ? 4  'binding site for residue CL G 201'                 
AE5 Software E CYS 40  ? 23 'binding site for Di-peptide CYS E 40 and G47 J 70' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2  G47 A  144 ? G47 I 70  . ? 1_555 ? 
2  AC1 2  DG  A  145 ? DG  I 71  . ? 1_555 ? 
3  AC2 2  DG  A  15  ? DG  I -59 . ? 1_555 ? 
4  AC2 2  DG  A  16  ? DG  I -58 . ? 1_555 ? 
5  AC3 2  DG  A  129 ? DG  I 55  . ? 1_555 ? 
6  AC3 2  DG  A  130 ? DG  I 56  . ? 1_555 ? 
7  AC4 2  DT  A  121 ? DT  I 47  . ? 1_555 ? 
8  AC4 2  DG  A  122 ? DG  I 48  . ? 1_555 ? 
9  AC5 1  DG  A  135 ? DG  I 61  . ? 1_555 ? 
10 AC6 2  DG  A  101 ? DG  I 27  . ? 1_555 ? 
11 AC6 2  HOH JA .   ? HOH J 208 . ? 1_555 ? 
12 AC7 1  DG  A  79  ? DG  I 5   . ? 1_555 ? 
13 AC8 2  DG  A  71  ? DG  I -3  . ? 1_555 ? 
14 AC8 2  DG  A  72  ? DG  I -2  . ? 1_555 ? 
15 AC9 2  DG  A  39  ? DG  I -35 . ? 1_555 ? 
16 AC9 2  DG  A  40  ? DG  I -34 . ? 1_555 ? 
17 AD1 1  DG  B  15  ? DG  J -59 . ? 1_555 ? 
18 AD2 1  DG  B  58  ? DG  J -16 . ? 1_555 ? 
19 AD3 2  DG  B  39  ? DG  J -35 . ? 1_555 ? 
20 AD3 2  DG  B  40  ? DG  J -34 . ? 1_555 ? 
21 AD4 2  G47 B  144 ? G47 J 70  . ? 1_555 ? 
22 AD4 2  DG  B  145 ? DG  J 71  . ? 1_555 ? 
23 AD5 1  DG  B  135 ? DG  J 61  . ? 1_555 ? 
24 AD6 1  DG  B  101 ? DG  J 27  . ? 1_555 ? 
25 AD7 1  DG  B  71  ? DG  J -3  . ? 1_555 ? 
26 AD8 3  DG  B  122 ? DG  J 48  . ? 1_555 ? 
27 AD8 3  HOH JA .   ? HOH J 203 . ? 1_555 ? 
28 AD8 3  HOH JA .   ? HOH J 204 . ? 1_555 ? 
29 AD9 2  PRO C  121 ? PRO A 121 . ? 1_555 ? 
30 AD9 2  LYS C  122 ? LYS A 122 . ? 1_555 ? 
31 AE1 3  GLY E  46  ? GLY C 46  . ? 1_555 ? 
32 AE1 3  THR F  87  ? THR D 87  . ? 1_555 ? 
33 AE1 3  SER F  88  ? SER D 88  . ? 1_555 ? 
34 AE2 4  VAL F  45  ? VAL D 45  . ? 2_564 ? 
35 AE2 4  HOH NA .   ? HOH D 301 . ? 2_564 ? 
36 AE2 4  ASP G  77  ? ASP E 77  . ? 1_555 ? 
37 AE2 4  HOH PA .   ? HOH F 206 . ? 1_555 ? 
38 AE3 2  PRO G  121 ? PRO E 121 . ? 1_555 ? 
39 AE3 2  LYS G  122 ? LYS E 122 . ? 1_555 ? 
40 AE4 4  GLY I  44  ? GLY G 44  . ? 1_555 ? 
41 AE4 4  GLY I  46  ? GLY G 46  . ? 1_555 ? 
42 AE4 4  THR J  87  ? THR H 87  . ? 1_555 ? 
43 AE4 4  SER J  88  ? SER H 88  . ? 1_555 ? 
44 AE5 23 HIS G  39  ? HIS E 39  . ? 1_555 ? 
45 AE5 23 TYR G  41  ? TYR E 41  . ? 1_555 ? 
46 AE5 23 PRO G  66  ? PRO E 66  . ? 1_555 ? 
47 AE5 23 PHE G  67  ? PHE E 67  . ? 1_555 ? 
48 AE5 23 GLN G  68  ? GLN E 68  . ? 1_555 ? 
49 AE5 23 ARG G  69  ? ARG E 69  . ? 1_555 ? 
50 AE5 23 VAL G  71  ? VAL E 71  . ? 1_555 ? 
51 AE5 23 ARG G  72  ? ARG E 72  . ? 1_555 ? 
52 AE5 23 GLU G  73  ? GLU E 73  . ? 1_555 ? 
53 AE5 23 ILE G  74  ? ILE E 74  . ? 1_555 ? 
54 AE5 23 ILE H  27  ? ILE F 26  . ? 1_555 ? 
55 AE5 23 ILE H  30  ? ILE F 29  . ? 1_555 ? 
56 AE5 23 LEU H  63  ? LEU F 62  . ? 1_555 ? 
57 AE5 23 DA  A  35  ? DA  I -39 . ? 1_555 ? 
58 AE5 23 DG  A  33  ? DG  I -41 . ? 1_555 ? 
59 AE5 23 DT  A  34  ? DT  I -40 . ? 1_555 ? 
60 AE5 23 DA  A  5   ? DA  I -69 . ? 1_555 ? 
61 AE5 23 DC  A  4   ? DC  I -70 . ? 1_555 ? 
62 AE5 23 DT  B  113 ? DT  J 39  . ? 1_555 ? 
63 AE5 23 DC  B  115 ? DC  J 41  . ? 1_555 ? 
64 AE5 23 DT  B  143 ? DT  J 69  . ? 1_555 ? 
65 AE5 23 DG  B  145 ? DG  J 71  . ? 1_555 ? 
66 AE5 23 MN  X  .   ? MN  J 104 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5ONG 
_atom_sites.fract_transf_matrix[1][1]   0.009413 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005461 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009133 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     O  "O5'" . DA  A  1 1   ? 23.245 140.311 29.043  1.00 177.32 ? -73 DA  I "O5'" 1 
ATOM   2     C  "C5'" . DA  A  1 1   ? 23.305 140.210 27.626  1.00 174.19 ? -73 DA  I "C5'" 1 
ATOM   3     C  "C4'" . DA  A  1 1   ? 21.965 140.562 27.005  1.00 179.28 ? -73 DA  I "C4'" 1 
ATOM   4     O  "O4'" . DA  A  1 1   ? 22.111 140.654 25.562  1.00 176.76 ? -73 DA  I "O4'" 1 
ATOM   5     C  "C3'" . DA  A  1 1   ? 20.862 139.540 27.232  1.00 182.35 ? -73 DA  I "C3'" 1 
ATOM   6     O  "O3'" . DA  A  1 1   ? 19.594 140.189 27.190  1.00 186.31 ? -73 DA  I "O3'" 1 
ATOM   7     C  "C2'" . DA  A  1 1   ? 21.056 138.611 26.043  1.00 178.23 ? -73 DA  I "C2'" 1 
ATOM   8     C  "C1'" . DA  A  1 1   ? 21.390 139.607 24.940  1.00 177.17 ? -73 DA  I "C1'" 1 
ATOM   9     N  N9    . DA  A  1 1   ? 22.217 139.047 23.873  1.00 174.35 ? -73 DA  I N9    1 
ATOM   10    C  C8    . DA  A  1 1   ? 23.311 138.238 24.012  1.00 171.68 ? -73 DA  I C8    1 
ATOM   11    N  N7    . DA  A  1 1   ? 23.863 137.892 22.872  1.00 166.76 ? -73 DA  I N7    1 
ATOM   12    C  C5    . DA  A  1 1   ? 23.079 138.520 21.919  1.00 166.50 ? -73 DA  I C5    1 
ATOM   13    C  C6    . DA  A  1 1   ? 23.135 138.552 20.511  1.00 162.68 ? -73 DA  I C6    1 
ATOM   14    N  N6    . DA  A  1 1   ? 24.063 137.908 19.792  1.00 157.08 ? -73 DA  I N6    1 
ATOM   15    N  N1    . DA  A  1 1   ? 22.198 139.277 19.867  1.00 164.18 ? -73 DA  I N1    1 
ATOM   16    C  C2    . DA  A  1 1   ? 21.271 139.921 20.585  1.00 168.95 ? -73 DA  I C2    1 
ATOM   17    N  N3    . DA  A  1 1   ? 21.116 139.965 21.905  1.00 173.11 ? -73 DA  I N3    1 
ATOM   18    C  C4    . DA  A  1 1   ? 22.060 139.237 22.520  1.00 171.59 ? -73 DA  I C4    1 
ATOM   19    P  P     . DT  A  1 2   ? 18.235 139.369 27.449  1.00 188.63 ? -72 DT  I P     1 
ATOM   20    O  OP1   . DT  A  1 2   ? 17.467 140.110 28.474  1.00 196.35 ? -72 DT  I OP1   1 
ATOM   21    O  OP2   . DT  A  1 2   ? 18.555 137.942 27.678  1.00 184.66 ? -72 DT  I OP2   1 
ATOM   22    O  "O5'" . DT  A  1 2   ? 17.458 139.486 26.057  1.00 185.59 ? -72 DT  I "O5'" 1 
ATOM   23    C  "C5'" . DT  A  1 2   ? 17.210 140.769 25.495  1.00 185.39 ? -72 DT  I "C5'" 1 
ATOM   24    C  "C4'" . DT  A  1 2   ? 16.244 140.678 24.326  1.00 183.53 ? -72 DT  I "C4'" 1 
ATOM   25    O  "O4'" . DT  A  1 2   ? 16.952 140.268 23.128  1.00 178.96 ? -72 DT  I "O4'" 1 
ATOM   26    C  "C3'" . DT  A  1 2   ? 15.094 139.695 24.505  1.00 182.75 ? -72 DT  I "C3'" 1 
ATOM   27    O  "O3'" . DT  A  1 2   ? 13.902 140.258 23.966  1.00 178.82 ? -72 DT  I "O3'" 1 
ATOM   28    C  "C2'" . DT  A  1 2   ? 15.560 138.459 23.727  1.00 179.81 ? -72 DT  I "C2'" 1 
ATOM   29    C  "C1'" . DT  A  1 2   ? 16.406 139.068 22.614  1.00 177.60 ? -72 DT  I "C1'" 1 
ATOM   30    N  N1    . DT  A  1 2   ? 17.550 138.201 22.174  1.00 174.39 ? -72 DT  I N1    1 
ATOM   31    C  C2    . DT  A  1 2   ? 17.836 138.086 20.829  1.00 169.26 ? -72 DT  I C2    1 
ATOM   32    O  O2    . DT  A  1 2   ? 17.191 138.644 19.959  1.00 167.31 ? -72 DT  I O2    1 
ATOM   33    N  N3    . DT  A  1 2   ? 18.912 137.283 20.537  1.00 165.90 ? -72 DT  I N3    1 
ATOM   34    C  C4    . DT  A  1 2   ? 19.714 136.604 21.437  1.00 165.46 ? -72 DT  I C4    1 
ATOM   35    O  O4    . DT  A  1 2   ? 20.658 135.907 21.079  1.00 161.31 ? -72 DT  I O4    1 
ATOM   36    C  C5    . DT  A  1 2   ? 19.364 136.772 22.827  1.00 169.34 ? -72 DT  I C5    1 
ATOM   37    C  C7    . DT  A  1 2   ? 20.163 136.078 23.889  1.00 167.05 ? -72 DT  I C7    1 
ATOM   38    C  C6    . DT  A  1 2   ? 18.314 137.555 23.126  1.00 175.25 ? -72 DT  I C6    1 
ATOM   39    P  P     . DC  A  1 3   ? 12.542 139.406 23.895  1.00 191.90 ? -71 DC  I P     1 
ATOM   40    O  OP1   . DC  A  1 3   ? 11.419 140.362 24.012  1.00 197.80 ? -71 DC  I OP1   1 
ATOM   41    O  OP2   . DC  A  1 3   ? 12.636 138.272 24.841  1.00 189.07 ? -71 DC  I OP2   1 
ATOM   42    O  "O5'" . DC  A  1 3   ? 12.551 138.832 22.407  1.00 186.36 ? -71 DC  I "O5'" 1 
ATOM   43    C  "C5'" . DC  A  1 3   ? 12.833 139.708 21.324  1.00 184.33 ? -71 DC  I "C5'" 1 
ATOM   44    C  "C4'" . DC  A  1 3   ? 12.588 139.031 19.988  1.00 180.43 ? -71 DC  I "C4'" 1 
ATOM   45    O  "O4'" . DC  A  1 3   ? 13.754 138.258 19.600  1.00 172.69 ? -71 DC  I "O4'" 1 
ATOM   46    C  "C3'" . DC  A  1 3   ? 11.415 138.064 19.949  1.00 182.81 ? -71 DC  I "C3'" 1 
ATOM   47    O  "O3'" . DC  A  1 3   ? 10.826 138.115 18.655  1.00 183.43 ? -71 DC  I "O3'" 1 
ATOM   48    C  "C2'" . DC  A  1 3   ? 12.089 136.715 20.223  1.00 176.54 ? -71 DC  I "C2'" 1 
ATOM   49    C  "C1'" . DC  A  1 3   ? 13.422 136.885 19.502  1.00 169.06 ? -71 DC  I "C1'" 1 
ATOM   50    N  N1    . DC  A  1 3   ? 14.552 136.106 20.098  1.00 163.47 ? -71 DC  I N1    1 
ATOM   51    C  C2    . DC  A  1 3   ? 15.567 135.614 19.266  1.00 153.43 ? -71 DC  I C2    1 
ATOM   52    O  O2    . DC  A  1 3   ? 15.496 135.814 18.047  1.00 147.97 ? -71 DC  I O2    1 
ATOM   53    N  N3    . DC  A  1 3   ? 16.597 134.926 19.820  1.00 149.85 ? -71 DC  I N3    1 
ATOM   54    C  C4    . DC  A  1 3   ? 16.636 134.733 21.140  1.00 152.00 ? -71 DC  I C4    1 
ATOM   55    N  N4    . DC  A  1 3   ? 17.670 134.050 21.642  1.00 147.29 ? -71 DC  I N4    1 
ATOM   56    C  C5    . DC  A  1 3   ? 15.616 135.233 22.005  1.00 161.87 ? -71 DC  I C5    1 
ATOM   57    C  C6    . DC  A  1 3   ? 14.606 135.910 21.447  1.00 166.45 ? -71 DC  I C6    1 
ATOM   58    P  P     . DC  A  1 4   ? 9.301  137.668 18.413  1.00 182.51 ? -70 DC  I P     1 
ATOM   59    O  OP1   . DC  A  1 4   ? 8.590  138.806 17.789  1.00 184.74 ? -70 DC  I OP1   1 
ATOM   60    O  OP2   . DC  A  1 4   ? 8.787  137.066 19.663  1.00 188.36 ? -70 DC  I OP2   1 
ATOM   61    O  "O5'" . DC  A  1 4   ? 9.449  136.537 17.300  1.00 175.02 ? -70 DC  I "O5'" 1 
ATOM   62    C  "C5'" . DC  A  1 4   ? 10.682 135.867 17.190  1.00 169.45 ? -70 DC  I "C5'" 1 
ATOM   63    C  "C4'" . DC  A  1 4   ? 10.972 135.449 15.771  1.00 165.48 ? -70 DC  I "C4'" 1 
ATOM   64    O  "O4'" . DC  A  1 4   ? 12.288 134.850 15.743  1.00 161.83 ? -70 DC  I "O4'" 1 
ATOM   65    C  "C3'" . DC  A  1 4   ? 10.075 134.348 15.264  1.00 165.55 ? -70 DC  I "C3'" 1 
ATOM   66    O  "O3'" . DC  A  1 4   ? 10.247 134.192 13.860  1.00 162.55 ? -70 DC  I "O3'" 1 
ATOM   67    C  "C2'" . DC  A  1 4   ? 10.651 133.167 16.025  1.00 164.18 ? -70 DC  I "C2'" 1 
ATOM   68    C  "C1'" . DC  A  1 4   ? 12.154 133.449 15.911  1.00 159.01 ? -70 DC  I "C1'" 1 
ATOM   69    N  N1    . DC  A  1 4   ? 12.945 133.021 17.115  1.00 154.26 ? -70 DC  I N1    1 
ATOM   70    C  C2    . DC  A  1 4   ? 14.178 132.382 16.941  1.00 143.53 ? -70 DC  I C2    1 
ATOM   71    O  O2    . DC  A  1 4   ? 14.599 132.186 15.795  1.00 135.65 ? -70 DC  I O2    1 
ATOM   72    N  N3    . DC  A  1 4   ? 14.880 131.999 18.038  1.00 143.36 ? -70 DC  I N3    1 
ATOM   73    C  C4    . DC  A  1 4   ? 14.391 132.229 19.258  1.00 148.38 ? -70 DC  I C4    1 
ATOM   74    N  N4    . DC  A  1 4   ? 15.119 131.833 20.308  1.00 147.57 ? -70 DC  I N4    1 
ATOM   75    C  C5    . DC  A  1 4   ? 13.136 132.875 19.455  1.00 155.03 ? -70 DC  I C5    1 
ATOM   76    C  C6    . DC  A  1 4   ? 12.452 133.247 18.368  1.00 157.29 ? -70 DC  I C6    1 
ATOM   77    P  P     . DA  A  1 5   ? 9.146  133.406 12.991  1.00 164.61 ? -69 DA  I P     1 
ATOM   78    O  OP1   . DA  A  1 5   ? 8.655  134.336 11.951  1.00 164.85 ? -69 DA  I OP1   1 
ATOM   79    O  OP2   . DA  A  1 5   ? 8.186  132.786 13.931  1.00 167.84 ? -69 DA  I OP2   1 
ATOM   80    O  "O5'" . DA  A  1 5   ? 9.974  132.232 12.284  1.00 157.34 ? -69 DA  I "O5'" 1 
ATOM   81    C  "C5'" . DA  A  1 5   ? 10.655 132.476 11.054  1.00 152.72 ? -69 DA  I "C5'" 1 
ATOM   82    C  "C4'" . DA  A  1 5   ? 11.570 131.315 10.686  1.00 147.64 ? -69 DA  I "C4'" 1 
ATOM   83    O  "O4'" . DA  A  1 5   ? 12.471 131.028 11.791  1.00 147.01 ? -69 DA  I "O4'" 1 
ATOM   84    C  "C3'" . DA  A  1 5   ? 10.870 129.994 10.388  1.00 144.69 ? -69 DA  I "C3'" 1 
ATOM   85    O  "O3'" . DA  A  1 5   ? 11.669 129.235 9.472   1.00 138.99 ? -69 DA  I "O3'" 1 
ATOM   86    C  "C2'" . DA  A  1 5   ? 10.837 129.351 11.768  1.00 145.12 ? -69 DA  I "C2'" 1 
ATOM   87    C  "C1'" . DA  A  1 5   ? 12.223 129.721 12.279  1.00 143.05 ? -69 DA  I "C1'" 1 
ATOM   88    N  N9    . DA  A  1 5   ? 12.324 129.751 13.732  1.00 142.15 ? -69 DA  I N9    1 
ATOM   89    C  C8    . DA  A  1 5   ? 11.476 130.384 14.586  1.00 146.07 ? -69 DA  I C8    1 
ATOM   90    N  N7    . DA  A  1 5   ? 11.803 130.259 15.848  1.00 147.60 ? -69 DA  I N7    1 
ATOM   91    C  C5    . DA  A  1 5   ? 12.953 129.498 15.822  1.00 143.27 ? -69 DA  I C5    1 
ATOM   92    C  C6    . DA  A  1 5   ? 13.787 129.024 16.848  1.00 140.48 ? -69 DA  I C6    1 
ATOM   93    N  N6    . DA  A  1 5   ? 13.562 129.270 18.139  1.00 142.96 ? -69 DA  I N6    1 
ATOM   94    N  N1    . DA  A  1 5   ? 14.858 128.283 16.496  1.00 136.50 ? -69 DA  I N1    1 
ATOM   95    C  C2    . DA  A  1 5   ? 15.074 128.041 15.194  1.00 134.22 ? -69 DA  I C2    1 
ATOM   96    N  N3    . DA  A  1 5   ? 14.354 128.436 14.136  1.00 134.59 ? -69 DA  I N3    1 
ATOM   97    C  C4    . DA  A  1 5   ? 13.296 129.171 14.526  1.00 139.61 ? -69 DA  I C4    1 
ATOM   98    P  P     . DT  A  1 6   ? 11.111 127.886 8.794   1.00 147.01 ? -68 DT  I P     1 
ATOM   99    O  OP1   . DT  A  1 6   ? 11.256 128.035 7.329   1.00 144.89 ? -68 DT  I OP1   1 
ATOM   100   O  OP2   . DT  A  1 6   ? 9.783  127.581 9.371   1.00 153.06 ? -68 DT  I OP2   1 
ATOM   101   O  "O5'" . DT  A  1 6   ? 12.139 126.762 9.287   1.00 134.65 ? -68 DT  I "O5'" 1 
ATOM   102   C  "C5'" . DT  A  1 6   ? 12.440 126.653 10.666  1.00 130.66 ? -68 DT  I "C5'" 1 
ATOM   103   C  "C4'" . DT  A  1 6   ? 13.570 125.689 10.916  1.00 123.10 ? -68 DT  I "C4'" 1 
ATOM   104   O  "O4'" . DT  A  1 6   ? 14.065 125.882 12.268  1.00 124.31 ? -68 DT  I "O4'" 1 
ATOM   105   C  "C3'" . DT  A  1 6   ? 13.169 124.231 10.837  1.00 119.59 ? -68 DT  I "C3'" 1 
ATOM   106   O  "O3'" . DT  A  1 6   ? 14.285 123.447 10.470  1.00 114.80 ? -68 DT  I "O3'" 1 
ATOM   107   C  "C2'" . DT  A  1 6   ? 12.710 123.945 12.264  1.00 122.97 ? -68 DT  I "C2'" 1 
ATOM   108   C  "C1'" . DT  A  1 6   ? 13.667 124.801 13.091  1.00 123.70 ? -68 DT  I "C1'" 1 
ATOM   109   N  N1    . DT  A  1 6   ? 13.045 125.352 14.345  1.00 128.47 ? -68 DT  I N1    1 
ATOM   110   C  C2    . DT  A  1 6   ? 13.628 125.084 15.565  1.00 128.82 ? -68 DT  I C2    1 
ATOM   111   O  O2    . DT  A  1 6   ? 14.642 124.421 15.691  1.00 124.60 ? -68 DT  I O2    1 
ATOM   112   N  N3    . DT  A  1 6   ? 12.978 125.630 16.643  1.00 134.81 ? -68 DT  I N3    1 
ATOM   113   C  C4    . DT  A  1 6   ? 11.829 126.397 16.628  1.00 139.96 ? -68 DT  I C4    1 
ATOM   114   O  O4    . DT  A  1 6   ? 11.323 126.843 17.655  1.00 145.61 ? -68 DT  I O4    1 
ATOM   115   C  C5    . DT  A  1 6   ? 11.268 126.638 15.319  1.00 138.25 ? -68 DT  I C5    1 
ATOM   116   C  C7    . DT  A  1 6   ? 10.019 127.455 15.176  1.00 141.49 ? -68 DT  I C7    1 
ATOM   117   C  C6    . DT  A  1 6   ? 11.894 126.109 14.254  1.00 134.01 ? -68 DT  I C6    1 
ATOM   118   P  P     . DA  A  1 7   ? 14.116 121.876 10.180  1.00 116.04 ? -67 DA  I P     1 
ATOM   119   O  OP1   . DA  A  1 7   ? 14.811 121.587 8.905   1.00 112.41 ? -67 DA  I OP1   1 
ATOM   120   O  OP2   . DA  A  1 7   ? 12.687 121.516 10.326  1.00 117.87 ? -67 DA  I OP2   1 
ATOM   121   O  "O5'" . DA  A  1 7   ? 14.934 121.200 11.374  1.00 117.98 ? -67 DA  I "O5'" 1 
ATOM   122   C  "C5'" . DA  A  1 7   ? 16.226 121.693 11.690  1.00 112.11 ? -67 DA  I "C5'" 1 
ATOM   123   C  "C4'" . DA  A  1 7   ? 16.654 121.277 13.085  1.00 106.82 ? -67 DA  I "C4'" 1 
ATOM   124   O  "O4'" . DA  A  1 7   ? 15.838 121.947 14.081  1.00 112.25 ? -67 DA  I "O4'" 1 
ATOM   125   C  "C3'" . DA  A  1 7   ? 16.550 119.785 13.386  1.00 105.87 ? -67 DA  I "C3'" 1 
ATOM   126   O  "O3'" . DA  A  1 7   ? 17.709 119.386 14.095  1.00 104.30 ? -67 DA  I "O3'" 1 
ATOM   127   C  "C2'" . DA  A  1 7   ? 15.288 119.694 14.253  1.00 114.31 ? -67 DA  I "C2'" 1 
ATOM   128   C  "C1'" . DA  A  1 7   ? 15.377 121.000 15.019  1.00 117.66 ? -67 DA  I "C1'" 1 
ATOM   129   N  N9    . DA  A  1 7   ? 14.109 121.489 15.559  1.00 128.26 ? -67 DA  I N9    1 
ATOM   130   C  C8    . DA  A  1 7   ? 13.035 121.942 14.848  1.00 131.01 ? -67 DA  I C8    1 
ATOM   131   N  N7    . DA  A  1 7   ? 12.040 122.360 15.594  1.00 136.88 ? -67 DA  I N7    1 
ATOM   132   C  C5    . DA  A  1 7   ? 12.495 122.175 16.888  1.00 138.99 ? -67 DA  I C5    1 
ATOM   133   C  C6    . DA  A  1 7   ? 11.905 122.422 18.143  1.00 145.63 ? -67 DA  I C6    1 
ATOM   134   N  N6    . DA  A  1 7   ? 10.678 122.930 18.289  1.00 150.53 ? -67 DA  I N6    1 
ATOM   135   N  N1    . DA  A  1 7   ? 12.627 122.125 19.245  1.00 148.36 ? -67 DA  I N1    1 
ATOM   136   C  C2    . DA  A  1 7   ? 13.855 121.614 19.091  1.00 144.49 ? -67 DA  I C2    1 
ATOM   137   N  N3    . DA  A  1 7   ? 14.516 121.340 17.963  1.00 137.88 ? -67 DA  I N3    1 
ATOM   138   C  C4    . DA  A  1 7   ? 13.772 121.646 16.887  1.00 135.13 ? -67 DA  I C4    1 
ATOM   139   P  P     . DT  A  1 8   ? 17.985 117.838 14.415  1.00 110.16 ? -66 DT  I P     1 
ATOM   140   O  OP1   . DT  A  1 8   ? 19.448 117.633 14.347  1.00 108.63 ? -66 DT  I OP1   1 
ATOM   141   O  OP2   . DT  A  1 8   ? 17.085 117.022 13.571  1.00 111.29 ? -66 DT  I OP2   1 
ATOM   142   O  "O5'" . DT  A  1 8   ? 17.532 117.692 15.937  1.00 117.98 ? -66 DT  I "O5'" 1 
ATOM   143   C  "C5'" . DT  A  1 8   ? 18.017 118.618 16.896  1.00 124.26 ? -66 DT  I "C5'" 1 
ATOM   144   C  "C4'" . DT  A  1 8   ? 17.597 118.224 18.298  1.00 129.39 ? -66 DT  I "C4'" 1 
ATOM   145   O  "O4'" . DT  A  1 8   ? 16.307 118.809 18.613  1.00 133.82 ? -66 DT  I "O4'" 1 
ATOM   146   C  "C3'" . DT  A  1 8   ? 17.449 116.724 18.541  1.00 129.73 ? -66 DT  I "C3'" 1 
ATOM   147   O  "O3'" . DT  A  1 8   ? 17.936 116.431 19.835  1.00 131.68 ? -66 DT  I "O3'" 1 
ATOM   148   C  "C2'" . DT  A  1 8   ? 15.934 116.517 18.448  1.00 132.92 ? -66 DT  I "C2'" 1 
ATOM   149   C  "C1'" . DT  A  1 8   ? 15.440 117.802 19.086  1.00 137.20 ? -66 DT  I "C1'" 1 
ATOM   150   N  N1    . DT  A  1 8   ? 14.045 118.189 18.728  1.00 138.83 ? -66 DT  I N1    1 
ATOM   151   C  C2    . DT  A  1 8   ? 13.183 118.565 19.731  1.00 143.46 ? -66 DT  I C2    1 
ATOM   152   O  O2    . DT  A  1 8   ? 13.494 118.577 20.909  1.00 145.06 ? -66 DT  I O2    1 
ATOM   153   N  N3    . DT  A  1 8   ? 11.934 118.929 19.309  1.00 145.16 ? -66 DT  I N3    1 
ATOM   154   C  C4    . DT  A  1 8   ? 11.468 118.958 18.008  1.00 140.62 ? -66 DT  I C4    1 
ATOM   155   O  O4    . DT  A  1 8   ? 10.322 119.301 17.731  1.00 141.49 ? -66 DT  I O4    1 
ATOM   156   C  C5    . DT  A  1 8   ? 12.424 118.558 16.999  1.00 134.81 ? -66 DT  I C5    1 
ATOM   157   C  C7    . DT  A  1 8   ? 12.034 118.550 15.551  1.00 130.99 ? -66 DT  I C7    1 
ATOM   158   C  C6    . DT  A  1 8   ? 13.655 118.201 17.403  1.00 133.85 ? -66 DT  I C6    1 
ATOM   159   P  P     . DC  A  1 9   ? 18.312 114.931 20.265  1.00 135.46 ? -65 DC  I P     1 
ATOM   160   O  OP1   . DC  A  1 9   ? 19.780 114.874 20.447  1.00 132.68 ? -65 DC  I OP1   1 
ATOM   161   O  OP2   . DC  A  1 9   ? 17.648 113.988 19.338  1.00 132.04 ? -65 DC  I OP2   1 
ATOM   162   O  "O5'" . DC  A  1 9   ? 17.615 114.794 21.692  1.00 141.68 ? -65 DC  I "O5'" 1 
ATOM   163   C  "C5'" . DC  A  1 9   ? 17.352 115.964 22.454  1.00 147.72 ? -65 DC  I "C5'" 1 
ATOM   164   C  "C4'" . DC  A  1 9   ? 16.105 115.784 23.293  1.00 157.47 ? -65 DC  I "C4'" 1 
ATOM   165   O  "O4'" . DC  A  1 9   ? 14.950 116.285 22.577  1.00 157.52 ? -65 DC  I "O4'" 1 
ATOM   166   C  "C3'" . DC  A  1 9   ? 15.790 114.334 23.662  1.00 165.41 ? -65 DC  I "C3'" 1 
ATOM   167   O  "O3'" . DC  A  1 9   ? 15.653 114.226 25.064  1.00 181.23 ? -65 DC  I "O3'" 1 
ATOM   168   C  "C2'" . DC  A  1 9   ? 14.473 114.035 22.928  1.00 161.90 ? -65 DC  I "C2'" 1 
ATOM   169   C  "C1'" . DC  A  1 9   ? 13.864 115.420 22.795  1.00 159.88 ? -65 DC  I "C1'" 1 
ATOM   170   N  N1    . DC  A  1 9   ? 12.917 115.564 21.647  1.00 151.74 ? -65 DC  I N1    1 
ATOM   171   C  C2    . DC  A  1 9   ? 11.637 116.086 21.868  1.00 155.15 ? -65 DC  I C2    1 
ATOM   172   O  O2    . DC  A  1 9   ? 11.314 116.407 23.018  1.00 159.50 ? -65 DC  I O2    1 
ATOM   173   N  N3    . DC  A  1 9   ? 10.791 116.221 20.815  1.00 150.56 ? -65 DC  I N3    1 
ATOM   174   C  C4    . DC  A  1 9   ? 11.186 115.861 19.592  1.00 142.15 ? -65 DC  I C4    1 
ATOM   175   N  N4    . DC  A  1 9   ? 10.321 116.011 18.582  1.00 137.60 ? -65 DC  I N4    1 
ATOM   176   C  C5    . DC  A  1 9   ? 12.488 115.331 19.349  1.00 136.76 ? -65 DC  I C5    1 
ATOM   177   C  C6    . DC  A  1 9   ? 13.312 115.203 20.394  1.00 139.41 ? -65 DC  I C6    1 
ATOM   178   P  P     . DC  A  1 10  ? 15.711 112.791 25.780  1.00 155.16 ? -64 DC  I P     1 
ATOM   179   O  OP1   . DC  A  1 10  ? 16.664 112.892 26.909  1.00 159.76 ? -64 DC  I OP1   1 
ATOM   180   O  OP2   . DC  A  1 10  ? 15.916 111.764 24.733  1.00 149.54 ? -64 DC  I OP2   1 
ATOM   181   O  "O5'" . DC  A  1 10  ? 14.236 112.622 26.363  1.00 163.04 ? -64 DC  I "O5'" 1 
ATOM   182   C  "C5'" . DC  A  1 10  ? 13.411 113.769 26.512  1.00 169.70 ? -64 DC  I "C5'" 1 
ATOM   183   C  "C4'" . DC  A  1 10  ? 12.038 113.383 27.019  1.00 178.50 ? -64 DC  I "C4'" 1 
ATOM   184   O  "O4'" . DC  A  1 10  ? 11.034 113.763 26.038  1.00 181.94 ? -64 DC  I "O4'" 1 
ATOM   185   C  "C3'" . DC  A  1 10  ? 11.836 111.891 27.253  1.00 176.19 ? -64 DC  I "C3'" 1 
ATOM   186   O  "O3'" . DC  A  1 10  ? 10.890 111.708 28.291  1.00 170.33 ? -64 DC  I "O3'" 1 
ATOM   187   C  "C2'" . DC  A  1 10  ? 11.276 111.442 25.912  1.00 178.22 ? -64 DC  I "C2'" 1 
ATOM   188   C  "C1'" . DC  A  1 10  ? 10.353 112.608 25.596  1.00 184.80 ? -64 DC  I "C1'" 1 
ATOM   189   N  N1    . DC  A  1 10  ? 10.050 112.751 24.149  1.00 187.69 ? -64 DC  I N1    1 
ATOM   190   C  C2    . DC  A  1 10  ? 8.814  113.271 23.748  1.00 194.07 ? -64 DC  I C2    1 
ATOM   191   O  O2    . DC  A  1 10  ? 7.993  113.609 24.609  1.00 200.57 ? -64 DC  I O2    1 
ATOM   192   N  N3    . DC  A  1 10  ? 8.553  113.391 22.422  1.00 192.34 ? -64 DC  I N3    1 
ATOM   193   C  C4    . DC  A  1 10  ? 9.470  113.013 21.526  1.00 186.38 ? -64 DC  I C4    1 
ATOM   194   N  N4    . DC  A  1 10  ? 9.173  113.149 20.230  1.00 183.46 ? -64 DC  I N4    1 
ATOM   195   C  C5    . DC  A  1 10  ? 10.731 112.478 21.919  1.00 181.95 ? -64 DC  I C5    1 
ATOM   196   C  C6    . DC  A  1 10  ? 10.976 112.364 23.227  1.00 183.73 ? -64 DC  I C6    1 
ATOM   197   P  P     . DA  A  1 11  ? 10.692 110.276 28.993  1.00 184.53 ? -63 DA  I P     1 
ATOM   198   O  OP1   . DA  A  1 11  ? 11.791 110.098 29.967  1.00 182.90 ? -63 DA  I OP1   1 
ATOM   199   O  OP2   . DA  A  1 11  ? 10.463 109.253 27.949  1.00 177.88 ? -63 DA  I OP2   1 
ATOM   200   O  "O5'" . DA  A  1 11  ? 9.320  110.459 29.785  1.00 186.55 ? -63 DA  I "O5'" 1 
ATOM   201   C  "C5'" . DA  A  1 11  ? 8.637  111.709 29.722  1.00 186.92 ? -63 DA  I "C5'" 1 
ATOM   202   C  "C4'" . DA  A  1 11  ? 7.163  111.508 29.421  1.00 193.11 ? -63 DA  I "C4'" 1 
ATOM   203   O  "O4'" . DA  A  1 11  ? 6.905  111.745 28.012  1.00 188.39 ? -63 DA  I "O4'" 1 
ATOM   204   C  "C3'" . DA  A  1 11  ? 6.627  110.116 29.726  1.00 201.68 ? -63 DA  I "C3'" 1 
ATOM   205   O  "O3'" . DA  A  1 11  ? 5.332  110.221 30.289  1.00 219.53 ? -63 DA  I "O3'" 1 
ATOM   206   C  "C2'" . DA  A  1 11  ? 6.603  109.435 28.356  1.00 192.70 ? -63 DA  I "C2'" 1 
ATOM   207   C  "C1'" . DA  A  1 11  ? 6.330  110.600 27.413  1.00 190.34 ? -63 DA  I "C1'" 1 
ATOM   208   N  N9    . DA  A  1 11  ? 6.945  110.437 26.097  1.00 186.94 ? -63 DA  I N9    1 
ATOM   209   C  C8    . DA  A  1 11  ? 8.236  110.075 25.843  1.00 181.89 ? -63 DA  I C8    1 
ATOM   210   N  N7    . DA  A  1 11  ? 8.534  110.022 24.568  1.00 175.64 ? -63 DA  I N7    1 
ATOM   211   C  C5    . DA  A  1 11  ? 7.356  110.375 23.936  1.00 177.06 ? -63 DA  I C5    1 
ATOM   212   C  C6    . DA  A  1 11  ? 7.015  110.503 22.577  1.00 172.23 ? -63 DA  I C6    1 
ATOM   213   N  N6    . DA  A  1 11  ? 7.879  110.277 21.583  1.00 167.43 ? -63 DA  I N6    1 
ATOM   214   N  N1    . DA  A  1 11  ? 5.752  110.870 22.279  1.00 173.93 ? -63 DA  I N1    1 
ATOM   215   C  C2    . DA  A  1 11  ? 4.891  111.094 23.281  1.00 180.89 ? -63 DA  I C2    1 
ATOM   216   N  N3    . DA  A  1 11  ? 5.095  111.006 24.599  1.00 186.24 ? -63 DA  I N3    1 
ATOM   217   C  C4    . DA  A  1 11  ? 6.362  110.640 24.861  1.00 184.18 ? -63 DA  I C4    1 
ATOM   218   P  P     . DC  A  1 12  ? 4.518  108.903 30.708  1.00 201.66 ? -62 DC  I P     1 
ATOM   219   O  OP1   . DC  A  1 12  ? 3.644  109.264 31.848  1.00 210.59 ? -62 DC  I OP1   1 
ATOM   220   O  OP2   . DC  A  1 12  ? 5.486  107.791 30.848  1.00 200.55 ? -62 DC  I OP2   1 
ATOM   221   O  "O5'" . DC  A  1 12  ? 3.607  108.612 29.430  1.00 200.53 ? -62 DC  I "O5'" 1 
ATOM   222   C  "C5'" . DC  A  1 12  ? 2.928  109.686 28.792  1.00 201.38 ? -62 DC  I "C5'" 1 
ATOM   223   C  "C4'" . DC  A  1 12  ? 2.066  109.173 27.657  1.00 198.50 ? -62 DC  I "C4'" 1 
ATOM   224   O  "O4'" . DC  A  1 12  ? 2.807  109.238 26.411  1.00 193.32 ? -62 DC  I "O4'" 1 
ATOM   225   C  "C3'" . DC  A  1 12  ? 1.601  107.726 27.813  1.00 196.11 ? -62 DC  I "C3'" 1 
ATOM   226   O  "O3'" . DC  A  1 12  ? 0.208  107.638 27.552  1.00 192.87 ? -62 DC  I "O3'" 1 
ATOM   227   C  "C2'" . DC  A  1 12  ? 2.431  106.962 26.776  1.00 192.34 ? -62 DC  I "C2'" 1 
ATOM   228   C  "C1'" . DC  A  1 12  ? 2.667  108.023 25.713  1.00 190.45 ? -62 DC  I "C1'" 1 
ATOM   229   N  N1    . DC  A  1 12  ? 3.907  107.799 24.915  1.00 185.14 ? -62 DC  I N1    1 
ATOM   230   C  C2    . DC  A  1 12  ? 3.852  107.847 23.516  1.00 178.87 ? -62 DC  I C2    1 
ATOM   231   O  O2    . DC  A  1 12  ? 2.769  108.074 22.964  1.00 180.27 ? -62 DC  I O2    1 
ATOM   232   N  N3    . DC  A  1 12  ? 4.994  107.643 22.809  1.00 172.07 ? -62 DC  I N3    1 
ATOM   233   C  C4    . DC  A  1 12  ? 6.141  107.402 23.449  1.00 170.22 ? -62 DC  I C4    1 
ATOM   234   N  N4    . DC  A  1 12  ? 7.242  107.206 22.716  1.00 163.08 ? -62 DC  I N4    1 
ATOM   235   C  C5    . DC  A  1 12  ? 6.212  107.348 24.871  1.00 176.94 ? -62 DC  I C5    1 
ATOM   236   C  C6    . DC  A  1 12  ? 5.084  107.552 25.557  1.00 185.57 ? -62 DC  I C6    1 
ATOM   237   P  P     . DC  A  1 13  ? -0.531 106.212 27.547  1.00 220.76 ? -61 DC  I P     1 
ATOM   238   O  OP1   . DC  A  1 13  ? -1.952 106.445 27.885  1.00 224.98 ? -61 DC  I OP1   1 
ATOM   239   O  OP2   . DC  A  1 13  ? 0.269  105.270 28.361  1.00 219.71 ? -61 DC  I OP2   1 
ATOM   240   O  "O5'" . DC  A  1 13  ? -0.441 105.756 26.020  1.00 209.57 ? -61 DC  I "O5'" 1 
ATOM   241   C  "C5'" . DC  A  1 13  ? -0.739 106.689 24.988  1.00 204.15 ? -61 DC  I "C5'" 1 
ATOM   242   C  "C4'" . DC  A  1 13  ? -0.920 105.983 23.659  1.00 196.60 ? -61 DC  I "C4'" 1 
ATOM   243   O  "O4'" . DC  A  1 13  ? 0.334  105.984 22.926  1.00 188.41 ? -61 DC  I "O4'" 1 
ATOM   244   C  "C3'" . DC  A  1 13  ? -1.342 104.522 23.762  1.00 196.11 ? -61 DC  I "C3'" 1 
ATOM   245   O  "O3'" . DC  A  1 13  ? -2.209 104.208 22.689  1.00 196.20 ? -61 DC  I "O3'" 1 
ATOM   246   C  "C2'" . DC  A  1 13  ? -0.012 103.786 23.638  1.00 189.35 ? -61 DC  I "C2'" 1 
ATOM   247   C  "C1'" . DC  A  1 13  ? 0.706  104.656 22.622  1.00 181.74 ? -61 DC  I "C1'" 1 
ATOM   248   N  N1    . DC  A  1 13  ? 2.200  104.566 22.668  1.00 170.02 ? -61 DC  I N1    1 
ATOM   249   C  C2    . DC  A  1 13  ? 2.915  104.520 21.470  1.00 157.99 ? -61 DC  I C2    1 
ATOM   250   O  O2    . DC  A  1 13  ? 2.287  104.539 20.407  1.00 152.93 ? -61 DC  I O2    1 
ATOM   251   N  N3    . DC  A  1 13  ? 4.269  104.452 21.511  1.00 152.50 ? -61 DC  I N3    1 
ATOM   252   C  C4    . DC  A  1 13  ? 4.900  104.434 22.687  1.00 154.15 ? -61 DC  I C4    1 
ATOM   253   N  N4    . DC  A  1 13  ? 6.237  104.366 22.679  1.00 148.37 ? -61 DC  I N4    1 
ATOM   254   C  C5    . DC  A  1 13  ? 4.188  104.486 23.923  1.00 162.52 ? -61 DC  I C5    1 
ATOM   255   C  C6    . DC  A  1 13  ? 2.851  104.553 23.868  1.00 169.70 ? -61 DC  I C6    1 
ATOM   256   P  P     . DT  A  1 14  ? -3.252 102.993 22.810  1.00 186.39 ? -60 DT  I P     1 
ATOM   257   O  OP1   . DT  A  1 14  ? -4.613 103.573 22.834  1.00 191.02 ? -60 DT  I OP1   1 
ATOM   258   O  OP2   . DT  A  1 14  ? -2.805 102.109 23.910  1.00 188.17 ? -60 DT  I OP2   1 
ATOM   259   O  "O5'" . DT  A  1 14  ? -3.054 102.205 21.436  1.00 183.33 ? -60 DT  I "O5'" 1 
ATOM   260   C  "C5'" . DT  A  1 14  ? -2.833 102.933 20.238  1.00 181.24 ? -60 DT  I "C5'" 1 
ATOM   261   C  "C4'" . DT  A  1 14  ? -2.185 102.059 19.180  1.00 177.81 ? -60 DT  I "C4'" 1 
ATOM   262   O  "O4'" . DT  A  1 14  ? -0.736 102.121 19.299  1.00 173.62 ? -60 DT  I "O4'" 1 
ATOM   263   C  "C3'" . DT  A  1 14  ? -2.542 100.576 19.248  1.00 180.31 ? -60 DT  I "C3'" 1 
ATOM   264   O  "O3'" . DT  A  1 14  ? -2.606 100.070 17.934  1.00 178.29 ? -60 DT  I "O3'" 1 
ATOM   265   C  "C2'" . DT  A  1 14  ? -1.351 99.992  20.003  1.00 177.97 ? -60 DT  I "C2'" 1 
ATOM   266   C  "C1'" . DT  A  1 14  ? -0.225 100.808 19.397  1.00 170.80 ? -60 DT  I "C1'" 1 
ATOM   267   N  N1    . DT  A  1 14  ? 1.025  100.847 20.211  1.00 165.77 ? -60 DT  I N1    1 
ATOM   268   C  C2    . DT  A  1 14  ? 2.238  100.858 19.565  1.00 158.16 ? -60 DT  I C2    1 
ATOM   269   O  O2    . DT  A  1 14  ? 2.350  100.822 18.353  1.00 153.34 ? -60 DT  I O2    1 
ATOM   270   N  N3    . DT  A  1 14  ? 3.326  100.908 20.393  1.00 156.47 ? -60 DT  I N3    1 
ATOM   271   C  C4    . DT  A  1 14  ? 3.326  100.952 21.772  1.00 160.59 ? -60 DT  I C4    1 
ATOM   272   O  O4    . DT  A  1 14  ? 4.362  100.996 22.427  1.00 160.14 ? -60 DT  I O4    1 
ATOM   273   C  C5    . DT  A  1 14  ? 2.023  100.942 22.390  1.00 166.29 ? -60 DT  I C5    1 
ATOM   274   C  C7    . DT  A  1 14  ? 1.905  100.981 23.885  1.00 171.28 ? -60 DT  I C7    1 
ATOM   275   C  C6    . DT  A  1 14  ? 0.944  100.893 21.590  1.00 168.40 ? -60 DT  I C6    1 
ATOM   276   P  P     . DG  A  1 15  ? -3.461 98.757  17.588  1.00 180.47 ? -59 DG  I P     1 
ATOM   277   O  OP1   . DG  A  1 15  ? -4.884 99.152  17.487  1.00 183.14 ? -59 DG  I OP1   1 
ATOM   278   O  OP2   . DG  A  1 15  ? -3.059 97.684  18.524  1.00 180.87 ? -59 DG  I OP2   1 
ATOM   279   O  "O5'" . DG  A  1 15  ? -2.930 98.373  16.132  1.00 176.45 ? -59 DG  I "O5'" 1 
ATOM   280   C  "C5'" . DG  A  1 15  ? -2.458 99.406  15.266  1.00 172.30 ? -59 DG  I "C5'" 1 
ATOM   281   C  "C4'" . DG  A  1 15  ? -1.234 98.955  14.486  1.00 163.46 ? -59 DG  I "C4'" 1 
ATOM   282   O  "O4'" . DG  A  1 15  ? -0.042 99.083  15.309  1.00 161.70 ? -59 DG  I "O4'" 1 
ATOM   283   C  "C3'" . DG  A  1 15  ? -1.273 97.513  14.013  1.00 160.30 ? -59 DG  I "C3'" 1 
ATOM   284   O  "O3'" . DG  A  1 15  ? -0.696 97.410  12.723  1.00 155.39 ? -59 DG  I "O3'" 1 
ATOM   285   C  "C2'" . DG  A  1 15  ? -0.452 96.775  15.068  1.00 160.22 ? -59 DG  I "C2'" 1 
ATOM   286   C  "C1'" . DG  A  1 15  ? 0.564  97.820  15.512  1.00 158.47 ? -59 DG  I "C1'" 1 
ATOM   287   N  N9    . DG  A  1 15  ? 0.918  97.720  16.930  1.00 158.08 ? -59 DG  I N9    1 
ATOM   288   C  C8    . DG  A  1 15  ? 0.045  97.626  17.985  1.00 162.66 ? -59 DG  I C8    1 
ATOM   289   N  N7    . DG  A  1 15  ? 0.631  97.568  19.147  1.00 164.27 ? -59 DG  I N7    1 
ATOM   290   C  C5    . DG  A  1 15  ? 1.985  97.634  18.852  1.00 159.53 ? -59 DG  I C5    1 
ATOM   291   C  C6    . DG  A  1 15  ? 3.104  97.615  19.719  1.00 158.07 ? -59 DG  I C6    1 
ATOM   292   O  O6    . DG  A  1 15  ? 3.113  97.533  20.955  1.00 161.61 ? -59 DG  I O6    1 
ATOM   293   N  N1    . DG  A  1 15  ? 4.302  97.701  19.017  1.00 150.97 ? -59 DG  I N1    1 
ATOM   294   C  C2    . DG  A  1 15  ? 4.407  97.794  17.647  1.00 144.43 ? -59 DG  I C2    1 
ATOM   295   N  N2    . DG  A  1 15  ? 5.650  97.865  17.148  1.00 137.18 ? -59 DG  I N2    1 
ATOM   296   N  N3    . DG  A  1 15  ? 3.363  97.814  16.820  1.00 146.77 ? -59 DG  I N3    1 
ATOM   297   C  C4    . DG  A  1 15  ? 2.186  97.731  17.491  1.00 154.37 ? -59 DG  I C4    1 
ATOM   298   P  P     . DG  A  1 16  ? -1.059 96.166  11.774  1.00 154.21 ? -58 DG  I P     1 
ATOM   299   O  OP1   . DG  A  1 16  ? -1.457 96.696  10.450  1.00 152.33 ? -58 DG  I OP1   1 
ATOM   300   O  OP2   . DG  A  1 16  ? -1.986 95.285  12.520  1.00 156.31 ? -58 DG  I OP2   1 
ATOM   301   O  "O5'" . DG  A  1 16  ? 0.332  95.398  11.626  1.00 147.04 ? -58 DG  I "O5'" 1 
ATOM   302   C  "C5'" . DG  A  1 16  ? 1.540  96.030  12.047  1.00 141.56 ? -58 DG  I "C5'" 1 
ATOM   303   C  "C4'" . DG  A  1 16  ? 2.558  94.998  12.496  1.00 133.12 ? -58 DG  I "C4'" 1 
ATOM   304   O  "O4'" . DG  A  1 16  ? 2.610  94.959  13.951  1.00 136.10 ? -58 DG  I "O4'" 1 
ATOM   305   C  "C3'" . DG  A  1 16  ? 2.248  93.573  12.063  1.00 129.04 ? -58 DG  I "C3'" 1 
ATOM   306   O  "O3'" . DG  A  1 16  ? 3.461  92.850  11.884  1.00 122.77 ? -58 DG  I "O3'" 1 
ATOM   307   C  "C2'" . DG  A  1 16  ? 1.457  93.052  13.256  1.00 136.10 ? -58 DG  I "C2'" 1 
ATOM   308   C  "C1'" . DG  A  1 16  ? 2.243  93.668  14.401  1.00 139.51 ? -58 DG  I "C1'" 1 
ATOM   309   N  N9    . DG  A  1 16  ? 1.478  93.810  15.637  1.00 150.15 ? -58 DG  I N9    1 
ATOM   310   C  C8    . DG  A  1 16  ? 0.112  93.785  15.772  1.00 157.33 ? -58 DG  I C8    1 
ATOM   311   N  N7    . DG  A  1 16  ? -0.294 93.957  16.999  1.00 164.41 ? -58 DG  I N7    1 
ATOM   312   C  C5    . DG  A  1 16  ? 0.879  94.087  17.730  1.00 160.96 ? -58 DG  I C5    1 
ATOM   313   C  C6    . DG  A  1 16  ? 1.070  94.285  19.118  1.00 164.61 ? -58 DG  I C6    1 
ATOM   314   O  O6    . DG  A  1 16  ? 0.211  94.387  20.005  1.00 170.67 ? -58 DG  I O6    1 
ATOM   315   N  N1    . DG  A  1 16  ? 2.422  94.363  19.446  1.00 160.71 ? -58 DG  I N1    1 
ATOM   316   C  C2    . DG  A  1 16  ? 3.456  94.263  18.546  1.00 153.65 ? -58 DG  I C2    1 
ATOM   317   N  N2    . DG  A  1 16  ? 4.694  94.364  19.051  1.00 151.24 ? -58 DG  I N2    1 
ATOM   318   N  N3    . DG  A  1 16  ? 3.291  94.079  17.242  1.00 150.06 ? -58 DG  I N3    1 
ATOM   319   C  C4    . DG  A  1 16  ? 1.980  94.000  16.907  1.00 153.86 ? -58 DG  I C4    1 
ATOM   320   P  P     . DT  A  1 17  ? 4.130  92.739  10.427  1.00 126.28 ? -57 DT  I P     1 
ATOM   321   O  OP1   . DT  A  1 17  ? 4.402  94.114  9.952   1.00 123.98 ? -57 DT  I OP1   1 
ATOM   322   O  OP2   . DT  A  1 17  ? 3.295  91.830  9.611   1.00 128.07 ? -57 DT  I OP2   1 
ATOM   323   O  "O5'" . DT  A  1 17  ? 5.526  92.007  10.696  1.00 123.68 ? -57 DT  I "O5'" 1 
ATOM   324   C  "C5'" . DT  A  1 17  ? 6.736  92.749  10.629  1.00 121.16 ? -57 DT  I "C5'" 1 
ATOM   325   C  "C4'" . DT  A  1 17  ? 7.451  92.737  11.964  1.00 121.92 ? -57 DT  I "C4'" 1 
ATOM   326   O  "O4'" . DT  A  1 17  ? 6.510  93.035  13.016  1.00 127.01 ? -57 DT  I "O4'" 1 
ATOM   327   C  "C3'" . DT  A  1 17  ? 8.034  91.398  12.371  1.00 118.06 ? -57 DT  I "C3'" 1 
ATOM   328   O  "O3'" . DT  A  1 17  ? 9.325  91.175  11.747  1.00 113.22 ? -57 DT  I "O3'" 1 
ATOM   329   C  "C2'" . DT  A  1 17  ? 8.134  91.537  13.885  1.00 120.31 ? -57 DT  I "C2'" 1 
ATOM   330   C  "C1'" . DT  A  1 17  ? 6.988  92.484  14.229  1.00 126.24 ? -57 DT  I "C1'" 1 
ATOM   331   N  N1    . DT  A  1 17  ? 5.861  91.825  14.952  1.00 132.94 ? -57 DT  I N1    1 
ATOM   332   C  C2    . DT  A  1 17  ? 5.878  91.806  16.325  1.00 135.32 ? -57 DT  I C2    1 
ATOM   333   O  O2    . DT  A  1 17  ? 6.772  92.299  16.989  1.00 133.77 ? -57 DT  I O2    1 
ATOM   334   N  N3    . DT  A  1 17  ? 4.805  91.188  16.902  1.00 137.78 ? -57 DT  I N3    1 
ATOM   335   C  C4    . DT  A  1 17  ? 3.736  90.597  16.261  1.00 138.92 ? -57 DT  I C4    1 
ATOM   336   O  O4    . DT  A  1 17  ? 2.816  90.067  16.877  1.00 140.40 ? -57 DT  I O4    1 
ATOM   337   C  C5    . DT  A  1 17  ? 3.776  90.646  14.820  1.00 138.79 ? -57 DT  I C5    1 
ATOM   338   C  C7    . DT  A  1 17  ? 2.671  90.027  14.018  1.00 140.77 ? -57 DT  I C7    1 
ATOM   339   C  C6    . DT  A  1 17  ? 4.827  91.252  14.238  1.00 134.75 ? -57 DT  I C6    1 
ATOM   340   P  P     . DC  A  1 18  ? 10.673 91.898  12.264  1.00 116.12 ? -56 DC  I P     1 
ATOM   341   O  OP1   . DC  A  1 18  ? 10.417 93.335  12.507  1.00 101.15 ? -56 DC  I OP1   1 
ATOM   342   O  OP2   . DC  A  1 18  ? 11.736 91.506  11.312  1.00 111.47 ? -56 DC  I OP2   1 
ATOM   343   O  "O5'" . DC  A  1 18  ? 11.022 91.185  13.655  1.00 109.89 ? -56 DC  I "O5'" 1 
ATOM   344   C  "C5'" . DC  A  1 18  ? 11.393 91.977  14.784  1.00 112.36 ? -56 DC  I "C5'" 1 
ATOM   345   C  "C4'" . DC  A  1 18  ? 11.456 91.128  16.039  1.00 108.31 ? -56 DC  I "C4'" 1 
ATOM   346   O  "O4'" . DC  A  1 18  ? 10.117 90.797  16.488  1.00 113.16 ? -56 DC  I "O4'" 1 
ATOM   347   C  "C3'" . DC  A  1 18  ? 12.194 89.801  15.876  1.00 117.22 ? -56 DC  I "C3'" 1 
ATOM   348   O  "O3'" . DC  A  1 18  ? 13.177 89.693  16.874  1.00 115.93 ? -56 DC  I "O3'" 1 
ATOM   349   C  "C2'" . DC  A  1 18  ? 11.097 88.743  16.038  1.00 108.82 ? -56 DC  I "C2'" 1 
ATOM   350   C  "C1'" . DC  A  1 18  ? 10.095 89.457  16.921  1.00 114.35 ? -56 DC  I "C1'" 1 
ATOM   351   N  N1    . DC  A  1 18  ? 8.707  88.942  16.769  1.00 117.51 ? -56 DC  I N1    1 
ATOM   352   C  C2    . DC  A  1 18  ? 7.935  88.656  17.902  1.00 123.24 ? -56 DC  I C2    1 
ATOM   353   O  O2    . DC  A  1 18  ? 8.422  88.833  19.025  1.00 125.64 ? -56 DC  I O2    1 
ATOM   354   N  N3    . DC  A  1 18  ? 6.669  88.194  17.729  1.00 126.12 ? -56 DC  I N3    1 
ATOM   355   C  C4    . DC  A  1 18  ? 6.186  88.018  16.497  1.00 123.47 ? -56 DC  I C4    1 
ATOM   356   N  N4    . DC  A  1 18  ? 4.937  87.560  16.367  1.00 129.93 ? -56 DC  I N4    1 
ATOM   357   C  C5    . DC  A  1 18  ? 6.962  88.302  15.339  1.00 121.97 ? -56 DC  I C5    1 
ATOM   358   C  C6    . DC  A  1 18  ? 8.204  88.748  15.522  1.00 119.03 ? -56 DC  I C6    1 
ATOM   359   P  P     . DC  A  1 19  ? 14.181 88.442  16.905  1.00 109.04 ? -55 DC  I P     1 
ATOM   360   O  OP1   . DC  A  1 19  ? 15.532 89.025  16.927  1.00 103.08 ? -55 DC  I OP1   1 
ATOM   361   O  OP2   . DC  A  1 19  ? 13.842 87.475  15.837  1.00 116.97 ? -55 DC  I OP2   1 
ATOM   362   O  "O5'" . DC  A  1 19  ? 13.864 87.770  18.314  1.00 112.30 ? -55 DC  I "O5'" 1 
ATOM   363   C  "C5'" . DC  A  1 19  ? 13.315 88.568  19.351  1.00 115.17 ? -55 DC  I "C5'" 1 
ATOM   364   C  "C4'" . DC  A  1 19  ? 12.508 87.724  20.315  1.00 118.60 ? -55 DC  I "C4'" 1 
ATOM   365   O  "O4'" . DC  A  1 19  ? 11.177 87.523  19.793  1.00 121.78 ? -55 DC  I "O4'" 1 
ATOM   366   C  "C3'" . DC  A  1 19  ? 13.085 86.336  20.586  1.00 114.91 ? -55 DC  I "C3'" 1 
ATOM   367   O  "O3'" . DC  A  1 19  ? 13.403 86.223  21.964  1.00 130.23 ? -55 DC  I "O3'" 1 
ATOM   368   C  "C2'" . DC  A  1 19  ? 11.970 85.361  20.163  1.00 116.34 ? -55 DC  I "C2'" 1 
ATOM   369   C  "C1'" . DC  A  1 19  ? 10.729 86.242  20.146  1.00 123.47 ? -55 DC  I "C1'" 1 
ATOM   370   N  N1    . DC  A  1 19  ? 9.706  85.826  19.139  1.00 127.17 ? -55 DC  I N1    1 
ATOM   371   C  C2    . DC  A  1 19  ? 8.445  85.396  19.567  1.00 131.47 ? -55 DC  I C2    1 
ATOM   372   O  O2    . DC  A  1 19  ? 8.208  85.355  20.779  1.00 136.85 ? -55 DC  I O2    1 
ATOM   373   N  N3    . DC  A  1 19  ? 7.524  85.033  18.636  1.00 130.88 ? -55 DC  I N3    1 
ATOM   374   C  C4    . DC  A  1 19  ? 7.828  85.095  17.337  1.00 127.33 ? -55 DC  I C4    1 
ATOM   375   N  N4    . DC  A  1 19  ? 6.892  84.728  16.454  1.00 123.56 ? -55 DC  I N4    1 
ATOM   376   C  C5    . DC  A  1 19  ? 9.105  85.536  16.884  1.00 126.34 ? -55 DC  I C5    1 
ATOM   377   C  C6    . DC  A  1 19  ? 10.002 85.891  17.809  1.00 126.38 ? -55 DC  I C6    1 
ATOM   378   P  P     . DT  A  1 20  ? 14.162 84.926  22.532  1.00 122.47 ? -54 DT  I P     1 
ATOM   379   O  OP1   . DT  A  1 20  ? 15.222 85.401  23.451  1.00 119.74 ? -54 DT  I OP1   1 
ATOM   380   O  OP2   . DT  A  1 20  ? 14.520 84.046  21.397  1.00 114.25 ? -54 DT  I OP2   1 
ATOM   381   O  "O5'" . DT  A  1 20  ? 13.024 84.194  23.380  1.00 137.60 ? -54 DT  I "O5'" 1 
ATOM   382   C  "C5'" . DT  A  1 20  ? 11.915 84.949  23.852  1.00 147.60 ? -54 DT  I "C5'" 1 
ATOM   383   C  "C4'" . DT  A  1 20  ? 10.735 84.049  24.157  1.00 159.22 ? -54 DT  I "C4'" 1 
ATOM   384   O  "O4'" . DT  A  1 20  ? 9.965  83.816  22.955  1.00 157.63 ? -54 DT  I "O4'" 1 
ATOM   385   C  "C3'" . DT  A  1 20  ? 11.101 82.667  24.706  1.00 170.03 ? -54 DT  I "C3'" 1 
ATOM   386   O  "O3'" . DT  A  1 20  ? 10.510 82.494  25.984  1.00 194.87 ? -54 DT  I "O3'" 1 
ATOM   387   C  "C2'" . DT  A  1 20  ? 10.529 81.684  23.672  1.00 163.12 ? -54 DT  I "C2'" 1 
ATOM   388   C  "C1'" . DT  A  1 20  ? 9.443  82.516  23.010  1.00 162.14 ? -54 DT  I "C1'" 1 
ATOM   389   N  N1    . DT  A  1 20  ? 9.094  82.080  21.620  1.00 162.08 ? -54 DT  I N1    1 
ATOM   390   C  C2    . DT  A  1 20  ? 7.827  81.603  21.363  1.00 166.38 ? -54 DT  I C2    1 
ATOM   391   O  O2    . DT  A  1 20  ? 6.965  81.506  22.218  1.00 169.44 ? -54 DT  I O2    1 
ATOM   392   N  N3    . DT  A  1 20  ? 7.604  81.238  20.060  1.00 167.18 ? -54 DT  I N3    1 
ATOM   393   C  C4    . DT  A  1 20  ? 8.500  81.304  19.009  1.00 163.35 ? -54 DT  I C4    1 
ATOM   394   O  O4    . DT  A  1 20  ? 8.204  80.951  17.870  1.00 163.00 ? -54 DT  I O4    1 
ATOM   395   C  C5    . DT  A  1 20  ? 9.810  81.815  19.345  1.00 158.04 ? -54 DT  I C5    1 
ATOM   396   C  C7    . DT  A  1 20  ? 10.867 81.933  18.287  1.00 150.85 ? -54 DT  I C7    1 
ATOM   397   C  C6    . DT  A  1 20  ? 10.040 82.176  20.619  1.00 159.04 ? -54 DT  I C6    1 
ATOM   398   P  P     . DA  A  1 21  ? 10.832 81.190  26.863  1.00 169.63 ? -53 DA  I P     1 
ATOM   399   O  OP1   . DA  A  1 21  ? 10.799 81.600  28.286  1.00 170.38 ? -53 DA  I OP1   1 
ATOM   400   O  OP2   . DA  A  1 21  ? 12.048 80.553  26.310  1.00 170.14 ? -53 DA  I OP2   1 
ATOM   401   O  "O5'" . DA  A  1 21  ? 9.587  80.229  26.573  1.00 178.12 ? -53 DA  I "O5'" 1 
ATOM   402   C  "C5'" . DA  A  1 21  ? 8.272  80.769  26.574  1.00 183.51 ? -53 DA  I "C5'" 1 
ATOM   403   C  "C4'" . DA  A  1 21  ? 7.241  79.710  26.229  1.00 186.61 ? -53 DA  I "C4'" 1 
ATOM   404   O  "O4'" . DA  A  1 21  ? 7.056  79.643  24.790  1.00 187.23 ? -53 DA  I "O4'" 1 
ATOM   405   C  "C3'" . DA  A  1 21  ? 7.585  78.287  26.676  1.00 185.46 ? -53 DA  I "C3'" 1 
ATOM   406   O  "O3'" . DA  A  1 21  ? 6.420  77.671  27.198  1.00 184.11 ? -53 DA  I "O3'" 1 
ATOM   407   C  "C2'" . DA  A  1 21  ? 8.027  77.620  25.371  1.00 185.37 ? -53 DA  I "C2'" 1 
ATOM   408   C  "C1'" . DA  A  1 21  ? 7.088  78.294  24.390  1.00 187.43 ? -53 DA  I "C1'" 1 
ATOM   409   N  N9    . DA  A  1 21  ? 7.513  78.234  22.993  1.00 185.67 ? -53 DA  I N9    1 
ATOM   410   C  C8    . DA  A  1 21  ? 8.724  78.603  22.477  1.00 182.50 ? -53 DA  I C8    1 
ATOM   411   N  N7    . DA  A  1 21  ? 8.810  78.455  21.174  1.00 181.73 ? -53 DA  I N7    1 
ATOM   412   C  C5    . DA  A  1 21  ? 7.566  77.963  20.811  1.00 185.25 ? -53 DA  I C5    1 
ATOM   413   C  C6    . DA  A  1 21  ? 7.012  77.595  19.566  1.00 188.29 ? -53 DA  I C6    1 
ATOM   414   N  N6    . DA  A  1 21  ? 7.679  77.673  18.408  1.00 187.12 ? -53 DA  I N6    1 
ATOM   415   N  N1    . DA  A  1 21  ? 5.741  77.140  19.557  1.00 192.00 ? -53 DA  I N1    1 
ATOM   416   C  C2    . DA  A  1 21  ? 5.077  77.061  20.716  1.00 193.30 ? -53 DA  I C2    1 
ATOM   417   N  N3    . DA  A  1 21  ? 5.490  77.377  21.942  1.00 191.46 ? -53 DA  I N3    1 
ATOM   418   C  C4    . DA  A  1 21  ? 6.754  77.826  21.920  1.00 187.41 ? -53 DA  I C4    1 
ATOM   419   P  P     . DC  A  1 22  ? 6.425  77.025  28.668  1.00 204.36 ? -52 DC  I P     1 
ATOM   420   O  OP1   . DC  A  1 22  ? 5.594  77.882  29.543  1.00 206.32 ? -52 DC  I OP1   1 
ATOM   421   O  OP2   . DC  A  1 22  ? 7.831  76.743  29.032  1.00 197.85 ? -52 DC  I OP2   1 
ATOM   422   O  "O5'" . DC  A  1 22  ? 5.689  75.622  28.456  1.00 199.87 ? -52 DC  I "O5'" 1 
ATOM   423   C  "C5'" . DC  A  1 22  ? 6.278  74.645  27.610  1.00 193.46 ? -52 DC  I "C5'" 1 
ATOM   424   C  "C4'" . DC  A  1 22  ? 5.224  73.916  26.797  1.00 192.70 ? -52 DC  I "C4'" 1 
ATOM   425   O  "O4'" . DC  A  1 22  ? 5.221  74.430  25.437  1.00 190.24 ? -52 DC  I "O4'" 1 
ATOM   426   C  "C3'" . DC  A  1 22  ? 5.443  72.409  26.697  1.00 193.26 ? -52 DC  I "C3'" 1 
ATOM   427   O  "O3'" . DC  A  1 22  ? 4.248  71.704  26.986  1.00 202.18 ? -52 DC  I "O3'" 1 
ATOM   428   C  "C2'" . DC  A  1 22  ? 5.899  72.182  25.258  1.00 189.73 ? -52 DC  I "C2'" 1 
ATOM   429   C  "C1'" . DC  A  1 22  ? 5.326  73.374  24.505  1.00 187.88 ? -52 DC  I "C1'" 1 
ATOM   430   N  N1    . DC  A  1 22  ? 6.212  73.827  23.381  1.00 179.30 ? -52 DC  I N1    1 
ATOM   431   C  C2    . DC  A  1 22  ? 5.878  73.535  22.042  1.00 180.65 ? -52 DC  I C2    1 
ATOM   432   O  O2    . DC  A  1 22  ? 4.839  72.907  21.795  1.00 186.17 ? -52 DC  I O2    1 
ATOM   433   N  N3    . DC  A  1 22  ? 6.713  73.958  21.053  1.00 174.62 ? -52 DC  I N3    1 
ATOM   434   C  C4    . DC  A  1 22  ? 7.824  74.633  21.361  1.00 167.02 ? -52 DC  I C4    1 
ATOM   435   N  N4    . DC  A  1 22  ? 8.620  75.030  20.363  1.00 161.33 ? -52 DC  I N4    1 
ATOM   436   C  C5    . DC  A  1 22  ? 8.175  74.930  22.711  1.00 167.22 ? -52 DC  I C5    1 
ATOM   437   C  C6    . DC  A  1 22  ? 7.352  74.513  23.675  1.00 171.81 ? -52 DC  I C6    1 
ATOM   438   P  P     . DT  A  1 23  ? 4.296  70.109  27.174  1.00 174.10 ? -51 DT  I P     1 
ATOM   439   O  OP1   . DT  A  1 23  ? 3.121  69.699  27.973  1.00 181.07 ? -51 DT  I OP1   1 
ATOM   440   O  OP2   . DT  A  1 23  ? 5.659  69.761  27.634  1.00 170.25 ? -51 DT  I OP2   1 
ATOM   441   O  "O5'" . DT  A  1 23  ? 4.138  69.545  25.687  1.00 180.15 ? -51 DT  I "O5'" 1 
ATOM   442   C  "C5'" . DT  A  1 23  ? 3.024  69.934  24.896  1.00 187.78 ? -51 DT  I "C5'" 1 
ATOM   443   C  "C4'" . DT  A  1 23  ? 2.990  69.153  23.596  1.00 192.56 ? -51 DT  I "C4'" 1 
ATOM   444   O  "O4'" . DT  A  1 23  ? 3.832  69.805  22.606  1.00 191.09 ? -51 DT  I "O4'" 1 
ATOM   445   C  "C3'" . DT  A  1 23  ? 3.488  67.713  23.694  1.00 194.19 ? -51 DT  I "C3'" 1 
ATOM   446   O  "O3'" . DT  A  1 23  ? 2.673  66.877  22.879  1.00 194.80 ? -51 DT  I "O3'" 1 
ATOM   447   C  "C2'" . DT  A  1 23  ? 4.918  67.813  23.160  1.00 192.46 ? -51 DT  I "C2'" 1 
ATOM   448   C  "C1'" . DT  A  1 23  ? 4.758  68.874  22.085  1.00 192.97 ? -51 DT  I "C1'" 1 
ATOM   449   N  N1    . DT  A  1 23  ? 6.019  69.602  21.755  1.00 193.04 ? -51 DT  I N1    1 
ATOM   450   C  C2    . DT  A  1 23  ? 6.355  69.805  20.435  1.00 194.98 ? -51 DT  I C2    1 
ATOM   451   O  O2    . DT  A  1 23  ? 5.675  69.411  19.503  1.00 198.09 ? -51 DT  I O2    1 
ATOM   452   N  N3    . DT  A  1 23  ? 7.526  70.492  20.243  1.00 192.06 ? -51 DT  I N3    1 
ATOM   453   C  C4    . DT  A  1 23  ? 8.375  70.985  21.215  1.00 188.18 ? -51 DT  I C4    1 
ATOM   454   O  O4    . DT  A  1 23  ? 9.407  71.590  20.944  1.00 183.37 ? -51 DT  I O4    1 
ATOM   455   C  C5    . DT  A  1 23  ? 7.965  70.741  22.574  1.00 188.68 ? -51 DT  I C5    1 
ATOM   456   C  C7    . DT  A  1 23  ? 8.814  71.229  23.710  1.00 185.52 ? -51 DT  I C7    1 
ATOM   457   C  C6    . DT  A  1 23  ? 6.821  70.067  22.778  1.00 191.63 ? -51 DT  I C6    1 
ATOM   458   P  P     . DA  A  1 24  ? 2.792  65.276  22.954  1.00 205.85 ? -50 DA  I P     1 
ATOM   459   O  OP1   . DA  A  1 24  ? 1.469  64.750  23.358  1.00 211.19 ? -50 DA  I OP1   1 
ATOM   460   O  OP2   . DA  A  1 24  ? 3.991  64.916  23.743  1.00 200.98 ? -50 DA  I OP2   1 
ATOM   461   O  "O5'" . DA  A  1 24  ? 3.059  64.862  21.435  1.00 202.16 ? -50 DA  I "O5'" 1 
ATOM   462   C  "C5'" . DA  A  1 24  ? 3.744  65.761  20.574  1.00 192.84 ? -50 DA  I "C5'" 1 
ATOM   463   C  "C4'" . DA  A  1 24  ? 4.541  65.001  19.538  1.00 188.61 ? -50 DA  I "C4'" 1 
ATOM   464   O  "O4'" . DA  A  1 24  ? 5.628  65.828  19.051  1.00 182.54 ? -50 DA  I "O4'" 1 
ATOM   465   C  "C3'" . DA  A  1 24  ? 5.165  63.707  20.038  1.00 188.38 ? -50 DA  I "C3'" 1 
ATOM   466   O  "O3'" . DA  A  1 24  ? 4.982  62.697  19.057  1.00 190.77 ? -50 DA  I "O3'" 1 
ATOM   467   C  "C2'" . DA  A  1 24  ? 6.641  64.068  20.256  1.00 182.19 ? -50 DA  I "C2'" 1 
ATOM   468   C  "C1'" . DA  A  1 24  ? 6.873  65.193  19.254  1.00 179.10 ? -50 DA  I "C1'" 1 
ATOM   469   N  N9    . DA  A  1 24  ? 7.818  66.213  19.714  1.00 173.82 ? -50 DA  I N9    1 
ATOM   470   C  C8    . DA  A  1 24  ? 7.985  66.670  20.994  1.00 172.43 ? -50 DA  I C8    1 
ATOM   471   N  N7    . DA  A  1 24  ? 8.897  67.609  21.107  1.00 168.10 ? -50 DA  I N7    1 
ATOM   472   C  C5    . DA  A  1 24  ? 9.354  67.788  19.811  1.00 165.56 ? -50 DA  I C5    1 
ATOM   473   C  C6    . DA  A  1 24  ? 10.328 68.645  19.252  1.00 158.88 ? -50 DA  I C6    1 
ATOM   474   N  N6    . DA  A  1 24  ? 11.043 69.519  19.970  1.00 152.27 ? -50 DA  I N6    1 
ATOM   475   N  N1    . DA  A  1 24  ? 10.539 68.569  17.920  1.00 161.74 ? -50 DA  I N1    1 
ATOM   476   C  C2    . DA  A  1 24  ? 9.822  67.694  17.205  1.00 167.03 ? -50 DA  I C2    1 
ATOM   477   N  N3    . DA  A  1 24  ? 8.884  66.841  17.615  1.00 170.94 ? -50 DA  I N3    1 
ATOM   478   C  C4    . DA  A  1 24  ? 8.696  66.939  18.940  1.00 170.08 ? -50 DA  I C4    1 
ATOM   479   P  P     . DC  A  1 25  ? 5.608  61.230  19.238  1.00 204.40 ? -49 DC  I P     1 
ATOM   480   O  OP1   . DC  A  1 25  ? 4.624  60.271  18.688  1.00 210.35 ? -49 DC  I OP1   1 
ATOM   481   O  OP2   . DC  A  1 25  ? 6.085  61.060  20.629  1.00 204.96 ? -49 DC  I OP2   1 
ATOM   482   O  "O5'" . DC  A  1 25  ? 6.865  61.272  18.261  1.00 193.60 ? -49 DC  I "O5'" 1 
ATOM   483   C  "C5'" . DC  A  1 25  ? 6.789  62.058  17.079  1.00 185.04 ? -49 DC  I "C5'" 1 
ATOM   484   C  "C4'" . DC  A  1 25  ? 8.109  62.048  16.344  1.00 173.35 ? -49 DC  I "C4'" 1 
ATOM   485   O  "O4'" . DC  A  1 25  ? 8.910  63.180  16.758  1.00 165.33 ? -49 DC  I "O4'" 1 
ATOM   486   C  "C3'" . DC  A  1 25  ? 8.953  60.801  16.575  1.00 169.35 ? -49 DC  I "C3'" 1 
ATOM   487   O  "O3'" . DC  A  1 25  ? 9.350  60.271  15.327  1.00 168.00 ? -49 DC  I "O3'" 1 
ATOM   488   C  "C2'" . DC  A  1 25  ? 10.145 61.300  17.403  1.00 163.60 ? -49 DC  I "C2'" 1 
ATOM   489   C  "C1'" . DC  A  1 25  ? 10.231 62.769  17.011  1.00 159.26 ? -49 DC  I "C1'" 1 
ATOM   490   N  N1    . DC  A  1 25  ? 10.780 63.652  18.085  1.00 149.50 ? -49 DC  I N1    1 
ATOM   491   C  C2    . DC  A  1 25  ? 11.783 64.581  17.778  1.00 141.69 ? -49 DC  I C2    1 
ATOM   492   O  O2    . DC  A  1 25  ? 12.212 64.641  16.620  1.00 140.39 ? -49 DC  I O2    1 
ATOM   493   N  N3    . DC  A  1 25  ? 12.257 65.385  18.766  1.00 135.90 ? -49 DC  I N3    1 
ATOM   494   C  C4    . DC  A  1 25  ? 11.762 65.285  20.003  1.00 134.89 ? -49 DC  I C4    1 
ATOM   495   N  N4    . DC  A  1 25  ? 12.257 66.093  20.946  1.00 127.39 ? -49 DC  I N4    1 
ATOM   496   C  C5    . DC  A  1 25  ? 10.738 64.348  20.329  1.00 140.15 ? -49 DC  I C5    1 
ATOM   497   C  C6    . DC  A  1 25  ? 10.279 63.564  19.350  1.00 146.22 ? -49 DC  I C6    1 
ATOM   498   P  P     . DC  A  1 26  ? 10.043 58.828  15.234  1.00 168.31 ? -48 DC  I P     1 
ATOM   499   O  OP1   . DC  A  1 26  ? 9.461  58.117  14.074  1.00 171.24 ? -48 DC  I OP1   1 
ATOM   500   O  OP2   . DC  A  1 26  ? 10.005 58.203  16.576  1.00 167.46 ? -48 DC  I OP2   1 
ATOM   501   O  "O5'" . DC  A  1 26  ? 11.555 59.187  14.894  1.00 161.19 ? -48 DC  I "O5'" 1 
ATOM   502   C  "C5'" . DC  A  1 26  ? 11.848 60.360  14.142  1.00 156.33 ? -48 DC  I "C5'" 1 
ATOM   503   C  "C4'" . DC  A  1 26  ? 13.341 60.513  13.965  1.00 152.59 ? -48 DC  I "C4'" 1 
ATOM   504   O  "O4'" . DC  A  1 26  ? 13.843 61.511  14.894  1.00 149.53 ? -48 DC  I "O4'" 1 
ATOM   505   C  "C3'" . DC  A  1 26  ? 14.135 59.250  14.253  1.00 153.65 ? -48 DC  I "C3'" 1 
ATOM   506   O  "O3'" . DC  A  1 26  ? 15.306 59.228  13.449  1.00 154.69 ? -48 DC  I "O3'" 1 
ATOM   507   C  "C2'" . DC  A  1 26  ? 14.461 59.417  15.733  1.00 150.01 ? -48 DC  I "C2'" 1 
ATOM   508   C  "C1'" . DC  A  1 26  ? 14.753 60.909  15.793  1.00 144.58 ? -48 DC  I "C1'" 1 
ATOM   509   N  N1    . DC  A  1 26  ? 14.554 61.517  17.143  1.00 136.51 ? -48 DC  I N1    1 
ATOM   510   C  C2    . DC  A  1 26  ? 15.367 62.581  17.548  1.00 130.72 ? -48 DC  I C2    1 
ATOM   511   O  O2    . DC  A  1 26  ? 16.242 62.991  16.778  1.00 133.79 ? -48 DC  I O2    1 
ATOM   512   N  N3    . DC  A  1 26  ? 15.171 63.129  18.774  1.00 122.16 ? -48 DC  I N3    1 
ATOM   513   C  C4    . DC  A  1 26  ? 14.210 62.653  19.570  1.00 119.19 ? -48 DC  I C4    1 
ATOM   514   N  N4    . DC  A  1 26  ? 14.050 63.221  20.770  1.00 115.82 ? -48 DC  I N4    1 
ATOM   515   C  C5    . DC  A  1 26  ? 13.372 61.571  19.173  1.00 126.33 ? -48 DC  I C5    1 
ATOM   516   C  C6    . DC  A  1 26  ? 13.576 61.039  17.964  1.00 133.78 ? -48 DC  I C6    1 
ATOM   517   P  P     . DA  A  1 27  ? 15.300 58.482  12.025  1.00 163.97 ? -47 DA  I P     1 
ATOM   518   O  OP1   . DA  A  1 27  ? 14.156 59.005  11.245  1.00 169.42 ? -47 DA  I OP1   1 
ATOM   519   O  OP2   . DA  A  1 27  ? 15.424 57.029  12.274  1.00 164.27 ? -47 DA  I OP2   1 
ATOM   520   O  "O5'" . DA  A  1 27  ? 16.652 58.974  11.327  1.00 153.07 ? -47 DA  I "O5'" 1 
ATOM   521   C  "C5'" . DA  A  1 27  ? 16.768 60.316  10.870  1.00 143.09 ? -47 DA  I "C5'" 1 
ATOM   522   C  "C4'" . DA  A  1 27  ? 18.066 60.947  11.347  1.00 136.07 ? -47 DA  I "C4'" 1 
ATOM   523   O  "O4'" . DA  A  1 27  ? 17.969 61.256  12.763  1.00 133.27 ? -47 DA  I "O4'" 1 
ATOM   524   C  "C3'" . DA  A  1 27  ? 19.313 60.080  11.195  1.00 135.65 ? -47 DA  I "C3'" 1 
ATOM   525   O  "O3'" . DA  A  1 27  ? 20.425 60.912  10.923  1.00 137.73 ? -47 DA  I "O3'" 1 
ATOM   526   C  "C2'" . DA  A  1 27  ? 19.428 59.437  12.572  1.00 132.35 ? -47 DA  I "C2'" 1 
ATOM   527   C  "C1'" . DA  A  1 27  ? 18.995 60.587  13.467  1.00 129.63 ? -47 DA  I "C1'" 1 
ATOM   528   N  N9    . DA  A  1 27  ? 18.461 60.151  14.753  1.00 128.52 ? -47 DA  I N9    1 
ATOM   529   C  C8    . DA  A  1 27  ? 17.734 59.023  14.994  1.00 130.61 ? -47 DA  I C8    1 
ATOM   530   N  N7    . DA  A  1 27  ? 17.379 58.879  16.247  1.00 130.80 ? -47 DA  I N7    1 
ATOM   531   C  C5    . DA  A  1 27  ? 17.902 59.993  16.873  1.00 125.89 ? -47 DA  I C5    1 
ATOM   532   C  C6    . DA  A  1 27  ? 17.866 60.428  18.210  1.00 117.97 ? -47 DA  I C6    1 
ATOM   533   N  N6    . DA  A  1 27  ? 17.246 59.756  19.184  1.00 113.95 ? -47 DA  I N6    1 
ATOM   534   N  N1    . DA  A  1 27  ? 18.496 61.580  18.509  1.00 110.87 ? -47 DA  I N1    1 
ATOM   535   C  C2    . DA  A  1 27  ? 19.113 62.252  17.529  1.00 111.16 ? -47 DA  I C2    1 
ATOM   536   N  N3    . DA  A  1 27  ? 19.213 61.944  16.234  1.00 116.79 ? -47 DA  I N3    1 
ATOM   537   C  C4    . DA  A  1 27  ? 18.576 60.791  15.969  1.00 124.70 ? -47 DA  I C4    1 
ATOM   538   P  P     . DA  A  1 28  ? 21.818 60.301  10.404  1.00 135.10 ? -46 DA  I P     1 
ATOM   539   O  OP1   . DA  A  1 28  ? 21.768 60.264  8.926   1.00 139.05 ? -46 DA  I OP1   1 
ATOM   540   O  OP2   . DA  A  1 28  ? 22.128 59.066  11.157  1.00 138.47 ? -46 DA  I OP2   1 
ATOM   541   O  "O5'" . DA  A  1 28  ? 22.872 61.406  10.858  1.00 127.59 ? -46 DA  I "O5'" 1 
ATOM   542   C  "C5'" . DA  A  1 28  ? 22.405 62.692  11.235  1.00 125.43 ? -46 DA  I "C5'" 1 
ATOM   543   C  "C4'" . DA  A  1 28  ? 22.931 63.083  12.603  1.00 121.08 ? -46 DA  I "C4'" 1 
ATOM   544   O  "O4'" . DA  A  1 28  ? 22.142 62.462  13.646  1.00 123.33 ? -46 DA  I "O4'" 1 
ATOM   545   C  "C3'" . DA  A  1 28  ? 24.385 62.701  12.871  1.00 113.18 ? -46 DA  I "C3'" 1 
ATOM   546   O  "O3'" . DA  A  1 28  ? 25.104 63.882  13.194  1.00 105.61 ? -46 DA  I "O3'" 1 
ATOM   547   C  "C2'" . DA  A  1 28  ? 24.306 61.707  14.050  1.00 115.97 ? -46 DA  I "C2'" 1 
ATOM   548   C  "C1'" . DA  A  1 28  ? 22.987 62.085  14.707  1.00 120.15 ? -46 DA  I "C1'" 1 
ATOM   549   N  N9    . DA  A  1 28  ? 22.320 60.996  15.429  1.00 121.78 ? -46 DA  I N9    1 
ATOM   550   C  C8    . DA  A  1 28  ? 21.784 59.867  14.883  1.00 121.69 ? -46 DA  I C8    1 
ATOM   551   N  N7    . DA  A  1 28  ? 21.203 59.075  15.751  1.00 122.65 ? -46 DA  I N7    1 
ATOM   552   C  C5    . DA  A  1 28  ? 21.368 59.727  16.960  1.00 119.94 ? -46 DA  I C5    1 
ATOM   553   C  C6    . DA  A  1 28  ? 20.975 59.399  18.273  1.00 115.66 ? -46 DA  I C6    1 
ATOM   554   N  N6    . DA  A  1 28  ? 20.314 58.280  18.584  1.00 112.40 ? -46 DA  I N6    1 
ATOM   555   N  N1    . DA  A  1 28  ? 21.291 60.266  19.258  1.00 118.72 ? -46 DA  I N1    1 
ATOM   556   C  C2    . DA  A  1 28  ? 21.946 61.390  18.940  1.00 120.22 ? -46 DA  I C2    1 
ATOM   557   N  N3    . DA  A  1 28  ? 22.373 61.805  17.743  1.00 121.72 ? -46 DA  I N3    1 
ATOM   558   C  C4    . DA  A  1 28  ? 22.046 60.920  16.784  1.00 121.16 ? -46 DA  I C4    1 
ATOM   559   P  P     . DA  A  1 29  ? 26.673 63.847  13.525  1.00 115.90 ? -45 DA  I P     1 
ATOM   560   O  OP1   . DA  A  1 29  ? 27.279 65.036  12.881  1.00 111.73 ? -45 DA  I OP1   1 
ATOM   561   O  OP2   . DA  A  1 29  ? 27.205 62.500  13.223  1.00 116.84 ? -45 DA  I OP2   1 
ATOM   562   O  "O5'" . DA  A  1 29  ? 26.696 64.070  15.102  1.00 113.13 ? -45 DA  I "O5'" 1 
ATOM   563   C  "C5'" . DA  A  1 29  ? 25.538 64.591  15.741  1.00 112.03 ? -45 DA  I "C5'" 1 
ATOM   564   C  "C4'" . DA  A  1 29  ? 25.777 64.810  17.219  1.00 109.80 ? -45 DA  I "C4'" 1 
ATOM   565   O  "O4'" . DA  A  1 29  ? 25.062 63.815  17.992  1.00 109.68 ? -45 DA  I "O4'" 1 
ATOM   566   C  "C3'" . DA  A  1 29  ? 27.218 64.703  17.667  1.00 106.66 ? -45 DA  I "C3'" 1 
ATOM   567   O  "O3'" . DA  A  1 29  ? 27.379 65.510  18.805  1.00 112.47 ? -45 DA  I "O3'" 1 
ATOM   568   C  "C2'" . DA  A  1 29  ? 27.345 63.213  17.999  1.00 104.05 ? -45 DA  I "C2'" 1 
ATOM   569   C  "C1'" . DA  A  1 29  ? 25.975 62.914  18.598  1.00 103.31 ? -45 DA  I "C1'" 1 
ATOM   570   N  N9    . DA  A  1 29  ? 25.476 61.564  18.348  1.00 102.33 ? -45 DA  I N9    1 
ATOM   571   C  C8    . DA  A  1 29  ? 25.399 60.919  17.144  1.00 104.18 ? -45 DA  I C8    1 
ATOM   572   N  N7    . DA  A  1 29  ? 24.866 59.721  17.216  1.00 106.72 ? -45 DA  I N7    1 
ATOM   573   C  C5    . DA  A  1 29  ? 24.560 59.576  18.560  1.00 106.18 ? -45 DA  I C5    1 
ATOM   574   C  C6    . DA  A  1 29  ? 23.966 58.529  19.294  1.00 109.59 ? -45 DA  I C6    1 
ATOM   575   N  N6    . DA  A  1 29  ? 23.565 57.378  18.745  1.00 114.02 ? -45 DA  I N6    1 
ATOM   576   N  N1    . DA  A  1 29  ? 23.802 58.711  20.623  1.00 109.42 ? -45 DA  I N1    1 
ATOM   577   C  C2    . DA  A  1 29  ? 24.198 59.865  21.168  1.00 105.46 ? -45 DA  I C2    1 
ATOM   578   N  N3    . DA  A  1 29  ? 24.767 60.917  20.585  1.00 103.51 ? -45 DA  I N3    1 
ATOM   579   C  C4    . DA  A  1 29  ? 24.926 60.705  19.269  1.00 104.51 ? -45 DA  I C4    1 
ATOM   580   P  P     . DA  A  1 30  ? 28.828 65.782  19.430  1.00 116.31 ? -44 DA  I P     1 
ATOM   581   O  OP1   . DA  A  1 30  ? 28.886 67.231  19.715  1.00 119.61 ? -44 DA  I OP1   1 
ATOM   582   O  OP2   . DA  A  1 30  ? 29.857 65.146  18.577  1.00 117.85 ? -44 DA  I OP2   1 
ATOM   583   O  "O5'" . DA  A  1 30  ? 28.757 65.006  20.817  1.00 111.09 ? -44 DA  I "O5'" 1 
ATOM   584   C  "C5'" . DA  A  1 30  ? 27.528 64.966  21.521  1.00 105.16 ? -44 DA  I "C5'" 1 
ATOM   585   C  "C4'" . DA  A  1 30  ? 27.617 64.014  22.691  1.00 102.45 ? -44 DA  I "C4'" 1 
ATOM   586   O  "O4'" . DA  A  1 30  ? 27.051 62.730  22.326  1.00 104.31 ? -44 DA  I "O4'" 1 
ATOM   587   C  "C3'" . DA  A  1 30  ? 29.034 63.741  23.180  1.00 97.93  ? -44 DA  I "C3'" 1 
ATOM   588   O  "O3'" . DA  A  1 30  ? 29.053 63.803  24.592  1.00 100.57 ? -44 DA  I "O3'" 1 
ATOM   589   C  "C2'" . DA  A  1 30  ? 29.334 62.333  22.652  1.00 97.63  ? -44 DA  I "C2'" 1 
ATOM   590   C  "C1'" . DA  A  1 30  ? 27.955 61.696  22.642  1.00 101.29 ? -44 DA  I "C1'" 1 
ATOM   591   N  N9    . DA  A  1 30  ? 27.795 60.647  21.639  1.00 101.65 ? -44 DA  I N9    1 
ATOM   592   C  C8    . DA  A  1 30  ? 28.118 60.720  20.312  1.00 100.30 ? -44 DA  I C8    1 
ATOM   593   N  N7    . DA  A  1 30  ? 27.844 59.627  19.640  1.00 103.78 ? -44 DA  I N7    1 
ATOM   594   C  C5    . DA  A  1 30  ? 27.296 58.781  20.589  1.00 103.88 ? -44 DA  I C5    1 
ATOM   595   C  C6    . DA  A  1 30  ? 26.799 57.464  20.515  1.00 104.08 ? -44 DA  I C6    1 
ATOM   596   N  N6    . DA  A  1 30  ? 26.775 56.748  19.387  1.00 106.54 ? -44 DA  I N6    1 
ATOM   597   N  N1    . DA  A  1 30  ? 26.323 56.911  21.651  1.00 106.10 ? -44 DA  I N1    1 
ATOM   598   C  C2    . DA  A  1 30  ? 26.345 57.631  22.778  1.00 104.74 ? -44 DA  I C2    1 
ATOM   599   N  N3    . DA  A  1 30  ? 26.788 58.873  22.971  1.00 103.72 ? -44 DA  I N3    1 
ATOM   600   C  C4    . DA  A  1 30  ? 27.258 59.395  21.827  1.00 104.20 ? -44 DA  I C4    1 
ATOM   601   P  P     . DG  A  1 31  ? 30.432 63.690  25.407  1.00 80.29  ? -43 DG  I P     1 
ATOM   602   O  OP1   . DG  A  1 31  ? 30.510 64.867  26.301  1.00 82.55  ? -43 DG  I OP1   1 
ATOM   603   O  OP2   . DG  A  1 31  ? 31.542 63.421  24.465  1.00 78.68  ? -43 DG  I OP2   1 
ATOM   604   O  "O5'" . DG  A  1 31  ? 30.196 62.397  26.308  1.00 92.36  ? -43 DG  I "O5'" 1 
ATOM   605   C  "C5'" . DG  A  1 31  ? 28.929 62.205  26.927  1.00 97.61  ? -43 DG  I "C5'" 1 
ATOM   606   C  "C4'" . DG  A  1 31  ? 28.756 60.769  27.370  1.00 106.29 ? -43 DG  I "C4'" 1 
ATOM   607   O  "O4'" . DG  A  1 31  ? 28.475 59.932  26.219  1.00 112.38 ? -43 DG  I "O4'" 1 
ATOM   608   C  "C3'" . DG  A  1 31  ? 29.978 60.164  28.061  1.00 111.01 ? -43 DG  I "C3'" 1 
ATOM   609   O  "O3'" . DG  A  1 31  ? 29.586 59.537  29.269  1.00 111.60 ? -43 DG  I "O3'" 1 
ATOM   610   C  "C2'" . DG  A  1 31  ? 30.517 59.157  27.041  1.00 116.89 ? -43 DG  I "C2'" 1 
ATOM   611   C  "C1'" . DG  A  1 31  ? 29.258 58.766  26.285  1.00 118.97 ? -43 DG  I "C1'" 1 
ATOM   612   N  N9    . DG  A  1 31  ? 29.513 58.304  24.921  1.00 124.59 ? -43 DG  I N9    1 
ATOM   613   C  C8    . DG  A  1 31  ? 30.127 59.005  23.909  1.00 123.96 ? -43 DG  I C8    1 
ATOM   614   N  N7    . DG  A  1 31  ? 30.214 58.335  22.792  1.00 125.80 ? -43 DG  I N7    1 
ATOM   615   C  C5    . DG  A  1 31  ? 29.619 57.113  23.080  1.00 128.91 ? -43 DG  I C5    1 
ATOM   616   C  C6    . DG  A  1 31  ? 29.417 55.977  22.255  1.00 132.46 ? -43 DG  I C6    1 
ATOM   617   O  O6    . DG  A  1 31  ? 29.736 55.823  21.067  1.00 130.56 ? -43 DG  I O6    1 
ATOM   618   N  N1    . DG  A  1 31  ? 28.772 54.950  22.942  1.00 137.31 ? -43 DG  I N1    1 
ATOM   619   C  C2    . DG  A  1 31  ? 28.373 55.013  24.257  1.00 137.47 ? -43 DG  I C2    1 
ATOM   620   N  N2    . DG  A  1 31  ? 27.764 53.928  24.755  1.00 140.21 ? -43 DG  I N2    1 
ATOM   621   N  N3    . DG  A  1 31  ? 28.556 56.071  25.037  1.00 134.86 ? -43 DG  I N3    1 
ATOM   622   C  C4    . DG  A  1 31  ? 29.182 57.079  24.386  1.00 129.98 ? -43 DG  I C4    1 
ATOM   623   P  P     . DT  A  1 32  ? 30.688 58.866  30.225  1.00 116.37 ? -42 DT  I P     1 
ATOM   624   O  OP1   . DT  A  1 32  ? 30.170 58.910  31.610  1.00 116.94 ? -42 DT  I OP1   1 
ATOM   625   O  OP2   . DT  A  1 32  ? 31.999 59.475  29.906  1.00 117.96 ? -42 DT  I OP2   1 
ATOM   626   O  "O5'" . DT  A  1 32  ? 30.725 57.347  29.739  1.00 114.98 ? -42 DT  I "O5'" 1 
ATOM   627   C  "C5'" . DT  A  1 32  ? 29.518 56.608  29.648  1.00 114.92 ? -42 DT  I "C5'" 1 
ATOM   628   C  "C4'" . DT  A  1 32  ? 29.803 55.121  29.690  1.00 120.23 ? -42 DT  I "C4'" 1 
ATOM   629   O  "O4'" . DT  A  1 32  ? 29.896 54.604  28.339  1.00 125.66 ? -42 DT  I "O4'" 1 
ATOM   630   C  "C3'" . DT  A  1 32  ? 31.100 54.739  30.392  1.00 120.70 ? -42 DT  I "C3'" 1 
ATOM   631   O  "O3'" . DT  A  1 32  ? 30.891 53.578  31.184  1.00 122.50 ? -42 DT  I "O3'" 1 
ATOM   632   C  "C2'" . DT  A  1 32  ? 32.075 54.490  29.236  1.00 123.98 ? -42 DT  I "C2'" 1 
ATOM   633   C  "C1'" . DT  A  1 32  ? 31.157 54.005  28.121  1.00 127.93 ? -42 DT  I "C1'" 1 
ATOM   634   N  N1    . DT  A  1 32  ? 31.619 54.392  26.751  1.00 126.50 ? -42 DT  I N1    1 
ATOM   635   C  C2    . DT  A  1 32  ? 31.515 53.484  25.722  1.00 131.55 ? -42 DT  I C2    1 
ATOM   636   O  O2    . DT  A  1 32  ? 31.071 52.360  25.866  1.00 138.70 ? -42 DT  I O2    1 
ATOM   637   N  N3    . DT  A  1 32  ? 31.957 53.941  24.507  1.00 130.60 ? -42 DT  I N3    1 
ATOM   638   C  C4    . DT  A  1 32  ? 32.478 55.190  24.223  1.00 127.94 ? -42 DT  I C4    1 
ATOM   639   O  O4    . DT  A  1 32  ? 32.847 55.505  23.095  1.00 129.54 ? -42 DT  I O4    1 
ATOM   640   C  C5    . DT  A  1 32  ? 32.556 56.096  25.345  1.00 123.34 ? -42 DT  I C5    1 
ATOM   641   C  C7    . DT  A  1 32  ? 33.105 57.479  25.159  1.00 118.23 ? -42 DT  I C7    1 
ATOM   642   C  C6    . DT  A  1 32  ? 32.127 55.659  26.540  1.00 123.25 ? -42 DT  I C6    1 
ATOM   643   P  P     . DG  A  1 33  ? 32.113 52.883  31.960  1.00 125.83 ? -41 DG  I P     1 
ATOM   644   O  OP1   . DG  A  1 33  ? 31.568 52.293  33.203  1.00 129.36 ? -41 DG  I OP1   1 
ATOM   645   O  OP2   . DG  A  1 33  ? 33.240 53.840  32.039  1.00 120.26 ? -41 DG  I OP2   1 
ATOM   646   O  "O5'" . DG  A  1 33  ? 32.528 51.691  30.985  1.00 128.00 ? -41 DG  I "O5'" 1 
ATOM   647   C  "C5'" . DG  A  1 33  ? 31.514 50.898  30.381  1.00 132.66 ? -41 DG  I "C5'" 1 
ATOM   648   C  "C4'" . DG  A  1 33  ? 32.118 49.793  29.537  1.00 139.50 ? -41 DG  I "C4'" 1 
ATOM   649   O  "O4'" . DG  A  1 33  ? 32.392 50.292  28.200  1.00 137.54 ? -41 DG  I "O4'" 1 
ATOM   650   C  "C3'" . DG  A  1 33  ? 33.442 49.236  30.050  1.00 146.08 ? -41 DG  I "C3'" 1 
ATOM   651   O  "O3'" . DG  A  1 33  ? 33.507 47.844  29.762  1.00 155.80 ? -41 DG  I "O3'" 1 
ATOM   652   C  "C2'" . DG  A  1 33  ? 34.463 50.024  29.232  1.00 141.66 ? -41 DG  I "C2'" 1 
ATOM   653   C  "C1'" . DG  A  1 33  ? 33.752 50.073  27.893  1.00 138.98 ? -41 DG  I "C1'" 1 
ATOM   654   N  N9    . DG  A  1 33  ? 34.203 51.139  27.004  1.00 132.87 ? -41 DG  I N9    1 
ATOM   655   C  C8    . DG  A  1 33  ? 34.459 52.449  27.329  1.00 128.54 ? -41 DG  I C8    1 
ATOM   656   N  N7    . DG  A  1 33  ? 34.840 53.171  26.309  1.00 125.53 ? -41 DG  I N7    1 
ATOM   657   C  C5    . DG  A  1 33  ? 34.824 52.282  25.240  1.00 127.48 ? -41 DG  I C5    1 
ATOM   658   C  C6    . DG  A  1 33  ? 35.139 52.485  23.874  1.00 124.86 ? -41 DG  I C6    1 
ATOM   659   O  O6    . DG  A  1 33  ? 35.508 53.528  23.315  1.00 119.41 ? -41 DG  I O6    1 
ATOM   660   N  N1    . DG  A  1 33  ? 34.991 51.314  23.132  1.00 126.54 ? -41 DG  I N1    1 
ATOM   661   C  C2    . DG  A  1 33  ? 34.588 50.103  23.647  1.00 129.52 ? -41 DG  I C2    1 
ATOM   662   N  N2    . DG  A  1 33  ? 34.500 49.081  22.788  1.00 132.60 ? -41 DG  I N2    1 
ATOM   663   N  N3    . DG  A  1 33  ? 34.292 49.904  24.920  1.00 132.24 ? -41 DG  I N3    1 
ATOM   664   C  C4    . DG  A  1 33  ? 34.432 51.031  25.655  1.00 130.89 ? -41 DG  I C4    1 
ATOM   665   P  P     . DT  A  1 34  ? 34.196 46.824  30.795  1.00 144.85 ? -40 DT  I P     1 
ATOM   666   O  OP1   . DT  A  1 34  ? 33.212 45.757  31.089  1.00 149.24 ? -40 DT  I OP1   1 
ATOM   667   O  OP2   . DT  A  1 34  ? 34.774 47.617  31.903  1.00 141.10 ? -40 DT  I OP2   1 
ATOM   668   O  "O5'" . DT  A  1 34  ? 35.395 46.190  29.949  1.00 147.94 ? -40 DT  I "O5'" 1 
ATOM   669   C  "C5'" . DT  A  1 34  ? 35.951 46.920  28.866  1.00 143.20 ? -40 DT  I "C5'" 1 
ATOM   670   C  "C4'" . DT  A  1 34  ? 36.416 45.993  27.764  1.00 143.57 ? -40 DT  I "C4'" 1 
ATOM   671   O  "O4'" . DT  A  1 34  ? 36.420 46.713  26.506  1.00 143.69 ? -40 DT  I "O4'" 1 
ATOM   672   C  "C3'" . DT  A  1 34  ? 37.831 45.474  27.934  1.00 141.36 ? -40 DT  I "C3'" 1 
ATOM   673   O  "O3'" . DT  A  1 34  ? 37.978 44.228  27.272  1.00 135.82 ? -40 DT  I "O3'" 1 
ATOM   674   C  "C2'" . DT  A  1 34  ? 38.657 46.568  27.268  1.00 143.11 ? -40 DT  I "C2'" 1 
ATOM   675   C  "C1'" . DT  A  1 34  ? 37.750 47.001  26.116  1.00 144.81 ? -40 DT  I "C1'" 1 
ATOM   676   N  N1    . DT  A  1 34  ? 37.850 48.459  25.806  1.00 143.77 ? -40 DT  I N1    1 
ATOM   677   C  C2    . DT  A  1 34  ? 38.060 48.863  24.506  1.00 143.01 ? -40 DT  I C2    1 
ATOM   678   O  O2    . DT  A  1 34  ? 38.169 48.085  23.575  1.00 145.07 ? -40 DT  I O2    1 
ATOM   679   N  N3    . DT  A  1 34  ? 38.143 50.221  24.335  1.00 139.28 ? -40 DT  I N3    1 
ATOM   680   C  C4    . DT  A  1 34  ? 38.039 51.194  25.313  1.00 136.86 ? -40 DT  I C4    1 
ATOM   681   O  O4    . DT  A  1 34  ? 38.126 52.391  25.060  1.00 135.44 ? -40 DT  I O4    1 
ATOM   682   C  C5    . DT  A  1 34  ? 37.820 50.702  26.653  1.00 137.44 ? -40 DT  I C5    1 
ATOM   683   C  C7    . DT  A  1 34  ? 37.692 51.661  27.799  1.00 134.10 ? -40 DT  I C7    1 
ATOM   684   C  C6    . DT  A  1 34  ? 37.739 49.375  26.832  1.00 142.15 ? -40 DT  I C6    1 
ATOM   685   P  P     . DA  A  1 35  ? 39.397 43.473  27.278  1.00 152.96 ? -39 DA  I P     1 
ATOM   686   O  OP1   . DA  A  1 35  ? 39.128 42.020  27.225  1.00 154.30 ? -39 DA  I OP1   1 
ATOM   687   O  OP2   . DA  A  1 35  ? 40.204 44.025  28.389  1.00 151.71 ? -39 DA  I OP2   1 
ATOM   688   O  "O5'" . DA  A  1 35  ? 40.071 43.924  25.899  1.00 148.63 ? -39 DA  I "O5'" 1 
ATOM   689   C  "C5'" . DA  A  1 35  ? 39.364 43.738  24.679  1.00 144.20 ? -39 DA  I "C5'" 1 
ATOM   690   C  "C4'" . DA  A  1 35  ? 40.223 44.097  23.478  1.00 139.39 ? -39 DA  I "C4'" 1 
ATOM   691   O  "O4'" . DA  A  1 35  ? 40.156 45.524  23.225  1.00 131.88 ? -39 DA  I "O4'" 1 
ATOM   692   C  "C3'" . DA  A  1 35  ? 41.704 43.759  23.598  1.00 142.52 ? -39 DA  I "C3'" 1 
ATOM   693   O  "O3'" . DA  A  1 35  ? 42.175 43.312  22.332  1.00 147.55 ? -39 DA  I "O3'" 1 
ATOM   694   C  "C2'" . DA  A  1 35  ? 42.327 45.098  24.002  1.00 136.70 ? -39 DA  I "C2'" 1 
ATOM   695   C  "C1'" . DA  A  1 35  ? 41.457 46.080  23.234  1.00 130.64 ? -39 DA  I "C1'" 1 
ATOM   696   N  N9    . DA  A  1 35  ? 41.358 47.403  23.843  1.00 127.05 ? -39 DA  I N9    1 
ATOM   697   C  C8    . DA  A  1 35  ? 41.031 47.693  25.138  1.00 127.17 ? -39 DA  I C8    1 
ATOM   698   N  N7    . DA  A  1 35  ? 40.986 48.978  25.399  1.00 122.19 ? -39 DA  I N7    1 
ATOM   699   C  C5    . DA  A  1 35  ? 41.294 49.573  24.188  1.00 120.65 ? -39 DA  I C5    1 
ATOM   700   C  C6    . DA  A  1 35  ? 41.410 50.919  23.796  1.00 119.72 ? -39 DA  I C6    1 
ATOM   701   N  N6    . DA  A  1 35  ? 41.219 51.947  24.629  1.00 118.88 ? -39 DA  I N6    1 
ATOM   702   N  N1    . DA  A  1 35  ? 41.732 51.169  22.510  1.00 116.73 ? -39 DA  I N1    1 
ATOM   703   C  C2    . DA  A  1 35  ? 41.924 50.138  21.679  1.00 117.71 ? -39 DA  I C2    1 
ATOM   704   N  N3    . DA  A  1 35  ? 41.841 48.834  21.931  1.00 120.39 ? -39 DA  I N3    1 
ATOM   705   C  C4    . DA  A  1 35  ? 41.519 48.617  23.216  1.00 122.75 ? -39 DA  I C4    1 
ATOM   706   P  P     . DT  A  1 36  ? 43.707 42.879  22.116  1.00 144.09 ? -38 DT  I P     1 
ATOM   707   O  OP1   . DT  A  1 36  ? 43.696 41.677  21.252  1.00 144.54 ? -38 DT  I OP1   1 
ATOM   708   O  OP2   . DT  A  1 36  ? 44.385 42.827  23.431  1.00 145.47 ? -38 DT  I OP2   1 
ATOM   709   O  "O5'" . DT  A  1 36  ? 44.316 44.093  21.273  1.00 139.94 ? -38 DT  I "O5'" 1 
ATOM   710   C  "C5'" . DT  A  1 36  ? 43.639 44.538  20.105  1.00 137.10 ? -38 DT  I "C5'" 1 
ATOM   711   C  "C4'" . DT  A  1 36  ? 44.415 45.639  19.406  1.00 134.09 ? -38 DT  I "C4'" 1 
ATOM   712   O  "O4'" . DT  A  1 36  ? 44.189 46.904  20.079  1.00 132.03 ? -38 DT  I "O4'" 1 
ATOM   713   C  "C3'" . DT  A  1 36  ? 45.928 45.436  19.354  1.00 134.27 ? -38 DT  I "C3'" 1 
ATOM   714   O  "O3'" . DT  A  1 36  ? 46.396 45.731  18.040  1.00 133.04 ? -38 DT  I "O3'" 1 
ATOM   715   C  "C2'" . DT  A  1 36  ? 46.455 46.424  20.398  1.00 133.15 ? -38 DT  I "C2'" 1 
ATOM   716   C  "C1'" . DT  A  1 36  ? 45.422 47.537  20.338  1.00 130.60 ? -38 DT  I "C1'" 1 
ATOM   717   N  N1    . DT  A  1 36  ? 45.282 48.308  21.614  1.00 127.12 ? -38 DT  I N1    1 
ATOM   718   C  C2    . DT  A  1 36  ? 45.283 49.684  21.574  1.00 122.06 ? -38 DT  I C2    1 
ATOM   719   O  O2    . DT  A  1 36  ? 45.406 50.323  20.544  1.00 120.81 ? -38 DT  I O2    1 
ATOM   720   N  N3    . DT  A  1 36  ? 45.135 50.293  22.794  1.00 116.96 ? -38 DT  I N3    1 
ATOM   721   C  C4    . DT  A  1 36  ? 44.987 49.676  24.023  1.00 113.57 ? -38 DT  I C4    1 
ATOM   722   O  O4    . DT  A  1 36  ? 44.860 50.312  25.066  1.00 104.38 ? -38 DT  I O4    1 
ATOM   723   C  C5    . DT  A  1 36  ? 44.991 48.232  23.994  1.00 123.58 ? -38 DT  I C5    1 
ATOM   724   C  C7    . DT  A  1 36  ? 44.839 47.452  25.266  1.00 127.84 ? -38 DT  I C7    1 
ATOM   725   C  C6    . DT  A  1 36  ? 45.135 47.625  22.805  1.00 128.29 ? -38 DT  I C6    1 
ATOM   726   P  P     . DT  A  1 37  ? 47.966 45.788  17.699  1.00 133.37 ? -37 DT  I P     1 
ATOM   727   O  OP1   . DT  A  1 37  ? 48.128 45.205  16.348  1.00 133.27 ? -37 DT  I OP1   1 
ATOM   728   O  OP2   . DT  A  1 37  ? 48.751 45.223  18.820  1.00 134.52 ? -37 DT  I OP2   1 
ATOM   729   O  "O5'" . DT  A  1 37  ? 48.255 47.355  17.601  1.00 128.37 ? -37 DT  I "O5'" 1 
ATOM   730   C  "C5'" . DT  A  1 37  ? 47.337 48.185  16.903  1.00 122.11 ? -37 DT  I "C5'" 1 
ATOM   731   C  "C4'" . DT  A  1 37  ? 47.776 49.636  16.930  1.00 115.56 ? -37 DT  I "C4'" 1 
ATOM   732   O  "O4'" . DT  A  1 37  ? 47.512 50.209  18.236  1.00 113.19 ? -37 DT  I "O4'" 1 
ATOM   733   C  "C3'" . DT  A  1 37  ? 49.255 49.875  16.646  1.00 112.69 ? -37 DT  I "C3'" 1 
ATOM   734   O  "O3'" . DT  A  1 37  ? 49.389 51.014  15.814  1.00 105.33 ? -37 DT  I "O3'" 1 
ATOM   735   C  "C2'" . DT  A  1 37  ? 49.846 50.109  18.040  1.00 113.99 ? -37 DT  I "C2'" 1 
ATOM   736   C  "C1'" . DT  A  1 37  ? 48.688 50.790  18.755  1.00 113.08 ? -37 DT  I "C1'" 1 
ATOM   737   N  N1    . DT  A  1 37  ? 48.677 50.595  20.236  1.00 117.00 ? -37 DT  I N1    1 
ATOM   738   C  C2    . DT  A  1 37  ? 48.525 51.688  21.056  1.00 116.74 ? -37 DT  I C2    1 
ATOM   739   O  O2    . DT  A  1 37  ? 48.415 52.827  20.638  1.00 115.07 ? -37 DT  I O2    1 
ATOM   740   N  N3    . DT  A  1 37  ? 48.509 51.402  22.395  1.00 115.34 ? -37 DT  I N3    1 
ATOM   741   C  C4    . DT  A  1 37  ? 48.622 50.159  22.986  1.00 115.19 ? -37 DT  I C4    1 
ATOM   742   O  O4    . DT  A  1 37  ? 48.597 50.008  24.204  1.00 116.54 ? -37 DT  I O4    1 
ATOM   743   C  C5    . DT  A  1 37  ? 48.773 49.053  22.072  1.00 117.79 ? -37 DT  I C5    1 
ATOM   744   C  C7    . DT  A  1 37  ? 48.908 47.655  22.600  1.00 119.67 ? -37 DT  I C7    1 
ATOM   745   C  C6    . DT  A  1 37  ? 48.786 49.319  20.755  1.00 119.78 ? -37 DT  I C6    1 
ATOM   746   P  P     . DT  A  1 38  ? 50.764 51.310  15.042  1.00 108.41 ? -36 DT  I P     1 
ATOM   747   O  OP1   . DT  A  1 38  ? 50.438 51.562  13.620  1.00 104.31 ? -36 DT  I OP1   1 
ATOM   748   O  OP2   . DT  A  1 38  ? 51.735 50.251  15.399  1.00 110.67 ? -36 DT  I OP2   1 
ATOM   749   O  "O5'" . DT  A  1 38  ? 51.258 52.674  15.702  1.00 108.27 ? -36 DT  I "O5'" 1 
ATOM   750   C  "C5'" . DT  A  1 38  ? 50.311 53.540  16.319  1.00 98.51  ? -36 DT  I "C5'" 1 
ATOM   751   C  "C4'" . DT  A  1 38  ? 51.016 54.623  17.106  1.00 94.26  ? -36 DT  I "C4'" 1 
ATOM   752   O  "O4'" . DT  A  1 38  ? 50.822 54.403  18.529  1.00 96.16  ? -36 DT  I "O4'" 1 
ATOM   753   C  "C3'" . DT  A  1 38  ? 52.526 54.684  16.896  1.00 95.72  ? -36 DT  I "C3'" 1 
ATOM   754   O  "O3'" . DT  A  1 38  ? 52.947 56.031  16.936  1.00 95.38  ? -36 DT  I "O3'" 1 
ATOM   755   C  "C2'" . DT  A  1 38  ? 53.055 53.903  18.098  1.00 96.17  ? -36 DT  I "C2'" 1 
ATOM   756   C  "C1'" . DT  A  1 38  ? 52.080 54.360  19.168  1.00 97.97  ? -36 DT  I "C1'" 1 
ATOM   757   N  N1    . DT  A  1 38  ? 51.981 53.447  20.342  1.00 103.07 ? -36 DT  I N1    1 
ATOM   758   C  C2    . DT  A  1 38  ? 51.749 53.985  21.585  1.00 102.62 ? -36 DT  I C2    1 
ATOM   759   O  O2    . DT  A  1 38  ? 51.625 55.180  21.782  1.00 102.07 ? -36 DT  I O2    1 
ATOM   760   N  N3    . DT  A  1 38  ? 51.667 53.071  22.599  1.00 103.72 ? -36 DT  I N3    1 
ATOM   761   C  C4    . DT  A  1 38  ? 51.789 51.697  22.496  1.00 110.59 ? -36 DT  I C4    1 
ATOM   762   O  O4    . DT  A  1 38  ? 51.699 50.958  23.470  1.00 115.25 ? -36 DT  I O4    1 
ATOM   763   C  C5    . DT  A  1 38  ? 52.030 51.196  21.163  1.00 111.67 ? -36 DT  I C5    1 
ATOM   764   C  C7    . DT  A  1 38  ? 52.184 49.723  20.927  1.00 116.11 ? -36 DT  I C7    1 
ATOM   765   C  C6    . DT  A  1 38  ? 52.113 52.086  20.162  1.00 108.06 ? -36 DT  I C6    1 
ATOM   766   P  P     . DG  A  1 39  ? 53.076 56.896  15.588  1.00 92.56  ? -35 DG  I P     1 
ATOM   767   O  OP1   . DG  A  1 39  ? 51.896 56.610  14.742  1.00 90.11  ? -35 DG  I OP1   1 
ATOM   768   O  OP2   . DG  A  1 39  ? 54.438 56.683  15.050  1.00 100.44 ? -35 DG  I OP2   1 
ATOM   769   O  "O5'" . DG  A  1 39  ? 52.971 58.406  16.104  1.00 81.28  ? -35 DG  I "O5'" 1 
ATOM   770   C  "C5'" . DG  A  1 39  ? 51.719 58.907  16.564  1.00 79.93  ? -35 DG  I "C5'" 1 
ATOM   771   C  "C4'" . DG  A  1 39  ? 51.887 59.839  17.759  1.00 77.39  ? -35 DG  I "C4'" 1 
ATOM   772   O  "O4'" . DG  A  1 39  ? 52.191 59.077  18.953  1.00 83.66  ? -35 DG  I "O4'" 1 
ATOM   773   C  "C3'" . DG  A  1 39  ? 52.985 60.882  17.644  1.00 73.97  ? -35 DG  I "C3'" 1 
ATOM   774   O  "O3'" . DG  A  1 39  ? 52.581 62.050  18.339  1.00 71.29  ? -35 DG  I "O3'" 1 
ATOM   775   C  "C2'" . DG  A  1 39  ? 54.177 60.201  18.321  1.00 77.98  ? -35 DG  I "C2'" 1 
ATOM   776   C  "C1'" . DG  A  1 39  ? 53.504 59.362  19.407  1.00 87.53  ? -35 DG  I "C1'" 1 
ATOM   777   N  N9    . DG  A  1 39  ? 54.157 58.080  19.658  1.00 96.55  ? -35 DG  I N9    1 
ATOM   778   C  C8    . DG  A  1 39  ? 54.748 57.262  18.729  1.00 99.32  ? -35 DG  I C8    1 
ATOM   779   N  N7    . DG  A  1 39  ? 55.221 56.158  19.233  1.00 102.08 ? -35 DG  I N7    1 
ATOM   780   C  C5    . DG  A  1 39  ? 54.922 56.244  20.584  1.00 102.17 ? -35 DG  I C5    1 
ATOM   781   C  C6    . DG  A  1 39  ? 55.193 55.338  21.634  1.00 107.26 ? -35 DG  I C6    1 
ATOM   782   O  O6    . DG  A  1 39  ? 55.772 54.246  21.571  1.00 111.93 ? -35 DG  I O6    1 
ATOM   783   N  N1    . DG  A  1 39  ? 54.720 55.807  22.857  1.00 104.03 ? -35 DG  I N1    1 
ATOM   784   C  C2    . DG  A  1 39  ? 54.066 57.003  23.041  1.00 100.53 ? -35 DG  I C2    1 
ATOM   785   N  N2    . DG  A  1 39  ? 53.682 57.290  24.293  1.00 97.70  ? -35 DG  I N2    1 
ATOM   786   N  N3    . DG  A  1 39  ? 53.804 57.863  22.062  1.00 100.99 ? -35 DG  I N3    1 
ATOM   787   C  C4    . DG  A  1 39  ? 54.260 57.419  20.864  1.00 99.62  ? -35 DG  I C4    1 
ATOM   788   P  P     . DG  A  1 40  ? 53.364 63.436  18.138  1.00 74.48  ? -34 DG  I P     1 
ATOM   789   O  OP1   . DG  A  1 40  ? 52.358 64.520  18.190  1.00 65.90  ? -34 DG  I OP1   1 
ATOM   790   O  OP2   . DG  A  1 40  ? 54.251 63.299  16.960  1.00 83.20  ? -34 DG  I OP2   1 
ATOM   791   O  "O5'" . DG  A  1 40  ? 54.279 63.533  19.442  1.00 77.10  ? -34 DG  I "O5'" 1 
ATOM   792   C  "C5'" . DG  A  1 40  ? 53.690 63.359  20.721  1.00 71.04  ? -34 DG  I "C5'" 1 
ATOM   793   C  "C4'" . DG  A  1 40  ? 54.730 62.959  21.747  1.00 73.69  ? -34 DG  I "C4'" 1 
ATOM   794   O  "O4'" . DG  A  1 40  ? 55.120 61.573  21.543  1.00 86.22  ? -34 DG  I "O4'" 1 
ATOM   795   C  "C3'" . DG  A  1 40  ? 56.038 63.766  21.709  1.00 77.81  ? -34 DG  I "C3'" 1 
ATOM   796   O  "O3'" . DG  A  1 40  ? 56.458 64.038  23.038  1.00 84.72  ? -34 DG  I "O3'" 1 
ATOM   797   C  "C2'" . DG  A  1 40  ? 56.999 62.794  21.030  1.00 80.12  ? -34 DG  I "C2'" 1 
ATOM   798   C  "C1'" . DG  A  1 40  ? 56.515 61.510  21.661  1.00 85.58  ? -34 DG  I "C1'" 1 
ATOM   799   N  N9    . DG  A  1 40  ? 57.020 60.285  21.049  1.00 90.95  ? -34 DG  I N9    1 
ATOM   800   C  C8    . DG  A  1 40  ? 57.291 60.051  19.722  1.00 91.94  ? -34 DG  I C8    1 
ATOM   801   N  N7    . DG  A  1 40  ? 57.743 58.845  19.492  1.00 96.07  ? -34 DG  I N7    1 
ATOM   802   C  C5    . DG  A  1 40  ? 57.777 58.251  20.750  1.00 97.47  ? -34 DG  I C5    1 
ATOM   803   C  C6    . DG  A  1 40  ? 58.178 56.950  21.142  1.00 101.87 ? -34 DG  I C6    1 
ATOM   804   O  O6    . DG  A  1 40  ? 58.598 56.025  20.433  1.00 104.42 ? -34 DG  I O6    1 
ATOM   805   N  N1    . DG  A  1 40  ? 58.052 56.767  22.519  1.00 102.14 ? -34 DG  I N1    1 
ATOM   806   C  C2    . DG  A  1 40  ? 57.596 57.720  23.400  1.00 99.06  ? -34 DG  I C2    1 
ATOM   807   N  N2    . DG  A  1 40  ? 57.540 57.374  24.692  1.00 102.03 ? -34 DG  I N2    1 
ATOM   808   N  N3    . DG  A  1 40  ? 57.221 58.934  23.043  1.00 96.24  ? -34 DG  I N3    1 
ATOM   809   C  C4    . DG  A  1 40  ? 57.338 59.129  21.711  1.00 95.28  ? -34 DG  I C4    1 
ATOM   810   P  P     . DA  A  1 41  ? 56.465 65.540  23.607  1.00 83.58  ? -33 DA  I P     1 
ATOM   811   O  OP1   . DA  A  1 41  ? 55.077 66.053  23.537  1.00 79.15  ? -33 DA  I OP1   1 
ATOM   812   O  OP2   . DA  A  1 41  ? 57.559 66.273  22.929  1.00 86.20  ? -33 DA  I OP2   1 
ATOM   813   O  "O5'" . DA  A  1 41  ? 56.867 65.357  25.146  1.00 86.69  ? -33 DA  I "O5'" 1 
ATOM   814   C  "C5'" . DA  A  1 41  ? 55.974 64.698  26.040  1.00 90.60  ? -33 DA  I "C5'" 1 
ATOM   815   C  "C4'" . DA  A  1 41  ? 56.725 63.875  27.079  1.00 94.59  ? -33 DA  I "C4'" 1 
ATOM   816   O  "O4'" . DA  A  1 41  ? 57.176 62.627  26.495  1.00 97.43  ? -33 DA  I "O4'" 1 
ATOM   817   C  "C3'" . DA  A  1 41  ? 57.967 64.523  27.673  1.00 98.38  ? -33 DA  I "C3'" 1 
ATOM   818   O  "O3'" . DA  A  1 41  ? 58.112 64.087  29.018  1.00 103.42 ? -33 DA  I "O3'" 1 
ATOM   819   C  "C2'" . DA  A  1 41  ? 59.081 63.973  26.783  1.00 101.34 ? -33 DA  I "C2'" 1 
ATOM   820   C  "C1'" . DA  A  1 41  ? 58.589 62.553  26.537  1.00 104.00 ? -33 DA  I "C1'" 1 
ATOM   821   N  N9    . DA  A  1 41  ? 59.036 61.970  25.276  1.00 110.66 ? -33 DA  I N9    1 
ATOM   822   C  C8    . DA  A  1 41  ? 58.896 62.503  24.026  1.00 109.82 ? -33 DA  I C8    1 
ATOM   823   N  N7    . DA  A  1 41  ? 59.372 61.741  23.069  1.00 110.66 ? -33 DA  I N7    1 
ATOM   824   C  C5    . DA  A  1 41  ? 59.842 60.624  23.736  1.00 114.24 ? -33 DA  I C5    1 
ATOM   825   C  C6    . DA  A  1 41  ? 60.462 59.443  23.286  1.00 116.53 ? -33 DA  I C6    1 
ATOM   826   N  N6    . DA  A  1 41  ? 60.721 59.190  21.999  1.00 113.32 ? -33 DA  I N6    1 
ATOM   827   N  N1    . DA  A  1 41  ? 60.811 58.529  24.215  1.00 123.23 ? -33 DA  I N1    1 
ATOM   828   C  C2    . DA  A  1 41  ? 60.549 58.784  25.502  1.00 124.12 ? -33 DA  I C2    1 
ATOM   829   N  N3    . DA  A  1 41  ? 59.971 59.854  26.044  1.00 122.50 ? -33 DA  I N3    1 
ATOM   830   C  C4    . DA  A  1 41  ? 59.638 60.745  25.097  1.00 116.90 ? -33 DA  I C4    1 
ATOM   831   P  P     . DA  A  1 42  ? 59.069 64.871  30.040  1.00 103.89 ? -32 DA  I P     1 
ATOM   832   O  OP1   . DA  A  1 42  ? 58.299 65.087  31.286  1.00 102.17 ? -32 DA  I OP1   1 
ATOM   833   O  OP2   . DA  A  1 42  ? 59.656 66.027  29.328  1.00 104.99 ? -32 DA  I OP2   1 
ATOM   834   O  "O5'" . DA  A  1 42  ? 60.237 63.821  30.334  1.00 106.47 ? -32 DA  I "O5'" 1 
ATOM   835   C  "C5'" . DA  A  1 42  ? 59.908 62.469  30.625  1.00 109.77 ? -32 DA  I "C5'" 1 
ATOM   836   C  "C4'" . DA  A  1 42  ? 61.148 61.593  30.623  1.00 117.04 ? -32 DA  I "C4'" 1 
ATOM   837   O  "O4'" . DA  A  1 42  ? 61.372 61.046  29.296  1.00 118.44 ? -32 DA  I "O4'" 1 
ATOM   838   C  "C3'" . DA  A  1 42  ? 62.444 62.298  31.015  1.00 120.07 ? -32 DA  I "C3'" 1 
ATOM   839   O  "O3'" . DA  A  1 42  ? 63.211 61.434  31.828  1.00 124.86 ? -32 DA  I "O3'" 1 
ATOM   840   C  "C2'" . DA  A  1 42  ? 63.120 62.548  29.665  1.00 120.90 ? -32 DA  I "C2'" 1 
ATOM   841   C  "C1'" . DA  A  1 42  ? 62.699 61.309  28.892  1.00 122.22 ? -32 DA  I "C1'" 1 
ATOM   842   N  N9    . DA  A  1 42  ? 62.702 61.470  27.439  1.00 121.97 ? -32 DA  I N9    1 
ATOM   843   C  C8    . DA  A  1 42  ? 62.128 62.481  26.721  1.00 119.39 ? -32 DA  I C8    1 
ATOM   844   N  N7    . DA  A  1 42  ? 62.269 62.355  25.422  1.00 121.03 ? -32 DA  I N7    1 
ATOM   845   C  C5    . DA  A  1 42  ? 62.976 61.173  25.276  1.00 120.37 ? -32 DA  I C5    1 
ATOM   846   C  C6    . DA  A  1 42  ? 63.444 60.478  24.141  1.00 115.12 ? -32 DA  I C6    1 
ATOM   847   N  N6    . DA  A  1 42  ? 63.254 60.904  22.887  1.00 110.92 ? -32 DA  I N6    1 
ATOM   848   N  N1    . DA  A  1 42  ? 64.116 59.324  24.344  1.00 120.06 ? -32 DA  I N1    1 
ATOM   849   C  C2    . DA  A  1 42  ? 64.304 58.903  25.601  1.00 125.90 ? -32 DA  I C2    1 
ATOM   850   N  N3    . DA  A  1 42  ? 63.912 59.468  26.744  1.00 128.58 ? -32 DA  I N3    1 
ATOM   851   C  C4    . DA  A  1 42  ? 63.247 60.611  26.509  1.00 124.13 ? -32 DA  I C4    1 
ATOM   852   P  P     . DA  A  1 43  ? 64.266 62.023  32.885  1.00 126.44 ? -31 DA  I P     1 
ATOM   853   O  OP1   . DA  A  1 43  ? 63.816 61.629  34.239  1.00 125.67 ? -31 DA  I OP1   1 
ATOM   854   O  OP2   . DA  A  1 43  ? 64.487 63.451  32.567  1.00 124.44 ? -31 DA  I OP2   1 
ATOM   855   O  "O5'" . DA  A  1 43  ? 65.603 61.226  32.539  1.00 123.60 ? -31 DA  I "O5'" 1 
ATOM   856   C  "C5'" . DA  A  1 43  ? 65.521 59.876  32.109  1.00 125.38 ? -31 DA  I "C5'" 1 
ATOM   857   C  "C4'" . DA  A  1 43  ? 66.772 59.485  31.352  1.00 131.00 ? -31 DA  I "C4'" 1 
ATOM   858   O  "O4'" . DA  A  1 43  ? 66.537 59.593  29.926  1.00 130.45 ? -31 DA  I "O4'" 1 
ATOM   859   C  "C3'" . DA  A  1 43  ? 67.998 60.340  31.663  1.00 132.87 ? -31 DA  I "C3'" 1 
ATOM   860   O  "O3'" . DA  A  1 43  ? 69.104 59.495  31.935  1.00 139.31 ? -31 DA  I "O3'" 1 
ATOM   861   C  "C2'" . DA  A  1 43  ? 68.200 61.177  30.393  1.00 130.39 ? -31 DA  I "C2'" 1 
ATOM   862   C  "C1'" . DA  A  1 43  ? 67.595 60.292  29.313  1.00 129.48 ? -31 DA  I "C1'" 1 
ATOM   863   N  N9    . DA  A  1 43  ? 67.040 61.036  28.183  1.00 122.97 ? -31 DA  I N9    1 
ATOM   864   C  C8    . DA  A  1 43  ? 66.214 62.126  28.240  1.00 119.63 ? -31 DA  I C8    1 
ATOM   865   N  N7    . DA  A  1 43  ? 65.854 62.581  27.062  1.00 116.28 ? -31 DA  I N7    1 
ATOM   866   C  C5    . DA  A  1 43  ? 66.481 61.726  26.170  1.00 119.89 ? -31 DA  I C5    1 
ATOM   867   C  C6    . DA  A  1 43  ? 66.501 61.670  24.761  1.00 118.35 ? -31 DA  I C6    1 
ATOM   868   N  N6    . DA  A  1 43  ? 65.842 62.533  23.979  1.00 113.97 ? -31 DA  I N6    1 
ATOM   869   N  N1    . DA  A  1 43  ? 67.229 60.690  24.184  1.00 120.71 ? -31 DA  I N1    1 
ATOM   870   C  C2    . DA  A  1 43  ? 67.887 59.829  24.970  1.00 123.40 ? -31 DA  I C2    1 
ATOM   871   N  N3    . DA  A  1 43  ? 67.944 59.780  26.300  1.00 124.12 ? -31 DA  I N3    1 
ATOM   872   C  C4    . DA  A  1 43  ? 67.212 60.765  26.844  1.00 122.79 ? -31 DA  I C4    1 
ATOM   873   P  P     . DC  A  1 44  ? 70.545 60.109  32.290  1.00 144.67 ? -30 DC  I P     1 
ATOM   874   O  OP1   . DC  A  1 44  ? 71.153 59.228  33.312  1.00 148.42 ? -30 DC  I OP1   1 
ATOM   875   O  OP2   . DC  A  1 44  ? 70.394 61.556  32.570  1.00 142.13 ? -30 DC  I OP2   1 
ATOM   876   O  "O5'" . DC  A  1 44  ? 71.353 59.934  30.926  1.00 140.23 ? -30 DC  I "O5'" 1 
ATOM   877   C  "C5'" . DC  A  1 44  ? 71.176 58.749  30.162  1.00 136.20 ? -30 DC  I "C5'" 1 
ATOM   878   C  "C4'" . DC  A  1 44  ? 71.871 58.860  28.821  1.00 134.04 ? -30 DC  I "C4'" 1 
ATOM   879   O  "O4'" . DC  A  1 44  ? 71.008 59.535  27.872  1.00 130.18 ? -30 DC  I "O4'" 1 
ATOM   880   C  "C3'" . DC  A  1 44  ? 73.186 59.644  28.837  1.00 136.26 ? -30 DC  I "C3'" 1 
ATOM   881   O  "O3'" . DC  A  1 44  ? 74.191 58.894  28.177  1.00 144.47 ? -30 DC  I "O3'" 1 
ATOM   882   C  "C2'" . DC  A  1 44  ? 72.847 60.930  28.076  1.00 131.88 ? -30 DC  I "C2'" 1 
ATOM   883   C  "C1'" . DC  A  1 44  ? 71.788 60.426  27.116  1.00 129.50 ? -30 DC  I "C1'" 1 
ATOM   884   N  N1    . DC  A  1 44  ? 70.899 61.489  26.563  1.00 124.12 ? -30 DC  I N1    1 
ATOM   885   C  C2    . DC  A  1 44  ? 70.799 61.640  25.178  1.00 120.18 ? -30 DC  I C2    1 
ATOM   886   O  O2    . DC  A  1 44  ? 71.459 60.891  24.450  1.00 123.24 ? -30 DC  I O2    1 
ATOM   887   N  N3    . DC  A  1 44  ? 69.984 62.602  24.677  1.00 114.83 ? -30 DC  I N3    1 
ATOM   888   C  C4    . DC  A  1 44  ? 69.291 63.386  25.507  1.00 113.18 ? -30 DC  I C4    1 
ATOM   889   N  N4    . DC  A  1 44  ? 68.499 64.322  24.971  1.00 103.84 ? -30 DC  I N4    1 
ATOM   890   C  C5    . DC  A  1 44  ? 69.380 63.246  26.925  1.00 118.46 ? -30 DC  I C5    1 
ATOM   891   C  C6    . DC  A  1 44  ? 70.186 62.292  27.405  1.00 122.66 ? -30 DC  I C6    1 
ATOM   892   P  P     . DT  A  1 45  ? 75.728 59.349  28.263  1.00 137.37 ? -29 DT  I P     1 
ATOM   893   O  OP1   . DT  A  1 45  ? 76.563 58.137  28.101  1.00 141.31 ? -29 DT  I OP1   1 
ATOM   894   O  OP2   . DT  A  1 45  ? 75.881 60.199  29.464  1.00 143.70 ? -29 DT  I OP2   1 
ATOM   895   O  "O5'" . DT  A  1 45  ? 75.919 60.274  26.978  1.00 136.24 ? -29 DT  I "O5'" 1 
ATOM   896   C  "C5'" . DT  A  1 45  ? 75.736 59.728  25.683  1.00 136.82 ? -29 DT  I "C5'" 1 
ATOM   897   C  "C4'" . DT  A  1 45  ? 75.986 60.778  24.622  1.00 132.85 ? -29 DT  I "C4'" 1 
ATOM   898   O  "O4'" . DT  A  1 45  ? 74.805 61.612  24.472  1.00 129.26 ? -29 DT  I "O4'" 1 
ATOM   899   C  "C3'" . DT  A  1 45  ? 77.144 61.739  24.925  1.00 130.51 ? -29 DT  I "C3'" 1 
ATOM   900   O  "O3'" . DT  A  1 45  ? 77.875 61.999  23.732  1.00 122.37 ? -29 DT  I "O3'" 1 
ATOM   901   C  "C2'" . DT  A  1 45  ? 76.413 62.994  25.402  1.00 130.02 ? -29 DT  I "C2'" 1 
ATOM   902   C  "C1'" . DT  A  1 45  ? 75.216 62.955  24.474  1.00 129.55 ? -29 DT  I "C1'" 1 
ATOM   903   N  N1    . DT  A  1 45  ? 74.072 63.831  24.867  1.00 128.38 ? -29 DT  I N1    1 
ATOM   904   C  C2    . DT  A  1 45  ? 73.334 64.424  23.875  1.00 124.42 ? -29 DT  I C2    1 
ATOM   905   O  O2    . DT  A  1 45  ? 73.564 64.267  22.689  1.00 121.86 ? -29 DT  I O2    1 
ATOM   906   N  N3    . DT  A  1 45  ? 72.306 65.208  24.311  1.00 124.74 ? -29 DT  I N3    1 
ATOM   907   C  C4    . DT  A  1 45  ? 71.942 65.462  25.616  1.00 126.17 ? -29 DT  I C4    1 
ATOM   908   O  O4    . DT  A  1 45  ? 70.991 66.189  25.898  1.00 124.05 ? -29 DT  I O4    1 
ATOM   909   C  C5    . DT  A  1 45  ? 72.759 64.812  26.619  1.00 128.75 ? -29 DT  I C5    1 
ATOM   910   C  C7    . DT  A  1 45  ? 72.463 65.012  28.076  1.00 130.49 ? -29 DT  I C7    1 
ATOM   911   C  C6    . DT  A  1 45  ? 73.777 64.036  26.201  1.00 130.21 ? -29 DT  I C6    1 
ATOM   912   P  P     . DG  A  1 46  ? 79.136 61.092  23.315  1.00 125.20 ? -28 DG  I P     1 
ATOM   913   O  OP1   . DG  A  1 46  ? 78.754 59.672  23.475  1.00 122.91 ? -28 DG  I OP1   1 
ATOM   914   O  OP2   . DG  A  1 46  ? 80.327 61.609  24.026  1.00 124.03 ? -28 DG  I OP2   1 
ATOM   915   O  "O5'" . DG  A  1 46  ? 79.317 61.404  21.755  1.00 123.16 ? -28 DG  I "O5'" 1 
ATOM   916   C  "C5'" . DG  A  1 46  ? 78.352 60.926  20.823  1.00 123.70 ? -28 DG  I "C5'" 1 
ATOM   917   C  "C4'" . DG  A  1 46  ? 78.228 61.839  19.604  1.00 125.48 ? -28 DG  I "C4'" 1 
ATOM   918   O  "O4'" . DG  A  1 46  ? 77.202 62.841  19.820  1.00 123.27 ? -28 DG  I "O4'" 1 
ATOM   919   C  "C3'" . DG  A  1 46  ? 79.463 62.628  19.212  1.00 129.01 ? -28 DG  I "C3'" 1 
ATOM   920   O  "O3'" . DG  A  1 46  ? 79.375 62.905  17.822  1.00 130.56 ? -28 DG  I "O3'" 1 
ATOM   921   C  "C2'" . DG  A  1 46  ? 79.290 63.902  20.040  1.00 126.74 ? -28 DG  I "C2'" 1 
ATOM   922   C  "C1'" . DG  A  1 46  ? 77.792 64.133  19.884  1.00 123.52 ? -28 DG  I "C1'" 1 
ATOM   923   N  N9    . DG  A  1 46  ? 77.151 64.829  20.991  1.00 123.53 ? -28 DG  I N9    1 
ATOM   924   C  C8    . DG  A  1 46  ? 77.311 64.580  22.329  1.00 125.94 ? -28 DG  I C8    1 
ATOM   925   N  N7    . DG  A  1 46  ? 76.564 65.331  23.088  1.00 123.94 ? -28 DG  I N7    1 
ATOM   926   C  C5    . DG  A  1 46  ? 75.841 66.106  22.197  1.00 119.77 ? -28 DG  I C5    1 
ATOM   927   C  C6    . DG  A  1 46  ? 74.867 67.101  22.438  1.00 118.35 ? -28 DG  I C6    1 
ATOM   928   O  O6    . DG  A  1 46  ? 74.432 67.505  23.524  1.00 115.77 ? -28 DG  I O6    1 
ATOM   929   N  N1    . DG  A  1 46  ? 74.385 67.646  21.252  1.00 118.90 ? -28 DG  I N1    1 
ATOM   930   C  C2    . DG  A  1 46  ? 74.791 67.275  19.992  1.00 119.56 ? -28 DG  I C2    1 
ATOM   931   N  N2    . DG  A  1 46  ? 74.212 67.913  18.966  1.00 117.88 ? -28 DG  I N2    1 
ATOM   932   N  N3    . DG  A  1 46  ? 75.704 66.343  19.753  1.00 120.97 ? -28 DG  I N3    1 
ATOM   933   C  C4    . DG  A  1 46  ? 76.182 65.802  20.899  1.00 120.80 ? -28 DG  I C4    1 
ATOM   934   P  P     . DC  A  1 47  ? 80.670 63.300  16.964  1.00 136.81 ? -27 DC  I P     1 
ATOM   935   O  OP1   . DC  A  1 47  ? 80.818 62.292  15.890  1.00 139.03 ? -27 DC  I OP1   1 
ATOM   936   O  OP2   . DC  A  1 47  ? 81.789 63.551  17.900  1.00 138.79 ? -27 DC  I OP2   1 
ATOM   937   O  "O5'" . DC  A  1 47  ? 80.251 64.688  16.293  1.00 135.24 ? -27 DC  I "O5'" 1 
ATOM   938   C  "C5'" . DC  A  1 47  ? 78.895 64.906  15.893  1.00 130.19 ? -27 DC  I "C5'" 1 
ATOM   939   C  "C4'" . DC  A  1 47  ? 78.582 66.392  15.816  1.00 124.99 ? -27 DC  I "C4'" 1 
ATOM   940   O  "O4'" . DC  A  1 47  ? 78.121 66.868  17.116  1.00 122.38 ? -27 DC  I "O4'" 1 
ATOM   941   C  "C3'" . DC  A  1 47  ? 79.771 67.284  15.464  1.00 125.15 ? -27 DC  I "C3'" 1 
ATOM   942   O  "O3'" . DC  A  1 47  ? 79.309 68.455  14.803  1.00 120.91 ? -27 DC  I "O3'" 1 
ATOM   943   C  "C2'" . DC  A  1 47  ? 80.292 67.630  16.847  1.00 125.98 ? -27 DC  I "C2'" 1 
ATOM   944   C  "C1'" . DC  A  1 47  ? 78.970 67.916  17.533  1.00 121.37 ? -27 DC  I "C1'" 1 
ATOM   945   N  N1    . DC  A  1 47  ? 79.032 67.947  19.026  1.00 118.70 ? -27 DC  I N1    1 
ATOM   946   C  C2    . DC  A  1 47  ? 78.079 68.687  19.732  1.00 115.21 ? -27 DC  I C2    1 
ATOM   947   O  O2    . DC  A  1 47  ? 77.206 69.287  19.097  1.00 108.88 ? -27 DC  I O2    1 
ATOM   948   N  N3    . DC  A  1 47  ? 78.137 68.717  21.087  1.00 119.83 ? -27 DC  I N3    1 
ATOM   949   C  C4    . DC  A  1 47  ? 79.099 68.049  21.727  1.00 124.37 ? -27 DC  I C4    1 
ATOM   950   N  N4    . DC  A  1 47  ? 79.120 68.105  23.065  1.00 124.86 ? -27 DC  I N4    1 
ATOM   951   C  C5    . DC  A  1 47  ? 80.084 67.292  21.023  1.00 126.92 ? -27 DC  I C5    1 
ATOM   952   C  C6    . DC  A  1 47  ? 80.015 67.272  19.686  1.00 123.47 ? -27 DC  I C6    1 
ATOM   953   P  P     . DT  A  1 48  ? 79.269 68.545  13.200  1.00 120.05 ? -26 DT  I P     1 
ATOM   954   O  OP1   . DT  A  1 48  ? 78.508 67.375  12.705  1.00 118.07 ? -26 DT  I OP1   1 
ATOM   955   O  OP2   . DT  A  1 48  ? 80.645 68.787  12.714  1.00 121.39 ? -26 DT  I OP2   1 
ATOM   956   O  "O5'" . DT  A  1 48  ? 78.407 69.865  12.927  1.00 112.43 ? -26 DT  I "O5'" 1 
ATOM   957   C  "C5'" . DT  A  1 48  ? 76.990 69.810  13.030  1.00 107.59 ? -26 DT  I "C5'" 1 
ATOM   958   C  "C4'" . DT  A  1 48  ? 76.426 71.043  13.722  1.00 104.85 ? -26 DT  I "C4'" 1 
ATOM   959   O  "O4'" . DT  A  1 48  ? 76.777 71.043  15.130  1.00 108.48 ? -26 DT  I "O4'" 1 
ATOM   960   C  "C3'" . DT  A  1 48  ? 76.890 72.396  13.175  1.00 102.86 ? -26 DT  I "C3'" 1 
ATOM   961   O  "O3'" . DT  A  1 48  ? 75.762 73.253  13.097  1.00 97.06  ? -26 DT  I "O3'" 1 
ATOM   962   C  "C2'" . DT  A  1 48  ? 77.882 72.875  14.244  1.00 107.08 ? -26 DT  I "C2'" 1 
ATOM   963   C  "C1'" . DT  A  1 48  ? 77.206 72.338  15.489  1.00 109.17 ? -26 DT  I "C1'" 1 
ATOM   964   N  N1    . DT  A  1 48  ? 78.071 72.221  16.706  1.00 111.98 ? -26 DT  I N1    1 
ATOM   965   C  C2    . DT  A  1 48  ? 77.615 72.743  17.897  1.00 111.85 ? -26 DT  I C2    1 
ATOM   966   O  O2    . DT  A  1 48  ? 76.556 73.334  18.005  1.00 113.76 ? -26 DT  I O2    1 
ATOM   967   N  N3    . DT  A  1 48  ? 78.455 72.558  18.962  1.00 112.28 ? -26 DT  I N3    1 
ATOM   968   C  C4    . DT  A  1 48  ? 79.673 71.908  18.962  1.00 116.35 ? -26 DT  I C4    1 
ATOM   969   O  O4    . DT  A  1 48  ? 80.356 71.794  19.973  1.00 118.28 ? -26 DT  I O4    1 
ATOM   970   C  C5    . DT  A  1 48  ? 80.089 71.374  17.690  1.00 115.32 ? -26 DT  I C5    1 
ATOM   971   C  C7    . DT  A  1 48  ? 81.400 70.660  17.577  1.00 119.48 ? -26 DT  I C7    1 
ATOM   972   C  C6    . DT  A  1 48  ? 79.275 71.546  16.633  1.00 114.12 ? -26 DT  I C6    1 
ATOM   973   P  P     . DC  A  1 49  ? 75.725 74.487  12.072  1.00 100.54 ? -25 DC  I P     1 
ATOM   974   O  OP1   . DC  A  1 49  ? 74.435 74.417  11.347  1.00 91.84  ? -25 DC  I OP1   1 
ATOM   975   O  OP2   . DC  A  1 49  ? 77.003 74.501  11.324  1.00 107.66 ? -25 DC  I OP2   1 
ATOM   976   O  "O5'" . DC  A  1 49  ? 75.691 75.760  13.034  1.00 98.36  ? -25 DC  I "O5'" 1 
ATOM   977   C  "C5'" . DC  A  1 49  ? 74.854 75.754  14.181  1.00 96.75  ? -25 DC  I "C5'" 1 
ATOM   978   C  "C4'" . DC  A  1 49  ? 75.352 76.744  15.216  1.00 97.97  ? -25 DC  I "C4'" 1 
ATOM   979   O  "O4'" . DC  A  1 49  ? 76.382 76.127  16.037  1.00 103.75 ? -25 DC  I "O4'" 1 
ATOM   980   C  "C3'" . DC  A  1 49  ? 75.985 78.020  14.643  1.00 94.71  ? -25 DC  I "C3'" 1 
ATOM   981   O  "O3'" . DC  A  1 49  ? 75.632 79.133  15.455  1.00 88.57  ? -25 DC  I "O3'" 1 
ATOM   982   C  "C2'" . DC  A  1 49  ? 77.476 77.720  14.772  1.00 100.85 ? -25 DC  I "C2'" 1 
ATOM   983   C  "C1'" . DC  A  1 49  ? 77.464 77.019  16.114  1.00 105.66 ? -25 DC  I "C1'" 1 
ATOM   984   N  N1    . DC  A  1 49  ? 78.709 76.271  16.452  1.00 112.87 ? -25 DC  I N1    1 
ATOM   985   C  C2    . DC  A  1 49  ? 79.025 76.066  17.796  1.00 116.98 ? -25 DC  I C2    1 
ATOM   986   O  O2    . DC  A  1 49  ? 78.255 76.504  18.658  1.00 118.52 ? -25 DC  I O2    1 
ATOM   987   N  N3    . DC  A  1 49  ? 80.156 75.389  18.113  1.00 120.07 ? -25 DC  I N3    1 
ATOM   988   C  C4    . DC  A  1 49  ? 80.953 74.935  17.142  1.00 118.00 ? -25 DC  I C4    1 
ATOM   989   N  N4    . DC  A  1 49  ? 82.059 74.273  17.500  1.00 116.84 ? -25 DC  I N4    1 
ATOM   990   C  C5    . DC  A  1 49  ? 80.648 75.140  15.762  1.00 117.34 ? -25 DC  I C5    1 
ATOM   991   C  C6    . DC  A  1 49  ? 79.527 75.809  15.465  1.00 114.91 ? -25 DC  I C6    1 
ATOM   992   P  P     . DC  A  1 50  ? 74.238 79.908  15.251  1.00 86.71  ? -24 DC  I P     1 
ATOM   993   O  OP1   . DC  A  1 50  ? 73.148 78.914  15.137  1.00 85.37  ? -24 DC  I OP1   1 
ATOM   994   O  OP2   . DC  A  1 50  ? 74.431 80.909  14.179  1.00 94.23  ? -24 DC  I OP2   1 
ATOM   995   O  "O5'" . DC  A  1 50  ? 74.051 80.689  16.634  1.00 87.19  ? -24 DC  I "O5'" 1 
ATOM   996   C  "C5'" . DC  A  1 50  ? 73.682 79.970  17.805  1.00 87.75  ? -24 DC  I "C5'" 1 
ATOM   997   C  "C4'" . DC  A  1 50  ? 74.461 80.451  19.020  1.00 88.58  ? -24 DC  I "C4'" 1 
ATOM   998   O  "O4'" . DC  A  1 50  ? 75.722 79.739  19.120  1.00 94.36  ? -24 DC  I "O4'" 1 
ATOM   999   C  "C3'" . DC  A  1 50  ? 74.814 81.942  19.037  1.00 90.49  ? -24 DC  I "C3'" 1 
ATOM   1000  O  "O3'" . DC  A  1 50  ? 74.516 82.476  20.320  1.00 90.06  ? -24 DC  I "O3'" 1 
ATOM   1001  C  "C2'" . DC  A  1 50  ? 76.322 81.948  18.761  1.00 95.02  ? -24 DC  I "C2'" 1 
ATOM   1002  C  "C1'" . DC  A  1 50  ? 76.738 80.659  19.440  1.00 97.39  ? -24 DC  I "C1'" 1 
ATOM   1003  N  N1    . DC  A  1 50  ? 78.042 80.107  18.973  1.00 102.49 ? -24 DC  I N1    1 
ATOM   1004  C  C2    . DC  A  1 50  ? 78.982 79.681  19.915  1.00 111.04 ? -24 DC  I C2    1 
ATOM   1005  O  O2    . DC  A  1 50  ? 78.710 79.784  21.117  1.00 115.79 ? -24 DC  I O2    1 
ATOM   1006  N  N3    . DC  A  1 50  ? 80.162 79.170  19.482  1.00 112.72 ? -24 DC  I N3    1 
ATOM   1007  C  C4    . DC  A  1 50  ? 80.408 79.079  18.174  1.00 108.27 ? -24 DC  I C4    1 
ATOM   1008  N  N4    . DC  A  1 50  ? 81.583 78.569  17.790  1.00 110.74 ? -24 DC  I N4    1 
ATOM   1009  C  C5    . DC  A  1 50  ? 79.461 79.509  17.200  1.00 105.34 ? -24 DC  I C5    1 
ATOM   1010  C  C6    . DC  A  1 50  ? 78.301 80.009  17.639  1.00 102.72 ? -24 DC  I C6    1 
ATOM   1011  P  P     . DA  A  1 51  ? 74.459 84.063  20.558  1.00 90.67  ? -23 DA  I P     1 
ATOM   1012  O  OP1   . DA  A  1 51  ? 73.098 84.387  21.037  1.00 78.96  ? -23 DA  I OP1   1 
ATOM   1013  O  OP2   . DA  A  1 51  ? 74.984 84.745  19.355  1.00 97.33  ? -23 DA  I OP2   1 
ATOM   1014  O  "O5'" . DA  A  1 51  ? 75.490 84.294  21.757  1.00 92.16  ? -23 DA  I "O5'" 1 
ATOM   1015  C  "C5'" . DA  A  1 51  ? 75.358 83.534  22.952  1.00 94.48  ? -23 DA  I "C5'" 1 
ATOM   1016  C  "C4'" . DA  A  1 51  ? 76.549 83.735  23.875  1.00 95.95  ? -23 DA  I "C4'" 1 
ATOM   1017  O  "O4'" . DA  A  1 51  ? 77.695 82.997  23.381  1.00 97.06  ? -23 DA  I "O4'" 1 
ATOM   1018  C  "C3'" . DA  A  1 51  ? 77.015 85.174  24.045  1.00 98.52  ? -23 DA  I "C3'" 1 
ATOM   1019  O  "O3'" . DA  A  1 51  ? 77.430 85.361  25.387  1.00 104.69 ? -23 DA  I "O3'" 1 
ATOM   1020  C  "C2'" . DA  A  1 51  ? 78.187 85.274  23.063  1.00 98.69  ? -23 DA  I "C2'" 1 
ATOM   1021  C  "C1'" . DA  A  1 51  ? 78.780 83.874  23.146  1.00 104.68 ? -23 DA  I "C1'" 1 
ATOM   1022  N  N9    . DA  A  1 51  ? 79.441 83.427  21.922  1.00 118.45 ? -23 DA  I N9    1 
ATOM   1023  C  C8    . DA  A  1 51  ? 78.951 83.502  20.647  1.00 119.24 ? -23 DA  I C8    1 
ATOM   1024  N  N7    . DA  A  1 51  ? 79.750 82.989  19.741  1.00 121.37 ? -23 DA  I N7    1 
ATOM   1025  C  C5    . DA  A  1 51  ? 80.834 82.533  20.473  1.00 124.97 ? -23 DA  I C5    1 
ATOM   1026  C  C6    . DA  A  1 51  ? 82.028 81.886  20.096  1.00 134.02 ? -23 DA  I C6    1 
ATOM   1027  N  N6    . DA  A  1 51  ? 82.326 81.581  18.830  1.00 135.89 ? -23 DA  I N6    1 
ATOM   1028  N  N1    . DA  A  1 51  ? 82.904 81.565  21.073  1.00 139.30 ? -23 DA  I N1    1 
ATOM   1029  C  C2    . DA  A  1 51  ? 82.598 81.874  22.339  1.00 137.18 ? -23 DA  I C2    1 
ATOM   1030  N  N3    . DA  A  1 51  ? 81.508 82.481  22.815  1.00 131.25 ? -23 DA  I N3    1 
ATOM   1031  C  C4    . DA  A  1 51  ? 80.658 82.787  21.820  1.00 124.82 ? -23 DA  I C4    1 
ATOM   1032  P  P     . DT  A  1 52  ? 77.683 86.831  25.979  1.00 104.00 ? -22 DT  I P     1 
ATOM   1033  O  OP1   . DT  A  1 52  ? 76.933 86.932  27.252  1.00 98.72  ? -22 DT  I OP1   1 
ATOM   1034  O  OP2   . DT  A  1 52  ? 77.441 87.818  24.903  1.00 103.62 ? -22 DT  I OP2   1 
ATOM   1035  O  "O5'" . DT  A  1 52  ? 79.245 86.820  26.304  1.00 111.46 ? -22 DT  I "O5'" 1 
ATOM   1036  C  "C5'" . DT  A  1 52  ? 79.957 85.587  26.272  1.00 118.40 ? -22 DT  I "C5'" 1 
ATOM   1037  C  "C4'" . DT  A  1 52  ? 81.450 85.832  26.238  1.00 128.25 ? -22 DT  I "C4'" 1 
ATOM   1038  O  "O4'" . DT  A  1 52  ? 82.018 85.245  25.036  1.00 130.98 ? -22 DT  I "O4'" 1 
ATOM   1039  C  "C3'" . DT  A  1 52  ? 81.855 87.304  26.234  1.00 133.67 ? -22 DT  I "C3'" 1 
ATOM   1040  O  "O3'" . DT  A  1 52  ? 82.922 87.505  27.151  1.00 144.06 ? -22 DT  I "O3'" 1 
ATOM   1041  C  "C2'" . DT  A  1 52  ? 82.282 87.550  24.784  1.00 133.05 ? -22 DT  I "C2'" 1 
ATOM   1042  C  "C1'" . DT  A  1 52  ? 82.835 86.189  24.386  1.00 135.87 ? -22 DT  I "C1'" 1 
ATOM   1043  N  N1    . DT  A  1 52  ? 82.780 85.928  22.910  1.00 140.44 ? -22 DT  I N1    1 
ATOM   1044  C  C2    . DT  A  1 52  ? 83.804 85.227  22.302  1.00 146.42 ? -22 DT  I C2    1 
ATOM   1045  O  O2    . DT  A  1 52  ? 84.771 84.798  22.905  1.00 151.72 ? -22 DT  I O2    1 
ATOM   1046  N  N3    . DT  A  1 52  ? 83.649 85.047  20.947  1.00 147.27 ? -22 DT  I N3    1 
ATOM   1047  C  C4    . DT  A  1 52  ? 82.598 85.488  20.162  1.00 145.18 ? -22 DT  I C4    1 
ATOM   1048  O  O4    . DT  A  1 52  ? 82.545 85.278  18.953  1.00 145.81 ? -22 DT  I O4    1 
ATOM   1049  C  C5    . DT  A  1 52  ? 81.564 86.214  20.863  1.00 140.33 ? -22 DT  I C5    1 
ATOM   1050  C  C7    . DT  A  1 52  ? 80.376 86.740  20.115  1.00 136.42 ? -22 DT  I C7    1 
ATOM   1051  C  C6    . DT  A  1 52  ? 81.704 86.397  22.184  1.00 139.48 ? -22 DT  I C6    1 
ATOM   1052  P  P     . DC  A  1 53  ? 83.188 88.954  27.794  1.00 140.97 ? -21 DC  I P     1 
ATOM   1053  O  OP1   . DC  A  1 53  ? 83.071 88.834  29.264  1.00 142.36 ? -21 DC  I OP1   1 
ATOM   1054  O  OP2   . DC  A  1 53  ? 82.364 89.941  27.061  1.00 134.45 ? -21 DC  I OP2   1 
ATOM   1055  O  "O5'" . DC  A  1 53  ? 84.713 89.230  27.428  1.00 147.66 ? -21 DC  I "O5'" 1 
ATOM   1056  C  "C5'" . DC  A  1 53  ? 85.193 88.815  26.172  1.00 149.75 ? -21 DC  I "C5'" 1 
ATOM   1057  C  "C4'" . DC  A  1 53  ? 86.560 88.185  26.288  1.00 156.07 ? -21 DC  I "C4'" 1 
ATOM   1058  O  "O4'" . DC  A  1 53  ? 86.750 87.267  25.186  1.00 158.50 ? -21 DC  I "O4'" 1 
ATOM   1059  C  "C3'" . DC  A  1 53  ? 87.696 89.172  26.164  1.00 156.48 ? -21 DC  I "C3'" 1 
ATOM   1060  O  "O3'" . DC  A  1 53  ? 88.877 88.638  26.737  1.00 150.08 ? -21 DC  I "O3'" 1 
ATOM   1061  C  "C2'" . DC  A  1 53  ? 87.814 89.315  24.652  1.00 160.06 ? -21 DC  I "C2'" 1 
ATOM   1062  C  "C1'" . DC  A  1 53  ? 87.502 87.899  24.164  1.00 161.64 ? -21 DC  I "C1'" 1 
ATOM   1063  N  N1    . DC  A  1 53  ? 86.707 87.864  22.891  1.00 161.13 ? -21 DC  I N1    1 
ATOM   1064  C  C2    . DC  A  1 53  ? 87.280 87.333  21.730  1.00 163.24 ? -21 DC  I C2    1 
ATOM   1065  O  O2    . DC  A  1 53  ? 88.436 86.898  21.780  1.00 167.25 ? -21 DC  I O2    1 
ATOM   1066  N  N3    . DC  A  1 53  ? 86.547 87.312  20.587  1.00 159.76 ? -21 DC  I N3    1 
ATOM   1067  C  C4    . DC  A  1 53  ? 85.302 87.793  20.582  1.00 155.21 ? -21 DC  I C4    1 
ATOM   1068  N  N4    . DC  A  1 53  ? 84.615 87.754  19.435  1.00 153.12 ? -21 DC  I N4    1 
ATOM   1069  C  C5    . DC  A  1 53  ? 84.705 88.340  21.753  1.00 153.98 ? -21 DC  I C5    1 
ATOM   1070  C  C6    . DC  A  1 53  ? 85.435 88.355  22.871  1.00 157.29 ? -21 DC  I C6    1 
ATOM   1071  P  P     . DA  A  1 54  ? 90.083 89.622  27.135  1.00 155.82 ? -20 DA  I P     1 
ATOM   1072  O  OP1   . DA  A  1 54  ? 90.910 88.945  28.158  1.00 157.26 ? -20 DA  I OP1   1 
ATOM   1073  O  OP2   . DA  A  1 54  ? 89.492 90.947  27.423  1.00 150.43 ? -20 DA  I OP2   1 
ATOM   1074  O  "O5'" . DA  A  1 54  ? 90.924 89.752  25.783  1.00 156.80 ? -20 DA  I "O5'" 1 
ATOM   1075  C  "C5'" . DA  A  1 54  ? 91.229 88.589  25.025  1.00 158.27 ? -20 DA  I "C5'" 1 
ATOM   1076  C  "C4'" . DA  A  1 54  ? 92.159 88.925  23.875  1.00 162.13 ? -20 DA  I "C4'" 1 
ATOM   1077  O  "O4'" . DA  A  1 54  ? 91.445 88.847  22.614  1.00 160.12 ? -20 DA  I "O4'" 1 
ATOM   1078  C  "C3'" . DA  A  1 54  ? 92.779 90.312  23.928  1.00 166.14 ? -20 DA  I "C3'" 1 
ATOM   1079  O  "O3'" . DA  A  1 54  ? 94.144 90.224  23.481  1.00 173.64 ? -20 DA  I "O3'" 1 
ATOM   1080  C  "C2'" . DA  A  1 54  ? 91.872 91.135  22.999  1.00 162.06 ? -20 DA  I "C2'" 1 
ATOM   1081  C  "C1'" . DA  A  1 54  ? 91.445 90.104  21.960  1.00 161.26 ? -20 DA  I "C1'" 1 
ATOM   1082  N  N9    . DA  A  1 54  ? 90.101 90.312  21.417  1.00 159.71 ? -20 DA  I N9    1 
ATOM   1083  C  C8    . DA  A  1 54  ? 89.015 90.825  22.067  1.00 158.62 ? -20 DA  I C8    1 
ATOM   1084  N  N7    . DA  A  1 54  ? 87.923 90.857  21.336  1.00 155.05 ? -20 DA  I N7    1 
ATOM   1085  C  C5    . DA  A  1 54  ? 88.320 90.323  20.122  1.00 156.48 ? -20 DA  I C5    1 
ATOM   1086  C  C6    . DA  A  1 54  ? 87.629 90.084  18.912  1.00 154.68 ? -20 DA  I C6    1 
ATOM   1087  N  N6    . DA  A  1 54  ? 86.334 90.368  18.729  1.00 149.58 ? -20 DA  I N6    1 
ATOM   1088  N  N1    . DA  A  1 54  ? 88.327 89.538  17.893  1.00 157.86 ? -20 DA  I N1    1 
ATOM   1089  C  C2    . DA  A  1 54  ? 89.621 89.254  18.078  1.00 162.48 ? -20 DA  I C2    1 
ATOM   1090  N  N3    . DA  A  1 54  ? 90.374 89.432  19.163  1.00 163.47 ? -20 DA  I N3    1 
ATOM   1091  C  C4    . DA  A  1 54  ? 89.658 89.975  20.157  1.00 159.84 ? -20 DA  I C4    1 
ATOM   1092  P  P     . DA  A  1 55  ? 94.865 91.413  22.676  1.00 175.47 ? -19 DA  I P     1 
ATOM   1093  O  OP1   . DA  A  1 55  ? 96.308 91.088  22.650  1.00 179.71 ? -19 DA  I OP1   1 
ATOM   1094  O  OP2   . DA  A  1 55  ? 94.440 92.716  23.237  1.00 173.28 ? -19 DA  I OP2   1 
ATOM   1095  O  "O5'" . DA  A  1 55  ? 94.304 91.244  21.189  1.00 177.65 ? -19 DA  I "O5'" 1 
ATOM   1096  C  "C5'" . DA  A  1 55  ? 95.161 91.415  20.081  1.00 183.85 ? -19 DA  I "C5'" 1 
ATOM   1097  C  "C4'" . DA  A  1 55  ? 94.843 92.711  19.373  1.00 184.69 ? -19 DA  I "C4'" 1 
ATOM   1098  O  "O4'" . DA  A  1 55  ? 93.425 92.746  19.058  1.00 177.00 ? -19 DA  I "O4'" 1 
ATOM   1099  C  "C3'" . DA  A  1 55  ? 95.125 93.974  20.197  1.00 191.64 ? -19 DA  I "C3'" 1 
ATOM   1100  O  "O3'" . DA  A  1 55  ? 95.753 94.950  19.382  1.00 203.40 ? -19 DA  I "O3'" 1 
ATOM   1101  C  "C2'" . DA  A  1 55  ? 93.731 94.421  20.635  1.00 182.73 ? -19 DA  I "C2'" 1 
ATOM   1102  C  "C1'" . DA  A  1 55  ? 92.918 94.001  19.428  1.00 173.90 ? -19 DA  I "C1'" 1 
ATOM   1103  N  N9    . DA  A  1 55  ? 91.478 93.905  19.667  1.00 163.83 ? -19 DA  I N9    1 
ATOM   1104  C  C8    . DA  A  1 55  ? 90.815 94.110  20.847  1.00 161.40 ? -19 DA  I C8    1 
ATOM   1105  N  N7    . DA  A  1 55  ? 89.512 93.970  20.751  1.00 158.25 ? -19 DA  I N7    1 
ATOM   1106  C  C5    . DA  A  1 55  ? 89.307 93.662  19.414  1.00 156.11 ? -19 DA  I C5    1 
ATOM   1107  C  C6    . DA  A  1 55  ? 88.141 93.394  18.663  1.00 147.71 ? -19 DA  I C6    1 
ATOM   1108  N  N6    . DA  A  1 55  ? 86.911 93.395  19.188  1.00 141.10 ? -19 DA  I N6    1 
ATOM   1109  N  N1    . DA  A  1 55  ? 88.293 93.121  17.346  1.00 146.80 ? -19 DA  I N1    1 
ATOM   1110  C  C2    . DA  A  1 55  ? 89.529 93.122  16.832  1.00 152.01 ? -19 DA  I C2    1 
ATOM   1111  N  N3    . DA  A  1 55  ? 90.691 93.358  17.434  1.00 157.51 ? -19 DA  I N3    1 
ATOM   1112  C  C4    . DA  A  1 55  ? 90.509 93.623  18.735  1.00 159.11 ? -19 DA  I C4    1 
ATOM   1113  P  P     . DA  A  1 56  ? 97.116 95.650  19.864  1.00 207.02 ? -18 DA  I P     1 
ATOM   1114  O  OP1   . DA  A  1 56  ? 98.131 94.585  20.025  1.00 212.79 ? -18 DA  I OP1   1 
ATOM   1115  O  OP2   . DA  A  1 56  ? 96.792 96.538  21.003  1.00 210.59 ? -18 DA  I OP2   1 
ATOM   1116  O  "O5'" . DA  A  1 56  ? 97.531 96.572  18.625  1.00 207.94 ? -18 DA  I "O5'" 1 
ATOM   1117  C  "C5'" . DA  A  1 56  ? 96.539 97.313  17.926  1.00 201.51 ? -18 DA  I "C5'" 1 
ATOM   1118  C  "C4'" . DA  A  1 56  ? 96.191 96.637  16.612  1.00 197.66 ? -18 DA  I "C4'" 1 
ATOM   1119  O  "O4'" . DA  A  1 56  ? 94.905 95.969  16.732  1.00 191.65 ? -18 DA  I "O4'" 1 
ATOM   1120  C  "C3'" . DA  A  1 56  ? 96.010 97.576  15.438  1.00 195.31 ? -18 DA  I "C3'" 1 
ATOM   1121  O  "O3'" . DA  A  1 56  ? 96.139 96.829  14.239  1.00 192.89 ? -18 DA  I "O3'" 1 
ATOM   1122  C  "C2'" . DA  A  1 56  ? 94.570 98.017  15.654  1.00 189.23 ? -18 DA  I "C2'" 1 
ATOM   1123  C  "C1'" . DA  A  1 56  ? 93.941 96.667  15.954  1.00 184.64 ? -18 DA  I "C1'" 1 
ATOM   1124  N  N9    . DA  A  1 56  ? 92.691 96.704  16.712  1.00 173.85 ? -18 DA  I N9    1 
ATOM   1125  C  C8    . DA  A  1 56  ? 92.562 96.851  18.062  1.00 170.94 ? -18 DA  I C8    1 
ATOM   1126  N  N7    . DA  A  1 56  ? 91.323 96.798  18.487  1.00 165.79 ? -18 DA  I N7    1 
ATOM   1127  C  C5    . DA  A  1 56  ? 90.583 96.601  17.336  1.00 160.37 ? -18 DA  I C5    1 
ATOM   1128  C  C6    . DA  A  1 56  ? 89.199 96.463  17.113  1.00 149.73 ? -18 DA  I C6    1 
ATOM   1129  N  N6    . DA  A  1 56  ? 88.290 96.514  18.092  1.00 143.26 ? -18 DA  I N6    1 
ATOM   1130  N  N1    . DA  A  1 56  ? 88.783 96.280  15.844  1.00 147.81 ? -18 DA  I N1    1 
ATOM   1131  C  C2    . DA  A  1 56  ? 89.698 96.229  14.865  1.00 151.34 ? -18 DA  I C2    1 
ATOM   1132  N  N3    . DA  A  1 56  ? 91.027 96.345  14.952  1.00 157.63 ? -18 DA  I N3    1 
ATOM   1133  C  C4    . DA  A  1 56  ? 91.408 96.528  16.229  1.00 163.92 ? -18 DA  I C4    1 
ATOM   1134  P  P     . DA  A  1 57  ? 96.854 97.461  12.949  1.00 205.82 ? -17 DA  I P     1 
ATOM   1135  O  OP1   . DA  A  1 57  ? 97.426 96.345  12.163  1.00 208.49 ? -17 DA  I OP1   1 
ATOM   1136  O  OP2   . DA  A  1 57  ? 97.728 98.563  13.407  1.00 208.94 ? -17 DA  I OP2   1 
ATOM   1137  O  "O5'" . DA  A  1 57  ? 95.646 98.106  12.129  1.00 198.60 ? -17 DA  I "O5'" 1 
ATOM   1138  C  "C5'" . DA  A  1 57  ? 94.443 97.371  11.925  1.00 190.97 ? -17 DA  I "C5'" 1 
ATOM   1139  C  "C4'" . DA  A  1 57  ? 93.624 98.016  10.826  1.00 184.93 ? -17 DA  I "C4'" 1 
ATOM   1140  O  "O4'" . DA  A  1 57  ? 92.239 98.126  11.235  1.00 176.93 ? -17 DA  I "O4'" 1 
ATOM   1141  C  "C3'" . DA  A  1 57  ? 94.061 99.423  10.468  1.00 187.93 ? -17 DA  I "C3'" 1 
ATOM   1142  O  "O3'" . DA  A  1 57  ? 93.846 99.657  9.086   1.00 190.65 ? -17 DA  I "O3'" 1 
ATOM   1143  C  "C2'" . DA  A  1 57  ? 93.179 100.308 11.358  1.00 182.61 ? -17 DA  I "C2'" 1 
ATOM   1144  C  "C1'" . DA  A  1 57  ? 91.917 99.468  11.565  1.00 172.78 ? -17 DA  I "C1'" 1 
ATOM   1145  N  N9    . DA  A  1 57  ? 91.435 99.478  12.943  1.00 161.71 ? -17 DA  I N9    1 
ATOM   1146  C  C8    . DA  A  1 57  ? 92.199 99.486  14.071  1.00 162.17 ? -17 DA  I C8    1 
ATOM   1147  N  N7    . DA  A  1 57  ? 91.509 99.471  15.183  1.00 160.56 ? -17 DA  I N7    1 
ATOM   1148  C  C5    . DA  A  1 57  ? 90.195 99.452  14.758  1.00 154.93 ? -17 DA  I C5    1 
ATOM   1149  C  C6    . DA  A  1 57  ? 88.976 99.431  15.458  1.00 146.25 ? -17 DA  I C6    1 
ATOM   1150  N  N6    . DA  A  1 57  ? 88.898 99.430  16.792  1.00 143.15 ? -17 DA  I N6    1 
ATOM   1151  N  N1    . DA  A  1 57  ? 87.838 99.413  14.735  1.00 141.15 ? -17 DA  I N1    1 
ATOM   1152  C  C2    . DA  A  1 57  ? 87.922 99.416  13.398  1.00 139.34 ? -17 DA  I C2    1 
ATOM   1153  N  N3    . DA  A  1 57  ? 89.012 99.434  12.627  1.00 144.22 ? -17 DA  I N3    1 
ATOM   1154  C  C4    . DA  A  1 57  ? 90.126 99.451  13.377  1.00 153.30 ? -17 DA  I C4    1 
ATOM   1155  P  P     . DG  A  1 58  ? 94.113 101.107 8.452   1.00 180.86 ? -16 DG  I P     1 
ATOM   1156  O  OP1   . DG  A  1 58  ? 94.554 100.909 7.054   1.00 181.64 ? -16 DG  I OP1   1 
ATOM   1157  O  OP2   . DG  A  1 58  ? 94.964 101.885 9.381   1.00 184.85 ? -16 DG  I OP2   1 
ATOM   1158  O  "O5'" . DG  A  1 58  ? 92.660 101.759 8.437   1.00 177.27 ? -16 DG  I "O5'" 1 
ATOM   1159  C  "C5'" . DG  A  1 58  ? 91.536 100.942 8.146   1.00 172.01 ? -16 DG  I "C5'" 1 
ATOM   1160  C  "C4'" . DG  A  1 58  ? 90.254 101.650 8.518   1.00 165.10 ? -16 DG  I "C4'" 1 
ATOM   1161  O  "O4'" . DG  A  1 58  ? 90.122 101.692 9.966   1.00 163.71 ? -16 DG  I "O4'" 1 
ATOM   1162  C  "C3'" . DG  A  1 58  ? 90.169 103.104 8.041   1.00 162.35 ? -16 DG  I "C3'" 1 
ATOM   1163  O  "O3'" . DG  A  1 58  ? 88.869 103.371 7.542   1.00 151.91 ? -16 DG  I "O3'" 1 
ATOM   1164  C  "C2'" . DG  A  1 58  ? 90.438 103.892 9.322   1.00 164.43 ? -16 DG  I "C2'" 1 
ATOM   1165  C  "C1'" . DG  A  1 58  ? 89.755 102.994 10.335  1.00 161.06 ? -16 DG  I "C1'" 1 
ATOM   1166  N  N9    . DG  A  1 58  ? 90.138 103.244 11.724  1.00 159.25 ? -16 DG  I N9    1 
ATOM   1167  C  C8    . DG  A  1 58  ? 91.373 103.617 12.197  1.00 162.54 ? -16 DG  I C8    1 
ATOM   1168  N  N7    . DG  A  1 58  ? 91.405 103.776 13.493  1.00 162.83 ? -16 DG  I N7    1 
ATOM   1169  C  C5    . DG  A  1 58  ? 90.107 103.494 13.904  1.00 158.57 ? -16 DG  I C5    1 
ATOM   1170  C  C6    . DG  A  1 58  ? 89.534 103.499 15.200  1.00 155.47 ? -16 DG  I C6    1 
ATOM   1171  O  O6    . DG  A  1 58  ? 90.079 103.763 16.282  1.00 157.13 ? -16 DG  I O6    1 
ATOM   1172  N  N1    . DG  A  1 58  ? 88.184 103.154 15.168  1.00 151.29 ? -16 DG  I N1    1 
ATOM   1173  C  C2    . DG  A  1 58  ? 87.480 102.843 14.028  1.00 149.24 ? -16 DG  I C2    1 
ATOM   1174  N  N2    . DG  A  1 58  ? 86.188 102.533 14.184  1.00 146.57 ? -16 DG  I N2    1 
ATOM   1175  N  N3    . DG  A  1 58  ? 88.006 102.834 12.813  1.00 150.37 ? -16 DG  I N3    1 
ATOM   1176  C  C4    . DG  A  1 58  ? 89.317 103.169 12.826  1.00 155.63 ? -16 DG  I C4    1 
ATOM   1177  P  P     . DG  A  1 59  ? 88.512 103.142 5.992   1.00 158.87 ? -15 DG  I P     1 
ATOM   1178  O  OP1   . DG  A  1 59  ? 89.286 101.980 5.501   1.00 158.36 ? -15 DG  I OP1   1 
ATOM   1179  O  OP2   . DG  A  1 59  ? 88.637 104.445 5.301   1.00 154.75 ? -15 DG  I OP2   1 
ATOM   1180  O  "O5'" . DG  A  1 59  ? 86.963 102.749 6.033   1.00 151.13 ? -15 DG  I "O5'" 1 
ATOM   1181  C  "C5'" . DG  A  1 59  ? 86.548 101.621 6.796   1.00 145.12 ? -15 DG  I "C5'" 1 
ATOM   1182  C  "C4'" . DG  A  1 59  ? 85.173 101.833 7.415   1.00 137.81 ? -15 DG  I "C4'" 1 
ATOM   1183  O  "O4'" . DG  A  1 59  ? 85.296 102.262 8.796   1.00 137.59 ? -15 DG  I "O4'" 1 
ATOM   1184  C  "C3'" . DG  A  1 59  ? 84.287 102.861 6.736   1.00 134.68 ? -15 DG  I "C3'" 1 
ATOM   1185  O  "O3'" . DG  A  1 59  ? 82.940 102.408 6.805   1.00 127.80 ? -15 DG  I "O3'" 1 
ATOM   1186  C  "C2'" . DG  A  1 59  ? 84.523 104.130 7.570   1.00 136.79 ? -15 DG  I "C2'" 1 
ATOM   1187  C  "C1'" . DG  A  1 59  ? 84.762 103.566 8.970   1.00 136.76 ? -15 DG  I "C1'" 1 
ATOM   1188  N  N9    . DG  A  1 59  ? 85.737 104.313 9.763   1.00 139.66 ? -15 DG  I N9    1 
ATOM   1189  C  C8    . DG  A  1 59  ? 86.995 104.677 9.365   1.00 144.28 ? -15 DG  I C8    1 
ATOM   1190  N  N7    . DG  A  1 59  ? 87.674 105.299 10.282  1.00 148.10 ? -15 DG  I N7    1 
ATOM   1191  C  C5    . DG  A  1 59  ? 86.825 105.336 11.374  1.00 145.47 ? -15 DG  I C5    1 
ATOM   1192  C  C6    . DG  A  1 59  ? 87.030 105.888 12.655  1.00 145.66 ? -15 DG  I C6    1 
ATOM   1193  O  O6    . DG  A  1 59  ? 88.036 106.465 13.084  1.00 150.80 ? -15 DG  I O6    1 
ATOM   1194  N  N1    . DG  A  1 59  ? 85.920 105.725 13.474  1.00 138.84 ? -15 DG  I N1    1 
ATOM   1195  C  C2    . DG  A  1 59  ? 84.753 105.100 13.104  1.00 132.14 ? -15 DG  I C2    1 
ATOM   1196  N  N2    . DG  A  1 59  ? 83.791 105.043 14.042  1.00 127.17 ? -15 DG  I N2    1 
ATOM   1197  N  N3    . DG  A  1 59  ? 84.542 104.572 11.895  1.00 133.88 ? -15 DG  I N3    1 
ATOM   1198  C  C4    . DG  A  1 59  ? 85.624 104.727 11.083  1.00 139.77 ? -15 DG  I C4    1 
ATOM   1199  P  P     . DC  A  1 60  ? 81.725 103.323 6.295   1.00 124.03 ? -14 DC  I P     1 
ATOM   1200  O  OP1   . DC  A  1 60  ? 80.634 102.409 5.886   1.00 123.90 ? -14 DC  I OP1   1 
ATOM   1201  O  OP2   . DC  A  1 60  ? 82.252 104.319 5.336   1.00 123.75 ? -14 DC  I OP2   1 
ATOM   1202  O  "O5'" . DC  A  1 60  ? 81.263 104.085 7.617   1.00 120.10 ? -14 DC  I "O5'" 1 
ATOM   1203  C  "C5'" . DC  A  1 60  ? 81.114 103.359 8.830   1.00 116.90 ? -14 DC  I "C5'" 1 
ATOM   1204  C  "C4'" . DC  A  1 60  ? 80.682 104.275 9.958   1.00 115.08 ? -14 DC  I "C4'" 1 
ATOM   1205  O  "O4'" . DC  A  1 60  ? 81.822 105.036 10.436  1.00 119.16 ? -14 DC  I "O4'" 1 
ATOM   1206  C  "C3'" . DC  A  1 60  ? 79.624 105.307 9.581   1.00 110.66 ? -14 DC  I "C3'" 1 
ATOM   1207  O  "O3'" . DC  A  1 60  ? 78.771 105.522 10.684  1.00 111.13 ? -14 DC  I "O3'" 1 
ATOM   1208  C  "C2'" . DC  A  1 60  ? 80.463 106.547 9.283   1.00 114.30 ? -14 DC  I "C2'" 1 
ATOM   1209  C  "C1'" . DC  A  1 60  ? 81.537 106.416 10.349  1.00 121.38 ? -14 DC  I "C1'" 1 
ATOM   1210  N  N1    . DC  A  1 60  ? 82.801 107.136 10.039  1.00 129.99 ? -14 DC  I N1    1 
ATOM   1211  C  C2    . DC  A  1 60  ? 83.562 107.646 11.089  1.00 133.11 ? -14 DC  I C2    1 
ATOM   1212  O  O2    . DC  A  1 60  ? 83.152 107.490 12.244  1.00 131.35 ? -14 DC  I O2    1 
ATOM   1213  N  N3    . DC  A  1 60  ? 84.719 108.294 10.811  1.00 139.24 ? -14 DC  I N3    1 
ATOM   1214  C  C4    . DC  A  1 60  ? 85.115 108.435 9.544   1.00 140.83 ? -14 DC  I C4    1 
ATOM   1215  N  N4    . DC  A  1 60  ? 86.264 109.082 9.315   1.00 146.06 ? -14 DC  I N4    1 
ATOM   1216  C  C5    . DC  A  1 60  ? 84.350 107.918 8.455   1.00 135.87 ? -14 DC  I C5    1 
ATOM   1217  C  C6    . DC  A  1 60  ? 83.211 107.279 8.747   1.00 132.38 ? -14 DC  I C6    1 
ATOM   1218  P  P     . DA  A  1 61  ? 77.232 105.916 10.459  1.00 90.15  ? -13 DA  I P     1 
ATOM   1219  O  OP1   . DA  A  1 61  ? 76.473 104.664 10.240  1.00 84.59  ? -13 DA  I OP1   1 
ATOM   1220  O  OP2   . DA  A  1 61  ? 77.185 106.994 9.445   1.00 92.79  ? -13 DA  I OP2   1 
ATOM   1221  O  "O5'" . DA  A  1 61  ? 76.806 106.536 11.868  1.00 95.31  ? -13 DA  I "O5'" 1 
ATOM   1222  C  "C5'" . DA  A  1 61  ? 77.083 105.817 13.060  1.00 100.63 ? -13 DA  I "C5'" 1 
ATOM   1223  C  "C4'" . DA  A  1 61  ? 77.545 106.747 14.169  1.00 105.00 ? -13 DA  I "C4'" 1 
ATOM   1224  O  "O4'" . DA  A  1 61  ? 78.845 107.305 13.844  1.00 110.48 ? -13 DA  I "O4'" 1 
ATOM   1225  C  "C3'" . DA  A  1 61  ? 76.633 107.937 14.446  1.00 103.63 ? -13 DA  I "C3'" 1 
ATOM   1226  O  "O3'" . DA  A  1 61  ? 76.577 108.159 15.844  1.00 101.28 ? -13 DA  I "O3'" 1 
ATOM   1227  C  "C2'" . DA  A  1 61  ? 77.332 109.085 13.716  1.00 108.10 ? -13 DA  I "C2'" 1 
ATOM   1228  C  "C1'" . DA  A  1 61  ? 78.793 108.716 13.911  1.00 113.69 ? -13 DA  I "C1'" 1 
ATOM   1229  N  N9    . DA  A  1 61  ? 79.695 109.241 12.888  1.00 120.67 ? -13 DA  I N9    1 
ATOM   1230  C  C8    . DA  A  1 61  ? 79.637 109.011 11.542  1.00 120.73 ? -13 DA  I C8    1 
ATOM   1231  N  N7    . DA  A  1 61  ? 80.601 109.589 10.864  1.00 120.93 ? -13 DA  I N7    1 
ATOM   1232  C  C5    . DA  A  1 61  ? 81.349 110.236 11.834  1.00 124.86 ? -13 DA  I C5    1 
ATOM   1233  C  C6    . DA  A  1 61  ? 82.510 111.033 11.765  1.00 132.40 ? -13 DA  I C6    1 
ATOM   1234  N  N6    . DA  A  1 61  ? 83.140 111.319 10.621  1.00 135.56 ? -13 DA  I N6    1 
ATOM   1235  N  N1    . DA  A  1 61  ? 83.000 111.525 12.923  1.00 136.17 ? -13 DA  I N1    1 
ATOM   1236  C  C2    . DA  A  1 61  ? 82.366 111.237 14.065  1.00 134.96 ? -13 DA  I C2    1 
ATOM   1237  N  N3    . DA  A  1 61  ? 81.271 110.502 14.254  1.00 131.38 ? -13 DA  I N3    1 
ATOM   1238  C  C4    . DA  A  1 61  ? 80.808 110.026 13.088  1.00 125.17 ? -13 DA  I C4    1 
ATOM   1239  P  P     . DT  A  1 62  ? 75.554 109.230 16.461  1.00 110.01 ? -12 DT  I P     1 
ATOM   1240  O  OP1   . DT  A  1 62  ? 75.074 108.697 17.756  1.00 108.80 ? -12 DT  I OP1   1 
ATOM   1241  O  OP2   . DT  A  1 62  ? 74.582 109.596 15.407  1.00 116.78 ? -12 DT  I OP2   1 
ATOM   1242  O  "O5'" . DT  A  1 62  ? 76.477 110.499 16.742  1.00 113.87 ? -12 DT  I "O5'" 1 
ATOM   1243  C  "C5'" . DT  A  1 62  ? 77.737 110.324 17.372  1.00 116.85 ? -12 DT  I "C5'" 1 
ATOM   1244  C  "C4'" . DT  A  1 62  ? 78.293 111.655 17.837  1.00 116.05 ? -12 DT  I "C4'" 1 
ATOM   1245  O  "O4'" . DT  A  1 62  ? 79.254 112.150 16.871  1.00 115.25 ? -12 DT  I "O4'" 1 
ATOM   1246  C  "C3'" . DT  A  1 62  ? 77.262 112.762 18.005  1.00 118.87 ? -12 DT  I "C3'" 1 
ATOM   1247  O  "O3'" . DT  A  1 62  ? 77.643 113.585 19.091  1.00 125.42 ? -12 DT  I "O3'" 1 
ATOM   1248  C  "C2'" . DT  A  1 62  ? 77.342 113.503 16.668  1.00 119.45 ? -12 DT  I "C2'" 1 
ATOM   1249  C  "C1'" . DT  A  1 62  ? 78.824 113.392 16.349  1.00 118.82 ? -12 DT  I "C1'" 1 
ATOM   1250  N  N1    . DT  A  1 62  ? 79.143 113.407 14.892  1.00 121.17 ? -12 DT  I N1    1 
ATOM   1251  C  C2    . DT  A  1 62  ? 80.276 114.055 14.471  1.00 128.51 ? -12 DT  I C2    1 
ATOM   1252  O  O2    . DT  A  1 62  ? 81.030 114.640 15.228  1.00 135.98 ? -12 DT  I O2    1 
ATOM   1253  N  N3    . DT  A  1 62  ? 80.501 114.002 13.125  1.00 127.35 ? -12 DT  I N3    1 
ATOM   1254  C  C4    . DT  A  1 62  ? 79.725 113.375 12.171  1.00 125.40 ? -12 DT  I C4    1 
ATOM   1255  O  O4    . DT  A  1 62  ? 80.018 113.387 10.979  1.00 130.15 ? -12 DT  I O4    1 
ATOM   1256  C  C5    . DT  A  1 62  ? 78.549 112.705 12.675  1.00 118.89 ? -12 DT  I C5    1 
ATOM   1257  C  C7    . DT  A  1 62  ? 77.628 111.990 11.732  1.00 113.17 ? -12 DT  I C7    1 
ATOM   1258  C  C6    . DT  A  1 62  ? 78.318 112.749 14.000  1.00 118.69 ? -12 DT  I C6    1 
ATOM   1259  P  P     . DG  A  1 63  ? 76.643 114.695 19.679  1.00 113.64 ? -11 DG  I P     1 
ATOM   1260  O  OP1   . DG  A  1 63  ? 76.480 114.425 21.124  1.00 112.64 ? -11 DG  I OP1   1 
ATOM   1261  O  OP2   . DG  A  1 63  ? 75.449 114.777 18.808  1.00 115.01 ? -11 DG  I OP2   1 
ATOM   1262  O  "O5'" . DG  A  1 63  ? 77.475 116.045 19.516  1.00 119.11 ? -11 DG  I "O5'" 1 
ATOM   1263  C  "C5'" . DG  A  1 63  ? 78.862 116.050 19.820  1.00 124.63 ? -11 DG  I "C5'" 1 
ATOM   1264  C  "C4'" . DG  A  1 63  ? 79.523 117.303 19.286  1.00 131.15 ? -11 DG  I "C4'" 1 
ATOM   1265  O  "O4'" . DG  A  1 63  ? 79.844 117.124 17.883  1.00 134.30 ? -11 DG  I "O4'" 1 
ATOM   1266  C  "C3'" . DG  A  1 63  ? 78.671 118.565 19.372  1.00 131.80 ? -11 DG  I "C3'" 1 
ATOM   1267  O  "O3'" . DG  A  1 63  ? 79.491 119.662 19.744  1.00 130.48 ? -11 DG  I "O3'" 1 
ATOM   1268  C  "C2'" . DG  A  1 63  ? 78.122 118.712 17.951  1.00 134.87 ? -11 DG  I "C2'" 1 
ATOM   1269  C  "C1'" . DG  A  1 63  ? 79.274 118.168 17.124  1.00 138.72 ? -11 DG  I "C1'" 1 
ATOM   1270  N  N9    . DG  A  1 63  ? 78.877 117.622 15.828  1.00 143.50 ? -11 DG  I N9    1 
ATOM   1271  C  C8    . DG  A  1 63  ? 77.789 116.828 15.551  1.00 142.51 ? -11 DG  I C8    1 
ATOM   1272  N  N7    . DG  A  1 63  ? 77.705 116.484 14.292  1.00 142.36 ? -11 DG  I N7    1 
ATOM   1273  C  C5    . DG  A  1 63  ? 78.814 117.082 13.703  1.00 144.55 ? -11 DG  I C5    1 
ATOM   1274  C  C6    . DG  A  1 63  ? 79.261 117.067 12.357  1.00 145.23 ? -11 DG  I C6    1 
ATOM   1275  O  O6    . DG  A  1 63  ? 78.749 116.502 11.380  1.00 142.56 ? -11 DG  I O6    1 
ATOM   1276  N  N1    . DG  A  1 63  ? 80.433 117.805 12.197  1.00 149.48 ? -11 DG  I N1    1 
ATOM   1277  C  C2    . DG  A  1 63  ? 81.086 118.472 13.208  1.00 151.69 ? -11 DG  I C2    1 
ATOM   1278  N  N2    . DG  A  1 63  ? 82.201 119.133 12.876  1.00 156.29 ? -11 DG  I N2    1 
ATOM   1279  N  N3    . DG  A  1 63  ? 80.677 118.491 14.465  1.00 149.44 ? -11 DG  I N3    1 
ATOM   1280  C  C4    . DG  A  1 63  ? 79.543 117.780 14.639  1.00 146.32 ? -11 DG  I C4    1 
ATOM   1281  P  P     . DT  A  1 64  ? 78.860 121.123 19.952  1.00 145.21 ? -10 DT  I P     1 
ATOM   1282  O  OP1   . DT  A  1 64  ? 79.586 121.759 21.073  1.00 147.16 ? -10 DT  I OP1   1 
ATOM   1283  O  OP2   . DT  A  1 64  ? 77.387 120.991 20.015  1.00 143.54 ? -10 DT  I OP2   1 
ATOM   1284  O  "O5'" . DT  A  1 64  ? 79.243 121.882 18.601  1.00 143.68 ? -10 DT  I "O5'" 1 
ATOM   1285  C  "C5'" . DT  A  1 64  ? 80.542 121.714 18.049  1.00 144.10 ? -10 DT  I "C5'" 1 
ATOM   1286  C  "C4'" . DT  A  1 64  ? 80.727 122.588 16.824  1.00 145.36 ? -10 DT  I "C4'" 1 
ATOM   1287  O  "O4'" . DT  A  1 64  ? 80.413 121.832 15.625  1.00 141.72 ? -10 DT  I "O4'" 1 
ATOM   1288  C  "C3'" . DT  A  1 64  ? 79.851 123.840 16.786  1.00 145.35 ? -10 DT  I "C3'" 1 
ATOM   1289  O  "O3'" . DT  A  1 64  ? 80.634 124.953 16.390  1.00 147.18 ? -10 DT  I "O3'" 1 
ATOM   1290  C  "C2'" . DT  A  1 64  ? 78.788 123.493 15.742  1.00 141.31 ? -10 DT  I "C2'" 1 
ATOM   1291  C  "C1'" . DT  A  1 64  ? 79.573 122.600 14.797  1.00 139.54 ? -10 DT  I "C1'" 1 
ATOM   1292  N  N1    . DT  A  1 64  ? 78.725 121.667 13.993  1.00 132.48 ? -10 DT  I N1    1 
ATOM   1293  C  C2    . DT  A  1 64  ? 79.012 121.479 12.659  1.00 129.54 ? -10 DT  I C2    1 
ATOM   1294  O  O2    . DT  A  1 64  ? 79.926 122.045 12.088  1.00 128.76 ? -10 DT  I O2    1 
ATOM   1295  N  N3    . DT  A  1 64  ? 78.183 120.600 12.012  1.00 128.76 ? -10 DT  I N3    1 
ATOM   1296  C  C4    . DT  A  1 64  ? 77.119 119.902 12.555  1.00 125.52 ? -10 DT  I C4    1 
ATOM   1297  O  O4    . DT  A  1 64  ? 76.432 119.133 11.890  1.00 124.73 ? -10 DT  I O4    1 
ATOM   1298  C  C5    . DT  A  1 64  ? 76.874 120.143 13.959  1.00 124.45 ? -10 DT  I C5    1 
ATOM   1299  C  C7    . DT  A  1 64  ? 75.746 119.444 14.659  1.00 119.73 ? -10 DT  I C7    1 
ATOM   1300  C  C6    . DT  A  1 64  ? 77.680 121.003 14.602  1.00 128.62 ? -10 DT  I C6    1 
ATOM   1301  P  P     . DT  A  1 65  ? 80.066 126.449 16.531  1.00 138.00 ? -9  DT  I P     1 
ATOM   1302  O  OP1   . DT  A  1 65  ? 81.050 127.225 17.318  1.00 136.58 ? -9  DT  I OP1   1 
ATOM   1303  O  OP2   . DT  A  1 65  ? 78.658 126.382 16.982  1.00 134.65 ? -9  DT  I OP2   1 
ATOM   1304  O  "O5'" . DT  A  1 65  ? 80.077 126.983 15.028  1.00 140.43 ? -9  DT  I "O5'" 1 
ATOM   1305  C  "C5'" . DT  A  1 65  ? 81.156 126.640 14.169  1.00 144.11 ? -9  DT  I "C5'" 1 
ATOM   1306  C  "C4'" . DT  A  1 65  ? 80.903 127.143 12.762  1.00 148.72 ? -9  DT  I "C4'" 1 
ATOM   1307  O  "O4'" . DT  A  1 65  ? 80.238 126.114 11.984  1.00 146.72 ? -9  DT  I "O4'" 1 
ATOM   1308  C  "C3'" . DT  A  1 65  ? 80.026 128.386 12.676  1.00 152.21 ? -9  DT  I "C3'" 1 
ATOM   1309  O  "O3'" . DT  A  1 65  ? 80.553 129.272 11.702  1.00 157.48 ? -9  DT  I "O3'" 1 
ATOM   1310  C  "C2'" . DT  A  1 65  ? 78.658 127.831 12.271  1.00 149.71 ? -9  DT  I "C2'" 1 
ATOM   1311  C  "C1'" . DT  A  1 65  ? 79.036 126.614 11.438  1.00 146.55 ? -9  DT  I "C1'" 1 
ATOM   1312  N  N1    . DT  A  1 65  ? 78.021 125.515 11.481  1.00 139.87 ? -9  DT  I N1    1 
ATOM   1313  C  C2    . DT  A  1 65  ? 77.775 124.781 10.343  1.00 135.72 ? -9  DT  I C2    1 
ATOM   1314  O  O2    . DT  A  1 65  ? 78.337 124.985 9.282   1.00 133.50 ? -9  DT  I O2    1 
ATOM   1315  N  N3    . DT  A  1 65  ? 76.838 123.793 10.492  1.00 134.24 ? -9  DT  I N3    1 
ATOM   1316  C  C4    . DT  A  1 65  ? 76.140 123.467 11.639  1.00 131.31 ? -9  DT  I C4    1 
ATOM   1317  O  O4    . DT  A  1 65  ? 75.313 122.560 11.670  1.00 127.95 ? -9  DT  I O4    1 
ATOM   1318  C  C5    . DT  A  1 65  ? 76.445 124.273 12.797  1.00 132.98 ? -9  DT  I C5    1 
ATOM   1319  C  C7    . DT  A  1 65  ? 75.745 124.014 14.098  1.00 130.82 ? -9  DT  I C7    1 
ATOM   1320  C  C6    . DT  A  1 65  ? 77.363 125.244 12.665  1.00 136.95 ? -9  DT  I C6    1 
ATOM   1321  P  P     . DC  A  1 66  ? 79.945 130.748 11.527  1.00 154.36 ? -8  DC  I P     1 
ATOM   1322  O  OP1   . DC  A  1 66  ? 81.080 131.684 11.359  1.00 157.52 ? -8  DC  I OP1   1 
ATOM   1323  O  OP2   . DC  A  1 66  ? 78.958 130.978 12.606  1.00 151.84 ? -8  DC  I OP2   1 
ATOM   1324  O  "O5'" . DC  A  1 66  ? 79.156 130.652 10.145  1.00 154.26 ? -8  DC  I "O5'" 1 
ATOM   1325  C  "C5'" . DC  A  1 66  ? 79.745 129.963 9.050   1.00 151.72 ? -8  DC  I "C5'" 1 
ATOM   1326  C  "C4'" . DC  A  1 66  ? 78.748 129.799 7.922   1.00 147.60 ? -8  DC  I "C4'" 1 
ATOM   1327  O  "O4'" . DC  A  1 66  ? 77.979 128.582 8.118   1.00 144.15 ? -8  DC  I "O4'" 1 
ATOM   1328  C  "C3'" . DC  A  1 66  ? 77.732 130.932 7.800   1.00 145.44 ? -8  DC  I "C3'" 1 
ATOM   1329  O  "O3'" . DC  A  1 66  ? 77.555 131.267 6.438   1.00 142.49 ? -8  DC  I "O3'" 1 
ATOM   1330  C  "C2'" . DC  A  1 66  ? 76.464 130.329 8.403   1.00 143.63 ? -8  DC  I "C2'" 1 
ATOM   1331  C  "C1'" . DC  A  1 66  ? 76.606 128.871 8.000   1.00 142.48 ? -8  DC  I "C1'" 1 
ATOM   1332  N  N1    . DC  A  1 66  ? 75.847 127.928 8.872   1.00 139.42 ? -8  DC  I N1    1 
ATOM   1333  C  C2    . DC  A  1 66  ? 75.166 126.848 8.297   1.00 137.12 ? -8  DC  I C2    1 
ATOM   1334  O  O2    . DC  A  1 66  ? 75.207 126.701 7.070   1.00 136.64 ? -8  DC  I O2    1 
ATOM   1335  N  N3    . DC  A  1 66  ? 74.483 125.997 9.105   1.00 132.96 ? -8  DC  I N3    1 
ATOM   1336  C  C4    . DC  A  1 66  ? 74.469 126.196 10.425  1.00 130.46 ? -8  DC  I C4    1 
ATOM   1337  N  N4    . DC  A  1 66  ? 73.782 125.335 11.184  1.00 127.55 ? -8  DC  I N4    1 
ATOM   1338  C  C5    . DC  A  1 66  ? 75.157 127.292 11.027  1.00 132.25 ? -8  DC  I C5    1 
ATOM   1339  C  C6    . DC  A  1 66  ? 75.826 128.123 10.221  1.00 136.46 ? -8  DC  I C6    1 
ATOM   1340  P  P     . DA  A  1 67  ? 77.026 132.724 6.019   1.00 151.10 ? -7  DA  I P     1 
ATOM   1341  O  OP1   . DA  A  1 67  ? 78.171 133.487 5.475   1.00 155.29 ? -7  DA  I OP1   1 
ATOM   1342  O  OP2   . DA  A  1 67  ? 76.245 133.272 7.150   1.00 149.39 ? -7  DA  I OP2   1 
ATOM   1343  O  "O5'" . DA  A  1 67  ? 76.009 132.410 4.831   1.00 146.68 ? -7  DA  I "O5'" 1 
ATOM   1344  C  "C5'" . DA  A  1 67  ? 76.181 131.232 4.054   1.00 138.99 ? -7  DA  I "C5'" 1 
ATOM   1345  C  "C4'" . DA  A  1 67  ? 74.841 130.620 3.701   1.00 131.68 ? -7  DA  I "C4'" 1 
ATOM   1346  O  "O4'" . DA  A  1 67  ? 74.400 129.739 4.774   1.00 126.73 ? -7  DA  I "O4'" 1 
ATOM   1347  C  "C3'" . DA  A  1 67  ? 73.707 131.627 3.497   1.00 131.41 ? -7  DA  I "C3'" 1 
ATOM   1348  O  "O3'" . DA  A  1 67  ? 72.865 131.176 2.454   1.00 129.46 ? -7  DA  I "O3'" 1 
ATOM   1349  C  "C2'" . DA  A  1 67  ? 72.985 131.573 4.841   1.00 129.25 ? -7  DA  I "C2'" 1 
ATOM   1350  C  "C1'" . DA  A  1 67  ? 73.082 130.087 5.127   1.00 126.09 ? -7  DA  I "C1'" 1 
ATOM   1351  N  N9    . DA  A  1 67  ? 72.843 129.718 6.520   1.00 127.04 ? -7  DA  I N9    1 
ATOM   1352  C  C8    . DA  A  1 67  ? 73.266 130.384 7.635   1.00 129.35 ? -7  DA  I C8    1 
ATOM   1353  N  N7    . DA  A  1 67  ? 72.909 129.812 8.762   1.00 126.84 ? -7  DA  I N7    1 
ATOM   1354  C  C5    . DA  A  1 67  ? 72.197 128.695 8.357   1.00 124.65 ? -7  DA  I C5    1 
ATOM   1355  C  C6    . DA  A  1 67  ? 71.548 127.670 9.074   1.00 124.16 ? -7  DA  I C6    1 
ATOM   1356  N  N6    . DA  A  1 67  ? 71.516 127.613 10.410  1.00 125.80 ? -7  DA  I N6    1 
ATOM   1357  N  N1    . DA  A  1 67  ? 70.930 126.703 8.364   1.00 122.43 ? -7  DA  I N1    1 
ATOM   1358  C  C2    . DA  A  1 67  ? 70.965 126.763 7.027   1.00 121.80 ? -7  DA  I C2    1 
ATOM   1359  N  N3    . DA  A  1 67  ? 71.542 127.673 6.243   1.00 123.19 ? -7  DA  I N3    1 
ATOM   1360  C  C4    . DA  A  1 67  ? 72.146 128.621 6.978   1.00 125.13 ? -7  DA  I C4    1 
ATOM   1361  P  P     . DG  A  1 68  ? 72.917 131.848 0.997   1.00 130.14 ? -6  DG  I P     1 
ATOM   1362  O  OP1   . DG  A  1 68  ? 74.339 132.028 0.631   1.00 132.80 ? -6  DG  I OP1   1 
ATOM   1363  O  OP2   . DG  A  1 68  ? 72.008 133.016 1.007   1.00 135.06 ? -6  DG  I OP2   1 
ATOM   1364  O  "O5'" . DG  A  1 68  ? 72.270 130.727 0.055   1.00 121.84 ? -6  DG  I "O5'" 1 
ATOM   1365  C  "C5'" . DG  A  1 68  ? 72.784 129.397 0.089   1.00 115.75 ? -6  DG  I "C5'" 1 
ATOM   1366  C  "C4'" . DG  A  1 68  ? 71.672 128.357 -0.013  1.00 111.02 ? -6  DG  I "C4'" 1 
ATOM   1367  O  "O4'" . DG  A  1 68  ? 71.185 127.999 1.308   1.00 110.54 ? -6  DG  I "O4'" 1 
ATOM   1368  C  "C3'" . DG  A  1 68  ? 70.440 128.768 -0.798  1.00 110.71 ? -6  DG  I "C3'" 1 
ATOM   1369  O  "O3'" . DG  A  1 68  ? 69.878 127.609 -1.387  1.00 107.37 ? -6  DG  I "O3'" 1 
ATOM   1370  C  "C2'" . DG  A  1 68  ? 69.536 129.337 0.297   1.00 111.86 ? -6  DG  I "C2'" 1 
ATOM   1371  C  "C1'" . DG  A  1 68  ? 69.827 128.390 1.457   1.00 113.12 ? -6  DG  I "C1'" 1 
ATOM   1372  N  N9    . DG  A  1 68  ? 69.707 128.999 2.779   1.00 117.24 ? -6  DG  I N9    1 
ATOM   1373  C  C8    . DG  A  1 68  ? 70.285 130.170 3.188   1.00 120.27 ? -6  DG  I C8    1 
ATOM   1374  N  N7    . DG  A  1 68  ? 70.052 130.463 4.432   1.00 118.24 ? -6  DG  I N7    1 
ATOM   1375  C  C5    . DG  A  1 68  ? 69.286 129.409 4.895   1.00 116.51 ? -6  DG  I C5    1 
ATOM   1376  C  C6    . DG  A  1 68  ? 68.742 129.187 6.177   1.00 123.23 ? -6  DG  I C6    1 
ATOM   1377  O  O6    . DG  A  1 68  ? 68.840 129.902 7.182   1.00 127.75 ? -6  DG  I O6    1 
ATOM   1378  N  N1    . DG  A  1 68  ? 68.020 128.001 6.234   1.00 125.92 ? -6  DG  I N1    1 
ATOM   1379  C  C2    . DG  A  1 68  ? 67.847 127.132 5.183   1.00 125.96 ? -6  DG  I C2    1 
ATOM   1380  N  N2    . DG  A  1 68  ? 67.114 126.035 5.438   1.00 125.93 ? -6  DG  I N2    1 
ATOM   1381  N  N3    . DG  A  1 68  ? 68.355 127.328 3.965   1.00 121.71 ? -6  DG  I N3    1 
ATOM   1382  C  C4    . DG  A  1 68  ? 69.064 128.487 3.896   1.00 116.36 ? -6  DG  I C4    1 
ATOM   1383  P  P     . DC  A  1 69  ? 68.840 127.717 -2.606  1.00 113.66 ? -5  DC  I P     1 
ATOM   1384  O  OP1   . DC  A  1 69  ? 69.434 127.046 -3.779  1.00 120.13 ? -5  DC  I OP1   1 
ATOM   1385  O  OP2   . DC  A  1 69  ? 68.386 129.121 -2.712  1.00 113.44 ? -5  DC  I OP2   1 
ATOM   1386  O  "O5'" . DC  A  1 69  ? 67.620 126.816 -2.119  1.00 109.38 ? -5  DC  I "O5'" 1 
ATOM   1387  C  "C5'" . DC  A  1 69  ? 67.768 125.980 -0.973  1.00 110.64 ? -5  DC  I "C5'" 1 
ATOM   1388  C  "C4'" . DC  A  1 69  ? 66.438 125.810 -0.267  1.00 111.36 ? -5  DC  I "C4'" 1 
ATOM   1389  O  "O4'" . DC  A  1 69  ? 66.402 126.659 0.916   1.00 110.85 ? -5  DC  I "O4'" 1 
ATOM   1390  C  "C3'" . DC  A  1 69  ? 65.227 126.235 -1.090  1.00 115.22 ? -5  DC  I "C3'" 1 
ATOM   1391  O  "O3'" . DC  A  1 69  ? 64.081 125.550 -0.631  1.00 113.52 ? -5  DC  I "O3'" 1 
ATOM   1392  C  "C2'" . DC  A  1 69  ? 65.138 127.703 -0.729  1.00 116.98 ? -5  DC  I "C2'" 1 
ATOM   1393  C  "C1'" . DC  A  1 69  ? 65.352 127.593 0.768   1.00 112.08 ? -5  DC  I "C1'" 1 
ATOM   1394  N  N1    . DC  A  1 69  ? 65.730 128.867 1.432   1.00 111.20 ? -5  DC  I N1    1 
ATOM   1395  C  C2    . DC  A  1 69  ? 65.529 129.001 2.805   1.00 104.94 ? -5  DC  I C2    1 
ATOM   1396  O  O2    . DC  A  1 69  ? 65.051 128.047 3.427   1.00 100.48 ? -5  DC  I O2    1 
ATOM   1397  N  N3    . DC  A  1 69  ? 65.870 130.165 3.409   1.00 106.32 ? -5  DC  I N3    1 
ATOM   1398  C  C4    . DC  A  1 69  ? 66.385 131.163 2.689   1.00 114.28 ? -5  DC  I C4    1 
ATOM   1399  N  N4    . DC  A  1 69  ? 66.707 132.295 3.326   1.00 119.36 ? -5  DC  I N4    1 
ATOM   1400  C  C5    . DC  A  1 69  ? 66.591 131.046 1.283   1.00 116.47 ? -5  DC  I C5    1 
ATOM   1401  C  C6    . DC  A  1 69  ? 66.247 129.893 0.700   1.00 114.15 ? -5  DC  I C6    1 
ATOM   1402  P  P     . DT  A  1 70  ? 63.467 124.322 -1.462  1.00 108.83 ? -4  DT  I P     1 
ATOM   1403  O  OP1   . DT  A  1 70  ? 64.585 123.421 -1.825  1.00 109.82 ? -4  DT  I OP1   1 
ATOM   1404  O  OP2   . DT  A  1 70  ? 62.591 124.878 -2.517  1.00 112.01 ? -4  DT  I OP2   1 
ATOM   1405  O  "O5'" . DT  A  1 70  ? 62.544 123.590 -0.384  1.00 101.88 ? -4  DT  I "O5'" 1 
ATOM   1406  C  "C5'" . DT  A  1 70  ? 63.105 123.198 0.863   1.00 96.89  ? -4  DT  I "C5'" 1 
ATOM   1407  C  "C4'" . DT  A  1 70  ? 62.228 123.628 2.031   1.00 91.22  ? -4  DT  I "C4'" 1 
ATOM   1408  O  "O4'" . DT  A  1 70  ? 62.548 124.983 2.439   1.00 94.62  ? -4  DT  I "O4'" 1 
ATOM   1409  C  "C3'" . DT  A  1 70  ? 60.719 123.605 1.779   1.00 89.00  ? -4  DT  I "C3'" 1 
ATOM   1410  O  "O3'" . DT  A  1 70  ? 60.096 122.955 2.869   1.00 83.40  ? -4  DT  I "O3'" 1 
ATOM   1411  C  "C2'" . DT  A  1 70  ? 60.348 125.097 1.725   1.00 96.42  ? -4  DT  I "C2'" 1 
ATOM   1412  C  "C1'" . DT  A  1 70  ? 61.346 125.668 2.713   1.00 97.11  ? -4  DT  I "C1'" 1 
ATOM   1413  N  N1    . DT  A  1 70  ? 61.610 127.139 2.588   1.00 100.16 ? -4  DT  I N1    1 
ATOM   1414  C  C2    . DT  A  1 70  ? 61.620 127.917 3.728   1.00 104.02 ? -4  DT  I C2    1 
ATOM   1415  O  O2    . DT  A  1 70  ? 61.391 127.475 4.840   1.00 102.96 ? -4  DT  I O2    1 
ATOM   1416  N  N3    . DT  A  1 70  ? 61.900 129.241 3.516   1.00 109.12 ? -4  DT  I N3    1 
ATOM   1417  C  C4    . DT  A  1 70  ? 62.175 129.853 2.309   1.00 112.52 ? -4  DT  I C4    1 
ATOM   1418  O  O4    . DT  A  1 70  ? 62.417 131.051 2.221   1.00 117.44 ? -4  DT  I O4    1 
ATOM   1419  C  C5    . DT  A  1 70  ? 62.159 128.987 1.158   1.00 107.37 ? -4  DT  I C5    1 
ATOM   1420  C  C7    . DT  A  1 70  ? 62.435 129.554 -0.202  1.00 113.35 ? -4  DT  I C7    1 
ATOM   1421  C  C6    . DT  A  1 70  ? 61.885 127.684 1.347   1.00 100.00 ? -4  DT  I C6    1 
ATOM   1422  P  P     . DG  A  1 71  ? 58.629 122.320 2.728   1.00 83.71  ? -3  DG  I P     1 
ATOM   1423  O  OP1   . DG  A  1 71  ? 58.770 120.847 2.787   1.00 81.24  ? -3  DG  I OP1   1 
ATOM   1424  O  OP2   . DG  A  1 71  ? 57.955 122.953 1.574   1.00 88.98  ? -3  DG  I OP2   1 
ATOM   1425  O  "O5'" . DG  A  1 71  ? 57.904 122.800 4.065   1.00 85.52  ? -3  DG  I "O5'" 1 
ATOM   1426  C  "C5'" . DG  A  1 71  ? 58.543 122.600 5.322   1.00 84.25  ? -3  DG  I "C5'" 1 
ATOM   1427  C  "C4'" . DG  A  1 71  ? 57.967 123.519 6.387   1.00 82.76  ? -3  DG  I "C4'" 1 
ATOM   1428  O  "O4'" . DG  A  1 71  ? 58.298 124.896 6.081   1.00 86.20  ? -3  DG  I "O4'" 1 
ATOM   1429  C  "C3'" . DG  A  1 71  ? 56.455 123.485 6.530   1.00 82.66  ? -3  DG  I "C3'" 1 
ATOM   1430  O  "O3'" . DG  A  1 71  ? 56.109 123.769 7.871   1.00 87.85  ? -3  DG  I "O3'" 1 
ATOM   1431  C  "C2'" . DG  A  1 71  ? 56.010 124.601 5.588   1.00 85.14  ? -3  DG  I "C2'" 1 
ATOM   1432  C  "C1'" . DG  A  1 71  ? 57.121 125.626 5.788   1.00 87.54  ? -3  DG  I "C1'" 1 
ATOM   1433  N  N9    . DG  A  1 71  ? 57.393 126.454 4.616   1.00 92.96  ? -3  DG  I N9    1 
ATOM   1434  C  C8    . DG  A  1 71  ? 57.316 126.086 3.294   1.00 96.03  ? -3  DG  I C8    1 
ATOM   1435  N  N7    . DG  A  1 71  ? 57.641 127.046 2.470   1.00 100.30 ? -3  DG  I N7    1 
ATOM   1436  C  C5    . DG  A  1 71  ? 57.963 128.112 3.300   1.00 99.81  ? -3  DG  I C5    1 
ATOM   1437  C  C6    . DG  A  1 71  ? 58.391 129.427 2.983   1.00 104.13 ? -3  DG  I C6    1 
ATOM   1438  O  O6    . DG  A  1 71  ? 58.579 129.928 1.866   1.00 106.48 ? -3  DG  I O6    1 
ATOM   1439  N  N1    . DG  A  1 71  ? 58.607 130.188 4.131   1.00 109.93 ? -3  DG  I N1    1 
ATOM   1440  C  C2    . DG  A  1 71  ? 58.431 129.734 5.418   1.00 111.69 ? -3  DG  I C2    1 
ATOM   1441  N  N2    . DG  A  1 71  ? 58.683 130.603 6.405   1.00 119.16 ? -3  DG  I N2    1 
ATOM   1442  N  N3    . DG  A  1 71  ? 58.033 128.510 5.723   1.00 102.51 ? -3  DG  I N3    1 
ATOM   1443  C  C4    . DG  A  1 71  ? 57.819 127.758 4.622   1.00 98.30  ? -3  DG  I C4    1 
ATOM   1444  P  P     . DG  A  1 72  ? 54.703 123.282 8.474   1.00 91.68  ? -2  DG  I P     1 
ATOM   1445  O  OP1   . DG  A  1 72  ? 54.985 122.369 9.603   1.00 93.61  ? -2  DG  I OP1   1 
ATOM   1446  O  OP2   . DG  A  1 72  ? 53.848 122.837 7.350   1.00 94.74  ? -2  DG  I OP2   1 
ATOM   1447  O  "O5'" . DG  A  1 72  ? 54.078 124.625 9.059   1.00 91.05  ? -2  DG  I "O5'" 1 
ATOM   1448  C  "C5'" . DG  A  1 72  ? 54.929 125.584 9.658   1.00 88.92  ? -2  DG  I "C5'" 1 
ATOM   1449  C  "C4'" . DG  A  1 72  ? 54.409 126.982 9.407   1.00 92.39  ? -2  DG  I "C4'" 1 
ATOM   1450  O  "O4'" . DG  A  1 72  ? 54.915 127.479 8.138   1.00 93.78  ? -2  DG  I "O4'" 1 
ATOM   1451  C  "C3'" . DG  A  1 72  ? 52.882 127.098 9.323   1.00 94.22  ? -2  DG  I "C3'" 1 
ATOM   1452  O  "O3'" . DG  A  1 72  ? 52.463 128.225 10.060  1.00 96.71  ? -2  DG  I "O3'" 1 
ATOM   1453  C  "C2'" . DG  A  1 72  ? 52.639 127.298 7.827   1.00 94.86  ? -2  DG  I "C2'" 1 
ATOM   1454  C  "C1'" . DG  A  1 72  ? 53.857 128.123 7.478   1.00 96.95  ? -2  DG  I "C1'" 1 
ATOM   1455  N  N9    . DG  A  1 72  ? 54.148 128.219 6.050   1.00 101.01 ? -2  DG  I N9    1 
ATOM   1456  C  C8    . DG  A  1 72  ? 54.054 127.228 5.102   1.00 101.30 ? -2  DG  I C8    1 
ATOM   1457  N  N7    . DG  A  1 72  ? 54.383 127.628 3.901   1.00 104.49 ? -2  DG  I N7    1 
ATOM   1458  C  C5    . DG  A  1 72  ? 54.709 128.970 4.068   1.00 107.67 ? -2  DG  I C5    1 
ATOM   1459  C  C6    . DG  A  1 72  ? 55.142 129.936 3.124   1.00 115.31 ? -2  DG  I C6    1 
ATOM   1460  O  O6    . DG  A  1 72  ? 55.328 129.796 1.907   1.00 119.16 ? -2  DG  I O6    1 
ATOM   1461  N  N1    . DG  A  1 72  ? 55.360 131.178 3.722   1.00 119.17 ? -2  DG  I N1    1 
ATOM   1462  C  C2    . DG  A  1 72  ? 55.185 131.446 5.060   1.00 118.73 ? -2  DG  I C2    1 
ATOM   1463  N  N2    . DG  A  1 72  ? 55.443 132.697 5.466   1.00 120.86 ? -2  DG  I N2    1 
ATOM   1464  N  N3    . DG  A  1 72  ? 54.784 130.551 5.947   1.00 113.65 ? -2  DG  I N3    1 
ATOM   1465  C  C4    . DG  A  1 72  ? 54.569 129.341 5.384   1.00 106.64 ? -2  DG  I C4    1 
ATOM   1466  P  P     . DA  A  1 73  ? 50.990 128.290 10.695  1.00 102.96 ? -1  DA  I P     1 
ATOM   1467  O  OP1   . DA  A  1 73  ? 50.985 127.450 11.912  1.00 102.81 ? -1  DA  I OP1   1 
ATOM   1468  O  OP2   . DA  A  1 73  ? 50.011 128.030 9.617   1.00 104.88 ? -1  DA  I OP2   1 
ATOM   1469  O  "O5'" . DA  A  1 73  ? 50.851 129.822 11.116  1.00 102.72 ? -1  DA  I "O5'" 1 
ATOM   1470  C  "C5'" . DA  A  1 73  ? 52.023 130.605 11.306  1.00 104.98 ? -1  DA  I "C5'" 1 
ATOM   1471  C  "C4'" . DA  A  1 73  ? 51.908 131.931 10.579  1.00 110.96 ? -1  DA  I "C4'" 1 
ATOM   1472  O  "O4'" . DA  A  1 73  ? 52.399 131.798 9.219   1.00 112.79 ? -1  DA  I "O4'" 1 
ATOM   1473  C  "C3'" . DA  A  1 73  ? 50.487 132.483 10.469  1.00 114.24 ? -1  DA  I "C3'" 1 
ATOM   1474  O  "O3'" . DA  A  1 73  ? 50.491 133.857 10.801  1.00 118.86 ? -1  DA  I "O3'" 1 
ATOM   1475  C  "C2'" . DA  A  1 73  ? 50.126 132.254 8.997   1.00 112.21 ? -1  DA  I "C2'" 1 
ATOM   1476  C  "C1'" . DA  A  1 73  ? 51.483 132.392 8.327   1.00 113.05 ? -1  DA  I "C1'" 1 
ATOM   1477  N  N9    . DA  A  1 73  ? 51.588 131.702 7.041   1.00 110.09 ? -1  DA  I N9    1 
ATOM   1478  C  C8    . DA  A  1 73  ? 51.439 130.364 6.814   1.00 105.10 ? -1  DA  I C8    1 
ATOM   1479  N  N7    . DA  A  1 73  ? 51.606 130.015 5.560   1.00 102.48 ? -1  DA  I N7    1 
ATOM   1480  C  C5    . DA  A  1 73  ? 51.889 131.209 4.917   1.00 105.25 ? -1  DA  I C5    1 
ATOM   1481  C  C6    . DA  A  1 73  ? 52.168 131.519 3.570   1.00 105.21 ? -1  DA  I C6    1 
ATOM   1482  N  N6    . DA  A  1 73  ? 52.202 130.604 2.595   1.00 103.93 ? -1  DA  I N6    1 
ATOM   1483  N  N1    . DA  A  1 73  ? 52.405 132.811 3.260   1.00 110.99 ? -1  DA  I N1    1 
ATOM   1484  C  C2    . DA  A  1 73  ? 52.369 133.725 4.239   1.00 114.45 ? -1  DA  I C2    1 
ATOM   1485  N  N3    . DA  A  1 73  ? 52.120 133.554 5.539   1.00 113.92 ? -1  DA  I N3    1 
ATOM   1486  C  C4    . DA  A  1 73  ? 51.888 132.260 5.815   1.00 109.60 ? -1  DA  I C4    1 
ATOM   1487  P  P     . DA  A  1 74  ? 49.131 134.593 11.232  1.00 109.43 ? 0   DA  I P     1 
ATOM   1488  O  OP1   . DA  A  1 74  ? 49.395 135.315 12.497  1.00 110.89 ? 0   DA  I OP1   1 
ATOM   1489  O  OP2   . DA  A  1 74  ? 48.034 133.600 11.161  1.00 104.99 ? 0   DA  I OP2   1 
ATOM   1490  O  "O5'" . DA  A  1 74  ? 48.912 135.665 10.070  1.00 110.54 ? 0   DA  I "O5'" 1 
ATOM   1491  C  "C5'" . DA  A  1 74  ? 50.005 136.461 9.637   1.00 113.46 ? 0   DA  I "C5'" 1 
ATOM   1492  C  "C4'" . DA  A  1 74  ? 49.662 137.201 8.359   1.00 119.87 ? 0   DA  I "C4'" 1 
ATOM   1493  O  "O4'" . DA  A  1 74  ? 49.988 136.377 7.206   1.00 120.76 ? 0   DA  I "O4'" 1 
ATOM   1494  C  "C3'" . DA  A  1 74  ? 48.192 137.579 8.204   1.00 122.56 ? 0   DA  I "C3'" 1 
ATOM   1495  O  "O3'" . DA  A  1 74  ? 48.104 138.873 7.627   1.00 126.27 ? 0   DA  I "O3'" 1 
ATOM   1496  C  "C2'" . DA  A  1 74  ? 47.662 136.498 7.260   1.00 120.88 ? 0   DA  I "C2'" 1 
ATOM   1497  C  "C1'" . DA  A  1 74  ? 48.865 136.293 6.356   1.00 122.13 ? 0   DA  I "C1'" 1 
ATOM   1498  N  N9    . DA  A  1 74  ? 48.901 134.998 5.679   1.00 121.61 ? 0   DA  I N9    1 
ATOM   1499  C  C8    . DA  A  1 74  ? 48.791 133.762 6.252   1.00 120.29 ? 0   DA  I C8    1 
ATOM   1500  N  N7    . DA  A  1 74  ? 48.876 132.771 5.394   1.00 119.31 ? 0   DA  I N7    1 
ATOM   1501  C  C5    . DA  A  1 74  ? 49.066 133.401 4.175   1.00 120.57 ? 0   DA  I C5    1 
ATOM   1502  C  C6    . DA  A  1 74  ? 49.233 132.908 2.863   1.00 119.52 ? 0   DA  I C6    1 
ATOM   1503  N  N6    . DA  A  1 74  ? 49.234 131.605 2.560   1.00 118.27 ? 0   DA  I N6    1 
ATOM   1504  N  N1    . DA  A  1 74  ? 49.400 133.809 1.872   1.00 120.62 ? 0   DA  I N1    1 
ATOM   1505  C  C2    . DA  A  1 74  ? 49.398 135.112 2.179   1.00 123.98 ? 0   DA  I C2    1 
ATOM   1506  N  N3    . DA  A  1 74  ? 49.252 135.693 3.369   1.00 125.50 ? 0   DA  I N3    1 
ATOM   1507  C  C4    . DA  A  1 74  ? 49.089 134.774 4.333   1.00 122.92 ? 0   DA  I C4    1 
ATOM   1508  P  P     . DT  A  1 75  ? 46.768 139.751 7.774   1.00 131.34 ? 1   DT  I P     1 
ATOM   1509  O  OP1   . DT  A  1 75  ? 47.133 141.004 8.472   1.00 123.83 ? 1   DT  I OP1   1 
ATOM   1510  O  OP2   . DT  A  1 75  ? 45.702 138.885 8.326   1.00 127.65 ? 1   DT  I OP2   1 
ATOM   1511  O  "O5'" . DT  A  1 75  ? 46.398 140.101 6.260   1.00 137.90 ? 1   DT  I "O5'" 1 
ATOM   1512  C  "C5'" . DT  A  1 75  ? 46.759 139.194 5.228   1.00 136.28 ? 1   DT  I "C5'" 1 
ATOM   1513  C  "C4'" . DT  A  1 75  ? 46.502 139.790 3.862   1.00 137.46 ? 1   DT  I "C4'" 1 
ATOM   1514  O  "O4'" . DT  A  1 75  ? 46.819 138.804 2.849   1.00 134.36 ? 1   DT  I "O4'" 1 
ATOM   1515  C  "C3'" . DT  A  1 75  ? 45.059 140.168 3.600   1.00 138.77 ? 1   DT  I "C3'" 1 
ATOM   1516  O  "O3'" . DT  A  1 75  ? 45.001 141.156 2.583   1.00 143.86 ? 1   DT  I "O3'" 1 
ATOM   1517  C  "C2'" . DT  A  1 75  ? 44.468 138.844 3.132   1.00 134.16 ? 1   DT  I "C2'" 1 
ATOM   1518  C  "C1'" . DT  A  1 75  ? 45.624 138.246 2.331   1.00 131.70 ? 1   DT  I "C1'" 1 
ATOM   1519  N  N1    . DT  A  1 75  ? 45.716 136.757 2.431   1.00 124.36 ? 1   DT  I N1    1 
ATOM   1520  C  C2    . DT  A  1 75  ? 45.913 136.017 1.288   1.00 121.67 ? 1   DT  I C2    1 
ATOM   1521  O  O2    . DT  A  1 75  ? 46.020 136.513 0.181   1.00 124.82 ? 1   DT  I O2    1 
ATOM   1522  N  N3    . DT  A  1 75  ? 45.983 134.663 1.487   1.00 113.62 ? 1   DT  I N3    1 
ATOM   1523  C  C4    . DT  A  1 75  ? 45.877 133.989 2.690   1.00 108.06 ? 1   DT  I C4    1 
ATOM   1524  O  O4    . DT  A  1 75  ? 45.955 132.766 2.765   1.00 102.85 ? 1   DT  I O4    1 
ATOM   1525  C  C5    . DT  A  1 75  ? 45.671 134.824 3.850   1.00 111.94 ? 1   DT  I C5    1 
ATOM   1526  C  C7    . DT  A  1 75  ? 45.540 134.207 5.211   1.00 109.51 ? 1   DT  I C7    1 
ATOM   1527  C  C6    . DT  A  1 75  ? 45.601 136.152 3.667   1.00 118.53 ? 1   DT  I C6    1 
ATOM   1528  P  P     . DC  A  1 76  ? 43.601 141.840 2.194   1.00 153.83 ? 2   DC  I P     1 
ATOM   1529  O  OP1   . DC  A  1 76  ? 43.866 143.272 1.928   1.00 156.09 ? 2   DC  I OP1   1 
ATOM   1530  O  OP2   . DC  A  1 76  ? 42.603 141.456 3.217   1.00 153.19 ? 2   DC  I OP2   1 
ATOM   1531  O  "O5'" . DC  A  1 76  ? 43.205 141.130 0.817   1.00 147.57 ? 2   DC  I "O5'" 1 
ATOM   1532  C  "C5'" . DC  A  1 76  ? 44.080 141.227 -0.299  1.00 141.45 ? 2   DC  I "C5'" 1 
ATOM   1533  C  "C4'" . DC  A  1 76  ? 43.588 140.379 -1.458  1.00 131.91 ? 2   DC  I "C4'" 1 
ATOM   1534  O  "O4'" . DC  A  1 76  ? 43.813 138.975 -1.172  1.00 124.13 ? 2   DC  I "O4'" 1 
ATOM   1535  C  "C3'" . DC  A  1 76  ? 42.101 140.516 -1.782  1.00 131.44 ? 2   DC  I "C3'" 1 
ATOM   1536  O  "O3'" . DC  A  1 76  ? 41.932 140.567 -3.188  1.00 134.54 ? 2   DC  I "O3'" 1 
ATOM   1537  C  "C2'" . DC  A  1 76  ? 41.498 139.242 -1.188  1.00 125.23 ? 2   DC  I "C2'" 1 
ATOM   1538  C  "C1'" . DC  A  1 76  ? 42.627 138.252 -1.413  1.00 121.21 ? 2   DC  I "C1'" 1 
ATOM   1539  N  N1    . DC  A  1 76  ? 42.607 137.074 -0.493  1.00 117.16 ? 2   DC  I N1    1 
ATOM   1540  C  C2    . DC  A  1 76  ? 42.799 135.791 -1.015  1.00 111.14 ? 2   DC  I C2    1 
ATOM   1541  O  O2    . DC  A  1 76  ? 42.967 135.663 -2.232  1.00 113.83 ? 2   DC  I O2    1 
ATOM   1542  N  N3    . DC  A  1 76  ? 42.793 134.729 -0.170  1.00 101.69 ? 2   DC  I N3    1 
ATOM   1543  C  C4    . DC  A  1 76  ? 42.610 134.919 1.138   1.00 99.27  ? 2   DC  I C4    1 
ATOM   1544  N  N4    . DC  A  1 76  ? 42.610 133.845 1.936   1.00 90.82  ? 2   DC  I N4    1 
ATOM   1545  C  C5    . DC  A  1 76  ? 42.416 136.221 1.688   1.00 109.94 ? 2   DC  I C5    1 
ATOM   1546  C  C6    . DC  A  1 76  ? 42.424 137.259 0.845   1.00 117.55 ? 2   DC  I C6    1 
ATOM   1547  P  P     . DC  A  1 77  ? 40.680 141.336 -3.835  1.00 138.41 ? 3   DC  I P     1 
ATOM   1548  O  OP1   . DC  A  1 77  ? 41.210 142.322 -4.804  1.00 139.82 ? 3   DC  I OP1   1 
ATOM   1549  O  OP2   . DC  A  1 77  ? 39.801 141.784 -2.732  1.00 140.02 ? 3   DC  I OP2   1 
ATOM   1550  O  "O5'" . DC  A  1 77  ? 39.918 140.187 -4.640  1.00 135.51 ? 3   DC  I "O5'" 1 
ATOM   1551  C  "C5'" . DC  A  1 77  ? 40.659 139.302 -5.471  1.00 132.04 ? 3   DC  I "C5'" 1 
ATOM   1552  C  "C4'" . DC  A  1 77  ? 39.874 138.035 -5.749  1.00 125.31 ? 3   DC  I "C4'" 1 
ATOM   1553  O  "O4'" . DC  A  1 77  ? 40.142 137.047 -4.714  1.00 119.15 ? 3   DC  I "O4'" 1 
ATOM   1554  C  "C3'" . DC  A  1 77  ? 38.353 138.206 -5.775  1.00 124.04 ? 3   DC  I "C3'" 1 
ATOM   1555  O  "O3'" . DC  A  1 77  ? 37.809 137.362 -6.774  1.00 122.85 ? 3   DC  I "O3'" 1 
ATOM   1556  C  "C2'" . DC  A  1 77  ? 37.957 137.722 -4.382  1.00 119.08 ? 3   DC  I "C2'" 1 
ATOM   1557  C  "C1'" . DC  A  1 77  ? 38.910 136.551 -4.251  1.00 114.87 ? 3   DC  I "C1'" 1 
ATOM   1558  N  N1    . DC  A  1 77  ? 39.074 136.020 -2.863  1.00 110.82 ? 3   DC  I N1    1 
ATOM   1559  C  C2    . DC  A  1 77  ? 39.261 134.646 -2.680  1.00 105.70 ? 3   DC  I C2    1 
ATOM   1560  O  O2    . DC  A  1 77  ? 39.286 133.913 -3.675  1.00 102.04 ? 3   DC  I O2    1 
ATOM   1561  N  N3    . DC  A  1 77  ? 39.410 134.163 -1.421  1.00 102.27 ? 3   DC  I N3    1 
ATOM   1562  C  C4    . DC  A  1 77  ? 39.375 134.997 -0.380  1.00 99.96  ? 3   DC  I C4    1 
ATOM   1563  N  N4    . DC  A  1 77  ? 39.525 134.478 0.845   1.00 92.12  ? 3   DC  I N4    1 
ATOM   1564  C  C5    . DC  A  1 77  ? 39.183 136.402 -0.548  1.00 106.77 ? 3   DC  I C5    1 
ATOM   1565  C  C6    . DC  A  1 77  ? 39.035 136.865 -1.795  1.00 111.04 ? 3   DC  I C6    1 
ATOM   1566  P  P     . DA  A  1 78  ? 37.284 137.956 -8.171  1.00 125.09 ? 4   DA  I P     1 
ATOM   1567  O  OP1   . DA  A  1 78  ? 38.382 138.754 -8.761  1.00 128.15 ? 4   DA  I OP1   1 
ATOM   1568  O  OP2   . DA  A  1 78  ? 35.965 138.582 -7.930  1.00 124.47 ? 4   DA  I OP2   1 
ATOM   1569  O  "O5'" . DA  A  1 78  ? 37.052 136.648 -9.070  1.00 118.92 ? 4   DA  I "O5'" 1 
ATOM   1570  C  "C5'" . DA  A  1 78  ? 38.172 135.885 -9.524  1.00 110.99 ? 4   DA  I "C5'" 1 
ATOM   1571  C  "C4'" . DA  A  1 78  ? 37.876 134.384 -9.563  1.00 102.45 ? 4   DA  I "C4'" 1 
ATOM   1572  O  "O4'" . DA  A  1 78  ? 37.869 133.831 -8.223  1.00 102.40 ? 4   DA  I "O4'" 1 
ATOM   1573  C  "C3'" . DA  A  1 78  ? 36.543 133.966 -10.154 1.00 102.08 ? 4   DA  I "C3'" 1 
ATOM   1574  O  "O3'" . DA  A  1 78  ? 36.672 132.633 -10.611 1.00 101.01 ? 4   DA  I "O3'" 1 
ATOM   1575  C  "C2'" . DA  A  1 78  ? 35.636 134.029 -8.928  1.00 102.20 ? 4   DA  I "C2'" 1 
ATOM   1576  C  "C1'" . DA  A  1 78  ? 36.553 133.419 -7.875  1.00 104.49 ? 4   DA  I "C1'" 1 
ATOM   1577  N  N9    . DA  A  1 78  ? 36.321 133.877 -6.511  1.00 110.86 ? 4   DA  I N9    1 
ATOM   1578  C  C8    . DA  A  1 78  ? 36.128 135.162 -6.099  1.00 115.53 ? 4   DA  I C8    1 
ATOM   1579  N  N7    . DA  A  1 78  ? 36.000 135.288 -4.801  1.00 114.64 ? 4   DA  I N7    1 
ATOM   1580  C  C5    . DA  A  1 78  ? 36.144 133.999 -4.324  1.00 110.64 ? 4   DA  I C5    1 
ATOM   1581  C  C6    . DA  A  1 78  ? 36.108 133.461 -3.025  1.00 108.69 ? 4   DA  I C6    1 
ATOM   1582  N  N6    . DA  A  1 78  ? 35.915 134.202 -1.930  1.00 106.99 ? 4   DA  I N6    1 
ATOM   1583  N  N1    . DA  A  1 78  ? 36.281 132.129 -2.893  1.00 110.42 ? 4   DA  I N1    1 
ATOM   1584  C  C2    . DA  A  1 78  ? 36.477 131.393 -3.994  1.00 108.95 ? 4   DA  I C2    1 
ATOM   1585  N  N3    . DA  A  1 78  ? 36.526 131.786 -5.267  1.00 107.78 ? 4   DA  I N3    1 
ATOM   1586  C  C4    . DA  A  1 78  ? 36.352 133.114 -5.364  1.00 109.71 ? 4   DA  I C4    1 
ATOM   1587  P  P     . DG  A  1 79  ? 35.907 132.119 -11.923 1.00 92.07  ? 5   DG  I P     1 
ATOM   1588  O  OP1   . DG  A  1 79  ? 36.846 132.228 -13.064 1.00 94.44  ? 5   DG  I OP1   1 
ATOM   1589  O  OP2   . DG  A  1 79  ? 34.584 132.781 -11.978 1.00 96.96  ? 5   DG  I OP2   1 
ATOM   1590  O  "O5'" . DG  A  1 79  ? 35.673 130.572 -11.608 1.00 92.62  ? 5   DG  I "O5'" 1 
ATOM   1591  C  "C5'" . DG  A  1 79  ? 36.410 129.953 -10.559 1.00 91.82  ? 5   DG  I "C5'" 1 
ATOM   1592  C  "C4'" . DG  A  1 79  ? 35.475 129.280 -9.573  1.00 90.03  ? 5   DG  I "C4'" 1 
ATOM   1593  O  "O4'" . DG  A  1 79  ? 35.190 130.173 -8.457  1.00 91.24  ? 5   DG  I "O4'" 1 
ATOM   1594  C  "C3'" . DG  A  1 79  ? 34.107 128.879 -10.147 1.00 91.87  ? 5   DG  I "C3'" 1 
ATOM   1595  O  "O3'" . DG  A  1 79  ? 33.745 127.598 -9.653  1.00 87.90  ? 5   DG  I "O3'" 1 
ATOM   1596  C  "C2'" . DG  A  1 79  ? 33.189 129.956 -9.576  1.00 95.25  ? 5   DG  I "C2'" 1 
ATOM   1597  C  "C1'" . DG  A  1 79  ? 33.812 130.094 -8.204  1.00 96.69  ? 5   DG  I "C1'" 1 
ATOM   1598  N  N9    . DG  A  1 79  ? 33.367 131.251 -7.430  1.00 113.10 ? 5   DG  I N9    1 
ATOM   1599  C  C8    . DG  A  1 79  ? 32.965 132.475 -7.903  1.00 121.63 ? 5   DG  I C8    1 
ATOM   1600  N  N7    . DG  A  1 79  ? 32.615 133.307 -6.958  1.00 125.49 ? 5   DG  I N7    1 
ATOM   1601  C  C5    . DG  A  1 79  ? 32.782 132.578 -5.785  1.00 124.44 ? 5   DG  I C5    1 
ATOM   1602  C  C6    . DG  A  1 79  ? 32.559 132.948 -4.434  1.00 142.86 ? 5   DG  I C6    1 
ATOM   1603  O  O6    . DG  A  1 79  ? 32.153 134.031 -3.987  1.00 172.53 ? 5   DG  I O6    1 
ATOM   1604  N  N1    . DG  A  1 79  ? 32.857 131.904 -3.559  1.00 132.09 ? 5   DG  I N1    1 
ATOM   1605  C  C2    . DG  A  1 79  ? 33.310 130.663 -3.943  1.00 122.80 ? 5   DG  I C2    1 
ATOM   1606  N  N2    . DG  A  1 79  ? 33.547 129.778 -2.967  1.00 122.25 ? 5   DG  I N2    1 
ATOM   1607  N  N3    . DG  A  1 79  ? 33.524 130.310 -5.200  1.00 115.25 ? 5   DG  I N3    1 
ATOM   1608  C  C4    . DG  A  1 79  ? 33.240 131.312 -6.063  1.00 116.80 ? 5   DG  I C4    1 
ATOM   1609  P  P     . DC  A  1 80  ? 33.951 126.278 -10.545 1.00 96.32  ? 6   DC  I P     1 
ATOM   1610  O  OP1   . DC  A  1 80  ? 35.240 126.408 -11.260 1.00 95.75  ? 6   DC  I OP1   1 
ATOM   1611  O  OP2   . DC  A  1 80  ? 32.707 126.052 -11.314 1.00 93.70  ? 6   DC  I OP2   1 
ATOM   1612  O  "O5'" . DC  A  1 80  ? 34.074 125.113 -9.456  1.00 88.63  ? 6   DC  I "O5'" 1 
ATOM   1613  C  "C5'" . DC  A  1 80  ? 35.149 125.129 -8.525  1.00 82.74  ? 6   DC  I "C5'" 1 
ATOM   1614  C  "C4'" . DC  A  1 80  ? 34.669 124.844 -7.111  1.00 75.51  ? 6   DC  I "C4'" 1 
ATOM   1615  O  "O4'" . DC  A  1 80  ? 34.068 126.035 -6.531  1.00 76.88  ? 6   DC  I "O4'" 1 
ATOM   1616  C  "C3'" . DC  A  1 80  ? 33.617 123.748 -6.980  1.00 74.21  ? 6   DC  I "C3'" 1 
ATOM   1617  O  "O3'" . DC  A  1 80  ? 33.854 123.042 -5.784  1.00 76.28  ? 6   DC  I "O3'" 1 
ATOM   1618  C  "C2'" . DC  A  1 80  ? 32.321 124.550 -6.891  1.00 79.13  ? 6   DC  I "C2'" 1 
ATOM   1619  C  "C1'" . DC  A  1 80  ? 32.787 125.709 -6.032  1.00 79.44  ? 6   DC  I "C1'" 1 
ATOM   1620  N  N1    . DC  A  1 80  ? 31.941 126.926 -6.117  1.00 82.15  ? 6   DC  I N1    1 
ATOM   1621  C  C2    . DC  A  1 80  ? 31.461 127.527 -4.944  1.00 88.58  ? 6   DC  I C2    1 
ATOM   1622  O  O2    . DC  A  1 80  ? 31.721 127.013 -3.847  1.00 95.53  ? 6   DC  I O2    1 
ATOM   1623  N  N3    . DC  A  1 80  ? 30.711 128.652 -5.047  1.00 86.65  ? 6   DC  I N3    1 
ATOM   1624  C  C4    . DC  A  1 80  ? 30.454 129.174 -6.246  1.00 87.77  ? 6   DC  I C4    1 
ATOM   1625  N  N4    . DC  A  1 80  ? 29.713 130.283 -6.302  1.00 90.66  ? 6   DC  I N4    1 
ATOM   1626  C  C5    . DC  A  1 80  ? 30.936 128.579 -7.444  1.00 89.09  ? 6   DC  I C5    1 
ATOM   1627  C  C6    . DC  A  1 80  ? 31.675 127.474 -7.334  1.00 85.92  ? 6   DC  I C6    1 
ATOM   1628  P  P     . DT  A  1 81  ? 33.703 121.446 -5.730  1.00 69.36  ? 7   DT  I P     1 
ATOM   1629  O  OP1   . DT  A  1 81  ? 35.009 120.912 -5.280  1.00 59.68  ? 7   DT  I OP1   1 
ATOM   1630  O  OP2   . DT  A  1 81  ? 33.112 120.988 -7.008  1.00 64.63  ? 7   DT  I OP2   1 
ATOM   1631  O  "O5'" . DT  A  1 81  ? 32.635 121.223 -4.564  1.00 68.33  ? 7   DT  I "O5'" 1 
ATOM   1632  C  "C5'" . DT  A  1 81  ? 32.918 121.704 -3.262  1.00 66.05  ? 7   DT  I "C5'" 1 
ATOM   1633  C  "C4'" . DT  A  1 81  ? 31.673 122.270 -2.606  1.00 66.60  ? 7   DT  I "C4'" 1 
ATOM   1634  O  "O4'" . DT  A  1 81  ? 31.195 123.403 -3.354  1.00 72.54  ? 7   DT  I "O4'" 1 
ATOM   1635  C  "C3'" . DT  A  1 81  ? 30.493 121.305 -2.500  1.00 64.84  ? 7   DT  I "C3'" 1 
ATOM   1636  O  "O3'" . DT  A  1 81  ? 30.338 120.910 -1.135  1.00 58.28  ? 7   DT  I "O3'" 1 
ATOM   1637  C  "C2'" . DT  A  1 81  ? 29.284 122.111 -3.023  1.00 73.07  ? 7   DT  I "C2'" 1 
ATOM   1638  C  "C1'" . DT  A  1 81  ? 29.820 123.534 -3.120  1.00 79.98  ? 7   DT  I "C1'" 1 
ATOM   1639  N  N1    . DT  A  1 81  ? 29.232 124.331 -4.241  1.00 85.34  ? 7   DT  I N1    1 
ATOM   1640  C  C2    . DT  A  1 81  ? 28.662 125.554 -3.970  1.00 87.63  ? 7   DT  I C2    1 
ATOM   1641  O  O2    . DT  A  1 81  ? 28.598 126.028 -2.851  1.00 93.91  ? 7   DT  I O2    1 
ATOM   1642  N  N3    . DT  A  1 81  ? 28.167 126.209 -5.067  1.00 88.51  ? 7   DT  I N3    1 
ATOM   1643  C  C4    . DT  A  1 81  ? 28.184 125.776 -6.378  1.00 90.91  ? 7   DT  I C4    1 
ATOM   1644  O  O4    . DT  A  1 81  ? 27.710 126.441 -7.294  1.00 93.62  ? 7   DT  I O4    1 
ATOM   1645  C  C5    . DT  A  1 81  ? 28.798 124.487 -6.594  1.00 86.80  ? 7   DT  I C5    1 
ATOM   1646  C  C7    . DT  A  1 81  ? 28.874 123.910 -7.976  1.00 90.42  ? 7   DT  I C7    1 
ATOM   1647  C  C6    . DT  A  1 81  ? 29.286 123.835 -5.527  1.00 83.50  ? 7   DT  I C6    1 
ATOM   1648  P  P     . DG  A  1 82  ? 29.101 120.005 -0.650  1.00 57.40  ? 8   DG  I P     1 
ATOM   1649  O  OP1   . DG  A  1 82  ? 29.647 119.037 0.326   1.00 69.28  ? 8   DG  I OP1   1 
ATOM   1650  O  OP2   . DG  A  1 82  ? 28.339 119.505 -1.816  1.00 61.18  ? 8   DG  I OP2   1 
ATOM   1651  O  "O5'" . DG  A  1 82  ? 28.190 121.039 0.154   1.00 60.03  ? 8   DG  I "O5'" 1 
ATOM   1652  C  "C5'" . DG  A  1 82  ? 28.791 121.891 1.127   1.00 61.27  ? 8   DG  I "C5'" 1 
ATOM   1653  C  "C4'" . DG  A  1 82  ? 27.751 122.715 1.869   1.00 63.81  ? 8   DG  I "C4'" 1 
ATOM   1654  O  "O4'" . DG  A  1 82  ? 27.241 123.760 1.009   1.00 75.09  ? 8   DG  I "O4'" 1 
ATOM   1655  C  "C3'" . DG  A  1 82  ? 26.529 121.954 2.353   1.00 63.46  ? 8   DG  I "C3'" 1 
ATOM   1656  O  "O3'" . DG  A  1 82  ? 26.033 122.572 3.527   1.00 66.58  ? 8   DG  I "O3'" 1 
ATOM   1657  C  "C2'" . DG  A  1 82  ? 25.555 122.098 1.184   1.00 64.44  ? 8   DG  I "C2'" 1 
ATOM   1658  C  "C1'" . DG  A  1 82  ? 25.902 123.483 0.638   1.00 73.08  ? 8   DG  I "C1'" 1 
ATOM   1659  N  N9    . DG  A  1 82  ? 25.822 123.585 -0.816  1.00 73.34  ? 8   DG  I N9    1 
ATOM   1660  C  C8    . DG  A  1 82  ? 26.310 122.694 -1.740  1.00 70.49  ? 8   DG  I C8    1 
ATOM   1661  N  N7    . DG  A  1 82  ? 26.115 123.066 -2.976  1.00 70.39  ? 8   DG  I N7    1 
ATOM   1662  C  C5    . DG  A  1 82  ? 25.459 124.285 -2.862  1.00 76.07  ? 8   DG  I C5    1 
ATOM   1663  C  C6    . DG  A  1 82  ? 24.984 125.166 -3.863  1.00 81.83  ? 8   DG  I C6    1 
ATOM   1664  O  O6    . DG  A  1 82  ? 25.053 125.041 -5.094  1.00 82.90  ? 8   DG  I O6    1 
ATOM   1665  N  N1    . DG  A  1 82  ? 24.375 126.291 -3.311  1.00 88.77  ? 8   DG  I N1    1 
ATOM   1666  C  C2    . DG  A  1 82  ? 24.245 126.533 -1.963  1.00 88.66  ? 8   DG  I C2    1 
ATOM   1667  N  N2    . DG  A  1 82  ? 23.632 127.670 -1.610  1.00 95.26  ? 8   DG  I N2    1 
ATOM   1668  N  N3    . DG  A  1 82  ? 24.686 125.716 -1.020  1.00 79.11  ? 8   DG  I N3    1 
ATOM   1669  C  C4    . DG  A  1 82  ? 25.278 124.618 -1.538  1.00 74.72  ? 8   DG  I C4    1 
ATOM   1670  P  P     . DA  A  1 83  ? 24.771 121.959 4.307   1.00 65.72  ? 9   DA  I P     1 
ATOM   1671  O  OP1   . DA  A  1 83  ? 25.003 122.201 5.748   1.00 70.24  ? 9   DA  I OP1   1 
ATOM   1672  O  OP2   . DA  A  1 83  ? 24.544 120.581 3.819   1.00 72.16  ? 9   DA  I OP2   1 
ATOM   1673  O  "O5'" . DA  A  1 83  ? 23.554 122.877 3.829   1.00 75.60  ? 9   DA  I "O5'" 1 
ATOM   1674  C  "C5'" . DA  A  1 83  ? 23.640 124.289 3.982   1.00 84.26  ? 9   DA  I "C5'" 1 
ATOM   1675  C  "C4'" . DA  A  1 83  ? 22.334 124.970 3.605   1.00 86.55  ? 9   DA  I "C4'" 1 
ATOM   1676  O  "O4'" . DA  A  1 83  ? 22.297 125.220 2.177   1.00 83.32  ? 9   DA  I "O4'" 1 
ATOM   1677  C  "C3'" . DA  A  1 83  ? 21.066 124.191 3.927   1.00 83.63  ? 9   DA  I "C3'" 1 
ATOM   1678  O  "O3'" . DA  A  1 83  ? 20.049 125.107 4.296   1.00 86.58  ? 9   DA  I "O3'" 1 
ATOM   1679  C  "C2'" . DA  A  1 83  ? 20.751 123.501 2.598   1.00 81.93  ? 9   DA  I "C2'" 1 
ATOM   1680  C  "C1'" . DA  A  1 83  ? 21.186 124.563 1.598   1.00 83.28  ? 9   DA  I "C1'" 1 
ATOM   1681  N  N9    . DA  A  1 83  ? 21.618 124.037 0.307   1.00 86.97  ? 9   DA  I N9    1 
ATOM   1682  C  C8    . DA  A  1 83  ? 22.431 122.961 0.082   1.00 86.85  ? 9   DA  I C8    1 
ATOM   1683  N  N7    . DA  A  1 83  ? 22.675 122.738 -1.189  1.00 84.95  ? 9   DA  I N7    1 
ATOM   1684  C  C5    . DA  A  1 83  ? 21.985 123.747 -1.840  1.00 85.27  ? 9   DA  I C5    1 
ATOM   1685  C  C6    . DA  A  1 83  ? 21.839 124.073 -3.203  1.00 78.60  ? 9   DA  I C6    1 
ATOM   1686  N  N6    . DA  A  1 83  ? 22.409 123.377 -4.193  1.00 69.87  ? 9   DA  I N6    1 
ATOM   1687  N  N1    . DA  A  1 83  ? 21.081 125.145 -3.512  1.00 83.43  ? 9   DA  I N1    1 
ATOM   1688  C  C2    . DA  A  1 83  ? 20.509 125.838 -2.521  1.00 90.12  ? 9   DA  I C2    1 
ATOM   1689  N  N3    . DA  A  1 83  ? 20.574 125.631 -1.208  1.00 92.61  ? 9   DA  I N3    1 
ATOM   1690  C  C4    . DA  A  1 83  ? 21.334 124.560 -0.932  1.00 88.53  ? 9   DA  I C4    1 
ATOM   1691  P  P     . DA  A  1 84  ? 18.668 124.597 4.937   1.00 91.54  ? 10  DA  I P     1 
ATOM   1692  O  OP1   . DA  A  1 84  ? 18.401 125.438 6.126   1.00 85.05  ? 10  DA  I OP1   1 
ATOM   1693  O  OP2   . DA  A  1 84  ? 18.728 123.125 5.073   1.00 90.24  ? 10  DA  I OP2   1 
ATOM   1694  O  "O5'" . DA  A  1 84  ? 17.591 124.957 3.815   1.00 95.06  ? 10  DA  I "O5'" 1 
ATOM   1695  C  "C5'" . DA  A  1 84  ? 17.557 126.270 3.275   1.00 95.72  ? 10  DA  I "C5'" 1 
ATOM   1696  C  "C4'" . DA  A  1 84  ? 16.567 126.361 2.130   1.00 93.76  ? 10  DA  I "C4'" 1 
ATOM   1697  O  "O4'" . DA  A  1 84  ? 17.195 125.919 0.898   1.00 88.16  ? 10  DA  I "O4'" 1 
ATOM   1698  C  "C3'" . DA  A  1 84  ? 15.305 125.519 2.293   1.00 95.04  ? 10  DA  I "C3'" 1 
ATOM   1699  O  "O3'" . DA  A  1 84  ? 14.190 126.265 1.836   1.00 103.49 ? 10  DA  I "O3'" 1 
ATOM   1700  C  "C2'" . DA  A  1 84  ? 15.582 124.305 1.403   1.00 88.22  ? 10  DA  I "C2'" 1 
ATOM   1701  C  "C1'" . DA  A  1 84  ? 16.395 124.934 0.284   1.00 87.45  ? 10  DA  I "C1'" 1 
ATOM   1702  N  N9    . DA  A  1 84  ? 17.281 124.000 -0.405  1.00 88.23  ? 10  DA  I N9    1 
ATOM   1703  C  C8    . DA  A  1 84  ? 18.113 123.077 0.166   1.00 87.87  ? 10  DA  I C8    1 
ATOM   1704  N  N7    . DA  A  1 84  ? 18.807 122.381 -0.705  1.00 86.23  ? 10  DA  I N7    1 
ATOM   1705  C  C5    . DA  A  1 84  ? 18.407 122.888 -1.930  1.00 85.58  ? 10  DA  I C5    1 
ATOM   1706  C  C6    . DA  A  1 84  ? 18.774 122.574 -3.255  1.00 85.36  ? 10  DA  I C6    1 
ATOM   1707  N  N6    . DA  A  1 84  ? 19.668 121.630 -3.569  1.00 84.16  ? 10  DA  I N6    1 
ATOM   1708  N  N1    . DA  A  1 84  ? 18.182 123.269 -4.249  1.00 88.90  ? 10  DA  I N1    1 
ATOM   1709  C  C2    . DA  A  1 84  ? 17.289 124.214 -3.931  1.00 91.13  ? 10  DA  I C2    1 
ATOM   1710  N  N3    . DA  A  1 84  ? 16.867 124.598 -2.729  1.00 90.80  ? 10  DA  I N3    1 
ATOM   1711  C  C4    . DA  A  1 84  ? 17.471 123.890 -1.762  1.00 88.95  ? 10  DA  I C4    1 
ATOM   1712  P  P     . DC  A  1 85  ? 12.688 125.761 2.097   1.00 107.38 ? 11  DC  I P     1 
ATOM   1713  O  OP1   . DC  A  1 85  ? 12.009 126.804 2.897   1.00 109.47 ? 11  DC  I OP1   1 
ATOM   1714  O  OP2   . DC  A  1 85  ? 12.718 124.367 2.592   1.00 104.78 ? 11  DC  I OP2   1 
ATOM   1715  O  "O5'" . DC  A  1 85  ? 12.058 125.749 0.632   1.00 112.12 ? 11  DC  I "O5'" 1 
ATOM   1716  C  "C5'" . DC  A  1 85  ? 12.589 126.614 -0.369  1.00 111.67 ? 11  DC  I "C5'" 1 
ATOM   1717  C  "C4'" . DC  A  1 85  ? 12.197 126.131 -1.750  1.00 105.10 ? 11  DC  I "C4'" 1 
ATOM   1718  O  "O4'" . DC  A  1 85  ? 13.268 125.326 -2.313  1.00 102.88 ? 11  DC  I "O4'" 1 
ATOM   1719  C  "C3'" . DC  A  1 85  ? 10.942 125.258 -1.779  1.00 98.64  ? 11  DC  I "C3'" 1 
ATOM   1720  O  "O3'" . DC  A  1 85  ? 10.078 125.688 -2.812  1.00 97.02  ? 11  DC  I "O3'" 1 
ATOM   1721  C  "C2'" . DC  A  1 85  ? 11.487 123.854 -2.043  1.00 97.73  ? 11  DC  I "C2'" 1 
ATOM   1722  C  "C1'" . DC  A  1 85  ? 12.724 124.154 -2.871  1.00 95.92  ? 11  DC  I "C1'" 1 
ATOM   1723  N  N1    . DC  A  1 85  ? 13.760 123.076 -2.817  1.00 84.54  ? 11  DC  I N1    1 
ATOM   1724  C  C2    . DC  A  1 85  ? 14.283 122.556 -4.008  1.00 84.50  ? 11  DC  I C2    1 
ATOM   1725  O  O2    . DC  A  1 85  ? 13.875 123.003 -5.085  1.00 91.97  ? 11  DC  I O2    1 
ATOM   1726  N  N3    . DC  A  1 85  ? 15.223 121.578 -3.942  1.00 76.48  ? 11  DC  I N3    1 
ATOM   1727  C  C4    . DC  A  1 85  ? 15.632 121.126 -2.754  1.00 74.85  ? 11  DC  I C4    1 
ATOM   1728  N  N4    . DC  A  1 85  ? 16.559 120.161 -2.733  1.00 71.65  ? 11  DC  I N4    1 
ATOM   1729  C  C5    . DC  A  1 85  ? 15.108 121.642 -1.532  1.00 77.70  ? 11  DC  I C5    1 
ATOM   1730  C  C6    . DC  A  1 85  ? 14.185 122.606 -1.610  1.00 80.18  ? 11  DC  I C6    1 
ATOM   1731  P  P     . DA  A  1 86  ? 8.488  125.544 -2.642  1.00 101.17 ? 12  DA  I P     1 
ATOM   1732  O  OP1   . DA  A  1 86  ? 7.945  126.862 -2.243  1.00 99.41  ? 12  DA  I OP1   1 
ATOM   1733  O  OP2   . DA  A  1 86  ? 8.237  124.358 -1.795  1.00 99.47  ? 12  DA  I OP2   1 
ATOM   1734  O  "O5'" . DA  A  1 86  ? 7.989  125.194 -4.117  1.00 106.88 ? 12  DA  I "O5'" 1 
ATOM   1735  C  "C5'" . DA  A  1 86  ? 8.802  125.530 -5.232  1.00 105.98 ? 12  DA  I "C5'" 1 
ATOM   1736  C  "C4'" . DA  A  1 86  ? 8.612  124.528 -6.354  1.00 101.17 ? 12  DA  I "C4'" 1 
ATOM   1737  O  "O4'" . DA  A  1 86  ? 9.715  123.584 -6.366  1.00 93.96  ? 12  DA  I "O4'" 1 
ATOM   1738  C  "C3'" . DA  A  1 86  ? 7.336  123.698 -6.269  1.00 106.10 ? 12  DA  I "C3'" 1 
ATOM   1739  O  "O3'" . DA  A  1 86  ? 6.771  123.572 -7.567  1.00 116.88 ? 12  DA  I "O3'" 1 
ATOM   1740  C  "C2'" . DA  A  1 86  ? 7.825  122.356 -5.714  1.00 98.95  ? 12  DA  I "C2'" 1 
ATOM   1741  C  "C1'" . DA  A  1 86  ? 9.227  122.260 -6.296  1.00 93.57  ? 12  DA  I "C1'" 1 
ATOM   1742  N  N9    . DA  A  1 86  ? 10.156 121.492 -5.470  1.00 90.15  ? 12  DA  I N9    1 
ATOM   1743  C  C8    . DA  A  1 86  ? 10.307 121.573 -4.116  1.00 89.83  ? 12  DA  I C8    1 
ATOM   1744  N  N7    . DA  A  1 86  ? 11.234 120.780 -3.636  1.00 83.16  ? 12  DA  I N7    1 
ATOM   1745  C  C5    . DA  A  1 86  ? 11.731 120.136 -4.756  1.00 83.49  ? 12  DA  I C5    1 
ATOM   1746  C  C6    . DA  A  1 86  ? 12.737 119.164 -4.921  1.00 82.84  ? 12  DA  I C6    1 
ATOM   1747  N  N6    . DA  A  1 86  ? 13.444 118.663 -3.904  1.00 77.85  ? 12  DA  I N6    1 
ATOM   1748  N  N1    . DA  A  1 86  ? 12.988 118.728 -6.174  1.00 81.30  ? 12  DA  I N1    1 
ATOM   1749  C  C2    . DA  A  1 86  ? 12.277 119.238 -7.188  1.00 82.06  ? 12  DA  I C2    1 
ATOM   1750  N  N3    . DA  A  1 86  ? 11.307 120.153 -7.154  1.00 86.58  ? 12  DA  I N3    1 
ATOM   1751  C  C4    . DA  A  1 86  ? 11.082 120.565 -5.897  1.00 86.05  ? 12  DA  I C4    1 
ATOM   1752  P  P     . DT  A  1 87  ? 5.489  122.641 -7.832  1.00 118.27 ? 13  DT  I P     1 
ATOM   1753  O  OP1   . DT  A  1 87  ? 4.650  123.346 -8.827  1.00 120.39 ? 13  DT  I OP1   1 
ATOM   1754  O  OP2   . DT  A  1 87  ? 4.889  122.238 -6.540  1.00 121.17 ? 13  DT  I OP2   1 
ATOM   1755  O  "O5'" . DT  A  1 87  ? 6.121  121.354 -8.535  1.00 116.48 ? 13  DT  I "O5'" 1 
ATOM   1756  C  "C5'" . DT  A  1 87  ? 7.086  121.530 -9.563  1.00 112.67 ? 13  DT  I "C5'" 1 
ATOM   1757  C  "C4'" . DT  A  1 87  ? 7.562  120.196 -10.104 1.00 106.44 ? 13  DT  I "C4'" 1 
ATOM   1758  O  "O4'" . DT  A  1 87  ? 8.542  119.618 -9.204  1.00 103.72 ? 13  DT  I "O4'" 1 
ATOM   1759  C  "C3'" . DT  A  1 87  ? 6.473  119.144 -10.289 1.00 103.10 ? 13  DT  I "C3'" 1 
ATOM   1760  O  "O3'" . DT  A  1 87  ? 6.652  118.505 -11.542 1.00 96.54  ? 13  DT  I "O3'" 1 
ATOM   1761  C  "C2'" . DT  A  1 87  ? 6.703  118.183 -9.117  1.00 100.84 ? 13  DT  I "C2'" 1 
ATOM   1762  C  "C1'" . DT  A  1 87  ? 8.211  118.274 -8.939  1.00 98.04  ? 13  DT  I "C1'" 1 
ATOM   1763  N  N1    . DT  A  1 87  ? 8.692  117.947 -7.559  1.00 91.06  ? 13  DT  I N1    1 
ATOM   1764  C  C2    . DT  A  1 87  ? 9.704  117.027 -7.398  1.00 84.40  ? 13  DT  I C2    1 
ATOM   1765  O  O2    . DT  A  1 87  ? 10.225 116.437 -8.327  1.00 83.42  ? 13  DT  I O2    1 
ATOM   1766  N  N3    . DT  A  1 87  ? 10.084 116.814 -6.098  1.00 79.80  ? 13  DT  I N3    1 
ATOM   1767  C  C4    . DT  A  1 87  ? 9.570  117.422 -4.968  1.00 86.01  ? 13  DT  I C4    1 
ATOM   1768  O  O4    . DT  A  1 87  ? 9.980  117.163 -3.840  1.00 86.66  ? 13  DT  I O4    1 
ATOM   1769  C  C5    . DT  A  1 87  ? 8.519  118.381 -5.206  1.00 91.96  ? 13  DT  I C5    1 
ATOM   1770  C  C7    . DT  A  1 87  ? 7.882  119.103 -4.055  1.00 96.24  ? 13  DT  I C7    1 
ATOM   1771  C  C6    . DT  A  1 87  ? 8.138  118.598 -6.475  1.00 93.32  ? 13  DT  I C6    1 
ATOM   1772  P  P     . DG  A  1 88  ? 5.426  117.762 -12.265 1.00 92.76  ? 14  DG  I P     1 
ATOM   1773  O  OP1   . DG  A  1 88  ? 5.341  118.266 -13.653 1.00 88.58  ? 14  DG  I OP1   1 
ATOM   1774  O  OP2   . DG  A  1 88  ? 4.245  117.846 -11.377 1.00 95.38  ? 14  DG  I OP2   1 
ATOM   1775  O  "O5'" . DG  A  1 88  ? 5.907  116.243 -12.313 1.00 91.05  ? 14  DG  I "O5'" 1 
ATOM   1776  C  "C5'" . DG  A  1 88  ? 7.253  115.947 -12.655 1.00 91.49  ? 14  DG  I "C5'" 1 
ATOM   1777  C  "C4'" . DG  A  1 88  ? 7.670  114.610 -12.083 1.00 83.29  ? 14  DG  I "C4'" 1 
ATOM   1778  O  "O4'" . DG  A  1 88  ? 8.021  114.768 -10.682 1.00 82.38  ? 14  DG  I "O4'" 1 
ATOM   1779  C  "C3'" . DG  A  1 88  ? 6.581  113.529 -12.115 1.00 81.79  ? 14  DG  I "C3'" 1 
ATOM   1780  O  "O3'" . DG  A  1 88  ? 7.176  112.259 -12.357 1.00 77.09  ? 14  DG  I "O3'" 1 
ATOM   1781  C  "C2'" . DG  A  1 88  ? 6.029  113.604 -10.698 1.00 81.90  ? 14  DG  I "C2'" 1 
ATOM   1782  C  "C1'" . DG  A  1 88  ? 7.335  113.783 -9.955  1.00 84.48  ? 14  DG  I "C1'" 1 
ATOM   1783  N  N9    . DG  A  1 88  ? 7.203  114.187 -8.558  1.00 86.32  ? 14  DG  I N9    1 
ATOM   1784  C  C8    . DG  A  1 88  ? 6.290  115.057 -8.014  1.00 89.15  ? 14  DG  I C8    1 
ATOM   1785  N  N7    . DG  A  1 88  ? 6.428  115.213 -6.724  1.00 88.84  ? 14  DG  I N7    1 
ATOM   1786  C  C5    . DG  A  1 88  ? 7.497  114.387 -6.397  1.00 85.40  ? 14  DG  I C5    1 
ATOM   1787  C  C6    . DG  A  1 88  ? 8.111  114.135 -5.146  1.00 82.00  ? 14  DG  I C6    1 
ATOM   1788  O  O6    . DG  A  1 88  ? 7.822  114.607 -4.039  1.00 89.73  ? 14  DG  I O6    1 
ATOM   1789  N  N1    . DG  A  1 88  ? 9.162  113.228 -5.263  1.00 81.86  ? 14  DG  I N1    1 
ATOM   1790  C  C2    . DG  A  1 88  ? 9.569  112.644 -6.440  1.00 82.85  ? 14  DG  I C2    1 
ATOM   1791  N  N2    . DG  A  1 88  ? 10.601 111.793 -6.367  1.00 78.90  ? 14  DG  I N2    1 
ATOM   1792  N  N3    . DG  A  1 88  ? 9.003  112.873 -7.612  1.00 81.30  ? 14  DG  I N3    1 
ATOM   1793  C  C4    . DG  A  1 88  ? 7.978  113.749 -7.515  1.00 84.45  ? 14  DG  I C4    1 
ATOM   1794  P  P     . DC  A  1 89  ? 7.414  111.734 -13.858 1.00 71.91  ? 15  DC  I P     1 
ATOM   1795  O  OP1   . DC  A  1 89  ? 7.805  112.882 -14.706 1.00 69.18  ? 15  DC  I OP1   1 
ATOM   1796  O  OP2   . DC  A  1 89  ? 6.231  110.928 -14.233 1.00 72.06  ? 15  DC  I OP2   1 
ATOM   1797  O  "O5'" . DC  A  1 89  ? 8.660  110.736 -13.717 1.00 68.16  ? 15  DC  I "O5'" 1 
ATOM   1798  C  "C5'" . DC  A  1 89  ? 9.820  111.128 -12.963 1.00 74.80  ? 15  DC  I "C5'" 1 
ATOM   1799  C  "C4'" . DC  A  1 89  ? 10.490 109.933 -12.289 1.00 77.48  ? 15  DC  I "C4'" 1 
ATOM   1800  O  "O4'" . DC  A  1 89  ? 10.270 110.002 -10.855 1.00 82.03  ? 15  DC  I "O4'" 1 
ATOM   1801  C  "C3'" . DC  A  1 89  ? 9.949  108.568 -12.675 1.00 83.40  ? 15  DC  I "C3'" 1 
ATOM   1802  O  "O3'" . DC  A  1 89  ? 10.884 107.566 -12.282 1.00 85.33  ? 15  DC  I "O3'" 1 
ATOM   1803  C  "C2'" . DC  A  1 89  ? 8.731  108.504 -11.774 1.00 88.11  ? 15  DC  I "C2'" 1 
ATOM   1804  C  "C1'" . DC  A  1 89  ? 9.366  108.973 -10.475 1.00 83.86  ? 15  DC  I "C1'" 1 
ATOM   1805  N  N1    . DC  A  1 89  ? 8.413  109.537 -9.493  1.00 82.92  ? 15  DC  I N1    1 
ATOM   1806  C  C2    . DC  A  1 89  ? 8.662  109.380 -8.128  1.00 84.33  ? 15  DC  I C2    1 
ATOM   1807  O  O2    . DC  A  1 89  ? 9.666  108.754 -7.772  1.00 86.11  ? 15  DC  I O2    1 
ATOM   1808  N  N3    . DC  A  1 89  ? 7.793  109.915 -7.238  1.00 87.67  ? 15  DC  I N3    1 
ATOM   1809  C  C4    . DC  A  1 89  ? 6.725  110.585 -7.670  1.00 85.18  ? 15  DC  I C4    1 
ATOM   1810  N  N4    . DC  A  1 89  ? 5.894  111.097 -6.758  1.00 88.36  ? 15  DC  I N4    1 
ATOM   1811  C  C5    . DC  A  1 89  ? 6.454  110.748 -9.054  1.00 87.34  ? 15  DC  I C5    1 
ATOM   1812  C  C6    . DC  A  1 89  ? 7.322  110.225 -9.924  1.00 87.66  ? 15  DC  I C6    1 
ATOM   1813  P  P     . DC  A  1 90  ? 12.123 107.146 -13.215 1.00 87.30  ? 16  DC  I P     1 
ATOM   1814  O  OP1   . DC  A  1 90  ? 13.007 108.320 -13.390 1.00 85.79  ? 16  DC  I OP1   1 
ATOM   1815  O  OP2   . DC  A  1 90  ? 11.576 106.448 -14.399 1.00 89.33  ? 16  DC  I OP2   1 
ATOM   1816  O  "O5'" . DC  A  1 90  ? 12.899 106.069 -12.320 1.00 82.65  ? 16  DC  I "O5'" 1 
ATOM   1817  C  "C5'" . DC  A  1 90  ? 13.390 106.440 -11.029 1.00 77.14  ? 16  DC  I "C5'" 1 
ATOM   1818  C  "C4'" . DC  A  1 90  ? 12.953 105.451 -9.956  1.00 71.11  ? 16  DC  I "C4'" 1 
ATOM   1819  O  "O4'" . DC  A  1 90  ? 11.666 105.851 -9.400  1.00 72.53  ? 16  DC  I "O4'" 1 
ATOM   1820  C  "C3'" . DC  A  1 90  ? 12.761 104.007 -10.421 1.00 68.47  ? 16  DC  I "C3'" 1 
ATOM   1821  O  "O3'" . DC  A  1 90  ? 13.120 103.122 -9.364  1.00 69.73  ? 16  DC  I "O3'" 1 
ATOM   1822  C  "C2'" . DC  A  1 90  ? 11.257 103.965 -10.662 1.00 69.60  ? 16  DC  I "C2'" 1 
ATOM   1823  C  "C1'" . DC  A  1 90  ? 10.800 104.737 -9.443  1.00 68.07  ? 16  DC  I "C1'" 1 
ATOM   1824  N  N1    . DC  A  1 90  ? 9.388  105.217 -9.498  1.00 68.71  ? 16  DC  I N1    1 
ATOM   1825  C  C2    . DC  A  1 90  ? 8.758  105.626 -8.318  1.00 80.15  ? 16  DC  I C2    1 
ATOM   1826  O  O2    . DC  A  1 90  ? 9.390  105.583 -7.257  1.00 87.65  ? 16  DC  I O2    1 
ATOM   1827  N  N3    . DC  A  1 90  ? 7.475  106.063 -8.376  1.00 82.85  ? 16  DC  I N3    1 
ATOM   1828  C  C4    . DC  A  1 90  ? 6.834  106.096 -9.545  1.00 77.65  ? 16  DC  I C4    1 
ATOM   1829  N  N4    . DC  A  1 90  ? 5.571  106.534 -9.556  1.00 82.02  ? 16  DC  I N4    1 
ATOM   1830  C  C5    . DC  A  1 90  ? 7.456  105.669 -10.754 1.00 69.05  ? 16  DC  I C5    1 
ATOM   1831  C  C6    . DC  A  1 90  ? 8.723  105.246 -10.686 1.00 65.79  ? 16  DC  I C6    1 
ATOM   1832  P  P     . DT  A  1 91  ? 14.589 102.477 -9.279  1.00 66.59  ? 17  DT  I P     1 
ATOM   1833  O  OP1   . DT  A  1 91  ? 15.585 103.527 -9.593  1.00 63.51  ? 17  DT  I OP1   1 
ATOM   1834  O  OP2   . DT  A  1 91  ? 14.567 101.223 -10.066 1.00 68.30  ? 17  DT  I OP2   1 
ATOM   1835  O  "O5'" . DT  A  1 91  ? 14.736 102.097 -7.733  1.00 64.14  ? 17  DT  I "O5'" 1 
ATOM   1836  C  "C5'" . DT  A  1 91  ? 14.971 103.126 -6.775  1.00 63.55  ? 17  DT  I "C5'" 1 
ATOM   1837  C  "C4'" . DT  A  1 91  ? 14.053 102.982 -5.572  1.00 59.62  ? 17  DT  I "C4'" 1 
ATOM   1838  O  "O4'" . DT  A  1 91  ? 12.685 103.280 -5.952  1.00 64.34  ? 17  DT  I "O4'" 1 
ATOM   1839  C  "C3'" . DT  A  1 91  ? 14.031 101.593 -4.927  1.00 58.01  ? 17  DT  I "C3'" 1 
ATOM   1840  O  "O3'" . DT  A  1 91  ? 14.167 101.724 -3.525  1.00 56.86  ? 17  DT  I "O3'" 1 
ATOM   1841  C  "C2'" . DT  A  1 91  ? 12.656 101.040 -5.310  1.00 68.66  ? 17  DT  I "C2'" 1 
ATOM   1842  C  "C1'" . DT  A  1 91  ? 11.825 102.309 -5.403  1.00 73.94  ? 17  DT  I "C1'" 1 
ATOM   1843  N  N1    . DT  A  1 91  ? 10.625 102.196 -6.291  1.00 83.73  ? 17  DT  I N1    1 
ATOM   1844  C  C2    . DT  A  1 91  ? 9.405  102.652 -5.839  1.00 89.93  ? 17  DT  I C2    1 
ATOM   1845  O  O2    . DT  A  1 91  ? 9.239  103.132 -4.731  1.00 95.86  ? 17  DT  I O2    1 
ATOM   1846  N  N3    . DT  A  1 91  ? 8.377  102.518 -6.736  1.00 89.00  ? 17  DT  I N3    1 
ATOM   1847  C  C4    . DT  A  1 91  ? 8.442  101.992 -8.012  1.00 86.82  ? 17  DT  I C4    1 
ATOM   1848  O  O4    . DT  A  1 91  ? 7.458  101.915 -8.742  1.00 88.63  ? 17  DT  I O4    1 
ATOM   1849  C  C5    . DT  A  1 91  ? 9.749  101.537 -8.425  1.00 81.25  ? 17  DT  I C5    1 
ATOM   1850  C  C7    . DT  A  1 91  ? 9.941  100.940 -9.787  1.00 75.56  ? 17  DT  I C7    1 
ATOM   1851  C  C6    . DT  A  1 91  ? 10.766 101.666 -7.558  1.00 84.42  ? 17  DT  I C6    1 
ATOM   1852  P  P     . DT  A  1 92  ? 14.619 100.476 -2.621  1.00 63.14  ? 18  DT  I P     1 
ATOM   1853  O  OP1   . DT  A  1 92  ? 15.856 100.861 -1.904  1.00 52.75  ? 18  DT  I OP1   1 
ATOM   1854  O  OP2   . DT  A  1 92  ? 14.608 99.266  -3.472  1.00 65.72  ? 18  DT  I OP2   1 
ATOM   1855  O  "O5'" . DT  A  1 92  ? 13.425 100.332 -1.569  1.00 71.39  ? 18  DT  I "O5'" 1 
ATOM   1856  C  "C5'" . DT  A  1 92  ? 12.746 101.492 -1.117  1.00 58.82  ? 18  DT  I "C5'" 1 
ATOM   1857  C  "C4'" . DT  A  1 92  ? 11.346 101.147 -0.649  1.00 61.81  ? 18  DT  I "C4'" 1 
ATOM   1858  O  "O4'" . DT  A  1 92  ? 10.426 101.177 -1.769  1.00 67.03  ? 18  DT  I "O4'" 1 
ATOM   1859  C  "C3'" . DT  A  1 92  ? 11.196 99.767  -0.006  1.00 69.19  ? 18  DT  I "C3'" 1 
ATOM   1860  O  "O3'" . DT  A  1 92  ? 10.521 99.906  1.236   1.00 71.72  ? 18  DT  I "O3'" 1 
ATOM   1861  C  "C2'" . DT  A  1 92  ? 10.367 98.975  -1.029  1.00 68.22  ? 18  DT  I "C2'" 1 
ATOM   1862  C  "C1'" . DT  A  1 92  ? 9.549  100.082 -1.669  1.00 70.18  ? 18  DT  I "C1'" 1 
ATOM   1863  N  N1    . DT  A  1 92  ? 9.028  99.771  -3.038  1.00 70.65  ? 18  DT  I N1    1 
ATOM   1864  C  C2    . DT  A  1 92  ? 7.695  99.990  -3.309  1.00 76.87  ? 18  DT  I C2    1 
ATOM   1865  O  O2    . DT  A  1 92  ? 6.907  100.407 -2.480  1.00 82.55  ? 18  DT  I O2    1 
ATOM   1866  N  N3    . DT  A  1 92  ? 7.313  99.697  -4.591  1.00 77.59  ? 18  DT  I N3    1 
ATOM   1867  C  C4    . DT  A  1 92  ? 8.113  99.220  -5.613  1.00 78.16  ? 18  DT  I C4    1 
ATOM   1868  O  O4    . DT  A  1 92  ? 7.675  98.987  -6.735  1.00 85.22  ? 18  DT  I O4    1 
ATOM   1869  C  C5    . DT  A  1 92  ? 9.502  99.018  -5.267  1.00 69.78  ? 18  DT  I C5    1 
ATOM   1870  C  C7    . DT  A  1 92  ? 10.463 98.499  -6.297  1.00 67.82  ? 18  DT  I C7    1 
ATOM   1871  C  C6    . DT  A  1 92  ? 9.891  99.304  -4.011  1.00 67.35  ? 18  DT  I C6    1 
ATOM   1872  P  P     . DT  A  1 93  ? 10.350 98.653  2.224   1.00 72.09  ? 19  DT  I P     1 
ATOM   1873  O  OP1   . DT  A  1 93  ? 10.452 99.163  3.610   1.00 78.97  ? 19  DT  I OP1   1 
ATOM   1874  O  OP2   . DT  A  1 93  ? 11.256 97.577  1.767   1.00 77.38  ? 19  DT  I OP2   1 
ATOM   1875  O  "O5'" . DT  A  1 93  ? 8.847  98.186  1.965   1.00 71.17  ? 19  DT  I "O5'" 1 
ATOM   1876  C  "C5'" . DT  A  1 93  ? 7.824  99.161  1.834   1.00 77.34  ? 19  DT  I "C5'" 1 
ATOM   1877  C  "C4'" . DT  A  1 93  ? 6.475  98.501  1.641   1.00 87.93  ? 19  DT  I "C4'" 1 
ATOM   1878  O  "O4'" . DT  A  1 93  ? 6.167  98.406  0.225   1.00 95.00  ? 19  DT  I "O4'" 1 
ATOM   1879  C  "C3'" . DT  A  1 93  ? 6.368  97.083  2.196   1.00 93.48  ? 19  DT  I "C3'" 1 
ATOM   1880  O  "O3'" . DT  A  1 93  ? 5.107  96.921  2.818   1.00 100.03 ? 19  DT  I "O3'" 1 
ATOM   1881  C  "C2'" . DT  A  1 93  ? 6.500  96.211  0.945   1.00 98.34  ? 19  DT  I "C2'" 1 
ATOM   1882  C  "C1'" . DT  A  1 93  ? 5.809  97.079  -0.091  1.00 98.61  ? 19  DT  I "C1'" 1 
ATOM   1883  N  N1    . DT  A  1 93  ? 6.227  96.810  -1.496  1.00 99.46  ? 19  DT  I N1    1 
ATOM   1884  C  C2    . DT  A  1 93  ? 5.290  96.898  -2.497  1.00 109.11 ? 19  DT  I C2    1 
ATOM   1885  O  O2    . DT  A  1 93  ? 4.121  97.173  -2.293  1.00 115.22 ? 19  DT  I O2    1 
ATOM   1886  N  N3    . DT  A  1 93  ? 5.766  96.646  -3.754  1.00 105.57 ? 19  DT  I N3    1 
ATOM   1887  C  C4    . DT  A  1 93  ? 7.063  96.325  -4.107  1.00 99.40  ? 19  DT  I C4    1 
ATOM   1888  O  O4    . DT  A  1 93  ? 7.392  96.117  -5.271  1.00 100.97 ? 19  DT  I O4    1 
ATOM   1889  C  C5    . DT  A  1 93  ? 8.002  96.252  -3.009  1.00 91.80  ? 19  DT  I C5    1 
ATOM   1890  C  C7    . DT  A  1 93  ? 9.440  95.910  -3.269  1.00 83.93  ? 19  DT  I C7    1 
ATOM   1891  C  C6    . DT  A  1 93  ? 7.544  96.498  -1.769  1.00 92.72  ? 19  DT  I C6    1 
ATOM   1892  P  P     . DT  A  1 94  ? 4.826  95.670  3.783   1.00 101.84 ? 20  DT  I P     1 
ATOM   1893  O  OP1   . DT  A  1 94  ? 4.346  96.206  5.076   1.00 108.17 ? 20  DT  I OP1   1 
ATOM   1894  O  OP2   . DT  A  1 94  ? 6.008  94.780  3.749   1.00 99.68  ? 20  DT  I OP2   1 
ATOM   1895  O  "O5'" . DT  A  1 94  ? 3.622  94.917  3.058   1.00 106.25 ? 20  DT  I "O5'" 1 
ATOM   1896  C  "C5'" . DT  A  1 94  ? 2.718  95.655  2.249   1.00 113.97 ? 20  DT  I "C5'" 1 
ATOM   1897  C  "C4'" . DT  A  1 94  ? 1.755  94.722  1.545   1.00 123.44 ? 20  DT  I "C4'" 1 
ATOM   1898  O  "O4'" . DT  A  1 94  ? 2.101  94.626  0.139   1.00 124.10 ? 20  DT  I "O4'" 1 
ATOM   1899  C  "C3'" . DT  A  1 94  ? 1.744  93.295  2.084   1.00 126.49 ? 20  DT  I "C3'" 1 
ATOM   1900  O  "O3'" . DT  A  1 94  ? 0.408  92.819  2.144   1.00 127.96 ? 20  DT  I "O3'" 1 
ATOM   1901  C  "C2'" . DT  A  1 94  ? 2.589  92.525  1.067   1.00 126.48 ? 20  DT  I "C2'" 1 
ATOM   1902  C  "C1'" . DT  A  1 94  ? 2.291  93.275  -0.223  1.00 124.94 ? 20  DT  I "C1'" 1 
ATOM   1903  N  N1    . DT  A  1 94  ? 3.398  93.219  -1.223  1.00 121.00 ? 20  DT  I N1    1 
ATOM   1904  C  C2    . DT  A  1 94  ? 3.092  93.281  -2.560  1.00 118.88 ? 20  DT  I C2    1 
ATOM   1905  O  O2    . DT  A  1 94  ? 1.952  93.369  -2.980  1.00 119.45 ? 20  DT  I O2    1 
ATOM   1906  N  N3    . DT  A  1 94  ? 4.171  93.233  -3.399  1.00 117.46 ? 20  DT  I N3    1 
ATOM   1907  C  C4    . DT  A  1 94  ? 5.503  93.133  -3.044  1.00 114.49 ? 20  DT  I C4    1 
ATOM   1908  O  O4    . DT  A  1 94  ? 6.402  93.097  -3.881  1.00 110.07 ? 20  DT  I O4    1 
ATOM   1909  C  C5    . DT  A  1 94  ? 5.759  93.076  -1.623  1.00 119.00 ? 20  DT  I C5    1 
ATOM   1910  C  C7    . DT  A  1 94  ? 7.166  92.969  -1.113  1.00 119.42 ? 20  DT  I C7    1 
ATOM   1911  C  C6    . DT  A  1 94  ? 4.705  93.123  -0.790  1.00 120.87 ? 20  DT  I C6    1 
ATOM   1912  P  P     . DG  A  1 95  ? 0.094  91.335  2.671   1.00 122.33 ? 21  DG  I P     1 
ATOM   1913  O  OP1   . DG  A  1 95  ? -1.206 91.387  3.376   1.00 125.58 ? 21  DG  I OP1   1 
ATOM   1914  O  OP2   . DG  A  1 95  ? 1.289  90.822  3.378   1.00 117.23 ? 21  DG  I OP2   1 
ATOM   1915  O  "O5'" . DG  A  1 95  ? -0.095 90.504  1.322   1.00 124.38 ? 21  DG  I "O5'" 1 
ATOM   1916  C  "C5'" . DG  A  1 95  ? -0.882 91.052  0.277   1.00 128.68 ? 21  DG  I "C5'" 1 
ATOM   1917  C  "C4'" . DG  A  1 95  ? -0.944 90.111  -0.911  1.00 132.98 ? 21  DG  I "C4'" 1 
ATOM   1918  O  "O4'" . DG  A  1 95  ? 0.120  90.422  -1.844  1.00 131.45 ? 21  DG  I "O4'" 1 
ATOM   1919  C  "C3'" . DG  A  1 95  ? -0.810 88.624  -0.577  1.00 135.74 ? 21  DG  I "C3'" 1 
ATOM   1920  O  "O3'" . DG  A  1 95  ? -1.855 87.909  -1.229  1.00 138.81 ? 21  DG  I "O3'" 1 
ATOM   1921  C  "C2'" . DG  A  1 95  ? 0.579  88.256  -1.121  1.00 132.35 ? 21  DG  I "C2'" 1 
ATOM   1922  C  "C1'" . DG  A  1 95  ? 0.724  89.229  -2.278  1.00 131.07 ? 21  DG  I "C1'" 1 
ATOM   1923  N  N9    . DG  A  1 95  ? 2.107  89.533  -2.642  1.00 128.03 ? 21  DG  I N9    1 
ATOM   1924  C  C8    . DG  A  1 95  ? 3.158  89.787  -1.792  1.00 125.00 ? 21  DG  I C8    1 
ATOM   1925  N  N7    . DG  A  1 95  ? 4.277  90.048  -2.414  1.00 121.60 ? 21  DG  I N7    1 
ATOM   1926  C  C5    . DG  A  1 95  ? 3.943  89.970  -3.761  1.00 123.05 ? 21  DG  I C5    1 
ATOM   1927  C  C6    . DG  A  1 95  ? 4.744  90.157  -4.916  1.00 120.90 ? 21  DG  I C6    1 
ATOM   1928  O  O6    . DG  A  1 95  ? 5.949  90.438  -4.979  1.00 117.85 ? 21  DG  I O6    1 
ATOM   1929  N  N1    . DG  A  1 95  ? 4.007  89.985  -6.088  1.00 124.14 ? 21  DG  I N1    1 
ATOM   1930  C  C2    . DG  A  1 95  ? 2.668  89.673  -6.135  1.00 128.88 ? 21  DG  I C2    1 
ATOM   1931  N  N2    . DG  A  1 95  ? 2.121  89.546  -7.352  1.00 131.16 ? 21  DG  I N2    1 
ATOM   1932  N  N3    . DG  A  1 95  ? 1.911  89.496  -5.062  1.00 130.58 ? 21  DG  I N3    1 
ATOM   1933  C  C4    . DG  A  1 95  ? 2.611  89.659  -3.915  1.00 127.34 ? 21  DG  I C4    1 
ATOM   1934  P  P     . DA  A  1 96  ? -1.962 86.308  -1.137  1.00 145.57 ? 22  DA  I P     1 
ATOM   1935  O  OP1   . DA  A  1 96  ? -3.401 85.989  -0.997  1.00 144.41 ? 22  DA  I OP1   1 
ATOM   1936  O  OP2   . DA  A  1 96  ? -1.006 85.806  -0.125  1.00 146.30 ? 22  DA  I OP2   1 
ATOM   1937  O  "O5'" . DA  A  1 96  ? -1.480 85.834  -2.584  1.00 139.59 ? 22  DA  I "O5'" 1 
ATOM   1938  C  "C5'" . DA  A  1 96  ? -1.684 86.697  -3.698  1.00 135.92 ? 22  DA  I "C5'" 1 
ATOM   1939  C  "C4'" . DA  A  1 96  ? -1.304 86.019  -5.001  1.00 133.58 ? 22  DA  I "C4'" 1 
ATOM   1940  O  "O4'" . DA  A  1 96  ? -0.019 86.515  -5.459  1.00 131.53 ? 22  DA  I "O4'" 1 
ATOM   1941  C  "C3'" . DA  A  1 96  ? -1.179 84.502  -4.937  1.00 131.66 ? 22  DA  I "C3'" 1 
ATOM   1942  O  "O3'" . DA  A  1 96  ? -1.688 83.940  -6.136  1.00 132.61 ? 22  DA  I "O3'" 1 
ATOM   1943  C  "C2'" . DA  A  1 96  ? 0.329  84.287  -4.802  1.00 129.23 ? 22  DA  I "C2'" 1 
ATOM   1944  C  "C1'" . DA  A  1 96  ? 0.885  85.443  -5.624  1.00 127.80 ? 22  DA  I "C1'" 1 
ATOM   1945  N  N9    . DA  A  1 96  ? 2.202  85.897  -5.187  1.00 121.65 ? 22  DA  I N9    1 
ATOM   1946  C  C8    . DA  A  1 96  ? 2.610  86.130  -3.902  1.00 119.62 ? 22  DA  I C8    1 
ATOM   1947  N  N7    . DA  A  1 96  ? 3.852  86.547  -3.807  1.00 116.56 ? 22  DA  I N7    1 
ATOM   1948  C  C5    . DA  A  1 96  ? 4.285  86.602  -5.122  1.00 115.99 ? 22  DA  I C5    1 
ATOM   1949  C  C6    . DA  A  1 96  ? 5.515  86.971  -5.702  1.00 111.94 ? 22  DA  I C6    1 
ATOM   1950  N  N6    . DA  A  1 96  ? 6.576  87.372  -4.992  1.00 108.71 ? 22  DA  I N6    1 
ATOM   1951  N  N1    . DA  A  1 96  ? 5.614  86.913  -7.046  1.00 110.52 ? 22  DA  I N1    1 
ATOM   1952  C  C2    . DA  A  1 96  ? 4.552  86.511  -7.755  1.00 112.15 ? 22  DA  I C2    1 
ATOM   1953  N  N3    . DA  A  1 96  ? 3.347  86.140  -7.324  1.00 114.37 ? 22  DA  I N3    1 
ATOM   1954  C  C4    . DA  A  1 96  ? 3.279  86.209  -5.986  1.00 117.58 ? 22  DA  I C4    1 
ATOM   1955  P  P     . DT  A  1 97  ? -1.898 82.354  -6.280  1.00 129.82 ? 23  DT  I P     1 
ATOM   1956  O  OP1   . DT  A  1 97  ? -3.257 82.134  -6.823  1.00 126.26 ? 23  DT  I OP1   1 
ATOM   1957  O  OP2   . DT  A  1 97  ? -1.509 81.708  -5.006  1.00 130.29 ? 23  DT  I OP2   1 
ATOM   1958  O  "O5'" . DT  A  1 97  ? -0.831 81.946  -7.396  1.00 129.64 ? 23  DT  I "O5'" 1 
ATOM   1959  C  "C5'" . DT  A  1 97  ? -0.687 82.754  -8.558  1.00 127.94 ? 23  DT  I "C5'" 1 
ATOM   1960  C  "C4'" . DT  A  1 97  ? 0.464  82.264  -9.414  1.00 124.74 ? 23  DT  I "C4'" 1 
ATOM   1961  O  "O4'" . DT  A  1 97  ? 1.695  82.924  -9.011  1.00 121.49 ? 23  DT  I "O4'" 1 
ATOM   1962  C  "C3'" . DT  A  1 97  ? 0.737  80.762  -9.322  1.00 124.09 ? 23  DT  I "C3'" 1 
ATOM   1963  O  "O3'" . DT  A  1 97  ? 1.005  80.248  -10.613 1.00 121.41 ? 23  DT  I "O3'" 1 
ATOM   1964  C  "C2'" . DT  A  1 97  ? 1.971  80.692  -8.425  1.00 122.44 ? 23  DT  I "C2'" 1 
ATOM   1965  C  "C1'" . DT  A  1 97  ? 2.702  81.954  -8.845  1.00 121.02 ? 23  DT  I "C1'" 1 
ATOM   1966  N  N1    . DT  A  1 97  ? 3.681  82.446  -7.835  1.00 119.14 ? 23  DT  I N1    1 
ATOM   1967  C  C2    . DT  A  1 97  ? 4.930  82.850  -8.251  1.00 115.17 ? 23  DT  I C2    1 
ATOM   1968  O  O2    . DT  A  1 97  ? 5.286  82.830  -9.416  1.00 113.14 ? 23  DT  I O2    1 
ATOM   1969  N  N3    . DT  A  1 97  ? 5.754  83.285  -7.247  1.00 113.25 ? 23  DT  I N3    1 
ATOM   1970  C  C4    . DT  A  1 97  ? 5.462  83.354  -5.897  1.00 113.37 ? 23  DT  I C4    1 
ATOM   1971  O  O4    . DT  A  1 97  ? 6.273  83.761  -5.070  1.00 108.99 ? 23  DT  I O4    1 
ATOM   1972  C  C5    . DT  A  1 97  ? 4.136  82.913  -5.529  1.00 117.32 ? 23  DT  I C5    1 
ATOM   1973  C  C7    . DT  A  1 97  ? 3.705  82.939  -4.093  1.00 115.81 ? 23  DT  I C7    1 
ATOM   1974  C  C6    . DT  A  1 97  ? 3.320  82.485  -6.504  1.00 120.74 ? 23  DT  I C6    1 
ATOM   1975  P  P     . DG  A  1 98  ? 0.702  78.709  -10.954 1.00 123.14 ? 24  DG  I P     1 
ATOM   1976  O  OP1   . DG  A  1 98  ? -0.636 78.639  -11.584 1.00 126.68 ? 24  DG  I OP1   1 
ATOM   1977  O  OP2   . DG  A  1 98  ? 0.992  77.909  -9.743  1.00 120.09 ? 24  DG  I OP2   1 
ATOM   1978  O  "O5'" . DG  A  1 98  ? 1.811  78.351  -12.047 1.00 122.40 ? 24  DG  I "O5'" 1 
ATOM   1979  C  "C5'" . DG  A  1 98  ? 2.133  79.295  -13.056 1.00 120.19 ? 24  DG  I "C5'" 1 
ATOM   1980  C  "C4'" . DG  A  1 98  ? 3.601  79.212  -13.441 1.00 115.29 ? 24  DG  I "C4'" 1 
ATOM   1981  O  "O4'" . DG  A  1 98  ? 4.429  79.795  -12.400 1.00 113.15 ? 24  DG  I "O4'" 1 
ATOM   1982  C  "C3'" . DG  A  1 98  ? 4.147  77.809  -13.660 1.00 113.46 ? 24  DG  I "C3'" 1 
ATOM   1983  O  "O3'" . DG  A  1 98  ? 5.118  77.861  -14.686 1.00 109.12 ? 24  DG  I "O3'" 1 
ATOM   1984  C  "C2'" . DG  A  1 98  ? 4.778  77.482  -12.304 1.00 113.43 ? 24  DG  I "C2'" 1 
ATOM   1985  C  "C1'" . DG  A  1 98  ? 5.360  78.835  -11.931 1.00 113.66 ? 24  DG  I "C1'" 1 
ATOM   1986  N  N9    . DG  A  1 98  ? 5.530  79.062  -10.497 1.00 116.45 ? 24  DG  I N9    1 
ATOM   1987  C  C8    . DG  A  1 98  ? 4.579  78.908  -9.520  1.00 119.18 ? 24  DG  I C8    1 
ATOM   1988  N  N7    . DG  A  1 98  ? 5.002  79.220  -8.327  1.00 116.73 ? 24  DG  I N7    1 
ATOM   1989  C  C5    . DG  A  1 98  ? 6.317  79.620  -8.525  1.00 112.57 ? 24  DG  I C5    1 
ATOM   1990  C  C6    . DG  A  1 98  ? 7.281  80.070  -7.592  1.00 106.11 ? 24  DG  I C6    1 
ATOM   1991  O  O6    . DG  A  1 98  ? 7.155  80.206  -6.368  1.00 103.52 ? 24  DG  I O6    1 
ATOM   1992  N  N1    . DG  A  1 98  ? 8.493  80.375  -8.206  1.00 103.77 ? 24  DG  I N1    1 
ATOM   1993  C  C2    . DG  A  1 98  ? 8.742  80.262  -9.555  1.00 106.75 ? 24  DG  I C2    1 
ATOM   1994  N  N2    . DG  A  1 98  ? 9.973  80.604  -9.966  1.00 105.71 ? 24  DG  I N2    1 
ATOM   1995  N  N3    . DG  A  1 98  ? 7.845  79.841  -10.442 1.00 111.02 ? 24  DG  I N3    1 
ATOM   1996  C  C4    . DG  A  1 98  ? 6.657  79.539  -9.857  1.00 113.90 ? 24  DG  I C4    1 
ATOM   1997  P  P     . DG  A  1 99  ? 5.501  76.548  -15.522 1.00 118.19 ? 25  DG  I P     1 
ATOM   1998  O  OP1   . DG  A  1 99  ? 5.390  76.880  -16.960 1.00 125.16 ? 25  DG  I OP1   1 
ATOM   1999  O  OP2   . DG  A  1 99  ? 4.738  75.410  -14.962 1.00 119.44 ? 25  DG  I OP2   1 
ATOM   2000  O  "O5'" . DG  A  1 99  ? 7.039  76.334  -15.169 1.00 111.54 ? 25  DG  I "O5'" 1 
ATOM   2001  C  "C5'" . DG  A  1 99  ? 7.887  77.461  -15.024 1.00 105.42 ? 25  DG  I "C5'" 1 
ATOM   2002  C  "C4'" . DG  A  1 99  ? 9.061  77.121  -14.137 1.00 103.75 ? 25  DG  I "C4'" 1 
ATOM   2003  O  "O4'" . DG  A  1 99  ? 8.727  77.409  -12.749 1.00 105.72 ? 25  DG  I "O4'" 1 
ATOM   2004  C  "C3'" . DG  A  1 99  ? 9.475  75.643  -14.172 1.00 104.27 ? 25  DG  I "C3'" 1 
ATOM   2005  O  "O3'" . DG  A  1 99  ? 10.887 75.545  -14.194 1.00 100.27 ? 25  DG  I "O3'" 1 
ATOM   2006  C  "C2'" . DG  A  1 99  ? 8.912  75.110  -12.857 1.00 107.79 ? 25  DG  I "C2'" 1 
ATOM   2007  C  "C1'" . DG  A  1 99  ? 9.145  76.319  -11.974 1.00 107.33 ? 25  DG  I "C1'" 1 
ATOM   2008  N  N9    . DG  A  1 99  ? 8.430  76.295  -10.699 1.00 112.58 ? 25  DG  I N9    1 
ATOM   2009  C  C8    . DG  A  1 99  ? 7.173  75.802  -10.450 1.00 116.74 ? 25  DG  I C8    1 
ATOM   2010  N  N7    . DG  A  1 99  ? 6.812  75.912  -9.199  1.00 116.23 ? 25  DG  I N7    1 
ATOM   2011  C  C5    . DG  A  1 99  ? 7.905  76.509  -8.581  1.00 112.82 ? 25  DG  I C5    1 
ATOM   2012  C  C6    . DG  A  1 99  ? 8.106  76.880  -7.226  1.00 111.72 ? 25  DG  I C6    1 
ATOM   2013  O  O6    . DG  A  1 99  ? 7.330  76.752  -6.269  1.00 115.49 ? 25  DG  I O6    1 
ATOM   2014  N  N1    . DG  A  1 99  ? 9.360  77.457  -7.031  1.00 106.87 ? 25  DG  I N1    1 
ATOM   2015  C  C2    . DG  A  1 99  ? 10.298 77.649  -8.018  1.00 107.04 ? 25  DG  I C2    1 
ATOM   2016  N  N2    . DG  A  1 99  ? 11.452 78.220  -7.651  1.00 102.13 ? 25  DG  I N2    1 
ATOM   2017  N  N3    . DG  A  1 99  ? 10.120 77.307  -9.284  1.00 111.75 ? 25  DG  I N3    1 
ATOM   2018  C  C4    . DG  A  1 99  ? 8.908  76.746  -9.492  1.00 112.55 ? 25  DG  I C4    1 
ATOM   2019  P  P     . DA  A  1 100 ? 11.675 75.290  -15.570 1.00 99.59  ? 26  DA  I P     1 
ATOM   2020  O  OP1   . DA  A  1 100 ? 11.041 76.127  -16.612 1.00 100.62 ? 26  DA  I OP1   1 
ATOM   2021  O  OP2   . DA  A  1 100 ? 11.786 73.828  -15.769 1.00 100.80 ? 26  DA  I OP2   1 
ATOM   2022  O  "O5'" . DA  A  1 100 ? 13.139 75.862  -15.267 1.00 98.72  ? 26  DA  I "O5'" 1 
ATOM   2023  C  "C5'" . DA  A  1 100 ? 13.313 77.250  -14.995 1.00 99.72  ? 26  DA  I "C5'" 1 
ATOM   2024  C  "C4'" . DA  A  1 100 ? 14.340 77.492  -13.893 1.00 97.43  ? 26  DA  I "C4'" 1 
ATOM   2025  O  "O4'" . DA  A  1 100 ? 13.725 77.357  -12.583 1.00 100.94 ? 26  DA  I "O4'" 1 
ATOM   2026  C  "C3'" . DA  A  1 100 ? 15.533 76.551  -13.865 1.00 94.78  ? 26  DA  I "C3'" 1 
ATOM   2027  O  "O3'" . DA  A  1 100 ? 16.617 77.243  -13.286 1.00 90.04  ? 26  DA  I "O3'" 1 
ATOM   2028  C  "C2'" . DA  A  1 100 ? 15.036 75.449  -12.936 1.00 101.13 ? 26  DA  I "C2'" 1 
ATOM   2029  C  "C1'" . DA  A  1 100 ? 14.333 76.286  -11.876 1.00 102.35 ? 26  DA  I "C1'" 1 
ATOM   2030  N  N9    . DA  A  1 100 ? 13.272 75.600  -11.151 1.00 107.77 ? 26  DA  I N9    1 
ATOM   2031  C  C8    . DA  A  1 100 ? 12.189 74.976  -11.692 1.00 113.41 ? 26  DA  I C8    1 
ATOM   2032  N  N7    . DA  A  1 100 ? 11.363 74.482  -10.805 1.00 116.97 ? 26  DA  I N7    1 
ATOM   2033  C  C5    . DA  A  1 100 ? 11.930 74.823  -9.594  1.00 112.16 ? 26  DA  I C5    1 
ATOM   2034  C  C6    . DA  A  1 100 ? 11.531 74.586  -8.269  1.00 110.31 ? 26  DA  I C6    1 
ATOM   2035  N  N6    . DA  A  1 100 ? 10.418 73.923  -7.953  1.00 112.01 ? 26  DA  I N6    1 
ATOM   2036  N  N1    . DA  A  1 100 ? 12.324 75.051  -7.282  1.00 108.57 ? 26  DA  I N1    1 
ATOM   2037  C  C2    . DA  A  1 100 ? 13.439 75.717  -7.610  1.00 107.46 ? 26  DA  I C2    1 
ATOM   2038  N  N3    . DA  A  1 100 ? 13.918 76.001  -8.825  1.00 107.96 ? 26  DA  I N3    1 
ATOM   2039  C  C4    . DA  A  1 100 ? 13.105 75.522  -9.783  1.00 109.04 ? 26  DA  I C4    1 
ATOM   2040  P  P     . DG  A  1 101 ? 18.133 76.844  -13.619 1.00 87.29  ? 27  DG  I P     1 
ATOM   2041  O  OP1   . DG  A  1 101 ? 18.806 78.106  -13.997 1.00 77.69  ? 27  DG  I OP1   1 
ATOM   2042  O  OP2   . DG  A  1 101 ? 18.129 75.693  -14.551 1.00 94.33  ? 27  DG  I OP2   1 
ATOM   2043  O  "O5'" . DG  A  1 101 ? 18.701 76.353  -12.208 1.00 87.18  ? 27  DG  I "O5'" 1 
ATOM   2044  C  "C5'" . DG  A  1 101 ? 18.496 77.156  -11.053 1.00 82.92  ? 27  DG  I "C5'" 1 
ATOM   2045  C  "C4'" . DG  A  1 101 ? 18.487 76.311  -9.793  1.00 78.56  ? 27  DG  I "C4'" 1 
ATOM   2046  O  "O4'" . DG  A  1 101 ? 17.176 75.700  -9.610  1.00 82.95  ? 27  DG  I "O4'" 1 
ATOM   2047  C  "C3'" . DG  A  1 101 ? 19.487 75.146  -9.778  1.00 75.91  ? 27  DG  I "C3'" 1 
ATOM   2048  O  "O3'" . DG  A  1 101 ? 20.007 74.993  -8.465  1.00 77.56  ? 27  DG  I "O3'" 1 
ATOM   2049  C  "C2'" . DG  A  1 101 ? 18.591 73.966  -10.131 1.00 79.58  ? 27  DG  I "C2'" 1 
ATOM   2050  C  "C1'" . DG  A  1 101 ? 17.388 74.347  -9.296  1.00 85.84  ? 27  DG  I "C1'" 1 
ATOM   2051  N  N9    . DG  A  1 101 ? 16.176 73.565  -9.544  1.00 96.40  ? 27  DG  I N9    1 
ATOM   2052  C  C8    . DG  A  1 101 ? 15.686 73.137  -10.753 1.00 103.06 ? 27  DG  I C8    1 
ATOM   2053  N  N7    . DG  A  1 101 ? 14.577 72.453  -10.651 1.00 108.11 ? 27  DG  I N7    1 
ATOM   2054  C  C5    . DG  A  1 101 ? 14.324 72.416  -9.285  1.00 104.81 ? 27  DG  I C5    1 
ATOM   2055  C  C6    . DG  A  1 101 ? 13.261 71.813  -8.565  1.00 111.20 ? 27  DG  I C6    1 
ATOM   2056  O  O6    . DG  A  1 101 ? 12.299 71.169  -9.008  1.00 115.80 ? 27  DG  I O6    1 
ATOM   2057  N  N1    . DG  A  1 101 ? 13.387 72.018  -7.192  1.00 113.22 ? 27  DG  I N1    1 
ATOM   2058  C  C2    . DG  A  1 101 ? 14.410 72.715  -6.592  1.00 109.11 ? 27  DG  I C2    1 
ATOM   2059  N  N2    . DG  A  1 101 ? 14.371 72.811  -5.255  1.00 106.78 ? 27  DG  I N2    1 
ATOM   2060  N  N3    . DG  A  1 101 ? 15.408 73.282  -7.256  1.00 106.61 ? 27  DG  I N3    1 
ATOM   2061  C  C4    . DG  A  1 101 ? 15.301 73.093  -8.592  1.00 102.33 ? 27  DG  I C4    1 
ATOM   2062  P  P     . DC  A  1 102 ? 21.537 75.348  -8.127  1.00 72.58  ? 28  DC  I P     1 
ATOM   2063  O  OP1   . DC  A  1 102 ? 21.769 76.757  -8.515  1.00 72.46  ? 28  DC  I OP1   1 
ATOM   2064  O  OP2   . DC  A  1 102 ? 22.388 74.278  -8.692  1.00 81.13  ? 28  DC  I OP2   1 
ATOM   2065  O  "O5'" . DC  A  1 102 ? 21.598 75.234  -6.534  1.00 75.87  ? 28  DC  I "O5'" 1 
ATOM   2066  C  "C5'" . DC  A  1 102 ? 20.750 76.051  -5.737  1.00 79.02  ? 28  DC  I "C5'" 1 
ATOM   2067  C  "C4'" . DC  A  1 102 ? 20.104 75.254  -4.613  1.00 78.11  ? 28  DC  I "C4'" 1 
ATOM   2068  O  "O4'" . DC  A  1 102 ? 19.017 74.443  -5.129  1.00 79.81  ? 28  DC  I "O4'" 1 
ATOM   2069  C  "C3'" . DC  A  1 102 ? 21.024 74.291  -3.866  1.00 82.96  ? 28  DC  I "C3'" 1 
ATOM   2070  O  "O3'" . DC  A  1 102 ? 20.708 74.351  -2.482  1.00 91.84  ? 28  DC  I "O3'" 1 
ATOM   2071  C  "C2'" . DC  A  1 102 ? 20.655 72.930  -4.472  1.00 81.51  ? 28  DC  I "C2'" 1 
ATOM   2072  C  "C1'" . DC  A  1 102 ? 19.163 73.116  -4.665  1.00 82.43  ? 28  DC  I "C1'" 1 
ATOM   2073  N  N1    . DC  A  1 102 ? 18.527 72.214  -5.669  1.00 87.92  ? 28  DC  I N1    1 
ATOM   2074  C  C2    . DC  A  1 102 ? 17.492 71.356  -5.274  1.00 94.67  ? 28  DC  I C2    1 
ATOM   2075  O  O2    . DC  A  1 102 ? 17.153 71.325  -4.086  1.00 99.55  ? 28  DC  I O2    1 
ATOM   2076  N  N3    . DC  A  1 102 ? 16.902 70.568  -6.208  1.00 95.26  ? 28  DC  I N3    1 
ATOM   2077  C  C4    . DC  A  1 102 ? 17.295 70.631  -7.479  1.00 93.95  ? 28  DC  I C4    1 
ATOM   2078  N  N4    . DC  A  1 102 ? 16.683 69.838  -8.365  1.00 97.97  ? 28  DC  I N4    1 
ATOM   2079  C  C5    . DC  A  1 102 ? 18.338 71.500  -7.898  1.00 91.44  ? 28  DC  I C5    1 
ATOM   2080  C  C6    . DC  A  1 102 ? 18.911 72.277  -6.973  1.00 90.18  ? 28  DC  I C6    1 
ATOM   2081  P  P     . DA  A  1 103 ? 21.682 73.699  -1.387  1.00 91.40  ? 29  DA  I P     1 
ATOM   2082  O  OP1   . DA  A  1 103 ? 21.600 74.540  -0.173  1.00 88.29  ? 29  DA  I OP1   1 
ATOM   2083  O  OP2   . DA  A  1 103 ? 22.992 73.451  -2.028  1.00 93.93  ? 29  DA  I OP2   1 
ATOM   2084  O  "O5'" . DA  A  1 103 ? 21.000 72.287  -1.075  1.00 96.23  ? 29  DA  I "O5'" 1 
ATOM   2085  C  "C5'" . DA  A  1 103 ? 19.660 72.242  -0.602  1.00 96.31  ? 29  DA  I "C5'" 1 
ATOM   2086  C  "C4'" . DA  A  1 103 ? 19.163 70.812  -0.497  1.00 95.95  ? 29  DA  I "C4'" 1 
ATOM   2087  O  "O4'" . DA  A  1 103 ? 18.770 70.328  -1.807  1.00 95.20  ? 29  DA  I "O4'" 1 
ATOM   2088  C  "C3'" . DA  A  1 103 ? 20.180 69.797  0.028   1.00 97.00  ? 29  DA  I "C3'" 1 
ATOM   2089  O  "O3'" . DA  A  1 103 ? 19.501 68.833  0.812   1.00 102.02 ? 29  DA  I "O3'" 1 
ATOM   2090  C  "C2'" . DA  A  1 103 ? 20.711 69.176  -1.262  1.00 96.28  ? 29  DA  I "C2'" 1 
ATOM   2091  C  "C1'" . DA  A  1 103 ? 19.422 69.103  -2.055  1.00 97.48  ? 29  DA  I "C1'" 1 
ATOM   2092  N  N9    . DA  A  1 103 ? 19.589 68.947  -3.496  1.00 97.92  ? 29  DA  I N9    1 
ATOM   2093  C  C8    . DA  A  1 103 ? 20.585 69.451  -4.288  1.00 95.31  ? 29  DA  I C8    1 
ATOM   2094  N  N7    . DA  A  1 103 ? 20.449 69.150  -5.562  1.00 95.08  ? 29  DA  I N7    1 
ATOM   2095  C  C5    . DA  A  1 103 ? 19.281 68.402  -5.601  1.00 99.05  ? 29  DA  I C5    1 
ATOM   2096  C  C6    . DA  A  1 103 ? 18.577 67.777  -6.655  1.00 101.02 ? 29  DA  I C6    1 
ATOM   2097  N  N6    . DA  A  1 103 ? 18.965 67.809  -7.936  1.00 108.08 ? 29  DA  I N6    1 
ATOM   2098  N  N1    . DA  A  1 103 ? 17.446 67.115  -6.338  1.00 103.23 ? 29  DA  I N1    1 
ATOM   2099  C  C2    . DA  A  1 103 ? 17.053 67.081  -5.062  1.00 104.87 ? 29  DA  I C2    1 
ATOM   2100  N  N3    . DA  A  1 103 ? 17.623 67.623  -3.995  1.00 103.02 ? 29  DA  I N3    1 
ATOM   2101  C  C4    . DA  A  1 103 ? 18.743 68.274  -4.335  1.00 101.16 ? 29  DA  I C4    1 
ATOM   2102  P  P     . DG  A  1 104 ? 20.165 68.246  2.150   1.00 104.80 ? 30  DG  I P     1 
ATOM   2103  O  OP1   . DG  A  1 104 ? 19.961 69.237  3.230   1.00 103.97 ? 30  DG  I OP1   1 
ATOM   2104  O  OP2   . DG  A  1 104 ? 21.532 67.793  1.810   1.00 104.24 ? 30  DG  I OP2   1 
ATOM   2105  O  "O5'" . DG  A  1 104 ? 19.282 66.952  2.463   1.00 110.62 ? 30  DG  I "O5'" 1 
ATOM   2106  C  "C5'" . DG  A  1 104 ? 17.862 67.048  2.479   1.00 114.52 ? 30  DG  I "C5'" 1 
ATOM   2107  C  "C4'" . DG  A  1 104 ? 17.227 65.760  1.986   1.00 117.06 ? 30  DG  I "C4'" 1 
ATOM   2108  O  "O4'" . DG  A  1 104 ? 17.223 65.741  0.534   1.00 118.47 ? 30  DG  I "O4'" 1 
ATOM   2109  C  "C3'" . DG  A  1 104 ? 17.934 64.480  2.428   1.00 119.03 ? 30  DG  I "C3'" 1 
ATOM   2110  O  "O3'" . DG  A  1 104 ? 16.970 63.500  2.785   1.00 125.70 ? 30  DG  I "O3'" 1 
ATOM   2111  C  "C2'" . DG  A  1 104 ? 18.725 64.069  1.185   1.00 118.29 ? 30  DG  I "C2'" 1 
ATOM   2112  C  "C1'" . DG  A  1 104 ? 17.806 64.543  0.070   1.00 118.68 ? 30  DG  I "C1'" 1 
ATOM   2113  N  N9    . DG  A  1 104 ? 18.494 64.826  -1.189  1.00 115.55 ? 30  DG  I N9    1 
ATOM   2114  C  C8    . DG  A  1 104 ? 19.538 65.698  -1.386  1.00 112.58 ? 30  DG  I C8    1 
ATOM   2115  N  N7    . DG  A  1 104 ? 19.945 65.751  -2.626  1.00 112.21 ? 30  DG  I N7    1 
ATOM   2116  C  C5    . DG  A  1 104 ? 19.110 64.864  -3.296  1.00 114.58 ? 30  DG  I C5    1 
ATOM   2117  C  C6    . DG  A  1 104 ? 19.072 64.501  -4.665  1.00 111.53 ? 30  DG  I C6    1 
ATOM   2118  O  O6    . DG  A  1 104 ? 19.790 64.907  -5.590  1.00 107.72 ? 30  DG  I O6    1 
ATOM   2119  N  N1    . DG  A  1 104 ? 18.069 63.568  -4.923  1.00 115.47 ? 30  DG  I N1    1 
ATOM   2120  C  C2    . DG  A  1 104 ? 17.215 63.051  -3.976  1.00 119.33 ? 30  DG  I C2    1 
ATOM   2121  N  N2    . DG  A  1 104 ? 16.310 62.161  -4.403  1.00 124.54 ? 30  DG  I N2    1 
ATOM   2122  N  N3    . DG  A  1 104 ? 17.243 63.382  -2.692  1.00 119.30 ? 30  DG  I N3    1 
ATOM   2123  C  C4    . DG  A  1 104 ? 18.211 64.290  -2.425  1.00 117.43 ? 30  DG  I C4    1 
ATOM   2124  P  P     . DT  A  1 105 ? 17.381 62.258  3.717   1.00 120.41 ? 31  DT  I P     1 
ATOM   2125  O  OP1   . DT  A  1 105 ? 16.289 62.060  4.697   1.00 121.69 ? 31  DT  I OP1   1 
ATOM   2126  O  OP2   . DT  A  1 105 ? 18.763 62.488  4.193   1.00 117.64 ? 31  DT  I OP2   1 
ATOM   2127  O  "O5'" . DT  A  1 105 ? 17.398 61.020  2.704   1.00 123.65 ? 31  DT  I "O5'" 1 
ATOM   2128  C  "C5'" . DT  A  1 105 ? 16.239 60.729  1.933   1.00 129.85 ? 31  DT  I "C5'" 1 
ATOM   2129  C  "C4'" . DT  A  1 105 ? 16.539 59.707  0.847   1.00 134.51 ? 31  DT  I "C4'" 1 
ATOM   2130  O  "O4'" . DT  A  1 105 ? 17.139 60.357  -0.300  1.00 132.03 ? 31  DT  I "O4'" 1 
ATOM   2131  C  "C3'" . DT  A  1 105 ? 17.495 58.576  1.249   1.00 137.00 ? 31  DT  I "C3'" 1 
ATOM   2132  O  "O3'" . DT  A  1 105 ? 16.875 57.322  0.997   1.00 142.56 ? 31  DT  I "O3'" 1 
ATOM   2133  C  "C2'" . DT  A  1 105 ? 18.718 58.793  0.346   1.00 134.47 ? 31  DT  I "C2'" 1 
ATOM   2134  C  "C1'" . DT  A  1 105 ? 18.094 59.489  -0.851  1.00 134.25 ? 31  DT  I "C1'" 1 
ATOM   2135  N  N1    . DT  A  1 105 ? 19.055 60.295  -1.669  1.00 133.85 ? 31  DT  I N1    1 
ATOM   2136  C  C2    . DT  A  1 105 ? 19.125 60.080  -3.029  1.00 134.82 ? 31  DT  I C2    1 
ATOM   2137  O  O2    . DT  A  1 105 ? 18.445 59.253  -3.610  1.00 136.48 ? 31  DT  I O2    1 
ATOM   2138  N  N3    . DT  A  1 105 ? 20.028 60.873  -3.689  1.00 133.41 ? 31  DT  I N3    1 
ATOM   2139  C  C4    . DT  A  1 105 ? 20.849 61.841  -3.137  1.00 130.55 ? 31  DT  I C4    1 
ATOM   2140  O  O4    . DT  A  1 105 ? 21.630 62.504  -3.813  1.00 128.54 ? 31  DT  I O4    1 
ATOM   2141  C  C5    . DT  A  1 105 ? 20.723 62.017  -1.709  1.00 130.11 ? 31  DT  I C5    1 
ATOM   2142  C  C7    . DT  A  1 105 ? 21.565 63.035  -1.000  1.00 124.73 ? 31  DT  I C7    1 
ATOM   2143  C  C6    . DT  A  1 105 ? 19.842 61.246  -1.052  1.00 133.20 ? 31  DT  I C6    1 
ATOM   2144  P  P     . DT  A  1 106 ? 17.473 55.972  1.632   1.00 144.06 ? 32  DT  I P     1 
ATOM   2145  O  OP1   . DT  A  1 106 ? 16.339 55.226  2.222   1.00 143.43 ? 32  DT  I OP1   1 
ATOM   2146  O  OP2   . DT  A  1 106 ? 18.634 56.334  2.477   1.00 139.68 ? 32  DT  I OP2   1 
ATOM   2147  O  "O5'" . DT  A  1 106 ? 18.010 55.164  0.361   1.00 146.10 ? 32  DT  I "O5'" 1 
ATOM   2148  C  "C5'" . DT  A  1 106 ? 17.110 54.816  -0.685  1.00 148.22 ? 32  DT  I "C5'" 1 
ATOM   2149  C  "C4'" . DT  A  1 106 ? 17.858 54.352  -1.923  1.00 146.80 ? 32  DT  I "C4'" 1 
ATOM   2150  O  "O4'" . DT  A  1 106 ? 18.560 55.471  -2.524  1.00 141.69 ? 32  DT  I "O4'" 1 
ATOM   2151  C  "C3'" . DT  A  1 106 ? 18.908 53.261  -1.682  1.00 148.35 ? 32  DT  I "C3'" 1 
ATOM   2152  O  "O3'" . DT  A  1 106 ? 18.687 52.174  -2.580  1.00 155.50 ? 32  DT  I "O3'" 1 
ATOM   2153  C  "C2'" . DT  A  1 106 ? 20.237 53.969  -1.960  1.00 143.68 ? 32  DT  I "C2'" 1 
ATOM   2154  C  "C1'" . DT  A  1 106 ? 19.824 55.038  -2.955  1.00 142.75 ? 32  DT  I "C1'" 1 
ATOM   2155  N  N1    . DT  A  1 106 ? 20.744 56.218  -2.994  1.00 142.87 ? 32  DT  I N1    1 
ATOM   2156  C  C2    . DT  A  1 106 ? 21.253 56.635  -4.204  1.00 144.09 ? 32  DT  I C2    1 
ATOM   2157  O  O2    . DT  A  1 106 ? 20.996 56.086  -5.261  1.00 147.82 ? 32  DT  I O2    1 
ATOM   2158  N  N3    . DT  A  1 106 ? 22.080 57.726  -4.134  1.00 139.86 ? 32  DT  I N3    1 
ATOM   2159  C  C4    . DT  A  1 106 ? 22.443 58.428  -3.000  1.00 137.30 ? 32  DT  I C4    1 
ATOM   2160  O  O4    . DT  A  1 106 ? 23.195 59.397  -3.040  1.00 134.29 ? 32  DT  I O4    1 
ATOM   2161  C  C5    . DT  A  1 106 ? 21.876 57.940  -1.764  1.00 140.62 ? 32  DT  I C5    1 
ATOM   2162  C  C7    . DT  A  1 106 ? 22.200 58.622  -0.468  1.00 141.48 ? 32  DT  I C7    1 
ATOM   2163  C  C6    . DT  A  1 106 ? 21.063 56.872  -1.820  1.00 142.66 ? 32  DT  I C6    1 
ATOM   2164  P  P     . DT  A  1 107 ? 19.664 50.897  -2.592  1.00 149.84 ? 33  DT  I P     1 
ATOM   2165  O  OP1   . DT  A  1 107 ? 18.809 49.703  -2.772  1.00 152.98 ? 33  DT  I OP1   1 
ATOM   2166  O  OP2   . DT  A  1 107 ? 20.575 50.966  -1.426  1.00 149.76 ? 33  DT  I OP2   1 
ATOM   2167  O  "O5'" . DT  A  1 107 ? 20.528 51.099  -3.923  1.00 148.15 ? 33  DT  I "O5'" 1 
ATOM   2168  C  "C5'" . DT  A  1 107 ? 19.862 51.347  -5.155  1.00 149.40 ? 33  DT  I "C5'" 1 
ATOM   2169  C  "C4'" . DT  A  1 107 ? 20.842 51.425  -6.315  1.00 149.37 ? 33  DT  I "C4'" 1 
ATOM   2170  O  "O4'" . DT  A  1 107 ? 21.575 52.676  -6.270  1.00 148.49 ? 33  DT  I "O4'" 1 
ATOM   2171  C  "C3'" . DT  A  1 107 ? 21.890 50.320  -6.369  1.00 148.56 ? 33  DT  I "C3'" 1 
ATOM   2172  O  "O3'" . DT  A  1 107 ? 22.076 49.933  -7.722  1.00 144.81 ? 33  DT  I "O3'" 1 
ATOM   2173  C  "C2'" . DT  A  1 107 ? 23.138 50.997  -5.787  1.00 148.19 ? 33  DT  I "C2'" 1 
ATOM   2174  C  "C1'" . DT  A  1 107 ? 22.967 52.425  -6.285  1.00 148.14 ? 33  DT  I "C1'" 1 
ATOM   2175  N  N1    . DT  A  1 107 ? 23.618 53.469  -5.434  1.00 146.80 ? 33  DT  I N1    1 
ATOM   2176  C  C2    . DT  A  1 107 ? 24.396 54.437  -6.033  1.00 144.20 ? 33  DT  I C2    1 
ATOM   2177  O  O2    . DT  A  1 107 ? 24.616 54.473  -7.231  1.00 142.69 ? 33  DT  I O2    1 
ATOM   2178  N  N3    . DT  A  1 107 ? 24.922 55.363  -5.168  1.00 142.82 ? 33  DT  I N3    1 
ATOM   2179  C  C4    . DT  A  1 107 ? 24.744 55.425  -3.799  1.00 142.57 ? 33  DT  I C4    1 
ATOM   2180  O  O4    . DT  A  1 107 ? 25.259 56.297  -3.107  1.00 139.77 ? 33  DT  I O4    1 
ATOM   2181  C  C5    . DT  A  1 107 ? 23.910 54.392  -3.238  1.00 145.08 ? 33  DT  I C5    1 
ATOM   2182  C  C7    . DT  A  1 107 ? 23.653 54.360  -1.762  1.00 144.96 ? 33  DT  I C7    1 
ATOM   2183  C  C6    . DT  A  1 107 ? 23.387 53.477  -4.072  1.00 147.58 ? 33  DT  I C6    1 
ATOM   2184  P  P     . DC  A  1 108 ? 22.955 48.644  -8.096  1.00 155.40 ? 34  DC  I P     1 
ATOM   2185  O  OP1   . DC  A  1 108 ? 22.397 48.070  -9.341  1.00 156.73 ? 34  DC  I OP1   1 
ATOM   2186  O  OP2   . DC  A  1 108 ? 23.078 47.802  -6.887  1.00 156.27 ? 34  DC  I OP2   1 
ATOM   2187  O  "O5'" . DC  A  1 108 ? 24.388 49.262  -8.421  1.00 149.41 ? 34  DC  I "O5'" 1 
ATOM   2188  C  "C5'" . DC  A  1 108 ? 24.482 50.451  -9.195  1.00 146.40 ? 34  DC  I "C5'" 1 
ATOM   2189  C  "C4'" . DC  A  1 108 ? 25.931 50.830  -9.412  1.00 142.63 ? 34  DC  I "C4'" 1 
ATOM   2190  O  "O4'" . DC  A  1 108 ? 26.346 51.781  -8.394  1.00 138.86 ? 34  DC  I "O4'" 1 
ATOM   2191  C  "C3'" . DC  A  1 108 ? 26.914 49.665  -9.324  1.00 142.17 ? 34  DC  I "C3'" 1 
ATOM   2192  O  "O3'" . DC  A  1 108 ? 27.945 49.842  -10.272 1.00 140.08 ? 34  DC  I "O3'" 1 
ATOM   2193  C  "C2'" . DC  A  1 108 ? 27.444 49.785  -7.899  1.00 139.57 ? 34  DC  I "C2'" 1 
ATOM   2194  C  "C1'" . DC  A  1 108 ? 27.499 51.295  -7.747  1.00 135.68 ? 34  DC  I "C1'" 1 
ATOM   2195  N  N1    . DC  A  1 108 ? 27.488 51.765  -6.332  1.00 131.35 ? 34  DC  I N1    1 
ATOM   2196  C  C2    . DC  A  1 108 ? 27.999 53.029  -6.028  1.00 126.26 ? 34  DC  I C2    1 
ATOM   2197  O  O2    . DC  A  1 108 ? 28.447 53.723  -6.946  1.00 122.91 ? 34  DC  I O2    1 
ATOM   2198  N  N3    . DC  A  1 108 ? 27.984 53.454  -4.740  1.00 125.17 ? 34  DC  I N3    1 
ATOM   2199  C  C4    . DC  A  1 108 ? 27.488 52.665  -3.784  1.00 124.43 ? 34  DC  I C4    1 
ATOM   2200  N  N4    . DC  A  1 108 ? 27.493 53.123  -2.525  1.00 119.80 ? 34  DC  I N4    1 
ATOM   2201  C  C5    . DC  A  1 108 ? 26.963 51.370  -4.075  1.00 128.45 ? 34  DC  I C5    1 
ATOM   2202  C  C6    . DC  A  1 108 ? 26.983 50.964  -5.350  1.00 131.66 ? 34  DC  I C6    1 
ATOM   2203  P  P     . DC  A  1 109 ? 28.655 48.571  -10.949 1.00 152.43 ? 35  DC  I P     1 
ATOM   2204  O  OP1   . DC  A  1 109 ? 27.835 48.161  -12.111 1.00 155.93 ? 35  DC  I OP1   1 
ATOM   2205  O  OP2   . DC  A  1 109 ? 28.953 47.596  -9.876  1.00 153.89 ? 35  DC  I OP2   1 
ATOM   2206  O  "O5'" . DC  A  1 109 ? 30.038 49.166  -11.481 1.00 146.87 ? 35  DC  I "O5'" 1 
ATOM   2207  C  "C5'" . DC  A  1 109 ? 30.051 50.421  -12.151 1.00 142.70 ? 35  DC  I "C5'" 1 
ATOM   2208  C  "C4'" . DC  A  1 109 ? 31.273 51.238  -11.764 1.00 135.76 ? 35  DC  I "C4'" 1 
ATOM   2209  O  "O4'" . DC  A  1 109 ? 31.081 51.835  -10.448 1.00 132.72 ? 35  DC  I "O4'" 1 
ATOM   2210  C  "C3'" . DC  A  1 109 ? 32.577 50.451  -11.673 1.00 132.98 ? 35  DC  I "C3'" 1 
ATOM   2211  O  "O3'" . DC  A  1 109 ? 33.645 51.273  -12.103 1.00 130.28 ? 35  DC  I "O3'" 1 
ATOM   2212  C  "C2'" . DC  A  1 109 ? 32.672 50.172  -10.176 1.00 130.76 ? 35  DC  I "C2'" 1 
ATOM   2213  C  "C1'" . DC  A  1 109 ? 32.179 51.498  -9.628  1.00 127.26 ? 35  DC  I "C1'" 1 
ATOM   2214  N  N1    . DC  A  1 109 ? 31.721 51.441  -8.206  1.00 119.76 ? 35  DC  I N1    1 
ATOM   2215  C  C2    . DC  A  1 109 ? 32.064 52.474  -7.318  1.00 112.54 ? 35  DC  I C2    1 
ATOM   2216  O  O2    . DC  A  1 109 ? 32.746 53.422  -7.727  1.00 108.73 ? 35  DC  I O2    1 
ATOM   2217  N  N3    . DC  A  1 109 ? 31.632 52.402  -6.032  1.00 108.92 ? 35  DC  I N3    1 
ATOM   2218  C  C4    . DC  A  1 109 ? 30.896 51.362  -5.634  1.00 107.57 ? 35  DC  I C4    1 
ATOM   2219  N  N4    . DC  A  1 109 ? 30.492 51.327  -4.361  1.00 104.91 ? 35  DC  I N4    1 
ATOM   2220  C  C5    . DC  A  1 109 ? 30.545 50.305  -6.521  1.00 112.73 ? 35  DC  I C5    1 
ATOM   2221  C  C6    . DC  A  1 109 ? 30.970 50.386  -7.784  1.00 117.91 ? 35  DC  I C6    1 
ATOM   2222  P  P     . DA  A  1 110 ? 34.407 50.983  -13.486 1.00 123.02 ? 36  DA  I P     1 
ATOM   2223  O  OP1   . DA  A  1 110 ? 33.406 51.080  -14.573 1.00 121.48 ? 36  DA  I OP1   1 
ATOM   2224  O  OP2   . DA  A  1 110 ? 35.198 49.741  -13.327 1.00 123.59 ? 36  DA  I OP2   1 
ATOM   2225  O  "O5'" . DA  A  1 110 ? 35.429 52.210  -13.611 1.00 115.79 ? 36  DA  I "O5'" 1 
ATOM   2226  C  "C5'" . DA  A  1 110 ? 34.933 53.521  -13.858 1.00 112.39 ? 36  DA  I "C5'" 1 
ATOM   2227  C  "C4'" . DA  A  1 110 ? 35.447 54.521  -12.829 1.00 108.79 ? 36  DA  I "C4'" 1 
ATOM   2228  O  "O4'" . DA  A  1 110 ? 35.075 54.104  -11.488 1.00 108.56 ? 36  DA  I "O4'" 1 
ATOM   2229  C  "C3'" . DA  A  1 110 ? 36.955 54.720  -12.789 1.00 104.76 ? 36  DA  I "C3'" 1 
ATOM   2230  O  "O3'" . DA  A  1 110 ? 37.225 56.062  -12.413 1.00 98.97  ? 36  DA  I "O3'" 1 
ATOM   2231  C  "C2'" . DA  A  1 110 ? 37.385 53.736  -11.701 1.00 104.16 ? 36  DA  I "C2'" 1 
ATOM   2232  C  "C1'" . DA  A  1 110 ? 36.240 53.883  -10.708 1.00 107.41 ? 36  DA  I "C1'" 1 
ATOM   2233  N  N9    . DA  A  1 110 ? 35.991 52.703  -9.887  1.00 116.32 ? 36  DA  I N9    1 
ATOM   2234  C  C8    . DA  A  1 110 ? 35.869 51.415  -10.319 1.00 121.33 ? 36  DA  I C8    1 
ATOM   2235  N  N7    . DA  A  1 110 ? 35.609 50.557  -9.364  1.00 122.99 ? 36  DA  I N7    1 
ATOM   2236  C  C5    . DA  A  1 110 ? 35.537 51.337  -8.225  1.00 122.17 ? 36  DA  I C5    1 
ATOM   2237  C  C6    . DA  A  1 110 ? 35.285 51.021  -6.877  1.00 128.23 ? 36  DA  I C6    1 
ATOM   2238  N  N6    . DA  A  1 110 ? 35.053 49.777  -6.444  1.00 134.99 ? 36  DA  I N6    1 
ATOM   2239  N  N1    . DA  A  1 110 ? 35.295 52.032  -5.985  1.00 125.65 ? 36  DA  I N1    1 
ATOM   2240  C  C2    . DA  A  1 110 ? 35.534 53.275  -6.422  1.00 120.98 ? 36  DA  I C2    1 
ATOM   2241  N  N3    . DA  A  1 110 ? 35.777 53.695  -7.665  1.00 118.64 ? 36  DA  I N3    1 
ATOM   2242  C  C4    . DA  A  1 110 ? 35.764 52.665  -8.527  1.00 119.21 ? 36  DA  I C4    1 
ATOM   2243  P  P     . DA  A  1 111 ? 38.638 56.743  -12.753 1.00 127.07 ? 37  DA  I P     1 
ATOM   2244  O  OP1   . DA  A  1 111 ? 38.353 58.063  -13.360 1.00 127.34 ? 37  DA  I OP1   1 
ATOM   2245  O  OP2   . DA  A  1 111 ? 39.463 55.758  -13.486 1.00 130.14 ? 37  DA  I OP2   1 
ATOM   2246  O  "O5'" . DA  A  1 111 ? 39.288 56.979  -11.314 1.00 120.10 ? 37  DA  I "O5'" 1 
ATOM   2247  C  "C5'" . DA  A  1 111 ? 38.580 57.734  -10.342 1.00 113.57 ? 37  DA  I "C5'" 1 
ATOM   2248  C  "C4'" . DA  A  1 111 ? 39.115 57.470  -8.948  1.00 107.12 ? 37  DA  I "C4'" 1 
ATOM   2249  O  "O4'" . DA  A  1 111 ? 38.573 56.223  -8.432  1.00 105.95 ? 37  DA  I "O4'" 1 
ATOM   2250  C  "C3'" . DA  A  1 111 ? 40.639 57.340  -8.840  1.00 107.22 ? 37  DA  I "C3'" 1 
ATOM   2251  O  "O3'" . DA  A  1 111 ? 41.076 58.025  -7.683  1.00 106.79 ? 37  DA  I "O3'" 1 
ATOM   2252  C  "C2'" . DA  A  1 111 ? 40.835 55.833  -8.691  1.00 107.85 ? 37  DA  I "C2'" 1 
ATOM   2253  C  "C1'" . DA  A  1 111 ? 39.624 55.497  -7.846  1.00 108.20 ? 37  DA  I "C1'" 1 
ATOM   2254  N  N9    . DA  A  1 111 ? 39.278 54.080  -7.823  1.00 109.95 ? 37  DA  I N9    1 
ATOM   2255  C  C8    . DA  A  1 111 ? 39.199 53.228  -8.887  1.00 113.12 ? 37  DA  I C8    1 
ATOM   2256  N  N7    . DA  A  1 111 ? 38.860 52.003  -8.558  1.00 116.94 ? 37  DA  I N7    1 
ATOM   2257  C  C5    . DA  A  1 111 ? 38.709 52.058  -7.182  1.00 113.01 ? 37  DA  I C5    1 
ATOM   2258  C  C6    . DA  A  1 111 ? 38.360 51.087  -6.223  1.00 112.34 ? 37  DA  I C6    1 
ATOM   2259  N  N6    . DA  A  1 111 ? 38.087 49.816  -6.533  1.00 114.80 ? 37  DA  I N6    1 
ATOM   2260  N  N1    . DA  A  1 111 ? 38.297 51.475  -4.930  1.00 107.86 ? 37  DA  I N1    1 
ATOM   2261  C  C2    . DA  A  1 111 ? 38.566 52.748  -4.627  1.00 102.07 ? 37  DA  I C2    1 
ATOM   2262  N  N3    . DA  A  1 111 ? 38.911 53.747  -5.438  1.00 102.34 ? 37  DA  I N3    1 
ATOM   2263  C  C4    . DA  A  1 111 ? 38.963 53.331  -6.714  1.00 108.62 ? 37  DA  I C4    1 
ATOM   2264  P  P     . DA  A  1 112 ? 42.618 58.430  -7.488  1.00 104.30 ? 38  DA  I P     1 
ATOM   2265  O  OP1   . DA  A  1 112 ? 42.857 59.671  -8.256  1.00 105.30 ? 38  DA  I OP1   1 
ATOM   2266  O  OP2   . DA  A  1 112 ? 43.457 57.237  -7.740  1.00 105.47 ? 38  DA  I OP2   1 
ATOM   2267  O  "O5'" . DA  A  1 112 ? 42.706 58.758  -5.927  1.00 99.52  ? 38  DA  I "O5'" 1 
ATOM   2268  C  "C5'" . DA  A  1 112 ? 41.510 59.004  -5.187  1.00 94.28  ? 38  DA  I "C5'" 1 
ATOM   2269  C  "C4'" . DA  A  1 112 ? 41.535 58.262  -3.862  1.00 89.25  ? 38  DA  I "C4'" 1 
ATOM   2270  O  "O4'" . DA  A  1 112 ? 41.037 56.906  -4.050  1.00 95.97  ? 38  DA  I "O4'" 1 
ATOM   2271  C  "C3'" . DA  A  1 112 ? 42.925 58.124  -3.240  1.00 90.51  ? 38  DA  I "C3'" 1 
ATOM   2272  O  "O3'" . DA  A  1 112 ? 42.874 58.369  -1.841  1.00 94.72  ? 38  DA  I "O3'" 1 
ATOM   2273  C  "C2'" . DA  A  1 112 ? 43.296 56.679  -3.540  1.00 96.31  ? 38  DA  I "C2'" 1 
ATOM   2274  C  "C1'" . DA  A  1 112 ? 41.949 55.986  -3.493  1.00 98.91  ? 38  DA  I "C1'" 1 
ATOM   2275  N  N9    . DA  A  1 112 ? 41.914 54.752  -4.280  1.00 101.52 ? 38  DA  I N9    1 
ATOM   2276  C  C8    . DA  A  1 112 ? 42.131 54.631  -5.624  1.00 99.57  ? 38  DA  I C8    1 
ATOM   2277  N  N7    . DA  A  1 112 ? 42.044 53.400  -6.069  1.00 100.90 ? 38  DA  I N7    1 
ATOM   2278  C  C5    . DA  A  1 112 ? 41.758 52.656  -4.936  1.00 101.94 ? 38  DA  I C5    1 
ATOM   2279  C  C6    . DA  A  1 112 ? 41.539 51.278  -4.737  1.00 107.39 ? 38  DA  I C6    1 
ATOM   2280  N  N6    . DA  A  1 112 ? 41.586 50.379  -5.724  1.00 111.66 ? 38  DA  I N6    1 
ATOM   2281  N  N1    . DA  A  1 112 ? 41.271 50.859  -3.481  1.00 108.32 ? 38  DA  I N1    1 
ATOM   2282  C  C2    . DA  A  1 112 ? 41.222 51.766  -2.496  1.00 104.93 ? 38  DA  I C2    1 
ATOM   2283  N  N3    . DA  A  1 112 ? 41.409 53.087  -2.561  1.00 101.11 ? 38  DA  I N3    1 
ATOM   2284  C  C4    . DA  A  1 112 ? 41.674 53.472  -3.822  1.00 100.77 ? 38  DA  I C4    1 
ATOM   2285  P  P     . DT  A  1 113 ? 44.209 58.247  -0.951  1.00 97.14  ? 39  DT  I P     1 
ATOM   2286  O  OP1   . DT  A  1 113 ? 44.215 59.365  0.014   1.00 93.32  ? 39  DT  I OP1   1 
ATOM   2287  O  OP2   . DT  A  1 113 ? 45.368 58.061  -1.851  1.00 116.00 ? 39  DT  I OP2   1 
ATOM   2288  O  "O5'" . DT  A  1 113 ? 44.007 56.887  -0.144  1.00 96.00  ? 39  DT  I "O5'" 1 
ATOM   2289  C  "C5'" . DT  A  1 113 ? 42.883 56.734  0.705   1.00 97.62  ? 39  DT  I "C5'" 1 
ATOM   2290  C  "C4'" . DT  A  1 113 ? 42.913 55.386  1.397   1.00 104.76 ? 39  DT  I "C4'" 1 
ATOM   2291  O  "O4'" . DT  A  1 113 ? 42.816 54.327  0.408   1.00 108.01 ? 39  DT  I "O4'" 1 
ATOM   2292  C  "C3'" . DT  A  1 113 ? 44.178 55.102  2.204   1.00 111.75 ? 39  DT  I "C3'" 1 
ATOM   2293  O  "O3'" . DT  A  1 113 ? 43.826 54.462  3.421   1.00 121.95 ? 39  DT  I "O3'" 1 
ATOM   2294  C  "C2'" . DT  A  1 113 ? 44.980 54.179  1.283   1.00 113.07 ? 39  DT  I "C2'" 1 
ATOM   2295  C  "C1'" . DT  A  1 113 ? 43.868 53.405  0.593   1.00 109.98 ? 39  DT  I "C1'" 1 
ATOM   2296  N  N1    . DT  A  1 113 ? 44.241 52.838  -0.749  1.00 108.59 ? 39  DT  I N1    1 
ATOM   2297  C  C2    . DT  A  1 113 ? 44.129 51.481  -0.958  1.00 113.01 ? 39  DT  I C2    1 
ATOM   2298  O  O2    . DT  A  1 113 ? 43.754 50.702  -0.100  1.00 112.57 ? 39  DT  I O2    1 
ATOM   2299  N  N3    . DT  A  1 113 ? 44.477 51.065  -2.217  1.00 115.24 ? 39  DT  I N3    1 
ATOM   2300  C  C4    . DT  A  1 113 ? 44.912 51.848  -3.267  1.00 112.69 ? 39  DT  I C4    1 
ATOM   2301  O  O4    . DT  A  1 113 ? 45.203 51.380  -4.362  1.00 118.84 ? 39  DT  I O4    1 
ATOM   2302  C  C5    . DT  A  1 113 ? 45.005 53.257  -2.989  1.00 105.41 ? 39  DT  I C5    1 
ATOM   2303  C  C7    . DT  A  1 113 ? 45.474 54.193  -4.061  1.00 101.88 ? 39  DT  I C7    1 
ATOM   2304  C  C6    . DT  A  1 113 ? 44.665 53.686  -1.758  1.00 104.18 ? 39  DT  I C6    1 
ATOM   2305  P  P     . DA  A  1 114 ? 44.844 54.444  4.663   1.00 117.69 ? 40  DA  I P     1 
ATOM   2306  O  OP1   . DA  A  1 114 ? 44.076 54.778  5.884   1.00 119.93 ? 40  DA  I OP1   1 
ATOM   2307  O  OP2   . DA  A  1 114 ? 46.033 55.246  4.299   1.00 114.77 ? 40  DA  I OP2   1 
ATOM   2308  O  "O5'" . DA  A  1 114 ? 45.290 52.915  4.745   1.00 119.59 ? 40  DA  I "O5'" 1 
ATOM   2309  C  "C5'" . DA  A  1 114 ? 44.330 51.891  4.526   1.00 120.76 ? 40  DA  I "C5'" 1 
ATOM   2310  C  "C4'" . DA  A  1 114 ? 45.010 50.545  4.402   1.00 124.43 ? 40  DA  I "C4'" 1 
ATOM   2311  O  "O4'" . DA  A  1 114 ? 45.163 50.197  2.997   1.00 125.49 ? 40  DA  I "O4'" 1 
ATOM   2312  C  "C3'" . DA  A  1 114 ? 46.407 50.481  5.013   1.00 126.49 ? 40  DA  I "C3'" 1 
ATOM   2313  O  "O3'" . DA  A  1 114 ? 46.573 49.241  5.696   1.00 130.81 ? 40  DA  I "O3'" 1 
ATOM   2314  C  "C2'" . DA  A  1 114 ? 47.321 50.593  3.790   1.00 126.49 ? 40  DA  I "C2'" 1 
ATOM   2315  C  "C1'" . DA  A  1 114 ? 46.507 49.857  2.737   1.00 127.45 ? 40  DA  I "C1'" 1 
ATOM   2316  N  N9    . DA  A  1 114 ? 46.828 50.247  1.363   1.00 128.19 ? 40  DA  I N9    1 
ATOM   2317  C  C8    . DA  A  1 114 ? 47.055 51.513  0.902   1.00 127.02 ? 40  DA  I C8    1 
ATOM   2318  N  N7    . DA  A  1 114 ? 47.315 51.572  -0.383  1.00 127.59 ? 40  DA  I N7    1 
ATOM   2319  C  C5    . DA  A  1 114 ? 47.255 50.252  -0.797  1.00 132.10 ? 40  DA  I C5    1 
ATOM   2320  C  C6    . DA  A  1 114 ? 47.439 49.643  -2.056  1.00 138.88 ? 40  DA  I C6    1 
ATOM   2321  N  N6    . DA  A  1 114 ? 47.734 50.325  -3.168  1.00 141.98 ? 40  DA  I N6    1 
ATOM   2322  N  N1    . DA  A  1 114 ? 47.309 48.303  -2.127  1.00 142.91 ? 40  DA  I N1    1 
ATOM   2323  C  C2    . DA  A  1 114 ? 47.017 47.622  -1.011  1.00 142.28 ? 40  DA  I C2    1 
ATOM   2324  N  N3    . DA  A  1 114 ? 46.818 48.083  0.226   1.00 137.53 ? 40  DA  I N3    1 
ATOM   2325  C  C4    . DA  A  1 114 ? 46.954 49.419  0.265   1.00 132.24 ? 40  DA  I C4    1 
ATOM   2326  P  P     . DC  A  1 115 ? 47.747 49.047  6.777   1.00 135.00 ? 41  DC  I P     1 
ATOM   2327  O  OP1   . DC  A  1 115 ? 47.125 48.582  8.036   1.00 134.57 ? 41  DC  I OP1   1 
ATOM   2328  O  OP2   . DC  A  1 115 ? 48.583 50.268  6.774   1.00 132.08 ? 41  DC  I OP2   1 
ATOM   2329  O  "O5'" . DC  A  1 115 ? 48.606 47.852  6.161   1.00 137.15 ? 41  DC  I "O5'" 1 
ATOM   2330  C  "C5'" . DC  A  1 115 ? 48.446 47.533  4.793   1.00 140.28 ? 41  DC  I "C5'" 1 
ATOM   2331  C  "C4'" . DC  A  1 115 ? 49.312 46.368  4.389   1.00 145.94 ? 41  DC  I "C4'" 1 
ATOM   2332  O  "O4'" . DC  A  1 115 ? 49.442 46.362  2.944   1.00 147.13 ? 41  DC  I "O4'" 1 
ATOM   2333  C  "C3'" . DC  A  1 115 ? 50.734 46.409  4.919   1.00 148.38 ? 41  DC  I "C3'" 1 
ATOM   2334  O  "O3'" . DC  A  1 115 ? 51.232 45.082  4.995   1.00 154.92 ? 41  DC  I "O3'" 1 
ATOM   2335  C  "C2'" . DC  A  1 115 ? 51.445 47.224  3.844   1.00 146.33 ? 41  DC  I "C2'" 1 
ATOM   2336  C  "C1'" . DC  A  1 115 ? 50.760 46.722  2.579   1.00 146.52 ? 41  DC  I "C1'" 1 
ATOM   2337  N  N1    . DC  A  1 115 ? 50.699 47.738  1.481   1.00 141.94 ? 41  DC  I N1    1 
ATOM   2338  C  C2    . DC  A  1 115 ? 50.860 47.322  0.159   1.00 144.07 ? 41  DC  I C2    1 
ATOM   2339  O  O2    . DC  A  1 115 ? 51.046 46.122  -0.063  1.00 147.56 ? 41  DC  I O2    1 
ATOM   2340  N  N3    . DC  A  1 115 ? 50.812 48.245  -0.834  1.00 142.22 ? 41  DC  I N3    1 
ATOM   2341  C  C4    . DC  A  1 115 ? 50.611 49.531  -0.540  1.00 136.80 ? 41  DC  I C4    1 
ATOM   2342  N  N4    . DC  A  1 115 ? 50.570 50.407  -1.551  1.00 136.79 ? 41  DC  I N4    1 
ATOM   2343  C  C5    . DC  A  1 115 ? 50.444 49.977  0.806   1.00 132.96 ? 41  DC  I C5    1 
ATOM   2344  C  C6    . DC  A  1 115 ? 50.496 49.055  1.775   1.00 135.65 ? 41  DC  I C6    1 
ATOM   2345  P  P     . DA  A  1 116 ? 52.675 44.759  5.624   1.00 140.28 ? 42  DA  I P     1 
ATOM   2346  O  OP1   . DA  A  1 116 ? 52.452 43.830  6.755   1.00 142.37 ? 42  DA  I OP1   1 
ATOM   2347  O  OP2   . DA  A  1 116 ? 53.418 46.018  5.855   1.00 136.71 ? 42  DA  I OP2   1 
ATOM   2348  O  "O5'" . DA  A  1 116 ? 53.394 43.954  4.448   1.00 145.12 ? 42  DA  I "O5'" 1 
ATOM   2349  C  "C5'" . DA  A  1 116 ? 52.593 43.277  3.485   1.00 147.80 ? 42  DA  I "C5'" 1 
ATOM   2350  C  "C4'" . DA  A  1 116 ? 53.444 42.633  2.405   1.00 151.47 ? 42  DA  I "C4'" 1 
ATOM   2351  O  "O4'" . DA  A  1 116 ? 53.375 43.415  1.187   1.00 152.86 ? 42  DA  I "O4'" 1 
ATOM   2352  C  "C3'" . DA  A  1 116 ? 54.920 42.501  2.729   1.00 150.55 ? 42  DA  I "C3'" 1 
ATOM   2353  O  "O3'" . DA  A  1 116 ? 55.432 41.335  2.102   1.00 148.84 ? 42  DA  I "O3'" 1 
ATOM   2354  C  "C2'" . DA  A  1 116 ? 55.516 43.783  2.139   1.00 151.41 ? 42  DA  I "C2'" 1 
ATOM   2355  C  "C1'" . DA  A  1 116 ? 54.616 44.047  0.931   1.00 154.16 ? 42  DA  I "C1'" 1 
ATOM   2356  N  N9    . DA  A  1 116 ? 54.347 45.465  0.688   1.00 154.67 ? 42  DA  I N9    1 
ATOM   2357  C  C8    . DA  A  1 116 ? 53.991 46.405  1.614   1.00 153.44 ? 42  DA  I C8    1 
ATOM   2358  N  N7    . DA  A  1 116 ? 53.789 47.599  1.107   1.00 152.43 ? 42  DA  I N7    1 
ATOM   2359  C  C5    . DA  A  1 116 ? 54.023 47.430  -0.247  1.00 153.63 ? 42  DA  I C5    1 
ATOM   2360  C  C6    . DA  A  1 116 ? 53.976 48.322  -1.340  1.00 153.08 ? 42  DA  I C6    1 
ATOM   2361  N  N6    . DA  A  1 116 ? 53.663 49.618  -1.224  1.00 149.23 ? 42  DA  I N6    1 
ATOM   2362  N  N1    . DA  A  1 116 ? 54.265 47.828  -2.561  1.00 155.65 ? 42  DA  I N1    1 
ATOM   2363  C  C2    . DA  A  1 116 ? 54.579 46.531  -2.676  1.00 157.79 ? 42  DA  I C2    1 
ATOM   2364  N  N3    . DA  A  1 116 ? 54.656 45.600  -1.727  1.00 158.37 ? 42  DA  I N3    1 
ATOM   2365  C  C4    . DA  A  1 116 ? 54.362 46.118  -0.525  1.00 155.75 ? 42  DA  I C4    1 
ATOM   2366  P  P     . DC  A  1 117 ? 56.965 40.904  2.298   1.00 162.16 ? 43  DC  I P     1 
ATOM   2367  O  OP1   . DC  A  1 117 ? 57.022 39.427  2.225   1.00 163.76 ? 43  DC  I OP1   1 
ATOM   2368  O  OP2   . DC  A  1 117 ? 57.497 41.605  3.488   1.00 158.69 ? 43  DC  I OP2   1 
ATOM   2369  O  "O5'" . DC  A  1 117 ? 57.679 41.502  1.004   1.00 158.59 ? 43  DC  I "O5'" 1 
ATOM   2370  C  "C5'" . DC  A  1 117 ? 57.071 41.339  -0.268  1.00 158.06 ? 43  DC  I "C5'" 1 
ATOM   2371  C  "C4'" . DC  A  1 117 ? 57.873 42.047  -1.337  1.00 156.07 ? 43  DC  I "C4'" 1 
ATOM   2372  O  "O4'" . DC  A  1 117 ? 57.372 43.400  -1.514  1.00 152.87 ? 43  DC  I "O4'" 1 
ATOM   2373  C  "C3'" . DC  A  1 117 ? 59.368 42.177  -1.035  1.00 155.05 ? 43  DC  I "C3'" 1 
ATOM   2374  O  "O3'" . DC  A  1 117 ? 60.117 41.811  -2.186  1.00 157.76 ? 43  DC  I "O3'" 1 
ATOM   2375  C  "C2'" . DC  A  1 117 ? 59.528 43.659  -0.694  1.00 151.06 ? 43  DC  I "C2'" 1 
ATOM   2376  C  "C1'" . DC  A  1 117 ? 58.459 44.289  -1.564  1.00 151.04 ? 43  DC  I "C1'" 1 
ATOM   2377  N  N1    . DC  A  1 117 ? 58.008 45.628  -1.081  1.00 147.47 ? 43  DC  I N1    1 
ATOM   2378  C  C2    . DC  A  1 117 ? 57.920 46.691  -1.985  1.00 144.64 ? 43  DC  I C2    1 
ATOM   2379  O  O2    . DC  A  1 117 ? 58.217 46.493  -3.168  1.00 148.58 ? 43  DC  I O2    1 
ATOM   2380  N  N3    . DC  A  1 117 ? 57.510 47.904  -1.535  1.00 137.87 ? 43  DC  I N3    1 
ATOM   2381  C  C4    . DC  A  1 117 ? 57.200 48.068  -0.247  1.00 134.20 ? 43  DC  I C4    1 
ATOM   2382  N  N4    . DC  A  1 117 ? 56.798 49.280  0.155   1.00 128.56 ? 43  DC  I N4    1 
ATOM   2383  C  C5    . DC  A  1 117 ? 57.287 46.996  0.689   1.00 137.58 ? 43  DC  I C5    1 
ATOM   2384  C  C6    . DC  A  1 117 ? 57.692 45.806  0.233   1.00 143.88 ? 43  DC  I C6    1 
ATOM   2385  P  P     . DT  A  1 118 ? 61.725 41.833  -2.184  1.00 157.46 ? 44  DT  I P     1 
ATOM   2386  O  OP1   . DT  A  1 118 ? 62.171 40.491  -2.615  1.00 160.36 ? 44  DT  I OP1   1 
ATOM   2387  O  OP2   . DT  A  1 118 ? 62.235 42.385  -0.908  1.00 154.75 ? 44  DT  I OP2   1 
ATOM   2388  O  "O5'" . DT  A  1 118 ? 62.064 42.869  -3.348  1.00 153.54 ? 44  DT  I "O5'" 1 
ATOM   2389  C  "C5'" . DT  A  1 118 ? 61.259 42.881  -4.521  1.00 152.10 ? 44  DT  I "C5'" 1 
ATOM   2390  C  "C4'" . DT  A  1 118 ? 61.716 43.961  -5.480  1.00 148.50 ? 44  DT  I "C4'" 1 
ATOM   2391  O  "O4'" . DT  A  1 118 ? 61.130 45.232  -5.100  1.00 144.56 ? 44  DT  I "O4'" 1 
ATOM   2392  C  "C3'" . DT  A  1 118 ? 63.225 44.165  -5.540  1.00 148.00 ? 44  DT  I "C3'" 1 
ATOM   2393  O  "O3'" . DT  A  1 118 ? 63.646 44.259  -6.898  1.00 152.87 ? 44  DT  I "O3'" 1 
ATOM   2394  C  "C2'" . DT  A  1 118 ? 63.453 45.463  -4.762  1.00 144.07 ? 44  DT  I "C2'" 1 
ATOM   2395  C  "C1'" . DT  A  1 118 ? 62.132 46.208  -4.917  1.00 142.44 ? 44  DT  I "C1'" 1 
ATOM   2396  N  N1    . DT  A  1 118 ? 61.762 47.028  -3.713  1.00 140.44 ? 44  DT  I N1    1 
ATOM   2397  C  C2    . DT  A  1 118 ? 61.387 48.344  -3.876  1.00 137.36 ? 44  DT  I C2    1 
ATOM   2398  O  O2    . DT  A  1 118 ? 61.344 48.898  -4.959  1.00 138.87 ? 44  DT  I O2    1 
ATOM   2399  N  N3    . DT  A  1 118 ? 61.062 48.994  -2.711  1.00 132.19 ? 44  DT  I N3    1 
ATOM   2400  C  C4    . DT  A  1 118 ? 61.074 48.474  -1.431  1.00 129.77 ? 44  DT  I C4    1 
ATOM   2401  O  O4    . DT  A  1 118 ? 60.767 49.140  -0.446  1.00 122.28 ? 44  DT  I O4    1 
ATOM   2402  C  C5    . DT  A  1 118 ? 61.473 47.092  -1.330  1.00 135.50 ? 44  DT  I C5    1 
ATOM   2403  C  C7    . DT  A  1 118 ? 61.525 46.423  0.010   1.00 136.17 ? 44  DT  I C7    1 
ATOM   2404  C  C6    . DT  A  1 118 ? 61.790 46.442  -2.462  1.00 140.03 ? 44  DT  I C6    1 
ATOM   2405  P  P     . DT  A  1 119 ? 65.136 44.728  -7.276  1.00 150.84 ? 45  DT  I P     1 
ATOM   2406  O  OP1   . DT  A  1 119 ? 65.477 44.093  -8.569  1.00 152.60 ? 45  DT  I OP1   1 
ATOM   2407  O  OP2   . DT  A  1 119 ? 66.031 44.520  -6.115  1.00 152.25 ? 45  DT  I OP2   1 
ATOM   2408  O  "O5'" . DT  A  1 119 ? 64.965 46.294  -7.522  1.00 146.35 ? 45  DT  I "O5'" 1 
ATOM   2409  C  "C5'" . DT  A  1 119 ? 63.798 46.766  -8.179  1.00 144.53 ? 45  DT  I "C5'" 1 
ATOM   2410  C  "C4'" . DT  A  1 119 ? 63.900 48.247  -8.476  1.00 140.94 ? 45  DT  I "C4'" 1 
ATOM   2411  O  "O4'" . DT  A  1 119 ? 63.451 49.014  -7.329  1.00 140.77 ? 45  DT  I "O4'" 1 
ATOM   2412  C  "C3'" . DT  A  1 119 ? 65.300 48.747  -8.804  1.00 140.23 ? 45  DT  I "C3'" 1 
ATOM   2413  O  "O3'" . DT  A  1 119 ? 65.210 49.716  -9.839  1.00 139.35 ? 45  DT  I "O3'" 1 
ATOM   2414  C  "C2'" . DT  A  1 119 ? 65.768 49.350  -7.476  1.00 139.40 ? 45  DT  I "C2'" 1 
ATOM   2415  C  "C1'" . DT  A  1 119 ? 64.471 49.893  -6.899  1.00 139.28 ? 45  DT  I "C1'" 1 
ATOM   2416  N  N1    . DT  A  1 119 ? 64.424 49.946  -5.398  1.00 137.64 ? 45  DT  I N1    1 
ATOM   2417  C  C2    . DT  A  1 119 ? 64.018 51.107  -4.781  1.00 133.78 ? 45  DT  I C2    1 
ATOM   2418  O  O2    . DT  A  1 119 ? 63.718 52.118  -5.391  1.00 133.64 ? 45  DT  I O2    1 
ATOM   2419  N  N3    . DT  A  1 119 ? 63.983 51.048  -3.413  1.00 131.02 ? 45  DT  I N3    1 
ATOM   2420  C  C4    . DT  A  1 119 ? 64.298 49.966  -2.614  1.00 132.06 ? 45  DT  I C4    1 
ATOM   2421  O  O4    . DT  A  1 119 ? 64.234 50.013  -1.390  1.00 133.27 ? 45  DT  I O4    1 
ATOM   2422  C  C5    . DT  A  1 119 ? 64.706 48.776  -3.319  1.00 134.52 ? 45  DT  I C5    1 
ATOM   2423  C  C7    . DT  A  1 119 ? 65.076 47.543  -2.550  1.00 135.96 ? 45  DT  I C7    1 
ATOM   2424  C  C6    . DT  A  1 119 ? 64.745 48.819  -4.663  1.00 137.98 ? 45  DT  I C6    1 
ATOM   2425  P  P     . DT  A  1 120 ? 66.510 50.479  -10.393 1.00 139.96 ? 46  DT  I P     1 
ATOM   2426  O  OP1   . DT  A  1 120 ? 66.402 50.493  -11.869 1.00 138.84 ? 46  DT  I OP1   1 
ATOM   2427  O  OP2   . DT  A  1 120 ? 67.728 49.919  -9.763  1.00 143.45 ? 46  DT  I OP2   1 
ATOM   2428  O  "O5'" . DT  A  1 120 ? 66.293 51.967  -9.862  1.00 131.48 ? 46  DT  I "O5'" 1 
ATOM   2429  C  "C5'" . DT  A  1 120 ? 64.966 52.455  -9.704  1.00 127.20 ? 46  DT  I "C5'" 1 
ATOM   2430  C  "C4'" . DT  A  1 120 ? 64.960 53.892  -9.224  1.00 123.34 ? 46  DT  I "C4'" 1 
ATOM   2431  O  "O4'" . DT  A  1 120 ? 64.885 53.933  -7.776  1.00 122.06 ? 46  DT  I "O4'" 1 
ATOM   2432  C  "C3'" . DT  A  1 120 ? 66.179 54.714  -9.608  1.00 124.98 ? 46  DT  I "C3'" 1 
ATOM   2433  O  "O3'" . DT  A  1 120 ? 65.767 56.043  -9.868  1.00 123.82 ? 46  DT  I "O3'" 1 
ATOM   2434  C  "C2'" . DT  A  1 120 ? 67.062 54.614  -8.361  1.00 124.48 ? 46  DT  I "C2'" 1 
ATOM   2435  C  "C1'" . DT  A  1 120 ? 66.033 54.561  -7.239  1.00 122.78 ? 46  DT  I "C1'" 1 
ATOM   2436  N  N1    . DT  A  1 120 ? 66.465 53.767  -6.041  1.00 129.83 ? 46  DT  I N1    1 
ATOM   2437  C  C2    . DT  A  1 120 ? 66.152 54.228  -4.780  1.00 133.84 ? 46  DT  I C2    1 
ATOM   2438  O  O2    . DT  A  1 120 ? 65.557 55.273  -4.579  1.00 134.78 ? 46  DT  I O2    1 
ATOM   2439  N  N3    . DT  A  1 120 ? 66.570 53.420  -3.755  1.00 134.15 ? 46  DT  I N3    1 
ATOM   2440  C  C4    . DT  A  1 120 ? 67.247 52.221  -3.857  1.00 130.70 ? 46  DT  I C4    1 
ATOM   2441  O  O4    . DT  A  1 120 ? 67.580 51.567  -2.872  1.00 127.88 ? 46  DT  I O4    1 
ATOM   2442  C  C5    . DT  A  1 120 ? 67.537 51.789  -5.202  1.00 131.13 ? 46  DT  I C5    1 
ATOM   2443  C  C7    . DT  A  1 120 ? 68.274 50.503  -5.430  1.00 132.05 ? 46  DT  I C7    1 
ATOM   2444  C  C6    . DT  A  1 120 ? 67.132 52.570  -6.220  1.00 132.52 ? 46  DT  I C6    1 
ATOM   2445  P  P     . DT  A  1 121 ? 66.777 57.133  -10.478 1.00 130.22 ? 47  DT  I P     1 
ATOM   2446  O  OP1   . DT  A  1 121 ? 66.200 57.591  -11.761 1.00 128.28 ? 47  DT  I OP1   1 
ATOM   2447  O  OP2   . DT  A  1 121 ? 68.161 56.609  -10.441 1.00 138.00 ? 47  DT  I OP2   1 
ATOM   2448  O  "O5'" . DT  A  1 121 ? 66.660 58.329  -9.432  1.00 123.17 ? 47  DT  I "O5'" 1 
ATOM   2449  C  "C5'" . DT  A  1 121 ? 65.541 58.377  -8.545  1.00 116.72 ? 47  DT  I "C5'" 1 
ATOM   2450  C  "C4'" . DT  A  1 121 ? 65.842 59.258  -7.351  1.00 109.28 ? 47  DT  I "C4'" 1 
ATOM   2451  O  "O4'" . DT  A  1 121 ? 66.166 58.432  -6.198  1.00 109.18 ? 47  DT  I "O4'" 1 
ATOM   2452  C  "C3'" . DT  A  1 121 ? 67.034 60.188  -7.538  1.00 111.84 ? 47  DT  I "C3'" 1 
ATOM   2453  O  "O3'" . DT  A  1 121 ? 66.805 61.398  -6.842  1.00 108.63 ? 47  DT  I "O3'" 1 
ATOM   2454  C  "C2'" . DT  A  1 121 ? 68.165 59.389  -6.901  1.00 118.78 ? 47  DT  I "C2'" 1 
ATOM   2455  C  "C1'" . DT  A  1 121 ? 67.440 58.800  -5.707  1.00 114.52 ? 47  DT  I "C1'" 1 
ATOM   2456  N  N1    . DT  A  1 121 ? 68.097 57.593  -5.124  1.00 117.89 ? 47  DT  I N1    1 
ATOM   2457  C  C2    . DT  A  1 121 ? 68.078 57.412  -3.758  1.00 119.91 ? 47  DT  I C2    1 
ATOM   2458  O  O2    . DT  A  1 121 ? 67.550 58.194  -2.987  1.00 119.70 ? 47  DT  I O2    1 
ATOM   2459  N  N3    . DT  A  1 121 ? 68.701 56.272  -3.323  1.00 124.17 ? 47  DT  I N3    1 
ATOM   2460  C  C4    . DT  A  1 121 ? 69.328 55.316  -4.100  1.00 129.26 ? 47  DT  I C4    1 
ATOM   2461  O  O4    . DT  A  1 121 ? 69.862 54.324  -3.617  1.00 134.47 ? 47  DT  I O4    1 
ATOM   2462  C  C5    . DT  A  1 121 ? 69.315 55.567  -5.521  1.00 128.16 ? 47  DT  I C5    1 
ATOM   2463  C  C7    . DT  A  1 121 ? 69.971 54.599  -6.460  1.00 133.54 ? 47  DT  I C7    1 
ATOM   2464  C  C6    . DT  A  1 121 ? 68.707 56.681  -5.960  1.00 122.51 ? 47  DT  I C6    1 
ATOM   2465  P  P     . DG  A  1 122 ? 66.633 62.777  -7.646  1.00 107.47 ? 48  DG  I P     1 
ATOM   2466  O  OP1   . DG  A  1 122 ? 65.394 62.685  -8.450  1.00 104.42 ? 48  DG  I OP1   1 
ATOM   2467  O  OP2   . DG  A  1 122 ? 67.921 63.069  -8.311  1.00 114.59 ? 48  DG  I OP2   1 
ATOM   2468  O  "O5'" . DG  A  1 122 ? 66.416 63.857  -6.489  1.00 96.31  ? 48  DG  I "O5'" 1 
ATOM   2469  C  "C5'" . DG  A  1 122 ? 65.453 63.613  -5.472  1.00 91.66  ? 48  DG  I "C5'" 1 
ATOM   2470  C  "C4'" . DG  A  1 122 ? 66.077 63.712  -4.091  1.00 93.06  ? 48  DG  I "C4'" 1 
ATOM   2471  O  "O4'" . DG  A  1 122 ? 66.882 62.533  -3.825  1.00 100.99 ? 48  DG  I "O4'" 1 
ATOM   2472  C  "C3'" . DG  A  1 122 ? 66.997 64.911  -3.874  1.00 90.49  ? 48  DG  I "C3'" 1 
ATOM   2473  O  "O3'" . DG  A  1 122 ? 66.763 65.447  -2.586  1.00 85.34  ? 48  DG  I "O3'" 1 
ATOM   2474  C  "C2'" . DG  A  1 122 ? 68.395 64.301  -3.983  1.00 99.95  ? 48  DG  I "C2'" 1 
ATOM   2475  C  "C1'" . DG  A  1 122 ? 68.164 62.925  -3.384  1.00 105.04 ? 48  DG  I "C1'" 1 
ATOM   2476  N  N9    . DG  A  1 122 ? 69.121 61.915  -3.827  1.00 113.82 ? 48  DG  I N9    1 
ATOM   2477  C  C8    . DG  A  1 122 ? 69.620 61.748  -5.095  1.00 116.96 ? 48  DG  I C8    1 
ATOM   2478  N  N7    . DG  A  1 122 ? 70.450 60.747  -5.199  1.00 121.45 ? 48  DG  I N7    1 
ATOM   2479  C  C5    . DG  A  1 122 ? 70.499 60.210  -3.920  1.00 121.84 ? 48  DG  I C5    1 
ATOM   2480  C  C6    . DG  A  1 122 ? 71.232 59.107  -3.421  1.00 127.89 ? 48  DG  I C6    1 
ATOM   2481  O  O6    . DG  A  1 122 ? 72.006 58.360  -4.036  1.00 130.64 ? 48  DG  I O6    1 
ATOM   2482  N  N1    . DG  A  1 122 ? 70.999 58.903  -2.063  1.00 129.69 ? 48  DG  I N1    1 
ATOM   2483  C  C2    . DG  A  1 122 ? 70.161 59.670  -1.286  1.00 125.93 ? 48  DG  I C2    1 
ATOM   2484  N  N2    . DG  A  1 122 ? 70.059 59.327  0.006   1.00 127.59 ? 48  DG  I N2    1 
ATOM   2485  N  N3    . DG  A  1 122 ? 69.468 60.706  -1.743  1.00 120.72 ? 48  DG  I N3    1 
ATOM   2486  C  C4    . DG  A  1 122 ? 69.686 60.917  -3.063  1.00 118.50 ? 48  DG  I C4    1 
ATOM   2487  P  P     . DG  A  1 123 ? 67.173 66.961  -2.244  1.00 100.47 ? 49  DG  I P     1 
ATOM   2488  O  OP1   . DG  A  1 123 ? 65.937 67.696  -1.896  1.00 89.24  ? 49  DG  I OP1   1 
ATOM   2489  O  OP2   . DG  A  1 123 ? 68.042 67.455  -3.333  1.00 105.10 ? 49  DG  I OP2   1 
ATOM   2490  O  "O5'" . DG  A  1 123 ? 68.066 66.812  -0.928  1.00 105.80 ? 49  DG  I "O5'" 1 
ATOM   2491  C  "C5'" . DG  A  1 123 ? 67.594 66.022  0.158   1.00 107.53 ? 49  DG  I "C5'" 1 
ATOM   2492  C  "C4'" . DG  A  1 123 ? 68.750 65.550  1.017   1.00 107.57 ? 49  DG  I "C4'" 1 
ATOM   2493  O  "O4'" . DG  A  1 123 ? 69.393 64.416  0.385   1.00 108.87 ? 49  DG  I "O4'" 1 
ATOM   2494  C  "C3'" . DG  A  1 123 ? 69.841 66.597  1.252   1.00 107.65 ? 49  DG  I "C3'" 1 
ATOM   2495  O  "O3'" . DG  A  1 123 ? 70.075 66.748  2.644   1.00 112.75 ? 49  DG  I "O3'" 1 
ATOM   2496  C  "C2'" . DG  A  1 123 ? 71.065 66.034  0.521   1.00 109.56 ? 49  DG  I "C2'" 1 
ATOM   2497  C  "C1'" . DG  A  1 123 ? 70.787 64.541  0.505   1.00 109.83 ? 49  DG  I "C1'" 1 
ATOM   2498  N  N9    . DG  A  1 123 ? 71.406 63.842  -0.622  1.00 111.49 ? 49  DG  I N9    1 
ATOM   2499  C  C8    . DG  A  1 123 ? 71.273 64.143  -1.956  1.00 109.94 ? 49  DG  I C8    1 
ATOM   2500  N  N7    . DG  A  1 123 ? 71.937 63.338  -2.740  1.00 112.13 ? 49  DG  I N7    1 
ATOM   2501  C  C5    . DG  A  1 123 ? 72.548 62.444  -1.871  1.00 116.99 ? 49  DG  I C5    1 
ATOM   2502  C  C6    . DG  A  1 123 ? 73.397 61.344  -2.142  1.00 124.09 ? 49  DG  I C6    1 
ATOM   2503  O  O6    . DG  A  1 123 ? 73.790 60.930  -3.242  1.00 129.80 ? 49  DG  I O6    1 
ATOM   2504  N  N1    . DG  A  1 123 ? 73.797 60.702  -0.972  1.00 127.48 ? 49  DG  I N1    1 
ATOM   2505  C  C2    . DG  A  1 123 ? 73.423 61.075  0.298   1.00 124.64 ? 49  DG  I C2    1 
ATOM   2506  N  N2    . DG  A  1 123 ? 73.906 60.339  1.308   1.00 127.32 ? 49  DG  I N2    1 
ATOM   2507  N  N3    . DG  A  1 123 ? 72.628 62.103  0.564   1.00 119.99 ? 49  DG  I N3    1 
ATOM   2508  C  C4    . DG  A  1 123 ? 72.230 62.739  -0.563  1.00 116.69 ? 49  DG  I C4    1 
ATOM   2509  P  P     . DT  A  1 124 ? 71.163 67.801  3.182   1.00 111.28 ? 50  DT  I P     1 
ATOM   2510  O  OP1   . DT  A  1 124 ? 70.619 68.403  4.418   1.00 114.79 ? 50  DT  I OP1   1 
ATOM   2511  O  OP2   . DT  A  1 124 ? 71.576 68.679  2.065   1.00 110.64 ? 50  DT  I OP2   1 
ATOM   2512  O  "O5'" . DT  A  1 124 ? 72.400 66.881  3.588   1.00 118.75 ? 50  DT  I "O5'" 1 
ATOM   2513  C  "C5'" . DT  A  1 124 ? 72.199 65.800  4.485   1.00 124.06 ? 50  DT  I "C5'" 1 
ATOM   2514  C  "C4'" . DT  A  1 124 ? 73.489 65.040  4.715   1.00 134.69 ? 50  DT  I "C4'" 1 
ATOM   2515  O  "O4'" . DT  A  1 124 ? 73.841 64.295  3.519   1.00 140.95 ? 50  DT  I "O4'" 1 
ATOM   2516  C  "C3'" . DT  A  1 124 ? 74.702 65.908  5.049   1.00 137.60 ? 50  DT  I "C3'" 1 
ATOM   2517  O  "O3'" . DT  A  1 124 ? 75.449 65.283  6.084   1.00 141.31 ? 50  DT  I "O3'" 1 
ATOM   2518  C  "C2'" . DT  A  1 124 ? 75.474 65.947  3.727   1.00 140.48 ? 50  DT  I "C2'" 1 
ATOM   2519  C  "C1'" . DT  A  1 124 ? 75.181 64.563  3.174   1.00 144.06 ? 50  DT  I "C1'" 1 
ATOM   2520  N  N1    . DT  A  1 124 ? 75.317 64.451  1.689   1.00 145.37 ? 50  DT  I N1    1 
ATOM   2521  C  C2    . DT  A  1 124 ? 76.095 63.445  1.162   1.00 149.73 ? 50  DT  I C2    1 
ATOM   2522  O  O2    . DT  A  1 124 ? 76.697 62.637  1.848   1.00 152.93 ? 50  DT  I O2    1 
ATOM   2523  N  N3    . DT  A  1 124 ? 76.147 63.418  -0.206  1.00 149.18 ? 50  DT  I N3    1 
ATOM   2524  C  C4    . DT  A  1 124 ? 75.513 64.274  -1.085  1.00 142.51 ? 50  DT  I C4    1 
ATOM   2525  O  O4    . DT  A  1 124 ? 75.624 64.167  -2.303  1.00 139.84 ? 50  DT  I O4    1 
ATOM   2526  C  C5    . DT  A  1 124 ? 74.710 65.304  -0.471  1.00 139.69 ? 50  DT  I C5    1 
ATOM   2527  C  C7    . DT  A  1 124 ? 73.978 66.292  -1.329  1.00 135.36 ? 50  DT  I C7    1 
ATOM   2528  C  C6    . DT  A  1 124 ? 74.648 65.342  0.872   1.00 141.35 ? 50  DT  I C6    1 
ATOM   2529  P  P     . DA  A  1 125 ? 76.597 66.081  6.875   1.00 143.47 ? 51  DA  I P     1 
ATOM   2530  O  OP1   . DA  A  1 125 ? 76.189 66.156  8.295   1.00 142.97 ? 51  DA  I OP1   1 
ATOM   2531  O  OP2   . DA  A  1 125 ? 76.913 67.326  6.141   1.00 141.50 ? 51  DA  I OP2   1 
ATOM   2532  O  "O5'" . DA  A  1 125 ? 77.855 65.105  6.759   1.00 150.52 ? 51  DA  I "O5'" 1 
ATOM   2533  C  "C5'" . DA  A  1 125 ? 77.957 64.221  5.649   1.00 155.54 ? 51  DA  I "C5'" 1 
ATOM   2534  C  "C4'" . DA  A  1 125 ? 79.396 64.095  5.202   1.00 162.34 ? 51  DA  I "C4'" 1 
ATOM   2535  O  "O4'" . DA  A  1 125 ? 79.445 63.804  3.779   1.00 164.37 ? 51  DA  I "O4'" 1 
ATOM   2536  C  "C3'" . DA  A  1 125 ? 80.232 65.352  5.404   1.00 162.53 ? 51  DA  I "C3'" 1 
ATOM   2537  O  "O3'" . DA  A  1 125 ? 81.544 64.985  5.794   1.00 164.73 ? 51  DA  I "O3'" 1 
ATOM   2538  C  "C2'" . DA  A  1 125 ? 80.205 66.005  4.021   1.00 162.89 ? 51  DA  I "C2'" 1 
ATOM   2539  C  "C1'" . DA  A  1 125 ? 80.213 64.785  3.113   1.00 165.91 ? 51  DA  I "C1'" 1 
ATOM   2540  N  N9    . DA  A  1 125 ? 79.612 65.021  1.801   1.00 165.46 ? 51  DA  I N9    1 
ATOM   2541  C  C8    . DA  A  1 125 ? 78.576 65.865  1.509   1.00 161.59 ? 51  DA  I C8    1 
ATOM   2542  N  N7    . DA  A  1 125 ? 78.236 65.868  0.241   1.00 161.68 ? 51  DA  I N7    1 
ATOM   2543  C  C5    . DA  A  1 125 ? 79.106 64.959  -0.340  1.00 164.86 ? 51  DA  I C5    1 
ATOM   2544  C  C6    . DA  A  1 125 ? 79.261 64.508  -1.667  1.00 163.97 ? 51  DA  I C6    1 
ATOM   2545  N  N6    . DA  A  1 125 ? 78.505 64.937  -2.682  1.00 160.73 ? 51  DA  I N6    1 
ATOM   2546  N  N1    . DA  A  1 125 ? 80.225 63.595  -1.910  1.00 166.96 ? 51  DA  I N1    1 
ATOM   2547  C  C2    . DA  A  1 125 ? 80.980 63.167  -0.890  1.00 169.86 ? 51  DA  I C2    1 
ATOM   2548  N  N3    . DA  A  1 125 ? 80.928 63.517  0.397   1.00 169.84 ? 51  DA  I N3    1 
ATOM   2549  C  C4    . DA  A  1 125 ? 79.960 64.425  0.607   1.00 167.40 ? 51  DA  I C4    1 
ATOM   2550  P  P     . DG  A  1 126 ? 82.491 66.027  6.565   1.00 170.69 ? 52  DG  I P     1 
ATOM   2551  O  OP1   . DG  A  1 126 ? 82.829 65.445  7.883   1.00 172.37 ? 52  DG  I OP1   1 
ATOM   2552  O  OP2   . DG  A  1 126 ? 81.862 67.365  6.488   1.00 164.27 ? 52  DG  I OP2   1 
ATOM   2553  O  "O5'" . DG  A  1 126 ? 83.805 66.047  5.662   1.00 176.02 ? 52  DG  I "O5'" 1 
ATOM   2554  C  "C5'" . DG  A  1 126 ? 83.690 65.772  4.279   1.00 178.37 ? 52  DG  I "C5'" 1 
ATOM   2555  C  "C4'" . DG  A  1 126 ? 84.765 64.813  3.821   1.00 187.43 ? 52  DG  I "C4'" 1 
ATOM   2556  O  "O4'" . DG  A  1 126 ? 84.397 64.276  2.532   1.00 187.20 ? 52  DG  I "O4'" 1 
ATOM   2557  C  "C3'" . DG  A  1 126 ? 86.105 65.462  3.580   1.00 195.65 ? 52  DG  I "C3'" 1 
ATOM   2558  O  "O3'" . DG  A  1 126 ? 87.123 64.478  3.554   1.00 207.73 ? 52  DG  I "O3'" 1 
ATOM   2559  C  "C2'" . DG  A  1 126 ? 85.892 66.087  2.206   1.00 191.60 ? 52  DG  I "C2'" 1 
ATOM   2560  C  "C1'" . DG  A  1 126 ? 85.004 65.048  1.510   1.00 186.94 ? 52  DG  I "C1'" 1 
ATOM   2561  N  N9    . DG  A  1 126 ? 83.945 65.632  0.685   1.00 178.42 ? 52  DG  I N9    1 
ATOM   2562  C  C8    . DG  A  1 126 ? 82.919 66.444  1.107   1.00 172.65 ? 52  DG  I C8    1 
ATOM   2563  N  N7    . DG  A  1 126 ? 82.113 66.807  0.149   1.00 169.22 ? 52  DG  I N7    1 
ATOM   2564  C  C5    . DG  A  1 126 ? 82.632 66.193  -0.983  1.00 172.72 ? 52  DG  I C5    1 
ATOM   2565  C  C6    . DG  A  1 126 ? 82.179 66.223  -2.323  1.00 167.98 ? 52  DG  I C6    1 
ATOM   2566  O  O6    . DG  A  1 126 ? 81.196 66.818  -2.789  1.00 159.29 ? 52  DG  I O6    1 
ATOM   2567  N  N1    . DG  A  1 126 ? 82.994 65.464  -3.159  1.00 171.48 ? 52  DG  I N1    1 
ATOM   2568  C  C2    . DG  A  1 126 ? 84.106 64.766  -2.751  1.00 175.10 ? 52  DG  I C2    1 
ATOM   2569  N  N2    . DG  A  1 126 ? 84.766 64.092  -3.704  1.00 176.22 ? 52  DG  I N2    1 
ATOM   2570  N  N3    . DG  A  1 126 ? 84.542 64.729  -1.498  1.00 179.43 ? 52  DG  I N3    1 
ATOM   2571  C  C4    . DG  A  1 126 ? 83.759 65.463  -0.671  1.00 177.79 ? 52  DG  I C4    1 
ATOM   2572  P  P     . DT  A  1 127 ? 88.666 64.919  3.623   1.00 196.65 ? 53  DT  I P     1 
ATOM   2573  O  OP1   . DT  A  1 127 ? 89.448 63.756  4.097   1.00 202.78 ? 53  DT  I OP1   1 
ATOM   2574  O  OP2   . DT  A  1 127 ? 88.729 66.199  4.363   1.00 195.63 ? 53  DT  I OP2   1 
ATOM   2575  O  "O5'" . DT  A  1 127 ? 89.043 65.217  2.098   1.00 200.14 ? 53  DT  I "O5'" 1 
ATOM   2576  C  "C5'" . DT  A  1 127 ? 88.837 64.216  1.109   1.00 201.70 ? 53  DT  I "C5'" 1 
ATOM   2577  C  "C4'" . DT  A  1 127 ? 89.136 64.757  -0.278  1.00 200.96 ? 53  DT  I "C4'" 1 
ATOM   2578  O  "O4'" . DT  A  1 127 ? 87.923 65.285  -0.874  1.00 195.61 ? 53  DT  I "O4'" 1 
ATOM   2579  C  "C3'" . DT  A  1 127 ? 90.169 65.887  -0.325  1.00 200.92 ? 53  DT  I "C3'" 1 
ATOM   2580  O  "O3'" . DT  A  1 127 ? 91.183 65.570  -1.276  1.00 202.69 ? 53  DT  I "O3'" 1 
ATOM   2581  C  "C2'" . DT  A  1 127 ? 89.351 67.116  -0.741  1.00 196.05 ? 53  DT  I "C2'" 1 
ATOM   2582  C  "C1'" . DT  A  1 127 ? 88.223 66.487  -1.539  1.00 194.82 ? 53  DT  I "C1'" 1 
ATOM   2583  N  N1    . DT  A  1 127 ? 86.987 67.322  -1.583  1.00 192.19 ? 53  DT  I N1    1 
ATOM   2584  C  C2    . DT  A  1 127 ? 86.295 67.441  -2.765  1.00 191.39 ? 53  DT  I C2    1 
ATOM   2585  O  O2    . DT  A  1 127 ? 86.639 66.895  -3.798  1.00 193.52 ? 53  DT  I O2    1 
ATOM   2586  N  N3    . DT  A  1 127 ? 85.174 68.227  -2.695  1.00 186.80 ? 53  DT  I N3    1 
ATOM   2587  C  C4    . DT  A  1 127 ? 84.688 68.893  -1.585  1.00 182.70 ? 53  DT  I C4    1 
ATOM   2588  O  O4    . DT  A  1 127 ? 83.670 69.577  -1.622  1.00 176.91 ? 53  DT  I O4    1 
ATOM   2589  C  C5    . DT  A  1 127 ? 85.463 68.726  -0.378  1.00 185.29 ? 53  DT  I C5    1 
ATOM   2590  C  C7    . DT  A  1 127 ? 85.035 69.399  0.892   1.00 181.82 ? 53  DT  I C7    1 
ATOM   2591  C  C6    . DT  A  1 127 ? 86.564 67.961  -0.437  1.00 190.18 ? 53  DT  I C6    1 
ATOM   2592  P  P     . DA  A  1 128 ? 92.246 66.678  -1.752  1.00 224.19 ? 54  DA  I P     1 
ATOM   2593  O  OP1   . DA  A  1 128 ? 93.452 65.954  -2.208  1.00 229.20 ? 54  DA  I OP1   1 
ATOM   2594  O  OP2   . DA  A  1 128 ? 92.374 67.709  -0.696  1.00 223.46 ? 54  DA  I OP2   1 
ATOM   2595  O  "O5'" . DA  A  1 128 ? 91.550 67.341  -3.028  1.00 214.87 ? 54  DA  I "O5'" 1 
ATOM   2596  C  "C5'" . DA  A  1 128 ? 91.055 66.509  -4.071  1.00 208.23 ? 54  DA  I "C5'" 1 
ATOM   2597  C  "C4'" . DA  A  1 128 ? 90.666 67.332  -5.284  1.00 199.67 ? 54  DA  I "C4'" 1 
ATOM   2598  O  "O4'" . DA  A  1 128 ? 89.330 67.875  -5.102  1.00 189.82 ? 54  DA  I "O4'" 1 
ATOM   2599  C  "C3'" . DA  A  1 128 ? 91.575 68.528  -5.578  1.00 199.85 ? 54  DA  I "C3'" 1 
ATOM   2600  O  "O3'" . DA  A  1 128 ? 91.788 68.628  -6.977  1.00 203.99 ? 54  DA  I "O3'" 1 
ATOM   2601  C  "C2'" . DA  A  1 128 ? 90.762 69.707  -5.050  1.00 191.39 ? 54  DA  I "C2'" 1 
ATOM   2602  C  "C1'" . DA  A  1 128 ? 89.351 69.257  -5.373  1.00 185.29 ? 54  DA  I "C1'" 1 
ATOM   2603  N  N9    . DA  A  1 128 ? 88.333 69.908  -4.556  1.00 178.01 ? 54  DA  I N9    1 
ATOM   2604  C  C8    . DA  A  1 128 ? 88.360 70.103  -3.203  1.00 177.04 ? 54  DA  I C8    1 
ATOM   2605  N  N7    . DA  A  1 128 ? 87.302 70.723  -2.737  1.00 173.12 ? 54  DA  I N7    1 
ATOM   2606  C  C5    . DA  A  1 128 ? 86.527 70.949  -3.863  1.00 169.09 ? 54  DA  I C5    1 
ATOM   2607  C  C6    . DA  A  1 128 ? 85.274 71.567  -4.045  1.00 157.64 ? 54  DA  I C6    1 
ATOM   2608  N  N6    . DA  A  1 128 ? 84.560 72.090  -3.044  1.00 151.28 ? 54  DA  I N6    1 
ATOM   2609  N  N1    . DA  A  1 128 ? 84.783 71.627  -5.300  1.00 154.28 ? 54  DA  I N1    1 
ATOM   2610  C  C2    . DA  A  1 128 ? 85.500 71.100  -6.300  1.00 157.82 ? 54  DA  I C2    1 
ATOM   2611  N  N3    . DA  A  1 128 ? 86.687 70.497  -6.252  1.00 167.66 ? 54  DA  I N3    1 
ATOM   2612  C  C4    . DA  A  1 128 ? 87.149 70.453  -4.993  1.00 172.63 ? 54  DA  I C4    1 
ATOM   2613  P  P     . DG  A  1 129 ? 92.904 69.618  -7.576  1.00 191.14 ? 55  DG  I P     1 
ATOM   2614  O  OP1   . DG  A  1 129 ? 93.981 68.775  -8.138  1.00 196.04 ? 55  DG  I OP1   1 
ATOM   2615  O  OP2   . DG  A  1 129 ? 93.240 70.648  -6.567  1.00 191.12 ? 55  DG  I OP2   1 
ATOM   2616  O  "O5'" . DG  A  1 129 ? 92.137 70.350  -8.772  1.00 187.17 ? 55  DG  I "O5'" 1 
ATOM   2617  C  "C5'" . DG  A  1 129 ? 91.170 69.634  -9.531  1.00 187.12 ? 55  DG  I "C5'" 1 
ATOM   2618  C  "C4'" . DG  A  1 129 ? 90.201 70.587  -10.208 1.00 185.96 ? 55  DG  I "C4'" 1 
ATOM   2619  O  "O4'" . DG  A  1 129 ? 89.168 70.988  -9.273  1.00 181.82 ? 55  DG  I "O4'" 1 
ATOM   2620  C  "C3'" . DG  A  1 129 ? 90.830 71.876  -10.740 1.00 189.51 ? 55  DG  I "C3'" 1 
ATOM   2621  O  "O3'" . DG  A  1 129 ? 90.547 72.011  -12.128 1.00 192.34 ? 55  DG  I "O3'" 1 
ATOM   2622  C  "C2'" . DG  A  1 129 ? 90.179 72.989  -9.906  1.00 184.67 ? 55  DG  I "C2'" 1 
ATOM   2623  C  "C1'" . DG  A  1 129 ? 88.873 72.349  -9.462  1.00 178.98 ? 55  DG  I "C1'" 1 
ATOM   2624  N  N9    . DG  A  1 129 ? 88.362 72.883  -8.199  1.00 173.36 ? 55  DG  I N9    1 
ATOM   2625  C  C8    . DG  A  1 129 ? 88.933 72.741  -6.958  1.00 174.35 ? 55  DG  I C8    1 
ATOM   2626  N  N7    . DG  A  1 129 ? 88.258 73.317  -6.004  1.00 170.79 ? 55  DG  I N7    1 
ATOM   2627  C  C5    . DG  A  1 129 ? 87.165 73.880  -6.650  1.00 166.78 ? 55  DG  I C5    1 
ATOM   2628  C  C6    . DG  A  1 129 ? 86.085 74.630  -6.124  1.00 160.61 ? 55  DG  I C6    1 
ATOM   2629  O  O6    . DG  A  1 129 ? 85.884 74.954  -4.946  1.00 157.70 ? 55  DG  I O6    1 
ATOM   2630  N  N1    . DG  A  1 129 ? 85.185 75.013  -7.117  1.00 158.19 ? 55  DG  I N1    1 
ATOM   2631  C  C2    . DG  A  1 129 ? 85.312 74.707  -8.452  1.00 160.14 ? 55  DG  I C2    1 
ATOM   2632  N  N2    . DG  A  1 129 ? 84.344 75.166  -9.265  1.00 156.48 ? 55  DG  I N2    1 
ATOM   2633  N  N3    . DG  A  1 129 ? 86.322 74.002  -8.961  1.00 164.90 ? 55  DG  I N3    1 
ATOM   2634  C  C4    . DG  A  1 129 ? 87.208 73.621  -8.003  1.00 167.81 ? 55  DG  I C4    1 
ATOM   2635  P  P     . DG  A  1 130 ? 90.997 73.328  -12.931 1.00 182.17 ? 56  DG  I P     1 
ATOM   2636  O  OP1   . DG  A  1 130 ? 91.138 72.953  -14.355 1.00 184.65 ? 56  DG  I OP1   1 
ATOM   2637  O  OP2   . DG  A  1 130 ? 92.140 73.941  -12.218 1.00 185.10 ? 56  DG  I OP2   1 
ATOM   2638  O  "O5'" . DG  A  1 130 ? 89.737 74.299  -12.788 1.00 178.72 ? 56  DG  I "O5'" 1 
ATOM   2639  C  "C5'" . DG  A  1 130 ? 88.432 73.789  -13.021 1.00 177.28 ? 56  DG  I "C5'" 1 
ATOM   2640  C  "C4'" . DG  A  1 130 ? 87.391 74.889  -12.938 1.00 173.30 ? 56  DG  I "C4'" 1 
ATOM   2641  O  "O4'" . DG  A  1 130 ? 87.108 75.199  -11.549 1.00 173.27 ? 56  DG  I "O4'" 1 
ATOM   2642  C  "C3'" . DG  A  1 130 ? 87.785 76.212  -13.588 1.00 170.23 ? 56  DG  I "C3'" 1 
ATOM   2643  O  "O3'" . DG  A  1 130 ? 86.637 76.788  -14.179 1.00 158.20 ? 56  DG  I "O3'" 1 
ATOM   2644  C  "C2'" . DG  A  1 130 ? 88.267 77.037  -12.395 1.00 172.80 ? 56  DG  I "C2'" 1 
ATOM   2645  C  "C1'" . DG  A  1 130 ? 87.280 76.584  -11.334 1.00 172.12 ? 56  DG  I "C1'" 1 
ATOM   2646  N  N9    . DG  A  1 130 ? 87.725 76.777  -9.958  1.00 173.21 ? 56  DG  I N9    1 
ATOM   2647  C  C8    . DG  A  1 130 ? 88.902 76.348  -9.392  1.00 177.19 ? 56  DG  I C8    1 
ATOM   2648  N  N7    . DG  A  1 130 ? 89.006 76.646  -8.125  1.00 176.82 ? 56  DG  I N7    1 
ATOM   2649  C  C5    . DG  A  1 130 ? 87.817 77.303  -7.831  1.00 171.33 ? 56  DG  I C5    1 
ATOM   2650  C  C6    . DG  A  1 130 ? 87.354 77.857  -6.613  1.00 167.45 ? 56  DG  I C6    1 
ATOM   2651  O  O6    . DG  A  1 130 ? 87.928 77.885  -5.514  1.00 168.92 ? 56  DG  I O6    1 
ATOM   2652  N  N1    . DG  A  1 130 ? 86.092 78.434  -6.755  1.00 161.60 ? 56  DG  I N1    1 
ATOM   2653  C  C2    . DG  A  1 130 ? 85.372 78.462  -7.925  1.00 158.36 ? 56  DG  I C2    1 
ATOM   2654  N  N2    . DG  A  1 130 ? 84.177 79.057  -7.871  1.00 149.95 ? 56  DG  I N2    1 
ATOM   2655  N  N3    . DG  A  1 130 ? 85.793 77.944  -9.068  1.00 161.95 ? 56  DG  I N3    1 
ATOM   2656  C  C4    . DG  A  1 130 ? 87.019 77.385  -8.948  1.00 168.68 ? 56  DG  I C4    1 
ATOM   2657  P  P     . DA  A  1 131 ? 86.746 77.627  -15.543 1.00 167.91 ? 57  DA  I P     1 
ATOM   2658  O  OP1   . DA  A  1 131 ? 86.070 76.849  -16.606 1.00 166.36 ? 57  DA  I OP1   1 
ATOM   2659  O  OP2   . DA  A  1 131 ? 88.156 78.040  -15.714 1.00 171.05 ? 57  DA  I OP2   1 
ATOM   2660  O  "O5'" . DA  A  1 131 ? 85.875 78.929  -15.236 1.00 159.12 ? 57  DA  I "O5'" 1 
ATOM   2661  C  "C5'" . DA  A  1 131 ? 84.753 78.834  -14.359 1.00 149.80 ? 57  DA  I "C5'" 1 
ATOM   2662  C  "C4'" . DA  A  1 131 ? 84.321 80.207  -13.878 1.00 142.44 ? 57  DA  I "C4'" 1 
ATOM   2663  O  "O4'" . DA  A  1 131 ? 84.633 80.356  -12.466 1.00 142.43 ? 57  DA  I "O4'" 1 
ATOM   2664  C  "C3'" . DA  A  1 131 ? 85.013 81.375  -14.564 1.00 143.29 ? 57  DA  I "C3'" 1 
ATOM   2665  O  "O3'" . DA  A  1 131 ? 84.172 82.511  -14.503 1.00 140.14 ? 57  DA  I "O3'" 1 
ATOM   2666  C  "C2'" . DA  A  1 131 ? 86.229 81.565  -13.663 1.00 146.52 ? 57  DA  I "C2'" 1 
ATOM   2667  C  "C1'" . DA  A  1 131 ? 85.566 81.409  -12.303 1.00 146.79 ? 57  DA  I "C1'" 1 
ATOM   2668  N  N9    . DA  A  1 131 ? 86.475 81.052  -11.220 1.00 157.12 ? 57  DA  I N9    1 
ATOM   2669  C  C8    . DA  A  1 131 ? 87.594 80.273  -11.303 1.00 162.93 ? 57  DA  I C8    1 
ATOM   2670  N  N7    . DA  A  1 131 ? 88.209 80.108  -10.155 1.00 164.59 ? 57  DA  I N7    1 
ATOM   2671  C  C5    . DA  A  1 131 ? 87.436 80.824  -9.257  1.00 160.93 ? 57  DA  I C5    1 
ATOM   2672  C  C6    . DA  A  1 131 ? 87.554 81.046  -7.870  1.00 161.08 ? 57  DA  I C6    1 
ATOM   2673  N  N6    . DA  A  1 131 ? 88.545 80.543  -7.131  1.00 165.95 ? 57  DA  I N6    1 
ATOM   2674  N  N1    . DA  A  1 131 ? 86.614 81.809  -7.274  1.00 156.56 ? 57  DA  I N1    1 
ATOM   2675  C  C2    . DA  A  1 131 ? 85.622 82.310  -8.021  1.00 152.65 ? 57  DA  I C2    1 
ATOM   2676  N  N3    . DA  A  1 131 ? 85.409 82.173  -9.332  1.00 152.14 ? 57  DA  I N3    1 
ATOM   2677  C  C4    . DA  A  1 131 ? 86.361 81.410  -9.894  1.00 156.92 ? 57  DA  I C4    1 
ATOM   2678  P  P     . DC  A  1 132 ? 83.016 82.771  -15.590 1.00 138.13 ? 58  DC  I P     1 
ATOM   2679  O  OP1   . DC  A  1 132 ? 82.427 81.473  -15.989 1.00 135.38 ? 58  DC  I OP1   1 
ATOM   2680  O  OP2   . DC  A  1 132 ? 83.576 83.663  -16.628 1.00 141.54 ? 58  DC  I OP2   1 
ATOM   2681  O  "O5'" . DC  A  1 132 ? 81.915 83.603  -14.770 1.00 136.03 ? 58  DC  I "O5'" 1 
ATOM   2682  C  "C5'" . DC  A  1 132 ? 81.201 82.975  -13.701 1.00 134.33 ? 58  DC  I "C5'" 1 
ATOM   2683  C  "C4'" . DC  A  1 132 ? 80.624 83.989  -12.712 1.00 130.50 ? 58  DC  I "C4'" 1 
ATOM   2684  O  "O4'" . DC  A  1 132 ? 81.559 84.230  -11.637 1.00 132.47 ? 58  DC  I "O4'" 1 
ATOM   2685  C  "C3'" . DC  A  1 132 ? 80.288 85.363  -13.260 1.00 128.66 ? 58  DC  I "C3'" 1 
ATOM   2686  O  "O3'" . DC  A  1 132 ? 79.222 85.917  -12.487 1.00 124.80 ? 58  DC  I "O3'" 1 
ATOM   2687  C  "C2'" . DC  A  1 132 ? 81.595 86.132  -13.061 1.00 131.70 ? 58  DC  I "C2'" 1 
ATOM   2688  C  "C1'" . DC  A  1 132 ? 82.173 85.500  -11.792 1.00 133.19 ? 58  DC  I "C1'" 1 
ATOM   2689  N  N1    . DC  A  1 132 ? 83.636 85.271  -11.856 1.00 138.77 ? 58  DC  I N1    1 
ATOM   2690  C  C2    . DC  A  1 132 ? 84.392 85.260  -10.678 1.00 142.32 ? 58  DC  I C2    1 
ATOM   2691  O  O2    . DC  A  1 132 ? 83.827 85.470  -9.599  1.00 143.29 ? 58  DC  I O2    1 
ATOM   2692  N  N3    . DC  A  1 132 ? 85.726 85.026  -10.760 1.00 145.41 ? 58  DC  I N3    1 
ATOM   2693  C  C4    . DC  A  1 132 ? 86.292 84.801  -11.946 1.00 148.76 ? 58  DC  I C4    1 
ATOM   2694  N  N4    . DC  A  1 132 ? 87.610 84.577  -11.984 1.00 154.37 ? 58  DC  I N4    1 
ATOM   2695  C  C5    . DC  A  1 132 ? 85.536 84.812  -13.152 1.00 147.35 ? 58  DC  I C5    1 
ATOM   2696  C  C6    . DC  A  1 132 ? 84.224 85.037  -13.059 1.00 142.68 ? 58  DC  I C6    1 
ATOM   2697  P  P     . DC  A  1 133 ? 78.798 87.461  -12.635 1.00 125.56 ? 59  DC  I P     1 
ATOM   2698  O  OP1   . DC  A  1 133 ? 77.386 87.557  -12.202 1.00 122.41 ? 59  DC  I OP1   1 
ATOM   2699  O  OP2   . DC  A  1 133 ? 79.185 87.934  -13.983 1.00 128.47 ? 59  DC  I OP2   1 
ATOM   2700  O  "O5'" . DC  A  1 133 ? 79.702 88.214  -11.551 1.00 124.03 ? 59  DC  I "O5'" 1 
ATOM   2701  C  "C5'" . DC  A  1 133 ? 79.558 87.905  -10.164 1.00 120.10 ? 59  DC  I "C5'" 1 
ATOM   2702  C  "C4'" . DC  A  1 133 ? 80.444 88.792  -9.304  1.00 118.39 ? 59  DC  I "C4'" 1 
ATOM   2703  O  "O4'" . DC  A  1 133 ? 81.829 88.353  -9.401  1.00 123.10 ? 59  DC  I "O4'" 1 
ATOM   2704  C  "C3'" . DC  A  1 133 ? 80.463 90.273  -9.686  1.00 117.74 ? 59  DC  I "C3'" 1 
ATOM   2705  O  "O3'" . DC  A  1 133 ? 80.677 91.050  -8.519  1.00 118.15 ? 59  DC  I "O3'" 1 
ATOM   2706  C  "C2'" . DC  A  1 133 ? 81.685 90.335  -10.590 1.00 122.68 ? 59  DC  I "C2'" 1 
ATOM   2707  C  "C1'" . DC  A  1 133 ? 82.621 89.457  -9.782  1.00 127.60 ? 59  DC  I "C1'" 1 
ATOM   2708  N  N1    . DC  A  1 133 ? 83.817 88.972  -10.523 1.00 136.75 ? 59  DC  I N1    1 
ATOM   2709  C  C2    . DC  A  1 133 ? 85.034 88.840  -9.844  1.00 141.66 ? 59  DC  I C2    1 
ATOM   2710  O  O2    . DC  A  1 133 ? 85.083 89.131  -8.643  1.00 141.97 ? 59  DC  I O2    1 
ATOM   2711  N  N3    . DC  A  1 133 ? 86.120 88.396  -10.524 1.00 144.94 ? 59  DC  I N3    1 
ATOM   2712  C  C4    . DC  A  1 133 ? 86.016 88.093  -11.819 1.00 145.29 ? 59  DC  I C4    1 
ATOM   2713  N  N4    . DC  A  1 133 ? 87.111 87.660  -12.452 1.00 149.91 ? 59  DC  I N4    1 
ATOM   2714  C  C5    . DC  A  1 133 ? 84.784 88.228  -12.527 1.00 142.23 ? 59  DC  I C5    1 
ATOM   2715  C  C6    . DC  A  1 133 ? 83.721 88.666  -11.846 1.00 138.31 ? 59  DC  I C6    1 
ATOM   2716  P  P     . DA  A  1 134 ? 79.502 91.942  -7.884  1.00 121.55 ? 60  DA  I P     1 
ATOM   2717  O  OP1   . DA  A  1 134 ? 78.408 91.025  -7.492  1.00 122.99 ? 60  DA  I OP1   1 
ATOM   2718  O  OP2   . DA  A  1 134 ? 79.226 93.065  -8.809  1.00 117.76 ? 60  DA  I OP2   1 
ATOM   2719  O  "O5'" . DA  A  1 134 ? 80.173 92.545  -6.559  1.00 116.58 ? 60  DA  I "O5'" 1 
ATOM   2720  C  "C5'" . DA  A  1 134 ? 80.546 91.673  -5.494  1.00 112.40 ? 60  DA  I "C5'" 1 
ATOM   2721  C  "C4'" . DA  A  1 134 ? 81.850 92.110  -4.833  1.00 115.65 ? 60  DA  I "C4'" 1 
ATOM   2722  O  "O4'" . DA  A  1 134 ? 82.983 91.734  -5.659  1.00 119.04 ? 60  DA  I "O4'" 1 
ATOM   2723  C  "C3'" . DA  A  1 134 ? 82.002 93.601  -4.578  1.00 117.76 ? 60  DA  I "C3'" 1 
ATOM   2724  O  "O3'" . DA  A  1 134 ? 82.774 93.793  -3.401  1.00 121.60 ? 60  DA  I "O3'" 1 
ATOM   2725  C  "C2'" . DA  A  1 134 ? 82.749 94.073  -5.825  1.00 118.95 ? 60  DA  I "C2'" 1 
ATOM   2726  C  "C1'" . DA  A  1 134 ? 83.675 92.891  -6.100  1.00 123.31 ? 60  DA  I "C1'" 1 
ATOM   2727  N  N9    . DA  A  1 134 ? 83.993 92.695  -7.515  1.00 131.87 ? 60  DA  I N9    1 
ATOM   2728  C  C8    . DA  A  1 134 ? 83.129 92.785  -8.569  1.00 132.47 ? 60  DA  I C8    1 
ATOM   2729  N  N7    . DA  A  1 134 ? 83.683 92.535  -9.732  1.00 135.84 ? 60  DA  I N7    1 
ATOM   2730  C  C5    . DA  A  1 134 ? 84.997 92.239  -9.420  1.00 138.38 ? 60  DA  I C5    1 
ATOM   2731  C  C6    . DA  A  1 134 ? 86.104 91.886  -10.219 1.00 135.98 ? 60  DA  I C6    1 
ATOM   2732  N  N6    . DA  A  1 134 ? 86.043 91.761  -11.549 1.00 136.11 ? 60  DA  I N6    1 
ATOM   2733  N  N1    . DA  A  1 134 ? 87.280 91.664  -9.596  1.00 137.21 ? 60  DA  I N1    1 
ATOM   2734  C  C2    . DA  A  1 134 ? 87.337 91.791  -8.264  1.00 139.28 ? 60  DA  I C2    1 
ATOM   2735  N  N3    . DA  A  1 134 ? 86.366 92.116  -7.408  1.00 140.99 ? 60  DA  I N3    1 
ATOM   2736  C  C4    . DA  A  1 134 ? 85.209 92.330  -8.057  1.00 139.06 ? 60  DA  I C4    1 
ATOM   2737  P  P     . DG  A  1 135 ? 82.684 95.165  -2.572  1.00 109.89 ? 61  DG  I P     1 
ATOM   2738  O  OP1   . DG  A  1 135 ? 82.517 94.808  -1.145  1.00 106.81 ? 61  DG  I OP1   1 
ATOM   2739  O  OP2   . DG  A  1 135 ? 81.691 96.044  -3.228  1.00 102.93 ? 61  DG  I OP2   1 
ATOM   2740  O  "O5'" . DG  A  1 135 ? 84.133 95.807  -2.769  1.00 118.86 ? 61  DG  I "O5'" 1 
ATOM   2741  C  "C5'" . DG  A  1 135 ? 85.284 95.033  -2.469  1.00 126.25 ? 61  DG  I "C5'" 1 
ATOM   2742  C  "C4'" . DG  A  1 135 ? 86.498 95.550  -3.218  1.00 133.94 ? 61  DG  I "C4'" 1 
ATOM   2743  O  "O4'" . DG  A  1 135 ? 86.475 95.078  -4.590  1.00 135.91 ? 61  DG  I "O4'" 1 
ATOM   2744  C  "C3'" . DG  A  1 135 ? 86.620 97.076  -3.295  1.00 136.00 ? 61  DG  I "C3'" 1 
ATOM   2745  O  "O3'" . DG  A  1 135 ? 87.933 97.454  -2.920  1.00 139.40 ? 61  DG  I "O3'" 1 
ATOM   2746  C  "C2'" . DG  A  1 135 ? 86.347 97.380  -4.772  1.00 136.03 ? 61  DG  I "C2'" 1 
ATOM   2747  C  "C1'" . DG  A  1 135 ? 86.894 96.126  -5.425  1.00 138.20 ? 61  DG  I "C1'" 1 
ATOM   2748  N  N9    . DG  A  1 135 ? 86.400 95.880  -6.778  1.00 137.99 ? 61  DG  I N9    1 
ATOM   2749  C  C8    . DG  A  1 135 ? 85.096 95.909  -7.211  1.00 134.72 ? 61  DG  I C8    1 
ATOM   2750  N  N7    . DG  A  1 135 ? 84.965 95.635  -8.481  1.00 135.40 ? 61  DG  I N7    1 
ATOM   2751  C  C5    . DG  A  1 135 ? 86.266 95.411  -8.916  1.00 138.44 ? 61  DG  I C5    1 
ATOM   2752  C  C6    . DG  A  1 135 ? 86.758 95.076  -10.201 1.00 138.05 ? 61  DG  I C6    1 
ATOM   2753  O  O6    . DG  A  1 135 ? 86.120 94.902  -11.249 1.00 137.01 ? 61  DG  I O6    1 
ATOM   2754  N  N1    . DG  A  1 135 ? 88.145 94.941  -10.201 1.00 140.14 ? 61  DG  I N1    1 
ATOM   2755  C  C2    . DG  A  1 135 ? 88.952 95.109  -9.100  1.00 142.72 ? 61  DG  I C2    1 
ATOM   2756  N  N2    . DG  A  1 135 ? 90.268 94.941  -9.284  1.00 149.85 ? 61  DG  I N2    1 
ATOM   2757  N  N3    . DG  A  1 135 ? 88.502 95.422  -7.895  1.00 140.86 ? 61  DG  I N3    1 
ATOM   2758  C  C4    . DG  A  1 135 ? 87.157 95.557  -7.877  1.00 139.81 ? 61  DG  I C4    1 
ATOM   2759  P  P     . DG  A  1 136 ? 88.277 98.977  -2.543  1.00 138.81 ? 62  DG  I P     1 
ATOM   2760  O  OP1   . DG  A  1 136 ? 88.785 98.982  -1.153  1.00 142.10 ? 62  DG  I OP1   1 
ATOM   2761  O  OP2   . DG  A  1 136 ? 87.122 99.827  -2.908  1.00 132.35 ? 62  DG  I OP2   1 
ATOM   2762  O  "O5'" . DG  A  1 136 ? 89.482 99.333  -3.527  1.00 139.06 ? 62  DG  I "O5'" 1 
ATOM   2763  C  "C5'" . DG  A  1 136 ? 90.507 98.376  -3.758  1.00 139.91 ? 62  DG  I "C5'" 1 
ATOM   2764  C  "C4'" . DG  A  1 136 ? 91.333 98.761  -4.968  1.00 141.08 ? 62  DG  I "C4'" 1 
ATOM   2765  O  "O4'" . DG  A  1 136 ? 90.731 98.212  -6.167  1.00 139.21 ? 62  DG  I "O4'" 1 
ATOM   2766  C  "C3'" . DG  A  1 136 ? 91.468 100.266 -5.194  1.00 140.25 ? 62  DG  I "C3'" 1 
ATOM   2767  O  "O3'" . DG  A  1 136 ? 92.839 100.605 -5.339  1.00 144.82 ? 62  DG  I "O3'" 1 
ATOM   2768  C  "C2'" . DG  A  1 136 ? 90.665 100.529 -6.474  1.00 137.60 ? 62  DG  I "C2'" 1 
ATOM   2769  C  "C1'" . DG  A  1 136 ? 90.719 99.185  -7.183  1.00 139.62 ? 62  DG  I "C1'" 1 
ATOM   2770  N  N9    . DG  A  1 136 ? 89.562 98.927  -8.039  1.00 139.07 ? 62  DG  I N9    1 
ATOM   2771  C  C8    . DG  A  1 136 ? 88.241 98.915  -7.661  1.00 135.76 ? 62  DG  I C8    1 
ATOM   2772  N  N7    . DG  A  1 136 ? 87.422 98.643  -8.639  1.00 134.11 ? 62  DG  I N7    1 
ATOM   2773  C  C5    . DG  A  1 136 ? 88.253 98.455  -9.736  1.00 137.21 ? 62  DG  I C5    1 
ATOM   2774  C  C6    . DG  A  1 136 ? 87.932 98.136  -11.078 1.00 138.46 ? 62  DG  I C6    1 
ATOM   2775  O  O6    . DG  A  1 136 ? 86.813 97.949  -11.576 1.00 138.04 ? 62  DG  I O6    1 
ATOM   2776  N  N1    . DG  A  1 136 ? 89.073 98.038  -11.871 1.00 140.03 ? 62  DG  I N1    1 
ATOM   2777  C  C2    . DG  A  1 136 ? 90.361 98.225  -11.424 1.00 140.76 ? 62  DG  I C2    1 
ATOM   2778  N  N2    . DG  A  1 136 ? 91.337 98.091  -12.331 1.00 140.45 ? 62  DG  I N2    1 
ATOM   2779  N  N3    . DG  A  1 136 ? 90.673 98.525  -10.169 1.00 143.12 ? 62  DG  I N3    1 
ATOM   2780  C  C4    . DG  A  1 136 ? 89.574 98.624  -9.384  1.00 140.23 ? 62  DG  I C4    1 
ATOM   2781  P  P     . DT  A  1 137 ? 93.279 102.114 -5.664  1.00 141.97 ? 63  DT  I P     1 
ATOM   2782  O  OP1   . DT  A  1 137 ? 94.587 102.347 -5.014  1.00 145.10 ? 63  DT  I OP1   1 
ATOM   2783  O  OP2   . DT  A  1 137 ? 92.146 103.020 -5.367  1.00 138.56 ? 63  DT  I OP2   1 
ATOM   2784  O  "O5'" . DT  A  1 137 ? 93.498 102.094 -7.242  1.00 142.73 ? 63  DT  I "O5'" 1 
ATOM   2785  C  "C5'" . DT  A  1 137 ? 94.304 101.080 -7.828  1.00 146.62 ? 63  DT  I "C5'" 1 
ATOM   2786  C  "C4'" . DT  A  1 137 ? 94.702 101.470 -9.234  1.00 149.57 ? 63  DT  I "C4'" 1 
ATOM   2787  O  "O4'" . DT  A  1 137 ? 93.674 101.039 -10.166 1.00 147.47 ? 63  DT  I "O4'" 1 
ATOM   2788  C  "C3'" . DT  A  1 137 ? 94.868 102.971 -9.448  1.00 150.93 ? 63  DT  I "C3'" 1 
ATOM   2789  O  "O3'" . DT  A  1 137 ? 95.949 103.220 -10.340 1.00 155.40 ? 63  DT  I "O3'" 1 
ATOM   2790  C  "C2'" . DT  A  1 137 ? 93.524 103.378 -10.049 1.00 147.83 ? 63  DT  I "C2'" 1 
ATOM   2791  C  "C1'" . DT  A  1 137 ? 93.171 102.150 -10.877 1.00 147.24 ? 63  DT  I "C1'" 1 
ATOM   2792  N  N1    . DT  A  1 137 ? 91.702 101.969 -11.063 1.00 143.51 ? 63  DT  I N1    1 
ATOM   2793  C  C2    . DT  A  1 137 ? 91.217 101.604 -12.298 1.00 143.27 ? 63  DT  I C2    1 
ATOM   2794  O  O2    . DT  A  1 137 ? 91.930 101.409 -13.266 1.00 147.34 ? 63  DT  I O2    1 
ATOM   2795  N  N3    . DT  A  1 137 ? 89.855 101.471 -12.359 1.00 139.43 ? 63  DT  I N3    1 
ATOM   2796  C  C4    . DT  A  1 137 ? 88.949 101.666 -11.333 1.00 138.45 ? 63  DT  I C4    1 
ATOM   2797  O  O4    . DT  A  1 137 ? 87.740 101.521 -11.487 1.00 138.17 ? 63  DT  I O4    1 
ATOM   2798  C  C5    . DT  A  1 137 ? 89.524 102.050 -10.067 1.00 138.61 ? 63  DT  I C5    1 
ATOM   2799  C  C7    . DT  A  1 137 ? 88.639 102.288 -8.880  1.00 136.65 ? 63  DT  I C7    1 
ATOM   2800  C  C6    . DT  A  1 137 ? 90.856 102.183 -9.994  1.00 141.23 ? 63  DT  I C6    1 
ATOM   2801  P  P     . DG  A  1 138 ? 96.631 104.675 -10.408 1.00 155.70 ? 64  DG  I P     1 
ATOM   2802  O  OP1   . DG  A  1 138 ? 98.080 104.507 -10.159 1.00 162.82 ? 64  DG  I OP1   1 
ATOM   2803  O  OP2   . DG  A  1 138 ? 95.839 105.590 -9.556  1.00 148.81 ? 64  DG  I OP2   1 
ATOM   2804  O  "O5'" . DG  A  1 138 ? 96.427 105.104 -11.934 1.00 159.28 ? 64  DG  I "O5'" 1 
ATOM   2805  C  "C5'" . DG  A  1 138 ? 95.363 104.532 -12.675 1.00 157.63 ? 64  DG  I "C5'" 1 
ATOM   2806  C  "C4'" . DG  A  1 138 ? 95.532 104.768 -14.156 1.00 160.24 ? 64  DG  I "C4'" 1 
ATOM   2807  O  "O4'" . DG  A  1 138 ? 94.309 104.397 -14.825 1.00 156.85 ? 64  DG  I "O4'" 1 
ATOM   2808  C  "C3'" . DG  A  1 138 ? 95.735 106.213 -14.541 1.00 161.97 ? 64  DG  I "C3'" 1 
ATOM   2809  O  "O3'" . DG  A  1 138 ? 96.273 106.283 -15.850 1.00 161.94 ? 64  DG  I "O3'" 1 
ATOM   2810  C  "C2'" . DG  A  1 138 ? 94.307 106.748 -14.487 1.00 158.97 ? 64  DG  I "C2'" 1 
ATOM   2811  C  "C1'" . DG  A  1 138 ? 93.482 105.541 -14.953 1.00 154.20 ? 64  DG  I "C1'" 1 
ATOM   2812  N  N9    . DG  A  1 138 ? 92.261 105.317 -14.175 1.00 146.23 ? 64  DG  I N9    1 
ATOM   2813  C  C8    . DG  A  1 138 ? 92.112 105.407 -12.810 1.00 144.70 ? 64  DG  I C8    1 
ATOM   2814  N  N7    . DG  A  1 138 ? 90.900 105.143 -12.400 1.00 140.00 ? 64  DG  I N7    1 
ATOM   2815  C  C5    . DG  A  1 138 ? 90.203 104.856 -13.566 1.00 137.63 ? 64  DG  I C5    1 
ATOM   2816  C  C6    . DG  A  1 138 ? 88.845 104.497 -13.755 1.00 129.42 ? 64  DG  I C6    1 
ATOM   2817  O  O6    . DG  A  1 138 ? 87.959 104.358 -12.899 1.00 124.49 ? 64  DG  I O6    1 
ATOM   2818  N  N1    . DG  A  1 138 ? 88.550 104.296 -15.102 1.00 129.87 ? 64  DG  I N1    1 
ATOM   2819  C  C2    . DG  A  1 138 ? 89.453 104.424 -16.133 1.00 134.22 ? 64  DG  I C2    1 
ATOM   2820  N  N2    . DG  A  1 138 ? 88.994 104.190 -17.369 1.00 131.66 ? 64  DG  I N2    1 
ATOM   2821  N  N3    . DG  A  1 138 ? 90.723 104.757 -15.967 1.00 139.97 ? 64  DG  I N3    1 
ATOM   2822  C  C4    . DG  A  1 138 ? 91.028 104.957 -14.665 1.00 141.70 ? 64  DG  I C4    1 
ATOM   2823  P  P     . DG  A  1 139 ? 96.734 107.692 -16.465 1.00 169.87 ? 65  DG  I P     1 
ATOM   2824  O  OP1   . DG  A  1 139 ? 97.846 107.428 -17.406 1.00 172.48 ? 65  DG  I OP1   1 
ATOM   2825  O  OP2   . DG  A  1 139 ? 96.926 108.639 -15.345 1.00 169.61 ? 65  DG  I OP2   1 
ATOM   2826  O  "O5'" . DG  A  1 139 ? 95.457 108.169 -17.295 1.00 163.09 ? 65  DG  I "O5'" 1 
ATOM   2827  C  "C5'" . DG  A  1 139 ? 94.838 107.275 -18.201 1.00 158.25 ? 65  DG  I "C5'" 1 
ATOM   2828  C  "C4'" . DG  A  1 139 ? 93.454 107.762 -18.572 1.00 151.03 ? 65  DG  I "C4'" 1 
ATOM   2829  O  "O4'" . DG  A  1 139 ? 92.504 107.390 -17.536 1.00 144.93 ? 65  DG  I "O4'" 1 
ATOM   2830  C  "C3'" . DG  A  1 139 ? 93.319 109.284 -18.732 1.00 150.20 ? 65  DG  I "C3'" 1 
ATOM   2831  O  "O3'" . DG  A  1 139 ? 92.505 109.560 -19.859 1.00 147.56 ? 65  DG  I "O3'" 1 
ATOM   2832  C  "C2'" . DG  A  1 139 ? 92.616 109.689 -17.439 1.00 145.90 ? 65  DG  I "C2'" 1 
ATOM   2833  C  "C1'" . DG  A  1 139 ? 91.690 108.504 -17.286 1.00 141.25 ? 65  DG  I "C1'" 1 
ATOM   2834  N  N9    . DG  A  1 139 ? 91.055 108.377 -15.979 1.00 138.45 ? 65  DG  I N9    1 
ATOM   2835  C  C8    . DG  A  1 139 ? 91.618 108.565 -14.739 1.00 139.78 ? 65  DG  I C8    1 
ATOM   2836  N  N7    . DG  A  1 139 ? 90.777 108.375 -13.756 1.00 136.13 ? 65  DG  I N7    1 
ATOM   2837  C  C5    . DG  A  1 139 ? 89.585 108.050 -14.391 1.00 132.56 ? 65  DG  I C5    1 
ATOM   2838  C  C6    . DG  A  1 139 ? 88.311 107.738 -13.855 1.00 129.30 ? 65  DG  I C6    1 
ATOM   2839  O  O6    . DG  A  1 139 ? 87.966 107.684 -12.667 1.00 129.18 ? 65  DG  I O6    1 
ATOM   2840  N  N1    . DG  A  1 139 ? 87.383 107.469 -14.862 1.00 126.12 ? 65  DG  I N1    1 
ATOM   2841  C  C2    . DG  A  1 139 ? 87.655 107.497 -16.209 1.00 125.78 ? 65  DG  I C2    1 
ATOM   2842  N  N2    . DG  A  1 139 ? 86.644 107.212 -17.039 1.00 122.29 ? 65  DG  I N2    1 
ATOM   2843  N  N3    . DG  A  1 139 ? 88.837 107.784 -16.716 1.00 130.52 ? 65  DG  I N3    1 
ATOM   2844  C  C4    . DG  A  1 139 ? 89.748 108.046 -15.755 1.00 133.76 ? 65  DG  I C4    1 
ATOM   2845  P  P     . DA  A  1 140 ? 92.543 110.997 -20.575 1.00 153.74 ? 66  DA  I P     1 
ATOM   2846  O  OP1   . DA  A  1 140 ? 93.686 110.999 -21.516 1.00 152.95 ? 66  DA  I OP1   1 
ATOM   2847  O  OP2   . DA  A  1 140 ? 92.442 112.044 -19.533 1.00 153.90 ? 66  DA  I OP2   1 
ATOM   2848  O  "O5'" . DA  A  1 140 ? 91.181 111.023 -21.411 1.00 145.17 ? 66  DA  I "O5'" 1 
ATOM   2849  C  "C5'" . DA  A  1 140 ? 90.659 109.813 -21.947 1.00 138.96 ? 66  DA  I "C5'" 1 
ATOM   2850  C  "C4'" . DA  A  1 140 ? 89.146 109.777 -21.826 1.00 134.09 ? 66  DA  I "C4'" 1 
ATOM   2851  O  "O4'" . DA  A  1 140 ? 88.768 109.447 -20.463 1.00 138.37 ? 66  DA  I "O4'" 1 
ATOM   2852  C  "C3'" . DA  A  1 140 ? 88.440 111.089 -22.158 1.00 132.81 ? 66  DA  I "C3'" 1 
ATOM   2853  O  "O3'" . DA  A  1 140 ? 87.272 110.825 -22.918 1.00 129.58 ? 66  DA  I "O3'" 1 
ATOM   2854  C  "C2'" . DA  A  1 140 ? 88.104 111.667 -20.783 1.00 134.00 ? 66  DA  I "C2'" 1 
ATOM   2855  C  "C1'" . DA  A  1 140 ? 87.854 110.405 -19.972 1.00 135.03 ? 66  DA  I "C1'" 1 
ATOM   2856  N  N9    . DA  A  1 140 ? 88.090 110.561 -18.537 1.00 132.45 ? 66  DA  I N9    1 
ATOM   2857  C  C8    . DA  A  1 140 ? 89.288 110.792 -17.921 1.00 134.41 ? 66  DA  I C8    1 
ATOM   2858  N  N7    . DA  A  1 140 ? 89.206 110.876 -16.613 1.00 133.02 ? 66  DA  I N7    1 
ATOM   2859  C  C5    . DA  A  1 140 ? 87.861 110.674 -16.351 1.00 127.73 ? 66  DA  I C5    1 
ATOM   2860  C  C6    . DA  A  1 140 ? 87.122 110.633 -15.150 1.00 124.77 ? 66  DA  I C6    1 
ATOM   2861  N  N6    . DA  A  1 140 ? 87.666 110.807 -13.940 1.00 126.13 ? 66  DA  I N6    1 
ATOM   2862  N  N1    . DA  A  1 140 ? 85.795 110.408 -15.243 1.00 120.61 ? 66  DA  I N1    1 
ATOM   2863  C  C2    . DA  A  1 140 ? 85.251 110.233 -16.454 1.00 119.38 ? 66  DA  I C2    1 
ATOM   2864  N  N3    . DA  A  1 140 ? 85.842 110.246 -17.647 1.00 121.73 ? 66  DA  I N3    1 
ATOM   2865  C  C4    . DA  A  1 140 ? 87.159 110.473 -17.525 1.00 126.34 ? 66  DA  I C4    1 
ATOM   2866  P  P     . DT  A  1 141 ? 86.607 111.987 -23.804 1.00 130.94 ? 67  DT  I P     1 
ATOM   2867  O  OP1   . DT  A  1 141 ? 86.074 111.360 -25.035 1.00 127.81 ? 67  DT  I OP1   1 
ATOM   2868  O  OP2   . DT  A  1 141 ? 87.584 113.094 -23.906 1.00 132.60 ? 67  DT  I OP2   1 
ATOM   2869  O  "O5'" . DT  A  1 141 ? 85.382 112.489 -22.906 1.00 134.45 ? 67  DT  I "O5'" 1 
ATOM   2870  C  "C5'" . DT  A  1 141 ? 84.399 111.556 -22.473 1.00 128.40 ? 67  DT  I "C5'" 1 
ATOM   2871  C  "C4'" . DT  A  1 141 ? 83.425 112.189 -21.494 1.00 125.90 ? 67  DT  I "C4'" 1 
ATOM   2872  O  "O4'" . DT  A  1 141 ? 83.954 112.112 -20.140 1.00 127.32 ? 67  DT  I "O4'" 1 
ATOM   2873  C  "C3'" . DT  A  1 141 ? 83.117 113.676 -21.720 1.00 127.27 ? 67  DT  I "C3'" 1 
ATOM   2874  O  "O3'" . DT  A  1 141 ? 81.778 113.919 -21.344 1.00 132.24 ? 67  DT  I "O3'" 1 
ATOM   2875  C  "C2'" . DT  A  1 141 ? 84.054 114.335 -20.718 1.00 125.73 ? 67  DT  I "C2'" 1 
ATOM   2876  C  "C1'" . DT  A  1 141 ? 83.823 113.388 -19.563 1.00 125.56 ? 67  DT  I "C1'" 1 
ATOM   2877  N  N1    . DT  A  1 141 ? 84.761 113.530 -18.421 1.00 127.81 ? 67  DT  I N1    1 
ATOM   2878  C  C2    . DT  A  1 141 ? 84.248 113.507 -17.147 1.00 124.17 ? 67  DT  I C2    1 
ATOM   2879  O  O2    . DT  A  1 141 ? 83.061 113.373 -16.911 1.00 123.45 ? 67  DT  I O2    1 
ATOM   2880  N  N3    . DT  A  1 141 ? 85.172 113.641 -16.152 1.00 124.45 ? 67  DT  I N3    1 
ATOM   2881  C  C4    . DT  A  1 141 ? 86.536 113.797 -16.298 1.00 130.52 ? 67  DT  I C4    1 
ATOM   2882  O  O4    . DT  A  1 141 ? 87.286 113.909 -15.333 1.00 133.38 ? 67  DT  I O4    1 
ATOM   2883  C  C5    . DT  A  1 141 ? 87.014 113.816 -17.664 1.00 127.79 ? 67  DT  I C5    1 
ATOM   2884  C  C7    . DT  A  1 141 ? 88.477 113.982 -17.949 1.00 132.57 ? 67  DT  I C7    1 
ATOM   2885  C  C6    . DT  A  1 141 ? 86.112 113.684 -18.650 1.00 125.40 ? 67  DT  I C6    1 
ATOM   2886  P  P     . DA  A  1 142 ? 80.675 114.381 -22.414 1.00 117.96 ? 68  DA  I P     1 
ATOM   2887  O  OP1   . DA  A  1 142 ? 80.774 113.491 -23.592 1.00 118.18 ? 68  DA  I OP1   1 
ATOM   2888  O  OP2   . DA  A  1 142 ? 80.799 115.846 -22.584 1.00 116.83 ? 68  DA  I OP2   1 
ATOM   2889  O  "O5'" . DA  A  1 142 ? 79.301 114.096 -21.646 1.00 122.66 ? 68  DA  I "O5'" 1 
ATOM   2890  C  "C5'" . DA  A  1 142 ? 79.192 112.954 -20.798 1.00 128.89 ? 68  DA  I "C5'" 1 
ATOM   2891  C  "C4'" . DA  A  1 142 ? 78.616 113.328 -19.440 1.00 132.87 ? 68  DA  I "C4'" 1 
ATOM   2892  O  "O4'" . DA  A  1 142 ? 79.687 113.641 -18.509 1.00 138.56 ? 68  DA  I "O4'" 1 
ATOM   2893  C  "C3'" . DA  A  1 142 ? 77.686 114.538 -19.435 1.00 131.67 ? 68  DA  I "C3'" 1 
ATOM   2894  O  "O3'" . DA  A  1 142 ? 76.587 114.279 -18.570 1.00 125.31 ? 68  DA  I "O3'" 1 
ATOM   2895  C  "C2'" . DA  A  1 142 ? 78.582 115.659 -18.902 1.00 135.76 ? 68  DA  I "C2'" 1 
ATOM   2896  C  "C1'" . DA  A  1 142 ? 79.449 114.900 -17.913 1.00 138.35 ? 68  DA  I "C1'" 1 
ATOM   2897  N  N9    . DA  A  1 142 ? 80.746 115.520 -17.644 1.00 142.88 ? 68  DA  I N9    1 
ATOM   2898  C  C8    . DA  A  1 142 ? 81.703 115.850 -18.561 1.00 146.51 ? 68  DA  I C8    1 
ATOM   2899  N  N7    . DA  A  1 142 ? 82.787 116.368 -18.035 1.00 149.87 ? 68  DA  I N7    1 
ATOM   2900  C  C5    . DA  A  1 142 ? 82.528 116.372 -16.675 1.00 148.73 ? 68  DA  I C5    1 
ATOM   2901  C  C6    . DA  A  1 142 ? 83.286 116.797 -15.567 1.00 151.68 ? 68  DA  I C6    1 
ATOM   2902  N  N6    . DA  A  1 142 ? 84.510 117.323 -15.675 1.00 156.57 ? 68  DA  I N6    1 
ATOM   2903  N  N1    . DA  A  1 142 ? 82.737 116.662 -14.342 1.00 149.99 ? 68  DA  I N1    1 
ATOM   2904  C  C2    . DA  A  1 142 ? 81.508 116.138 -14.241 1.00 145.67 ? 68  DA  I C2    1 
ATOM   2905  N  N3    . DA  A  1 142 ? 80.702 115.698 -15.208 1.00 143.00 ? 68  DA  I N3    1 
ATOM   2906  C  C4    . DA  A  1 142 ? 81.276 115.846 -16.413 1.00 144.58 ? 68  DA  I C4    1 
ATOM   2907  P  P     . DT  A  1 143 ? 75.510 115.424 -18.240 1.00 130.61 ? 69  DT  I P     1 
ATOM   2908  O  OP1   . DT  A  1 143 ? 74.243 114.747 -17.883 1.00 122.20 ? 69  DT  I OP1   1 
ATOM   2909  O  OP2   . DT  A  1 143 ? 75.534 116.411 -19.343 1.00 133.47 ? 69  DT  I OP2   1 
ATOM   2910  O  "O5'" . DT  A  1 143 ? 76.098 116.127 -16.931 1.00 130.42 ? 69  DT  I "O5'" 1 
ATOM   2911  C  "C5'" . DT  A  1 143 ? 76.556 115.328 -15.844 1.00 128.16 ? 69  DT  I "C5'" 1 
ATOM   2912  C  "C4'" . DT  A  1 143 ? 76.365 116.049 -14.523 1.00 124.54 ? 69  DT  I "C4'" 1 
ATOM   2913  O  "O4'" . DT  A  1 143 ? 77.615 116.647 -14.095 1.00 127.33 ? 69  DT  I "O4'" 1 
ATOM   2914  C  "C3'" . DT  A  1 143 ? 75.349 117.177 -14.544 1.00 120.17 ? 69  DT  I "C3'" 1 
ATOM   2915  O  "O3'" . DT  A  1 143 ? 74.710 117.249 -13.284 1.00 118.05 ? 69  DT  I "O3'" 1 
ATOM   2916  C  "C2'" . DT  A  1 143 ? 76.211 118.413 -14.818 1.00 122.04 ? 69  DT  I "C2'" 1 
ATOM   2917  C  "C1'" . DT  A  1 143 ? 77.529 118.062 -14.131 1.00 127.21 ? 69  DT  I "C1'" 1 
ATOM   2918  N  N1    . DT  A  1 143 ? 78.741 118.569 -14.847 1.00 132.17 ? 69  DT  I N1    1 
ATOM   2919  C  C2    . DT  A  1 143 ? 79.818 119.019 -14.114 1.00 138.00 ? 69  DT  I C2    1 
ATOM   2920  O  O2    . DT  A  1 143 ? 79.831 119.044 -12.896 1.00 142.28 ? 69  DT  I O2    1 
ATOM   2921  N  N3    . DT  A  1 143 ? 80.888 119.444 -14.860 1.00 139.13 ? 69  DT  I N3    1 
ATOM   2922  C  C4    . DT  A  1 143 ? 80.983 119.460 -16.241 1.00 139.29 ? 69  DT  I C4    1 
ATOM   2923  O  O4    . DT  A  1 143 ? 81.985 119.861 -16.825 1.00 140.89 ? 69  DT  I O4    1 
ATOM   2924  C  C5    . DT  A  1 143 ? 79.822 118.969 -16.948 1.00 137.97 ? 69  DT  I C5    1 
ATOM   2925  C  C7    . DT  A  1 143 ? 79.812 118.940 -18.447 1.00 143.22 ? 69  DT  I C7    1 
ATOM   2926  C  C6    . DT  A  1 143 ? 78.772 118.550 -16.226 1.00 131.37 ? 69  DT  I C6    1 
HETATM 2927  P  P     . G47 A  1 144 ? 73.349 118.082 -13.097 1.00 123.16 ? 70  G47 I P     1 
HETATM 2928  O  O1P   . G47 A  1 144 ? 72.274 117.129 -12.726 1.00 117.90 ? 70  G47 I O1P   1 
HETATM 2929  O  O2P   . G47 A  1 144 ? 73.160 118.968 -14.272 1.00 120.37 ? 70  G47 I O2P   1 
HETATM 2930  O  "O5'" . G47 A  1 144 ? 73.648 118.981 -11.818 1.00 118.69 ? 70  G47 I "O5'" 1 
HETATM 2931  C  "C5'" . G47 A  1 144 ? 74.312 118.411 -10.692 1.00 113.45 ? 70  G47 I "C5'" 1 
HETATM 2932  C  "C4'" . G47 A  1 144 ? 74.955 119.493 -9.857  1.00 109.52 ? 70  G47 I "C4'" 1 
HETATM 2933  O  "O4'" . G47 A  1 144 ? 76.207 119.900 -10.460 1.00 113.76 ? 70  G47 I "O4'" 1 
HETATM 2934  C  "C3'" . G47 A  1 144 ? 74.117 120.763 -9.711  1.00 104.28 ? 70  G47 I "C3'" 1 
HETATM 2935  O  "O3'" . G47 A  1 144 ? 74.219 121.241 -8.369  1.00 101.27 ? 70  G47 I "O3'" 1 
HETATM 2936  C  "C2'" . G47 A  1 144 ? 74.769 121.734 -10.677 1.00 109.08 ? 70  G47 I "C2'" 1 
HETATM 2937  C  "C1'" . G47 A  1 144 ? 76.224 121.307 -10.639 1.00 114.95 ? 70  G47 I "C1'" 1 
HETATM 2938  N  N9    . G47 A  1 144 ? 76.952 121.588 -11.845 1.00 117.72 ? 70  G47 I N9    1 
HETATM 2939  C  C8    . G47 A  1 144 ? 76.503 121.447 -13.137 1.00 116.28 ? 70  G47 I C8    1 
HETATM 2940  N  N7    . G47 A  1 144 ? 77.395 121.780 -14.030 1.00 118.85 ? 70  G47 I N7    1 
HETATM 2941  C  C5    . G47 A  1 144 ? 78.499 122.162 -13.283 1.00 122.22 ? 70  G47 I C5    1 
HETATM 2942  C  C6    . G47 A  1 144 ? 79.801 122.632 -13.688 1.00 124.23 ? 70  G47 I C6    1 
HETATM 2943  O  O6    . G47 A  1 144 ? 80.235 122.807 -14.835 1.00 125.32 ? 70  G47 I O6    1 
HETATM 2944  N  N1    . G47 A  1 144 ? 80.611 122.906 -12.594 1.00 127.67 ? 70  G47 I N1    1 
HETATM 2945  C  C2    . G47 A  1 144 ? 80.245 122.753 -11.283 1.00 130.81 ? 70  G47 I C2    1 
HETATM 2946  N  N2    . G47 A  1 144 ? 81.173 123.073 -10.368 1.00 140.81 ? 70  G47 I N2    1 
HETATM 2947  N  N3    . G47 A  1 144 ? 79.060 122.324 -10.888 1.00 127.59 ? 70  G47 I N3    1 
HETATM 2948  C  C4    . G47 A  1 144 ? 78.246 122.050 -11.930 1.00 122.92 ? 70  G47 I C4    1 
HETATM 2949  C  C6A   . G47 A  1 144 ? 81.298 124.299 -9.748  1.00 149.76 ? 70  G47 I C6A   1 
HETATM 2950  C  C7A   . G47 A  1 144 ? 80.587 124.335 -8.484  1.00 154.40 ? 70  G47 I C7A   1 
HETATM 2951  S  SG    . G47 A  1 144 ? 81.441 123.778 -6.939  1.00 165.44 ? 70  G47 I SG    1 
ATOM   2952  P  P     . DG  A  1 145 ? 73.460 122.583 -7.923  1.00 98.55  ? 71  DG  I P     1 
ATOM   2953  O  OP1   . DG  A  1 145 ? 73.259 122.495 -6.458  1.00 97.09  ? 71  DG  I OP1   1 
ATOM   2954  O  OP2   . DG  A  1 145 ? 72.304 122.766 -8.830  1.00 96.52  ? 71  DG  I OP2   1 
ATOM   2955  O  "O5'" . DG  A  1 145 ? 74.520 123.739 -8.231  1.00 102.84 ? 71  DG  I "O5'" 1 
ATOM   2956  C  "C5'" . DG  A  1 145 ? 75.870 123.585 -7.818  1.00 106.04 ? 71  DG  I "C5'" 1 
ATOM   2957  C  "C4'" . DG  A  1 145 ? 76.692 124.813 -8.167  1.00 109.55 ? 71  DG  I "C4'" 1 
ATOM   2958  O  "O4'" . DG  A  1 145 ? 77.218 124.695 -9.517  1.00 112.67 ? 71  DG  I "O4'" 1 
ATOM   2959  C  "C3'" . DG  A  1 145 ? 75.933 126.144 -8.127  1.00 110.55 ? 71  DG  I "C3'" 1 
ATOM   2960  O  "O3'" . DG  A  1 145 ? 76.766 127.136 -7.552  1.00 119.73 ? 71  DG  I "O3'" 1 
ATOM   2961  C  "C2'" . DG  A  1 145 ? 75.682 126.430 -9.606  1.00 111.96 ? 71  DG  I "C2'" 1 
ATOM   2962  C  "C1'" . DG  A  1 145 ? 76.973 125.902 -10.198 1.00 119.56 ? 71  DG  I "C1'" 1 
ATOM   2963  N  N9    . DG  A  1 145 ? 76.923 125.638 -11.633 1.00 132.24 ? 71  DG  I N9    1 
ATOM   2964  C  C8    . DG  A  1 145 ? 75.850 125.196 -12.368 1.00 131.90 ? 71  DG  I C8    1 
ATOM   2965  N  N7    . DG  A  1 145 ? 76.118 125.048 -13.638 1.00 132.80 ? 71  DG  I N7    1 
ATOM   2966  C  C5    . DG  A  1 145 ? 77.456 125.413 -13.747 1.00 141.61 ? 71  DG  I C5    1 
ATOM   2967  C  C6    . DG  A  1 145 ? 78.306 125.456 -14.880 1.00 168.13 ? 71  DG  I C6    1 
ATOM   2968  O  O6    . DG  A  1 145 ? 78.038 125.171 -16.056 1.00 211.82 ? 71  DG  I O6    1 
ATOM   2969  N  N1    . DG  A  1 145 ? 79.589 125.886 -14.544 1.00 157.04 ? 71  DG  I N1    1 
ATOM   2970  C  C2    . DG  A  1 145 ? 79.996 126.228 -13.275 1.00 148.51 ? 71  DG  I C2    1 
ATOM   2971  N  N2    . DG  A  1 145 ? 81.268 126.619 -13.133 1.00 149.48 ? 71  DG  I N2    1 
ATOM   2972  N  N3    . DG  A  1 145 ? 79.210 126.190 -12.212 1.00 142.94 ? 71  DG  I N3    1 
ATOM   2973  C  C4    . DG  A  1 145 ? 77.961 125.776 -12.521 1.00 138.92 ? 71  DG  I C4    1 
ATOM   2974  P  P     . DA  A  1 146 ? 76.136 128.418 -6.818  1.00 122.54 ? 72  DA  I P     1 
ATOM   2975  O  OP1   . DA  A  1 146 ? 75.725 128.009 -5.456  1.00 123.13 ? 72  DA  I OP1   1 
ATOM   2976  O  OP2   . DA  A  1 146 ? 75.145 129.024 -7.734  1.00 121.02 ? 72  DA  I OP2   1 
ATOM   2977  O  "O5'" . DA  A  1 146 ? 77.373 129.427 -6.714  1.00 126.98 ? 72  DA  I "O5'" 1 
ATOM   2978  C  "C5'" . DA  A  1 146 ? 78.680 128.924 -6.453  1.00 130.77 ? 72  DA  I "C5'" 1 
ATOM   2979  C  "C4'" . DA  A  1 146 ? 79.732 129.721 -7.206  1.00 136.85 ? 72  DA  I "C4'" 1 
ATOM   2980  O  "O4'" . DA  A  1 146 ? 79.833 129.236 -8.573  1.00 138.44 ? 72  DA  I "O4'" 1 
ATOM   2981  C  "C3'" . DA  A  1 146 ? 79.459 131.220 -7.311  1.00 140.17 ? 72  DA  I "C3'" 1 
ATOM   2982  O  "O3'" . DA  A  1 146 ? 80.678 131.942 -7.198  1.00 145.11 ? 72  DA  I "O3'" 1 
ATOM   2983  C  "C2'" . DA  A  1 146 ? 78.855 131.358 -8.705  1.00 141.04 ? 72  DA  I "C2'" 1 
ATOM   2984  C  "C1'" . DA  A  1 146 ? 79.636 130.306 -9.475  1.00 143.24 ? 72  DA  I "C1'" 1 
ATOM   2985  N  N9    . DA  A  1 146 ? 78.924 129.794 -10.640 1.00 146.02 ? 72  DA  I N9    1 
ATOM   2986  C  C8    . DA  A  1 146 ? 77.693 129.205 -10.652 1.00 142.83 ? 72  DA  I C8    1 
ATOM   2987  N  N7    . DA  A  1 146 ? 77.296 128.833 -11.844 1.00 141.31 ? 72  DA  I N7    1 
ATOM   2988  C  C5    . DA  A  1 146 ? 78.340 129.203 -12.673 1.00 144.53 ? 72  DA  I C5    1 
ATOM   2989  C  C6    . DA  A  1 146 ? 78.532 129.081 -14.060 1.00 147.99 ? 72  DA  I C6    1 
ATOM   2990  N  N6    . DA  A  1 146 ? 77.632 128.528 -14.877 1.00 147.13 ? 72  DA  I N6    1 
ATOM   2991  N  N1    . DA  A  1 146 ? 79.687 129.551 -14.577 1.00 152.56 ? 72  DA  I N1    1 
ATOM   2992  C  C2    . DA  A  1 146 ? 80.585 130.104 -13.752 1.00 156.09 ? 72  DA  I C2    1 
ATOM   2993  N  N3    . DA  A  1 146 ? 80.515 130.274 -12.430 1.00 155.38 ? 72  DA  I N3    1 
ATOM   2994  C  C4    . DA  A  1 146 ? 79.355 129.796 -11.949 1.00 148.96 ? 72  DA  I C4    1 
ATOM   2995  P  P     . DT  A  1 147 ? 80.663 133.498 -6.797  1.00 156.72 ? 73  DT  I P     1 
ATOM   2996  O  OP1   . DT  A  1 147 ? 81.495 133.656 -5.583  1.00 158.93 ? 73  DT  I OP1   1 
ATOM   2997  O  OP2   . DT  A  1 147 ? 79.252 133.943 -6.782  1.00 152.01 ? 73  DT  I OP2   1 
ATOM   2998  O  "O5'" . DT  A  1 147 ? 81.392 134.221 -8.026  1.00 156.22 ? 73  DT  I "O5'" 1 
ATOM   2999  C  "C5'" . DT  A  1 147 ? 80.749 134.289 -9.296  1.00 149.49 ? 73  DT  I "C5'" 1 
ATOM   3000  C  "C4'" . DT  A  1 147 ? 81.769 134.340 -10.419 1.00 148.84 ? 73  DT  I "C4'" 1 
ATOM   3001  O  "O4'" . DT  A  1 147 ? 81.398 133.388 -11.448 1.00 144.34 ? 73  DT  I "O4'" 1 
ATOM   3002  C  "C3'" . DT  A  1 147 ? 81.879 135.682 -11.126 1.00 152.18 ? 73  DT  I "C3'" 1 
ATOM   3003  O  "O3'" . DT  A  1 147 ? 83.190 135.854 -11.646 1.00 156.33 ? 73  DT  I "O3'" 1 
ATOM   3004  C  "C2'" . DT  A  1 147 ? 80.850 135.548 -12.242 1.00 149.38 ? 73  DT  I "C2'" 1 
ATOM   3005  C  "C1'" . DT  A  1 147 ? 80.977 134.072 -12.614 1.00 146.86 ? 73  DT  I "C1'" 1 
ATOM   3006  N  N1    . DT  A  1 147 ? 79.694 133.474 -13.070 1.00 143.45 ? 73  DT  I N1    1 
ATOM   3007  C  C2    . DT  A  1 147 ? 79.510 133.209 -14.408 1.00 145.08 ? 73  DT  I C2    1 
ATOM   3008  O  O2    . DT  A  1 147 ? 80.356 133.430 -15.257 1.00 149.05 ? 73  DT  I O2    1 
ATOM   3009  N  N3    . DT  A  1 147 ? 78.292 132.667 -14.718 1.00 140.55 ? 73  DT  I N3    1 
ATOM   3010  C  C4    . DT  A  1 147 ? 77.262 132.373 -13.847 1.00 138.22 ? 73  DT  I C4    1 
ATOM   3011  O  O4    . DT  A  1 147 ? 76.206 131.885 -14.225 1.00 136.50 ? 73  DT  I O4    1 
ATOM   3012  C  C5    . DT  A  1 147 ? 77.518 132.680 -12.461 1.00 137.78 ? 73  DT  I C5    1 
ATOM   3013  C  C7    . DT  A  1 147 ? 76.471 132.404 -11.422 1.00 135.15 ? 73  DT  I C7    1 
ATOM   3014  C  C6    . DT  A  1 147 ? 78.707 133.210 -12.143 1.00 139.62 ? 73  DT  I C6    1 
ATOM   3015  O  "O5'" . DA  B  2 1   ? 76.002 130.164 -24.926 1.00 168.39 ? -73 DA  J "O5'" 1 
ATOM   3016  C  "C5'" . DA  B  2 1   ? 76.664 131.195 -25.649 1.00 171.25 ? -73 DA  J "C5'" 1 
ATOM   3017  C  "C4'" . DA  B  2 1   ? 77.850 131.726 -24.866 1.00 172.43 ? -73 DA  J "C4'" 1 
ATOM   3018  O  "O4'" . DA  B  2 1   ? 77.386 132.282 -23.605 1.00 169.50 ? -73 DA  J "O4'" 1 
ATOM   3019  C  "C3'" . DA  B  2 1   ? 78.901 130.672 -24.513 1.00 172.34 ? -73 DA  J "C3'" 1 
ATOM   3020  O  "O3'" . DA  B  2 1   ? 80.212 131.172 -24.736 1.00 176.39 ? -73 DA  J "O3'" 1 
ATOM   3021  C  "C2'" . DA  B  2 1   ? 78.654 130.404 -23.035 1.00 169.49 ? -73 DA  J "C2'" 1 
ATOM   3022  C  "C1'" . DA  B  2 1   ? 78.140 131.745 -22.544 1.00 169.09 ? -73 DA  J "C1'" 1 
ATOM   3023  N  N9    . DA  B  2 1   ? 77.281 131.618 -21.373 1.00 165.04 ? -73 DA  J N9    1 
ATOM   3024  C  C8    . DA  B  2 1   ? 75.989 131.172 -21.343 1.00 161.46 ? -73 DA  J C8    1 
ATOM   3025  N  N7    . DA  B  2 1   ? 75.466 131.147 -20.141 1.00 158.44 ? -73 DA  J N7    1 
ATOM   3026  C  C5    . DA  B  2 1   ? 76.489 131.599 -19.324 1.00 160.10 ? -73 DA  J C5    1 
ATOM   3027  C  C6    . DA  B  2 1   ? 76.573 131.805 -17.934 1.00 158.34 ? -73 DA  J C6    1 
ATOM   3028  N  N6    . DA  B  2 1   ? 75.562 131.565 -17.095 1.00 154.45 ? -73 DA  J N6    1 
ATOM   3029  N  N1    . DA  B  2 1   ? 77.741 132.266 -17.440 1.00 161.16 ? -73 DA  J N1    1 
ATOM   3030  C  C2    . DA  B  2 1   ? 78.751 132.504 -18.284 1.00 164.40 ? -73 DA  J C2    1 
ATOM   3031  N  N3    . DA  B  2 1   ? 78.790 132.349 -19.606 1.00 165.49 ? -73 DA  J N3    1 
ATOM   3032  C  C4    . DA  B  2 1   ? 77.616 131.890 -20.068 1.00 163.88 ? -73 DA  J C4    1 
ATOM   3033  P  P     . DT  B  2 2   ? 81.486 130.235 -24.440 1.00 184.65 ? -72 DT  J P     1 
ATOM   3034  O  OP1   . DT  B  2 2   ? 82.560 130.620 -25.381 1.00 192.21 ? -72 DT  J OP1   1 
ATOM   3035  O  OP2   . DT  B  2 2   ? 81.019 128.831 -24.394 1.00 182.54 ? -72 DT  J OP2   1 
ATOM   3036  O  "O5'" . DT  B  2 2   ? 81.930 130.643 -22.958 1.00 177.40 ? -72 DT  J "O5'" 1 
ATOM   3037  C  "C5'" . DT  B  2 2   ? 82.662 131.842 -22.739 1.00 176.72 ? -72 DT  J "C5'" 1 
ATOM   3038  C  "C4'" . DT  B  2 2   ? 83.564 131.709 -21.524 1.00 175.54 ? -72 DT  J "C4'" 1 
ATOM   3039  O  "O4'" . DT  B  2 2   ? 82.751 131.623 -20.324 1.00 172.06 ? -72 DT  J "O4'" 1 
ATOM   3040  C  "C3'" . DT  B  2 2   ? 84.463 130.475 -21.519 1.00 176.08 ? -72 DT  J "C3'" 1 
ATOM   3041  O  "O3'" . DT  B  2 2   ? 85.741 130.804 -20.993 1.00 180.08 ? -72 DT  J "O3'" 1 
ATOM   3042  C  "C2'" . DT  B  2 2   ? 83.716 129.497 -20.616 1.00 171.38 ? -72 DT  J "C2'" 1 
ATOM   3043  C  "C1'" . DT  B  2 2   ? 83.042 130.433 -19.621 1.00 170.13 ? -72 DT  J "C1'" 1 
ATOM   3044  N  N1    . DT  B  2 2   ? 81.764 129.890 -19.077 1.00 165.72 ? -72 DT  J N1    1 
ATOM   3045  C  C2    . DT  B  2 2   ? 81.489 130.025 -17.735 1.00 161.13 ? -72 DT  J C2    1 
ATOM   3046  O  O2    . DT  B  2 2   ? 82.240 130.576 -16.950 1.00 159.34 ? -72 DT  J O2    1 
ATOM   3047  N  N3    . DT  B  2 2   ? 80.289 129.490 -17.342 1.00 158.92 ? -72 DT  J N3    1 
ATOM   3048  C  C4    . DT  B  2 2   ? 79.360 128.847 -18.140 1.00 157.30 ? -72 DT  J C4    1 
ATOM   3049  O  O4    . DT  B  2 2   ? 78.309 128.399 -17.697 1.00 152.73 ? -72 DT  J O4    1 
ATOM   3050  C  C5    . DT  B  2 2   ? 79.711 128.739 -19.532 1.00 161.76 ? -72 DT  J C5    1 
ATOM   3051  C  C7    . DT  B  2 2   ? 78.778 128.056 -20.487 1.00 160.95 ? -72 DT  J C7    1 
ATOM   3052  C  C6    . DT  B  2 2   ? 80.882 129.258 -19.930 1.00 165.99 ? -72 DT  J C6    1 
ATOM   3053  P  P     . DC  B  2 3   ? 86.943 129.740 -21.070 1.00 178.49 ? -71 DC  J P     1 
ATOM   3054  O  OP1   . DC  B  2 3   ? 88.212 130.496 -21.153 1.00 181.93 ? -71 DC  J OP1   1 
ATOM   3055  O  OP2   . DC  B  2 3   ? 86.605 128.754 -22.120 1.00 178.41 ? -71 DC  J OP2   1 
ATOM   3056  O  "O5'" . DC  B  2 3   ? 86.872 128.989 -19.661 1.00 176.67 ? -71 DC  J "O5'" 1 
ATOM   3057  C  "C5'" . DC  B  2 3   ? 86.766 129.743 -18.462 1.00 176.87 ? -71 DC  J "C5'" 1 
ATOM   3058  C  "C4'" . DC  B  2 3   ? 86.590 128.831 -17.263 1.00 175.21 ? -71 DC  J "C4'" 1 
ATOM   3059  O  "O4'" . DC  B  2 3   ? 85.187 128.486 -17.105 1.00 171.03 ? -71 DC  J "O4'" 1 
ATOM   3060  C  "C3'" . DC  B  2 3   ? 87.342 127.496 -17.343 1.00 176.83 ? -71 DC  J "C3'" 1 
ATOM   3061  O  "O3'" . DC  B  2 3   ? 87.875 127.173 -16.068 1.00 175.90 ? -71 DC  J "O3'" 1 
ATOM   3062  C  "C2'" . DC  B  2 3   ? 86.233 126.520 -17.725 1.00 173.19 ? -71 DC  J "C2'" 1 
ATOM   3063  C  "C1'" . DC  B  2 3   ? 85.097 127.098 -16.906 1.00 168.56 ? -71 DC  J "C1'" 1 
ATOM   3064  N  N1    . DC  B  2 3   ? 83.742 126.626 -17.300 1.00 164.21 ? -71 DC  J N1    1 
ATOM   3065  C  C2    . DC  B  2 3   ? 82.751 126.534 -16.323 1.00 159.50 ? -71 DC  J C2    1 
ATOM   3066  O  O2    . DC  B  2 3   ? 83.031 126.859 -15.164 1.00 158.05 ? -71 DC  J O2    1 
ATOM   3067  N  N3    . DC  B  2 3   ? 81.516 126.100 -16.675 1.00 156.22 ? -71 DC  J N3    1 
ATOM   3068  C  C4    . DC  B  2 3   ? 81.266 125.763 -17.942 1.00 156.40 ? -71 DC  J C4    1 
ATOM   3069  N  N4    . DC  B  2 3   ? 80.034 125.340 -18.247 1.00 152.76 ? -71 DC  J N4    1 
ATOM   3070  C  C5    . DC  B  2 3   ? 82.269 125.847 -18.955 1.00 161.19 ? -71 DC  J C5    1 
ATOM   3071  C  C6    . DC  B  2 3   ? 83.483 126.277 -18.592 1.00 164.77 ? -71 DC  J C6    1 
ATOM   3072  P  P     . DC  B  2 4   ? 89.294 127.758 -15.596 1.00 181.95 ? -70 DC  J P     1 
ATOM   3073  O  OP1   . DC  B  2 4   ? 89.154 129.223 -15.441 1.00 183.82 ? -70 DC  J OP1   1 
ATOM   3074  O  OP2   . DC  B  2 4   ? 90.339 127.211 -16.489 1.00 185.89 ? -70 DC  J OP2   1 
ATOM   3075  O  "O5'" . DC  B  2 4   ? 89.487 127.131 -14.138 1.00 176.35 ? -70 DC  J "O5'" 1 
ATOM   3076  C  "C5'" . DC  B  2 4   ? 89.097 127.882 -12.999 1.00 173.53 ? -70 DC  J "C5'" 1 
ATOM   3077  C  "C4'" . DC  B  2 4   ? 88.122 127.106 -12.127 1.00 168.33 ? -70 DC  J "C4'" 1 
ATOM   3078  O  "O4'" . DC  B  2 4   ? 86.962 126.706 -12.896 1.00 165.05 ? -70 DC  J "O4'" 1 
ATOM   3079  C  "C3'" . DC  B  2 4   ? 88.676 125.818 -11.499 1.00 165.86 ? -70 DC  J "C3'" 1 
ATOM   3080  O  "O3'" . DC  B  2 4   ? 88.645 125.927 -10.082 1.00 164.47 ? -70 DC  J "O3'" 1 
ATOM   3081  C  "C2'" . DC  B  2 4   ? 87.724 124.721 -12.000 1.00 161.33 ? -70 DC  J "C2'" 1 
ATOM   3082  C  "C1'" . DC  B  2 4   ? 86.477 125.522 -12.327 1.00 158.78 ? -70 DC  J "C1'" 1 
ATOM   3083  N  N1    . DC  B  2 4   ? 85.546 124.846 -13.284 1.00 152.58 ? -70 DC  J N1    1 
ATOM   3084  C  C2    . DC  B  2 4   ? 84.252 124.513 -12.864 1.00 146.37 ? -70 DC  J C2    1 
ATOM   3085  O  O2    . DC  B  2 4   ? 83.903 124.792 -11.710 1.00 141.99 ? -70 DC  J O2    1 
ATOM   3086  N  N3    . DC  B  2 4   ? 83.415 123.897 -13.735 1.00 144.38 ? -70 DC  J N3    1 
ATOM   3087  C  C4    . DC  B  2 4   ? 83.828 123.615 -14.971 1.00 146.33 ? -70 DC  J C4    1 
ATOM   3088  N  N4    . DC  B  2 4   ? 82.967 123.006 -15.794 1.00 143.60 ? -70 DC  J N4    1 
ATOM   3089  C  C5    . DC  B  2 4   ? 85.145 123.940 -15.417 1.00 150.89 ? -70 DC  J C5    1 
ATOM   3090  C  C6    . DC  B  2 4   ? 85.963 124.549 -14.549 1.00 153.04 ? -70 DC  J C6    1 
ATOM   3091  P  P     . DA  B  2 5   ? 89.492 124.911 -9.171  1.00 168.54 ? -69 DA  J P     1 
ATOM   3092  O  OP1   . DA  B  2 5   ? 90.053 125.687 -8.044  1.00 170.92 ? -69 DA  J OP1   1 
ATOM   3093  O  OP2   . DA  B  2 5   ? 90.395 124.147 -10.058 1.00 171.13 ? -69 DA  J OP2   1 
ATOM   3094  O  "O5'" . DA  B  2 5   ? 88.391 123.898 -8.605  1.00 160.59 ? -69 DA  J "O5'" 1 
ATOM   3095  C  "C5'" . DA  B  2 5   ? 87.277 124.395 -7.873  1.00 155.96 ? -69 DA  J "C5'" 1 
ATOM   3096  C  "C4'" . DA  B  2 5   ? 86.303 123.279 -7.532  1.00 148.67 ? -69 DA  J "C4'" 1 
ATOM   3097  O  "O4'" . DA  B  2 5   ? 85.550 122.901 -8.715  1.00 145.91 ? -69 DA  J "O4'" 1 
ATOM   3098  C  "C3'" . DA  B  2 5   ? 86.938 121.994 -7.015  1.00 146.13 ? -69 DA  J "C3'" 1 
ATOM   3099  O  "O3'" . DA  B  2 5   ? 86.083 121.404 -6.043  1.00 142.06 ? -69 DA  J "O3'" 1 
ATOM   3100  C  "C2'" . DA  B  2 5   ? 87.033 121.137 -8.278  1.00 146.37 ? -69 DA  J "C2'" 1 
ATOM   3101  C  "C1'" . DA  B  2 5   ? 85.751 121.531 -9.000  1.00 143.05 ? -69 DA  J "C1'" 1 
ATOM   3102  N  N9    . DA  B  2 5   ? 85.806 121.380 -10.453 1.00 140.46 ? -69 DA  J N9    1 
ATOM   3103  C  C8    . DA  B  2 5   ? 86.867 121.643 -11.274 1.00 143.40 ? -69 DA  J C8    1 
ATOM   3104  N  N7    . DA  B  2 5   ? 86.617 121.433 -12.547 1.00 143.32 ? -69 DA  J N7    1 
ATOM   3105  C  C5    . DA  B  2 5   ? 85.296 121.010 -12.561 1.00 140.20 ? -69 DA  J C5    1 
ATOM   3106  C  C6    . DA  B  2 5   ? 84.427 120.627 -13.606 1.00 139.32 ? -69 DA  J C6    1 
ATOM   3107  N  N6    . DA  B  2 5   ? 84.787 120.610 -14.893 1.00 141.85 ? -69 DA  J N6    1 
ATOM   3108  N  N1    . DA  B  2 5   ? 83.165 120.261 -13.271 1.00 136.55 ? -69 DA  J N1    1 
ATOM   3109  C  C2    . DA  B  2 5   ? 82.819 120.282 -11.979 1.00 132.94 ? -69 DA  J C2    1 
ATOM   3110  N  N3    . DA  B  2 5   ? 83.543 120.620 -10.917 1.00 133.67 ? -69 DA  J N3    1 
ATOM   3111  C  C4    . DA  B  2 5   ? 84.783 120.978 -11.278 1.00 137.75 ? -69 DA  J C4    1 
ATOM   3112  P  P     . DT  B  2 6   ? 86.693 120.556 -4.822  1.00 142.67 ? -68 DT  J P     1 
ATOM   3113  O  OP1   . DT  B  2 6   ? 86.281 121.214 -3.561  1.00 143.25 ? -68 DT  J OP1   1 
ATOM   3114  O  OP2   . DT  B  2 6   ? 88.127 120.324 -5.100  1.00 143.66 ? -68 DT  J OP2   1 
ATOM   3115  O  "O5'" . DT  B  2 6   ? 85.940 119.153 -4.938  1.00 135.65 ? -68 DT  J "O5'" 1 
ATOM   3116  C  "C5'" . DT  B  2 6   ? 85.620 118.641 -6.220  1.00 132.70 ? -68 DT  J "C5'" 1 
ATOM   3117  C  "C4'" . DT  B  2 6   ? 84.192 118.142 -6.261  1.00 129.40 ? -68 DT  J "C4'" 1 
ATOM   3118  O  "O4'" . DT  B  2 6   ? 83.653 118.340 -7.593  1.00 132.45 ? -68 DT  J "O4'" 1 
ATOM   3119  C  "C3'" . DT  B  2 6   ? 84.041 116.659 -5.991  1.00 126.74 ? -68 DT  J "C3'" 1 
ATOM   3120  O  "O3'" . DT  B  2 6   ? 82.737 116.384 -5.514  1.00 119.98 ? -68 DT  J "O3'" 1 
ATOM   3121  C  "C2'" . DT  B  2 6   ? 84.267 116.070 -7.376  1.00 132.14 ? -68 DT  J "C2'" 1 
ATOM   3122  C  "C1'" . DT  B  2 6   ? 83.577 117.098 -8.270  1.00 131.76 ? -68 DT  J "C1'" 1 
ATOM   3123  N  N1    . DT  B  2 6   ? 84.222 117.253 -9.608  1.00 129.62 ? -68 DT  J N1    1 
ATOM   3124  C  C2    . DT  B  2 6   ? 83.508 116.946 -10.745 1.00 128.08 ? -68 DT  J C2    1 
ATOM   3125  O  O2    . DT  B  2 6   ? 82.357 116.548 -10.725 1.00 125.96 ? -68 DT  J O2    1 
ATOM   3126  N  N3    . DT  B  2 6   ? 84.196 117.125 -11.918 1.00 129.39 ? -68 DT  J N3    1 
ATOM   3127  C  C4    . DT  B  2 6   ? 85.499 117.568 -12.062 1.00 131.06 ? -68 DT  J C4    1 
ATOM   3128  O  O4    . DT  B  2 6   ? 86.032 117.696 -13.159 1.00 132.46 ? -68 DT  J O4    1 
ATOM   3129  C  C5    . DT  B  2 6   ? 86.189 117.870 -10.831 1.00 130.74 ? -68 DT  J C5    1 
ATOM   3130  C  C7    . DT  B  2 6   ? 87.607 118.358 -10.862 1.00 130.21 ? -68 DT  J C7    1 
ATOM   3131  C  C6    . DT  B  2 6   ? 85.525 117.700 -9.679  1.00 129.90 ? -68 DT  J C6    1 
ATOM   3132  P  P     . DA  B  2 7   ? 82.397 114.952 -4.870  1.00 120.18 ? -67 DA  J P     1 
ATOM   3133  O  OP1   . DA  B  2 7   ? 81.720 115.191 -3.576  1.00 117.56 ? -67 DA  J OP1   1 
ATOM   3134  O  OP2   . DA  B  2 7   ? 83.625 114.128 -4.914  1.00 118.78 ? -67 DA  J OP2   1 
ATOM   3135  O  "O5'" . DA  B  2 7   ? 81.352 114.321 -5.901  1.00 116.05 ? -67 DA  J "O5'" 1 
ATOM   3136  C  "C5'" . DA  B  2 7   ? 80.368 115.149 -6.501  1.00 112.60 ? -67 DA  J "C5'" 1 
ATOM   3137  C  "C4'" . DA  B  2 7   ? 79.790 114.489 -7.738  1.00 110.56 ? -67 DA  J "C4'" 1 
ATOM   3138  O  "O4'" . DA  B  2 7   ? 80.703 114.647 -8.856  1.00 114.02 ? -67 DA  J "O4'" 1 
ATOM   3139  C  "C3'" . DA  B  2 7   ? 79.522 112.994 -7.606  1.00 105.26 ? -67 DA  J "C3'" 1 
ATOM   3140  O  "O3'" . DA  B  2 7   ? 78.247 112.692 -8.164  1.00 94.14  ? -67 DA  J "O3'" 1 
ATOM   3141  C  "C2'" . DA  B  2 7   ? 80.673 112.350 -8.392  1.00 110.63 ? -67 DA  J "C2'" 1 
ATOM   3142  C  "C1'" . DA  B  2 7   ? 80.955 113.396 -9.461  1.00 113.53 ? -67 DA  J "C1'" 1 
ATOM   3143  N  N9    . DA  B  2 7   ? 82.340 113.408 -9.939  1.00 114.98 ? -67 DA  J N9    1 
ATOM   3144  C  C8    . DA  B  2 7   ? 83.469 113.484 -9.176  1.00 115.50 ? -67 DA  J C8    1 
ATOM   3145  N  N7    . DA  B  2 7   ? 84.582 113.503 -9.871  1.00 117.24 ? -67 DA  J N7    1 
ATOM   3146  C  C5    . DA  B  2 7   ? 84.155 113.440 -11.185 1.00 118.93 ? -67 DA  J C5    1 
ATOM   3147  C  C6    . DA  B  2 7   ? 84.852 113.424 -12.412 1.00 122.28 ? -67 DA  J C6    1 
ATOM   3148  N  N6    . DA  B  2 7   ? 86.187 113.471 -12.505 1.00 122.11 ? -67 DA  J N6    1 
ATOM   3149  N  N1    . DA  B  2 7   ? 84.122 113.358 -13.543 1.00 122.88 ? -67 DA  J N1    1 
ATOM   3150  C  C2    . DA  B  2 7   ? 82.789 113.306 -13.447 1.00 120.01 ? -67 DA  J C2    1 
ATOM   3151  N  N3    . DA  B  2 7   ? 82.022 113.321 -12.357 1.00 117.47 ? -67 DA  J N3    1 
ATOM   3152  C  C4    . DA  B  2 7   ? 82.774 113.387 -11.248 1.00 116.28 ? -67 DA  J C4    1 
ATOM   3153  P  P     . DT  B  2 8   ? 77.717 111.178 -8.227  1.00 94.11  ? -66 DT  J P     1 
ATOM   3154  O  OP1   . DT  B  2 8   ? 76.249 111.214 -8.392  1.00 91.38  ? -66 DT  J OP1   1 
ATOM   3155  O  OP2   . DT  B  2 8   ? 78.330 110.420 -7.114  1.00 98.60  ? -66 DT  J OP2   1 
ATOM   3156  O  "O5'" . DT  B  2 8   ? 78.308 110.648 -9.602  1.00 99.09  ? -66 DT  J "O5'" 1 
ATOM   3157  C  "C5'" . DT  B  2 8   ? 78.085 111.397 -10.778 1.00 100.89 ? -66 DT  J "C5'" 1 
ATOM   3158  C  "C4'" . DT  B  2 8   ? 78.402 110.567 -11.995 1.00 102.55 ? -66 DT  J "C4'" 1 
ATOM   3159  O  "O4'" . DT  B  2 8   ? 79.766 110.821 -12.412 1.00 99.41  ? -66 DT  J "O4'" 1 
ATOM   3160  C  "C3'" . DT  B  2 8   ? 78.283 109.059 -11.784 1.00 106.08 ? -66 DT  J "C3'" 1 
ATOM   3161  O  "O3'" . DT  B  2 8   ? 77.547 108.498 -12.860 1.00 116.31 ? -66 DT  J "O3'" 1 
ATOM   3162  C  "C2'" . DT  B  2 8   ? 79.742 108.583 -11.755 1.00 102.88 ? -66 DT  J "C2'" 1 
ATOM   3163  C  "C1'" . DT  B  2 8   ? 80.419 109.600 -12.655 1.00 103.97 ? -66 DT  J "C1'" 1 
ATOM   3164  N  N1    . DT  B  2 8   ? 81.869 109.788 -12.373 1.00 107.58 ? -66 DT  J N1    1 
ATOM   3165  C  C2    . DT  B  2 8   ? 82.741 109.893 -13.428 1.00 110.30 ? -66 DT  J C2    1 
ATOM   3166  O  O2    . DT  B  2 8   ? 82.388 109.832 -14.593 1.00 110.03 ? -66 DT  J O2    1 
ATOM   3167  N  N3    . DT  B  2 8   ? 84.050 110.072 -13.076 1.00 111.69 ? -66 DT  J N3    1 
ATOM   3168  C  C4    . DT  B  2 8   ? 84.567 110.156 -11.797 1.00 108.02 ? -66 DT  J C4    1 
ATOM   3169  O  O4    . DT  B  2 8   ? 85.766 110.319 -11.586 1.00 110.44 ? -66 DT  J O4    1 
ATOM   3170  C  C5    . DT  B  2 8   ? 83.598 110.041 -10.730 1.00 106.61 ? -66 DT  J C5    1 
ATOM   3171  C  C7    . DT  B  2 8   ? 84.039 110.116 -9.299  1.00 104.35 ? -66 DT  J C7    1 
ATOM   3172  C  C6    . DT  B  2 8   ? 82.309 109.866 -11.066 1.00 106.16 ? -66 DT  J C6    1 
ATOM   3173  P  P     . DC  B  2 9   ? 77.289 106.917 -12.967 1.00 118.15 ? -65 DC  J P     1 
ATOM   3174  O  OP1   . DC  B  2 9   ? 75.858 106.739 -13.293 1.00 118.84 ? -65 DC  J OP1   1 
ATOM   3175  O  OP2   . DC  B  2 9   ? 77.851 106.221 -11.788 1.00 118.07 ? -65 DC  J OP2   1 
ATOM   3176  O  "O5'" . DC  B  2 9   ? 78.145 106.514 -14.248 1.00 119.33 ? -65 DC  J "O5'" 1 
ATOM   3177  C  "C5'" . DC  B  2 9   ? 78.266 107.439 -15.323 1.00 119.37 ? -65 DC  J "C5'" 1 
ATOM   3178  C  "C4'" . DC  B  2 9   ? 79.288 106.955 -16.326 1.00 119.15 ? -65 DC  J "C4'" 1 
ATOM   3179  O  "O4'" . DC  B  2 9   ? 80.612 107.380 -15.913 1.00 119.16 ? -65 DC  J "O4'" 1 
ATOM   3180  C  "C3'" . DC  B  2 9   ? 79.347 105.439 -16.483 1.00 121.23 ? -65 DC  J "C3'" 1 
ATOM   3181  O  "O3'" . DC  B  2 9   ? 79.422 105.099 -17.853 1.00 125.48 ? -65 DC  J "O3'" 1 
ATOM   3182  C  "C2'" . DC  B  2 9   ? 80.615 105.045 -15.725 1.00 121.19 ? -65 DC  J "C2'" 1 
ATOM   3183  C  "C1'" . DC  B  2 9   ? 81.488 106.276 -15.904 1.00 119.86 ? -65 DC  J "C1'" 1 
ATOM   3184  N  N1    . DC  B  2 9   ? 82.472 106.471 -14.802 1.00 115.53 ? -65 DC  J N1    1 
ATOM   3185  C  C2    . DC  B  2 9   ? 83.801 106.759 -15.112 1.00 116.68 ? -65 DC  J C2    1 
ATOM   3186  O  O2    . DC  B  2 9   ? 84.126 106.846 -16.299 1.00 120.69 ? -65 DC  J O2    1 
ATOM   3187  N  N3    . DC  B  2 9   ? 84.689 106.936 -14.101 1.00 113.44 ? -65 DC  J N3    1 
ATOM   3188  C  C4    . DC  B  2 9   ? 84.286 106.834 -12.833 1.00 109.27 ? -65 DC  J C4    1 
ATOM   3189  N  N4    . DC  B  2 9   ? 85.196 107.016 -11.868 1.00 107.97 ? -65 DC  J N4    1 
ATOM   3190  C  C5    . DC  B  2 9   ? 82.931 106.540 -12.498 1.00 108.39 ? -65 DC  J C5    1 
ATOM   3191  C  C6    . DC  B  2 9   ? 82.067 106.367 -13.504 1.00 110.41 ? -65 DC  J C6    1 
ATOM   3192  P  P     . DC  B  2 10  ? 79.022 103.623 -18.341 1.00 120.78 ? -64 DC  J P     1 
ATOM   3193  O  OP1   . DC  B  2 10  ? 77.897 103.745 -19.295 1.00 123.06 ? -64 DC  J OP1   1 
ATOM   3194  O  OP2   . DC  B  2 10  ? 78.885 102.766 -17.141 1.00 117.16 ? -64 DC  J OP2   1 
ATOM   3195  O  "O5'" . DC  B  2 10  ? 80.312 103.141 -19.143 1.00 120.16 ? -64 DC  J "O5'" 1 
ATOM   3196  C  "C5'" . DC  B  2 10  ? 80.900 104.001 -20.104 1.00 121.62 ? -64 DC  J "C5'" 1 
ATOM   3197  C  "C4'" . DC  B  2 10  ? 82.309 103.552 -20.421 1.00 125.66 ? -64 DC  J "C4'" 1 
ATOM   3198  O  "O4'" . DC  B  2 10  ? 83.207 103.996 -19.371 1.00 125.84 ? -64 DC  J "O4'" 1 
ATOM   3199  C  "C3'" . DC  B  2 10  ? 82.483 102.037 -20.528 1.00 126.42 ? -64 DC  J "C3'" 1 
ATOM   3200  O  "O3'" . DC  B  2 10  ? 83.269 101.724 -21.664 1.00 129.61 ? -64 DC  J "O3'" 1 
ATOM   3201  C  "C2'" . DC  B  2 10  ? 83.186 101.662 -19.222 1.00 125.58 ? -64 DC  J "C2'" 1 
ATOM   3202  C  "C1'" . DC  B  2 10  ? 83.993 102.915 -18.929 1.00 125.72 ? -64 DC  J "C1'" 1 
ATOM   3203  N  N1    . DC  B  2 10  ? 84.288 103.109 -17.483 1.00 122.10 ? -64 DC  J N1    1 
ATOM   3204  C  C2    . DC  B  2 10  ? 85.568 103.503 -17.093 1.00 122.10 ? -64 DC  J C2    1 
ATOM   3205  O  O2    . DC  B  2 10  ? 86.422 103.684 -17.967 1.00 121.79 ? -64 DC  J O2    1 
ATOM   3206  N  N3    . DC  B  2 10  ? 85.830 103.679 -15.774 1.00 122.42 ? -64 DC  J N3    1 
ATOM   3207  C  C4    . DC  B  2 10  ? 84.869 103.472 -14.870 1.00 119.73 ? -64 DC  J C4    1 
ATOM   3208  N  N4    . DC  B  2 10  ? 85.171 103.656 -13.579 1.00 117.71 ? -64 DC  J N4    1 
ATOM   3209  C  C5    . DC  B  2 10  ? 83.555 103.067 -15.250 1.00 117.30 ? -64 DC  J C5    1 
ATOM   3210  C  C6    . DC  B  2 10  ? 83.311 102.899 -16.554 1.00 118.52 ? -64 DC  J C6    1 
ATOM   3211  P  P     . DA  B  2 11  ? 83.540 100.194 -22.072 1.00 133.48 ? -63 DA  J P     1 
ATOM   3212  O  OP1   . DA  B  2 11  ? 83.426 100.099 -23.544 1.00 133.31 ? -63 DA  J OP1   1 
ATOM   3213  O  OP2   . DA  B  2 11  ? 82.707 99.317  -21.217 1.00 122.89 ? -63 DA  J OP2   1 
ATOM   3214  O  "O5'" . DA  B  2 11  ? 85.067 99.975  -21.670 1.00 130.17 ? -63 DA  J "O5'" 1 
ATOM   3215  C  "C5'" . DA  B  2 11  ? 86.048 100.899 -22.112 1.00 129.41 ? -63 DA  J "C5'" 1 
ATOM   3216  C  "C4'" . DA  B  2 11  ? 87.440 100.323 -21.948 1.00 131.31 ? -63 DA  J "C4'" 1 
ATOM   3217  O  "O4'" . DA  B  2 11  ? 87.968 100.689 -20.650 1.00 131.01 ? -63 DA  J "O4'" 1 
ATOM   3218  C  "C3'" . DA  B  2 11  ? 87.518 98.805  -22.028 1.00 129.43 ? -63 DA  J "C3'" 1 
ATOM   3219  O  "O3'" . DA  B  2 11  ? 88.725 98.412  -22.668 1.00 133.22 ? -63 DA  J "O3'" 1 
ATOM   3220  C  "C2'" . DA  B  2 11  ? 87.474 98.368  -20.564 1.00 124.28 ? -63 DA  J "C2'" 1 
ATOM   3221  C  "C1'" . DA  B  2 11  ? 88.109 99.546  -19.829 1.00 124.54 ? -63 DA  J "C1'" 1 
ATOM   3222  N  N9    . DA  B  2 11  ? 87.472 99.826  -18.547 1.00 116.05 ? -63 DA  J N9    1 
ATOM   3223  C  C8    . DA  B  2 11  ? 86.133 99.797  -18.272 1.00 112.49 ? -63 DA  J C8    1 
ATOM   3224  N  N7    . DA  B  2 11  ? 85.841 100.090 -17.028 1.00 110.30 ? -63 DA  J N7    1 
ATOM   3225  C  C5    . DA  B  2 11  ? 87.074 100.331 -16.446 1.00 112.52 ? -63 DA  J C5    1 
ATOM   3226  C  C6    . DA  B  2 11  ? 87.450 100.691 -15.138 1.00 113.97 ? -63 DA  J C6    1 
ATOM   3227  N  N6    . DA  B  2 11  ? 86.574 100.877 -14.147 1.00 111.21 ? -63 DA  J N6    1 
ATOM   3228  N  N1    . DA  B  2 11  ? 88.767 100.853 -14.888 1.00 118.89 ? -63 DA  J N1    1 
ATOM   3229  C  C2    . DA  B  2 11  ? 89.641 100.665 -15.885 1.00 121.73 ? -63 DA  J C2    1 
ATOM   3230  N  N3    . DA  B  2 11  ? 89.407 100.327 -17.152 1.00 120.23 ? -63 DA  J N3    1 
ATOM   3231  C  C4    . DA  B  2 11  ? 88.091 100.173 -17.369 1.00 115.81 ? -63 DA  J C4    1 
ATOM   3232  P  P     . DC  B  2 12  ? 89.151 96.863  -22.722 1.00 127.85 ? -62 DC  J P     1 
ATOM   3233  O  OP1   . DC  B  2 12  ? 90.034 96.681  -23.895 1.00 133.66 ? -62 DC  J OP1   1 
ATOM   3234  O  OP2   . DC  B  2 12  ? 87.931 96.035  -22.587 1.00 119.90 ? -62 DC  J OP2   1 
ATOM   3235  O  "O5'" . DC  B  2 12  ? 90.029 96.676  -21.402 1.00 128.18 ? -62 DC  J "O5'" 1 
ATOM   3236  C  "C5'" . DC  B  2 12  ? 90.985 97.668  -21.051 1.00 130.23 ? -62 DC  J "C5'" 1 
ATOM   3237  C  "C4'" . DC  B  2 12  ? 91.644 97.334  -19.731 1.00 127.20 ? -62 DC  J "C4'" 1 
ATOM   3238  O  "O4'" . DC  B  2 12  ? 90.796 97.764  -18.638 1.00 125.07 ? -62 DC  J "O4'" 1 
ATOM   3239  C  "C3'" . DC  B  2 12  ? 91.909 95.841  -19.507 1.00 126.64 ? -62 DC  J "C3'" 1 
ATOM   3240  O  "O3'" . DC  B  2 12  ? 93.274 95.640  -19.191 1.00 129.64 ? -62 DC  J "O3'" 1 
ATOM   3241  C  "C2'" . DC  B  2 12  ? 90.996 95.474  -18.333 1.00 126.60 ? -62 DC  J "C2'" 1 
ATOM   3242  C  "C1'" . DC  B  2 12  ? 90.865 96.804  -17.618 1.00 126.32 ? -62 DC  J "C1'" 1 
ATOM   3243  N  N1    . DC  B  2 12  ? 89.645 96.909  -16.768 1.00 121.78 ? -62 DC  J N1    1 
ATOM   3244  C  C2    . DC  B  2 12  ? 89.778 97.261  -15.422 1.00 119.39 ? -62 DC  J C2    1 
ATOM   3245  O  O2    . DC  B  2 12  ? 90.910 97.483  -14.975 1.00 122.85 ? -62 DC  J O2    1 
ATOM   3246  N  N3    . DC  B  2 12  ? 88.665 97.352  -14.653 1.00 113.16 ? -62 DC  J N3    1 
ATOM   3247  C  C4    . DC  B  2 12  ? 87.466 97.102  -15.185 1.00 112.91 ? -62 DC  J C4    1 
ATOM   3248  N  N4    . DC  B  2 12  ? 86.394 97.204  -14.392 1.00 105.87 ? -62 DC  J N4    1 
ATOM   3249  C  C5    . DC  B  2 12  ? 87.312 96.739  -16.556 1.00 114.23 ? -62 DC  J C5    1 
ATOM   3250  C  C6    . DC  B  2 12  ? 88.417 96.653  -17.304 1.00 116.90 ? -62 DC  J C6    1 
ATOM   3251  P  P     . DC  B  2 13  ? 93.867 94.153  -19.059 1.00 138.77 ? -61 DC  J P     1 
ATOM   3252  O  OP1   . DC  B  2 13  ? 95.210 94.150  -19.683 1.00 134.99 ? -61 DC  J OP1   1 
ATOM   3253  O  OP2   . DC  B  2 13  ? 92.832 93.204  -19.529 1.00 134.97 ? -61 DC  J OP2   1 
ATOM   3254  O  "O5'" . DC  B  2 13  ? 94.025 93.952  -17.482 1.00 133.33 ? -61 DC  J "O5'" 1 
ATOM   3255  C  "C5'" . DC  B  2 13  ? 94.608 94.980  -16.693 1.00 129.73 ? -61 DC  J "C5'" 1 
ATOM   3256  C  "C4'" . DC  B  2 13  ? 94.669 94.564  -15.237 1.00 133.12 ? -61 DC  J "C4'" 1 
ATOM   3257  O  "O4'" . DC  B  2 13  ? 93.425 94.913  -14.577 1.00 124.53 ? -61 DC  J "O4'" 1 
ATOM   3258  C  "C3'" . DC  B  2 13  ? 94.870 93.066  -15.010 1.00 136.46 ? -61 DC  J "C3'" 1 
ATOM   3259  O  "O3'" . DC  B  2 13  ? 95.826 92.854  -13.985 1.00 144.40 ? -61 DC  J "O3'" 1 
ATOM   3260  C  "C2'" . DC  B  2 13  ? 93.480 92.577  -14.600 1.00 130.06 ? -61 DC  J "C2'" 1 
ATOM   3261  C  "C1'" . DC  B  2 13  ? 92.928 93.794  -13.880 1.00 125.53 ? -61 DC  J "C1'" 1 
ATOM   3262  N  N1    . DC  B  2 13  ? 91.439 93.866  -13.877 1.00 125.43 ? -61 DC  J N1    1 
ATOM   3263  C  C2    . DC  B  2 13  ? 90.771 94.182  -12.692 1.00 124.08 ? -61 DC  J C2    1 
ATOM   3264  O  O2    . DC  B  2 13  ? 91.436 94.394  -11.673 1.00 123.66 ? -61 DC  J O2    1 
ATOM   3265  N  N3    . DC  B  2 13  ? 89.415 94.247  -12.698 1.00 120.93 ? -61 DC  J N3    1 
ATOM   3266  C  C4    . DC  B  2 13  ? 88.742 94.012  -13.827 1.00 117.07 ? -61 DC  J C4    1 
ATOM   3267  N  N4    . DC  B  2 13  ? 87.406 94.087  -13.789 1.00 111.05 ? -61 DC  J N4    1 
ATOM   3268  C  C5    . DC  B  2 13  ? 89.408 93.688  -15.046 1.00 124.98 ? -61 DC  J C5    1 
ATOM   3269  C  C6    . DC  B  2 13  ? 90.744 93.626  -15.026 1.00 128.53 ? -61 DC  J C6    1 
ATOM   3270  P  P     . DT  B  2 14  ? 96.542 91.423  -13.835 1.00 139.98 ? -60 DT  J P     1 
ATOM   3271  O  OP1   . DT  B  2 14  ? 97.995 91.661  -13.686 1.00 145.15 ? -60 DT  J OP1   1 
ATOM   3272  O  OP2   . DT  B  2 14  ? 96.049 90.557  -14.930 1.00 141.07 ? -60 DT  J OP2   1 
ATOM   3273  O  "O5'" . DT  B  2 14  ? 95.964 90.855  -12.457 1.00 138.77 ? -60 DT  J "O5'" 1 
ATOM   3274  C  "C5'" . DT  B  2 14  ? 96.159 91.590  -11.259 1.00 141.79 ? -60 DT  J "C5'" 1 
ATOM   3275  C  "C4'" . DT  B  2 14  ? 95.341 91.009  -10.119 1.00 146.12 ? -60 DT  J "C4'" 1 
ATOM   3276  O  "O4'" . DT  B  2 14  ? 93.934 91.323  -10.304 1.00 145.76 ? -60 DT  J "O4'" 1 
ATOM   3277  C  "C3'" . DT  B  2 14  ? 95.416 89.486  -9.965  1.00 153.16 ? -60 DT  J "C3'" 1 
ATOM   3278  O  "O3'" . DT  B  2 14  ? 95.512 89.162  -8.589  1.00 159.87 ? -60 DT  J "O3'" 1 
ATOM   3279  C  "C2'" . DT  B  2 14  ? 94.082 89.023  -10.547 1.00 150.27 ? -60 DT  J "C2'" 1 
ATOM   3280  C  "C1'" . DT  B  2 14  ? 93.180 90.153  -10.089 1.00 146.36 ? -60 DT  J "C1'" 1 
ATOM   3281  N  N1    . DT  B  2 14  ? 91.897 90.264  -10.840 1.00 145.80 ? -60 DT  J N1    1 
ATOM   3282  C  C2    . DT  B  2 14  ? 90.756 90.627  -10.161 1.00 142.26 ? -60 DT  J C2    1 
ATOM   3283  O  O2    . DT  B  2 14  ? 90.737 90.861  -8.966  1.00 138.74 ? -60 DT  J O2    1 
ATOM   3284  N  N3    . DT  B  2 14  ? 89.629 90.708  -10.934 1.00 143.33 ? -60 DT  J N3    1 
ATOM   3285  C  C4    . DT  B  2 14  ? 89.531 90.466  -12.293 1.00 146.08 ? -60 DT  J C4    1 
ATOM   3286  O  O4    . DT  B  2 14  ? 88.469 90.565  -12.900 1.00 145.84 ? -60 DT  J O4    1 
ATOM   3287  C  C5    . DT  B  2 14  ? 90.765 90.090  -12.945 1.00 148.77 ? -60 DT  J C5    1 
ATOM   3288  C  C7    . DT  B  2 14  ? 90.783 89.804  -14.418 1.00 149.49 ? -60 DT  J C7    1 
ATOM   3289  C  C6    . DT  B  2 14  ? 91.876 90.009  -12.196 1.00 149.67 ? -60 DT  J C6    1 
ATOM   3290  P  P     . DG  B  2 15  ? 96.296 87.846  -8.107  1.00 166.07 ? -59 DG  J P     1 
ATOM   3291  O  OP1   . DG  B  2 15  ? 97.745 88.145  -8.138  1.00 168.23 ? -59 DG  J OP1   1 
ATOM   3292  O  OP2   . DG  B  2 15  ? 95.763 86.695  -8.869  1.00 169.60 ? -59 DG  J OP2   1 
ATOM   3293  O  "O5'" . DG  B  2 15  ? 95.834 87.683  -6.585  1.00 160.23 ? -59 DG  J "O5'" 1 
ATOM   3294  C  "C5'" . DG  B  2 15  ? 95.752 88.829  -5.748  1.00 156.16 ? -59 DG  J "C5'" 1 
ATOM   3295  C  "C4'" . DG  B  2 15  ? 94.475 88.815  -4.923  1.00 149.34 ? -59 DG  J "C4'" 1 
ATOM   3296  O  "O4'" . DG  B  2 15  ? 93.325 88.999  -5.789  1.00 147.89 ? -59 DG  J "O4'" 1 
ATOM   3297  C  "C3'" . DG  B  2 15  ? 94.220 87.534  -4.141  1.00 146.27 ? -59 DG  J "C3'" 1 
ATOM   3298  O  "O3'" . DG  B  2 15  ? 93.666 87.855  -2.875  1.00 140.47 ? -59 DG  J "O3'" 1 
ATOM   3299  C  "C2'" . DG  B  2 15  ? 93.229 86.771  -5.022  1.00 148.08 ? -59 DG  J "C2'" 1 
ATOM   3300  C  "C1'" . DG  B  2 15  ? 92.443 87.898  -5.683  1.00 147.03 ? -59 DG  J "C1'" 1 
ATOM   3301  N  N9    . DG  B  2 15  ? 91.976 87.575  -7.031  1.00 147.44 ? -59 DG  J N9    1 
ATOM   3302  C  C8    . DG  B  2 15  ? 92.721 87.039  -8.052  1.00 149.91 ? -59 DG  J C8    1 
ATOM   3303  N  N7    . DG  B  2 15  ? 92.048 86.869  -9.155  1.00 149.92 ? -59 DG  J N7    1 
ATOM   3304  C  C5    . DG  B  2 15  ? 90.774 87.330  -8.851  1.00 146.95 ? -59 DG  J C5    1 
ATOM   3305  C  C6    . DG  B  2 15  ? 89.614 87.396  -9.660  1.00 146.86 ? -59 DG  J C6    1 
ATOM   3306  O  O6    . DG  B  2 15  ? 89.482 87.047  -10.841 1.00 147.58 ? -59 DG  J O6    1 
ATOM   3307  N  N1    . DG  B  2 15  ? 88.531 87.927  -8.965  1.00 146.21 ? -59 DG  J N1    1 
ATOM   3308  C  C2    . DG  B  2 15  ? 88.565 88.346  -7.654  1.00 145.25 ? -59 DG  J C2    1 
ATOM   3309  N  N2    . DG  B  2 15  ? 87.420 88.830  -7.152  1.00 143.44 ? -59 DG  J N2    1 
ATOM   3310  N  N3    . DG  B  2 15  ? 89.647 88.289  -6.885  1.00 144.44 ? -59 DG  J N3    1 
ATOM   3311  C  C4    . DG  B  2 15  ? 90.711 87.772  -7.548  1.00 145.44 ? -59 DG  J C4    1 
ATOM   3312  P  P     . DG  B  2 16  ? 93.644 86.762  -1.699  1.00 144.42 ? -58 DG  J P     1 
ATOM   3313  O  OP1   . DG  B  2 16  ? 93.964 87.459  -0.433  1.00 141.83 ? -58 DG  J OP1   1 
ATOM   3314  O  OP2   . DG  B  2 16  ? 94.466 85.612  -2.134  1.00 147.00 ? -58 DG  J OP2   1 
ATOM   3315  O  "O5'" . DG  B  2 16  ? 92.116 86.296  -1.656  1.00 141.72 ? -58 DG  J "O5'" 1 
ATOM   3316  C  "C5'" . DG  B  2 16  ? 91.081 87.275  -1.659  1.00 140.08 ? -58 DG  J "C5'" 1 
ATOM   3317  C  "C4'" . DG  B  2 16  ? 89.719 86.632  -1.843  1.00 137.68 ? -58 DG  J "C4'" 1 
ATOM   3318  O  "O4'" . DG  B  2 16  ? 89.405 86.527  -3.261  1.00 139.07 ? -58 DG  J "O4'" 1 
ATOM   3319  C  "C3'" . DG  B  2 16  ? 89.588 85.214  -1.286  1.00 139.02 ? -58 DG  J "C3'" 1 
ATOM   3320  O  "O3'" . DG  B  2 16  ? 88.283 85.040  -0.759  1.00 138.17 ? -58 DG  J "O3'" 1 
ATOM   3321  C  "C2'" . DG  B  2 16  ? 89.788 84.365  -2.536  1.00 141.03 ? -58 DG  J "C2'" 1 
ATOM   3322  C  "C1'" . DG  B  2 16  ? 89.018 85.201  -3.538  1.00 140.76 ? -58 DG  J "C1'" 1 
ATOM   3323  N  N9    . DG  B  2 16  ? 89.317 84.898  -4.934  1.00 145.02 ? -58 DG  J N9    1 
ATOM   3324  C  C8    . DG  B  2 16  ? 90.518 84.484  -5.457  1.00 149.11 ? -58 DG  J C8    1 
ATOM   3325  N  N7    . DG  B  2 16  ? 90.481 84.291  -6.747  1.00 150.78 ? -58 DG  J N7    1 
ATOM   3326  C  C5    . DG  B  2 16  ? 89.173 84.599  -7.101  1.00 148.66 ? -58 DG  J C5    1 
ATOM   3327  C  C6    . DG  B  2 16  ? 88.541 84.577  -8.366  1.00 152.58 ? -58 DG  J C6    1 
ATOM   3328  O  O6    . DG  B  2 16  ? 89.030 84.271  -9.462  1.00 158.21 ? -58 DG  J O6    1 
ATOM   3329  N  N1    . DG  B  2 16  ? 87.206 84.965  -8.283  1.00 148.60 ? -58 DG  J N1    1 
ATOM   3330  C  C2    . DG  B  2 16  ? 86.562 85.324  -7.122  1.00 145.68 ? -58 DG  J C2    1 
ATOM   3331  N  N2    . DG  B  2 16  ? 85.269 85.665  -7.233  1.00 144.95 ? -58 DG  J N2    1 
ATOM   3332  N  N3    . DG  B  2 16  ? 87.144 85.346  -5.930  1.00 143.99 ? -58 DG  J N3    1 
ATOM   3333  C  C4    . DG  B  2 16  ? 88.445 84.974  -5.996  1.00 145.21 ? -58 DG  J C4    1 
ATOM   3334  P  P     . DT  B  2 17  ? 88.050 84.802  0.813   1.00 140.44 ? -57 DT  J P     1 
ATOM   3335  O  OP1   . DT  B  2 17  ? 88.772 85.867  1.541   1.00 141.01 ? -57 DT  J OP1   1 
ATOM   3336  O  OP2   . DT  B  2 17  ? 88.350 83.383  1.107   1.00 139.12 ? -57 DT  J OP2   1 
ATOM   3337  O  "O5'" . DT  B  2 17  ? 86.473 85.013  0.993   1.00 136.84 ? -57 DT  J "O5'" 1 
ATOM   3338  C  "C5'" . DT  B  2 17  ? 85.870 86.252  0.620   1.00 136.29 ? -57 DT  J "C5'" 1 
ATOM   3339  C  "C4'" . DT  B  2 17  ? 84.756 86.042  -0.398  1.00 135.12 ? -57 DT  J "C4'" 1 
ATOM   3340  O  "O4'" . DT  B  2 17  ? 85.313 85.533  -1.640  1.00 134.94 ? -57 DT  J "O4'" 1 
ATOM   3341  C  "C3'" . DT  B  2 17  ? 83.671 85.046  0.010   1.00 133.93 ? -57 DT  J "C3'" 1 
ATOM   3342  O  "O3'" . DT  B  2 17  ? 82.406 85.482  -0.483  1.00 129.26 ? -57 DT  J "O3'" 1 
ATOM   3343  C  "C2'" . DT  B  2 17  ? 84.121 83.765  -0.681  1.00 135.87 ? -57 DT  J "C2'" 1 
ATOM   3344  C  "C1'" . DT  B  2 17  ? 84.679 84.317  -1.982  1.00 134.82 ? -57 DT  J "C1'" 1 
ATOM   3345  N  N1    . DT  B  2 17  ? 85.684 83.426  -2.616  1.00 139.12 ? -57 DT  J N1    1 
ATOM   3346  C  C2    . DT  B  2 17  ? 85.678 83.261  -3.983  1.00 136.98 ? -57 DT  J C2    1 
ATOM   3347  O  O2    . DT  B  2 17  ? 84.881 83.813  -4.720  1.00 134.48 ? -57 DT  J O2    1 
ATOM   3348  N  N3    . DT  B  2 17  ? 86.650 82.419  -4.459  1.00 138.34 ? -57 DT  J N3    1 
ATOM   3349  C  C4    . DT  B  2 17  ? 87.605 81.744  -3.718  1.00 140.22 ? -57 DT  J C4    1 
ATOM   3350  O  O4    . DT  B  2 17  ? 88.437 81.005  -4.233  1.00 139.68 ? -57 DT  J O4    1 
ATOM   3351  C  C5    . DT  B  2 17  ? 87.547 81.958  -2.293  1.00 144.67 ? -57 DT  J C5    1 
ATOM   3352  C  C7    . DT  B  2 17  ? 88.531 81.276  -1.387  1.00 147.20 ? -57 DT  J C7    1 
ATOM   3353  C  C6    . DT  B  2 17  ? 86.603 82.780  -1.818  1.00 144.57 ? -57 DT  J C6    1 
ATOM   3354  P  P     . DC  B  2 18  ? 81.107 84.546  -0.331  1.00 120.44 ? -56 DC  J P     1 
ATOM   3355  O  OP1   . DC  B  2 18  ? 79.922 85.428  -0.396  1.00 119.99 ? -56 DC  J OP1   1 
ATOM   3356  O  OP2   . DC  B  2 18  ? 81.307 83.671  0.845   1.00 125.32 ? -56 DC  J OP2   1 
ATOM   3357  O  "O5'" . DC  B  2 18  ? 81.126 83.627  -1.642  1.00 113.11 ? -56 DC  J "O5'" 1 
ATOM   3358  C  "C5'" . DC  B  2 18  ? 80.743 84.175  -2.897  1.00 112.05 ? -56 DC  J "C5'" 1 
ATOM   3359  C  "C4'" . DC  B  2 18  ? 80.623 83.092  -3.956  1.00 117.40 ? -56 DC  J "C4'" 1 
ATOM   3360  O  "O4'" . DC  B  2 18  ? 81.936 82.539  -4.252  1.00 127.30 ? -56 DC  J "O4'" 1 
ATOM   3361  C  "C3'" . DC  B  2 18  ? 79.741 81.893  -3.578  1.00 114.04 ? -56 DC  J "C3'" 1 
ATOM   3362  O  "O3'" . DC  B  2 18  ? 78.970 81.503  -4.706  1.00 111.34 ? -56 DC  J "O3'" 1 
ATOM   3363  C  "C2'" . DC  B  2 18  ? 80.772 80.824  -3.236  1.00 121.70 ? -56 DC  J "C2'" 1 
ATOM   3364  C  "C1'" . DC  B  2 18  ? 81.819 81.139  -4.284  1.00 131.20 ? -56 DC  J "C1'" 1 
ATOM   3365  N  N1    . DC  B  2 18  ? 83.151 80.518  -4.038  1.00 143.32 ? -56 DC  J N1    1 
ATOM   3366  C  C2    . DC  B  2 18  ? 83.847 79.954  -5.111  1.00 150.71 ? -56 DC  J C2    1 
ATOM   3367  O  O2    . DC  B  2 18  ? 83.343 79.993  -6.236  1.00 152.23 ? -56 DC  J O2    1 
ATOM   3368  N  N3    . DC  B  2 18  ? 85.053 79.384  -4.889  1.00 155.11 ? -56 DC  J N3    1 
ATOM   3369  C  C4    . DC  B  2 18  ? 85.560 79.360  -3.657  1.00 153.59 ? -56 DC  J C4    1 
ATOM   3370  N  N4    . DC  B  2 18  ? 86.757 78.788  -3.485  1.00 155.63 ? -56 DC  J N4    1 
ATOM   3371  C  C5    . DC  B  2 18  ? 84.866 79.928  -2.545  1.00 148.80 ? -56 DC  J C5    1 
ATOM   3372  C  C6    . DC  B  2 18  ? 83.674 80.489  -2.779  1.00 145.11 ? -56 DC  J C6    1 
ATOM   3373  P  P     . DC  B  2 19  ? 77.385 81.275  -4.583  1.00 115.45 ? -55 DC  J P     1 
ATOM   3374  O  OP1   . DC  B  2 19  ? 76.739 82.532  -5.019  1.00 112.70 ? -55 DC  J OP1   1 
ATOM   3375  O  OP2   . DC  B  2 19  ? 77.091 80.728  -3.240  1.00 115.18 ? -55 DC  J OP2   1 
ATOM   3376  O  "O5'" . DC  B  2 19  ? 77.084 80.134  -5.668  1.00 116.33 ? -55 DC  J "O5'" 1 
ATOM   3377  C  "C5'" . DC  B  2 19  ? 77.077 80.460  -7.052  1.00 116.77 ? -55 DC  J "C5'" 1 
ATOM   3378  C  "C4'" . DC  B  2 19  ? 77.942 79.500  -7.858  1.00 119.58 ? -55 DC  J "C4'" 1 
ATOM   3379  O  "O4'" . DC  B  2 19  ? 79.241 79.381  -7.259  1.00 123.09 ? -55 DC  J "O4'" 1 
ATOM   3380  C  "C3'" . DC  B  2 19  ? 77.426 78.072  -7.954  1.00 117.66 ? -55 DC  J "C3'" 1 
ATOM   3381  O  "O3'" . DC  B  2 19  ? 76.618 77.931  -9.122  1.00 115.98 ? -55 DC  J "O3'" 1 
ATOM   3382  C  "C2'" . DC  B  2 19  ? 78.708 77.223  -8.054  1.00 123.26 ? -55 DC  J "C2'" 1 
ATOM   3383  C  "C1'" . DC  B  2 19  ? 79.844 78.211  -7.756  1.00 125.40 ? -55 DC  J "C1'" 1 
ATOM   3384  N  N1    . DC  B  2 19  ? 80.832 77.717  -6.743  1.00 125.54 ? -55 DC  J N1    1 
ATOM   3385  C  C2    . DC  B  2 19  ? 81.949 76.969  -7.155  1.00 126.11 ? -55 DC  J C2    1 
ATOM   3386  O  O2    . DC  B  2 19  ? 82.102 76.718  -8.357  1.00 125.19 ? -55 DC  J O2    1 
ATOM   3387  N  N3    . DC  B  2 19  ? 82.832 76.539  -6.214  1.00 127.67 ? -55 DC  J N3    1 
ATOM   3388  C  C4    . DC  B  2 19  ? 82.630 76.832  -4.927  1.00 126.18 ? -55 DC  J C4    1 
ATOM   3389  N  N4    . DC  B  2 19  ? 83.521 76.392  -4.032  1.00 127.57 ? -55 DC  J N4    1 
ATOM   3390  C  C5    . DC  B  2 19  ? 81.504 77.591  -4.495  1.00 122.93 ? -55 DC  J C5    1 
ATOM   3391  C  C6    . DC  B  2 19  ? 80.642 78.010  -5.426  1.00 122.15 ? -55 DC  J C6    1 
ATOM   3392  P  P     . DT  B  2 20  ? 75.715 76.617  -9.337  1.00 121.90 ? -54 DT  J P     1 
ATOM   3393  O  OP1   . DT  B  2 20  ? 74.645 76.972  -10.295 1.00 125.05 ? -54 DT  J OP1   1 
ATOM   3394  O  OP2   . DT  B  2 20  ? 75.359 76.089  -8.002  1.00 113.96 ? -54 DT  J OP2   1 
ATOM   3395  O  "O5'" . DT  B  2 20  ? 76.706 75.572  -10.039 1.00 129.01 ? -54 DT  J "O5'" 1 
ATOM   3396  C  "C5'" . DT  B  2 20  ? 77.036 75.722  -11.417 1.00 132.47 ? -54 DT  J "C5'" 1 
ATOM   3397  C  "C4'" . DT  B  2 20  ? 78.193 74.817  -11.813 1.00 136.66 ? -54 DT  J "C4'" 1 
ATOM   3398  O  "O4'" . DT  B  2 20  ? 79.230 74.863  -10.793 1.00 134.31 ? -54 DT  J "O4'" 1 
ATOM   3399  C  "C3'" . DT  B  2 20  ? 77.841 73.333  -11.989 1.00 143.42 ? -54 DT  J "C3'" 1 
ATOM   3400  O  "O3'" . DT  B  2 20  ? 78.497 72.822  -13.150 1.00 159.04 ? -54 DT  J "O3'" 1 
ATOM   3401  C  "C2'" . DT  B  2 20  ? 78.403 72.702  -10.718 1.00 138.09 ? -54 DT  J "C2'" 1 
ATOM   3402  C  "C1'" . DT  B  2 20  ? 79.648 73.547  -10.524 1.00 134.77 ? -54 DT  J "C1'" 1 
ATOM   3403  N  N1    . DT  B  2 20  ? 80.224 73.483  -9.149  1.00 127.62 ? -54 DT  J N1    1 
ATOM   3404  C  C2    . DT  B  2 20  ? 81.468 72.925  -8.971  1.00 126.26 ? -54 DT  J C2    1 
ATOM   3405  O  O2    . DT  B  2 20  ? 82.132 72.470  -9.885  1.00 121.79 ? -54 DT  J O2    1 
ATOM   3406  N  N3    . DT  B  2 20  ? 81.909 72.910  -7.675  1.00 128.92 ? -54 DT  J N3    1 
ATOM   3407  C  C4    . DT  B  2 20  ? 81.248 73.392  -6.562  1.00 126.67 ? -54 DT  J C4    1 
ATOM   3408  O  O4    . DT  B  2 20  ? 81.730 73.335  -5.436  1.00 128.24 ? -54 DT  J O4    1 
ATOM   3409  C  C5    . DT  B  2 20  ? 79.949 73.966  -6.817  1.00 123.93 ? -54 DT  J C5    1 
ATOM   3410  C  C7    . DT  B  2 20  ? 79.135 74.521  -5.685  1.00 120.72 ? -54 DT  J C7    1 
ATOM   3411  C  C6    . DT  B  2 20  ? 79.504 73.981  -8.084  1.00 124.11 ? -54 DT  J C6    1 
ATOM   3412  P  P     . DA  B  2 21  ? 77.831 71.648  -14.026 1.00 129.95 ? -53 DA  J P     1 
ATOM   3413  O  OP1   . DA  B  2 21  ? 77.862 72.082  -15.441 1.00 127.56 ? -53 DA  J OP1   1 
ATOM   3414  O  OP2   . DA  B  2 21  ? 76.543 71.283  -13.394 1.00 127.91 ? -53 DA  J OP2   1 
ATOM   3415  O  "O5'" . DA  B  2 21  ? 78.847 70.420  -13.865 1.00 141.42 ? -53 DA  J "O5'" 1 
ATOM   3416  C  "C5'" . DA  B  2 21  ? 79.992 70.556  -13.033 1.00 148.20 ? -53 DA  J "C5'" 1 
ATOM   3417  C  "C4'" . DA  B  2 21  ? 81.049 69.517  -13.364 1.00 156.47 ? -53 DA  J "C4'" 1 
ATOM   3418  O  "O4'" . DA  B  2 21  ? 82.020 69.485  -12.297 1.00 158.14 ? -53 DA  J "O4'" 1 
ATOM   3419  C  "C3'" . DA  B  2 21  ? 80.545 68.089  -13.459 1.00 160.70 ? -53 DA  J "C3'" 1 
ATOM   3420  O  "O3'" . DA  B  2 21  ? 81.449 67.304  -14.228 1.00 165.09 ? -53 DA  J "O3'" 1 
ATOM   3421  C  "C2'" . DA  B  2 21  ? 80.532 67.651  -11.997 1.00 161.18 ? -53 DA  J "C2'" 1 
ATOM   3422  C  "C1'" . DA  B  2 21  ? 81.692 68.450  -11.387 1.00 159.94 ? -53 DA  J "C1'" 1 
ATOM   3423  N  N9    . DA  B  2 21  ? 81.353 69.050  -10.099 1.00 157.38 ? -53 DA  J N9    1 
ATOM   3424  C  C8    . DA  B  2 21  ? 80.264 69.824  -9.814  1.00 154.27 ? -53 DA  J C8    1 
ATOM   3425  N  N7    . DA  B  2 21  ? 80.205 70.219  -8.566  1.00 153.40 ? -53 DA  J N7    1 
ATOM   3426  C  C5    . DA  B  2 21  ? 81.335 69.667  -7.989  1.00 156.02 ? -53 DA  J C5    1 
ATOM   3427  C  C6    . DA  B  2 21  ? 81.851 69.716  -6.680  1.00 158.66 ? -53 DA  J C6    1 
ATOM   3428  N  N6    . DA  B  2 21  ? 81.261 70.381  -5.682  1.00 155.07 ? -53 DA  J N6    1 
ATOM   3429  N  N1    . DA  B  2 21  ? 82.999 69.052  -6.436  1.00 164.37 ? -53 DA  J N1    1 
ATOM   3430  C  C2    . DA  B  2 21  ? 83.586 68.387  -7.439  1.00 166.88 ? -53 DA  J C2    1 
ATOM   3431  N  N3    . DA  B  2 21  ? 83.196 68.269  -8.708  1.00 164.76 ? -53 DA  J N3    1 
ATOM   3432  C  C4    . DA  B  2 21  ? 82.055 68.941  -8.920  1.00 158.86 ? -53 DA  J C4    1 
ATOM   3433  P  P     . DC  B  2 22  ? 81.166 65.739  -14.468 1.00 162.89 ? -52 DC  J P     1 
ATOM   3434  O  OP1   . DC  B  2 22  ? 81.876 65.337  -15.703 1.00 167.16 ? -52 DC  J OP1   1 
ATOM   3435  O  OP2   . DC  B  2 22  ? 79.707 65.519  -14.349 1.00 158.92 ? -52 DC  J OP2   1 
ATOM   3436  O  "O5'" . DC  B  2 22  ? 81.867 65.024  -13.220 1.00 167.79 ? -52 DC  J "O5'" 1 
ATOM   3437  C  "C5'" . DC  B  2 22  ? 83.271 65.151  -13.021 1.00 170.46 ? -52 DC  J "C5'" 1 
ATOM   3438  C  "C4'" . DC  B  2 22  ? 83.728 64.296  -11.853 1.00 170.07 ? -52 DC  J "C4'" 1 
ATOM   3439  O  "O4'" . DC  B  2 22  ? 83.536 65.025  -10.612 1.00 167.37 ? -52 DC  J "O4'" 1 
ATOM   3440  C  "C3'" . DC  B  2 22  ? 82.976 62.969  -11.695 1.00 169.05 ? -52 DC  J "C3'" 1 
ATOM   3441  O  "O3'" . DC  B  2 22  ? 83.892 61.902  -11.480 1.00 167.57 ? -52 DC  J "O3'" 1 
ATOM   3442  C  "C2'" . DC  B  2 22  ? 82.092 63.202  -10.472 1.00 168.86 ? -52 DC  J "C2'" 1 
ATOM   3443  C  "C1'" . DC  B  2 22  ? 82.930 64.177  -9.666  1.00 169.38 ? -52 DC  J "C1'" 1 
ATOM   3444  N  N1    . DC  B  2 22  ? 82.122 65.000  -8.730  1.00 170.19 ? -52 DC  J N1    1 
ATOM   3445  C  C2    . DC  B  2 22  ? 82.521 65.127  -7.394  1.00 174.10 ? -52 DC  J C2    1 
ATOM   3446  O  O2    . DC  B  2 22  ? 83.554 64.560  -7.016  1.00 178.81 ? -52 DC  J O2    1 
ATOM   3447  N  N3    . DC  B  2 22  ? 81.765 65.875  -6.551  1.00 170.98 ? -52 DC  J N3    1 
ATOM   3448  C  C4    . DC  B  2 22  ? 80.658 66.471  -7.000  1.00 165.87 ? -52 DC  J C4    1 
ATOM   3449  N  N4    . DC  B  2 22  ? 79.944 67.197  -6.134  1.00 162.05 ? -52 DC  J N4    1 
ATOM   3450  C  C5    . DC  B  2 22  ? 80.232 66.344  -8.356  1.00 164.70 ? -52 DC  J C5    1 
ATOM   3451  C  C6    . DC  B  2 22  ? 80.985 65.605  -9.176  1.00 167.42 ? -52 DC  J C6    1 
ATOM   3452  P  P     . DT  B  2 23  ? 83.355 60.395  -11.306 1.00 178.01 ? -51 DT  J P     1 
ATOM   3453  O  OP1   . DT  B  2 23  ? 84.302 59.508  -12.016 1.00 181.63 ? -51 DT  J OP1   1 
ATOM   3454  O  OP2   . DT  B  2 23  ? 81.919 60.360  -11.662 1.00 171.65 ? -51 DT  J OP2   1 
ATOM   3455  O  "O5'" . DT  B  2 23  ? 83.483 60.121  -9.735  1.00 177.88 ? -51 DT  J "O5'" 1 
ATOM   3456  C  "C5'" . DT  B  2 23  ? 84.764 60.135  -9.116  1.00 178.62 ? -51 DT  J "C5'" 1 
ATOM   3457  C  "C4'" . DT  B  2 23  ? 84.685 59.628  -7.687  1.00 178.86 ? -51 DT  J "C4'" 1 
ATOM   3458  O  "O4'" . DT  B  2 23  ? 84.050 60.628  -6.847  1.00 173.68 ? -51 DT  J "O4'" 1 
ATOM   3459  C  "C3'" . DT  B  2 23  ? 83.887 58.336  -7.500  1.00 181.49 ? -51 DT  J "C3'" 1 
ATOM   3460  O  "O3'" . DT  B  2 23  ? 84.591 57.447  -6.641  1.00 186.53 ? -51 DT  J "O3'" 1 
ATOM   3461  C  "C2'" . DT  B  2 23  ? 82.579 58.814  -6.869  1.00 176.17 ? -51 DT  J "C2'" 1 
ATOM   3462  C  "C1'" . DT  B  2 23  ? 83.039 60.026  -6.075  1.00 172.28 ? -51 DT  J "C1'" 1 
ATOM   3463  N  N1    . DT  B  2 23  ? 81.958 61.026  -5.854  1.00 167.51 ? -51 DT  J N1    1 
ATOM   3464  C  C2    . DT  B  2 23  ? 81.770 61.558  -4.598  1.00 168.49 ? -51 DT  J C2    1 
ATOM   3465  O  O2    . DT  B  2 23  ? 82.454 61.256  -3.635  1.00 172.11 ? -51 DT  J O2    1 
ATOM   3466  N  N3    . DT  B  2 23  ? 80.746 62.466  -4.509  1.00 163.80 ? -51 DT  J N3    1 
ATOM   3467  C  C4    . DT  B  2 23  ? 79.909 62.883  -5.529  1.00 158.55 ? -51 DT  J C4    1 
ATOM   3468  O  O4    . DT  B  2 23  ? 79.016 63.705  -5.353  1.00 155.42 ? -51 DT  J O4    1 
ATOM   3469  C  C5    . DT  B  2 23  ? 80.161 62.284  -6.819  1.00 157.74 ? -51 DT  J C5    1 
ATOM   3470  C  C7    . DT  B  2 23  ? 79.320 62.660  -8.002  1.00 152.26 ? -51 DT  J C7    1 
ATOM   3471  C  C6    . DT  B  2 23  ? 81.159 61.395  -6.916  1.00 163.24 ? -51 DT  J C6    1 
ATOM   3472  P  P     . DA  B  2 24  ? 83.939 56.041  -6.215  1.00 173.04 ? -50 DA  J P     1 
ATOM   3473  O  OP1   . DA  B  2 24  ? 85.046 55.115  -5.889  1.00 178.96 ? -50 DA  J OP1   1 
ATOM   3474  O  OP2   . DA  B  2 24  ? 82.947 55.661  -7.245  1.00 171.27 ? -50 DA  J OP2   1 
ATOM   3475  O  "O5'" . DA  B  2 24  ? 83.148 56.381  -4.868  1.00 171.93 ? -50 DA  J "O5'" 1 
ATOM   3476  C  "C5'" . DA  B  2 24  ? 83.831 57.005  -3.789  1.00 172.74 ? -50 DA  J "C5'" 1 
ATOM   3477  C  "C4'" . DA  B  2 24  ? 83.116 56.754  -2.474  1.00 173.21 ? -50 DA  J "C4'" 1 
ATOM   3478  O  "O4'" . DA  B  2 24  ? 82.225 57.859  -2.181  1.00 169.97 ? -50 DA  J "O4'" 1 
ATOM   3479  C  "C3'" . DA  B  2 24  ? 82.260 55.493  -2.429  1.00 175.51 ? -50 DA  J "C3'" 1 
ATOM   3480  O  "O3'" . DA  B  2 24  ? 82.363 54.900  -1.141  1.00 176.44 ? -50 DA  J "O3'" 1 
ATOM   3481  C  "C2'" . DA  B  2 24  ? 80.852 56.022  -2.708  1.00 172.78 ? -50 DA  J "C2'" 1 
ATOM   3482  C  "C1'" . DA  B  2 24  ? 80.895 57.397  -2.056  1.00 170.05 ? -50 DA  J "C1'" 1 
ATOM   3483  N  N9    . DA  B  2 24  ? 80.022 58.380  -2.693  1.00 167.79 ? -50 DA  J N9    1 
ATOM   3484  C  C8    . DA  B  2 24  ? 79.816 58.557  -4.033  1.00 167.38 ? -50 DA  J C8    1 
ATOM   3485  N  N7    . DA  B  2 24  ? 78.986 59.535  -4.317  1.00 163.17 ? -50 DA  J N7    1 
ATOM   3486  C  C5    . DA  B  2 24  ? 78.631 60.039  -3.076  1.00 162.13 ? -50 DA  J C5    1 
ATOM   3487  C  C6    . DA  B  2 24  ? 77.777 61.091  -2.685  1.00 159.14 ? -50 DA  J C6    1 
ATOM   3488  N  N6    . DA  B  2 24  ? 77.099 61.851  -3.552  1.00 155.98 ? -50 DA  J N6    1 
ATOM   3489  N  N1    . DA  B  2 24  ? 77.647 61.331  -1.363  1.00 159.47 ? -50 DA  J N1    1 
ATOM   3490  C  C2    . DA  B  2 24  ? 78.326 60.569  -0.499  1.00 162.53 ? -50 DA  J C2    1 
ATOM   3491  N  N3    . DA  B  2 24  ? 79.155 59.557  -0.746  1.00 166.05 ? -50 DA  J N3    1 
ATOM   3492  C  C4    . DA  B  2 24  ? 79.265 59.342  -2.065  1.00 165.19 ? -50 DA  J C4    1 
ATOM   3493  P  P     . DC  B  2 25  ? 81.512 53.591  -0.765  1.00 182.47 ? -49 DC  J P     1 
ATOM   3494  O  OP1   . DC  B  2 25  ? 82.332 52.788  0.171   1.00 185.71 ? -49 DC  J OP1   1 
ATOM   3495  O  OP2   . DC  B  2 25  ? 81.011 52.972  -2.013  1.00 183.84 ? -49 DC  J OP2   1 
ATOM   3496  O  "O5'" . DC  B  2 25  ? 80.268 54.180  0.042   1.00 174.23 ? -49 DC  J "O5'" 1 
ATOM   3497  C  "C5'" . DC  B  2 25  ? 80.496 55.061  1.133   1.00 168.35 ? -49 DC  J "C5'" 1 
ATOM   3498  C  "C4'" . DC  B  2 25  ? 79.217 55.301  1.909   1.00 161.85 ? -49 DC  J "C4'" 1 
ATOM   3499  O  "O4'" . DC  B  2 25  ? 78.467 56.381  1.294   1.00 157.05 ? -49 DC  J "O4'" 1 
ATOM   3500  C  "C3'" . DC  B  2 25  ? 78.269 54.106  1.977   1.00 159.42 ? -49 DC  J "C3'" 1 
ATOM   3501  O  "O3'" . DC  B  2 25  ? 77.709 54.020  3.276   1.00 153.18 ? -49 DC  J "O3'" 1 
ATOM   3502  C  "C2'" . DC  B  2 25  ? 77.212 54.440  0.923   1.00 158.15 ? -49 DC  J "C2'" 1 
ATOM   3503  C  "C1'" . DC  B  2 25  ? 77.151 55.955  1.025   1.00 155.42 ? -49 DC  J "C1'" 1 
ATOM   3504  N  N1    . DC  B  2 25  ? 76.693 56.624  -0.224  1.00 152.63 ? -49 DC  J N1    1 
ATOM   3505  C  C2    . DC  B  2 25  ? 75.864 57.746  -0.137  1.00 148.09 ? -49 DC  J C2    1 
ATOM   3506  O  O2    . DC  B  2 25  ? 75.527 58.151  0.982   1.00 145.85 ? -49 DC  J O2    1 
ATOM   3507  N  N3    . DC  B  2 25  ? 75.456 58.352  -1.280  1.00 146.06 ? -49 DC  J N3    1 
ATOM   3508  C  C4    . DC  B  2 25  ? 75.850 57.876  -2.464  1.00 146.96 ? -49 DC  J C4    1 
ATOM   3509  N  N4    . DC  B  2 25  ? 75.425 58.503  -3.567  1.00 142.59 ? -49 DC  J N4    1 
ATOM   3510  C  C5    . DC  B  2 25  ? 76.698 56.732  -2.570  1.00 151.75 ? -49 DC  J C5    1 
ATOM   3511  C  C6    . DC  B  2 25  ? 77.092 56.145  -1.436  1.00 153.99 ? -49 DC  J C6    1 
ATOM   3512  P  P     . DC  B  2 26  ? 76.931 52.697  3.748   1.00 175.14 ? -48 DC  J P     1 
ATOM   3513  O  OP1   . DC  B  2 26  ? 77.563 52.229  5.001   1.00 174.54 ? -48 DC  J OP1   1 
ATOM   3514  O  OP2   . DC  B  2 26  ? 76.825 51.778  2.592   1.00 176.00 ? -48 DC  J OP2   1 
ATOM   3515  O  "O5'" . DC  B  2 26  ? 75.466 53.234  4.079   1.00 166.77 ? -48 DC  J "O5'" 1 
ATOM   3516  C  "C5'" . DC  B  2 26  ? 75.290 54.574  4.528   1.00 156.57 ? -48 DC  J "C5'" 1 
ATOM   3517  C  "C4'" . DC  B  2 26  ? 73.828 54.971  4.467   1.00 149.44 ? -48 DC  J "C4'" 1 
ATOM   3518  O  "O4'" . DC  B  2 26  ? 73.569 55.706  3.239   1.00 142.01 ? -48 DC  J "O4'" 1 
ATOM   3519  C  "C3'" . DC  B  2 26  ? 72.849 53.799  4.465   1.00 152.36 ? -48 DC  J "C3'" 1 
ATOM   3520  O  "O3'" . DC  B  2 26  ? 71.688 54.151  5.196   1.00 160.24 ? -48 DC  J "O3'" 1 
ATOM   3521  C  "C2'" . DC  B  2 26  ? 72.541 53.637  2.981   1.00 145.88 ? -48 DC  J "C2'" 1 
ATOM   3522  C  "C1'" . DC  B  2 26  ? 72.500 55.092  2.552   1.00 137.47 ? -48 DC  J "C1'" 1 
ATOM   3523  N  N1    . DC  B  2 26  ? 72.684 55.299  1.087   1.00 128.87 ? -48 DC  J N1    1 
ATOM   3524  C  C2    . DC  B  2 26  ? 72.038 56.368  0.454   1.00 123.09 ? -48 DC  J C2    1 
ATOM   3525  O  O2    . DC  B  2 26  ? 71.328 57.123  1.129   1.00 119.02 ? -48 DC  J O2    1 
ATOM   3526  N  N3    . DC  B  2 26  ? 72.213 56.544  -0.880  1.00 118.83 ? -48 DC  J N3    1 
ATOM   3527  C  C4    . DC  B  2 26  ? 72.990 55.703  -1.567  1.00 119.12 ? -48 DC  J C4    1 
ATOM   3528  N  N4    . DC  B  2 26  ? 73.136 55.912  -2.880  1.00 117.25 ? -48 DC  J N4    1 
ATOM   3529  C  C5    . DC  B  2 26  ? 73.653 54.608  -0.938  1.00 122.78 ? -48 DC  J C5    1 
ATOM   3530  C  C6    . DC  B  2 26  ? 73.473 54.444  0.376   1.00 126.03 ? -48 DC  J C6    1 
ATOM   3531  P  P     . DA  B  2 27  ? 71.070 53.137  6.278   1.00 146.24 ? -47 DA  J P     1 
ATOM   3532  O  OP1   . DA  B  2 27  ? 72.112 52.866  7.292   1.00 151.29 ? -47 DA  J OP1   1 
ATOM   3533  O  OP2   . DA  B  2 27  ? 70.451 52.014  5.540   1.00 150.69 ? -47 DA  J OP2   1 
ATOM   3534  O  "O5'" . DA  B  2 27  ? 69.899 53.987  6.956   1.00 142.19 ? -47 DA  J "O5'" 1 
ATOM   3535  C  "C5'" . DA  B  2 27  ? 70.149 55.322  7.381   1.00 136.42 ? -47 DA  J "C5'" 1 
ATOM   3536  C  "C4'" . DA  B  2 27  ? 69.124 56.281  6.799   1.00 131.17 ? -47 DA  J "C4'" 1 
ATOM   3537  O  "O4'" . DA  B  2 27  ? 69.338 56.424  5.369   1.00 131.45 ? -47 DA  J "O4'" 1 
ATOM   3538  C  "C3'" . DA  B  2 27  ? 67.671 55.857  6.971   1.00 129.68 ? -47 DA  J "C3'" 1 
ATOM   3539  O  "O3'" . DA  B  2 27  ? 66.863 56.998  7.213   1.00 125.39 ? -47 DA  J "O3'" 1 
ATOM   3540  C  "C2'" . DA  B  2 27  ? 67.341 55.205  5.631   1.00 131.86 ? -47 DA  J "C2'" 1 
ATOM   3541  C  "C1'" . DA  B  2 27  ? 68.186 56.016  4.656   1.00 134.11 ? -47 DA  J "C1'" 1 
ATOM   3542  N  N9    . DA  B  2 27  ? 68.626 55.245  3.495   1.00 141.66 ? -47 DA  J N9    1 
ATOM   3543  C  C8    . DA  B  2 27  ? 69.181 53.997  3.508   1.00 145.68 ? -47 DA  J C8    1 
ATOM   3544  N  N7    . DA  B  2 27  ? 69.488 53.539  2.320   1.00 147.65 ? -47 DA  J N7    1 
ATOM   3545  C  C5    . DA  B  2 27  ? 69.117 54.558  1.463   1.00 143.45 ? -47 DA  J C5    1 
ATOM   3546  C  C6    . DA  B  2 27  ? 69.188 54.686  0.063   1.00 138.04 ? -47 DA  J C6    1 
ATOM   3547  N  N6    . DA  B  2 27  ? 69.682 53.735  -0.736  1.00 138.25 ? -47 DA  J N6    1 
ATOM   3548  N  N1    . DA  B  2 27  ? 68.728 55.828  -0.485  1.00 133.18 ? -47 DA  J N1    1 
ATOM   3549  C  C2    . DA  B  2 27  ? 68.233 56.777  0.321   1.00 130.69 ? -47 DA  J C2    1 
ATOM   3550  N  N3    . DA  B  2 27  ? 68.115 56.772  1.652   1.00 132.45 ? -47 DA  J N3    1 
ATOM   3551  C  C4    . DA  B  2 27  ? 68.581 55.621  2.166   1.00 140.44 ? -47 DA  J C4    1 
ATOM   3552  P  P     . DA  B  2 28  ? 65.344 56.831  7.710   1.00 140.38 ? -46 DA  J P     1 
ATOM   3553  O  OP1   . DA  B  2 28  ? 65.182 57.640  8.940   1.00 139.54 ? -46 DA  J OP1   1 
ATOM   3554  O  OP2   . DA  B  2 28  ? 65.013 55.389  7.733   1.00 141.75 ? -46 DA  J OP2   1 
ATOM   3555  O  "O5'" . DA  B  2 28  ? 64.497 57.505  6.537   1.00 138.25 ? -46 DA  J "O5'" 1 
ATOM   3556  C  "C5'" . DA  B  2 28  ? 65.030 58.619  5.834   1.00 131.18 ? -46 DA  J "C5'" 1 
ATOM   3557  C  "C4'" . DA  B  2 28  ? 64.481 58.683  4.421   1.00 125.63 ? -46 DA  J "C4'" 1 
ATOM   3558  O  "O4'" . DA  B  2 28  ? 65.215 57.766  3.558   1.00 126.22 ? -46 DA  J "O4'" 1 
ATOM   3559  C  "C3'" . DA  B  2 28  ? 63.008 58.285  4.270   1.00 125.14 ? -46 DA  J "C3'" 1 
ATOM   3560  O  "O3'" . DA  B  2 28  ? 62.438 59.041  3.228   1.00 124.80 ? -46 DA  J "O3'" 1 
ATOM   3561  C  "C2'" . DA  B  2 28  ? 63.129 56.831  3.841   1.00 127.11 ? -46 DA  J "C2'" 1 
ATOM   3562  C  "C1'" . DA  B  2 28  ? 64.273 56.986  2.863   1.00 125.86 ? -46 DA  J "C1'" 1 
ATOM   3563  N  N9    . DA  B  2 28  ? 64.883 55.736  2.424   1.00 125.12 ? -46 DA  J N9    1 
ATOM   3564  C  C8    . DA  B  2 28  ? 65.245 54.671  3.195   1.00 126.71 ? -46 DA  J C8    1 
ATOM   3565  N  N7    . DA  B  2 28  ? 65.774 53.681  2.513   1.00 130.02 ? -46 DA  J N7    1 
ATOM   3566  C  C5    . DA  B  2 28  ? 65.746 54.129  1.203   1.00 128.01 ? -46 DA  J C5    1 
ATOM   3567  C  C6    . DA  B  2 28  ? 66.159 53.547  -0.012  1.00 128.02 ? -46 DA  J C6    1 
ATOM   3568  N  N6    . DA  B  2 28  ? 66.708 52.331  -0.097  1.00 132.81 ? -46 DA  J N6    1 
ATOM   3569  N  N1    . DA  B  2 28  ? 65.989 54.268  -1.141  1.00 125.26 ? -46 DA  J N1    1 
ATOM   3570  C  C2    . DA  B  2 28  ? 65.445 55.485  -1.051  1.00 122.89 ? -46 DA  J C2    1 
ATOM   3571  N  N3    . DA  B  2 28  ? 65.017 56.133  0.029   1.00 122.45 ? -46 DA  J N3    1 
ATOM   3572  C  C4    . DA  B  2 28  ? 65.199 55.393  1.133   1.00 124.58 ? -46 DA  J C4    1 
ATOM   3573  P  P     . DA  B  2 29  ? 61.303 60.138  3.512   1.00 119.83 ? -45 DA  J P     1 
ATOM   3574  O  OP1   . DA  B  2 29  ? 61.912 61.222  4.316   1.00 118.14 ? -45 DA  J OP1   1 
ATOM   3575  O  OP2   . DA  B  2 29  ? 60.097 59.437  4.007   1.00 119.92 ? -45 DA  J OP2   1 
ATOM   3576  O  "O5'" . DA  B  2 29  ? 60.990 60.696  2.048   1.00 118.51 ? -45 DA  J "O5'" 1 
ATOM   3577  C  "C5'" . DA  B  2 29  ? 62.070 60.986  1.169   1.00 116.19 ? -45 DA  J "C5'" 1 
ATOM   3578  C  "C4'" . DA  B  2 29  ? 61.881 60.320  -0.185  1.00 113.91 ? -45 DA  J "C4'" 1 
ATOM   3579  O  "O4'" . DA  B  2 29  ? 62.431 58.974  -0.180  1.00 113.89 ? -45 DA  J "O4'" 1 
ATOM   3580  C  "C3'" . DA  B  2 29  ? 60.434 60.176  -0.660  1.00 112.48 ? -45 DA  J "C3'" 1 
ATOM   3581  O  "O3'" . DA  B  2 29  ? 60.382 60.517  -2.022  1.00 115.10 ? -45 DA  J "O3'" 1 
ATOM   3582  C  "C2'" . DA  B  2 29  ? 60.156 58.684  -0.458  1.00 112.22 ? -45 DA  J "C2'" 1 
ATOM   3583  C  "C1'" . DA  B  2 29  ? 61.513 58.114  -0.816  1.00 114.16 ? -45 DA  J "C1'" 1 
ATOM   3584  N  N9    . DA  B  2 29  ? 61.754 56.753  -0.345  1.00 118.63 ? -45 DA  J N9    1 
ATOM   3585  C  C8    . DA  B  2 29  ? 61.645 56.291  0.934   1.00 120.06 ? -45 DA  J C8    1 
ATOM   3586  N  N7    . DA  B  2 29  ? 61.954 55.023  1.070   1.00 122.28 ? -45 DA  J N7    1 
ATOM   3587  C  C5    . DA  B  2 29  ? 62.291 54.625  -0.212  1.00 123.93 ? -45 DA  J C5    1 
ATOM   3588  C  C6    . DA  B  2 29  ? 62.713 53.390  -0.744  1.00 127.55 ? -45 DA  J C6    1 
ATOM   3589  N  N6    . DA  B  2 29  ? 62.863 52.285  -0.007  1.00 132.35 ? -45 DA  J N6    1 
ATOM   3590  N  N1    . DA  B  2 29  ? 62.969 53.333  -2.068  1.00 125.47 ? -45 DA  J N1    1 
ATOM   3591  C  C2    . DA  B  2 29  ? 62.815 54.440  -2.804  1.00 121.56 ? -45 DA  J C2    1 
ATOM   3592  N  N3    . DA  B  2 29  ? 62.429 55.655  -2.417  1.00 120.44 ? -45 DA  J N3    1 
ATOM   3593  C  C4    . DA  B  2 29  ? 62.178 55.680  -1.097  1.00 121.69 ? -45 DA  J C4    1 
ATOM   3594  P  P     . DA  B  2 30  ? 59.045 61.116  -2.670  1.00 112.16 ? -44 DA  J P     1 
ATOM   3595  O  OP1   . DA  B  2 30  ? 59.371 62.489  -3.111  1.00 110.74 ? -44 DA  J OP1   1 
ATOM   3596  O  OP2   . DA  B  2 30  ? 57.919 60.874  -1.739  1.00 109.15 ? -44 DA  J OP2   1 
ATOM   3597  O  "O5'" . DA  B  2 30  ? 58.836 60.204  -3.961  1.00 103.13 ? -44 DA  J "O5'" 1 
ATOM   3598  C  "C5'" . DA  B  2 30  ? 59.964 59.813  -4.727  1.00 95.62  ? -44 DA  J "C5'" 1 
ATOM   3599  C  "C4'" . DA  B  2 30  ? 59.688 58.517  -5.456  1.00 99.47  ? -44 DA  J "C4'" 1 
ATOM   3600  O  "O4'" . DA  B  2 30  ? 60.097 57.389  -4.636  1.00 106.48 ? -44 DA  J "O4'" 1 
ATOM   3601  C  "C3'" . DA  B  2 30  ? 58.215 58.279  -5.806  1.00 101.10 ? -44 DA  J "C3'" 1 
ATOM   3602  O  "O3'" . DA  B  2 30  ? 58.109 57.893  -7.161  1.00 105.78 ? -44 DA  J "O3'" 1 
ATOM   3603  C  "C2'" . DA  B  2 30  ? 57.808 57.142  -4.866  1.00 105.44 ? -44 DA  J "C2'" 1 
ATOM   3604  C  "C1'" . DA  B  2 30  ? 59.117 56.388  -4.735  1.00 109.93 ? -44 DA  J "C1'" 1 
ATOM   3605  N  N9    . DA  B  2 30  ? 59.192 55.528  -3.556  1.00 113.65 ? -44 DA  J N9    1 
ATOM   3606  C  C8    . DA  B  2 30  ? 58.878 55.860  -2.267  1.00 113.19 ? -44 DA  J C8    1 
ATOM   3607  N  N7    . DA  B  2 30  ? 59.043 54.876  -1.412  1.00 114.74 ? -44 DA  J N7    1 
ATOM   3608  C  C5    . DA  B  2 30  ? 59.498 53.828  -2.196  1.00 118.24 ? -44 DA  J C5    1 
ATOM   3609  C  C6    . DA  B  2 30  ? 59.860 52.499  -1.893  1.00 123.23 ? -44 DA  J C6    1 
ATOM   3610  N  N6    . DA  B  2 30  ? 59.819 51.988  -0.658  1.00 124.32 ? -44 DA  J N6    1 
ATOM   3611  N  N1    . DA  B  2 30  ? 60.272 51.714  -2.913  1.00 127.80 ? -44 DA  J N1    1 
ATOM   3612  C  C2    . DA  B  2 30  ? 60.316 52.229  -4.146  1.00 126.32 ? -44 DA  J C2    1 
ATOM   3613  N  N3    . DA  B  2 30  ? 60.000 53.457  -4.552  1.00 122.42 ? -44 DA  J N3    1 
ATOM   3614  C  C4    . DA  B  2 30  ? 59.594 54.213  -3.520  1.00 118.34 ? -44 DA  J C4    1 
ATOM   3615  P  P     . DG  B  2 31  ? 56.712 58.015  -7.944  1.00 103.63 ? -43 DG  J P     1 
ATOM   3616  O  OP1   . DG  B  2 31  ? 56.776 59.228  -8.789  1.00 95.93  ? -43 DG  J OP1   1 
ATOM   3617  O  OP2   . DG  B  2 31  ? 55.605 57.858  -6.973  1.00 105.42 ? -43 DG  J OP2   1 
ATOM   3618  O  "O5'" . DG  B  2 31  ? 56.720 56.730  -8.888  1.00 110.29 ? -43 DG  J "O5'" 1 
ATOM   3619  C  "C5'" . DG  B  2 31  ? 57.961 56.181  -9.310  1.00 113.32 ? -43 DG  J "C5'" 1 
ATOM   3620  C  "C4'" . DG  B  2 31  ? 57.956 54.672  -9.168  1.00 120.19 ? -43 DG  J "C4'" 1 
ATOM   3621  O  "O4'" . DG  B  2 31  ? 58.108 54.309  -7.778  1.00 122.55 ? -43 DG  J "O4'" 1 
ATOM   3622  C  "C3'" . DG  B  2 31  ? 56.673 53.990  -9.646  1.00 123.85 ? -43 DG  J "C3'" 1 
ATOM   3623  O  "O3'" . DG  B  2 31  ? 56.951 53.182  -10.778 1.00 127.49 ? -43 DG  J "O3'" 1 
ATOM   3624  C  "C2'" . DG  B  2 31  ? 56.205 53.150  -8.446  1.00 125.23 ? -43 DG  J "C2'" 1 
ATOM   3625  C  "C1'" . DG  B  2 31  ? 57.442 53.095  -7.563  1.00 125.89 ? -43 DG  J "C1'" 1 
ATOM   3626  N  N9    . DG  B  2 31  ? 57.143 52.974  -6.137  1.00 128.30 ? -43 DG  J N9    1 
ATOM   3627  C  C8    . DG  B  2 31  ? 56.672 53.959  -5.301  1.00 126.90 ? -43 DG  J C8    1 
ATOM   3628  N  N7    . DG  B  2 31  ? 56.500 53.561  -4.071  1.00 127.66 ? -43 DG  J N7    1 
ATOM   3629  C  C5    . DG  B  2 31  ? 56.881 52.225  -4.090  1.00 130.46 ? -43 DG  J C5    1 
ATOM   3630  C  C6    . DG  B  2 31  ? 56.909 51.269  -3.045  1.00 134.10 ? -43 DG  J C6    1 
ATOM   3631  O  O6    . DG  B  2 31  ? 56.590 51.420  -1.857  1.00 134.76 ? -43 DG  J O6    1 
ATOM   3632  N  N1    . DG  B  2 31  ? 57.362 50.030  -3.493  1.00 133.77 ? -43 DG  J N1    1 
ATOM   3633  C  C2    . DG  B  2 31  ? 57.739 49.751  -4.787  1.00 130.64 ? -43 DG  J C2    1 
ATOM   3634  N  N2    . DG  B  2 31  ? 58.150 48.501  -5.037  1.00 131.02 ? -43 DG  J N2    1 
ATOM   3635  N  N3    . DG  B  2 31  ? 57.717 50.638  -5.773  1.00 130.44 ? -43 DG  J N3    1 
ATOM   3636  C  C4    . DG  B  2 31  ? 57.279 51.849  -5.354  1.00 130.51 ? -43 DG  J C4    1 
ATOM   3637  P  P     . DT  B  2 32  ? 55.753 52.656  -11.707 1.00 128.26 ? -42 DT  J P     1 
ATOM   3638  O  OP1   . DT  B  2 32  ? 56.231 52.670  -13.107 1.00 129.09 ? -42 DT  J OP1   1 
ATOM   3639  O  OP2   . DT  B  2 32  ? 54.533 53.407  -11.334 1.00 127.76 ? -42 DT  J OP2   1 
ATOM   3640  O  "O5'" . DT  B  2 32  ? 55.553 51.142  -11.241 1.00 128.18 ? -42 DT  J "O5'" 1 
ATOM   3641  C  "C5'" . DT  B  2 32  ? 56.688 50.323  -10.994 1.00 131.55 ? -42 DT  J "C5'" 1 
ATOM   3642  C  "C4'" . DT  B  2 32  ? 56.274 49.000  -10.380 1.00 137.81 ? -42 DT  J "C4'" 1 
ATOM   3643  O  "O4'" . DT  B  2 32  ? 56.175 49.136  -8.937  1.00 140.95 ? -42 DT  J "O4'" 1 
ATOM   3644  C  "C3'" . DT  B  2 32  ? 54.918 48.467  -10.849 1.00 141.83 ? -42 DT  J "C3'" 1 
ATOM   3645  O  "O3'" . DT  B  2 32  ? 55.011 47.072  -11.086 1.00 149.58 ? -42 DT  J "O3'" 1 
ATOM   3646  C  "C2'" . DT  B  2 32  ? 53.998 48.775  -9.668  1.00 141.38 ? -42 DT  J "C2'" 1 
ATOM   3647  C  "C1'" . DT  B  2 32  ? 54.954 48.583  -8.506  1.00 143.66 ? -42 DT  J "C1'" 1 
ATOM   3648  N  N1    . DT  B  2 32  ? 54.537 49.268  -7.246  1.00 142.54 ? -42 DT  J N1    1 
ATOM   3649  C  C2    . DT  B  2 32  ? 54.556 48.561  -6.069  1.00 142.70 ? -42 DT  J C2    1 
ATOM   3650  O  O2    . DT  B  2 32  ? 54.894 47.393  -5.998  1.00 144.13 ? -42 DT  J O2    1 
ATOM   3651  N  N3    . DT  B  2 32  ? 54.164 49.269  -4.967  1.00 142.89 ? -42 DT  J N3    1 
ATOM   3652  C  C4    . DT  B  2 32  ? 53.761 50.591  -4.922  1.00 139.33 ? -42 DT  J C4    1 
ATOM   3653  O  O4    . DT  B  2 32  ? 53.425 51.137  -3.875  1.00 135.51 ? -42 DT  J O4    1 
ATOM   3654  C  C5    . DT  B  2 32  ? 53.763 51.279  -6.193  1.00 137.73 ? -42 DT  J C5    1 
ATOM   3655  C  C7    . DT  B  2 32  ? 53.344 52.718  -6.272  1.00 131.78 ? -42 DT  J C7    1 
ATOM   3656  C  C6    . DT  B  2 32  ? 54.146 50.592  -7.282  1.00 140.43 ? -42 DT  J C6    1 
ATOM   3657  P  P     . DG  B  2 33  ? 53.918 46.328  -11.999 1.00 149.79 ? -41 DG  J P     1 
ATOM   3658  O  OP1   . DG  B  2 33  ? 54.641 45.638  -13.091 1.00 153.08 ? -41 DG  J OP1   1 
ATOM   3659  O  OP2   . DG  B  2 33  ? 52.853 47.303  -12.320 1.00 145.96 ? -41 DG  J OP2   1 
ATOM   3660  O  "O5'" . DG  B  2 33  ? 53.296 45.228  -11.021 1.00 153.94 ? -41 DG  J "O5'" 1 
ATOM   3661  C  "C5'" . DG  B  2 33  ? 54.140 44.258  -10.413 1.00 156.84 ? -41 DG  J "C5'" 1 
ATOM   3662  C  "C4'" . DG  B  2 33  ? 53.424 43.560  -9.270  1.00 159.09 ? -41 DG  J "C4'" 1 
ATOM   3663  O  "O4'" . DG  B  2 33  ? 53.320 44.462  -8.137  1.00 155.18 ? -41 DG  J "O4'" 1 
ATOM   3664  C  "C3'" . DG  B  2 33  ? 51.995 43.110  -9.581  1.00 163.23 ? -41 DG  J "C3'" 1 
ATOM   3665  O  "O3'" . DG  B  2 33  ? 51.741 41.851  -8.973  1.00 173.07 ? -41 DG  J "O3'" 1 
ATOM   3666  C  "C2'" . DG  B  2 33  ? 51.148 44.211  -8.952  1.00 156.70 ? -41 DG  J "C2'" 1 
ATOM   3667  C  "C1'" . DG  B  2 33  ? 51.976 44.536  -7.722  1.00 154.98 ? -41 DG  J "C1'" 1 
ATOM   3668  N  N9    . DG  B  2 33  ? 51.728 45.864  -7.173  1.00 153.35 ? -41 DG  J N9    1 
ATOM   3669  C  C8    . DG  B  2 33  ? 51.631 47.050  -7.861  1.00 151.41 ? -41 DG  J C8    1 
ATOM   3670  N  N7    . DG  B  2 33  ? 51.405 48.080  -7.090  1.00 148.58 ? -41 DG  J N7    1 
ATOM   3671  C  C5    . DG  B  2 33  ? 51.354 47.540  -5.810  1.00 149.32 ? -41 DG  J C5    1 
ATOM   3672  C  C6    . DG  B  2 33  ? 51.139 48.167  -4.557  1.00 146.75 ? -41 DG  J C6    1 
ATOM   3673  O  O6    . DG  B  2 33  ? 50.943 49.368  -4.318  1.00 141.40 ? -41 DG  J O6    1 
ATOM   3674  N  N1    . DG  B  2 33  ? 51.166 47.246  -3.511  1.00 149.05 ? -41 DG  J N1    1 
ATOM   3675  C  C2    . DG  B  2 33  ? 51.374 45.894  -3.659  1.00 151.87 ? -41 DG  J C2    1 
ATOM   3676  N  N2    . DG  B  2 33  ? 51.368 45.155  -2.544  1.00 152.50 ? -41 DG  J N2    1 
ATOM   3677  N  N3    . DG  B  2 33  ? 51.576 45.301  -4.824  1.00 154.14 ? -41 DG  J N3    1 
ATOM   3678  C  C4    . DG  B  2 33  ? 51.553 46.179  -5.849  1.00 152.56 ? -41 DG  J C4    1 
ATOM   3679  P  P     . DT  B  2 34  ? 50.373 41.067  -9.286  1.00 164.10 ? -40 DT  J P     1 
ATOM   3680  O  OP1   . DT  B  2 34  ? 50.656 39.617  -9.189  1.00 169.85 ? -40 DT  J OP1   1 
ATOM   3681  O  OP2   . DT  B  2 34  ? 49.819 41.626  -10.539 1.00 163.70 ? -40 DT  J OP2   1 
ATOM   3682  O  "O5'" . DT  B  2 34  ? 49.397 41.489  -8.088  1.00 163.46 ? -40 DT  J "O5'" 1 
ATOM   3683  C  "C5'" . DT  B  2 34  ? 49.548 40.894  -6.800  1.00 164.33 ? -40 DT  J "C5'" 1 
ATOM   3684  C  "C4'" . DT  B  2 34  ? 48.396 41.266  -5.876  1.00 162.61 ? -40 DT  J "C4'" 1 
ATOM   3685  O  "O4'" . DT  B  2 34  ? 48.567 42.629  -5.387  1.00 161.73 ? -40 DT  J "O4'" 1 
ATOM   3686  C  "C3'" . DT  B  2 34  ? 46.994 41.240  -6.511  1.00 160.86 ? -40 DT  J "C3'" 1 
ATOM   3687  O  "O3'" . DT  B  2 34  ? 46.037 40.897  -5.524  1.00 155.84 ? -40 DT  J "O3'" 1 
ATOM   3688  C  "C2'" . DT  B  2 34  ? 46.814 42.703  -6.876  1.00 161.68 ? -40 DT  J "C2'" 1 
ATOM   3689  C  "C1'" . DT  B  2 34  ? 47.348 43.301  -5.592  1.00 162.52 ? -40 DT  J "C1'" 1 
ATOM   3690  N  N1    . DT  B  2 34  ? 47.561 44.770  -5.619  1.00 161.90 ? -40 DT  J N1    1 
ATOM   3691  C  C2    . DT  B  2 34  ? 47.462 45.471  -4.440  1.00 158.89 ? -40 DT  J C2    1 
ATOM   3692  O  O2    . DT  B  2 34  ? 47.231 44.941  -3.368  1.00 158.57 ? -40 DT  J O2    1 
ATOM   3693  N  N3    . DT  B  2 34  ? 47.654 46.819  -4.555  1.00 155.83 ? -40 DT  J N3    1 
ATOM   3694  C  C4    . DT  B  2 34  ? 47.922 47.526  -5.714  1.00 154.28 ? -40 DT  J C4    1 
ATOM   3695  O  O4    . DT  B  2 34  ? 48.080 48.743  -5.716  1.00 148.55 ? -40 DT  J O4    1 
ATOM   3696  C  C5    . DT  B  2 34  ? 48.002 46.731  -6.920  1.00 158.43 ? -40 DT  J C5    1 
ATOM   3697  C  C7    . DT  B  2 34  ? 48.285 47.387  -8.238  1.00 157.67 ? -40 DT  J C7    1 
ATOM   3698  C  C6    . DT  B  2 34  ? 47.814 45.405  -6.816  1.00 162.01 ? -40 DT  J C6    1 
ATOM   3699  P  P     . DA  B  2 35  ? 45.675 39.374  -5.169  1.00 173.02 ? -39 DA  J P     1 
ATOM   3700  O  OP1   . DA  B  2 35  ? 46.930 38.620  -4.955  1.00 173.13 ? -39 DA  J OP1   1 
ATOM   3701  O  OP2   . DA  B  2 35  ? 44.690 38.895  -6.164  1.00 175.65 ? -39 DA  J OP2   1 
ATOM   3702  O  "O5'" . DA  B  2 35  ? 44.921 39.522  -3.765  1.00 168.62 ? -39 DA  J "O5'" 1 
ATOM   3703  C  "C5'" . DA  B  2 35  ? 45.551 40.244  -2.708  1.00 160.86 ? -39 DA  J "C5'" 1 
ATOM   3704  C  "C4'" . DA  B  2 35  ? 44.572 41.157  -1.979  1.00 153.75 ? -39 DA  J "C4'" 1 
ATOM   3705  O  "O4'" . DA  B  2 35  ? 44.847 42.547  -2.298  1.00 149.62 ? -39 DA  J "O4'" 1 
ATOM   3706  C  "C3'" . DA  B  2 35  ? 43.085 40.935  -2.276  1.00 152.04 ? -39 DA  J "C3'" 1 
ATOM   3707  O  "O3'" . DA  B  2 35  ? 42.378 40.881  -1.035  1.00 149.83 ? -39 DA  J "O3'" 1 
ATOM   3708  C  "C2'" . DA  B  2 35  ? 42.704 42.171  -3.103  1.00 149.96 ? -39 DA  J "C2'" 1 
ATOM   3709  C  "C1'" . DA  B  2 35  ? 43.628 43.219  -2.513  1.00 146.89 ? -39 DA  J "C1'" 1 
ATOM   3710  N  N9    . DA  B  2 35  ? 43.886 44.360  -3.388  1.00 142.76 ? -39 DA  J N9    1 
ATOM   3711  C  C8    . DA  B  2 35  ? 44.179 44.330  -4.723  1.00 142.68 ? -39 DA  J C8    1 
ATOM   3712  N  N7    . DA  B  2 35  ? 44.385 45.516  -5.247  1.00 138.96 ? -39 DA  J N7    1 
ATOM   3713  C  C5    . DA  B  2 35  ? 44.222 46.383  -4.179  1.00 137.16 ? -39 DA  J C5    1 
ATOM   3714  C  C6    . DA  B  2 35  ? 44.308 47.786  -4.073  1.00 135.45 ? -39 DA  J C6    1 
ATOM   3715  N  N6    . DA  B  2 35  ? 44.593 48.584  -5.105  1.00 134.45 ? -39 DA  J N6    1 
ATOM   3716  N  N1    . DA  B  2 35  ? 44.088 48.336  -2.858  1.00 133.08 ? -39 DA  J N1    1 
ATOM   3717  C  C2    . DA  B  2 35  ? 43.801 47.531  -1.830  1.00 133.56 ? -39 DA  J C2    1 
ATOM   3718  N  N3    . DA  B  2 35  ? 43.695 46.204  -1.808  1.00 135.55 ? -39 DA  J N3    1 
ATOM   3719  C  C4    . DA  B  2 35  ? 43.919 45.687  -3.026  1.00 137.90 ? -39 DA  J C4    1 
ATOM   3720  P  P     . DT  B  2 36  ? 40.772 40.810  -0.968  1.00 158.50 ? -38 DT  J P     1 
ATOM   3721  O  OP1   . DT  B  2 36  ? 40.448 39.752  0.013   1.00 162.17 ? -38 DT  J OP1   1 
ATOM   3722  O  OP2   . DT  B  2 36  ? 40.194 40.726  -2.327  1.00 159.26 ? -38 DT  J OP2   1 
ATOM   3723  O  "O5'" . DT  B  2 36  ? 40.371 42.216  -0.320  1.00 152.45 ? -38 DT  J "O5'" 1 
ATOM   3724  C  "C5'" . DT  B  2 36  ? 40.993 42.630  0.895   1.00 145.92 ? -38 DT  J "C5'" 1 
ATOM   3725  C  "C4'" . DT  B  2 36  ? 40.492 43.995  1.334   1.00 137.25 ? -38 DT  J "C4'" 1 
ATOM   3726  O  "O4'" . DT  B  2 36  ? 40.999 45.013  0.438   1.00 131.13 ? -38 DT  J "O4'" 1 
ATOM   3727  C  "C3'" . DT  B  2 36  ? 38.971 44.146  1.367   1.00 138.08 ? -38 DT  J "C3'" 1 
ATOM   3728  O  "O3'" . DT  B  2 36  ? 38.559 44.581  2.662   1.00 141.82 ? -38 DT  J "O3'" 1 
ATOM   3729  C  "C2'" . DT  B  2 36  ? 38.665 45.183  0.277   1.00 133.72 ? -38 DT  J "C2'" 1 
ATOM   3730  C  "C1'" . DT  B  2 36  ? 39.982 45.931  0.121   1.00 129.43 ? -38 DT  J "C1'" 1 
ATOM   3731  N  N1    . DT  B  2 36  ? 40.225 46.411  -1.273  1.00 128.05 ? -38 DT  J N1    1 
ATOM   3732  C  C2    . DT  B  2 36  ? 40.427 47.756  -1.512  1.00 125.51 ? -38 DT  J C2    1 
ATOM   3733  O  O2    . DT  B  2 36  ? 40.414 48.601  -0.635  1.00 122.96 ? -38 DT  J O2    1 
ATOM   3734  N  N3    . DT  B  2 36  ? 40.647 48.075  -2.831  1.00 124.31 ? -38 DT  J N3    1 
ATOM   3735  C  C4    . DT  B  2 36  ? 40.685 47.201  -3.905  1.00 125.02 ? -38 DT  J C4    1 
ATOM   3736  O  O4    . DT  B  2 36  ? 40.888 47.579  -5.055  1.00 122.58 ? -38 DT  J O4    1 
ATOM   3737  C  C5    . DT  B  2 36  ? 40.467 45.812  -3.581  1.00 129.74 ? -38 DT  J C5    1 
ATOM   3738  C  C7    . DT  B  2 36  ? 40.485 44.774  -4.663  1.00 132.45 ? -38 DT  J C7    1 
ATOM   3739  C  C6    . DT  B  2 36  ? 40.252 45.489  -2.299  1.00 129.67 ? -38 DT  J C6    1 
ATOM   3740  P  P     . DT  B  2 37  ? 37.041 45.027  2.943   1.00 136.34 ? -37 DT  J P     1 
ATOM   3741  O  OP1   . DT  B  2 37  ? 36.764 44.754  4.371   1.00 136.91 ? -37 DT  J OP1   1 
ATOM   3742  O  OP2   . DT  B  2 37  ? 36.160 44.434  1.912   1.00 136.50 ? -37 DT  J OP2   1 
ATOM   3743  O  "O5'" . DT  B  2 37  ? 37.082 46.610  2.732   1.00 130.41 ? -37 DT  J "O5'" 1 
ATOM   3744  C  "C5'" . DT  B  2 37  ? 38.205 47.347  3.200   1.00 126.34 ? -37 DT  J "C5'" 1 
ATOM   3745  C  "C4'" . DT  B  2 37  ? 38.028 48.830  2.943   1.00 121.58 ? -37 DT  J "C4'" 1 
ATOM   3746  O  "O4'" . DT  B  2 37  ? 38.389 49.137  1.573   1.00 121.56 ? -37 DT  J "O4'" 1 
ATOM   3747  C  "C3'" . DT  B  2 37  ? 36.611 49.354  3.153   1.00 120.69 ? -37 DT  J "C3'" 1 
ATOM   3748  O  "O3'" . DT  B  2 37  ? 36.651 50.553  3.909   1.00 121.20 ? -37 DT  J "O3'" 1 
ATOM   3749  C  "C2'" . DT  B  2 37  ? 36.088 49.585  1.732   1.00 119.29 ? -37 DT  J "C2'" 1 
ATOM   3750  C  "C1'" . DT  B  2 37  ? 37.362 49.873  0.947   1.00 120.00 ? -37 DT  J "C1'" 1 
ATOM   3751  N  N1    . DT  B  2 37  ? 37.294 49.436  -0.481  1.00 121.84 ? -37 DT  J N1    1 
ATOM   3752  C  C2    . DT  B  2 37  ? 37.604 50.330  -1.484  1.00 122.33 ? -37 DT  J C2    1 
ATOM   3753  O  O2    . DT  B  2 37  ? 37.928 51.486  -1.275  1.00 122.52 ? -37 DT  J O2    1 
ATOM   3754  N  N3    . DT  B  2 37  ? 37.513 49.816  -2.754  1.00 122.54 ? -37 DT  J N3    1 
ATOM   3755  C  C4    . DT  B  2 37  ? 37.158 48.529  -3.112  1.00 125.97 ? -37 DT  J C4    1 
ATOM   3756  O  O4    . DT  B  2 37  ? 37.105 48.160  -4.281  1.00 129.15 ? -37 DT  J O4    1 
ATOM   3757  C  C5    . DT  B  2 37  ? 36.851 47.646  -2.015  1.00 128.13 ? -37 DT  J C5    1 
ATOM   3758  C  C7    . DT  B  2 37  ? 36.450 46.226  -2.284  1.00 131.61 ? -37 DT  J C7    1 
ATOM   3759  C  C6    . DT  B  2 37  ? 36.936 48.135  -0.768  1.00 125.57 ? -37 DT  J C6    1 
ATOM   3760  P  P     . DT  B  2 38  ? 35.290 51.258  4.389   1.00 126.47 ? -36 DT  J P     1 
ATOM   3761  O  OP1   . DT  B  2 38  ? 35.552 51.882  5.705   1.00 125.02 ? -36 DT  J OP1   1 
ATOM   3762  O  OP2   . DT  B  2 38  ? 34.188 50.281  4.243   1.00 125.46 ? -36 DT  J OP2   1 
ATOM   3763  O  "O5'" . DT  B  2 38  ? 35.077 52.416  3.311   1.00 125.29 ? -36 DT  J "O5'" 1 
ATOM   3764  C  "C5'" . DT  B  2 38  ? 36.173 53.247  2.953   1.00 121.44 ? -36 DT  J "C5'" 1 
ATOM   3765  C  "C4'" . DT  B  2 38  ? 35.790 54.212  1.846   1.00 115.71 ? -36 DT  J "C4'" 1 
ATOM   3766  O  "O4'" . DT  B  2 38  ? 35.927 53.564  0.552   1.00 112.51 ? -36 DT  J "O4'" 1 
ATOM   3767  C  "C3'" . DT  B  2 38  ? 34.353 54.734  1.902   1.00 113.49 ? -36 DT  J "C3'" 1 
ATOM   3768  O  "O3'" . DT  B  2 38  ? 34.335 56.094  1.504   1.00 110.28 ? -36 DT  J "O3'" 1 
ATOM   3769  C  "C2'" . DT  B  2 38  ? 33.646 53.855  0.874   1.00 113.33 ? -36 DT  J "C2'" 1 
ATOM   3770  C  "C1'" . DT  B  2 38  ? 34.734 53.747  -0.177  1.00 111.63 ? -36 DT  J "C1'" 1 
ATOM   3771  N  N1    . DT  B  2 38  ? 34.573 52.605  -1.116  1.00 113.50 ? -36 DT  J N1    1 
ATOM   3772  C  C2    . DT  B  2 38  ? 34.832 52.800  -2.453  1.00 116.16 ? -36 DT  J C2    1 
ATOM   3773  O  O2    . DT  B  2 38  ? 35.185 53.871  -2.915  1.00 118.17 ? -36 DT  J O2    1 
ATOM   3774  N  N3    . DT  B  2 38  ? 34.663 51.692  -3.237  1.00 118.68 ? -36 DT  J N3    1 
ATOM   3775  C  C4    . DT  B  2 38  ? 34.268 50.432  -2.827  1.00 118.61 ? -36 DT  J C4    1 
ATOM   3776  O  O4    . DT  B  2 38  ? 34.144 49.496  -3.611  1.00 115.73 ? -36 DT  J O4    1 
ATOM   3777  C  C5    . DT  B  2 38  ? 34.013 50.294  -1.411  1.00 118.64 ? -36 DT  J C5    1 
ATOM   3778  C  C7    . DT  B  2 38  ? 33.577 48.974  -0.849  1.00 120.42 ? -36 DT  J C7    1 
ATOM   3779  C  C6    . DT  B  2 38  ? 34.176 51.376  -0.632  1.00 116.00 ? -36 DT  J C6    1 
ATOM   3780  P  P     . DG  B  2 39  ? 33.955 57.252  2.549   1.00 106.28 ? -35 DG  J P     1 
ATOM   3781  O  OP1   . DG  B  2 39  ? 34.921 57.177  3.669   1.00 104.20 ? -35 DG  J OP1   1 
ATOM   3782  O  OP2   . DG  B  2 39  ? 32.502 57.164  2.817   1.00 112.12 ? -35 DG  J OP2   1 
ATOM   3783  O  "O5'" . DG  B  2 39  ? 34.228 58.598  1.727   1.00 95.98  ? -35 DG  J "O5'" 1 
ATOM   3784  C  "C5'" . DG  B  2 39  ? 35.551 58.918  1.314   1.00 92.73  ? -35 DG  J "C5'" 1 
ATOM   3785  C  "C4'" . DG  B  2 39  ? 35.575 59.452  -0.113  1.00 96.29  ? -35 DG  J "C4'" 1 
ATOM   3786  O  "O4'" . DG  B  2 39  ? 35.224 58.399  -1.046  1.00 103.37 ? -35 DG  J "O4'" 1 
ATOM   3787  C  "C3'" . DG  B  2 39  ? 34.625 60.604  -0.403  1.00 98.27  ? -35 DG  J "C3'" 1 
ATOM   3788  O  "O3'" . DG  B  2 39  ? 35.221 61.488  -1.341  1.00 100.36 ? -35 DG  J "O3'" 1 
ATOM   3789  C  "C2'" . DG  B  2 39  ? 33.399 59.903  -0.989  1.00 99.62  ? -35 DG  J "C2'" 1 
ATOM   3790  C  "C1'" . DG  B  2 39  ? 34.015 58.710  -1.717  1.00 105.15 ? -35 DG  J "C1'" 1 
ATOM   3791  N  N9    . DG  B  2 39  ? 33.176 57.514  -1.684  1.00 110.44 ? -35 DG  J N9    1 
ATOM   3792  C  C8    . DG  B  2 39  ? 32.471 57.040  -0.606  1.00 112.50 ? -35 DG  J C8    1 
ATOM   3793  N  N7    . DG  B  2 39  ? 31.820 55.940  -0.852  1.00 115.38 ? -35 DG  J N7    1 
ATOM   3794  C  C5    . DG  B  2 39  ? 32.116 55.658  -2.179  1.00 115.20 ? -35 DG  J C5    1 
ATOM   3795  C  C6    . DG  B  2 39  ? 31.689 54.585  -2.993  1.00 116.94 ? -35 DG  J C6    1 
ATOM   3796  O  O6    . DG  B  2 39  ? 30.943 53.647  -2.688  1.00 121.27 ? -35 DG  J O6    1 
ATOM   3797  N  N1    . DG  B  2 39  ? 32.214 54.670  -4.279  1.00 114.06 ? -35 DG  J N1    1 
ATOM   3798  C  C2    . DG  B  2 39  ? 33.051 55.668  -4.723  1.00 109.39 ? -35 DG  J C2    1 
ATOM   3799  N  N2    . DG  B  2 39  ? 33.458 55.583  -6.000  1.00 109.51 ? -35 DG  J N2    1 
ATOM   3800  N  N3    . DG  B  2 39  ? 33.461 56.684  -3.967  1.00 109.10 ? -35 DG  J N3    1 
ATOM   3801  C  C4    . DG  B  2 39  ? 32.954 56.614  -2.709  1.00 112.00 ? -35 DG  J C4    1 
ATOM   3802  P  P     . DG  B  2 40  ? 34.627 62.965  -1.552  1.00 99.09  ? -34 DG  J P     1 
ATOM   3803  O  OP1   . DG  B  2 40  ? 35.746 63.839  -1.974  1.00 96.20  ? -34 DG  J OP1   1 
ATOM   3804  O  OP2   . DG  B  2 40  ? 33.829 63.310  -0.354  1.00 99.30  ? -34 DG  J OP2   1 
ATOM   3805  O  "O5'" . DG  B  2 40  ? 33.625 62.794  -2.783  1.00 98.28  ? -34 DG  J "O5'" 1 
ATOM   3806  C  "C5'" . DG  B  2 40  ? 34.116 62.340  -4.033  1.00 96.68  ? -34 DG  J "C5'" 1 
ATOM   3807  C  "C4'" . DG  B  2 40  ? 32.981 61.897  -4.933  1.00 101.27 ? -34 DG  J "C4'" 1 
ATOM   3808  O  "O4'" . DG  B  2 40  ? 32.452 60.624  -4.469  1.00 104.96 ? -34 DG  J "O4'" 1 
ATOM   3809  C  "C3'" . DG  B  2 40  ? 31.776 62.850  -4.987  1.00 107.60 ? -34 DG  J "C3'" 1 
ATOM   3810  O  "O3'" . DG  B  2 40  ? 31.272 62.896  -6.315  1.00 125.31 ? -34 DG  J "O3'" 1 
ATOM   3811  C  "C2'" . DG  B  2 40  ? 30.779 62.157  -4.064  1.00 106.72 ? -34 DG  J "C2'" 1 
ATOM   3812  C  "C1'" . DG  B  2 40  ? 31.053 60.724  -4.463  1.00 107.64 ? -34 DG  J "C1'" 1 
ATOM   3813  N  N9    . DG  B  2 40  ? 30.479 59.708  -3.586  1.00 108.19 ? -34 DG  J N9    1 
ATOM   3814  C  C8    . DG  B  2 40  ? 30.260 59.785  -2.232  1.00 106.12 ? -34 DG  J C8    1 
ATOM   3815  N  N7    . DG  B  2 40  ? 29.717 58.704  -1.734  1.00 106.34 ? -34 DG  J N7    1 
ATOM   3816  C  C5    . DG  B  2 40  ? 29.565 57.865  -2.834  1.00 113.02 ? -34 DG  J C5    1 
ATOM   3817  C  C6    . DG  B  2 40  ? 29.032 56.555  -2.927  1.00 122.07 ? -34 DG  J C6    1 
ATOM   3818  O  O6    . DG  B  2 40  ? 28.571 55.845  -2.022  1.00 127.61 ? -34 DG  J O6    1 
ATOM   3819  N  N1    . DG  B  2 40  ? 29.068 56.076  -4.236  1.00 123.16 ? -34 DG  J N1    1 
ATOM   3820  C  C2    . DG  B  2 40  ? 29.557 56.775  -5.315  1.00 120.31 ? -34 DG  J C2    1 
ATOM   3821  N  N2    . DG  B  2 40  ? 29.516 56.160  -6.504  1.00 121.07 ? -34 DG  J N2    1 
ATOM   3822  N  N3    . DG  B  2 40  ? 30.055 57.995  -5.238  1.00 117.75 ? -34 DG  J N3    1 
ATOM   3823  C  C4    . DG  B  2 40  ? 30.027 58.475  -3.976  1.00 113.20 ? -34 DG  J C4    1 
ATOM   3824  P  P     . DA  B  2 41  ? 31.645 64.110  -7.299  1.00 102.97 ? -33 DA  J P     1 
ATOM   3825  O  OP1   . DA  B  2 41  ? 33.117 64.254  -7.299  1.00 102.24 ? -33 DA  J OP1   1 
ATOM   3826  O  OP2   . DA  B  2 41  ? 30.793 65.264  -6.935  1.00 106.79 ? -33 DA  J OP2   1 
ATOM   3827  O  "O5'" . DA  B  2 41  ? 31.177 63.585  -8.738  1.00 112.48 ? -33 DA  J "O5'" 1 
ATOM   3828  C  "C5'" . DA  B  2 41  ? 31.972 62.631  -9.439  1.00 113.73 ? -33 DA  J "C5'" 1 
ATOM   3829  C  "C4'" . DA  B  2 41  ? 31.108 61.618  -10.178 1.00 117.65 ? -33 DA  J "C4'" 1 
ATOM   3830  O  "O4'" . DA  B  2 41  ? 30.548 60.663  -9.238  1.00 120.56 ? -33 DA  J "O4'" 1 
ATOM   3831  C  "C3'" . DA  B  2 41  ? 29.918 62.193  -10.943 1.00 120.50 ? -33 DA  J "C3'" 1 
ATOM   3832  O  "O3'" . DA  B  2 41  ? 29.714 61.428  -12.125 1.00 125.39 ? -33 DA  J "O3'" 1 
ATOM   3833  C  "C2'" . DA  B  2 41  ? 28.770 62.006  -9.953  1.00 123.07 ? -33 DA  J "C2'" 1 
ATOM   3834  C  "C1'" . DA  B  2 41  ? 29.138 60.663  -9.343  1.00 125.13 ? -33 DA  J "C1'" 1 
ATOM   3835  N  N9    . DA  B  2 41  ? 28.588 60.437  -8.011  1.00 127.29 ? -33 DA  J N9    1 
ATOM   3836  C  C8    . DA  B  2 41  ? 28.742 61.234  -6.914  1.00 126.11 ? -33 DA  J C8    1 
ATOM   3837  N  N7    . DA  B  2 41  ? 28.151 60.772  -5.838  1.00 128.59 ? -33 DA  J N7    1 
ATOM   3838  C  C5    . DA  B  2 41  ? 27.577 59.585  -6.256  1.00 131.67 ? -33 DA  J C5    1 
ATOM   3839  C  C6    . DA  B  2 41  ? 26.808 58.616  -5.583  1.00 135.48 ? -33 DA  J C6    1 
ATOM   3840  N  N6    . DA  B  2 41  ? 26.480 58.708  -4.291  1.00 133.40 ? -33 DA  J N6    1 
ATOM   3841  N  N1    . DA  B  2 41  ? 26.387 57.547  -6.292  1.00 143.24 ? -33 DA  J N1    1 
ATOM   3842  C  C2    . DA  B  2 41  ? 26.719 57.462  -7.586  1.00 143.30 ? -33 DA  J C2    1 
ATOM   3843  N  N3    . DA  B  2 41  ? 27.437 58.309  -8.325  1.00 138.57 ? -33 DA  J N3    1 
ATOM   3844  C  C4    . DA  B  2 41  ? 27.840 59.359  -7.592  1.00 132.39 ? -33 DA  J C4    1 
ATOM   3845  P  P     . DA  B  2 42  ? 28.848 62.012  -13.346 1.00 128.98 ? -32 DA  J P     1 
ATOM   3846  O  OP1   . DA  B  2 42  ? 29.746 62.104  -14.518 1.00 123.82 ? -32 DA  J OP1   1 
ATOM   3847  O  OP2   . DA  B  2 42  ? 28.129 63.216  -12.872 1.00 130.42 ? -32 DA  J OP2   1 
ATOM   3848  O  "O5'" . DA  B  2 42  ? 27.774 60.860  -13.626 1.00 127.51 ? -32 DA  J "O5'" 1 
ATOM   3849  C  "C5'" . DA  B  2 42  ? 27.242 60.113  -12.541 1.00 123.96 ? -32 DA  J "C5'" 1 
ATOM   3850  C  "C4'" . DA  B  2 42  ? 26.161 59.164  -13.017 1.00 126.57 ? -32 DA  J "C4'" 1 
ATOM   3851  O  "O4'" . DA  B  2 42  ? 25.524 58.555  -11.874 1.00 128.22 ? -32 DA  J "O4'" 1 
ATOM   3852  C  "C3'" . DA  B  2 42  ? 25.028 59.821  -13.774 1.00 127.45 ? -32 DA  J "C3'" 1 
ATOM   3853  O  "O3'" . DA  B  2 42  ? 24.361 58.852  -14.570 1.00 127.98 ? -32 DA  J "O3'" 1 
ATOM   3854  C  "C2'" . DA  B  2 42  ? 24.141 60.330  -12.639 1.00 129.80 ? -32 DA  J "C2'" 1 
ATOM   3855  C  "C1'" . DA  B  2 42  ? 24.330 59.254  -11.564 1.00 131.66 ? -32 DA  J "C1'" 1 
ATOM   3856  N  N9    . DA  B  2 42  ? 24.457 59.792  -10.211 1.00 130.55 ? -32 DA  J N9    1 
ATOM   3857  C  C8    . DA  B  2 42  ? 25.163 60.897  -9.825  1.00 126.21 ? -32 DA  J C8    1 
ATOM   3858  N  N7    . DA  B  2 42  ? 25.107 61.139  -8.536  1.00 124.63 ? -32 DA  J N7    1 
ATOM   3859  C  C5    . DA  B  2 42  ? 24.311 60.118  -8.041  1.00 129.38 ? -32 DA  J C5    1 
ATOM   3860  C  C6    . DA  B  2 42  ? 23.867 59.803  -6.740  1.00 133.65 ? -32 DA  J C6    1 
ATOM   3861  N  N6    . DA  B  2 42  ? 24.181 60.525  -5.659  1.00 132.53 ? -32 DA  J N6    1 
ATOM   3862  N  N1    . DA  B  2 42  ? 23.084 58.713  -6.593  1.00 137.48 ? -32 DA  J N1    1 
ATOM   3863  C  C2    . DA  B  2 42  ? 22.772 57.993  -7.677  1.00 139.82 ? -32 DA  J C2    1 
ATOM   3864  N  N3    . DA  B  2 42  ? 23.129 58.189  -8.945  1.00 138.56 ? -32 DA  J N3    1 
ATOM   3865  C  C4    . DA  B  2 42  ? 23.905 59.278  -9.060  1.00 132.35 ? -32 DA  J C4    1 
ATOM   3866  P  P     . DA  B  2 43  ? 23.141 59.282  -15.522 1.00 129.30 ? -31 DA  J P     1 
ATOM   3867  O  OP1   . DA  B  2 43  ? 23.151 58.380  -16.695 1.00 132.16 ? -31 DA  J OP1   1 
ATOM   3868  O  OP2   . DA  B  2 43  ? 23.214 60.747  -15.721 1.00 123.38 ? -31 DA  J OP2   1 
ATOM   3869  O  "O5'" . DA  B  2 43  ? 21.847 58.966  -14.638 1.00 129.70 ? -31 DA  J "O5'" 1 
ATOM   3870  C  "C5'" . DA  B  2 43  ? 21.695 57.683  -14.043 1.00 129.89 ? -31 DA  J "C5'" 1 
ATOM   3871  C  "C4'" . DA  B  2 43  ? 20.421 57.615  -13.221 1.00 131.10 ? -31 DA  J "C4'" 1 
ATOM   3872  O  "O4'" . DA  B  2 43  ? 20.689 58.050  -11.863 1.00 127.93 ? -31 DA  J "O4'" 1 
ATOM   3873  C  "C3'" . DA  B  2 43  ? 19.272 58.482  -13.736 1.00 134.24 ? -31 DA  J "C3'" 1 
ATOM   3874  O  "O3'" . DA  B  2 43  ? 18.067 57.730  -13.734 1.00 145.29 ? -31 DA  J "O3'" 1 
ATOM   3875  C  "C2'" . DA  B  2 43  ? 19.223 59.645  -12.741 1.00 129.56 ? -31 DA  J "C2'" 1 
ATOM   3876  C  "C1'" . DA  B  2 43  ? 19.718 58.989  -11.462 1.00 129.21 ? -31 DA  J "C1'" 1 
ATOM   3877  N  N9    . DA  B  2 43  ? 20.350 59.924  -10.533 1.00 128.81 ? -31 DA  J N9    1 
ATOM   3878  C  C8    . DA  B  2 43  ? 21.257 60.900  -10.841 1.00 126.13 ? -31 DA  J C8    1 
ATOM   3879  N  N7    . DA  B  2 43  ? 21.667 61.588  -9.803  1.00 124.09 ? -31 DA  J N7    1 
ATOM   3880  C  C5    . DA  B  2 43  ? 20.985 61.025  -8.737  1.00 126.34 ? -31 DA  J C5    1 
ATOM   3881  C  C6    . DA  B  2 43  ? 20.980 61.310  -7.356  1.00 123.55 ? -31 DA  J C6    1 
ATOM   3882  N  N6    . DA  B  2 43  ? 21.719 62.277  -6.803  1.00 116.17 ? -31 DA  J N6    1 
ATOM   3883  N  N1    . DA  B  2 43  ? 20.186 60.559  -6.563  1.00 130.31 ? -31 DA  J N1    1 
ATOM   3884  C  C2    . DA  B  2 43  ? 19.448 59.591  -7.123  1.00 136.86 ? -31 DA  J C2    1 
ATOM   3885  N  N3    . DA  B  2 43  ? 19.368 59.231  -8.406  1.00 137.89 ? -31 DA  J N3    1 
ATOM   3886  C  C4    . DA  B  2 43  ? 20.169 59.995  -9.168  1.00 131.45 ? -31 DA  J C4    1 
ATOM   3887  P  P     . DC  B  2 44  ? 16.693 58.387  -14.248 1.00 153.61 ? -30 DC  J P     1 
ATOM   3888  O  OP1   . DC  B  2 44  ? 15.917 57.318  -14.915 1.00 157.94 ? -30 DC  J OP1   1 
ATOM   3889  O  OP2   . DC  B  2 44  ? 17.014 59.627  -14.989 1.00 151.27 ? -30 DC  J OP2   1 
ATOM   3890  O  "O5'" . DC  B  2 44  ? 15.943 58.789  -12.896 1.00 153.37 ? -30 DC  J "O5'" 1 
ATOM   3891  C  "C5'" . DC  B  2 44  ? 15.695 57.795  -11.911 1.00 151.31 ? -30 DC  J "C5'" 1 
ATOM   3892  C  "C4'" . DC  B  2 44  ? 15.070 58.401  -10.669 1.00 144.79 ? -30 DC  J "C4'" 1 
ATOM   3893  O  "O4'" . DC  B  2 44  ? 16.065 59.159  -9.937  1.00 138.70 ? -30 DC  J "O4'" 1 
ATOM   3894  C  "C3'" . DC  B  2 44  ? 13.904 59.363  -10.929 1.00 142.81 ? -30 DC  J "C3'" 1 
ATOM   3895  O  "O3'" . DC  B  2 44  ? 12.799 59.005  -10.111 1.00 146.00 ? -30 DC  J "O3'" 1 
ATOM   3896  C  "C2'" . DC  B  2 44  ? 14.473 60.731  -10.541 1.00 137.27 ? -30 DC  J "C2'" 1 
ATOM   3897  C  "C1'" . DC  B  2 44  ? 15.468 60.338  -9.465  1.00 135.32 ? -30 DC  J "C1'" 1 
ATOM   3898  N  N1    . DC  B  2 44  ? 16.533 61.354  -9.212  1.00 127.04 ? -30 DC  J N1    1 
ATOM   3899  C  C2    . DC  B  2 44  ? 16.744 61.809  -7.908  1.00 123.69 ? -30 DC  J C2    1 
ATOM   3900  O  O2    . DC  B  2 44  ? 16.039 61.354  -7.001  1.00 129.77 ? -30 DC  J O2    1 
ATOM   3901  N  N3    . DC  B  2 44  ? 17.713 62.730  -7.679  1.00 113.80 ? -30 DC  J N3    1 
ATOM   3902  C  C4    . DC  B  2 44  ? 18.448 63.189  -8.695  1.00 108.90 ? -30 DC  J C4    1 
ATOM   3903  N  N4    . DC  B  2 44  ? 19.394 64.096  -8.426  1.00 101.78 ? -30 DC  J N4    1 
ATOM   3904  C  C5    . DC  B  2 44  ? 18.247 62.735  -10.034 1.00 114.57 ? -30 DC  J C5    1 
ATOM   3905  C  C6    . DC  B  2 44  ? 17.288 61.826  -10.244 1.00 122.27 ? -30 DC  J C6    1 
ATOM   3906  P  P     . DT  B  2 45  ? 11.361 59.683  -10.343 1.00 134.80 ? -29 DT  J P     1 
ATOM   3907  O  OP1   . DT  B  2 45  ? 10.334 58.680  -9.983  1.00 134.96 ? -29 DT  J OP1   1 
ATOM   3908  O  OP2   . DT  B  2 45  ? 11.357 60.286  -11.694 1.00 137.98 ? -29 DT  J OP2   1 
ATOM   3909  O  "O5'" . DT  B  2 45  ? 11.324 60.868  -9.270  1.00 132.83 ? -29 DT  J "O5'" 1 
ATOM   3910  C  "C5'" . DT  B  2 45  ? 11.522 60.578  -7.893  1.00 132.79 ? -29 DT  J "C5'" 1 
ATOM   3911  C  "C4'" . DT  B  2 45  ? 11.571 61.852  -7.070  1.00 129.60 ? -29 DT  J "C4'" 1 
ATOM   3912  O  "O4'" . DT  B  2 45  ? 12.852 62.518  -7.259  1.00 125.89 ? -29 DT  J "O4'" 1 
ATOM   3913  C  "C3'" . DT  B  2 45  ? 10.502 62.902  -7.414  1.00 128.55 ? -29 DT  J "C3'" 1 
ATOM   3914  O  "O3'" . DT  B  2 45  ? 10.016 63.488  -6.216  1.00 123.69 ? -29 DT  J "O3'" 1 
ATOM   3915  C  "C2'" . DT  B  2 45  ? 11.301 63.923  -8.221  1.00 127.08 ? -29 DT  J "C2'" 1 
ATOM   3916  C  "C1'" . DT  B  2 45  ? 12.593 63.886  -7.435  1.00 125.62 ? -29 DT  J "C1'" 1 
ATOM   3917  N  N1    . DT  B  2 45  ? 13.757 64.550  -8.089  1.00 127.16 ? -29 DT  J N1    1 
ATOM   3918  C  C2    . DT  B  2 45  ? 14.663 65.206  -7.295  1.00 123.77 ? -29 DT  J C2    1 
ATOM   3919  O  O2    . DT  B  2 45  ? 14.568 65.260  -6.082  1.00 121.34 ? -29 DT  J O2    1 
ATOM   3920  N  N3    . DT  B  2 45  ? 15.697 65.795  -7.965  1.00 122.59 ? -29 DT  J N3    1 
ATOM   3921  C  C4    . DT  B  2 45  ? 15.914 65.803  -9.326  1.00 125.97 ? -29 DT  J C4    1 
ATOM   3922  O  O4    . DT  B  2 45  ? 16.884 66.368  -9.827  1.00 124.76 ? -29 DT  J O4    1 
ATOM   3923  C  C5    . DT  B  2 45  ? 14.922 65.100  -10.113 1.00 130.38 ? -29 DT  J C5    1 
ATOM   3924  C  C7    . DT  B  2 45  ? 15.050 65.037  -11.605 1.00 130.51 ? -29 DT  J C7    1 
ATOM   3925  C  C6    . DT  B  2 45  ? 13.899 64.515  -9.463  1.00 131.43 ? -29 DT  J C6    1 
ATOM   3926  P  P     . DG  B  2 46  ? 8.531  63.182  -5.686  1.00 141.78 ? -28 DG  J P     1 
ATOM   3927  O  OP1   . DG  B  2 46  ? 8.379  61.713  -5.598  1.00 140.81 ? -28 DG  J OP1   1 
ATOM   3928  O  OP2   . DG  B  2 46  ? 7.582  63.970  -6.502  1.00 140.77 ? -28 DG  J OP2   1 
ATOM   3929  O  "O5'" . DG  B  2 46  ? 8.535  63.791  -4.206  1.00 140.96 ? -28 DG  J "O5'" 1 
ATOM   3930  C  "C5'" . DG  B  2 46  ? 9.352  63.199  -3.200  1.00 137.42 ? -28 DG  J "C5'" 1 
ATOM   3931  C  "C4'" . DG  B  2 46  ? 10.061 64.255  -2.363  1.00 128.96 ? -28 DG  J "C4'" 1 
ATOM   3932  O  "O4'" . DG  B  2 46  ? 11.162 64.833  -3.112  1.00 120.72 ? -28 DG  J "O4'" 1 
ATOM   3933  C  "C3'" . DG  B  2 46  ? 9.201  65.431  -1.908  1.00 134.24 ? -28 DG  J "C3'" 1 
ATOM   3934  O  "O3'" . DG  B  2 46  ? 9.592  65.799  -0.595  1.00 146.52 ? -28 DG  J "O3'" 1 
ATOM   3935  C  "C2'" . DG  B  2 46  ? 9.555  66.517  -2.926  1.00 126.35 ? -28 DG  J "C2'" 1 
ATOM   3936  C  "C1'" . DG  B  2 46  ? 11.035 66.241  -3.129  1.00 118.69 ? -28 DG  J "C1'" 1 
ATOM   3937  N  N9    . DG  B  2 46  ? 11.578 66.719  -4.396  1.00 112.41 ? -28 DG  J N9    1 
ATOM   3938  C  C8    . DG  B  2 46  ? 11.177 66.354  -5.657  1.00 114.70 ? -28 DG  J C8    1 
ATOM   3939  N  N7    . DG  B  2 46  ? 11.867 66.922  -6.606  1.00 113.68 ? -28 DG  J N7    1 
ATOM   3940  C  C5    . DG  B  2 46  ? 12.795 67.704  -5.933  1.00 107.83 ? -28 DG  J C5    1 
ATOM   3941  C  C6    . DG  B  2 46  ? 13.812 68.547  -6.437  1.00 102.60 ? -28 DG  J C6    1 
ATOM   3942  O  O6    . DG  B  2 46  ? 14.105 68.775  -7.619  1.00 98.89  ? -28 DG  J O6    1 
ATOM   3943  N  N1    . DG  B  2 46  ? 14.529 69.158  -5.413  1.00 99.67  ? -28 DG  J N1    1 
ATOM   3944  C  C2    . DG  B  2 46  ? 14.297 68.977  -4.071  1.00 99.51  ? -28 DG  J C2    1 
ATOM   3945  N  N2    . DG  B  2 46  ? 15.095 69.652  -3.230  1.00 86.58  ? -28 DG  J N2    1 
ATOM   3946  N  N3    . DG  B  2 46  ? 13.345 68.188  -3.583  1.00 100.03 ? -28 DG  J N3    1 
ATOM   3947  C  C4    . DG  B  2 46  ? 12.637 67.585  -4.570  1.00 106.66 ? -28 DG  J C4    1 
ATOM   3948  P  P     . DC  B  2 47  ? 8.591  66.599  0.372   1.00 148.66 ? -27 DC  J P     1 
ATOM   3949  O  OP1   . DC  B  2 47  ? 8.752  66.036  1.731   1.00 147.29 ? -27 DC  J OP1   1 
ATOM   3950  O  OP2   . DC  B  2 47  ? 7.253  66.616  -0.257  1.00 174.67 ? -27 DC  J OP2   1 
ATOM   3951  O  "O5'" . DC  B  2 47  ? 9.180  68.084  0.359   1.00 138.30 ? -27 DC  J "O5'" 1 
ATOM   3952  C  "C5'" . DC  B  2 47  ? 10.577 68.282  0.532   1.00 124.60 ? -27 DC  J "C5'" 1 
ATOM   3953  C  "C4'" . DC  B  2 47  ? 10.984 69.694  0.154   1.00 115.39 ? -27 DC  J "C4'" 1 
ATOM   3954  O  "O4'" . DC  B  2 47  ? 11.306 69.763  -1.265  1.00 113.98 ? -27 DC  J "O4'" 1 
ATOM   3955  C  "C3'" . DC  B  2 47  ? 9.920  70.771  0.387   1.00 112.92 ? -27 DC  J "C3'" 1 
ATOM   3956  O  "O3'" . DC  B  2 47  ? 10.564 71.954  0.813   1.00 110.67 ? -27 DC  J "O3'" 1 
ATOM   3957  C  "C2'" . DC  B  2 47  ? 9.345  70.950  -1.012  1.00 111.32 ? -27 DC  J "C2'" 1 
ATOM   3958  C  "C1'" . DC  B  2 47  ? 10.629 70.871  -1.810  1.00 110.52 ? -27 DC  J "C1'" 1 
ATOM   3959  N  N1    . DC  B  2 47  ? 10.452 70.674  -3.281  1.00 108.97 ? -27 DC  J N1    1 
ATOM   3960  C  C2    . DC  B  2 47  ? 11.405 71.205  -4.156  1.00 105.19 ? -27 DC  J C2    1 
ATOM   3961  O  O2    . DC  B  2 47  ? 12.369 71.819  -3.683  1.00 100.19 ? -27 DC  J O2    1 
ATOM   3962  N  N3    . DC  B  2 47  ? 11.246 71.029  -5.492  1.00 107.04 ? -27 DC  J N3    1 
ATOM   3963  C  C4    . DC  B  2 47  ? 10.188 70.358  -5.953  1.00 108.26 ? -27 DC  J C4    1 
ATOM   3964  N  N4    . DC  B  2 47  ? 10.070 70.208  -7.278  1.00 104.65 ? -27 DC  J N4    1 
ATOM   3965  C  C5    . DC  B  2 47  ? 9.203  69.812  -5.074  1.00 113.06 ? -27 DC  J C5    1 
ATOM   3966  C  C6    . DC  B  2 47  ? 9.372  69.993  -3.758  1.00 112.36 ? -27 DC  J C6    1 
ATOM   3967  P  P     . DT  B  2 48  ? 9.852  72.975  1.826   1.00 105.90 ? -26 DT  J P     1 
ATOM   3968  O  OP1   . DT  B  2 48  ? 9.684  72.286  3.125   1.00 102.39 ? -26 DT  J OP1   1 
ATOM   3969  O  OP2   . DT  B  2 48  ? 8.675  73.559  1.144   1.00 107.15 ? -26 DT  J OP2   1 
ATOM   3970  O  "O5'" . DT  B  2 48  ? 10.950 74.125  1.986   1.00 101.70 ? -26 DT  J "O5'" 1 
ATOM   3971  C  "C5'" . DT  B  2 48  ? 12.325 73.769  2.080   1.00 98.31  ? -26 DT  J "C5'" 1 
ATOM   3972  C  "C4'" . DT  B  2 48  ? 13.167 74.555  1.087   1.00 97.83  ? -26 DT  J "C4'" 1 
ATOM   3973  O  "O4'" . DT  B  2 48  ? 12.833 74.169  -0.272  1.00 100.45 ? -26 DT  J "O4'" 1 
ATOM   3974  C  "C3'" . DT  B  2 48  ? 13.004 76.075  1.155   1.00 96.38  ? -26 DT  J "C3'" 1 
ATOM   3975  O  "O3'" . DT  B  2 48  ? 14.279 76.683  1.254   1.00 91.50  ? -26 DT  J "O3'" 1 
ATOM   3976  C  "C2'" . DT  B  2 48  ? 12.308 76.430  -0.165  1.00 97.59  ? -26 DT  J "C2'" 1 
ATOM   3977  C  "C1'" . DT  B  2 48  ? 12.798 75.321  -1.079  1.00 98.26  ? -26 DT  J "C1'" 1 
ATOM   3978  N  N1    . DT  B  2 48  ? 11.900 75.050  -2.242  1.00 102.71 ? -26 DT  J N1    1 
ATOM   3979  C  C2    . DT  B  2 48  ? 12.365 75.260  -3.526  1.00 105.07 ? -26 DT  J C2    1 
ATOM   3980  O  O2    . DT  B  2 48  ? 13.483 75.676  -3.775  1.00 100.10 ? -26 DT  J O2    1 
ATOM   3981  N  N3    . DT  B  2 48  ? 11.457 74.969  -4.514  1.00 112.18 ? -26 DT  J N3    1 
ATOM   3982  C  C4    . DT  B  2 48  ? 10.168 74.495  -4.350  1.00 116.44 ? -26 DT  J C4    1 
ATOM   3983  O  O4    . DT  B  2 48  ? 9.426  74.262  -5.297  1.00 120.41 ? -26 DT  J O4    1 
ATOM   3984  C  C5    . DT  B  2 48  ? 9.751  74.294  -2.986  1.00 114.07 ? -26 DT  J C5    1 
ATOM   3985  C  C7    . DT  B  2 48  ? 8.372  73.788  -2.694  1.00 117.21 ? -26 DT  J C7    1 
ATOM   3986  C  C6    . DT  B  2 48  ? 10.626 74.575  -2.009  1.00 107.70 ? -26 DT  J C6    1 
ATOM   3987  P  P     . DC  B  2 49  ? 14.426 78.156  1.875   1.00 90.58  ? -25 DC  J P     1 
ATOM   3988  O  OP1   . DC  B  2 49  ? 15.700 78.200  2.629   1.00 88.49  ? -25 DC  J OP1   1 
ATOM   3989  O  OP2   . DC  B  2 49  ? 13.151 78.485  2.552   1.00 91.69  ? -25 DC  J OP2   1 
ATOM   3990  O  "O5'" . DC  B  2 49  ? 14.555 79.092  0.588   1.00 87.21  ? -25 DC  J "O5'" 1 
ATOM   3991  C  "C5'" . DC  B  2 49  ? 15.439 78.731  -0.463  1.00 81.96  ? -25 DC  J "C5'" 1 
ATOM   3992  C  "C4'" . DC  B  2 49  ? 15.095 79.481  -1.735  1.00 80.29  ? -25 DC  J "C4'" 1 
ATOM   3993  O  "O4'" . DC  B  2 49  ? 13.981 78.829  -2.408  1.00 89.26  ? -25 DC  J "O4'" 1 
ATOM   3994  C  "C3'" . DC  B  2 49  ? 14.662 80.939  -1.533  1.00 75.24  ? -25 DC  J "C3'" 1 
ATOM   3995  O  "O3'" . DC  B  2 49  ? 15.173 81.737  -2.588  1.00 75.11  ? -25 DC  J "O3'" 1 
ATOM   3996  C  "C2'" . DC  B  2 49  ? 13.144 80.838  -1.632  1.00 80.93  ? -25 DC  J "C2'" 1 
ATOM   3997  C  "C1'" . DC  B  2 49  ? 13.042 79.818  -2.747  1.00 90.83  ? -25 DC  J "C1'" 1 
ATOM   3998  N  N1    . DC  B  2 49  ? 11.695 79.201  -2.912  1.00 99.71  ? -25 DC  J N1    1 
ATOM   3999  C  C2    . DC  B  2 49  ? 11.308 78.758  -4.178  1.00 98.44  ? -25 DC  J C2    1 
ATOM   4000  O  O2    . DC  B  2 49  ? 12.104 78.878  -5.115  1.00 100.11 ? -25 DC  J O2    1 
ATOM   4001  N  N3    . DC  B  2 49  ? 10.081 78.203  -4.337  1.00 96.34  ? -25 DC  J N3    1 
ATOM   4002  C  C4    . DC  B  2 49  ? 9.261  78.094  -3.289  1.00 99.83  ? -25 DC  J C4    1 
ATOM   4003  N  N4    . DC  B  2 49  ? 8.059  77.541  -3.490  1.00 102.42 ? -25 DC  J N4    1 
ATOM   4004  C  C5    . DC  B  2 49  ? 9.637  78.549  -1.988  1.00 101.15 ? -25 DC  J C5    1 
ATOM   4005  C  C6    . DC  B  2 49  ? 10.850 79.095  -1.847  1.00 100.59 ? -25 DC  J C6    1 
ATOM   4006  P  P     . DC  B  2 50  ? 16.611 82.443  -2.477  1.00 70.09  ? -24 DC  J P     1 
ATOM   4007  O  OP1   . DC  B  2 50  ? 17.604 81.412  -2.104  1.00 67.85  ? -24 DC  J OP1   1 
ATOM   4008  O  OP2   . DC  B  2 50  ? 16.464 83.653  -1.639  1.00 71.83  ? -24 DC  J OP2   1 
ATOM   4009  O  "O5'" . DC  B  2 50  ? 16.906 82.903  -3.980  1.00 75.76  ? -24 DC  J "O5'" 1 
ATOM   4010  C  "C5'" . DC  B  2 50  ? 17.153 81.921  -4.980  1.00 75.60  ? -24 DC  J "C5'" 1 
ATOM   4011  C  "C4'" . DC  B  2 50  ? 16.372 82.220  -6.250  1.00 77.92  ? -24 DC  J "C4'" 1 
ATOM   4012  O  "O4'" . DC  B  2 50  ? 15.036 81.663  -6.160  1.00 84.01  ? -24 DC  J "O4'" 1 
ATOM   4013  C  "C3'" . DC  B  2 50  ? 16.196 83.707  -6.580  1.00 72.58  ? -24 DC  J "C3'" 1 
ATOM   4014  O  "O3'" . DC  B  2 50  ? 16.671 83.957  -7.894  1.00 67.73  ? -24 DC  J "O3'" 1 
ATOM   4015  C  "C2'" . DC  B  2 50  ? 14.681 83.932  -6.471  1.00 76.30  ? -24 DC  J "C2'" 1 
ATOM   4016  C  "C1'" . DC  B  2 50  ? 14.135 82.547  -6.775  1.00 82.04  ? -24 DC  J "C1'" 1 
ATOM   4017  N  N1    . DC  B  2 50  ? 12.774 82.296  -6.211  1.00 81.58  ? -24 DC  J N1    1 
ATOM   4018  C  C2    . DC  B  2 50  ? 11.753 81.788  -7.033  1.00 82.76  ? -24 DC  J C2    1 
ATOM   4019  O  O2    . DC  B  2 50  ? 11.991 81.563  -8.226  1.00 77.34  ? -24 DC  J O2    1 
ATOM   4020  N  N3    . DC  B  2 50  ? 10.527 81.561  -6.490  1.00 91.98  ? -24 DC  J N3    1 
ATOM   4021  C  C4    . DC  B  2 50  ? 10.314 81.815  -5.197  1.00 91.67  ? -24 DC  J C4    1 
ATOM   4022  N  N4    . DC  B  2 50  ? 9.094  81.579  -4.701  1.00 93.75  ? -24 DC  J N4    1 
ATOM   4023  C  C5    . DC  B  2 50  ? 11.340 82.329  -4.352  1.00 84.68  ? -24 DC  J C5    1 
ATOM   4024  C  C6    . DC  B  2 50  ? 12.540 82.549  -4.894  1.00 77.94  ? -24 DC  J C6    1 
ATOM   4025  P  P     . DA  B  2 51  ? 16.975 85.455  -8.389  1.00 60.69  ? -23 DA  J P     1 
ATOM   4026  O  OP1   . DA  B  2 51  ? 18.382 85.494  -8.845  1.00 55.24  ? -23 DA  J OP1   1 
ATOM   4027  O  OP2   . DA  B  2 51  ? 16.526 86.402  -7.345  1.00 59.65  ? -23 DA  J OP2   1 
ATOM   4028  O  "O5'" . DA  B  2 51  ? 16.017 85.620  -9.656  1.00 68.43  ? -23 DA  J "O5'" 1 
ATOM   4029  C  "C5'" . DA  B  2 51  ? 15.953 84.583  -10.626 1.00 64.83  ? -23 DA  J "C5'" 1 
ATOM   4030  C  "C4'" . DA  B  2 51  ? 14.713 84.722  -11.488 1.00 68.53  ? -23 DA  J "C4'" 1 
ATOM   4031  O  "O4'" . DA  B  2 51  ? 13.542 84.301  -10.740 1.00 71.24  ? -23 DA  J "O4'" 1 
ATOM   4032  C  "C3'" . DA  B  2 51  ? 14.427 86.136  -11.981 1.00 69.17  ? -23 DA  J "C3'" 1 
ATOM   4033  O  "O3'" . DA  B  2 51  ? 14.034 86.092  -13.342 1.00 79.60  ? -23 DA  J "O3'" 1 
ATOM   4034  C  "C2'" . DA  B  2 51  ? 13.294 86.614  -11.069 1.00 68.21  ? -23 DA  J "C2'" 1 
ATOM   4035  C  "C1'" . DA  B  2 51  ? 12.563 85.316  -10.752 1.00 75.99  ? -23 DA  J "C1'" 1 
ATOM   4036  N  N9    . DA  B  2 51  ? 11.910 85.318  -9.445  1.00 88.48  ? -23 DA  J N9    1 
ATOM   4037  C  C8    . DA  B  2 51  ? 12.454 85.719  -8.256  1.00 87.58  ? -23 DA  J C8    1 
ATOM   4038  N  N7    . DA  B  2 51  ? 11.641 85.598  -7.233  1.00 89.94  ? -23 DA  J N7    1 
ATOM   4039  C  C5    . DA  B  2 51  ? 10.486 85.074  -7.786  1.00 92.55  ? -23 DA  J C5    1 
ATOM   4040  C  C6    . DA  B  2 51  ? 9.245  84.712  -7.225  1.00 100.76 ? -23 DA  J C6    1 
ATOM   4041  N  N6    . DA  B  2 51  ? 8.962  84.835  -5.923  1.00 102.06 ? -23 DA  J N6    1 
ATOM   4042  N  N1    . DA  B  2 51  ? 8.303  84.218  -8.056  1.00 108.05 ? -23 DA  J N1    1 
ATOM   4043  C  C2    . DA  B  2 51  ? 8.591  84.097  -9.358  1.00 105.90 ? -23 DA  J C2    1 
ATOM   4044  N  N3    . DA  B  2 51  ? 9.719  84.401  -10.000 1.00 95.35  ? -23 DA  J N3    1 
ATOM   4045  C  C4    . DA  B  2 51  ? 10.635 84.890  -9.149  1.00 90.80  ? -23 DA  J C4    1 
ATOM   4046  P  P     . DT  B  2 52  ? 13.873 87.447  -14.188 1.00 89.94  ? -22 DT  J P     1 
ATOM   4047  O  OP1   . DT  B  2 52  ? 14.364 87.186  -15.560 1.00 90.85  ? -22 DT  J OP1   1 
ATOM   4048  O  OP2   . DT  B  2 52  ? 14.457 88.555  -13.399 1.00 83.41  ? -22 DT  J OP2   1 
ATOM   4049  O  "O5'" . DT  B  2 52  ? 12.293 87.657  -14.232 1.00 94.90  ? -22 DT  J "O5'" 1 
ATOM   4050  C  "C5'" . DT  B  2 52  ? 11.435 86.526  -14.222 1.00 97.12  ? -22 DT  J "C5'" 1 
ATOM   4051  C  "C4'" . DT  B  2 52  ? 10.014 86.942  -13.912 1.00 99.29  ? -22 DT  J "C4'" 1 
ATOM   4052  O  "O4'" . DT  B  2 52  ? 9.731  86.724  -12.512 1.00 98.43  ? -22 DT  J "O4'" 1 
ATOM   4053  C  "C3'" . DT  B  2 52  ? 9.707  88.419  -14.183 1.00 104.88 ? -22 DT  J "C3'" 1 
ATOM   4054  O  "O3'" . DT  B  2 52  ? 8.711  88.520  -15.186 1.00 117.14 ? -22 DT  J "O3'" 1 
ATOM   4055  C  "C2'" . DT  B  2 52  ? 9.217  88.963  -12.830 1.00 104.01 ? -22 DT  J "C2'" 1 
ATOM   4056  C  "C1'" . DT  B  2 52  ? 8.809  87.694  -12.100 1.00 101.49 ? -22 DT  J "C1'" 1 
ATOM   4057  N  N1    . DT  B  2 52  ? 8.858  87.811  -10.614 1.00 96.40  ? -22 DT  J N1    1 
ATOM   4058  C  C2    . DT  B  2 52  ? 7.754  87.449  -9.882  1.00 100.23 ? -22 DT  J C2    1 
ATOM   4059  O  O2    . DT  B  2 52  ? 6.728  87.030  -10.386 1.00 106.79 ? -22 DT  J O2    1 
ATOM   4060  N  N3    . DT  B  2 52  ? 7.890  87.593  -8.529  1.00 98.39  ? -22 DT  J N3    1 
ATOM   4061  C  C4    . DT  B  2 52  ? 8.999  88.056  -7.845  1.00 93.20  ? -22 DT  J C4    1 
ATOM   4062  O  O4    . DT  B  2 52  ? 9.021  88.148  -6.621  1.00 95.65  ? -22 DT  J O4    1 
ATOM   4063  C  C5    . DT  B  2 52  ? 10.125 88.423  -8.672  1.00 86.62  ? -22 DT  J C5    1 
ATOM   4064  C  C7    . DT  B  2 52  ? 11.385 88.942  -8.044  1.00 78.21  ? -22 DT  J C7    1 
ATOM   4065  C  C6    . DT  B  2 52  ? 10.001 88.285  -10.002 1.00 89.83  ? -22 DT  J C6    1 
ATOM   4066  P  P     . DC  B  2 53  ? 8.381  89.933  -15.875 1.00 102.80 ? -21 DC  J P     1 
ATOM   4067  O  OP1   . DC  B  2 53  ? 8.460  89.739  -17.339 1.00 101.85 ? -21 DC  J OP1   1 
ATOM   4068  O  OP2   . DC  B  2 53  ? 9.199  90.983  -15.226 1.00 101.61 ? -21 DC  J OP2   1 
ATOM   4069  O  "O5'" . DC  B  2 53  ? 6.860  90.183  -15.472 1.00 106.95 ? -21 DC  J "O5'" 1 
ATOM   4070  C  "C5'" . DC  B  2 53  ? 5.982  89.077  -15.342 1.00 113.71 ? -21 DC  J "C5'" 1 
ATOM   4071  C  "C4'" . DC  B  2 53  ? 4.832  89.417  -14.417 1.00 121.26 ? -21 DC  J "C4'" 1 
ATOM   4072  O  "O4'" . DC  B  2 53  ? 5.238  89.243  -13.042 1.00 122.77 ? -21 DC  J "O4'" 1 
ATOM   4073  C  "C3'" . DC  B  2 53  ? 4.321  90.853  -14.534 1.00 123.62 ? -21 DC  J "C3'" 1 
ATOM   4074  O  "O3'" . DC  B  2 53  ? 2.992  90.846  -15.032 1.00 131.08 ? -21 DC  J "O3'" 1 
ATOM   4075  C  "C2'" . DC  B  2 53  ? 4.401  91.415  -13.101 1.00 122.14 ? -21 DC  J "C2'" 1 
ATOM   4076  C  "C1'" . DC  B  2 53  ? 4.537  90.160  -12.248 1.00 122.88 ? -21 DC  J "C1'" 1 
ATOM   4077  N  N1    . DC  B  2 53  ? 5.308  90.371  -10.984 1.00 120.36 ? -21 DC  J N1    1 
ATOM   4078  C  C2    . DC  B  2 53  ? 4.683  90.172  -9.746  1.00 126.92 ? -21 DC  J C2    1 
ATOM   4079  O  O2    . DC  B  2 53  ? 3.497  89.827  -9.723  1.00 133.72 ? -21 DC  J O2    1 
ATOM   4080  N  N3    . DC  B  2 53  ? 5.402  90.366  -8.609  1.00 125.84 ? -21 DC  J N3    1 
ATOM   4081  C  C4    . DC  B  2 53  ? 6.682  90.738  -8.684  1.00 121.86 ? -21 DC  J C4    1 
ATOM   4082  N  N4    . DC  B  2 53  ? 7.354  90.917  -7.540  1.00 120.64 ? -21 DC  J N4    1 
ATOM   4083  C  C5    . DC  B  2 53  ? 7.333  90.943  -9.937  1.00 117.54 ? -21 DC  J C5    1 
ATOM   4084  C  C6    . DC  B  2 53  ? 6.616  90.749  -11.048 1.00 116.35 ? -21 DC  J C6    1 
ATOM   4085  P  P     . DA  B  2 54  ? 2.274  92.221  -15.445 1.00 138.37 ? -20 DA  J P     1 
ATOM   4086  O  OP1   . DA  B  2 54  ? 1.220  91.905  -16.434 1.00 142.46 ? -20 DA  J OP1   1 
ATOM   4087  O  OP2   . DA  B  2 54  ? 3.329  93.205  -15.778 1.00 133.11 ? -20 DA  J OP2   1 
ATOM   4088  O  "O5'" . DA  B  2 54  ? 1.577  92.691  -14.092 1.00 137.51 ? -20 DA  J "O5'" 1 
ATOM   4089  C  "C5'" . DA  B  2 54  ? 0.834  91.759  -13.321 1.00 137.06 ? -20 DA  J "C5'" 1 
ATOM   4090  C  "C4'" . DA  B  2 54  ? -0.021 92.483  -12.305 1.00 137.33 ? -20 DA  J "C4'" 1 
ATOM   4091  O  "O4'" . DA  B  2 54  ? 0.602  92.403  -10.997 1.00 132.93 ? -20 DA  J "O4'" 1 
ATOM   4092  C  "C3'" . DA  B  2 54  ? -0.217 93.963  -12.594 1.00 137.69 ? -20 DA  J "C3'" 1 
ATOM   4093  O  "O3'" . DA  B  2 54  ? -1.524 94.354  -12.227 1.00 139.92 ? -20 DA  J "O3'" 1 
ATOM   4094  C  "C2'" . DA  B  2 54  ? 0.848  94.631  -11.725 1.00 132.70 ? -20 DA  J "C2'" 1 
ATOM   4095  C  "C1'" . DA  B  2 54  ? 0.913  93.697  -10.522 1.00 129.95 ? -20 DA  J "C1'" 1 
ATOM   4096  N  N9    . DA  B  2 54  ? 2.232  93.643  -9.891  1.00 120.66 ? -20 DA  J N9    1 
ATOM   4097  C  C8    . DA  B  2 54  ? 3.448  93.643  -10.517 1.00 115.60 ? -20 DA  J C8    1 
ATOM   4098  N  N7    . DA  B  2 54  ? 4.468  93.577  -9.692  1.00 113.03 ? -20 DA  J N7    1 
ATOM   4099  C  C5    . DA  B  2 54  ? 3.880  93.525  -8.439  1.00 113.11 ? -20 DA  J C5    1 
ATOM   4100  C  C6    . DA  B  2 54  ? 4.416  93.444  -7.135  1.00 107.57 ? -20 DA  J C6    1 
ATOM   4101  N  N6    . DA  B  2 54  ? 5.729  93.401  -6.875  1.00 95.50  ? -20 DA  J N6    1 
ATOM   4102  N  N1    . DA  B  2 54  ? 3.547  93.412  -6.104  1.00 113.35 ? -20 DA  J N1    1 
ATOM   4103  C  C2    . DA  B  2 54  ? 2.235  93.456  -6.365  1.00 115.74 ? -20 DA  J C2    1 
ATOM   4104  N  N3    . DA  B  2 54  ? 1.615  93.531  -7.539  1.00 116.19 ? -20 DA  J N3    1 
ATOM   4105  C  C4    . DA  B  2 54  ? 2.501  93.562  -8.545  1.00 116.32 ? -20 DA  J C4    1 
ATOM   4106  P  P     . DA  B  2 55  ? -2.188 95.662  -12.879 1.00 147.66 ? -19 DA  J P     1 
ATOM   4107  O  OP1   . DA  B  2 55  ? -3.461 95.255  -13.514 1.00 148.78 ? -19 DA  J OP1   1 
ATOM   4108  O  OP2   . DA  B  2 55  ? -1.152 96.347  -13.682 1.00 142.41 ? -19 DA  J OP2   1 
ATOM   4109  O  "O5'" . DA  B  2 55  ? -2.507 96.573  -11.609 1.00 142.65 ? -19 DA  J "O5'" 1 
ATOM   4110  C  "C5'" . DA  B  2 55  ? -2.991 95.966  -10.421 1.00 135.39 ? -19 DA  J "C5'" 1 
ATOM   4111  C  "C4'" . DA  B  2 55  ? -2.571 96.757  -9.198  1.00 125.70 ? -19 DA  J "C4'" 1 
ATOM   4112  O  "O4'" . DA  B  2 55  ? -1.239 96.360  -8.779  1.00 119.14 ? -19 DA  J "O4'" 1 
ATOM   4113  C  "C3'" . DA  B  2 55  ? -2.522 98.276  -9.393  1.00 124.56 ? -19 DA  J "C3'" 1 
ATOM   4114  O  "O3'" . DA  B  2 55  ? -3.230 98.904  -8.343  1.00 131.31 ? -19 DA  J "O3'" 1 
ATOM   4115  C  "C2'" . DA  B  2 55  ? -1.024 98.595  -9.329  1.00 118.42 ? -19 DA  J "C2'" 1 
ATOM   4116  C  "C1'" . DA  B  2 55  ? -0.537 97.512  -8.387  1.00 114.41 ? -19 DA  J "C1'" 1 
ATOM   4117  N  N9    . DA  B  2 55  ? 0.898  97.248  -8.470  1.00 103.62 ? -19 DA  J N9    1 
ATOM   4118  C  C8    . DA  B  2 55  ? 1.638  97.051  -9.600  1.00 101.58 ? -19 DA  J C8    1 
ATOM   4119  N  N7    . DA  B  2 55  ? 2.912  96.829  -9.368  1.00 98.50  ? -19 DA  J N7    1 
ATOM   4120  C  C5    . DA  B  2 55  ? 3.013  96.888  -7.989  1.00 96.82  ? -19 DA  J C5    1 
ATOM   4121  C  C6    . DA  B  2 55  ? 4.104  96.738  -7.108  1.00 89.93  ? -19 DA  J C6    1 
ATOM   4122  N  N6    . DA  B  2 55  ? 5.354  96.487  -7.514  1.00 86.51  ? -19 DA  J N6    1 
ATOM   4123  N  N1    . DA  B  2 55  ? 3.860  96.857  -5.787  1.00 101.89 ? -19 DA  J N1    1 
ATOM   4124  C  C2    . DA  B  2 55  ? 2.610  97.108  -5.382  1.00 103.74 ? -19 DA  J C2    1 
ATOM   4125  N  N3    . DA  B  2 55  ? 1.508  97.268  -6.112  1.00 102.32 ? -19 DA  J N3    1 
ATOM   4126  C  C4    . DA  B  2 55  ? 1.781  97.145  -7.420  1.00 99.51  ? -19 DA  J C4    1 
ATOM   4127  P  P     . DA  B  2 56  ? -3.805 100.393 -8.514  1.00 134.76 ? -18 DA  J P     1 
ATOM   4128  O  OP1   . DA  B  2 56  ? -5.169 100.289 -9.080  1.00 134.24 ? -18 DA  J OP1   1 
ATOM   4129  O  OP2   . DA  B  2 56  ? -2.783 101.213 -9.202  1.00 135.14 ? -18 DA  J OP2   1 
ATOM   4130  O  "O5'" . DA  B  2 56  ? -3.902 100.914 -7.008  1.00 137.13 ? -18 DA  J "O5'" 1 
ATOM   4131  C  "C5'" . DA  B  2 56  ? -3.616 100.021 -5.938  1.00 135.09 ? -18 DA  J "C5'" 1 
ATOM   4132  C  "C4'" . DA  B  2 56  ? -2.712 100.678 -4.913  1.00 129.12 ? -18 DA  J "C4'" 1 
ATOM   4133  O  "O4'" . DA  B  2 56  ? -1.348 100.209 -5.080  1.00 124.04 ? -18 DA  J "O4'" 1 
ATOM   4134  C  "C3'" . DA  B  2 56  ? -2.653 102.202 -4.986  1.00 129.66 ? -18 DA  J "C3'" 1 
ATOM   4135  O  "O3'" . DA  B  2 56  ? -2.752 102.738 -3.680  1.00 133.90 ? -18 DA  J "O3'" 1 
ATOM   4136  C  "C2'" . DA  B  2 56  ? -1.283 102.478 -5.615  1.00 125.43 ? -18 DA  J "C2'" 1 
ATOM   4137  C  "C1'" . DA  B  2 56  ? -0.466 101.309 -5.091  1.00 118.85 ? -18 DA  J "C1'" 1 
ATOM   4138  N  N9    . DA  B  2 56  ? 0.683  100.957 -5.925  1.00 107.20 ? -18 DA  J N9    1 
ATOM   4139  C  C8    . DA  B  2 56  ? 0.681  100.721 -7.270  1.00 103.88 ? -18 DA  J C8    1 
ATOM   4140  N  N7    . DA  B  2 56  ? 1.858  100.404 -7.755  1.00 98.52  ? -18 DA  J N7    1 
ATOM   4141  C  C5    . DA  B  2 56  ? 2.692  100.427 -6.650  1.00 96.02  ? -18 DA  J C5    1 
ATOM   4142  C  C6    . DA  B  2 56  ? 4.072  100.180 -6.494  1.00 87.67  ? -18 DA  J C6    1 
ATOM   4143  N  N6    . DA  B  2 56  ? 4.880  99.847  -7.507  1.00 83.36  ? -18 DA  J N6    1 
ATOM   4144  N  N1    . DA  B  2 56  ? 4.591  100.288 -5.253  1.00 83.56  ? -18 DA  J N1    1 
ATOM   4145  C  C2    . DA  B  2 56  ? 3.780  100.621 -4.241  1.00 85.68  ? -18 DA  J C2    1 
ATOM   4146  N  N3    . DA  B  2 56  ? 2.471  100.877 -4.264  1.00 98.17  ? -18 DA  J N3    1 
ATOM   4147  C  C4    . DA  B  2 56  ? 1.984  100.761 -5.510  1.00 102.48 ? -18 DA  J C4    1 
ATOM   4148  P  P     . DA  B  2 57  ? -3.110 104.287 -3.461  1.00 122.46 ? -17 DA  J P     1 
ATOM   4149  O  OP1   . DA  B  2 57  ? -4.154 104.364 -2.415  1.00 126.99 ? -17 DA  J OP1   1 
ATOM   4150  O  OP2   . DA  B  2 57  ? -3.358 104.887 -4.790  1.00 121.31 ? -17 DA  J OP2   1 
ATOM   4151  O  "O5'" . DA  B  2 57  ? -1.753 104.899 -2.882  1.00 123.02 ? -17 DA  J "O5'" 1 
ATOM   4152  C  "C5'" . DA  B  2 57  ? -1.074 104.232 -1.823  1.00 123.83 ? -17 DA  J "C5'" 1 
ATOM   4153  C  "C4'" . DA  B  2 57  ? 0.288  104.855 -1.568  1.00 121.02 ? -17 DA  J "C4'" 1 
ATOM   4154  O  "O4'" . DA  B  2 57  ? 1.271  104.287 -2.478  1.00 118.22 ? -17 DA  J "O4'" 1 
ATOM   4155  C  "C3'" . DA  B  2 57  ? 0.360  106.368 -1.776  1.00 120.93 ? -17 DA  J "C3'" 1 
ATOM   4156  O  "O3'" . DA  B  2 57  ? 1.258  106.930 -0.834  1.00 115.01 ? -17 DA  J "O3'" 1 
ATOM   4157  C  "C2'" . DA  B  2 57  ? 0.925  106.468 -3.188  1.00 120.44 ? -17 DA  J "C2'" 1 
ATOM   4158  C  "C1'" . DA  B  2 57  ? 1.936  105.338 -3.144  1.00 115.10 ? -17 DA  J "C1'" 1 
ATOM   4159  N  N9    . DA  B  2 57  ? 2.373  104.863 -4.453  1.00 110.45 ? -17 DA  J N9    1 
ATOM   4160  C  C8    . DA  B  2 57  ? 1.623  104.758 -5.592  1.00 111.85 ? -17 DA  J C8    1 
ATOM   4161  N  N7    . DA  B  2 57  ? 2.290  104.288 -6.621  1.00 110.06 ? -17 DA  J N7    1 
ATOM   4162  C  C5    . DA  B  2 57  ? 3.564  104.067 -6.120  1.00 106.11 ? -17 DA  J C5    1 
ATOM   4163  C  C6    . DA  B  2 57  ? 4.747  103.571 -6.707  1.00 102.95 ? -17 DA  J C6    1 
ATOM   4164  N  N6    . DA  B  2 57  ? 4.833  103.196 -7.987  1.00 103.24 ? -17 DA  J N6    1 
ATOM   4165  N  N1    . DA  B  2 57  ? 5.843  103.477 -5.923  1.00 101.07 ? -17 DA  J N1    1 
ATOM   4166  C  C2    . DA  B  2 57  ? 5.753  103.851 -4.643  1.00 98.59  ? -17 DA  J C2    1 
ATOM   4167  N  N3    . DA  B  2 57  ? 4.702  104.332 -3.982  1.00 101.01 ? -17 DA  J N3    1 
ATOM   4168  C  C4    . DA  B  2 57  ? 3.630  104.414 -4.785  1.00 105.34 ? -17 DA  J C4    1 
ATOM   4169  P  P     . DG  B  2 58  ? 0.712  107.720 0.454   1.00 120.44 ? -16 DG  J P     1 
ATOM   4170  O  OP1   . DG  B  2 58  ? -0.129 106.788 1.239   1.00 121.51 ? -16 DG  J OP1   1 
ATOM   4171  O  OP2   . DG  B  2 58  ? 0.152  109.008 -0.011  1.00 119.92 ? -16 DG  J OP2   1 
ATOM   4172  O  "O5'" . DG  B  2 58  ? 2.043  108.035 1.280   1.00 109.98 ? -16 DG  J "O5'" 1 
ATOM   4173  C  "C5'" . DG  B  2 58  ? 2.977  106.994 1.535   1.00 104.46 ? -16 DG  J "C5'" 1 
ATOM   4174  C  "C4'" . DG  B  2 58  ? 4.348  107.341 0.978   1.00 103.87 ? -16 DG  J "C4'" 1 
ATOM   4175  O  "O4'" . DG  B  2 58  ? 4.402  107.053 -0.448  1.00 110.51 ? -16 DG  J "O4'" 1 
ATOM   4176  C  "C3'" . DG  B  2 58  ? 4.765  108.809 1.123   1.00 98.51  ? -16 DG  J "C3'" 1 
ATOM   4177  O  "O3'" . DG  B  2 58  ? 6.129  108.866 1.482   1.00 92.18  ? -16 DG  J "O3'" 1 
ATOM   4178  C  "C2'" . DG  B  2 58  ? 4.559  109.353 -0.290  1.00 102.03 ? -16 DG  J "C2'" 1 
ATOM   4179  C  "C1'" . DG  B  2 58  ? 5.006  108.149 -1.096  1.00 104.74 ? -16 DG  J "C1'" 1 
ATOM   4180  N  N9    . DG  B  2 58  ? 4.595  108.165 -2.499  1.00 98.52  ? -16 DG  J N9    1 
ATOM   4181  C  C8    . DG  B  2 58  ? 3.413  108.632 -3.014  1.00 99.50  ? -16 DG  J C8    1 
ATOM   4182  N  N7    . DG  B  2 58  ? 3.327  108.509 -4.311  1.00 101.86 ? -16 DG  J N7    1 
ATOM   4183  C  C5    . DG  B  2 58  ? 4.533  107.924 -4.679  1.00 97.63  ? -16 DG  J C5    1 
ATOM   4184  C  C6    . DG  B  2 58  ? 5.017  107.549 -5.959  1.00 97.03  ? -16 DG  J C6    1 
ATOM   4185  O  O6    . DG  B  2 58  ? 4.456  107.665 -7.058  1.00 97.93  ? -16 DG  J O6    1 
ATOM   4186  N  N1    . DG  B  2 58  ? 6.290  106.988 -5.885  1.00 90.39  ? -16 DG  J N1    1 
ATOM   4187  C  C2    . DG  B  2 58  ? 7.005  106.812 -4.724  1.00 86.01  ? -16 DG  J C2    1 
ATOM   4188  N  N2    . DG  B  2 58  ? 8.214  106.247 -4.842  1.00 87.24  ? -16 DG  J N2    1 
ATOM   4189  N  N3    . DG  B  2 58  ? 6.561  107.157 -3.521  1.00 87.44  ? -16 DG  J N3    1 
ATOM   4190  C  C4    . DG  B  2 58  ? 5.324  107.706 -3.575  1.00 93.15  ? -16 DG  J C4    1 
ATOM   4191  P  P     . DG  B  2 59  ? 6.577  109.253 2.974   1.00 85.19  ? -15 DG  J P     1 
ATOM   4192  O  OP1   . DG  B  2 59  ? 5.697  108.527 3.915   1.00 95.46  ? -15 DG  J OP1   1 
ATOM   4193  O  OP2   . DG  B  2 59  ? 6.675  110.727 3.046   1.00 84.85  ? -15 DG  J OP2   1 
ATOM   4194  O  "O5'" . DG  B  2 59  ? 8.059  108.659 3.074   1.00 77.15  ? -15 DG  J "O5'" 1 
ATOM   4195  C  "C5'" . DG  B  2 59  ? 8.289  107.281 2.797   1.00 76.97  ? -15 DG  J "C5'" 1 
ATOM   4196  C  "C4'" . DG  B  2 59  ? 9.588  107.073 2.027   1.00 77.30  ? -15 DG  J "C4'" 1 
ATOM   4197  O  "O4'" . DG  B  2 59  ? 9.379  107.308 0.611   1.00 82.02  ? -15 DG  J "O4'" 1 
ATOM   4198  C  "C3'" . DG  B  2 59  ? 10.747 107.970 2.428   1.00 73.11  ? -15 DG  J "C3'" 1 
ATOM   4199  O  "O3'" . DG  B  2 59  ? 11.965 107.250 2.267   1.00 74.40  ? -15 DG  J "O3'" 1 
ATOM   4200  C  "C2'" . DG  B  2 59  ? 10.631 109.136 1.442   1.00 74.61  ? -15 DG  J "C2'" 1 
ATOM   4201  C  "C1'" . DG  B  2 59  ? 10.101 108.452 0.185   1.00 77.06  ? -15 DG  J "C1'" 1 
ATOM   4202  N  N9    . DG  B  2 59  ? 9.183  109.273 -0.600  1.00 78.68  ? -15 DG  J N9    1 
ATOM   4203  C  C8    . DG  B  2 59  ? 8.196  110.097 -0.122  1.00 80.20  ? -15 DG  J C8    1 
ATOM   4204  N  N7    . DG  B  2 59  ? 7.507  110.682 -1.061  1.00 79.73  ? -15 DG  J N7    1 
ATOM   4205  C  C5    . DG  B  2 59  ? 8.066  110.209 -2.239  1.00 81.64  ? -15 DG  J C5    1 
ATOM   4206  C  C6    . DG  B  2 59  ? 7.733  110.494 -3.584  1.00 88.32  ? -15 DG  J C6    1 
ATOM   4207  O  O6    . DG  B  2 59  ? 6.848  111.245 -4.013  1.00 92.67  ? -15 DG  J O6    1 
ATOM   4208  N  N1    . DG  B  2 59  ? 8.550  109.802 -4.474  1.00 89.43  ? -15 DG  J N1    1 
ATOM   4209  C  C2    . DG  B  2 59  ? 9.560  108.942 -4.110  1.00 90.80  ? -15 DG  J C2    1 
ATOM   4210  N  N2    . DG  B  2 59  ? 10.244 108.363 -5.109  1.00 84.59  ? -15 DG  J N2    1 
ATOM   4211  N  N3    . DG  B  2 59  ? 9.880  108.667 -2.851  1.00 90.12  ? -15 DG  J N3    1 
ATOM   4212  C  C4    . DG  B  2 59  ? 9.094  109.334 -1.973  1.00 82.07  ? -15 DG  J C4    1 
ATOM   4213  P  P     . DC  B  2 60  ? 13.386 107.960 2.509   1.00 82.85  ? -14 DC  J P     1 
ATOM   4214  O  OP1   . DC  B  2 60  ? 14.349 106.904 2.899   1.00 77.37  ? -14 DC  J OP1   1 
ATOM   4215  O  OP2   . DC  B  2 60  ? 13.182 109.128 3.394   1.00 91.10  ? -14 DC  J OP2   1 
ATOM   4216  O  "O5'" . DC  B  2 60  ? 13.787 108.489 1.056   1.00 75.94  ? -14 DC  J "O5'" 1 
ATOM   4217  C  "C5'" . DC  B  2 60  ? 13.750 107.596 -0.050  1.00 67.12  ? -14 DC  J "C5'" 1 
ATOM   4218  C  "C4'" . DC  B  2 60  ? 14.131 108.304 -1.334  1.00 60.48  ? -14 DC  J "C4'" 1 
ATOM   4219  O  "O4'" . DC  B  2 60  ? 13.026 109.131 -1.790  1.00 62.79  ? -14 DC  J "O4'" 1 
ATOM   4220  C  "C3'" . DC  B  2 60  ? 15.335 109.242 -1.231  1.00 51.32  ? -14 DC  J "C3'" 1 
ATOM   4221  O  "O3'" . DC  B  2 60  ? 16.073 109.159 -2.426  1.00 50.74  ? -14 DC  J "O3'" 1 
ATOM   4222  C  "C2'" . DC  B  2 60  ? 14.671 110.609 -1.102  1.00 55.31  ? -14 DC  J "C2'" 1 
ATOM   4223  C  "C1'" . DC  B  2 60  ? 13.518 110.421 -2.067  1.00 59.18  ? -14 DC  J "C1'" 1 
ATOM   4224  N  N1    . DC  B  2 60  ? 12.415 111.402 -1.915  1.00 65.95  ? -14 DC  J N1    1 
ATOM   4225  C  C2    . DC  B  2 60  ? 11.703 111.798 -3.045  1.00 70.50  ? -14 DC  J C2    1 
ATOM   4226  O  O2    . DC  B  2 60  ? 12.019 111.320 -4.139  1.00 76.25  ? -14 DC  J O2    1 
ATOM   4227  N  N3    . DC  B  2 60  ? 10.695 112.693 -2.908  1.00 75.70  ? -14 DC  J N3    1 
ATOM   4228  C  C4    . DC  B  2 60  ? 10.397 113.179 -1.702  1.00 81.07  ? -14 DC  J C4    1 
ATOM   4229  N  N4    . DC  B  2 60  ? 9.394  114.059 -1.611  1.00 90.05  ? -14 DC  J N4    1 
ATOM   4230  C  C5    . DC  B  2 60  ? 11.115 112.785 -0.534  1.00 71.92  ? -14 DC  J C5    1 
ATOM   4231  C  C6    . DC  B  2 60  ? 12.109 111.905 -0.687  1.00 67.43  ? -14 DC  J C6    1 
ATOM   4232  P  P     . DA  B  2 61  ? 17.677 109.180 -2.411  1.00 55.24  ? -13 DA  J P     1 
ATOM   4233  O  OP1   . DA  B  2 61  ? 18.139 107.814 -2.079  1.00 56.54  ? -13 DA  J OP1   1 
ATOM   4234  O  OP2   . DA  B  2 61  ? 18.114 110.324 -1.581  1.00 55.01  ? -13 DA  J OP2   1 
ATOM   4235  O  "O5'" . DA  B  2 61  ? 18.042 109.489 -3.936  1.00 61.70  ? -13 DA  J "O5'" 1 
ATOM   4236  C  "C5'" . DA  B  2 61  ? 17.531 108.643 -4.960  1.00 65.11  ? -13 DA  J "C5'" 1 
ATOM   4237  C  "C4'" . DA  B  2 61  ? 17.054 109.445 -6.161  1.00 69.25  ? -13 DA  J "C4'" 1 
ATOM   4238  O  "O4'" . DA  B  2 61  ? 15.879 110.222 -5.810  1.00 72.37  ? -13 DA  J "O4'" 1 
ATOM   4239  C  "C3'" . DA  B  2 61  ? 18.071 110.427 -6.740  1.00 65.54  ? -13 DA  J "C3'" 1 
ATOM   4240  O  "O3'" . DA  B  2 61  ? 18.121 110.268 -8.145  1.00 64.52  ? -13 DA  J "O3'" 1 
ATOM   4241  C  "C2'" . DA  B  2 61  ? 17.520 111.800 -6.343  1.00 66.09  ? -13 DA  J "C2'" 1 
ATOM   4242  C  "C1'" . DA  B  2 61  ? 16.021 111.542 -6.281  1.00 68.12  ? -13 DA  J "C1'" 1 
ATOM   4243  N  N9    . DA  B  2 61  ? 15.304 112.421 -5.358  1.00 67.88  ? -13 DA  J N9    1 
ATOM   4244  C  C8    . DA  B  2 61  ? 15.496 112.525 -4.009  1.00 72.41  ? -13 DA  J C8    1 
ATOM   4245  N  N7    . DA  B  2 61  ? 14.697 113.384 -3.423  1.00 77.80  ? -13 DA  J N7    1 
ATOM   4246  C  C5    . DA  B  2 61  ? 13.918 113.875 -4.458  1.00 78.51  ? -13 DA  J C5    1 
ATOM   4247  C  C6    . DA  B  2 61  ? 12.874 114.822 -4.494  1.00 84.77  ? -13 DA  J C6    1 
ATOM   4248  N  N6    . DA  B  2 61  ? 12.425 115.463 -3.409  1.00 78.02  ? -13 DA  J N6    1 
ATOM   4249  N  N1    . DA  B  2 61  ? 12.307 115.084 -5.692  1.00 86.03  ? -13 DA  J N1    1 
ATOM   4250  C  C2    . DA  B  2 61  ? 12.759 114.435 -6.772  1.00 76.36  ? -13 DA  J C2    1 
ATOM   4251  N  N3    . DA  B  2 61  ? 13.731 113.527 -6.860  1.00 73.61  ? -13 DA  J N3    1 
ATOM   4252  C  C4    . DA  B  2 61  ? 14.274 113.288 -5.657  1.00 71.89  ? -13 DA  J C4    1 
ATOM   4253  P  P     . DT  B  2 62  ? 19.393 110.767 -8.987  1.00 63.09  ? -12 DT  J P     1 
ATOM   4254  O  OP1   . DT  B  2 62  ? 19.862 109.629 -9.811  1.00 67.96  ? -12 DT  J OP1   1 
ATOM   4255  O  OP2   . DT  B  2 62  ? 20.333 111.442 -8.064  1.00 54.89  ? -12 DT  J OP2   1 
ATOM   4256  O  "O5'" . DT  B  2 62  ? 18.769 111.874 -9.949  1.00 63.41  ? -12 DT  J "O5'" 1 
ATOM   4257  C  "C5'" . DT  B  2 62  ? 17.416 111.757 -10.360 1.00 63.51  ? -12 DT  J "C5'" 1 
ATOM   4258  C  "C4'" . DT  B  2 62  ? 16.881 113.097 -10.814 1.00 69.86  ? -12 DT  J "C4'" 1 
ATOM   4259  O  "O4'" . DT  B  2 62  ? 16.178 113.744 -9.725  1.00 73.77  ? -12 DT  J "O4'" 1 
ATOM   4260  C  "C3'" . DT  B  2 62  ? 17.950 114.084 -11.289 1.00 70.02  ? -12 DT  J "C3'" 1 
ATOM   4261  O  "O3'" . DT  B  2 62  ? 17.616 114.554 -12.581 1.00 77.19  ? -12 DT  J "O3'" 1 
ATOM   4262  C  "C2'" . DT  B  2 62  ? 17.910 115.206 -10.243 1.00 71.87  ? -12 DT  J "C2'" 1 
ATOM   4263  C  "C1'" . DT  B  2 62  ? 16.478 115.115 -9.738  1.00 75.84  ? -12 DT  J "C1'" 1 
ATOM   4264  N  N1    . DT  B  2 62  ? 16.279 115.654 -8.356  1.00 71.98  ? -12 DT  J N1    1 
ATOM   4265  C  C2    . DT  B  2 62  ? 15.293 116.591 -8.132  1.00 78.59  ? -12 DT  J C2    1 
ATOM   4266  O  O2    . DT  B  2 62  ? 14.568 117.021 -9.011  1.00 85.56  ? -12 DT  J O2    1 
ATOM   4267  N  N3    . DT  B  2 62  ? 15.189 117.011 -6.831  1.00 76.89  ? -12 DT  J N3    1 
ATOM   4268  C  C4    . DT  B  2 62  ? 15.952 116.596 -5.756  1.00 76.10  ? -12 DT  J C4    1 
ATOM   4269  O  O4    . DT  B  2 62  ? 15.784 117.032 -4.622  1.00 77.15  ? -12 DT  J O4    1 
ATOM   4270  C  C5    . DT  B  2 62  ? 16.964 115.614 -6.059  1.00 73.87  ? -12 DT  J C5    1 
ATOM   4271  C  C7    . DT  B  2 62  ? 17.853 115.091 -4.969  1.00 74.03  ? -12 DT  J C7    1 
ATOM   4272  C  C6    . DT  B  2 62  ? 17.077 115.193 -7.329  1.00 69.15  ? -12 DT  J C6    1 
ATOM   4273  P  P     . DG  B  2 63  ? 18.752 115.117 -13.565 1.00 71.30  ? -11 DG  J P     1 
ATOM   4274  O  OP1   . DG  B  2 63  ? 18.564 114.461 -14.876 1.00 72.92  ? -11 DG  J OP1   1 
ATOM   4275  O  OP2   . DG  B  2 63  ? 20.054 115.021 -12.868 1.00 73.88  ? -11 DG  J OP2   1 
ATOM   4276  O  "O5'" . DG  B  2 63  ? 18.378 116.661 -13.703 1.00 56.87  ? -11 DG  J "O5'" 1 
ATOM   4277  C  "C5'" . DG  B  2 63  ? 17.013 117.042 -13.776 1.00 74.26  ? -11 DG  J "C5'" 1 
ATOM   4278  C  "C4'" . DG  B  2 63  ? 16.814 118.457 -13.265 1.00 77.17  ? -11 DG  J "C4'" 1 
ATOM   4279  O  "O4'" . DG  B  2 63  ? 16.654 118.449 -11.821 1.00 81.39  ? -11 DG  J "O4'" 1 
ATOM   4280  C  "C3'" . DG  B  2 63  ? 17.966 119.425 -13.557 1.00 79.49  ? -11 DG  J "C3'" 1 
ATOM   4281  O  "O3'" . DG  B  2 63  ? 17.434 120.647 -14.037 1.00 87.27  ? -11 DG  J "O3'" 1 
ATOM   4282  C  "C2'" . DG  B  2 63  ? 18.620 119.604 -12.185 1.00 86.24  ? -11 DG  J "C2'" 1 
ATOM   4283  C  "C1'" . DG  B  2 63  ? 17.404 119.511 -11.288 1.00 85.53  ? -11 DG  J "C1'" 1 
ATOM   4284  N  N9    . DG  B  2 63  ? 17.703 119.227 -9.885  1.00 82.64  ? -11 DG  J N9    1 
ATOM   4285  C  C8    . DG  B  2 63  ? 18.616 118.327 -9.387  1.00 80.05  ? -11 DG  J C8    1 
ATOM   4286  N  N7    . DG  B  2 63  ? 18.652 118.292 -8.082  1.00 79.39  ? -11 DG  J N7    1 
ATOM   4287  C  C5    . DG  B  2 63  ? 17.700 119.227 -7.692  1.00 81.20  ? -11 DG  J C5    1 
ATOM   4288  C  C6    . DG  B  2 63  ? 17.289 119.633 -6.399  1.00 79.81  ? -11 DG  J C6    1 
ATOM   4289  O  O6    . DG  B  2 63  ? 17.698 119.232 -5.301  1.00 80.09  ? -11 DG  J O6    1 
ATOM   4290  N  N1    . DG  B  2 63  ? 16.296 120.611 -6.456  1.00 82.80  ? -11 DG  J N1    1 
ATOM   4291  C  C2    . DG  B  2 63  ? 15.767 121.127 -7.616  1.00 80.46  ? -11 DG  J C2    1 
ATOM   4292  N  N2    . DG  B  2 63  ? 14.816 122.062 -7.483  1.00 83.09  ? -11 DG  J N2    1 
ATOM   4293  N  N3    . DG  B  2 63  ? 16.146 120.757 -8.829  1.00 81.45  ? -11 DG  J N3    1 
ATOM   4294  C  C4    . DG  B  2 63  ? 17.109 119.808 -8.791  1.00 82.64  ? -11 DG  J C4    1 
ATOM   4295  P  P     . DT  B  2 64  ? 18.377 121.733 -14.753 1.00 90.98  ? -10 DT  J P     1 
ATOM   4296  O  OP1   . DT  B  2 64  ? 17.898 121.880 -16.146 1.00 93.04  ? -10 DT  J OP1   1 
ATOM   4297  O  OP2   . DT  B  2 64  ? 19.790 121.373 -14.499 1.00 91.32  ? -10 DT  J OP2   1 
ATOM   4298  O  "O5'" . DT  B  2 64  ? 18.058 123.079 -13.951 1.00 90.32  ? -10 DT  J "O5'" 1 
ATOM   4299  C  "C5'" . DT  B  2 64  ? 16.722 123.363 -13.553 1.00 93.69  ? -10 DT  J "C5'" 1 
ATOM   4300  C  "C4'" . DT  B  2 64  ? 16.705 124.290 -12.352 1.00 98.35  ? -10 DT  J "C4'" 1 
ATOM   4301  O  "O4'" . DT  B  2 64  ? 16.957 123.535 -11.151 1.00 99.91  ? -10 DT  J "O4'" 1 
ATOM   4302  C  "C3'" . DT  B  2 64  ? 17.764 125.392 -12.379 1.00 97.56  ? -10 DT  J "C3'" 1 
ATOM   4303  O  "O3'" . DT  B  2 64  ? 17.151 126.644 -12.651 1.00 101.97 ? -10 DT  J "O3'" 1 
ATOM   4304  C  "C2'" . DT  B  2 64  ? 18.404 125.361 -10.978 1.00 97.63  ? -10 DT  J "C2'" 1 
ATOM   4305  C  "C1'" . DT  B  2 64  ? 17.511 124.400 -10.199 1.00 98.99  ? -10 DT  J "C1'" 1 
ATOM   4306  N  N1    . DT  B  2 64  ? 18.249 123.585 -9.187  1.00 95.29  ? -10 DT  J N1    1 
ATOM   4307  C  C2    . DT  B  2 64  ? 17.974 123.761 -7.849  1.00 94.57  ? -10 DT  J C2    1 
ATOM   4308  O  O2    . DT  B  2 64  ? 17.147 124.555 -7.436  1.00 95.87  ? -10 DT  J O2    1 
ATOM   4309  N  N3    . DT  B  2 64  ? 18.705 122.967 -7.006  1.00 91.34  ? -10 DT  J N3    1 
ATOM   4310  C  C4    . DT  B  2 64  ? 19.664 122.036 -7.357  1.00 91.72  ? -10 DT  J C4    1 
ATOM   4311  O  O4    . DT  B  2 64  ? 20.268 121.369 -6.522  1.00 92.45  ? -10 DT  J O4    1 
ATOM   4312  C  C5    . DT  B  2 64  ? 19.905 121.902 -8.775  1.00 91.23  ? -10 DT  J C5    1 
ATOM   4313  C  C7    . DT  B  2 64  ? 20.924 120.923 -9.277  1.00 89.68  ? -10 DT  J C7    1 
ATOM   4314  C  C6    . DT  B  2 64  ? 19.194 122.674 -9.612  1.00 90.18  ? -10 DT  J C6    1 
ATOM   4315  P  P     . DT  B  2 65  ? 18.045 127.972 -12.779 1.00 118.24 ? -9  DT  J P     1 
ATOM   4316  O  OP1   . DT  B  2 65  ? 17.328 128.916 -13.665 1.00 114.72 ? -9  DT  J OP1   1 
ATOM   4317  O  OP2   . DT  B  2 65  ? 19.428 127.560 -13.109 1.00 115.63 ? -9  DT  J OP2   1 
ATOM   4318  O  "O5'" . DT  B  2 65  ? 18.054 128.565 -11.296 1.00 117.42 ? -9  DT  J "O5'" 1 
ATOM   4319  C  "C5'" . DT  B  2 65  ? 16.831 128.707 -10.585 1.00 114.35 ? -9  DT  J "C5'" 1 
ATOM   4320  C  "C4'" . DT  B  2 65  ? 17.065 129.372 -9.243  1.00 111.18 ? -9  DT  J "C4'" 1 
ATOM   4321  O  "O4'" . DT  B  2 65  ? 17.586 128.400 -8.300  1.00 105.62 ? -9  DT  J "O4'" 1 
ATOM   4322  C  "C3'" . DT  B  2 65  ? 18.059 130.530 -9.267  1.00 112.28 ? -9  DT  J "C3'" 1 
ATOM   4323  O  "O3'" . DT  B  2 65  ? 17.564 131.606 -8.489  1.00 120.28 ? -9  DT  J "O3'" 1 
ATOM   4324  C  "C2'" . DT  B  2 65  ? 19.329 129.927 -8.664  1.00 106.83 ? -9  DT  J "C2'" 1 
ATOM   4325  C  "C1'" . DT  B  2 65  ? 18.766 128.890 -7.704  1.00 101.09 ? -9  DT  J "C1'" 1 
ATOM   4326  N  N1    . DT  B  2 65  ? 19.680 127.733 -7.473  1.00 89.27  ? -9  DT  J N1    1 
ATOM   4327  C  C2    . DT  B  2 65  ? 19.877 127.275 -6.191  1.00 86.73  ? -9  DT  J C2    1 
ATOM   4328  O  O2    . DT  B  2 65  ? 19.345 127.772 -5.215  1.00 94.01  ? -9  DT  J O2    1 
ATOM   4329  N  N3    . DT  B  2 65  ? 20.729 126.206 -6.090  1.00 81.01  ? -9  DT  J N3    1 
ATOM   4330  C  C4    . DT  B  2 65  ? 21.387 125.562 -7.121  1.00 77.87  ? -9  DT  J C4    1 
ATOM   4331  O  O4    . DT  B  2 65  ? 22.134 124.606 -6.926  1.00 72.80  ? -9  DT  J O4    1 
ATOM   4332  C  C5    . DT  B  2 65  ? 21.135 126.091 -8.440  1.00 77.39  ? -9  DT  J C5    1 
ATOM   4333  C  C7    . DT  B  2 65  ? 21.794 125.474 -9.638  1.00 68.77  ? -9  DT  J C7    1 
ATOM   4334  C  C6    . DT  B  2 65  ? 20.303 127.139 -8.552  1.00 80.08  ? -9  DT  J C6    1 
ATOM   4335  P  P     . DC  B  2 66  ? 18.253 133.053 -8.581  1.00 112.86 ? -8  DC  J P     1 
ATOM   4336  O  OP1   . DC  B  2 66  ? 17.181 134.073 -8.524  1.00 117.82 ? -8  DC  J OP1   1 
ATOM   4337  O  OP2   . DC  B  2 66  ? 19.194 133.035 -9.723  1.00 107.72 ? -8  DC  J OP2   1 
ATOM   4338  O  "O5'" . DC  B  2 66  ? 19.115 133.135 -7.241  1.00 109.31 ? -8  DC  J "O5'" 1 
ATOM   4339  C  "C5'" . DC  B  2 66  ? 18.540 132.730 -6.012  1.00 107.25 ? -8  DC  J "C5'" 1 
ATOM   4340  C  "C4'" . DC  B  2 66  ? 19.592 132.679 -4.926  1.00 106.33 ? -8  DC  J "C4'" 1 
ATOM   4341  O  "O4'" . DC  B  2 66  ? 20.244 131.382 -4.933  1.00 103.32 ? -8  DC  J "O4'" 1 
ATOM   4342  C  "C3'" . DC  B  2 66  ? 20.706 133.719 -5.067  1.00 105.76 ? -8  DC  J "C3'" 1 
ATOM   4343  O  "O3'" . DC  B  2 66  ? 20.918 134.362 -3.823  1.00 104.76 ? -8  DC  J "O3'" 1 
ATOM   4344  C  "C2'" . DC  B  2 66  ? 21.919 132.887 -5.492  1.00 103.99 ? -8  DC  J "C2'" 1 
ATOM   4345  C  "C1'" . DC  B  2 66  ? 21.630 131.567 -4.802  1.00 102.37 ? -8  DC  J "C1'" 1 
ATOM   4346  N  N1    . DC  B  2 66  ? 22.330 130.396 -5.408  1.00 100.27 ? -8  DC  J N1    1 
ATOM   4347  C  C2    . DC  B  2 66  ? 22.859 129.409 -4.573  1.00 96.56  ? -8  DC  J C2    1 
ATOM   4348  O  O2    . DC  B  2 66  ? 22.733 129.536 -3.351  1.00 96.74  ? -8  DC  J O2    1 
ATOM   4349  N  N3    . DC  B  2 66  ? 23.493 128.346 -5.128  1.00 94.63  ? -8  DC  J N3    1 
ATOM   4350  C  C4    . DC  B  2 66  ? 23.603 128.254 -6.456  1.00 94.84  ? -8  DC  J C4    1 
ATOM   4351  N  N4    . DC  B  2 66  ? 24.238 127.189 -6.961  1.00 85.37  ? -8  DC  J N4    1 
ATOM   4352  C  C5    . DC  B  2 66  ? 23.069 129.253 -7.325  1.00 100.31 ? -8  DC  J C5    1 
ATOM   4353  C  C6    . DC  B  2 66  ? 22.447 130.297 -6.763  1.00 101.57 ? -8  DC  J C6    1 
ATOM   4354  P  P     . DA  B  2 67  ? 21.646 135.792 -3.757  1.00 114.37 ? -7  DA  J P     1 
ATOM   4355  O  OP1   . DA  B  2 67  ? 20.651 136.790 -3.304  1.00 119.11 ? -7  DA  J OP1   1 
ATOM   4356  O  OP2   . DA  B  2 67  ? 22.371 136.004 -5.029  1.00 112.95 ? -7  DA  J OP2   1 
ATOM   4357  O  "O5'" . DA  B  2 67  ? 22.735 135.590 -2.610  1.00 107.96 ? -7  DA  J "O5'" 1 
ATOM   4358  C  "C5'" . DA  B  2 67  ? 22.420 134.793 -1.480  1.00 98.22  ? -7  DA  J "C5'" 1 
ATOM   4359  C  "C4'" . DA  B  2 67  ? 23.633 134.015 -1.011  1.00 93.21  ? -7  DA  J "C4'" 1 
ATOM   4360  O  "O4'" . DA  B  2 67  ? 23.903 132.915 -1.925  1.00 88.01  ? -7  DA  J "O4'" 1 
ATOM   4361  C  "C3'" . DA  B  2 67  ? 24.933 134.822 -0.939  1.00 96.44  ? -7  DA  J "C3'" 1 
ATOM   4362  O  "O3'" . DA  B  2 67  ? 25.660 134.430 0.209   1.00 97.49  ? -7  DA  J "O3'" 1 
ATOM   4363  C  "C2'" . DA  B  2 67  ? 25.655 134.391 -2.213  1.00 93.37  ? -7  DA  J "C2'" 1 
ATOM   4364  C  "C1'" . DA  B  2 67  ? 25.275 132.925 -2.234  1.00 89.11  ? -7  DA  J "C1'" 1 
ATOM   4365  N  N9    . DA  B  2 67  ? 25.490 132.256 -3.514  1.00 93.31  ? -7  DA  J N9    1 
ATOM   4366  C  C8    . DA  B  2 67  ? 25.175 132.720 -4.759  1.00 95.84  ? -7  DA  J C8    1 
ATOM   4367  N  N7    . DA  B  2 67  ? 25.486 131.889 -5.728  1.00 96.00  ? -7  DA  J N7    1 
ATOM   4368  C  C5    . DA  B  2 67  ? 26.047 130.806 -5.068  1.00 92.04  ? -7  DA  J C5    1 
ATOM   4369  C  C6    . DA  B  2 67  ? 26.584 129.585 -5.525  1.00 90.34  ? -7  DA  J C6    1 
ATOM   4370  N  N6    . DA  B  2 67  ? 26.641 129.241 -6.816  1.00 89.01  ? -7  DA  J N6    1 
ATOM   4371  N  N1    . DA  B  2 67  ? 27.062 128.727 -4.598  1.00 92.08  ? -7  DA  J N1    1 
ATOM   4372  C  C2    . DA  B  2 67  ? 27.000 129.072 -3.309  1.00 90.19  ? -7  DA  J C2    1 
ATOM   4373  N  N3    . DA  B  2 67  ? 26.520 130.185 -2.762  1.00 90.68  ? -7  DA  J N3    1 
ATOM   4374  C  C4    . DA  B  2 67  ? 26.056 131.018 -3.704  1.00 92.39  ? -7  DA  J C4    1 
ATOM   4375  P  P     . DG  B  2 68  ? 25.785 135.404 1.479   1.00 95.82  ? -6  DG  J P     1 
ATOM   4376  O  OP1   . DG  B  2 68  ? 24.426 135.869 1.834   1.00 98.76  ? -6  DG  J OP1   1 
ATOM   4377  O  OP2   . DG  B  2 68  ? 26.846 136.390 1.177   1.00 97.12  ? -6  DG  J OP2   1 
ATOM   4378  O  "O5'" . DG  B  2 68  ? 26.320 134.439 2.637   1.00 96.27  ? -6  DG  J "O5'" 1 
ATOM   4379  C  "C5'" . DG  B  2 68  ? 25.708 133.166 2.843   1.00 91.94  ? -6  DG  J "C5'" 1 
ATOM   4380  C  "C4'" . DG  B  2 68  ? 26.707 132.150 3.378   1.00 88.59  ? -6  DG  J "C4'" 1 
ATOM   4381  O  "O4'" . DG  B  2 68  ? 27.204 131.327 2.293   1.00 89.03  ? -6  DG  J "O4'" 1 
ATOM   4382  C  "C3'" . DG  B  2 68  ? 27.939 132.735 4.043   1.00 90.46  ? -6  DG  J "C3'" 1 
ATOM   4383  O  "O3'" . DG  B  2 68  ? 28.392 131.856 5.073   1.00 86.86  ? -6  DG  J "O3'" 1 
ATOM   4384  C  "C2'" . DG  B  2 68  ? 28.936 132.831 2.885   1.00 88.35  ? -6  DG  J "C2'" 1 
ATOM   4385  C  "C1'" . DG  B  2 68  ? 28.559 131.638 2.010   1.00 91.40  ? -6  DG  J "C1'" 1 
ATOM   4386  N  N9    . DG  B  2 68  ? 28.657 131.926 0.583   1.00 99.40  ? -6  DG  J N9    1 
ATOM   4387  C  C8    . DG  B  2 68  ? 28.203 133.054 -0.050  1.00 103.51 ? -6  DG  J C8    1 
ATOM   4388  N  N7    . DG  B  2 68  ? 28.413 133.052 -1.332  1.00 100.77 ? -6  DG  J N7    1 
ATOM   4389  C  C5    . DG  B  2 68  ? 29.039 131.841 -1.574  1.00 99.06  ? -6  DG  J C5    1 
ATOM   4390  C  C6    . DG  B  2 68  ? 29.499 131.294 -2.788  1.00 97.94  ? -6  DG  J C6    1 
ATOM   4391  O  O6    . DG  B  2 68  ? 29.436 131.791 -3.919  1.00 97.10  ? -6  DG  J O6    1 
ATOM   4392  N  N1    . DG  B  2 68  ? 30.080 130.045 -2.605  1.00 98.17  ? -6  DG  J N1    1 
ATOM   4393  C  C2    . DG  B  2 68  ? 30.201 129.401 -1.396  1.00 100.38 ? -6  DG  J C2    1 
ATOM   4394  N  N2    . DG  B  2 68  ? 30.795 128.197 -1.423  1.00 98.34  ? -6  DG  J N2    1 
ATOM   4395  N  N3    . DG  B  2 68  ? 29.771 129.906 -0.240  1.00 104.01 ? -6  DG  J N3    1 
ATOM   4396  C  C4    . DG  B  2 68  ? 29.200 131.128 -0.407  1.00 100.44 ? -6  DG  J C4    1 
ATOM   4397  P  P     . DC  B  2 69  ? 29.864 132.024 5.695   1.00 87.89  ? -5  DC  J P     1 
ATOM   4398  O  OP1   . DC  B  2 69  ? 29.897 131.362 7.011   1.00 90.66  ? -5  DC  J OP1   1 
ATOM   4399  O  OP2   . DC  B  2 69  ? 30.257 133.446 5.593   1.00 95.63  ? -5  DC  J OP2   1 
ATOM   4400  O  "O5'" . DC  B  2 69  ? 30.786 131.186 4.704   1.00 89.88  ? -5  DC  J "O5'" 1 
ATOM   4401  C  "C5'" . DC  B  2 69  ? 30.652 129.773 4.618   1.00 89.65  ? -5  DC  J "C5'" 1 
ATOM   4402  C  "C4'" . DC  B  2 69  ? 31.864 129.165 3.934   1.00 89.54  ? -5  DC  J "C4'" 1 
ATOM   4403  O  "O4'" . DC  B  2 69  ? 31.920 129.622 2.556   1.00 94.40  ? -5  DC  J "O4'" 1 
ATOM   4404  C  "C3'" . DC  B  2 69  ? 33.206 129.560 4.541   1.00 91.43  ? -5  DC  J "C3'" 1 
ATOM   4405  O  "O3'" . DC  B  2 69  ? 34.159 128.547 4.285   1.00 91.03  ? -5  DC  J "O3'" 1 
ATOM   4406  C  "C2'" . DC  B  2 69  ? 33.538 130.818 3.756   1.00 95.01  ? -5  DC  J "C2'" 1 
ATOM   4407  C  "C1'" . DC  B  2 69  ? 33.088 130.401 2.367   1.00 96.36  ? -5  DC  J "C1'" 1 
ATOM   4408  N  N1    . DC  B  2 69  ? 32.765 131.539 1.464   1.00 96.28  ? -5  DC  J N1    1 
ATOM   4409  C  C2    . DC  B  2 69  ? 32.943 131.387 0.090   1.00 95.24  ? -5  DC  J C2    1 
ATOM   4410  O  O2    . DC  B  2 69  ? 33.363 130.306 -0.335  1.00 88.69  ? -5  DC  J O2    1 
ATOM   4411  N  N3    . DC  B  2 69  ? 32.649 132.424 -0.732  1.00 102.63 ? -5  DC  J N3    1 
ATOM   4412  C  C4    . DC  B  2 69  ? 32.198 133.571 -0.222  1.00 105.40 ? -5  DC  J C4    1 
ATOM   4413  N  N4    . DC  B  2 69  ? 31.921 134.569 -1.070  1.00 111.04 ? -5  DC  J N4    1 
ATOM   4414  C  C5    . DC  B  2 69  ? 32.012 133.747 1.183   1.00 103.78 ? -5  DC  J C5    1 
ATOM   4415  C  C6    . DC  B  2 69  ? 32.307 132.715 1.981   1.00 100.37 ? -5  DC  J C6    1 
ATOM   4416  P  P     . DT  B  2 70  ? 34.568 127.499 5.430   1.00 83.91  ? -4  DT  J P     1 
ATOM   4417  O  OP1   . DT  B  2 70  ? 33.323 126.998 6.054   1.00 79.06  ? -4  DT  J OP1   1 
ATOM   4418  O  OP2   . DT  B  2 70  ? 35.609 128.130 6.271   1.00 81.13  ? -4  DT  J OP2   1 
ATOM   4419  O  "O5'" . DT  B  2 70  ? 35.244 126.309 4.607   1.00 78.59  ? -4  DT  J "O5'" 1 
ATOM   4420  C  "C5'" . DT  B  2 70  ? 34.556 125.741 3.501   1.00 76.19  ? -4  DT  J "C5'" 1 
ATOM   4421  C  "C4'" . DT  B  2 70  ? 35.438 125.722 2.265   1.00 75.49  ? -4  DT  J "C4'" 1 
ATOM   4422  O  "O4'" . DT  B  2 70  ? 35.301 126.969 1.535   1.00 80.74  ? -4  DT  J "O4'" 1 
ATOM   4423  C  "C3'" . DT  B  2 70  ? 36.932 125.536 2.535   1.00 74.70  ? -4  DT  J "C3'" 1 
ATOM   4424  O  "O3'" . DT  B  2 70  ? 37.418 124.465 1.746   1.00 68.59  ? -4  DT  J "O3'" 1 
ATOM   4425  C  "C2'" . DT  B  2 70  ? 37.552 126.878 2.120   1.00 80.47  ? -4  DT  J "C2'" 1 
ATOM   4426  C  "C1'" . DT  B  2 70  ? 36.566 127.379 1.077   1.00 80.37  ? -4  DT  J "C1'" 1 
ATOM   4427  N  N1    . DT  B  2 70  ? 36.551 128.869 0.931   1.00 83.77  ? -4  DT  J N1    1 
ATOM   4428  C  C2    . DT  B  2 70  ? 36.447 129.427 -0.325  1.00 87.98  ? -4  DT  J C2    1 
ATOM   4429  O  O2    . DT  B  2 70  ? 36.368 128.768 -1.344  1.00 90.34  ? -4  DT  J O2    1 
ATOM   4430  N  N3    . DT  B  2 70  ? 36.437 130.799 -0.340  1.00 88.98  ? -4  DT  J N3    1 
ATOM   4431  C  C4    . DT  B  2 70  ? 36.516 131.648 0.748   1.00 92.70  ? -4  DT  J C4    1 
ATOM   4432  O  O4    . DT  B  2 70  ? 36.501 132.867 0.633   1.00 96.96  ? -4  DT  J O4    1 
ATOM   4433  C  C5    . DT  B  2 70  ? 36.623 131.000 2.031   1.00 94.09  ? -4  DT  J C5    1 
ATOM   4434  C  C7    . DT  B  2 70  ? 36.725 131.823 3.283   1.00 101.00 ? -4  DT  J C7    1 
ATOM   4435  C  C6    . DT  B  2 70  ? 36.633 129.658 2.061   1.00 87.96  ? -4  DT  J C6    1 
ATOM   4436  P  P     . DG  B  2 71  ? 38.837 123.782 2.061   1.00 67.38  ? -3  DG  J P     1 
ATOM   4437  O  OP1   . DG  B  2 71  ? 38.585 122.364 2.400   1.00 68.02  ? -3  DG  J OP1   1 
ATOM   4438  O  OP2   . DG  B  2 71  ? 39.587 124.646 2.999   1.00 75.75  ? -3  DG  J OP2   1 
ATOM   4439  O  "O5'" . DG  B  2 71  ? 39.573 123.827 0.649   1.00 71.95  ? -3  DG  J "O5'" 1 
ATOM   4440  C  "C5'" . DG  B  2 71  ? 38.840 123.512 -0.524  1.00 73.83  ? -3  DG  J "C5'" 1 
ATOM   4441  C  "C4'" . DG  B  2 71  ? 39.458 124.173 -1.737  1.00 77.18  ? -3  DG  J "C4'" 1 
ATOM   4442  O  "O4'" . DG  B  2 71  ? 39.267 125.609 -1.661  1.00 83.59  ? -3  DG  J "O4'" 1 
ATOM   4443  C  "C3'" . DG  B  2 71  ? 40.953 123.940 -1.902  1.00 79.30  ? -3  DG  J "C3'" 1 
ATOM   4444  O  "O3'" . DG  B  2 71  ? 41.241 123.681 -3.263  1.00 84.49  ? -3  DG  J "O3'" 1 
ATOM   4445  C  "C2'" . DG  B  2 71  ? 41.582 125.250 -1.416  1.00 79.48  ? -3  DG  J "C2'" 1 
ATOM   4446  C  "C1'" . DG  B  2 71  ? 40.507 126.279 -1.744  1.00 85.14  ? -3  DG  J "C1'" 1 
ATOM   4447  N  N9    . DG  B  2 71  ? 40.468 127.405 -0.810  1.00 88.59  ? -3  DG  J N9    1 
ATOM   4448  C  C8    . DG  B  2 71  ? 40.604 127.353 0.558   1.00 87.59  ? -3  DG  J C8    1 
ATOM   4449  N  N7    . DG  B  2 71  ? 40.512 128.519 1.136   1.00 88.07  ? -3  DG  J N7    1 
ATOM   4450  C  C5    . DG  B  2 71  ? 40.294 129.403 0.086   1.00 90.98  ? -3  DG  J C5    1 
ATOM   4451  C  C6    . DG  B  2 71  ? 40.116 130.809 0.097   1.00 92.44  ? -3  DG  J C6    1 
ATOM   4452  O  O6    . DG  B  2 71  ? 40.115 131.576 1.070   1.00 93.12  ? -3  DG  J O6    1 
ATOM   4453  N  N1    . DG  B  2 71  ? 39.926 131.314 -1.187  1.00 92.80  ? -3  DG  J N1    1 
ATOM   4454  C  C2    . DG  B  2 71  ? 39.909 130.556 -2.336  1.00 88.83  ? -3  DG  J C2    1 
ATOM   4455  N  N2    . DG  B  2 71  ? 39.709 131.213 -3.486  1.00 83.86  ? -3  DG  J N2    1 
ATOM   4456  N  N3    . DG  B  2 71  ? 40.075 129.240 -2.358  1.00 88.32  ? -3  DG  J N3    1 
ATOM   4457  C  C4    . DG  B  2 71  ? 40.263 128.733 -1.118  1.00 89.65  ? -3  DG  J C4    1 
ATOM   4458  P  P     . DG  B  2 72  ? 42.684 123.134 -3.705  1.00 80.13  ? -2  DG  J P     1 
ATOM   4459  O  OP1   . DG  B  2 72  ? 42.466 122.002 -4.635  1.00 72.25  ? -2  DG  J OP1   1 
ATOM   4460  O  OP2   . DG  B  2 72  ? 43.504 122.938 -2.487  1.00 84.47  ? -2  DG  J OP2   1 
ATOM   4461  O  "O5'" . DG  B  2 72  ? 43.286 124.359 -4.525  1.00 81.50  ? -2  DG  J "O5'" 1 
ATOM   4462  C  "C5'" . DG  B  2 72  ? 42.410 125.199 -5.257  1.00 88.88  ? -2  DG  J "C5'" 1 
ATOM   4463  C  "C4'" . DG  B  2 72  ? 43.112 126.471 -5.682  1.00 98.24  ? -2  DG  J "C4'" 1 
ATOM   4464  O  "O4'" . DG  B  2 72  ? 42.846 127.527 -4.720  1.00 99.19  ? -2  DG  J "O4'" 1 
ATOM   4465  C  "C3'" . DG  B  2 72  ? 44.631 126.369 -5.782  1.00 101.30 ? -2  DG  J "C3'" 1 
ATOM   4466  O  "O3'" . DG  B  2 72  ? 45.071 127.139 -6.881  1.00 108.03 ? -2  DG  J "O3'" 1 
ATOM   4467  C  "C2'" . DG  B  2 72  ? 45.092 126.974 -4.457  1.00 97.22  ? -2  DG  J "C2'" 1 
ATOM   4468  C  "C1'" . DG  B  2 72  ? 44.070 128.083 -4.295  1.00 98.46  ? -2  DG  J "C1'" 1 
ATOM   4469  N  N9    . DG  B  2 72  ? 43.909 128.564 -2.927  1.00 97.80  ? -2  DG  J N9    1 
ATOM   4470  C  C8    . DG  B  2 72  ? 43.906 127.818 -1.773  1.00 96.09  ? -2  DG  J C8    1 
ATOM   4471  N  N7    . DG  B  2 72  ? 43.730 128.533 -0.695  1.00 94.40  ? -2  DG  J N7    1 
ATOM   4472  C  C5    . DG  B  2 72  ? 43.600 129.834 -1.168  1.00 98.97  ? -2  DG  J C5    1 
ATOM   4473  C  C6    . DG  B  2 72  ? 43.388 131.047 -0.467  1.00 102.72 ? -2  DG  J C6    1 
ATOM   4474  O  O6    . DG  B  2 72  ? 43.268 131.219 0.753   1.00 102.13 ? -2  DG  J O6    1 
ATOM   4475  N  N1    . DG  B  2 72  ? 43.319 132.137 -1.333  1.00 111.50 ? -2  DG  J N1    1 
ATOM   4476  C  C2    . DG  B  2 72  ? 43.439 132.062 -2.701  1.00 115.72 ? -2  DG  J C2    1 
ATOM   4477  N  N2    . DG  B  2 72  ? 43.347 133.215 -3.380  1.00 122.34 ? -2  DG  J N2    1 
ATOM   4478  N  N3    . DG  B  2 72  ? 43.637 130.934 -3.365  1.00 111.73 ? -2  DG  J N3    1 
ATOM   4479  C  C4    . DG  B  2 72  ? 43.706 129.865 -2.538  1.00 102.46 ? -2  DG  J C4    1 
ATOM   4480  P  P     . DA  B  2 73  ? 46.489 126.849 -7.574  1.00 111.20 ? -1  DA  J P     1 
ATOM   4481  O  OP1   . DA  B  2 73  ? 46.224 126.157 -8.856  1.00 110.18 ? -1  DA  J OP1   1 
ATOM   4482  O  OP2   . DA  B  2 73  ? 47.381 126.223 -6.573  1.00 102.77 ? -1  DA  J OP2   1 
ATOM   4483  O  "O5'" . DA  B  2 73  ? 47.039 128.315 -7.885  1.00 116.28 ? -1  DA  J "O5'" 1 
ATOM   4484  C  "C5'" . DA  B  2 73  ? 46.139 129.317 -8.341  1.00 116.33 ? -1  DA  J "C5'" 1 
ATOM   4485  C  "C4'" . DA  B  2 73  ? 46.527 130.678 -7.795  1.00 117.96 ? -1  DA  J "C4'" 1 
ATOM   4486  O  "O4'" . DA  B  2 73  ? 46.102 130.794 -6.416  1.00 115.38 ? -1  DA  J "O4'" 1 
ATOM   4487  C  "C3'" . DA  B  2 73  ? 48.028 130.972 -7.811  1.00 119.78 ? -1  DA  J "C3'" 1 
ATOM   4488  O  "O3'" . DA  B  2 73  ? 48.275 132.166 -8.538  1.00 120.09 ? -1  DA  J "O3'" 1 
ATOM   4489  C  "C2'" . DA  B  2 73  ? 48.405 131.115 -6.329  1.00 119.86 ? -1  DA  J "C2'" 1 
ATOM   4490  C  "C1'" . DA  B  2 73  ? 47.079 131.497 -5.692  1.00 117.35 ? -1  DA  J "C1'" 1 
ATOM   4491  N  N9    . DA  B  2 73  ? 46.971 131.116 -4.285  1.00 113.46 ? -1  DA  J N9    1 
ATOM   4492  C  C8    . DA  B  2 73  ? 47.025 129.851 -3.768  1.00 109.93 ? -1  DA  J C8    1 
ATOM   4493  N  N7    . DA  B  2 73  ? 46.896 129.806 -2.463  1.00 108.14 ? -1  DA  J N7    1 
ATOM   4494  C  C5    . DA  B  2 73  ? 46.742 131.133 -2.097  1.00 109.93 ? -1  DA  J C5    1 
ATOM   4495  C  C6    . DA  B  2 73  ? 46.559 131.759 -0.847  1.00 106.97 ? -1  DA  J C6    1 
ATOM   4496  N  N6    . DA  B  2 73  ? 46.497 131.091 0.310   1.00 105.36 ? -1  DA  J N6    1 
ATOM   4497  N  N1    . DA  B  2 73  ? 46.438 133.102 -0.833  1.00 108.15 ? -1  DA  J N1    1 
ATOM   4498  C  C2    . DA  B  2 73  ? 46.499 133.768 -1.992  1.00 111.43 ? -1  DA  J C2    1 
ATOM   4499  N  N3    . DA  B  2 73  ? 46.669 133.292 -3.226  1.00 112.56 ? -1  DA  J N3    1 
ATOM   4500  C  C4    . DA  B  2 73  ? 46.785 131.954 -3.208  1.00 112.44 ? -1  DA  J C4    1 
ATOM   4501  P  P     . DT  B  2 74  ? 49.778 132.591 -8.906  1.00 114.09 ? 0   DT  J P     1 
ATOM   4502  O  OP1   . DT  B  2 74  ? 49.735 133.326 -10.190 1.00 115.49 ? 0   DT  J OP1   1 
ATOM   4503  O  OP2   . DT  B  2 74  ? 50.633 131.391 -8.773  1.00 109.71 ? 0   DT  J OP2   1 
ATOM   4504  O  "O5'" . DT  B  2 74  ? 50.174 133.611 -7.743  1.00 110.95 ? 0   DT  J "O5'" 1 
ATOM   4505  C  "C5'" . DT  B  2 74  ? 49.330 134.717 -7.461  1.00 112.28 ? 0   DT  J "C5'" 1 
ATOM   4506  C  "C4'" . DT  B  2 74  ? 49.806 135.457 -6.227  1.00 116.55 ? 0   DT  J "C4'" 1 
ATOM   4507  O  "O4'" . DT  B  2 74  ? 49.387 134.750 -5.041  1.00 116.10 ? 0   DT  J "O4'" 1 
ATOM   4508  C  "C3'" . DT  B  2 74  ? 51.327 135.613 -6.116  1.00 121.16 ? 0   DT  J "C3'" 1 
ATOM   4509  O  "O3'" . DT  B  2 74  ? 51.673 136.988 -6.188  1.00 127.71 ? 0   DT  J "O3'" 1 
ATOM   4510  C  "C2'" . DT  B  2 74  ? 51.680 135.005 -4.747  1.00 120.56 ? 0   DT  J "C2'" 1 
ATOM   4511  C  "C1'" . DT  B  2 74  ? 50.334 134.978 -4.035  1.00 119.12 ? 0   DT  J "C1'" 1 
ATOM   4512  N  N1    . DT  B  2 74  ? 50.213 133.896 -3.015  1.00 117.58 ? 0   DT  J N1    1 
ATOM   4513  C  C2    . DT  B  2 74  ? 50.005 134.235 -1.698  1.00 121.88 ? 0   DT  J C2    1 
ATOM   4514  O  O2    . DT  B  2 74  ? 49.914 135.386 -1.311  1.00 125.97 ? 0   DT  J O2    1 
ATOM   4515  N  N3    . DT  B  2 74  ? 49.905 133.171 -0.841  1.00 121.39 ? 0   DT  J N3    1 
ATOM   4516  C  C4    . DT  B  2 74  ? 49.990 131.829 -1.162  1.00 121.53 ? 0   DT  J C4    1 
ATOM   4517  O  O4    . DT  B  2 74  ? 49.887 130.944 -0.318  1.00 122.09 ? 0   DT  J O4    1 
ATOM   4518  C  C5    . DT  B  2 74  ? 50.209 131.542 -2.562  1.00 119.46 ? 0   DT  J C5    1 
ATOM   4519  C  C7    . DT  B  2 74  ? 50.322 130.121 -3.031  1.00 117.33 ? 0   DT  J C7    1 
ATOM   4520  C  C6    . DT  B  2 74  ? 50.307 132.577 -3.411  1.00 116.37 ? 0   DT  J C6    1 
ATOM   4521  P  P     . DT  B  2 75  ? 53.202 137.434 -6.395  1.00 127.98 ? 1   DT  J P     1 
ATOM   4522  O  OP1   . DT  B  2 75  ? 53.217 138.571 -7.343  1.00 127.08 ? 1   DT  J OP1   1 
ATOM   4523  O  OP2   . DT  B  2 75  ? 53.995 136.217 -6.686  1.00 127.30 ? 1   DT  J OP2   1 
ATOM   4524  O  "O5'" . DT  B  2 75  ? 53.636 137.957 -4.951  1.00 121.22 ? 1   DT  J "O5'" 1 
ATOM   4525  C  "C5'" . DT  B  2 75  ? 52.675 138.571 -4.106  1.00 118.16 ? 1   DT  J "C5'" 1 
ATOM   4526  C  "C4'" . DT  B  2 75  ? 53.148 138.564 -2.666  1.00 124.13 ? 1   DT  J "C4'" 1 
ATOM   4527  O  "O4'" . DT  B  2 75  ? 52.715 137.349 -2.013  1.00 123.97 ? 1   DT  J "O4'" 1 
ATOM   4528  C  "C3'" . DT  B  2 75  ? 54.668 138.627 -2.490  1.00 131.40 ? 1   DT  J "C3'" 1 
ATOM   4529  O  "O3'" . DT  B  2 75  ? 55.017 139.796 -1.767  1.00 139.60 ? 1   DT  J "O3'" 1 
ATOM   4530  C  "C2'" . DT  B  2 75  ? 55.020 137.345 -1.714  1.00 129.32 ? 1   DT  J "C2'" 1 
ATOM   4531  C  "C1'" . DT  B  2 75  ? 53.690 136.971 -1.079  1.00 126.71 ? 1   DT  J "C1'" 1 
ATOM   4532  N  N1    . DT  B  2 75  ? 53.538 135.507 -0.800  1.00 126.62 ? 1   DT  J N1    1 
ATOM   4533  C  C2    . DT  B  2 75  ? 53.242 135.093 0.479   1.00 126.35 ? 1   DT  J C2    1 
ATOM   4534  O  O2    . DT  B  2 75  ? 53.102 135.861 1.413   1.00 129.88 ? 1   DT  J O2    1 
ATOM   4535  N  N3    . DT  B  2 75  ? 53.116 133.737 0.629   1.00 122.39 ? 1   DT  J N3    1 
ATOM   4536  C  C4    . DT  B  2 75  ? 53.253 132.772 -0.353  1.00 122.23 ? 1   DT  J C4    1 
ATOM   4537  O  O4    . DT  B  2 75  ? 53.121 131.575 -0.119  1.00 122.34 ? 1   DT  J O4    1 
ATOM   4538  C  C5    . DT  B  2 75  ? 53.562 133.273 -1.673  1.00 123.02 ? 1   DT  J C5    1 
ATOM   4539  C  C7    . DT  B  2 75  ? 53.735 132.321 -2.820  1.00 121.13 ? 1   DT  J C7    1 
ATOM   4540  C  C6    . DT  B  2 75  ? 53.687 134.600 -1.831  1.00 125.79 ? 1   DT  J C6    1 
ATOM   4541  P  P     . DC  B  2 76  ? 56.559 140.206 -1.581  1.00 137.02 ? 2   DC  J P     1 
ATOM   4542  O  OP1   . DC  B  2 76  ? 56.630 141.685 -1.582  1.00 142.62 ? 2   DC  J OP1   1 
ATOM   4543  O  OP2   . DC  B  2 76  ? 57.361 139.430 -2.553  1.00 135.80 ? 2   DC  J OP2   1 
ATOM   4544  O  "O5'" . DC  B  2 76  ? 56.906 139.678 -0.114  1.00 136.56 ? 2   DC  J "O5'" 1 
ATOM   4545  C  "C5'" . DC  B  2 76  ? 56.032 139.980 0.962   1.00 137.54 ? 2   DC  J "C5'" 1 
ATOM   4546  C  "C4'" . DC  B  2 76  ? 56.428 139.214 2.208   1.00 136.61 ? 2   DC  J "C4'" 1 
ATOM   4547  O  "O4'" . DC  B  2 76  ? 55.969 137.840 2.108   1.00 135.76 ? 2   DC  J "O4'" 1 
ATOM   4548  C  "C3'" . DC  B  2 76  ? 57.935 139.145 2.466   1.00 135.15 ? 2   DC  J "C3'" 1 
ATOM   4549  O  "O3'" . DC  B  2 76  ? 58.200 139.456 3.822   1.00 131.77 ? 2   DC  J "O3'" 1 
ATOM   4550  C  "C2'" . DC  B  2 76  ? 58.285 137.692 2.142   1.00 133.69 ? 2   DC  J "C2'" 1 
ATOM   4551  C  "C1'" . DC  B  2 76  ? 57.000 136.983 2.528   1.00 132.97 ? 2   DC  J "C1'" 1 
ATOM   4552  N  N1    . DC  B  2 76  ? 56.815 135.652 1.871   1.00 130.87 ? 2   DC  J N1    1 
ATOM   4553  C  C2    . DC  B  2 76  ? 56.406 134.560 2.640   1.00 128.69 ? 2   DC  J C2    1 
ATOM   4554  O  O2    . DC  B  2 76  ? 56.210 134.726 3.848   1.00 130.48 ? 2   DC  J O2    1 
ATOM   4555  N  N3    . DC  B  2 76  ? 56.237 133.356 2.037   1.00 125.24 ? 2   DC  J N3    1 
ATOM   4556  C  C4    . DC  B  2 76  ? 56.462 133.228 0.727   1.00 124.67 ? 2   DC  J C4    1 
ATOM   4557  N  N4    . DC  B  2 76  ? 56.285 132.022 0.174   1.00 120.93 ? 2   DC  J N4    1 
ATOM   4558  C  C5    . DC  B  2 76  ? 56.879 134.332 -0.074  1.00 128.53 ? 2   DC  J C5    1 
ATOM   4559  C  C6    . DC  B  2 76  ? 57.042 135.513 0.533   1.00 131.94 ? 2   DC  J C6    1 
ATOM   4560  P  P     . DC  B  2 77  ? 59.539 140.243 4.229   1.00 143.47 ? 3   DC  J P     1 
ATOM   4561  O  OP1   . DC  B  2 77  ? 59.160 141.613 4.644   1.00 144.08 ? 3   DC  J OP1   1 
ATOM   4562  O  OP2   . DC  B  2 77  ? 60.526 140.048 3.143   1.00 142.08 ? 3   DC  J OP2   1 
ATOM   4563  O  "O5'" . DC  B  2 77  ? 60.056 139.446 5.509   1.00 139.37 ? 3   DC  J "O5'" 1 
ATOM   4564  C  "C5'" . DC  B  2 77  ? 59.118 138.915 6.435   1.00 134.66 ? 3   DC  J "C5'" 1 
ATOM   4565  C  "C4'" . DC  B  2 77  ? 59.677 137.677 7.105   1.00 131.81 ? 3   DC  J "C4'" 1 
ATOM   4566  O  "O4'" . DC  B  2 77  ? 59.277 136.490 6.361   1.00 130.20 ? 3   DC  J "O4'" 1 
ATOM   4567  C  "C3'" . DC  B  2 77  ? 61.203 137.628 7.184   1.00 133.53 ? 3   DC  J "C3'" 1 
ATOM   4568  O  "O3'" . DC  B  2 77  ? 61.595 137.053 8.417   1.00 137.03 ? 3   DC  J "O3'" 1 
ATOM   4569  C  "C2'" . DC  B  2 77  ? 61.561 136.717 6.012   1.00 131.66 ? 3   DC  J "C2'" 1 
ATOM   4570  C  "C1'" . DC  B  2 77  ? 60.423 135.717 6.092   1.00 127.28 ? 3   DC  J "C1'" 1 
ATOM   4571  N  N1    . DC  B  2 77  ? 60.200 134.929 4.838   1.00 121.29 ? 3   DC  J N1    1 
ATOM   4572  C  C2    . DC  B  2 77  ? 59.716 133.623 4.933   1.00 114.01 ? 3   DC  J C2    1 
ATOM   4573  O  O2    . DC  B  2 77  ? 59.478 133.159 6.052   1.00 110.70 ? 3   DC  J O2    1 
ATOM   4574  N  N3    . DC  B  2 77  ? 59.517 132.909 3.796   1.00 112.68 ? 3   DC  J N3    1 
ATOM   4575  C  C4    . DC  B  2 77  ? 59.787 133.457 2.609   1.00 115.51 ? 3   DC  J C4    1 
ATOM   4576  N  N4    . DC  B  2 77  ? 59.577 132.717 1.513   1.00 115.32 ? 3   DC  J N4    1 
ATOM   4577  C  C5    . DC  B  2 77  ? 60.286 134.789 2.494   1.00 119.20 ? 3   DC  J C5    1 
ATOM   4578  C  C6    . DC  B  2 77  ? 60.478 135.481 3.623   1.00 121.56 ? 3   DC  J C6    1 
ATOM   4579  P  P     . DA  B  2 78  ? 61.981 137.978 9.673   1.00 136.08 ? 4   DA  J P     1 
ATOM   4580  O  OP1   . DA  B  2 78  ? 60.942 139.023 9.802   1.00 138.22 ? 4   DA  J OP1   1 
ATOM   4581  O  OP2   . DA  B  2 78  ? 63.400 138.372 9.534   1.00 138.42 ? 4   DA  J OP2   1 
ATOM   4582  O  "O5'" . DA  B  2 78  ? 61.863 136.978 10.916  1.00 127.65 ? 4   DA  J "O5'" 1 
ATOM   4583  C  "C5'" . DA  B  2 78  ? 60.590 136.467 11.288  1.00 121.96 ? 4   DA  J "C5'" 1 
ATOM   4584  C  "C4'" . DA  B  2 78  ? 60.656 134.982 11.618  1.00 119.02 ? 4   DA  J "C4'" 1 
ATOM   4585  O  "O4'" . DA  B  2 78  ? 60.689 134.193 10.400  1.00 119.30 ? 4   DA  J "O4'" 1 
ATOM   4586  C  "C3'" . DA  B  2 78  ? 61.855 134.534 12.439  1.00 119.86 ? 4   DA  J "C3'" 1 
ATOM   4587  O  "O3'" . DA  B  2 78  ? 61.434 133.514 13.329  1.00 118.30 ? 4   DA  J "O3'" 1 
ATOM   4588  C  "C2'" . DA  B  2 78  ? 62.823 134.006 11.374  1.00 120.99 ? 4   DA  J "C2'" 1 
ATOM   4589  C  "C1'" . DA  B  2 78  ? 61.867 133.406 10.349  1.00 119.87 ? 4   DA  J "C1'" 1 
ATOM   4590  N  N9    . DA  B  2 78  ? 62.349 133.453 8.971   1.00 122.65 ? 4   DA  J N9    1 
ATOM   4591  C  C8    . DA  B  2 78  ? 62.956 134.507 8.352   1.00 126.92 ? 4   DA  J C8    1 
ATOM   4592  N  N7    . DA  B  2 78  ? 63.251 134.286 7.094   1.00 127.37 ? 4   DA  J N7    1 
ATOM   4593  C  C5    . DA  B  2 78  ? 62.791 133.003 6.864   1.00 123.97 ? 4   DA  J C5    1 
ATOM   4594  C  C6    . DA  B  2 78  ? 62.806 132.185 5.718   1.00 123.01 ? 4   DA  J C6    1 
ATOM   4595  N  N6    . DA  B  2 78  ? 63.323 132.573 4.550   1.00 125.76 ? 4   DA  J N6    1 
ATOM   4596  N  N1    . DA  B  2 78  ? 62.271 130.951 5.821   1.00 118.99 ? 4   DA  J N1    1 
ATOM   4597  C  C2    . DA  B  2 78  ? 61.756 130.569 6.996   1.00 118.84 ? 4   DA  J C2    1 
ATOM   4598  N  N3    . DA  B  2 78  ? 61.684 131.251 8.143   1.00 120.95 ? 4   DA  J N3    1 
ATOM   4599  C  C4    . DA  B  2 78  ? 62.225 132.473 8.006   1.00 122.25 ? 4   DA  J C4    1 
ATOM   4600  P  P     . DG  B  2 79  ? 62.406 132.966 14.483  1.00 116.23 ? 5   DG  J P     1 
ATOM   4601  O  OP1   . DG  B  2 79  ? 61.602 132.843 15.719  1.00 110.37 ? 5   DG  J OP1   1 
ATOM   4602  O  OP2   . DG  B  2 79  ? 63.641 133.781 14.483  1.00 120.25 ? 5   DG  J OP2   1 
ATOM   4603  O  "O5'" . DG  B  2 79  ? 62.773 131.500 13.977  1.00 116.28 ? 5   DG  J "O5'" 1 
ATOM   4604  C  "C5'" . DG  B  2 79  ? 61.810 130.743 13.251  1.00 113.82 ? 5   DG  J "C5'" 1 
ATOM   4605  C  "C4'" . DG  B  2 79  ? 62.457 129.534 12.608  1.00 111.51 ? 5   DG  J "C4'" 1 
ATOM   4606  O  "O4'" . DG  B  2 79  ? 62.859 129.859 11.249  1.00 112.50 ? 5   DG  J "O4'" 1 
ATOM   4607  C  "C3'" . DG  B  2 79  ? 63.723 129.042 13.305  1.00 113.08 ? 5   DG  J "C3'" 1 
ATOM   4608  O  "O3'" . DG  B  2 79  ? 63.806 127.635 13.197  1.00 116.64 ? 5   DG  J "O3'" 1 
ATOM   4609  C  "C2'" . DG  B  2 79  ? 64.818 129.720 12.493  1.00 113.80 ? 5   DG  J "C2'" 1 
ATOM   4610  C  "C1'" . DG  B  2 79  ? 64.234 129.583 11.101  1.00 113.71 ? 5   DG  J "C1'" 1 
ATOM   4611  N  N9    . DG  B  2 79  ? 64.799 130.503 10.121  1.00 119.05 ? 5   DG  J N9    1 
ATOM   4612  C  C8    . DG  B  2 79  ? 65.271 131.774 10.341  1.00 125.02 ? 5   DG  J C8    1 
ATOM   4613  N  N7    . DG  B  2 79  ? 65.716 132.355 9.260   1.00 128.24 ? 5   DG  J N7    1 
ATOM   4614  C  C5    . DG  B  2 79  ? 65.527 131.406 8.263   1.00 125.11 ? 5   DG  J C5    1 
ATOM   4615  C  C6    . DG  B  2 79  ? 65.819 131.462 6.879   1.00 130.53 ? 5   DG  J C6    1 
ATOM   4616  O  O6    . DG  B  2 79  ? 66.321 132.394 6.236   1.00 136.52 ? 5   DG  J O6    1 
ATOM   4617  N  N1    . DG  B  2 79  ? 65.466 130.279 6.233   1.00 127.30 ? 5   DG  J N1    1 
ATOM   4618  C  C2    . DG  B  2 79  ? 64.903 129.184 6.847   1.00 121.36 ? 5   DG  J C2    1 
ATOM   4619  N  N2    . DG  B  2 79  ? 64.627 128.130 6.069   1.00 116.68 ? 5   DG  J N2    1 
ATOM   4620  N  N3    . DG  B  2 79  ? 64.627 129.123 8.139   1.00 119.25 ? 5   DG  J N3    1 
ATOM   4621  C  C4    . DG  B  2 79  ? 64.964 130.263 8.781   1.00 120.50 ? 5   DG  J C4    1 
ATOM   4622  P  P     . DC  B  2 80  ? 63.872 126.720 14.514  1.00 126.28 ? 6   DC  J P     1 
ATOM   4623  O  OP1   . DC  B  2 80  ? 62.575 126.857 15.213  1.00 127.89 ? 6   DC  J OP1   1 
ATOM   4624  O  OP2   . DC  B  2 80  ? 65.130 127.035 15.228  1.00 130.27 ? 6   DC  J OP2   1 
ATOM   4625  O  "O5'" . DC  B  2 80  ? 63.976 125.235 13.932  1.00 117.94 ? 6   DC  J "O5'" 1 
ATOM   4626  C  "C5'" . DC  B  2 80  ? 62.837 124.641 13.327  1.00 107.33 ? 6   DC  J "C5'" 1 
ATOM   4627  C  "C4'" . DC  B  2 80  ? 63.142 124.170 11.914  1.00 99.29  ? 6   DC  J "C4'" 1 
ATOM   4628  O  "O4'" . DC  B  2 80  ? 63.770 125.236 11.150  1.00 100.93 ? 6   DC  J "O4'" 1 
ATOM   4629  C  "C3'" . DC  B  2 80  ? 64.082 122.971 11.815  1.00 96.18  ? 6   DC  J "C3'" 1 
ATOM   4630  O  "O3'" . DC  B  2 80  ? 63.602 122.088 10.822  1.00 95.35  ? 6   DC  J "O3'" 1 
ATOM   4631  C  "C2'" . DC  B  2 80  ? 65.405 123.610 11.397  1.00 101.02 ? 6   DC  J "C2'" 1 
ATOM   4632  C  "C1'" . DC  B  2 80  ? 64.913 124.727 10.498  1.00 101.52 ? 6   DC  J "C1'" 1 
ATOM   4633  N  N1    . DC  B  2 80  ? 65.886 125.846 10.326  1.00 107.71 ? 6   DC  J N1    1 
ATOM   4634  C  C2    . DC  B  2 80  ? 66.394 126.154 9.051   1.00 111.55 ? 6   DC  J C2    1 
ATOM   4635  O  O2    . DC  B  2 80  ? 66.042 125.481 8.072   1.00 113.92 ? 6   DC  J O2    1 
ATOM   4636  N  N3    . DC  B  2 80  ? 67.268 127.187 8.930   1.00 113.97 ? 6   DC  J N3    1 
ATOM   4637  C  C4    . DC  B  2 80  ? 67.623 127.892 10.007  1.00 117.36 ? 6   DC  J C4    1 
ATOM   4638  N  N4    . DC  B  2 80  ? 68.484 128.899 9.841   1.00 122.00 ? 6   DC  J N4    1 
ATOM   4639  C  C5    . DC  B  2 80  ? 67.118 127.592 11.302  1.00 115.77 ? 6   DC  J C5    1 
ATOM   4640  C  C6    . DC  B  2 80  ? 66.257 126.578 11.413  1.00 111.35 ? 6   DC  J C6    1 
ATOM   4641  P  P     . DT  B  2 81  ? 63.617 120.501 11.061  1.00 97.34  ? 7   DT  J P     1 
ATOM   4642  O  OP1   . DT  B  2 81  ? 62.232 120.018 10.858  1.00 87.19  ? 7   DT  J OP1   1 
ATOM   4643  O  OP2   . DT  B  2 81  ? 64.312 120.227 12.338  1.00 101.54 ? 7   DT  J OP2   1 
ATOM   4644  O  "O5'" . DT  B  2 81  ? 64.534 119.965 9.870   1.00 100.69 ? 7   DT  J "O5'" 1 
ATOM   4645  C  "C5'" . DT  B  2 81  ? 64.331 120.466 8.558   1.00 94.33  ? 7   DT  J "C5'" 1 
ATOM   4646  C  "C4'" . DT  B  2 81  ? 65.649 120.632 7.826   1.00 91.07  ? 7   DT  J "C4'" 1 
ATOM   4647  O  "O4'" . DT  B  2 81  ? 66.337 121.822 8.289   1.00 93.67  ? 7   DT  J "O4'" 1 
ATOM   4648  C  "C3'" . DT  B  2 81  ? 66.644 119.476 7.991   1.00 90.38  ? 7   DT  J "C3'" 1 
ATOM   4649  O  "O3'" . DT  B  2 81  ? 67.035 119.023 6.712   1.00 91.06  ? 7   DT  J "O3'" 1 
ATOM   4650  C  "C2'" . DT  B  2 81  ? 67.820 120.114 8.743   1.00 91.40  ? 7   DT  J "C2'" 1 
ATOM   4651  C  "C1'" . DT  B  2 81  ? 67.714 121.553 8.281   1.00 95.49  ? 7   DT  J "C1'" 1 
ATOM   4652  N  N1    . DT  B  2 81  ? 68.410 122.533 9.165   1.00 98.41  ? 7   DT  J N1    1 
ATOM   4653  C  C2    . DT  B  2 81  ? 69.059 123.603 8.595   1.00 100.22 ? 7   DT  J C2    1 
ATOM   4654  O  O2    . DT  B  2 81  ? 69.095 123.799 7.394   1.00 98.02  ? 7   DT  J O2    1 
ATOM   4655  N  N3    . DT  B  2 81  ? 69.667 124.446 9.486   1.00 105.25 ? 7   DT  J N3    1 
ATOM   4656  C  C4    . DT  B  2 81  ? 69.695 124.327 10.862  1.00 107.46 ? 7   DT  J C4    1 
ATOM   4657  O  O4    . DT  B  2 81  ? 70.272 125.139 11.579  1.00 111.11 ? 7   DT  J O4    1 
ATOM   4658  C  C5    . DT  B  2 81  ? 68.998 123.179 11.397  1.00 100.99 ? 7   DT  J C5    1 
ATOM   4659  C  C7    . DT  B  2 81  ? 68.959 122.944 12.878  1.00 98.56  ? 7   DT  J C7    1 
ATOM   4660  C  C6    . DT  B  2 81  ? 68.400 122.345 10.532  1.00 97.81  ? 7   DT  J C6    1 
ATOM   4661  P  P     . DG  B  2 82  ? 67.664 117.560 6.507   1.00 82.96  ? 8   DG  J P     1 
ATOM   4662  O  OP1   . DG  B  2 82  ? 66.568 116.650 6.109   1.00 77.22  ? 8   DG  J OP1   1 
ATOM   4663  O  OP2   . DG  B  2 82  ? 68.506 117.232 7.678   1.00 82.84  ? 8   DG  J OP2   1 
ATOM   4664  O  "O5'" . DG  B  2 82  ? 68.622 117.764 5.250   1.00 86.45  ? 8   DG  J "O5'" 1 
ATOM   4665  C  "C5'" . DG  B  2 82  ? 68.194 118.582 4.172   1.00 88.09  ? 8   DG  J "C5'" 1 
ATOM   4666  C  "C4'" . DG  B  2 82  ? 69.362 119.339 3.569   1.00 97.31  ? 8   DG  J "C4'" 1 
ATOM   4667  O  "O4'" . DG  B  2 82  ? 69.791 120.391 4.471   1.00 104.62 ? 8   DG  J "O4'" 1 
ATOM   4668  C  "C3'" . DG  B  2 82  ? 70.600 118.498 3.291   1.00 100.43 ? 8   DG  J "C3'" 1 
ATOM   4669  O  "O3'" . DG  B  2 82  ? 71.204 118.949 2.103   1.00 105.29 ? 8   DG  J "O3'" 1 
ATOM   4670  C  "C2'" . DG  B  2 82  ? 71.482 118.776 4.507   1.00 101.34 ? 8   DG  J "C2'" 1 
ATOM   4671  C  "C1'" . DG  B  2 82  ? 71.164 120.238 4.766   1.00 106.93 ? 8   DG  J "C1'" 1 
ATOM   4672  N  N9    . DG  B  2 82  ? 71.377 120.660 6.146   1.00 114.22 ? 8   DG  J N9    1 
ATOM   4673  C  C8    . DG  B  2 82  ? 70.900 120.054 7.283   1.00 113.97 ? 8   DG  J C8    1 
ATOM   4674  N  N7    . DG  B  2 82  ? 71.238 120.672 8.381   1.00 115.09 ? 8   DG  J N7    1 
ATOM   4675  C  C5    . DG  B  2 82  ? 71.980 121.762 7.943   1.00 119.65 ? 8   DG  J C5    1 
ATOM   4676  C  C6    . DG  B  2 82  ? 72.610 122.794 8.680   1.00 122.91 ? 8   DG  J C6    1 
ATOM   4677  O  O6    . DG  B  2 82  ? 72.641 122.952 9.909   1.00 121.19 ? 8   DG  J O6    1 
ATOM   4678  N  N1    . DG  B  2 82  ? 73.261 123.700 7.845   1.00 126.08 ? 8   DG  J N1    1 
ATOM   4679  C  C2    . DG  B  2 82  ? 73.292 123.621 6.471   1.00 125.25 ? 8   DG  J C2    1 
ATOM   4680  N  N2    . DG  B  2 82  ? 73.965 124.586 5.829   1.00 128.78 ? 8   DG  J N2    1 
ATOM   4681  N  N3    . DG  B  2 82  ? 72.705 122.661 5.771   1.00 123.27 ? 8   DG  J N3    1 
ATOM   4682  C  C4    . DG  B  2 82  ? 72.070 121.770 6.569   1.00 120.25 ? 8   DG  J C4    1 
ATOM   4683  P  P     . DA  B  2 83  ? 72.202 117.991 1.296   1.00 109.36 ? 9   DA  J P     1 
ATOM   4684  O  OP1   . DA  B  2 83  ? 71.800 118.045 -0.127  1.00 108.56 ? 9   DA  J OP1   1 
ATOM   4685  O  OP2   . DA  B  2 83  ? 72.258 116.689 1.997   1.00 109.88 ? 9   DA  J OP2   1 
ATOM   4686  O  "O5'" . DA  B  2 83  ? 73.620 118.703 1.470   1.00 114.99 ? 9   DA  J "O5'" 1 
ATOM   4687  C  "C5'" . DA  B  2 83  ? 73.814 120.028 0.991   1.00 118.04 ? 9   DA  J "C5'" 1 
ATOM   4688  C  "C4'" . DA  B  2 83  ? 75.219 120.509 1.301   1.00 119.00 ? 9   DA  J "C4'" 1 
ATOM   4689  O  "O4'" . DA  B  2 83  ? 75.263 121.050 2.648   1.00 115.86 ? 9   DA  J "O4'" 1 
ATOM   4690  C  "C3'" . DA  B  2 83  ? 76.292 119.425 1.246   1.00 123.00 ? 9   DA  J "C3'" 1 
ATOM   4691  O  "O3'" . DA  B  2 83  ? 77.489 119.955 0.703   1.00 131.99 ? 9   DA  J "O3'" 1 
ATOM   4692  C  "C2'" . DA  B  2 83  ? 76.462 119.034 2.711   1.00 120.64 ? 9   DA  J "C2'" 1 
ATOM   4693  C  "C1'" . DA  B  2 83  ? 76.231 120.364 3.412   1.00 118.57 ? 9   DA  J "C1'" 1 
ATOM   4694  N  N9    . DA  B  2 83  ? 75.726 120.232 4.776   1.00 119.30 ? 9   DA  J N9    1 
ATOM   4695  C  C8    . DA  B  2 83  ? 74.834 119.306 5.241   1.00 118.08 ? 9   DA  J C8    1 
ATOM   4696  N  N7    . DA  B  2 83  ? 74.556 119.433 6.517   1.00 118.94 ? 9   DA  J N7    1 
ATOM   4697  C  C5    . DA  B  2 83  ? 75.316 120.521 6.916   1.00 119.38 ? 9   DA  J C5    1 
ATOM   4698  C  C6    . DA  B  2 83  ? 75.468 121.170 8.159   1.00 119.47 ? 9   DA  J C6    1 
ATOM   4699  N  N6    . DA  B  2 83  ? 74.832 120.790 9.272   1.00 118.08 ? 9   DA  J N6    1 
ATOM   4700  N  N1    . DA  B  2 83  ? 76.306 122.227 8.213   1.00 123.36 ? 9   DA  J N1    1 
ATOM   4701  C  C2    . DA  B  2 83  ? 76.942 122.603 7.098   1.00 128.12 ? 9   DA  J C2    1 
ATOM   4702  N  N3    . DA  B  2 83  ? 76.880 122.073 5.878   1.00 129.22 ? 9   DA  J N3    1 
ATOM   4703  C  C4    . DA  B  2 83  ? 76.040 121.027 5.855   1.00 122.54 ? 9   DA  J C4    1 
ATOM   4704  P  P     . DA  B  2 84  ? 78.569 118.980 0.020   1.00 135.72 ? 10  DA  J P     1 
ATOM   4705  O  OP1   . DA  B  2 84  ? 78.789 119.460 -1.363  1.00 133.19 ? 10  DA  J OP1   1 
ATOM   4706  O  OP2   . DA  B  2 84  ? 78.146 117.582 0.261   1.00 132.18 ? 10  DA  J OP2   1 
ATOM   4707  O  "O5'" . DA  B  2 84  ? 79.896 119.248 0.865   1.00 137.22 ? 10  DA  J "O5'" 1 
ATOM   4708  C  "C5'" . DA  B  2 84  ? 80.438 120.549 0.903   1.00 138.59 ? 10  DA  J "C5'" 1 
ATOM   4709  C  "C4'" . DA  B  2 84  ? 81.067 120.841 2.250   1.00 138.53 ? 10  DA  J "C4'" 1 
ATOM   4710  O  "O4'" . DA  B  2 84  ? 80.083 120.713 3.309   1.00 130.98 ? 10  DA  J "O4'" 1 
ATOM   4711  C  "C3'" . DA  B  2 84  ? 82.223 119.915 2.628   1.00 143.77 ? 10  DA  J "C3'" 1 
ATOM   4712  O  "O3'" . DA  B  2 84  ? 83.390 120.691 2.854   1.00 155.94 ? 10  DA  J "O3'" 1 
ATOM   4713  C  "C2'" . DA  B  2 84  ? 81.737 119.216 3.909   1.00 137.95 ? 10  DA  J "C2'" 1 
ATOM   4714  C  "C1'" . DA  B  2 84  ? 80.733 120.217 4.450   1.00 134.26 ? 10  DA  J "C1'" 1 
ATOM   4715  N  N9    . DA  B  2 84  ? 79.738 119.633 5.353   1.00 133.12 ? 10  DA  J N9    1 
ATOM   4716  C  C8    . DA  B  2 84  ? 78.808 118.679 5.049   1.00 130.29 ? 10  DA  J C8    1 
ATOM   4717  N  N7    . DA  B  2 84  ? 78.039 118.344 6.059   1.00 127.15 ? 10  DA  J N7    1 
ATOM   4718  C  C5    . DA  B  2 84  ? 78.497 119.130 7.103   1.00 129.67 ? 10  DA  J C5    1 
ATOM   4719  C  C6    . DA  B  2 84  ? 78.097 119.247 8.452   1.00 129.58 ? 10  DA  J C6    1 
ATOM   4720  N  N6    . DA  B  2 84  ? 77.100 118.535 8.989   1.00 125.12 ? 10  DA  J N6    1 
ATOM   4721  N  N1    . DA  B  2 84  ? 78.764 120.127 9.229   1.00 134.05 ? 10  DA  J N1    1 
ATOM   4722  C  C2    . DA  B  2 84  ? 79.761 120.838 8.687   1.00 136.73 ? 10  DA  J C2    1 
ATOM   4723  N  N3    . DA  B  2 84  ? 80.227 120.815 7.435   1.00 137.58 ? 10  DA  J N3    1 
ATOM   4724  C  C4    . DA  B  2 84  ? 79.545 119.932 6.687   1.00 133.68 ? 10  DA  J C4    1 
ATOM   4725  P  P     . DC  B  2 85  ? 84.825 120.168 2.357   1.00 141.45 ? 11  DC  J P     1 
ATOM   4726  O  OP1   . DC  B  2 85  ? 85.430 121.222 1.512   1.00 145.80 ? 11  DC  J OP1   1 
ATOM   4727  O  OP2   . DC  B  2 85  ? 84.649 118.798 1.825   1.00 138.56 ? 11  DC  J OP2   1 
ATOM   4728  O  "O5'" . DC  B  2 85  ? 85.654 120.066 3.713   1.00 148.81 ? 11  DC  J "O5'" 1 
ATOM   4729  C  "C5'" . DC  B  2 85  ? 84.980 119.691 4.889   1.00 149.68 ? 11  DC  J "C5'" 1 
ATOM   4730  C  "C4'" . DC  B  2 85  ? 85.502 120.445 6.084   1.00 156.24 ? 11  DC  J "C4'" 1 
ATOM   4731  O  "O4'" . DC  B  2 85  ? 84.443 120.550 7.068   1.00 157.96 ? 11  DC  J "O4'" 1 
ATOM   4732  C  "C3'" . DC  B  2 85  ? 86.621 119.730 6.802   1.00 157.20 ? 11  DC  J "C3'" 1 
ATOM   4733  O  "O3'" . DC  B  2 85  ? 87.347 120.636 7.610   1.00 153.83 ? 11  DC  J "O3'" 1 
ATOM   4734  C  "C2'" . DC  B  2 85  ? 85.840 118.732 7.640   1.00 159.06 ? 11  DC  J "C2'" 1 
ATOM   4735  C  "C1'" . DC  B  2 85  ? 84.629 119.562 8.066   1.00 160.94 ? 11  DC  J "C1'" 1 
ATOM   4736  N  N1    . DC  B  2 85  ? 83.365 118.762 8.201   1.00 164.05 ? 11  DC  J N1    1 
ATOM   4737  C  C2    . DC  B  2 85  ? 82.732 118.687 9.444   1.00 167.14 ? 11  DC  J C2    1 
ATOM   4738  O  O2    . DC  B  2 85  ? 83.230 119.289 10.399  1.00 171.38 ? 11  DC  J O2    1 
ATOM   4739  N  N3    . DC  B  2 85  ? 81.590 117.961 9.560   1.00 163.43 ? 11  DC  J N3    1 
ATOM   4740  C  C4    . DC  B  2 85  ? 81.089 117.329 8.496   1.00 160.40 ? 11  DC  J C4    1 
ATOM   4741  N  N4    . DC  B  2 85  ? 79.962 116.624 8.656   1.00 156.84 ? 11  DC  J N4    1 
ATOM   4742  C  C5    . DC  B  2 85  ? 81.724 117.392 7.219   1.00 160.84 ? 11  DC  J C5    1 
ATOM   4743  C  C6    . DC  B  2 85  ? 82.848 118.111 7.119   1.00 163.67 ? 11  DC  J C6    1 
ATOM   4744  P  P     . DA  B  2 86  ? 88.865 120.303 8.012   1.00 164.93 ? 12  DA  J P     1 
ATOM   4745  O  OP1   . DA  B  2 86  ? 89.672 121.532 7.844   1.00 167.50 ? 12  DA  J OP1   1 
ATOM   4746  O  OP2   . DA  B  2 86  ? 89.245 119.067 7.291   1.00 160.58 ? 12  DA  J OP2   1 
ATOM   4747  O  "O5'" . DA  B  2 86  ? 88.775 119.938 9.564   1.00 164.51 ? 12  DA  J "O5'" 1 
ATOM   4748  C  "C5'" . DA  B  2 86  ? 88.000 120.744 10.445  1.00 165.96 ? 12  DA  J "C5'" 1 
ATOM   4749  C  "C4'" . DA  B  2 86  ? 88.026 120.176 11.854  1.00 169.12 ? 12  DA  J "C4'" 1 
ATOM   4750  O  "O4'" . DA  B  2 86  ? 86.825 119.396 12.092  1.00 166.76 ? 12  DA  J "O4'" 1 
ATOM   4751  C  "C3'" . DA  B  2 86  ? 89.190 119.241 12.145  1.00 173.60 ? 12  DA  J "C3'" 1 
ATOM   4752  O  "O3'" . DA  B  2 86  ? 89.562 119.347 13.514  1.00 176.39 ? 12  DA  J "O3'" 1 
ATOM   4753  C  "C2'" . DA  B  2 86  ? 88.601 117.869 11.823  1.00 170.86 ? 12  DA  J "C2'" 1 
ATOM   4754  C  "C1'" . DA  B  2 86  ? 87.157 118.032 12.285  1.00 166.21 ? 12  DA  J "C1'" 1 
ATOM   4755  N  N9    . DA  B  2 86  ? 86.213 117.227 11.519  1.00 161.52 ? 12  DA  J N9    1 
ATOM   4756  C  C8    . DA  B  2 86  ? 86.288 116.920 10.193  1.00 161.33 ? 12  DA  J C8    1 
ATOM   4757  N  N7    . DA  B  2 86  ? 85.292 116.188 9.757   1.00 157.14 ? 12  DA  J N7    1 
ATOM   4758  C  C5    . DA  B  2 86  ? 84.508 115.996 10.878  1.00 155.04 ? 12  DA  J C5    1 
ATOM   4759  C  C6    . DA  B  2 86  ? 83.303 115.297 11.084  1.00 150.71 ? 12  DA  J C6    1 
ATOM   4760  N  N6    . DA  B  2 86  ? 82.656 114.637 10.116  1.00 146.93 ? 12  DA  J N6    1 
ATOM   4761  N  N1    . DA  B  2 86  ? 82.786 115.305 12.328  1.00 149.45 ? 12  DA  J N1    1 
ATOM   4762  C  C2    . DA  B  2 86  ? 83.433 115.966 13.295  1.00 152.49 ? 12  DA  J C2    1 
ATOM   4763  N  N3    . DA  B  2 86  ? 84.569 116.656 13.223  1.00 157.13 ? 12  DA  J N3    1 
ATOM   4764  C  C4    . DA  B  2 86  ? 85.060 116.632 11.976  1.00 157.72 ? 12  DA  J C4    1 
ATOM   4765  P  P     . DT  B  2 87  ? 91.008 118.843 14.004  1.00 191.97 ? 13  DT  J P     1 
ATOM   4766  O  OP1   . DT  B  2 87  ? 91.704 119.991 14.625  1.00 196.85 ? 13  DT  J OP1   1 
ATOM   4767  O  OP2   . DT  B  2 87  ? 91.642 118.121 12.878  1.00 194.23 ? 13  DT  J OP2   1 
ATOM   4768  O  "O5'" . DT  B  2 87  ? 90.663 117.772 15.138  1.00 187.26 ? 13  DT  J "O5'" 1 
ATOM   4769  C  "C5'" . DT  B  2 87  ? 89.700 116.766 14.877  1.00 180.09 ? 13  DT  J "C5'" 1 
ATOM   4770  C  "C4'" . DT  B  2 87  ? 88.861 116.486 16.104  1.00 173.40 ? 13  DT  J "C4'" 1 
ATOM   4771  O  "O4'" . DT  B  2 87  ? 87.522 116.110 15.698  1.00 165.59 ? 13  DT  J "O4'" 1 
ATOM   4772  C  "C3'" . DT  B  2 87  ? 89.366 115.340 16.956  1.00 171.18 ? 13  DT  J "C3'" 1 
ATOM   4773  O  "O3'" . DT  B  2 87  ? 89.020 115.542 18.315  1.00 168.41 ? 13  DT  J "O3'" 1 
ATOM   4774  C  "C2'" . DT  B  2 87  ? 88.654 114.130 16.357  1.00 166.33 ? 13  DT  J "C2'" 1 
ATOM   4775  C  "C1'" . DT  B  2 87  ? 87.337 114.714 15.846  1.00 160.56 ? 13  DT  J "C1'" 1 
ATOM   4776  N  N1    . DT  B  2 87  ? 86.904 114.151 14.522  1.00 153.59 ? 13  DT  J N1    1 
ATOM   4777  C  C2    . DT  B  2 87  ? 85.750 113.403 14.448  1.00 148.17 ? 13  DT  J C2    1 
ATOM   4778  O  O2    . DT  B  2 87  ? 85.046 113.164 15.413  1.00 145.22 ? 13  DT  J O2    1 
ATOM   4779  N  N3    . DT  B  2 87  ? 85.448 112.940 13.193  1.00 145.45 ? 13  DT  J N3    1 
ATOM   4780  C  C4    . DT  B  2 87  ? 86.167 113.146 12.029  1.00 144.14 ? 13  DT  J C4    1 
ATOM   4781  O  O4    . DT  B  2 87  ? 85.812 112.687 10.947  1.00 140.00 ? 13  DT  J O4    1 
ATOM   4782  C  C5    . DT  B  2 87  ? 87.365 113.937 12.177  1.00 147.50 ? 13  DT  J C5    1 
ATOM   4783  C  C7    . DT  B  2 87  ? 88.229 114.226 10.986  1.00 148.03 ? 13  DT  J C7    1 
ATOM   4784  C  C6    . DT  B  2 87  ? 87.672 114.395 13.400  1.00 152.35 ? 13  DT  J C6    1 
ATOM   4785  P  P     . DG  B  2 88  ? 89.942 114.917 19.471  1.00 172.80 ? 14  DG  J P     1 
ATOM   4786  O  OP1   . DG  B  2 88  ? 89.685 115.670 20.719  1.00 174.00 ? 14  DG  J OP1   1 
ATOM   4787  O  OP2   . DG  B  2 88  ? 91.320 114.822 18.940  1.00 174.68 ? 14  DG  J OP2   1 
ATOM   4788  O  "O5'" . DG  B  2 88  ? 89.381 113.430 19.632  1.00 168.19 ? 14  DG  J "O5'" 1 
ATOM   4789  C  "C5'" . DG  B  2 88  ? 88.004 113.227 19.907  1.00 162.24 ? 14  DG  J "C5'" 1 
ATOM   4790  C  "C4'" . DG  B  2 88  ? 87.572 111.825 19.518  1.00 157.96 ? 14  DG  J "C4'" 1 
ATOM   4791  O  "O4'" . DG  B  2 88  ? 87.380 111.742 18.076  1.00 156.63 ? 14  DG  J "O4'" 1 
ATOM   4792  C  "C3'" . DG  B  2 88  ? 88.568 110.708 19.870  1.00 156.90 ? 14  DG  J "C3'" 1 
ATOM   4793  O  "O3'" . DG  B  2 88  ? 87.853 109.578 20.343  1.00 152.22 ? 14  DG  J "O3'" 1 
ATOM   4794  C  "C2'" . DG  B  2 88  ? 89.202 110.404 18.514  1.00 157.53 ? 14  DG  J "C2'" 1 
ATOM   4795  C  "C1'" . DG  B  2 88  ? 87.972 110.545 17.644  1.00 153.36 ? 14  DG  J "C1'" 1 
ATOM   4796  N  N9    . DG  B  2 88  ? 88.219 110.587 16.203  1.00 149.44 ? 14  DG  J N9    1 
ATOM   4797  C  C8    . DG  B  2 88  ? 89.317 111.089 15.547  1.00 151.65 ? 14  DG  J C8    1 
ATOM   4798  N  N7    . DG  B  2 88  ? 89.242 110.972 14.247  1.00 149.98 ? 14  DG  J N7    1 
ATOM   4799  C  C5    . DG  B  2 88  ? 88.023 110.337 14.034  1.00 146.97 ? 14  DG  J C5    1 
ATOM   4800  C  C6    . DG  B  2 88  ? 87.394 109.936 12.828  1.00 147.08 ? 14  DG  J C6    1 
ATOM   4801  O  O6    . DG  B  2 88  ? 87.800 110.068 11.665  1.00 149.98 ? 14  DG  J O6    1 
ATOM   4802  N  N1    . DG  B  2 88  ? 86.164 109.326 13.069  1.00 142.76 ? 14  DG  J N1    1 
ATOM   4803  C  C2    . DG  B  2 88  ? 85.616 109.128 14.315  1.00 138.12 ? 14  DG  J C2    1 
ATOM   4804  N  N2    . DG  B  2 88  ? 84.421 108.525 14.362  1.00 130.42 ? 14  DG  J N2    1 
ATOM   4805  N  N3    . DG  B  2 88  ? 86.195 109.499 15.444  1.00 140.48 ? 14  DG  J N3    1 
ATOM   4806  C  C4    . DG  B  2 88  ? 87.389 110.093 15.229  1.00 144.60 ? 14  DG  J C4    1 
ATOM   4807  P  P     . DC  B  2 89  ? 87.665 109.304 21.914  1.00 140.47 ? 15  DC  J P     1 
ATOM   4808  O  OP1   . DC  B  2 89  ? 87.549 110.613 22.595  1.00 139.77 ? 15  DC  J OP1   1 
ATOM   4809  O  OP2   . DC  B  2 89  ? 88.719 108.354 22.331  1.00 142.20 ? 15  DC  J OP2   1 
ATOM   4810  O  "O5'" . DC  B  2 89  ? 86.255 108.544 21.994  1.00 137.74 ? 15  DC  J "O5'" 1 
ATOM   4811  C  "C5'" . DC  B  2 89  ? 85.040 109.283 21.854  1.00 137.91 ? 15  DC  J "C5'" 1 
ATOM   4812  C  "C4'" . DC  B  2 89  ? 83.956 108.467 21.158  1.00 137.58 ? 15  DC  J "C4'" 1 
ATOM   4813  O  "O4'" . DC  B  2 89  ? 84.244 108.356 19.739  1.00 142.25 ? 15  DC  J "O4'" 1 
ATOM   4814  C  "C3'" . DC  B  2 89  ? 83.769 107.042 21.662  1.00 134.28 ? 15  DC  J "C3'" 1 
ATOM   4815  O  "O3'" . DC  B  2 89  ? 82.387 106.707 21.631  1.00 127.19 ? 15  DC  J "O3'" 1 
ATOM   4816  C  "C2'" . DC  B  2 89  ? 84.571 106.215 20.658  1.00 138.75 ? 15  DC  J "C2'" 1 
ATOM   4817  C  "C1'" . DC  B  2 89  ? 84.365 106.996 19.364  1.00 142.91 ? 15  DC  J "C1'" 1 
ATOM   4818  N  N1    . DC  B  2 89  ? 85.513 106.897 18.418  1.00 150.30 ? 15  DC  J N1    1 
ATOM   4819  C  C2    . DC  B  2 89  ? 85.317 106.454 17.096  1.00 150.99 ? 15  DC  J C2    1 
ATOM   4820  O  O2    . DC  B  2 89  ? 84.184 106.123 16.719  1.00 146.15 ? 15  DC  J O2    1 
ATOM   4821  N  N3    . DC  B  2 89  ? 86.391 106.395 16.266  1.00 157.14 ? 15  DC  J N3    1 
ATOM   4822  C  C4    . DC  B  2 89  ? 87.597 106.761 16.705  1.00 161.85 ? 15  DC  J C4    1 
ATOM   4823  N  N4    . DC  B  2 89  ? 88.625 106.687 15.855  1.00 165.94 ? 15  DC  J N4    1 
ATOM   4824  C  C5    . DC  B  2 89  ? 87.807 107.210 18.037  1.00 161.01 ? 15  DC  J C5    1 
ATOM   4825  C  C6    . DC  B  2 89  ? 86.750 107.267 18.845  1.00 156.76 ? 15  DC  J C6    1 
ATOM   4826  P  P     . DC  B  2 90  ? 81.838 105.426 22.430  1.00 129.88 ? 16  DC  J P     1 
ATOM   4827  O  OP1   . DC  B  2 90  ? 80.461 105.733 22.876  1.00 124.66 ? 16  DC  J OP1   1 
ATOM   4828  O  OP2   . DC  B  2 90  ? 82.863 105.031 23.420  1.00 131.12 ? 16  DC  J OP2   1 
ATOM   4829  O  "O5'" . DC  B  2 90  ? 81.772 104.285 21.314  1.00 128.00 ? 16  DC  J "O5'" 1 
ATOM   4830  C  "C5'" . DC  B  2 90  ? 80.994 104.483 20.138  1.00 122.24 ? 16  DC  J "C5'" 1 
ATOM   4831  C  "C4'" . DC  B  2 90  ? 81.230 103.367 19.132  1.00 120.71 ? 16  DC  J "C4'" 1 
ATOM   4832  O  "O4'" . DC  B  2 90  ? 82.542 103.522 18.523  1.00 126.30 ? 16  DC  J "O4'" 1 
ATOM   4833  C  "C3'" . DC  B  2 90  ? 81.219 101.953 19.709  1.00 119.62 ? 16  DC  J "C3'" 1 
ATOM   4834  O  "O3'" . DC  B  2 90  ? 80.753 101.047 18.717  1.00 117.94 ? 16  DC  J "O3'" 1 
ATOM   4835  C  "C2'" . DC  B  2 90  ? 82.698 101.728 19.989  1.00 125.82 ? 16  DC  J "C2'" 1 
ATOM   4836  C  "C1'" . DC  B  2 90  ? 83.281 102.336 18.729  1.00 130.17 ? 16  DC  J "C1'" 1 
ATOM   4837  N  N1    . DC  B  2 90  ? 84.729 102.674 18.807  1.00 141.11 ? 16  DC  J N1    1 
ATOM   4838  C  C2    . DC  B  2 90  ? 85.478 102.703 17.630  1.00 146.90 ? 16  DC  J C2    1 
ATOM   4839  O  O2    . DC  B  2 90  ? 84.910 102.445 16.564  1.00 147.39 ? 16  DC  J O2    1 
ATOM   4840  N  N3    . DC  B  2 90  ? 86.796 103.012 17.694  1.00 151.65 ? 16  DC  J N3    1 
ATOM   4841  C  C4    . DC  B  2 90  ? 87.359 103.283 18.873  1.00 153.46 ? 16  DC  J C4    1 
ATOM   4842  N  N4    . DC  B  2 90  ? 88.663 103.583 18.890  1.00 158.66 ? 16  DC  J N4    1 
ATOM   4843  C  C5    . DC  B  2 90  ? 86.610 103.257 20.088  1.00 149.57 ? 16  DC  J C5    1 
ATOM   4844  C  C6    . DC  B  2 90  ? 85.310 102.947 20.009  1.00 144.20 ? 16  DC  J C6    1 
ATOM   4845  P  P     . DT  B  2 91  ? 79.626 99.955  19.060  1.00 124.63 ? 17  DT  J P     1 
ATOM   4846  O  OP1   . DT  B  2 91  ? 78.396 100.688 19.434  1.00 121.22 ? 17  DT  J OP1   1 
ATOM   4847  O  OP2   . DT  B  2 91  ? 80.212 98.970  19.995  1.00 125.59 ? 17  DT  J OP2   1 
ATOM   4848  O  "O5'" . DT  B  2 91  ? 79.378 99.221  17.660  1.00 117.52 ? 17  DT  J "O5'" 1 
ATOM   4849  C  "C5'" . DT  B  2 91  ? 78.731 99.920  16.602  1.00 106.25 ? 17  DT  J "C5'" 1 
ATOM   4850  C  "C4'" . DT  B  2 91  ? 79.483 99.759  15.292  1.00 101.57 ? 17  DT  J "C4'" 1 
ATOM   4851  O  "O4'" . DT  B  2 91  ? 80.878 100.116 15.483  1.00 103.66 ? 17  DT  J "O4'" 1 
ATOM   4852  C  "C3'" . DT  B  2 91  ? 79.473 98.345  14.710  1.00 100.16 ? 17  DT  J "C3'" 1 
ATOM   4853  O  "O3'" . DT  B  2 91  ? 79.197 98.392  13.316  1.00 95.79  ? 17  DT  J "O3'" 1 
ATOM   4854  C  "C2'" . DT  B  2 91  ? 80.884 97.833  14.987  1.00 104.21 ? 17  DT  J "C2'" 1 
ATOM   4855  C  "C1'" . DT  B  2 91  ? 81.702 99.113  14.935  1.00 108.35 ? 17  DT  J "C1'" 1 
ATOM   4856  N  N1    . DT  B  2 91  ? 82.963 99.047  15.737  1.00 120.15 ? 17  DT  J N1    1 
ATOM   4857  C  C2    . DT  B  2 91  ? 84.180 99.169  15.100  1.00 122.93 ? 17  DT  J C2    1 
ATOM   4858  O  O2    . DT  B  2 91  ? 84.293 99.332  13.898  1.00 120.79 ? 17  DT  J O2    1 
ATOM   4859  N  N3    . DT  B  2 91  ? 85.268 99.094  15.931  1.00 126.10 ? 17  DT  J N3    1 
ATOM   4860  C  C4    . DT  B  2 91  ? 85.262 98.914  17.302  1.00 128.36 ? 17  DT  J C4    1 
ATOM   4861  O  O4    . DT  B  2 91  ? 86.292 98.858  17.964  1.00 134.49 ? 17  DT  J O4    1 
ATOM   4862  C  C5    . DT  B  2 91  ? 83.957 98.790  17.903  1.00 124.16 ? 17  DT  J C5    1 
ATOM   4863  C  C7    . DT  B  2 91  ? 83.830 98.583  19.382  1.00 125.37 ? 17  DT  J C7    1 
ATOM   4864  C  C6    . DT  B  2 91  ? 82.883 98.865  17.103  1.00 123.07 ? 17  DT  J C6    1 
ATOM   4865  P  P     . DT  B  2 92  ? 78.780 97.053  12.530  1.00 97.19  ? 18  DT  J P     1 
ATOM   4866  O  OP1   . DT  B  2 92  ? 77.933 97.449  11.382  1.00 96.69  ? 18  DT  J OP1   1 
ATOM   4867  O  OP2   . DT  B  2 92  ? 78.261 96.088  13.524  1.00 89.57  ? 18  DT  J OP2   1 
ATOM   4868  O  "O5'" . DT  B  2 92  ? 80.170 96.494  11.971  1.00 100.23 ? 18  DT  J "O5'" 1 
ATOM   4869  C  "C5'" . DT  B  2 92  ? 80.902 97.255  11.025  1.00 101.55 ? 18  DT  J "C5'" 1 
ATOM   4870  C  "C4'" . DT  B  2 92  ? 82.263 96.636  10.759  1.00 107.79 ? 18  DT  J "C4'" 1 
ATOM   4871  O  "O4'" . DT  B  2 92  ? 83.150 96.881  11.881  1.00 110.18 ? 18  DT  J "O4'" 1 
ATOM   4872  C  "C3'" . DT  B  2 92  ? 82.264 95.121  10.536  1.00 111.65 ? 18  DT  J "C3'" 1 
ATOM   4873  O  "O3'" . DT  B  2 92  ? 83.016 94.820  9.371   1.00 118.96 ? 18  DT  J "O3'" 1 
ATOM   4874  C  "C2'" . DT  B  2 92  ? 82.937 94.575  11.801  1.00 111.69 ? 18  DT  J "C2'" 1 
ATOM   4875  C  "C1'" . DT  B  2 92  ? 83.885 95.712  12.138  1.00 112.89 ? 18  DT  J "C1'" 1 
ATOM   4876  N  N1    . DT  B  2 92  ? 84.336 95.738  13.562  1.00 118.85 ? 18  DT  J N1    1 
ATOM   4877  C  C2    . DT  B  2 92  ? 85.674 95.915  13.839  1.00 131.04 ? 18  DT  J C2    1 
ATOM   4878  O  O2    . DT  B  2 92  ? 86.522 96.044  12.975  1.00 137.91 ? 18  DT  J O2    1 
ATOM   4879  N  N3    . DT  B  2 92  ? 85.986 95.933  15.173  1.00 134.77 ? 18  DT  J N3    1 
ATOM   4880  C  C4    . DT  B  2 92  ? 85.111 95.796  16.236  1.00 132.58 ? 18  DT  J C4    1 
ATOM   4881  O  O4    . DT  B  2 92  ? 85.486 95.824  17.404  1.00 135.40 ? 18  DT  J O4    1 
ATOM   4882  C  C5    . DT  B  2 92  ? 83.724 95.616  15.876  1.00 128.08 ? 18  DT  J C5    1 
ATOM   4883  C  C7    . DT  B  2 92  ? 82.684 95.453  16.945  1.00 131.77 ? 18  DT  J C7    1 
ATOM   4884  C  C6    . DT  B  2 92  ? 83.408 95.596  14.571  1.00 119.75 ? 18  DT  J C6    1 
ATOM   4885  P  P     . DT  B  2 93  ? 82.776 93.448  8.572   1.00 112.69 ? 19  DT  J P     1 
ATOM   4886  O  OP1   . DT  B  2 93  ? 82.724 93.775  7.130   1.00 113.32 ? 19  DT  J OP1   1 
ATOM   4887  O  OP2   . DT  B  2 93  ? 81.642 92.738  9.204   1.00 112.85 ? 19  DT  J OP2   1 
ATOM   4888  O  "O5'" . DT  B  2 93  ? 84.104 92.613  8.864   1.00 120.37 ? 19  DT  J "O5'" 1 
ATOM   4889  C  "C5'" . DT  B  2 93  ? 85.371 93.249  8.765   1.00 126.68 ? 19  DT  J "C5'" 1 
ATOM   4890  C  "C4'" . DT  B  2 93  ? 86.426 92.462  9.516   1.00 135.20 ? 19  DT  J "C4'" 1 
ATOM   4891  O  "O4'" . DT  B  2 93  ? 86.456 92.877  10.912  1.00 138.90 ? 19  DT  J "O4'" 1 
ATOM   4892  C  "C3'" . DT  B  2 93  ? 86.207 90.945  9.533   1.00 137.80 ? 19  DT  J "C3'" 1 
ATOM   4893  O  "O3'" . DT  B  2 93  ? 87.437 90.285  9.311   1.00 139.39 ? 19  DT  J "O3'" 1 
ATOM   4894  C  "C2'" . DT  B  2 93  ? 85.705 90.696  10.952  1.00 139.89 ? 19  DT  J "C2'" 1 
ATOM   4895  C  "C1'" . DT  B  2 93  ? 86.526 91.722  11.708  1.00 142.78 ? 19  DT  J "C1'" 1 
ATOM   4896  N  N1    . DT  B  2 93  ? 86.020 92.022  13.084  1.00 147.84 ? 19  DT  J N1    1 
ATOM   4897  C  C2    . DT  B  2 93  ? 86.923 92.322  14.078  1.00 151.17 ? 19  DT  J C2    1 
ATOM   4898  O  O2    . DT  B  2 93  ? 88.126 92.374  13.892  1.00 151.99 ? 19  DT  J O2    1 
ATOM   4899  N  N3    . DT  B  2 93  ? 86.369 92.569  15.307  1.00 151.78 ? 19  DT  J N3    1 
ATOM   4900  C  C4    . DT  B  2 93  ? 85.025 92.540  15.634  1.00 146.39 ? 19  DT  J C4    1 
ATOM   4901  O  O4    . DT  B  2 93  ? 84.620 92.777  16.768  1.00 141.97 ? 19  DT  J O4    1 
ATOM   4902  C  C5    . DT  B  2 93  ? 84.131 92.211  14.546  1.00 145.99 ? 19  DT  J C5    1 
ATOM   4903  C  C7    . DT  B  2 93  ? 82.650 92.148  14.779  1.00 144.22 ? 19  DT  J C7    1 
ATOM   4904  C  C6    . DT  B  2 93  ? 84.666 91.970  13.339  1.00 147.40 ? 19  DT  J C6    1 
ATOM   4905  P  P     . DT  B  2 94  ? 87.691 89.450  7.964   1.00 151.23 ? 20  DT  J P     1 
ATOM   4906  O  OP1   . DT  B  2 94  ? 87.967 90.417  6.878   1.00 150.87 ? 20  DT  J OP1   1 
ATOM   4907  O  OP2   . DT  B  2 94  ? 86.593 88.468  7.816   1.00 147.02 ? 20  DT  J OP2   1 
ATOM   4908  O  "O5'" . DT  B  2 94  ? 89.030 88.642  8.290   1.00 153.75 ? 20  DT  J "O5'" 1 
ATOM   4909  C  "C5'" . DT  B  2 94  ? 89.875 89.082  9.351   1.00 156.60 ? 20  DT  J "C5'" 1 
ATOM   4910  C  "C4'" . DT  B  2 94  ? 90.019 88.002  10.407  1.00 160.99 ? 20  DT  J "C4'" 1 
ATOM   4911  O  "O4'" . DT  B  2 94  ? 89.493 88.472  11.680  1.00 158.30 ? 20  DT  J "O4'" 1 
ATOM   4912  C  "C3'" . DT  B  2 94  ? 89.272 86.692  10.105  1.00 167.50 ? 20  DT  J "C3'" 1 
ATOM   4913  O  "O3'" . DT  B  2 94  ? 90.064 85.571  10.501  1.00 184.04 ? 20  DT  J "O3'" 1 
ATOM   4914  C  "C2'" . DT  B  2 94  ? 88.045 86.813  11.007  1.00 160.33 ? 20  DT  J "C2'" 1 
ATOM   4915  C  "C1'" . DT  B  2 94  ? 88.701 87.444  12.217  1.00 158.15 ? 20  DT  J "C1'" 1 
ATOM   4916  N  N1    . DT  B  2 94  ? 87.758 88.003  13.238  1.00 152.61 ? 20  DT  J N1    1 
ATOM   4917  C  C2    . DT  B  2 94  ? 88.261 88.409  14.452  1.00 152.01 ? 20  DT  J C2    1 
ATOM   4918  O  O2    . DT  B  2 94  ? 89.444 88.354  14.734  1.00 155.09 ? 20  DT  J O2    1 
ATOM   4919  N  N3    . DT  B  2 94  ? 87.329 88.893  15.329  1.00 146.96 ? 20  DT  J N3    1 
ATOM   4920  C  C4    . DT  B  2 94  ? 85.967 89.004  15.123  1.00 142.29 ? 20  DT  J C4    1 
ATOM   4921  O  O4    . DT  B  2 94  ? 85.211 89.455  15.980  1.00 139.88 ? 20  DT  J O4    1 
ATOM   4922  C  C5    . DT  B  2 94  ? 85.499 88.551  13.831  1.00 141.20 ? 20  DT  J C5    1 
ATOM   4923  C  C7    . DT  B  2 94  ? 84.040 88.617  13.489  1.00 138.07 ? 20  DT  J C7    1 
ATOM   4924  C  C6    . DT  B  2 94  ? 86.408 88.071  12.964  1.00 145.10 ? 20  DT  J C6    1 
ATOM   4925  P  P     . DG  B  2 95  ? 91.407 85.151  9.720   1.00 164.97 ? 21  DG  J P     1 
ATOM   4926  O  OP1   . DG  B  2 95  ? 91.891 86.248  8.853   1.00 168.24 ? 21  DG  J OP1   1 
ATOM   4927  O  OP2   . DG  B  2 95  ? 91.149 83.825  9.119   1.00 166.98 ? 21  DG  J OP2   1 
ATOM   4928  O  "O5'" . DG  B  2 95  ? 92.451 84.932  10.910  1.00 167.40 ? 21  DG  J "O5'" 1 
ATOM   4929  C  "C5'" . DG  B  2 95  ? 92.285 85.655  12.127  1.00 166.65 ? 21  DG  J "C5'" 1 
ATOM   4930  C  "C4'" . DG  B  2 95  ? 92.551 84.768  13.329  1.00 167.68 ? 21  DG  J "C4'" 1 
ATOM   4931  O  "O4'" . DG  B  2 95  ? 91.672 85.155  14.421  1.00 167.71 ? 21  DG  J "O4'" 1 
ATOM   4932  C  "C3'" . DG  B  2 95  ? 92.298 83.282  13.113  1.00 166.74 ? 21  DG  J "C3'" 1 
ATOM   4933  O  "O3'" . DG  B  2 95  ? 93.180 82.537  13.944  1.00 167.85 ? 21  DG  J "O3'" 1 
ATOM   4934  C  "C2'" . DG  B  2 95  ? 90.846 83.137  13.557  1.00 165.85 ? 21  DG  J "C2'" 1 
ATOM   4935  C  "C1'" . DG  B  2 95  ? 90.813 84.078  14.750  1.00 168.92 ? 21  DG  J "C1'" 1 
ATOM   4936  N  N9    . DG  B  2 95  ? 89.488 84.618  15.040  1.00 169.65 ? 21  DG  J N9    1 
ATOM   4937  C  C8    . DG  B  2 95  ? 88.436 84.758  14.167  1.00 167.28 ? 21  DG  J C8    1 
ATOM   4938  N  N7    . DG  B  2 95  ? 87.374 85.284  14.713  1.00 165.27 ? 21  DG  J N7    1 
ATOM   4939  C  C5    . DG  B  2 95  ? 87.747 85.505  16.034  1.00 167.34 ? 21  DG  J C5    1 
ATOM   4940  C  C6    . DG  B  2 95  ? 87.012 86.056  17.110  1.00 167.27 ? 21  DG  J C6    1 
ATOM   4941  O  O6    . DG  B  2 95  ? 85.844 86.470  17.111  1.00 165.65 ? 21  DG  J O6    1 
ATOM   4942  N  N1    . DG  B  2 95  ? 87.767 86.099  18.281  1.00 169.51 ? 21  DG  J N1    1 
ATOM   4943  C  C2    . DG  B  2 95  ? 89.068 85.667  18.393  1.00 170.79 ? 21  DG  J C2    1 
ATOM   4944  N  N2    . DG  B  2 95  ? 89.642 85.785  19.598  1.00 171.87 ? 21  DG  J N2    1 
ATOM   4945  N  N3    . DG  B  2 95  ? 89.765 85.151  17.392  1.00 171.90 ? 21  DG  J N3    1 
ATOM   4946  C  C4    . DG  B  2 95  ? 89.045 85.101  16.248  1.00 170.27 ? 21  DG  J C4    1 
ATOM   4947  P  P     . DA  B  2 96  ? 93.200 80.930  13.914  1.00 178.96 ? 22  DA  J P     1 
ATOM   4948  O  OP1   . DA  B  2 96  ? 94.612 80.522  13.738  1.00 180.14 ? 22  DA  J OP1   1 
ATOM   4949  O  OP2   . DA  B  2 96  ? 92.180 80.440  12.961  1.00 176.53 ? 22  DA  J OP2   1 
ATOM   4950  O  "O5'" . DA  B  2 96  ? 92.726 80.533  15.388  1.00 174.45 ? 22  DA  J "O5'" 1 
ATOM   4951  C  "C5'" . DA  B  2 96  ? 93.017 81.403  16.478  1.00 171.57 ? 22  DA  J "C5'" 1 
ATOM   4952  C  "C4'" . DA  B  2 96  ? 92.243 81.000  17.719  1.00 170.24 ? 22  DA  J "C4'" 1 
ATOM   4953  O  "O4'" . DA  B  2 96  ? 91.030 81.801  17.834  1.00 166.93 ? 22  DA  J "O4'" 1 
ATOM   4954  C  "C3'" . DA  B  2 96  ? 91.783 79.539  17.753  1.00 171.96 ? 22  DA  J "C3'" 1 
ATOM   4955  O  "O3'" . DA  B  2 96  ? 91.936 79.033  19.068  1.00 177.90 ? 22  DA  J "O3'" 1 
ATOM   4956  C  "C2'" . DA  B  2 96  ? 90.311 79.657  17.380  1.00 168.07 ? 22  DA  J "C2'" 1 
ATOM   4957  C  "C1'" . DA  B  2 96  ? 89.955 80.935  18.110  1.00 166.45 ? 22  DA  J "C1'" 1 
ATOM   4958  N  N9    . DA  B  2 96  ? 88.702 81.549  17.671  1.00 162.30 ? 22  DA  J N9    1 
ATOM   4959  C  C8    . DA  B  2 96  ? 88.193 81.571  16.402  1.00 160.02 ? 22  DA  J C8    1 
ATOM   4960  N  N7    . DA  B  2 96  ? 87.038 82.189  16.306  1.00 157.91 ? 22  DA  J N7    1 
ATOM   4961  C  C5    . DA  B  2 96  ? 86.769 82.599  17.603  1.00 158.34 ? 22  DA  J C5    1 
ATOM   4962  C  C6    . DA  B  2 96  ? 85.690 83.309  18.173  1.00 156.59 ? 22  DA  J C6    1 
ATOM   4963  N  N6    . DA  B  2 96  ? 84.645 83.747  17.465  1.00 153.60 ? 22  DA  J N6    1 
ATOM   4964  N  N1    . DA  B  2 96  ? 85.731 83.555  19.502  1.00 158.15 ? 22  DA  J N1    1 
ATOM   4965  C  C2    . DA  B  2 96  ? 86.782 83.114  20.205  1.00 158.81 ? 22  DA  J C2    1 
ATOM   4966  N  N3    . DA  B  2 96  ? 87.852 82.437  19.781  1.00 159.46 ? 22  DA  J N3    1 
ATOM   4967  C  C4    . DA  B  2 96  ? 87.783 82.210  18.458  1.00 160.29 ? 22  DA  J C4    1 
ATOM   4968  P  P     . DT  B  2 97  ? 91.809 77.460  19.376  1.00 179.98 ? 23  DT  J P     1 
ATOM   4969  O  OP1   . DT  B  2 97  ? 93.125 76.842  19.100  1.00 185.91 ? 23  DT  J OP1   1 
ATOM   4970  O  OP2   . DT  B  2 97  ? 90.596 76.926  18.718  1.00 177.38 ? 23  DT  J OP2   1 
ATOM   4971  O  "O5'" . DT  B  2 97  ? 91.541 77.426  20.949  1.00 176.92 ? 23  DT  J "O5'" 1 
ATOM   4972  C  "C5'" . DT  B  2 97  ? 91.721 78.610  21.719  1.00 171.15 ? 23  DT  J "C5'" 1 
ATOM   4973  C  "C4'" . DT  B  2 97  ? 90.624 78.747  22.757  1.00 165.25 ? 23  DT  J "C4'" 1 
ATOM   4974  O  "O4'" . DT  B  2 97  ? 89.520 79.517  22.206  1.00 160.81 ? 23  DT  J "O4'" 1 
ATOM   4975  C  "C3'" . DT  B  2 97  ? 90.030 77.420  23.230  1.00 162.37 ? 23  DT  J "C3'" 1 
ATOM   4976  O  "O3'" . DT  B  2 97  ? 89.914 77.412  24.644  1.00 160.07 ? 23  DT  J "O3'" 1 
ATOM   4977  C  "C2'" . DT  B  2 97  ? 88.664 77.378  22.549  1.00 160.17 ? 23  DT  J "C2'" 1 
ATOM   4978  C  "C1'" . DT  B  2 97  ? 88.307 78.854  22.476  1.00 159.40 ? 23  DT  J "C1'" 1 
ATOM   4979  N  N1    . DT  B  2 97  ? 87.330 79.177  21.387  1.00 157.65 ? 23  DT  J N1    1 
ATOM   4980  C  C2    . DT  B  2 97  ? 86.192 79.899  21.685  1.00 155.71 ? 23  DT  J C2    1 
ATOM   4981  O  O2    . DT  B  2 97  ? 85.930 80.303  22.803  1.00 158.45 ? 23  DT  J O2    1 
ATOM   4982  N  N3    . DT  B  2 97  ? 85.368 80.133  20.612  1.00 150.07 ? 23  DT  J N3    1 
ATOM   4983  C  C4    . DT  B  2 97  ? 85.562 79.725  19.305  1.00 147.98 ? 23  DT  J C4    1 
ATOM   4984  O  O4    . DT  B  2 97  ? 84.765 79.982  18.408  1.00 143.70 ? 23  DT  J O4    1 
ATOM   4985  C  C5    . DT  B  2 97  ? 86.767 78.974  19.065  1.00 151.80 ? 23  DT  J C5    1 
ATOM   4986  C  C7    . DT  B  2 97  ? 87.077 78.478  17.684  1.00 150.27 ? 23  DT  J C7    1 
ATOM   4987  C  C6    . DT  B  2 97  ? 87.583 78.737  20.104  1.00 156.99 ? 23  DT  J C6    1 
ATOM   4988  P  P     . DG  B  2 98  ? 90.127 76.044  25.459  1.00 177.56 ? 24  DG  J P     1 
ATOM   4989  O  OP1   . DG  B  2 98  ? 91.430 76.119  26.157  1.00 181.32 ? 24  DG  J OP1   1 
ATOM   4990  O  OP2   . DG  B  2 98  ? 89.852 74.930  24.523  1.00 178.38 ? 24  DG  J OP2   1 
ATOM   4991  O  "O5'" . DG  B  2 98  ? 88.949 76.057  26.537  1.00 166.98 ? 24  DG  J "O5'" 1 
ATOM   4992  C  "C5'" . DG  B  2 98  ? 87.618 75.791  26.126  1.00 152.39 ? 24  DG  J "C5'" 1 
ATOM   4993  C  "C4'" . DG  B  2 98  ? 86.628 76.597  26.940  1.00 143.03 ? 24  DG  J "C4'" 1 
ATOM   4994  O  "O4'" . DG  B  2 98  ? 86.008 77.593  26.092  1.00 138.38 ? 24  DG  J "O4'" 1 
ATOM   4995  C  "C3'" . DG  B  2 98  ? 85.478 75.791  27.508  1.00 140.24 ? 24  DG  J "C3'" 1 
ATOM   4996  O  "O3'" . DG  B  2 98  ? 84.967 76.410  28.678  1.00 137.41 ? 24  DG  J "O3'" 1 
ATOM   4997  C  "C2'" . DG  B  2 98  ? 84.465 75.812  26.370  1.00 140.06 ? 24  DG  J "C2'" 1 
ATOM   4998  C  "C1'" . DG  B  2 98  ? 84.709 77.171  25.714  1.00 137.31 ? 24  DG  J "C1'" 1 
ATOM   4999  N  N9    . DG  B  2 98  ? 84.647 77.128  24.253  1.00 134.88 ? 24  DG  J N9    1 
ATOM   5000  C  C8    . DG  B  2 98  ? 85.593 76.610  23.405  1.00 136.58 ? 24  DG  J C8    1 
ATOM   5001  N  N7    . DG  B  2 98  ? 85.276 76.709  22.144  1.00 134.52 ? 24  DG  J N7    1 
ATOM   5002  C  C5    . DG  B  2 98  ? 84.035 77.329  22.154  1.00 131.88 ? 24  DG  J C5    1 
ATOM   5003  C  C6    . DG  B  2 98  ? 83.194 77.697  21.077  1.00 126.41 ? 24  DG  J C6    1 
ATOM   5004  O  O6    . DG  B  2 98  ? 83.388 77.539  19.863  1.00 124.40 ? 24  DG  J O6    1 
ATOM   5005  N  N1    . DG  B  2 98  ? 82.023 78.304  21.522  1.00 124.33 ? 24  DG  J N1    1 
ATOM   5006  C  C2    . DG  B  2 98  ? 81.706 78.528  22.843  1.00 126.32 ? 24  DG  J C2    1 
ATOM   5007  N  N2    . DG  B  2 98  ? 80.531 79.128  23.083  1.00 121.79 ? 24  DG  J N2    1 
ATOM   5008  N  N3    . DG  B  2 98  ? 82.487 78.189  23.862  1.00 130.54 ? 24  DG  J N3    1 
ATOM   5009  C  C4    . DG  B  2 98  ? 83.631 77.595  23.445  1.00 132.59 ? 24  DG  J C4    1 
ATOM   5010  P  P     . DG  B  2 99  ? 84.248 75.519  29.806  1.00 137.48 ? 25  DG  J P     1 
ATOM   5011  O  OP1   . DG  B  2 99  ? 84.275 76.277  31.077  1.00 139.58 ? 25  DG  J OP1   1 
ATOM   5012  O  OP2   . DG  B  2 99  ? 84.839 74.164  29.743  1.00 138.15 ? 25  DG  J OP2   1 
ATOM   5013  O  "O5'" . DG  B  2 99  ? 82.739 75.402  29.291  1.00 133.69 ? 25  DG  J "O5'" 1 
ATOM   5014  C  "C5'" . DG  B  2 99  ? 82.047 76.561  28.848  1.00 129.34 ? 25  DG  J "C5'" 1 
ATOM   5015  C  "C4'" . DG  B  2 99  ? 80.866 76.181  27.975  1.00 126.87 ? 25  DG  J "C4'" 1 
ATOM   5016  O  "O4'" . DG  B  2 99  ? 81.274 76.118  26.577  1.00 125.52 ? 25  DG  J "O4'" 1 
ATOM   5017  C  "C3'" . DG  B  2 99  ? 80.239 74.813  28.287  1.00 128.25 ? 25  DG  J "C3'" 1 
ATOM   5018  O  "O3'" . DG  B  2 99  ? 78.829 74.919  28.222  1.00 132.45 ? 25  DG  J "O3'" 1 
ATOM   5019  C  "C2'" . DG  B  2 99  ? 80.763 73.946  27.145  1.00 128.45 ? 25  DG  J "C2'" 1 
ATOM   5020  C  "C1'" . DG  B  2 99  ? 80.705 74.960  26.022  1.00 126.39 ? 25  DG  J "C1'" 1 
ATOM   5021  N  N9    . DG  B  2 99  ? 81.415 74.573  24.801  1.00 125.20 ? 25  DG  J N9    1 
ATOM   5022  C  C8    . DG  B  2 99  ? 82.565 73.828  24.700  1.00 127.71 ? 25  DG  J C8    1 
ATOM   5023  N  N7    . DG  B  2 99  ? 82.954 73.636  23.468  1.00 126.84 ? 25  DG  J N7    1 
ATOM   5024  C  C5    . DG  B  2 99  ? 81.990 74.281  22.703  1.00 123.54 ? 25  DG  J C5    1 
ATOM   5025  C  C6    . DG  B  2 99  ? 81.873 74.412  21.297  1.00 121.34 ? 25  DG  J C6    1 
ATOM   5026  O  O6    . DG  B  2 99  ? 82.624 73.969  20.417  1.00 123.43 ? 25  DG  J O6    1 
ATOM   5027  N  N1    . DG  B  2 99  ? 80.743 75.146  20.940  1.00 118.34 ? 25  DG  J N1    1 
ATOM   5028  C  C2    . DG  B  2 99  ? 79.842 75.682  21.830  1.00 117.59 ? 25  DG  J C2    1 
ATOM   5029  N  N2    . DG  B  2 99  ? 78.813 76.362  21.309  1.00 114.70 ? 25  DG  J N2    1 
ATOM   5030  N  N3    . DG  B  2 99  ? 79.942 75.566  23.145  1.00 119.61 ? 25  DG  J N3    1 
ATOM   5031  C  C4    . DG  B  2 99  ? 81.035 74.857  23.509  1.00 122.52 ? 25  DG  J C4    1 
ATOM   5032  P  P     . DA  B  2 100 ? 77.940 75.053  29.552  1.00 128.01 ? 26  DA  J P     1 
ATOM   5033  O  OP1   . DA  B  2 100 ? 78.634 75.983  30.470  1.00 127.82 ? 26  DA  J OP1   1 
ATOM   5034  O  OP2   . DA  B  2 100 ? 77.601 73.686  30.009  1.00 128.92 ? 26  DA  J OP2   1 
ATOM   5035  O  "O5'" . DA  B  2 100 ? 76.596 75.750  29.024  1.00 123.40 ? 26  DA  J "O5'" 1 
ATOM   5036  C  "C5'" . DA  B  2 100 ? 76.655 77.064  28.472  1.00 120.94 ? 26  DA  J "C5'" 1 
ATOM   5037  C  "C4'" . DA  B  2 100 ? 75.610 77.275  27.378  1.00 117.85 ? 26  DA  J "C4'" 1 
ATOM   5038  O  "O4'" . DA  B  2 100 ? 76.127 76.845  26.094  1.00 117.17 ? 26  DA  J "O4'" 1 
ATOM   5039  C  "C3'" . DA  B  2 100 ? 74.291 76.543  27.549  1.00 117.53 ? 26  DA  J "C3'" 1 
ATOM   5040  O  "O3'" . DA  B  2 100 ? 73.266 77.320  26.947  1.00 114.58 ? 26  DA  J "O3'" 1 
ATOM   5041  C  "C2'" . DA  B  2 100 ? 74.536 75.240  26.782  1.00 118.37 ? 26  DA  J "C2'" 1 
ATOM   5042  C  "C1'" . DA  B  2 100 ? 75.400 75.722  25.619  1.00 117.07 ? 26  DA  J "C1'" 1 
ATOM   5043  N  N9    . DA  B  2 100 ? 76.383 74.751  25.149  1.00 118.81 ? 26  DA  J N9    1 
ATOM   5044  C  C8    . DA  B  2 100 ? 77.300 74.086  25.906  1.00 121.88 ? 26  DA  J C8    1 
ATOM   5045  N  N7    . DA  B  2 100 ? 78.089 73.301  25.217  1.00 122.93 ? 26  DA  J N7    1 
ATOM   5046  C  C5    . DA  B  2 100 ? 77.676 73.477  23.910  1.00 120.32 ? 26  DA  J C5    1 
ATOM   5047  C  C6    . DA  B  2 100 ? 78.120 72.921  22.696  1.00 119.93 ? 26  DA  J C6    1 
ATOM   5048  N  N6    . DA  B  2 100 ? 79.123 72.041  22.618  1.00 122.29 ? 26  DA  J N6    1 
ATOM   5049  N  N1    . DA  B  2 100 ? 77.493 73.303  21.565  1.00 117.11 ? 26  DA  J N1    1 
ATOM   5050  C  C2    . DA  B  2 100 ? 76.490 74.185  21.652  1.00 114.86 ? 26  DA  J C2    1 
ATOM   5051  N  N3    . DA  B  2 100 ? 75.985 74.777  22.738  1.00 114.97 ? 26  DA  J N3    1 
ATOM   5052  C  C4    . DA  B  2 100 ? 76.631 74.375  23.844  1.00 117.77 ? 26  DA  J C4    1 
ATOM   5053  P  P     . DG  B  2 101 ? 71.718 77.010  27.231  1.00 93.13  ? 27  DG  J P     1 
ATOM   5054  O  OP1   . DG  B  2 101 ? 70.982 78.291  27.127  1.00 96.12  ? 27  DG  J OP1   1 
ATOM   5055  O  OP2   . DG  B  2 101 ? 71.631 76.196  28.465  1.00 93.62  ? 27  DG  J OP2   1 
ATOM   5056  O  "O5'" . DG  B  2 101 ? 71.291 76.096  25.995  1.00 91.61  ? 27  DG  J "O5'" 1 
ATOM   5057  C  "C5'" . DG  B  2 101 ? 71.568 76.527  24.668  1.00 86.27  ? 27  DG  J "C5'" 1 
ATOM   5058  C  "C4'" . DG  B  2 101 ? 71.378 75.389  23.687  1.00 81.82  ? 27  DG  J "C4'" 1 
ATOM   5059  O  "O4'" . DG  B  2 101 ? 72.587 74.579  23.635  1.00 84.57  ? 27  DG  J "O4'" 1 
ATOM   5060  C  "C3'" . DG  B  2 101 ? 70.246 74.416  24.040  1.00 81.30  ? 27  DG  J "C3'" 1 
ATOM   5061  O  "O3'" . DG  B  2 101 ? 69.612 73.977  22.848  1.00 83.49  ? 27  DG  J "O3'" 1 
ATOM   5062  C  "C2'" . DG  B  2 101 ? 71.010 73.271  24.693  1.00 86.06  ? 27  DG  J "C2'" 1 
ATOM   5063  C  "C1'" . DG  B  2 101 ? 72.209 73.233  23.771  1.00 88.77  ? 27  DG  J "C1'" 1 
ATOM   5064  N  N9    . DG  B  2 101 ? 73.336 72.439  24.251  1.00 100.29 ? 27  DG  J N9    1 
ATOM   5065  C  C8    . DG  B  2 101 ? 73.709 72.206  25.553  1.00 105.51 ? 27  DG  J C8    1 
ATOM   5066  N  N7    . DG  B  2 101 ? 74.763 71.440  25.660  1.00 109.52 ? 27  DG  J N7    1 
ATOM   5067  C  C5    . DG  B  2 101 ? 75.102 71.143  24.344  1.00 108.18 ? 27  DG  J C5    1 
ATOM   5068  C  C6    . DG  B  2 101 ? 76.156 70.350  23.823  1.00 112.98 ? 27  DG  J C6    1 
ATOM   5069  O  O6    . DG  B  2 101 ? 77.034 69.732  24.442  1.00 119.29 ? 27  DG  J O6    1 
ATOM   5070  N  N1    . DG  B  2 101 ? 76.132 70.314  22.429  1.00 110.63 ? 27  DG  J N1    1 
ATOM   5071  C  C2    . DG  B  2 101 ? 75.207 70.960  21.643  1.00 105.96 ? 27  DG  J C2    1 
ATOM   5072  N  N2    . DG  B  2 101 ? 75.335 70.817  20.317  1.00 103.73 ? 27  DG  J N2    1 
ATOM   5073  N  N3    . DG  B  2 101 ? 74.220 71.701  22.120  1.00 103.86 ? 27  DG  J N3    1 
ATOM   5074  C  C4    . DG  B  2 101 ? 74.228 71.747  23.471  1.00 104.35 ? 27  DG  J C4    1 
ATOM   5075  P  P     . DC  B  2 102 ? 68.250 74.658  22.332  1.00 83.16  ? 28  DC  J P     1 
ATOM   5076  O  OP1   . DC  B  2 102 ? 68.354 76.116  22.558  1.00 80.27  ? 28  DC  J OP1   1 
ATOM   5077  O  OP2   . DC  B  2 102 ? 67.117 73.902  22.910  1.00 82.67  ? 28  DC  J OP2   1 
ATOM   5078  O  "O5'" . DC  B  2 102 ? 68.271 74.380  20.756  1.00 86.88  ? 28  DC  J "O5'" 1 
ATOM   5079  C  "C5'" . DC  B  2 102 ? 69.267 74.990  19.943  1.00 87.35  ? 28  DC  J "C5'" 1 
ATOM   5080  C  "C4'" . DC  B  2 102 ? 69.766 74.039  18.866  1.00 82.19  ? 28  DC  J "C4'" 1 
ATOM   5081  O  "O4'" . DC  B  2 102 ? 70.753 73.134  19.422  1.00 80.14  ? 28  DC  J "O4'" 1 
ATOM   5082  C  "C3'" . DC  B  2 102 ? 68.705 73.157  18.219  1.00 81.31  ? 28  DC  J "C3'" 1 
ATOM   5083  O  "O3'" . DC  B  2 102 ? 69.010 73.003  16.841  1.00 86.77  ? 28  DC  J "O3'" 1 
ATOM   5084  C  "C2'" . DC  B  2 102 ? 68.848 71.838  18.982  1.00 78.88  ? 28  DC  J "C2'" 1 
ATOM   5085  C  "C1'" . DC  B  2 102 ? 70.348 71.793  19.231  1.00 81.34  ? 28  DC  J "C1'" 1 
ATOM   5086  N  N1    . DC  B  2 102 ? 70.746 71.025  20.447  1.00 86.37  ? 28  DC  J N1    1 
ATOM   5087  C  C2    . DC  B  2 102 ? 71.805 70.116  20.376  1.00 89.14  ? 28  DC  J C2    1 
ATOM   5088  O  O2    . DC  B  2 102 ? 72.382 69.947  19.296  1.00 92.96  ? 28  DC  J O2    1 
ATOM   5089  N  N3    . DC  B  2 102 ? 72.166 69.442  21.495  1.00 86.19  ? 28  DC  J N3    1 
ATOM   5090  C  C4    . DC  B  2 102 ? 71.522 69.657  22.642  1.00 82.67  ? 28  DC  J C4    1 
ATOM   5091  N  N4    . DC  B  2 102 ? 71.912 68.966  23.719  1.00 73.20  ? 28  DC  J N4    1 
ATOM   5092  C  C5    . DC  B  2 102 ? 70.439 70.575  22.733  1.00 81.34  ? 28  DC  J C5    1 
ATOM   5093  C  C6    . DC  B  2 102 ? 70.095 71.240  21.625  1.00 86.14  ? 28  DC  J C6    1 
ATOM   5094  P  P     . DA  B  2 103 ? 67.970 72.291  15.846  1.00 90.02  ? 29  DA  J P     1 
ATOM   5095  O  OP1   . DA  B  2 103 ? 68.153 72.894  14.507  1.00 93.15  ? 29  DA  J OP1   1 
ATOM   5096  O  OP2   . DA  B  2 103 ? 66.638 72.312  16.488  1.00 97.26  ? 29  DA  J OP2   1 
ATOM   5097  O  "O5'" . DA  B  2 103 ? 68.475 70.775  15.802  1.00 88.32  ? 29  DA  J "O5'" 1 
ATOM   5098  C  "C5'" . DA  B  2 103 ? 69.862 70.496  15.663  1.00 88.26  ? 29  DA  J "C5'" 1 
ATOM   5099  C  "C4'" . DA  B  2 103 ? 70.141 69.011  15.814  1.00 91.84  ? 29  DA  J "C4'" 1 
ATOM   5100  O  "O4'" . DA  B  2 103 ? 70.337 68.682  17.215  1.00 94.60  ? 29  DA  J "O4'" 1 
ATOM   5101  C  "C3'" . DA  B  2 103 ? 69.030 68.081  15.332  1.00 92.25  ? 29  DA  J "C3'" 1 
ATOM   5102  O  "O3'" . DA  B  2 103 ? 69.617 66.905  14.826  1.00 96.42  ? 29  DA  J "O3'" 1 
ATOM   5103  C  "C2'" . DA  B  2 103 ? 68.278 67.789  16.625  1.00 92.66  ? 29  DA  J "C2'" 1 
ATOM   5104  C  "C1'" . DA  B  2 103 ? 69.457 67.634  17.561  1.00 96.06  ? 29  DA  J "C1'" 1 
ATOM   5105  N  N9    . DA  B  2 103 ? 69.137 67.743  18.977  1.00 98.15  ? 29  DA  J N9    1 
ATOM   5106  C  C8    . DA  B  2 103 ? 68.106 68.433  19.555  1.00 96.62  ? 29  DA  J C8    1 
ATOM   5107  N  N7    . DA  B  2 103 ? 68.088 68.348  20.868  1.00 100.11 ? 29  DA  J N7    1 
ATOM   5108  C  C5    . DA  B  2 103 ? 69.186 67.552  21.162  1.00 99.93  ? 29  DA  J C5    1 
ATOM   5109  C  C6    . DA  B  2 103 ? 69.727 67.076  22.376  1.00 99.96  ? 29  DA  J C6    1 
ATOM   5110  N  N6    . DA  B  2 103 ? 69.214 67.354  23.580  1.00 102.97 ? 29  DA  J N6    1 
ATOM   5111  N  N1    . DA  B  2 103 ? 70.832 66.304  22.303  1.00 99.19  ? 29  DA  J N1    1 
ATOM   5112  C  C2    . DA  B  2 103 ? 71.348 66.027  21.103  1.00 99.07  ? 29  DA  J C2    1 
ATOM   5113  N  N3    . DA  B  2 103 ? 70.932 66.411  19.905  1.00 98.30  ? 29  DA  J N3    1 
ATOM   5114  C  C4    . DA  B  2 103 ? 69.838 67.176  20.005  1.00 98.80  ? 29  DA  J C4    1 
ATOM   5115  P  P     . DG  B  2 104 ? 68.948 66.128  13.595  1.00 102.82 ? 30  DG  J P     1 
ATOM   5116  O  OP1   . DG  B  2 104 ? 69.649 66.579  12.371  1.00 101.89 ? 30  DG  J OP1   1 
ATOM   5117  O  OP2   . DG  B  2 104 ? 67.479 66.263  13.700  1.00 102.51 ? 30  DG  J OP2   1 
ATOM   5118  O  "O5'" . DG  B  2 104 ? 69.334 64.600  13.857  1.00 102.90 ? 30  DG  J "O5'" 1 
ATOM   5119  C  "C5'" . DG  B  2 104 ? 70.689 64.190  13.754  1.00 104.74 ? 30  DG  J "C5'" 1 
ATOM   5120  C  "C4'" . DG  B  2 104 ? 70.956 62.974  14.622  1.00 107.05 ? 30  DG  J "C4'" 1 
ATOM   5121  O  "O4'" . DG  B  2 104 ? 70.867 63.341  16.020  1.00 104.00 ? 30  DG  J "O4'" 1 
ATOM   5122  C  "C3'" . DG  B  2 104 ? 69.994 61.803  14.414  1.00 110.39 ? 30  DG  J "C3'" 1 
ATOM   5123  O  "O3'" . DG  B  2 104 ? 70.738 60.608  14.211  1.00 116.95 ? 30  DG  J "O3'" 1 
ATOM   5124  C  "C2'" . DG  B  2 104 ? 69.175 61.759  15.711  1.00 107.80 ? 30  DG  J "C2'" 1 
ATOM   5125  C  "C1'" . DG  B  2 104 ? 70.137 62.365  16.722  1.00 105.20 ? 30  DG  J "C1'" 1 
ATOM   5126  N  N9    . DG  B  2 104 ? 69.475 63.022  17.849  1.00 101.30 ? 30  DG  J N9    1 
ATOM   5127  C  C8    . DG  B  2 104 ? 68.547 64.033  17.789  1.00 96.75  ? 30  DG  J C8    1 
ATOM   5128  N  N7    . DG  B  2 104 ? 68.137 64.434  18.961  1.00 95.64  ? 30  DG  J N7    1 
ATOM   5129  C  C5    . DG  B  2 104 ? 68.845 63.644  19.858  1.00 99.37  ? 30  DG  J C5    1 
ATOM   5130  C  C6    . DG  B  2 104 ? 68.820 63.624  21.274  1.00 104.97 ? 30  DG  J C6    1 
ATOM   5131  O  O6    . DG  B  2 104 ? 68.144 64.326  22.041  1.00 104.46 ? 30  DG  J O6    1 
ATOM   5132  N  N1    . DG  B  2 104 ? 69.693 62.669  21.791  1.00 110.85 ? 30  DG  J N1    1 
ATOM   5133  C  C2    . DG  B  2 104 ? 70.488 61.839  21.035  1.00 112.46 ? 30  DG  J C2    1 
ATOM   5134  N  N2    . DG  B  2 104 ? 71.268 60.980  21.706  1.00 116.04 ? 30  DG  J N2    1 
ATOM   5135  N  N3    . DG  B  2 104 ? 70.519 61.848  19.709  1.00 108.07 ? 30  DG  J N3    1 
ATOM   5136  C  C4    . DG  B  2 104 ? 69.676 62.772  19.190  1.00 102.20 ? 30  DG  J C4    1 
ATOM   5137  P  P     . DT  B  2 105 ? 69.989 59.212  13.946  1.00 114.54 ? 31  DT  J P     1 
ATOM   5138  O  OP1   . DT  B  2 105 ? 70.890 58.373  13.126  1.00 114.99 ? 31  DT  J OP1   1 
ATOM   5139  O  OP2   . DT  B  2 105 ? 68.618 59.503  13.472  1.00 111.01 ? 31  DT  J OP2   1 
ATOM   5140  O  "O5'" . DT  B  2 105 ? 69.886 58.565  15.402  1.00 115.46 ? 31  DT  J "O5'" 1 
ATOM   5141  C  "C5'" . DT  B  2 105 ? 71.048 58.474  16.214  1.00 115.27 ? 31  DT  J "C5'" 1 
ATOM   5142  C  "C4'" . DT  B  2 105 ? 70.776 57.629  17.440  1.00 117.82 ? 31  DT  J "C4'" 1 
ATOM   5143  O  "O4'" . DT  B  2 105 ? 70.306 58.474  18.519  1.00 116.32 ? 31  DT  J "O4'" 1 
ATOM   5144  C  "C3'" . DT  B  2 105 ? 69.718 56.543  17.241  1.00 121.25 ? 31  DT  J "C3'" 1 
ATOM   5145  O  "O3'" . DT  B  2 105 ? 70.213 55.296  17.701  1.00 127.76 ? 31  DT  J "O3'" 1 
ATOM   5146  C  "C2'" . DT  B  2 105 ? 68.527 57.027  18.071  1.00 118.97 ? 31  DT  J "C2'" 1 
ATOM   5147  C  "C1'" . DT  B  2 105 ? 69.194 57.878  19.140  1.00 117.75 ? 31  DT  J "C1'" 1 
ATOM   5148  N  N1    . DT  B  2 105 ? 68.318 58.967  19.667  1.00 116.06 ? 31  DT  J N1    1 
ATOM   5149  C  C2    . DT  B  2 105 ? 68.212 59.150  21.027  1.00 119.84 ? 31  DT  J C2    1 
ATOM   5150  O  O2    . DT  B  2 105 ? 68.800 58.462  21.842  1.00 124.54 ? 31  DT  J O2    1 
ATOM   5151  N  N3    . DT  B  2 105 ? 67.386 60.178  21.403  1.00 117.40 ? 31  DT  J N3    1 
ATOM   5152  C  C4    . DT  B  2 105 ? 66.671 61.023  20.574  1.00 115.25 ? 31  DT  J C4    1 
ATOM   5153  O  O4    . DT  B  2 105 ? 65.954 61.919  21.010  1.00 115.80 ? 31  DT  J O4    1 
ATOM   5154  C  C5    . DT  B  2 105 ? 66.828 60.776  19.159  1.00 111.14 ? 31  DT  J C5    1 
ATOM   5155  C  C7    . DT  B  2 105 ? 66.102 61.627  18.161  1.00 105.00 ? 31  DT  J C7    1 
ATOM   5156  C  C6    . DT  B  2 105 ? 67.635 59.774  18.779  1.00 113.06 ? 31  DT  J C6    1 
ATOM   5157  P  P     . DT  B  2 106 ? 69.418 53.938  17.379  1.00 131.38 ? 32  DT  J P     1 
ATOM   5158  O  OP1   . DT  B  2 106 ? 70.410 52.939  16.922  1.00 132.01 ? 32  DT  J OP1   1 
ATOM   5159  O  OP2   . DT  B  2 106 ? 68.257 54.268  16.521  1.00 126.24 ? 32  DT  J OP2   1 
ATOM   5160  O  "O5'" . DT  B  2 106 ? 68.865 53.490  18.809  1.00 133.61 ? 32  DT  J "O5'" 1 
ATOM   5161  C  "C5'" . DT  B  2 106 ? 69.743 53.487  19.924  1.00 130.88 ? 32  DT  J "C5'" 1 
ATOM   5162  C  "C4'" . DT  B  2 106 ? 68.970 53.417  21.226  1.00 128.36 ? 32  DT  J "C4'" 1 
ATOM   5163  O  "O4'" . DT  B  2 106 ? 68.347 54.700  21.503  1.00 124.81 ? 32  DT  J "O4'" 1 
ATOM   5164  C  "C3'" . DT  B  2 106 ? 67.846 52.379  21.261  1.00 129.95 ? 32  DT  J "C3'" 1 
ATOM   5165  O  "O3'" . DT  B  2 106 ? 67.909 51.666  22.492  1.00 134.37 ? 32  DT  J "O3'" 1 
ATOM   5166  C  "C2'" . DT  B  2 106 ? 66.579 53.236  21.161  1.00 125.98 ? 32  DT  J "C2'" 1 
ATOM   5167  C  "C1'" . DT  B  2 106 ? 67.017 54.483  21.907  1.00 124.83 ? 32  DT  J "C1'" 1 
ATOM   5168  N  N1    . DT  B  2 106 ? 66.212 55.709  21.594  1.00 122.69 ? 32  DT  J N1    1 
ATOM   5169  C  C2    . DT  B  2 106 ? 65.745 56.487  22.631  1.00 122.87 ? 32  DT  J C2    1 
ATOM   5170  O  O2    . DT  B  2 106 ? 65.947 56.228  23.804  1.00 126.91 ? 32  DT  J O2    1 
ATOM   5171  N  N3    . DT  B  2 106 ? 65.027 57.588  22.244  1.00 119.59 ? 32  DT  J N3    1 
ATOM   5172  C  C4    . DT  B  2 106 ? 64.735 57.982  20.951  1.00 117.59 ? 32  DT  J C4    1 
ATOM   5173  O  O4    . DT  B  2 106 ? 64.079 58.990  20.704  1.00 115.58 ? 32  DT  J O4    1 
ATOM   5174  C  C5    . DT  B  2 106 ? 65.254 57.124  19.911  1.00 118.54 ? 32  DT  J C5    1 
ATOM   5175  C  C7    . DT  B  2 106 ? 64.998 57.451  18.469  1.00 115.47 ? 32  DT  J C7    1 
ATOM   5176  C  C6    . DT  B  2 106 ? 65.960 56.041  20.278  1.00 122.06 ? 32  DT  J C6    1 
ATOM   5177  P  P     . DT  B  2 107 ? 67.190 50.239  22.659  1.00 141.71 ? 33  DT  J P     1 
ATOM   5178  O  OP1   . DT  B  2 107 ? 68.236 49.246  22.992  1.00 141.20 ? 33  DT  J OP1   1 
ATOM   5179  O  OP2   . DT  B  2 107 ? 66.314 50.020  21.486  1.00 144.10 ? 33  DT  J OP2   1 
ATOM   5180  O  "O5'" . DT  B  2 107 ? 66.263 50.452  23.942  1.00 141.73 ? 33  DT  J "O5'" 1 
ATOM   5181  C  "C5'" . DT  B  2 107 ? 65.643 51.709  24.138  1.00 137.40 ? 33  DT  J "C5'" 1 
ATOM   5182  C  "C4'" . DT  B  2 107 ? 65.225 51.905  25.579  1.00 136.52 ? 33  DT  J "C4'" 1 
ATOM   5183  O  "O4'" . DT  B  2 107 ? 64.690 53.239  25.733  1.00 131.36 ? 33  DT  J "O4'" 1 
ATOM   5184  C  "C3'" . DT  B  2 107 ? 64.103 51.004  26.038  1.00 137.41 ? 33  DT  J "C3'" 1 
ATOM   5185  O  "O3'" . DT  B  2 107 ? 64.070 50.972  27.456  1.00 135.21 ? 33  DT  J "O3'" 1 
ATOM   5186  C  "C2'" . DT  B  2 107 ? 62.885 51.723  25.464  1.00 134.88 ? 33  DT  J "C2'" 1 
ATOM   5187  C  "C1'" . DT  B  2 107 ? 63.275 53.195  25.640  1.00 129.61 ? 33  DT  J "C1'" 1 
ATOM   5188  N  N1    . DT  B  2 107 ? 62.850 54.077  24.507  1.00 121.85 ? 33  DT  J N1    1 
ATOM   5189  C  C2    . DT  B  2 107 ? 62.256 55.284  24.785  1.00 115.76 ? 33  DT  J C2    1 
ATOM   5190  O  O2    . DT  B  2 107 ? 62.047 55.680  25.918  1.00 116.66 ? 33  DT  J O2    1 
ATOM   5191  N  N3    . DT  B  2 107 ? 61.912 56.020  23.684  1.00 110.03 ? 33  DT  J N3    1 
ATOM   5192  C  C4    . DT  B  2 107 ? 62.098 55.677  22.357  1.00 109.49 ? 33  DT  J C4    1 
ATOM   5193  O  O4    . DT  B  2 107 ? 61.751 56.410  21.436  1.00 107.36 ? 33  DT  J O4    1 
ATOM   5194  C  C5    . DT  B  2 107 ? 62.728 54.398  22.134  1.00 112.98 ? 33  DT  J C5    1 
ATOM   5195  C  C7    . DT  B  2 107 ? 62.984 53.917  20.736  1.00 111.44 ? 33  DT  J C7    1 
ATOM   5196  C  C6    . DT  B  2 107 ? 63.068 53.669  23.207  1.00 119.23 ? 33  DT  J C6    1 
ATOM   5197  P  P     . DC  B  2 108 ? 63.110 49.939  28.224  1.00 138.29 ? 34  DC  J P     1 
ATOM   5198  O  OP1   . DC  B  2 108 ? 63.651 49.751  29.589  1.00 140.70 ? 34  DC  J OP1   1 
ATOM   5199  O  OP2   . DC  B  2 108 ? 62.911 48.769  27.341  1.00 140.33 ? 34  DC  J OP2   1 
ATOM   5200  O  "O5'" . DC  B  2 108 ? 61.720 50.719  28.326  1.00 131.78 ? 34  DC  J "O5'" 1 
ATOM   5201  C  "C5'" . DC  B  2 108 ? 61.674 52.013  28.911  1.00 127.15 ? 34  DC  J "C5'" 1 
ATOM   5202  C  "C4'" . DC  B  2 108 ? 60.263 52.569  28.875  1.00 125.08 ? 34  DC  J "C4'" 1 
ATOM   5203  O  "O4'" . DC  B  2 108 ? 60.037 53.261  27.617  1.00 123.47 ? 34  DC  J "O4'" 1 
ATOM   5204  C  "C3'" . DC  B  2 108 ? 59.151 51.523  28.975  1.00 125.45 ? 34  DC  J "C3'" 1 
ATOM   5205  O  "O3'" . DC  B  2 108 ? 58.062 52.066  29.694  1.00 124.59 ? 34  DC  J "O3'" 1 
ATOM   5206  C  "C2'" . DC  B  2 108 ? 58.780 51.310  27.512  1.00 123.77 ? 34  DC  J "C2'" 1 
ATOM   5207  C  "C1'" . DC  B  2 108 ? 58.876 52.738  27.013  1.00 120.75 ? 34  DC  J "C1'" 1 
ATOM   5208  N  N1    . DC  B  2 108 ? 58.998 52.872  25.537  1.00 114.94 ? 34  DC  J N1    1 
ATOM   5209  C  C2    . DC  B  2 108 ? 58.617 54.070  24.938  1.00 101.70 ? 34  DC  J C2    1 
ATOM   5210  O  O2    . DC  B  2 108 ? 58.191 54.978  25.658  1.00 93.86  ? 34  DC  J O2    1 
ATOM   5211  N  N3    . DC  B  2 108 ? 58.726 54.200  23.594  1.00 101.23 ? 34  DC  J N3    1 
ATOM   5212  C  C4    . DC  B  2 108 ? 59.192 53.185  22.863  1.00 108.48 ? 34  DC  J C4    1 
ATOM   5213  N  N4    . DC  B  2 108 ? 59.283 53.356  21.539  1.00 108.82 ? 34  DC  J N4    1 
ATOM   5214  C  C5    . DC  B  2 108 ? 59.586 51.949  23.459  1.00 114.91 ? 34  DC  J C5    1 
ATOM   5215  C  C6    . DC  B  2 108 ? 59.471 51.836  24.787  1.00 118.07 ? 34  DC  J C6    1 
ATOM   5216  P  P     . DC  B  2 109 ? 57.458 51.298  30.968  1.00 127.23 ? 35  DC  J P     1 
ATOM   5217  O  OP1   . DC  B  2 109 ? 58.444 51.406  32.066  1.00 130.38 ? 35  DC  J OP1   1 
ATOM   5218  O  OP2   . DC  B  2 109 ? 57.005 49.964  30.519  1.00 129.96 ? 35  DC  J OP2   1 
ATOM   5219  O  "O5'" . DC  B  2 109 ? 56.165 52.164  31.339  1.00 121.46 ? 35  DC  J "O5'" 1 
ATOM   5220  C  "C5'" . DC  B  2 109 ? 56.297 53.558  31.599  1.00 114.78 ? 35  DC  J "C5'" 1 
ATOM   5221  C  "C4'" . DC  B  2 109 ? 55.191 54.353  30.921  1.00 111.20 ? 35  DC  J "C4'" 1 
ATOM   5222  O  "O4'" . DC  B  2 109 ? 55.478 54.499  29.502  1.00 106.07 ? 35  DC  J "O4'" 1 
ATOM   5223  C  "C3'" . DC  B  2 109 ? 53.792 53.737  31.002  1.00 114.80 ? 35  DC  J "C3'" 1 
ATOM   5224  O  "O3'" . DC  B  2 109 ? 52.839 54.767  31.180  1.00 118.12 ? 35  DC  J "O3'" 1 
ATOM   5225  C  "C2'" . DC  B  2 109 ? 53.637 53.093  29.628  1.00 110.78 ? 35  DC  J "C2'" 1 
ATOM   5226  C  "C1'" . DC  B  2 109 ? 54.331 54.133  28.769  1.00 106.39 ? 35  DC  J "C1'" 1 
ATOM   5227  N  N1    . DC  B  2 109 ? 54.751 53.636  27.431  1.00 104.69 ? 35  DC  J N1    1 
ATOM   5228  C  C2    . DC  B  2 109 ? 54.615 54.468  26.313  1.00 96.91  ? 35  DC  J C2    1 
ATOM   5229  O  O2    . DC  B  2 109 ? 54.149 55.605  26.463  1.00 88.04  ? 35  DC  J O2    1 
ATOM   5230  N  N3    . DC  B  2 109 ? 55.003 54.003  25.099  1.00 98.16  ? 35  DC  J N3    1 
ATOM   5231  C  C4    . DC  B  2 109 ? 55.502 52.771  24.986  1.00 101.99 ? 35  DC  J C4    1 
ATOM   5232  N  N4    . DC  B  2 109 ? 55.872 52.351  23.772  1.00 103.64 ? 35  DC  J N4    1 
ATOM   5233  C  C5    . DC  B  2 109 ? 55.641 51.909  26.113  1.00 105.63 ? 35  DC  J C5    1 
ATOM   5234  C  C6    . DC  B  2 109 ? 55.260 52.379  27.305  1.00 105.80 ? 35  DC  J C6    1 
ATOM   5235  P  P     . DA  B  2 110 ? 51.937 54.833  32.505  1.00 122.51 ? 36  DA  J P     1 
ATOM   5236  O  OP1   . DA  B  2 110 ? 52.842 54.772  33.674  1.00 123.31 ? 36  DA  J OP1   1 
ATOM   5237  O  OP2   . DA  B  2 110 ? 50.851 53.837  32.366  1.00 122.27 ? 36  DA  J OP2   1 
ATOM   5238  O  "O5'" . DA  B  2 110 ? 51.274 56.286  32.424  1.00 118.85 ? 36  DA  J "O5'" 1 
ATOM   5239  C  "C5'" . DA  B  2 110 ? 52.083 57.418  32.117  1.00 114.58 ? 36  DA  J "C5'" 1 
ATOM   5240  C  "C4'" . DA  B  2 110 ? 51.455 58.265  31.018  1.00 107.43 ? 36  DA  J "C4'" 1 
ATOM   5241  O  "O4'" . DA  B  2 110 ? 51.632 57.618  29.732  1.00 103.02 ? 36  DA  J "O4'" 1 
ATOM   5242  C  "C3'" . DA  B  2 110 ? 49.960 58.520  31.160  1.00 107.26 ? 36  DA  J "C3'" 1 
ATOM   5243  O  "O3'" . DA  B  2 110 ? 49.652 59.830  30.692  1.00 107.43 ? 36  DA  J "O3'" 1 
ATOM   5244  C  "C2'" . DA  B  2 110 ? 49.336 57.437  30.279  1.00 104.19 ? 36  DA  J "C2'" 1 
ATOM   5245  C  "C1'" . DA  B  2 110 ? 50.378 57.261  29.180  1.00 99.59  ? 36  DA  J "C1'" 1 
ATOM   5246  N  N9    . DA  B  2 110 ? 50.480 55.887  28.701  1.00 97.61  ? 36  DA  J N9    1 
ATOM   5247  C  C8    . DA  B  2 110 ? 50.365 54.749  29.448  1.00 100.43 ? 36  DA  J C8    1 
ATOM   5248  N  N7    . DA  B  2 110 ? 50.513 53.645  28.758  1.00 104.80 ? 36  DA  J N7    1 
ATOM   5249  C  C5    . DA  B  2 110 ? 50.745 54.088  27.469  1.00 99.17  ? 36  DA  J C5    1 
ATOM   5250  C  C6    . DA  B  2 110 ? 50.985 53.404  26.262  1.00 94.52  ? 36  DA  J C6    1 
ATOM   5251  N  N6    . DA  B  2 110 ? 51.023 52.072  26.167  1.00 99.02  ? 36  DA  J N6    1 
ATOM   5252  N  N1    . DA  B  2 110 ? 51.176 54.143  25.153  1.00 89.44  ? 36  DA  J N1    1 
ATOM   5253  C  C2    . DA  B  2 110 ? 51.135 55.478  25.251  1.00 90.92  ? 36  DA  J C2    1 
ATOM   5254  N  N3    . DA  B  2 110 ? 50.920 56.233  26.328  1.00 89.64  ? 36  DA  J N3    1 
ATOM   5255  C  C4    . DA  B  2 110 ? 50.732 55.469  27.415  1.00 94.11  ? 36  DA  J C4    1 
ATOM   5256  P  P     . DA  B  2 111 ? 48.127 60.328  30.577  1.00 108.92 ? 37  DA  J P     1 
ATOM   5257  O  OP1   . DA  B  2 111 ? 48.121 61.776  30.880  1.00 106.25 ? 37  DA  J OP1   1 
ATOM   5258  O  OP2   . DA  B  2 111 ? 47.258 59.423  31.362  1.00 107.23 ? 37  DA  J OP2   1 
ATOM   5259  O  "O5'" . DA  B  2 111 ? 47.792 60.141  29.025  1.00 106.78 ? 37  DA  J "O5'" 1 
ATOM   5260  C  "C5'" . DA  B  2 111 ? 48.561 60.839  28.051  1.00 96.95  ? 37  DA  J "C5'" 1 
ATOM   5261  C  "C4'" . DA  B  2 111 ? 48.192 60.406  26.645  1.00 90.73  ? 37  DA  J "C4'" 1 
ATOM   5262  O  "O4'" . DA  B  2 111 ? 48.557 59.013  26.446  1.00 93.04  ? 37  DA  J "O4'" 1 
ATOM   5263  C  "C3'" . DA  B  2 111 ? 46.702 60.501  26.300  1.00 85.74  ? 37  DA  J "C3'" 1 
ATOM   5264  O  "O3'" . DA  B  2 111 ? 46.554 60.977  24.972  1.00 83.52  ? 37  DA  J "O3'" 1 
ATOM   5265  C  "C2'" . DA  B  2 111 ? 46.240 59.052  26.417  1.00 88.90  ? 37  DA  J "C2'" 1 
ATOM   5266  C  "C1'" . DA  B  2 111 ? 47.462 58.341  25.872  1.00 90.77  ? 37  DA  J "C1'" 1 
ATOM   5267  N  N9    . DA  B  2 111 ? 47.540 56.925  26.215  1.00 88.94  ? 37  DA  J N9    1 
ATOM   5268  C  C8    . DA  B  2 111 ? 47.446 56.364  27.456  1.00 91.55  ? 37  DA  J C8    1 
ATOM   5269  N  N7    . DA  B  2 111 ? 47.560 55.055  27.454  1.00 94.08  ? 37  DA  J N7    1 
ATOM   5270  C  C5    . DA  B  2 111 ? 47.743 54.741  26.116  1.00 94.32  ? 37  DA  J C5    1 
ATOM   5271  C  C6    . DA  B  2 111 ? 47.926 53.517  25.441  1.00 102.22 ? 37  DA  J C6    1 
ATOM   5272  N  N6    . DA  B  2 111 ? 47.959 52.331  26.058  1.00 104.99 ? 37  DA  J N6    1 
ATOM   5273  N  N1    . DA  B  2 111 ? 48.081 53.562  24.100  1.00 104.99 ? 37  DA  J N1    1 
ATOM   5274  C  C2    . DA  B  2 111 ? 48.051 54.749  23.486  1.00 95.01  ? 37  DA  J C2    1 
ATOM   5275  N  N3    . DA  B  2 111 ? 47.883 55.958  24.012  1.00 91.86  ? 37  DA  J N3    1 
ATOM   5276  C  C4    . DA  B  2 111 ? 47.734 55.884  25.342  1.00 91.81  ? 37  DA  J C4    1 
ATOM   5277  P  P     . DA  B  2 112 ? 45.246 61.802  24.540  1.00 75.66  ? 38  DA  J P     1 
ATOM   5278  O  OP1   . DA  B  2 112 ? 45.464 63.223  24.889  1.00 71.01  ? 38  DA  J OP1   1 
ATOM   5279  O  OP2   . DA  B  2 112 ? 44.066 61.088  25.075  1.00 71.41  ? 38  DA  J OP2   1 
ATOM   5280  O  "O5'" . DA  B  2 112 ? 45.216 61.656  22.948  1.00 84.02  ? 38  DA  J "O5'" 1 
ATOM   5281  C  "C5'" . DA  B  2 112 ? 46.393 61.276  22.241  1.00 85.67  ? 38  DA  J "C5'" 1 
ATOM   5282  C  "C4'" . DA  B  2 112 ? 46.057 60.270  21.157  1.00 86.24  ? 38  DA  J "C4'" 1 
ATOM   5283  O  "O4'" . DA  B  2 112 ? 46.264 58.922  21.667  1.00 89.40  ? 38  DA  J "O4'" 1 
ATOM   5284  C  "C3'" . DA  B  2 112 ? 44.609 60.332  20.667  1.00 82.92  ? 38  DA  J "C3'" 1 
ATOM   5285  O  "O3'" . DA  B  2 112 ? 44.557 60.288  19.239  1.00 78.99  ? 38  DA  J "O3'" 1 
ATOM   5286  C  "C2'" . DA  B  2 112 ? 43.965 59.103  21.303  1.00 87.18  ? 38  DA  J "C2'" 1 
ATOM   5287  C  "C1'" . DA  B  2 112 ? 45.127 58.132  21.406  1.00 90.50  ? 38  DA  J "C1'" 1 
ATOM   5288  N  N9    . DA  B  2 112 ? 44.968 57.166  22.495  1.00 95.11  ? 38  DA  J N9    1 
ATOM   5289  C  C8    . DA  B  2 112 ? 44.719 57.446  23.810  1.00 95.19  ? 38  DA  J C8    1 
ATOM   5290  N  N7    . DA  B  2 112 ? 44.615 56.381  24.570  1.00 97.54  ? 38  DA  J N7    1 
ATOM   5291  C  C5    . DA  B  2 112 ? 44.803 55.326  23.692  1.00 100.78 ? 38  DA  J C5    1 
ATOM   5292  C  C6    . DA  B  2 112 ? 44.815 53.927  23.875  1.00 104.63 ? 38  DA  J C6    1 
ATOM   5293  N  N6    . DA  B  2 112 ? 44.622 53.337  25.061  1.00 101.93 ? 38  DA  J N6    1 
ATOM   5294  N  N1    . DA  B  2 112 ? 45.035 53.155  22.789  1.00 108.04 ? 38  DA  J N1    1 
ATOM   5295  C  C2    . DA  B  2 112 ? 45.231 53.750  21.605  1.00 105.53 ? 38  DA  J C2    1 
ATOM   5296  N  N3    . DA  B  2 112 ? 45.242 55.050  21.310  1.00 101.28 ? 38  DA  J N3    1 
ATOM   5297  C  C4    . DA  B  2 112 ? 45.021 55.791  22.408  1.00 98.77  ? 38  DA  J C4    1 
ATOM   5298  P  P     . DT  B  2 113 ? 43.144 60.220  18.469  1.00 83.18  ? 39  DT  J P     1 
ATOM   5299  O  OP1   . DT  B  2 113 ? 43.212 61.118  17.300  1.00 80.48  ? 39  DT  J OP1   1 
ATOM   5300  O  OP2   . DT  B  2 113 ? 42.035 60.401  19.430  1.00 84.60  ? 39  DT  J OP2   1 
ATOM   5301  O  "O5'" . DT  B  2 113 ? 43.095 58.722  17.927  1.00 85.74  ? 39  DT  J "O5'" 1 
ATOM   5302  C  "C5'" . DT  B  2 113 ? 44.201 58.200  17.206  1.00 86.57  ? 39  DT  J "C5'" 1 
ATOM   5303  C  "C4'" . DT  B  2 113 ? 43.960 56.752  16.837  1.00 94.95  ? 39  DT  J "C4'" 1 
ATOM   5304  O  "O4'" . DT  B  2 113 ? 43.950 55.942  18.041  1.00 95.73  ? 39  DT  J "O4'" 1 
ATOM   5305  C  "C3'" . DT  B  2 113 ? 42.632 56.486  16.130  1.00 105.06 ? 39  DT  J "C3'" 1 
ATOM   5306  O  "O3'" . DT  B  2 113 ? 42.825 55.548  15.083  1.00 119.60 ? 39  DT  J "O3'" 1 
ATOM   5307  C  "C2'" . DT  B  2 113 ? 41.750 55.921  17.242  1.00 100.90 ? 39  DT  J "C2'" 1 
ATOM   5308  C  "C1'" . DT  B  2 113 ? 42.768 55.174  18.088  1.00 99.07  ? 39  DT  J "C1'" 1 
ATOM   5309  N  N1    . DT  B  2 113 ? 42.364 55.011  19.518  1.00 96.32  ? 39  DT  J N1    1 
ATOM   5310  C  C2    . DT  B  2 113 ? 42.330 53.749  20.061  1.00 100.03 ? 39  DT  J C2    1 
ATOM   5311  O  O2    . DT  B  2 113 ? 42.616 52.745  19.435  1.00 102.13 ? 39  DT  J O2    1 
ATOM   5312  N  N3    . DT  B  2 113 ? 41.953 53.703  21.376  1.00 103.99 ? 39  DT  J N3    1 
ATOM   5313  C  C4    . DT  B  2 113 ? 41.609 54.765  22.187  1.00 102.25 ? 39  DT  J C4    1 
ATOM   5314  O  O4    . DT  B  2 113 ? 41.280 54.619  23.360  1.00 102.88 ? 39  DT  J O4    1 
ATOM   5315  C  C5    . DT  B  2 113 ? 41.660 56.060  21.560  1.00 96.63  ? 39  DT  J C5    1 
ATOM   5316  C  C7    . DT  B  2 113 ? 41.301 57.283  22.349  1.00 92.70  ? 39  DT  J C7    1 
ATOM   5317  C  C6    . DT  B  2 113 ? 42.032 56.124  20.268  1.00 94.13  ? 39  DT  J C6    1 
ATOM   5318  P  P     . DA  B  2 114 ? 41.739 55.412  13.908  1.00 116.67 ? 40  DA  J P     1 
ATOM   5319  O  OP1   . DA  B  2 114 ? 42.462 55.416  12.617  1.00 118.72 ? 40  DA  J OP1   1 
ATOM   5320  O  OP2   . DA  B  2 114 ? 40.670 56.405  14.158  1.00 110.49 ? 40  DA  J OP2   1 
ATOM   5321  O  "O5'" . DA  B  2 114 ? 41.116 53.963  14.148  1.00 118.41 ? 40  DA  J "O5'" 1 
ATOM   5322  C  "C5'" . DA  B  2 114 ? 41.951 52.900  14.581  1.00 121.48 ? 40  DA  J "C5'" 1 
ATOM   5323  C  "C4'" . DA  B  2 114 ? 41.123 51.665  14.865  1.00 128.81 ? 40  DA  J "C4'" 1 
ATOM   5324  O  "O4'" . DA  B  2 114 ? 40.934 51.520  16.296  1.00 127.53 ? 40  DA  J "O4'" 1 
ATOM   5325  C  "C3'" . DA  B  2 114 ? 39.733 51.680  14.241  1.00 134.24 ? 40  DA  J "C3'" 1 
ATOM   5326  O  "O3'" . DA  B  2 114 ? 39.443 50.409  13.684  1.00 141.96 ? 40  DA  J "O3'" 1 
ATOM   5327  C  "C2'" . DA  B  2 114 ? 38.811 52.025  15.414  1.00 131.32 ? 40  DA  J "C2'" 1 
ATOM   5328  C  "C1'" . DA  B  2 114 ? 39.558 51.439  16.606  1.00 127.55 ? 40  DA  J "C1'" 1 
ATOM   5329  N  N9    . DA  B  2 114 ? 39.335 52.170  17.852  1.00 118.57 ? 40  DA  J N9    1 
ATOM   5330  C  C8    . DA  B  2 114 ? 39.350 53.526  18.024  1.00 112.53 ? 40  DA  J C8    1 
ATOM   5331  N  N7    . DA  B  2 114 ? 39.128 53.906  19.261  1.00 111.10 ? 40  DA  J N7    1 
ATOM   5332  C  C5    . DA  B  2 114 ? 38.961 52.717  19.950  1.00 112.66 ? 40  DA  J C5    1 
ATOM   5333  C  C6    . DA  B  2 114 ? 38.695 52.435  21.307  1.00 110.79 ? 40  DA  J C6    1 
ATOM   5334  N  N6    . DA  B  2 114 ? 38.548 53.381  22.241  1.00 105.12 ? 40  DA  J N6    1 
ATOM   5335  N  N1    . DA  B  2 114 ? 38.587 51.138  21.666  1.00 118.14 ? 40  DA  J N1    1 
ATOM   5336  C  C2    . DA  B  2 114 ? 38.733 50.195  20.727  1.00 125.00 ? 40  DA  J C2    1 
ATOM   5337  N  N3    . DA  B  2 114 ? 38.986 50.339  19.425  1.00 125.90 ? 40  DA  J N3    1 
ATOM   5338  C  C4    . DA  B  2 114 ? 39.088 51.636  19.098  1.00 118.39 ? 40  DA  J C4    1 
ATOM   5339  P  P     . DC  B  2 115 ? 38.043 50.149  12.944  1.00 138.21 ? 41  DC  J P     1 
ATOM   5340  O  OP1   . DC  B  2 115 ? 38.257 49.091  11.932  1.00 142.82 ? 41  DC  J OP1   1 
ATOM   5341  O  OP2   . DC  B  2 115 ? 37.479 51.457  12.540  1.00 132.26 ? 41  DC  J OP2   1 
ATOM   5342  O  "O5'" . DC  B  2 115 ? 37.127 49.556  14.103  1.00 139.27 ? 41  DC  J "O5'" 1 
ATOM   5343  C  "C5'" . DC  B  2 115 ? 37.656 48.568  14.970  1.00 138.56 ? 41  DC  J "C5'" 1 
ATOM   5344  C  "C4'" . DC  B  2 115 ? 36.558 47.973  15.820  1.00 137.67 ? 41  DC  J "C4'" 1 
ATOM   5345  O  "O4'" . DC  B  2 115 ? 36.558 48.603  17.125  1.00 132.38 ? 41  DC  J "O4'" 1 
ATOM   5346  C  "C3'" . DC  B  2 115 ? 35.152 48.147  15.252  1.00 137.18 ? 41  DC  J "C3'" 1 
ATOM   5347  O  "O3'" . DC  B  2 115 ? 34.431 46.935  15.401  1.00 138.99 ? 41  DC  J "O3'" 1 
ATOM   5348  C  "C2'" . DC  B  2 115 ? 34.565 49.283  16.094  1.00 132.03 ? 41  DC  J "C2'" 1 
ATOM   5349  C  "C1'" . DC  B  2 115 ? 35.272 49.094  17.426  1.00 131.27 ? 41  DC  J "C1'" 1 
ATOM   5350  N  N1    . DC  B  2 115 ? 35.428 50.356  18.204  1.00 128.15 ? 41  DC  J N1    1 
ATOM   5351  C  C2    . DC  B  2 115 ? 35.189 50.348  19.580  1.00 132.25 ? 41  DC  J C2    1 
ATOM   5352  O  O2    . DC  B  2 115 ? 34.847 49.289  20.116  1.00 139.76 ? 41  DC  J O2    1 
ATOM   5353  N  N3    . DC  B  2 115 ? 35.338 51.501  20.281  1.00 127.68 ? 41  DC  J N3    1 
ATOM   5354  C  C4    . DC  B  2 115 ? 35.709 52.619  19.653  1.00 120.73 ? 41  DC  J C4    1 
ATOM   5355  N  N4    . DC  B  2 115 ? 35.844 53.734  20.382  1.00 116.42 ? 41  DC  J N4    1 
ATOM   5356  C  C5    . DC  B  2 115 ? 35.959 52.645  18.248  1.00 118.65 ? 41  DC  J C5    1 
ATOM   5357  C  C6    . DC  B  2 115 ? 35.809 51.502  17.570  1.00 122.57 ? 41  DC  J C6    1 
ATOM   5358  P  P     . DA  B  2 116 ? 32.929 46.787  14.852  1.00 143.25 ? 42  DA  J P     1 
ATOM   5359  O  OP1   . DA  B  2 116 ? 32.866 45.520  14.090  1.00 143.08 ? 42  DA  J OP1   1 
ATOM   5360  O  OP2   . DA  B  2 116 ? 32.508 48.048  14.201  1.00 136.28 ? 42  DA  J OP2   1 
ATOM   5361  O  "O5'" . DA  B  2 116 ? 32.085 46.606  16.190  1.00 140.98 ? 42  DA  J "O5'" 1 
ATOM   5362  C  "C5'" . DA  B  2 116 ? 32.723 46.069  17.342  1.00 140.82 ? 42  DA  J "C5'" 1 
ATOM   5363  C  "C4'" . DA  B  2 116 ? 31.765 45.997  18.513  1.00 143.09 ? 42  DA  J "C4'" 1 
ATOM   5364  O  "O4'" . DA  B  2 116 ? 32.001 47.113  19.411  1.00 137.65 ? 42  DA  J "O4'" 1 
ATOM   5365  C  "C3'" . DA  B  2 116 ? 30.291 46.067  18.146  1.00 148.50 ? 42  DA  J "C3'" 1 
ATOM   5366  O  "O3'" . DA  B  2 116 ? 29.543 45.302  19.085  1.00 157.75 ? 42  DA  J "O3'" 1 
ATOM   5367  C  "C2'" . DA  B  2 116 ? 30.000 47.564  18.262  1.00 141.58 ? 42  DA  J "C2'" 1 
ATOM   5368  C  "C1'" . DA  B  2 116 ? 30.853 47.939  19.468  1.00 137.85 ? 42  DA  J "C1'" 1 
ATOM   5369  N  N9    . DA  B  2 116 ? 31.295 49.332  19.479  1.00 134.30 ? 42  DA  J N9    1 
ATOM   5370  C  C8    . DA  B  2 116 ? 31.739 50.068  18.415  1.00 132.99 ? 42  DA  J C8    1 
ATOM   5371  N  N7    . DA  B  2 116 ? 32.084 51.296  18.729  1.00 129.13 ? 42  DA  J N7    1 
ATOM   5372  C  C5    . DA  B  2 116 ? 31.857 51.368  20.094  1.00 128.64 ? 42  DA  J C5    1 
ATOM   5373  C  C6    . DA  B  2 116 ? 32.026 52.407  21.035  1.00 124.27 ? 42  DA  J C6    1 
ATOM   5374  N  N6    . DA  B  2 116 ? 32.484 53.624  20.718  1.00 117.05 ? 42  DA  J N6    1 
ATOM   5375  N  N1    . DA  B  2 116 ? 31.704 52.145  22.321  1.00 125.41 ? 42  DA  J N1    1 
ATOM   5376  C  C2    . DA  B  2 116 ? 31.247 50.927  22.633  1.00 131.63 ? 42  DA  J C2    1 
ATOM   5377  N  N3    . DA  B  2 116 ? 31.047 49.875  21.840  1.00 135.68 ? 42  DA  J N3    1 
ATOM   5378  C  C4    . DA  B  2 116 ? 31.375 50.165  20.572  1.00 132.63 ? 42  DA  J C4    1 
ATOM   5379  P  P     . DC  B  2 117 ? 28.047 44.818  18.755  1.00 151.08 ? 43  DC  J P     1 
ATOM   5380  O  OP1   . DC  B  2 117 ? 28.021 43.340  18.846  1.00 155.78 ? 43  DC  J OP1   1 
ATOM   5381  O  OP2   . DC  B  2 117 ? 27.608 45.487  17.511  1.00 152.81 ? 43  DC  J OP2   1 
ATOM   5382  O  "O5'" . DC  B  2 117 ? 27.202 45.424  19.965  1.00 151.14 ? 43  DC  J "O5'" 1 
ATOM   5383  C  "C5'" . DC  B  2 117 ? 27.588 46.673  20.508  1.00 147.09 ? 43  DC  J "C5'" 1 
ATOM   5384  C  "C4'" . DC  B  2 117 ? 26.933 46.924  21.843  1.00 147.67 ? 43  DC  J "C4'" 1 
ATOM   5385  O  "O4'" . DC  B  2 117 ? 27.487 48.133  22.414  1.00 144.58 ? 43  DC  J "O4'" 1 
ATOM   5386  C  "C3'" . DC  B  2 117 ? 25.441 47.172  21.771  1.00 149.64 ? 43  DC  J "C3'" 1 
ATOM   5387  O  "O3'" . DC  B  2 117 ? 24.839 46.861  23.017  1.00 153.22 ? 43  DC  J "O3'" 1 
ATOM   5388  C  "C2'" . DC  B  2 117 ? 25.378 48.665  21.465  1.00 145.66 ? 43  DC  J "C2'" 1 
ATOM   5389  C  "C1'" . DC  B  2 117 ? 26.592 49.213  22.219  1.00 143.62 ? 43  DC  J "C1'" 1 
ATOM   5390  N  N1    . DC  B  2 117 ? 27.309 50.311  21.484  1.00 140.89 ? 43  DC  J N1    1 
ATOM   5391  C  C2    . DC  B  2 117 ? 27.610 51.504  22.151  1.00 138.88 ? 43  DC  J C2    1 
ATOM   5392  O  O2    . DC  B  2 117 ? 27.286 51.621  23.337  1.00 140.36 ? 43  DC  J O2    1 
ATOM   5393  N  N3    . DC  B  2 117 ? 28.254 52.491  21.476  1.00 135.69 ? 43  DC  J N3    1 
ATOM   5394  C  C4    . DC  B  2 117 ? 28.585 52.318  20.194  1.00 135.91 ? 43  DC  J C4    1 
ATOM   5395  N  N4    . DC  B  2 117 ? 29.218 53.316  19.566  1.00 134.23 ? 43  DC  J N4    1 
ATOM   5396  C  C5    . DC  B  2 117 ? 28.282 51.110  19.497  1.00 137.57 ? 43  DC  J C5    1 
ATOM   5397  C  C6    . DC  B  2 117 ? 27.648 50.145  20.173  1.00 140.46 ? 43  DC  J C6    1 
ATOM   5398  P  P     . DT  B  2 118 ? 23.268 47.109  23.245  1.00 166.40 ? 44  DT  J P     1 
ATOM   5399  O  OP1   . DT  B  2 118 ? 22.784 46.059  24.168  1.00 170.10 ? 44  DT  J OP1   1 
ATOM   5400  O  OP2   . DT  B  2 118 ? 22.620 47.274  21.924  1.00 167.10 ? 44  DT  J OP2   1 
ATOM   5401  O  "O5'" . DT  B  2 118 ? 23.222 48.514  24.001  1.00 160.81 ? 44  DT  J "O5'" 1 
ATOM   5402  C  "C5'" . DT  B  2 118 ? 24.062 48.732  25.126  1.00 157.17 ? 44  DT  J "C5'" 1 
ATOM   5403  C  "C4'" . DT  B  2 118 ? 23.880 50.135  25.668  1.00 148.89 ? 44  DT  J "C4'" 1 
ATOM   5404  O  "O4'" . DT  B  2 118 ? 24.625 51.076  24.851  1.00 141.54 ? 44  DT  J "O4'" 1 
ATOM   5405  C  "C3'" . DT  B  2 118 ? 22.434 50.631  25.691  1.00 149.63 ? 44  DT  J "C3'" 1 
ATOM   5406  O  "O3'" . DT  B  2 118 ? 22.167 51.268  26.932  1.00 151.52 ? 44  DT  J "O3'" 1 
ATOM   5407  C  "C2'" . DT  B  2 118 ? 22.381 51.616  24.521  1.00 143.60 ? 44  DT  J "C2'" 1 
ATOM   5408  C  "C1'" . DT  B  2 118 ? 23.797 52.164  24.515  1.00 137.47 ? 44  DT  J "C1'" 1 
ATOM   5409  N  N1    . DT  B  2 118 ? 24.232 52.700  23.187  1.00 130.20 ? 44  DT  J N1    1 
ATOM   5410  C  C2    . DT  B  2 118 ? 24.778 53.962  23.119  1.00 123.58 ? 44  DT  J C2    1 
ATOM   5411  O  O2    . DT  B  2 118 ? 24.926 54.679  24.093  1.00 116.62 ? 44  DT  J O2    1 
ATOM   5412  N  N3    . DT  B  2 118 ? 25.147 54.359  21.861  1.00 124.04 ? 44  DT  J N3    1 
ATOM   5413  C  C4    . DT  B  2 118 ? 25.030 53.638  20.688  1.00 124.41 ? 44  DT  J C4    1 
ATOM   5414  O  O4    . DT  B  2 118 ? 25.393 54.083  19.604  1.00 120.97 ? 44  DT  J O4    1 
ATOM   5415  C  C5    . DT  B  2 118 ? 24.451 52.323  20.827  1.00 126.81 ? 44  DT  J C5    1 
ATOM   5416  C  C7    . DT  B  2 118 ? 24.272 51.450  19.621  1.00 128.37 ? 44  DT  J C7    1 
ATOM   5417  C  C6    . DT  B  2 118 ? 24.084 51.921  22.056  1.00 130.02 ? 44  DT  J C6    1 
ATOM   5418  P  P     . DT  B  2 119 ? 20.669 51.687  27.337  1.00 153.41 ? 45  DT  J P     1 
ATOM   5419  O  OP1   . DT  B  2 119 ? 20.380 51.074  28.653  1.00 155.62 ? 45  DT  J OP1   1 
ATOM   5420  O  OP2   . DT  B  2 119 ? 19.766 51.421  26.196  1.00 156.80 ? 45  DT  J OP2   1 
ATOM   5421  O  "O5'" . DT  B  2 119 ? 20.775 53.268  27.530  1.00 147.15 ? 45  DT  J "O5'" 1 
ATOM   5422  C  "C5'" . DT  B  2 119 ? 21.842 53.807  28.296  1.00 138.06 ? 45  DT  J "C5'" 1 
ATOM   5423  C  "C4'" . DT  B  2 119 ? 22.044 55.277  27.986  1.00 124.23 ? 45  DT  J "C4'" 1 
ATOM   5424  O  "O4'" . DT  B  2 119 ? 22.534 55.429  26.633  1.00 121.35 ? 45  DT  J "O4'" 1 
ATOM   5425  C  "C3'" . DT  B  2 119 ? 20.785 56.137  28.096  1.00 119.82 ? 45  DT  J "C3'" 1 
ATOM   5426  O  "O3'" . DT  B  2 119 ? 21.017 57.199  29.014  1.00 114.13 ? 45  DT  J "O3'" 1 
ATOM   5427  C  "C2'" . DT  B  2 119 ? 20.545 56.644  26.666  1.00 119.60 ? 45  DT  J "C2'" 1 
ATOM   5428  C  "C1'" . DT  B  2 119 ? 21.926 56.546  26.039  1.00 118.70 ? 45  DT  J "C1'" 1 
ATOM   5429  N  N1    . DT  B  2 119 ? 21.912 56.331  24.553  1.00 122.04 ? 45  DT  J N1    1 
ATOM   5430  C  C2    . DT  B  2 119 ? 22.484 57.275  23.727  1.00 120.95 ? 45  DT  J C2    1 
ATOM   5431  O  O2    . DT  B  2 119 ? 22.996 58.301  24.138  1.00 118.65 ? 45  DT  J O2    1 
ATOM   5432  N  N3    . DT  B  2 119 ? 22.430 56.973  22.390  1.00 120.27 ? 45  DT  J N3    1 
ATOM   5433  C  C4    . DT  B  2 119 ? 21.880 55.848  21.807  1.00 122.68 ? 45  DT  J C4    1 
ATOM   5434  O  O4    . DT  B  2 119 ? 21.880 55.670  20.592  1.00 121.46 ? 45  DT  J O4    1 
ATOM   5435  C  C5    . DT  B  2 119 ? 21.302 54.897  22.727  1.00 127.12 ? 45  DT  J C5    1 
ATOM   5436  C  C7    . DT  B  2 119 ? 20.674 53.639  22.207  1.00 132.18 ? 45  DT  J C7    1 
ATOM   5437  C  C6    . DT  B  2 119 ? 21.348 55.179  24.040  1.00 126.09 ? 45  DT  J C6    1 
ATOM   5438  P  P     . DT  B  2 120 ? 19.855 58.245  29.383  1.00 113.69 ? 46  DT  J P     1 
ATOM   5439  O  OP1   . DT  B  2 120 ? 19.936 58.488  30.840  1.00 112.36 ? 46  DT  J OP1   1 
ATOM   5440  O  OP2   . DT  B  2 120 ? 18.578 57.785  28.793  1.00 115.92 ? 46  DT  J OP2   1 
ATOM   5441  O  "O5'" . DT  B  2 120 ? 20.314 59.573  28.626  1.00 115.74 ? 46  DT  J "O5'" 1 
ATOM   5442  C  "C5'" . DT  B  2 120 ? 21.679 59.959  28.677  1.00 115.44 ? 46  DT  J "C5'" 1 
ATOM   5443  C  "C4'" . DT  B  2 120 ? 22.003 60.974  27.600  1.00 112.14 ? 46  DT  J "C4'" 1 
ATOM   5444  O  "O4'" . DT  B  2 120 ? 21.941 60.351  26.293  1.00 117.15 ? 46  DT  J "O4'" 1 
ATOM   5445  C  "C3'" . DT  B  2 120 ? 21.071 62.185  27.545  1.00 113.22 ? 46  DT  J "C3'" 1 
ATOM   5446  O  "O3'" . DT  B  2 120 ? 21.853 63.367  27.537  1.00 110.40 ? 46  DT  J "O3'" 1 
ATOM   5447  C  "C2'" . DT  B  2 120 ? 20.303 61.995  26.227  1.00 116.29 ? 46  DT  J "C2'" 1 
ATOM   5448  C  "C1'" . DT  B  2 120 ? 21.317 61.232  25.393  1.00 116.29 ? 46  DT  J "C1'" 1 
ATOM   5449  N  N1    . DT  B  2 120 ? 20.730 60.421  24.275  1.00 117.49 ? 46  DT  J N1    1 
ATOM   5450  C  C2    . DT  B  2 120 ? 21.066 60.723  22.972  1.00 118.15 ? 46  DT  J C2    1 
ATOM   5451  O  O2    . DT  B  2 120 ? 21.806 61.642  22.669  1.00 117.12 ? 46  DT  J O2    1 
ATOM   5452  N  N3    . DT  B  2 120 ? 20.491 59.909  22.030  1.00 123.17 ? 46  DT  J N3    1 
ATOM   5453  C  C4    . DT  B  2 120 ? 19.640 58.842  22.254  1.00 128.51 ? 46  DT  J C4    1 
ATOM   5454  O  O4    . DT  B  2 120 ? 19.175 58.169  21.341  1.00 137.07 ? 46  DT  J O4    1 
ATOM   5455  C  C5    . DT  B  2 120 ? 19.337 58.574  23.638  1.00 122.44 ? 46  DT  J C5    1 
ATOM   5456  C  C7    . DT  B  2 120 ? 18.422 57.442  24.000  1.00 122.42 ? 46  DT  J C7    1 
ATOM   5457  C  C6    . DT  B  2 120 ? 19.892 59.365  24.572  1.00 120.04 ? 46  DT  J C6    1 
ATOM   5458  P  P     . DT  B  2 121 ? 21.232 64.769  28.011  1.00 111.93 ? 47  DT  J P     1 
ATOM   5459  O  OP1   . DT  B  2 121 ? 22.166 65.363  28.992  1.00 100.19 ? 47  DT  J OP1   1 
ATOM   5460  O  OP2   . DT  B  2 121 ? 19.818 64.548  28.383  1.00 122.77 ? 47  DT  J OP2   1 
ATOM   5461  O  "O5'" . DT  B  2 121 ? 21.265 65.643  26.678  1.00 110.11 ? 47  DT  J "O5'" 1 
ATOM   5462  C  "C5'" . DT  B  2 121 ? 22.324 65.458  25.745  1.00 102.07 ? 47  DT  J "C5'" 1 
ATOM   5463  C  "C4'" . DT  B  2 121 ? 21.943 66.008  24.385  1.00 101.22 ? 47  DT  J "C4'" 1 
ATOM   5464  O  "O4'" . DT  B  2 121 ? 21.397 64.946  23.555  1.00 96.83  ? 47  DT  J "O4'" 1 
ATOM   5465  C  "C3'" . DT  B  2 121 ? 20.881 67.109  24.417  1.00 108.55 ? 47  DT  J "C3'" 1 
ATOM   5466  O  "O3'" . DT  B  2 121 ? 21.255 68.158  23.545  1.00 106.77 ? 47  DT  J "O3'" 1 
ATOM   5467  C  "C2'" . DT  B  2 121 ? 19.625 66.393  23.921  1.00 113.30 ? 47  DT  J "C2'" 1 
ATOM   5468  C  "C1'" . DT  B  2 121 ? 20.227 65.417  22.930  1.00 103.88 ? 47  DT  J "C1'" 1 
ATOM   5469  N  N1    . DT  B  2 121 ? 19.353 64.251  22.612  1.00 109.02 ? 47  DT  J N1    1 
ATOM   5470  C  C2    . DT  B  2 121 ? 19.317 63.774  21.322  1.00 112.34 ? 47  DT  J C2    1 
ATOM   5471  O  O2    . DT  B  2 121 ? 19.967 64.259  20.413  1.00 111.74 ? 47  DT  J O2    1 
ATOM   5472  N  N3    . DT  B  2 121 ? 18.490 62.701  21.131  1.00 117.92 ? 47  DT  J N3    1 
ATOM   5473  C  C4    . DT  B  2 121 ? 17.709 62.069  22.082  1.00 122.82 ? 47  DT  J C4    1 
ATOM   5474  O  O4    . DT  B  2 121 ? 16.995 61.110  21.811  1.00 127.90 ? 47  DT  J O4    1 
ATOM   5475  C  C5    . DT  B  2 121 ? 17.793 62.619  23.415  1.00 120.15 ? 47  DT  J C5    1 
ATOM   5476  C  C7    . DT  B  2 121 ? 16.990 62.017  24.530  1.00 125.63 ? 47  DT  J C7    1 
ATOM   5477  C  C6    . DT  B  2 121 ? 18.601 63.672  23.613  1.00 113.56 ? 47  DT  J C6    1 
ATOM   5478  P  P     . DG  B  2 122 ? 21.866 69.522  24.133  1.00 108.56 ? 48  DG  J P     1 
ATOM   5479  O  OP1   . DG  B  2 122 ? 23.073 69.179  24.917  1.00 103.21 ? 48  DG  J OP1   1 
ATOM   5480  O  OP2   . DG  B  2 122 ? 20.761 70.270  24.774  1.00 114.04 ? 48  DG  J OP2   1 
ATOM   5481  O  "O5'" . DG  B  2 122 ? 22.313 70.323  22.825  1.00 100.16 ? 48  DG  J "O5'" 1 
ATOM   5482  C  "C5'" . DG  B  2 122 ? 23.122 69.683  21.851  1.00 90.78  ? 48  DG  J "C5'" 1 
ATOM   5483  C  "C4'" . DG  B  2 122 ? 22.425 69.656  20.502  1.00 86.40  ? 48  DG  J "C4'" 1 
ATOM   5484  O  "O4'" . DG  B  2 122 ? 21.381 68.647  20.504  1.00 87.32  ? 48  DG  J "O4'" 1 
ATOM   5485  C  "C3'" . DG  B  2 122 ? 21.754 70.967  20.090  1.00 88.36  ? 48  DG  J "C3'" 1 
ATOM   5486  O  "O3'" . DG  B  2 122 ? 22.073 71.251  18.741  1.00 88.65  ? 48  DG  J "O3'" 1 
ATOM   5487  C  "C2'" . DG  B  2 122 ? 20.261 70.672  20.267  1.00 93.32  ? 48  DG  J "C2'" 1 
ATOM   5488  C  "C1'" . DG  B  2 122 ? 20.207 69.189  19.948  1.00 91.83  ? 48  DG  J "C1'" 1 
ATOM   5489  N  N9    . DG  B  2 122 ? 19.062 68.502  20.539  1.00 102.58 ? 48  DG  J N9    1 
ATOM   5490  C  C8    . DG  B  2 122 ? 18.476 68.766  21.752  1.00 106.96 ? 48  DG  J C8    1 
ATOM   5491  N  N7    . DG  B  2 122 ? 17.471 67.981  22.025  1.00 111.14 ? 48  DG  J N7    1 
ATOM   5492  C  C5    . DG  B  2 122 ? 17.388 67.139  20.923  1.00 111.87 ? 48  DG  J C5    1 
ATOM   5493  C  C6    . DG  B  2 122 ? 16.489 66.080  20.652  1.00 122.74 ? 48  DG  J C6    1 
ATOM   5494  O  O6    . DG  B  2 122 ? 15.559 65.666  21.359  1.00 132.78 ? 48  DG  J O6    1 
ATOM   5495  N  N1    . DG  B  2 122 ? 16.748 65.483  19.422  1.00 119.21 ? 48  DG  J N1    1 
ATOM   5496  C  C2    . DG  B  2 122 ? 17.753 65.862  18.562  1.00 111.08 ? 48  DG  J C2    1 
ATOM   5497  N  N2    . DG  B  2 122 ? 17.853 65.171  17.417  1.00 110.66 ? 48  DG  J N2    1 
ATOM   5498  N  N3    . DG  B  2 122 ? 18.603 66.853  18.805  1.00 103.68 ? 48  DG  J N3    1 
ATOM   5499  C  C4    . DG  B  2 122 ? 18.361 67.444  20.000  1.00 105.36 ? 48  DG  J C4    1 
ATOM   5500  P  P     . DG  B  2 123 ? 21.789 72.704  18.119  1.00 93.42  ? 49  DG  J P     1 
ATOM   5501  O  OP1   . DG  B  2 123 ? 23.079 73.222  17.607  1.00 93.82  ? 49  DG  J OP1   1 
ATOM   5502  O  OP2   . DG  B  2 123 ? 21.016 73.502  19.098  1.00 93.62  ? 49  DG  J OP2   1 
ATOM   5503  O  "O5'" . DG  B  2 123 ? 20.837 72.386  16.876  1.00 87.61  ? 49  DG  J "O5'" 1 
ATOM   5504  C  "C5'" . DG  B  2 123 ? 21.166 71.324  15.996  1.00 79.52  ? 49  DG  J "C5'" 1 
ATOM   5505  C  "C4'" . DG  B  2 123 ? 19.943 70.859  15.231  1.00 90.40  ? 49  DG  J "C4'" 1 
ATOM   5506  O  "O4'" . DG  B  2 123 ? 19.113 70.031  16.086  1.00 94.02  ? 49  DG  J "O4'" 1 
ATOM   5507  C  "C3'" . DG  B  2 123 ? 19.042 71.980  14.707  1.00 96.04  ? 49  DG  J "C3'" 1 
ATOM   5508  O  "O3'" . DG  B  2 123 ? 18.783 71.777  13.328  1.00 98.88  ? 49  DG  J "O3'" 1 
ATOM   5509  C  "C2'" . DG  B  2 123 ? 17.770 71.851  15.550  1.00 101.19 ? 49  DG  J "C2'" 1 
ATOM   5510  C  "C1'" . DG  B  2 123 ? 17.765 70.370  15.884  1.00 102.28 ? 49  DG  J "C1'" 1 
ATOM   5511  N  N9    . DG  B  2 123 ? 17.019 70.044  17.098  1.00 109.10 ? 49  DG  J N9    1 
ATOM   5512  C  C8    . DG  B  2 123 ? 17.137 70.643  18.329  1.00 110.61 ? 49  DG  J C8    1 
ATOM   5513  N  N7    . DG  B  2 123 ? 16.342 70.139  19.231  1.00 114.63 ? 49  DG  J N7    1 
ATOM   5514  C  C5    . DG  B  2 123 ? 15.654 69.138  18.556  1.00 118.94 ? 49  DG  J C5    1 
ATOM   5515  C  C6    . DG  B  2 123 ? 14.656 68.247  19.019  1.00 129.88 ? 49  DG  J C6    1 
ATOM   5516  O  O6    . DG  B  2 123 ? 14.171 68.164  20.156  1.00 136.46 ? 49  DG  J O6    1 
ATOM   5517  N  N1    . DG  B  2 123 ? 14.221 67.389  18.011  1.00 132.06 ? 49  DG  J N1    1 
ATOM   5518  C  C2    . DG  B  2 123 ? 14.691 67.394  16.718  1.00 128.06 ? 49  DG  J C2    1 
ATOM   5519  N  N2    . DG  B  2 123 ? 14.155 66.494  15.880  1.00 132.49 ? 49  DG  J N2    1 
ATOM   5520  N  N3    . DG  B  2 123 ? 15.626 68.226  16.272  1.00 117.17 ? 49  DG  J N3    1 
ATOM   5521  C  C4    . DG  B  2 123 ? 16.059 69.067  17.243  1.00 113.92 ? 49  DG  J C4    1 
ATOM   5522  P  P     . DT  B  2 124 ? 18.099 72.932  12.447  1.00 102.11 ? 50  DT  J P     1 
ATOM   5523  O  OP1   . DT  B  2 124 ? 18.928 73.117  11.235  1.00 101.36 ? 50  DT  J OP1   1 
ATOM   5524  O  OP2   . DT  B  2 124 ? 17.814 74.089  13.324  1.00 106.08 ? 50  DT  J OP2   1 
ATOM   5525  O  "O5'" . DT  B  2 124 ? 16.707 72.285  12.015  1.00 112.84 ? 50  DT  J "O5'" 1 
ATOM   5526  C  "C5'" . DT  B  2 124 ? 16.673 70.954  11.526  1.00 120.41 ? 50  DT  J "C5'" 1 
ATOM   5527  C  "C4'" . DT  B  2 124 ? 15.242 70.480  11.388  1.00 136.29 ? 50  DT  J "C4'" 1 
ATOM   5528  O  "O4'" . DT  B  2 124 ? 14.747 70.047  12.678  1.00 140.27 ? 50  DT  J "O4'" 1 
ATOM   5529  C  "C3'" . DT  B  2 124 ? 14.270 71.541  10.875  1.00 147.10 ? 50  DT  J "C3'" 1 
ATOM   5530  O  "O3'" . DT  B  2 124 ? 13.556 71.036  9.756   1.00 156.23 ? 50  DT  J "O3'" 1 
ATOM   5531  C  "C2'" . DT  B  2 124 ? 13.351 71.829  12.071  1.00 149.35 ? 50  DT  J "C2'" 1 
ATOM   5532  C  "C1'" . DT  B  2 124 ? 13.449 70.546  12.887  1.00 146.41 ? 50  DT  J "C1'" 1 
ATOM   5533  N  N1    . DT  B  2 124 ? 13.267 70.753  14.360  1.00 145.88 ? 50  DT  J N1    1 
ATOM   5534  C  C2    . DT  B  2 124 ? 12.386 69.952  15.052  1.00 150.42 ? 50  DT  J C2    1 
ATOM   5535  O  O2    . DT  B  2 124 ? 11.726 69.074  14.525  1.00 153.97 ? 50  DT  J O2    1 
ATOM   5536  N  N3    . DT  B  2 124 ? 12.300 70.220  16.395  1.00 150.88 ? 50  DT  J N3    1 
ATOM   5537  C  C4    . DT  B  2 124 ? 12.994 71.185  17.101  1.00 147.63 ? 50  DT  J C4    1 
ATOM   5538  O  O4    . DT  B  2 124 ? 12.847 71.348  18.310  1.00 148.01 ? 50  DT  J O4    1 
ATOM   5539  C  C5    . DT  B  2 124 ? 13.905 71.987  16.317  1.00 144.78 ? 50  DT  J C5    1 
ATOM   5540  C  C7    . DT  B  2 124 ? 14.713 73.067  16.974  1.00 143.19 ? 50  DT  J C7    1 
ATOM   5541  C  C6    . DT  B  2 124 ? 13.997 71.734  15.000  1.00 143.12 ? 50  DT  J C6    1 
ATOM   5542  P  P     . DA  B  2 125 ? 12.617 72.003  8.883   1.00 161.23 ? 51  DA  J P     1 
ATOM   5543  O  OP1   . DA  B  2 125 ? 12.723 71.576  7.470   1.00 159.34 ? 51  DA  J OP1   1 
ATOM   5544  O  OP2   . DA  B  2 125 ? 12.921 73.404  9.255   1.00 161.06 ? 51  DA  J OP2   1 
ATOM   5545  O  "O5'" . DA  B  2 125 ? 11.155 71.654  9.412   1.00 167.83 ? 51  DA  J "O5'" 1 
ATOM   5546  C  "C5'" . DA  B  2 125 ? 10.865 70.330  9.830   1.00 167.88 ? 51  DA  J "C5'" 1 
ATOM   5547  C  "C4'" . DA  B  2 125 ? 9.486  70.254  10.450  1.00 175.90 ? 51  DA  J "C4'" 1 
ATOM   5548  O  "O4'" . DA  B  2 125 ? 9.595  70.217  11.896  1.00 174.51 ? 51  DA  J "O4'" 1 
ATOM   5549  C  "C3'" . DA  B  2 125 ? 8.566  71.427  10.118  1.00 184.23 ? 51  DA  J "C3'" 1 
ATOM   5550  O  "O3'" . DA  B  2 125 ? 7.289  70.925  9.784   1.00 195.80 ? 51  DA  J "O3'" 1 
ATOM   5551  C  "C2'" . DA  B  2 125 ? 8.540  72.237  11.418  1.00 182.35 ? 51  DA  J "C2'" 1 
ATOM   5552  C  "C1'" . DA  B  2 125 ? 8.692  71.140  12.456  1.00 178.61 ? 51  DA  J "C1'" 1 
ATOM   5553  N  N9    . DA  B  2 125 ? 9.244  71.597  13.727  1.00 172.80 ? 51  DA  J N9    1 
ATOM   5554  C  C8    . DA  B  2 125 ? 10.356 72.369  13.914  1.00 166.70 ? 51  DA  J C8    1 
ATOM   5555  N  N7    . DA  B  2 125 ? 10.626 72.612  15.175  1.00 167.14 ? 51  DA  J N7    1 
ATOM   5556  C  C5    . DA  B  2 125 ? 9.625  71.946  15.863  1.00 171.59 ? 51  DA  J C5    1 
ATOM   5557  C  C6    . DA  B  2 125 ? 9.346  71.810  17.236  1.00 170.25 ? 51  DA  J C6    1 
ATOM   5558  N  N6    . DA  B  2 125 ? 10.089 72.369  18.194  1.00 165.89 ? 51  DA  J N6    1 
ATOM   5559  N  N1    . DA  B  2 125 ? 8.268  71.077  17.587  1.00 175.50 ? 51  DA  J N1    1 
ATOM   5560  C  C2    . DA  B  2 125 ? 7.527  70.518  16.623  1.00 180.04 ? 51  DA  J C2    1 
ATOM   5561  N  N3    . DA  B  2 125 ? 7.690  70.576  15.302  1.00 179.83 ? 51  DA  J N3    1 
ATOM   5562  C  C4    . DA  B  2 125 ? 8.768  71.311  14.986  1.00 175.11 ? 51  DA  J C4    1 
ATOM   5563  P  P     . DG  B  2 126 ? 6.193  71.857  9.074   1.00 188.68 ? 52  DG  J P     1 
ATOM   5564  O  OP1   . DG  B  2 126 ? 5.915  71.273  7.743   1.00 191.28 ? 52  DG  J OP1   1 
ATOM   5565  O  OP2   . DG  B  2 126 ? 6.620  73.270  9.177   1.00 187.28 ? 52  DG  J OP2   1 
ATOM   5566  O  "O5'" . DG  B  2 126 ? 4.911  71.652  10.000  1.00 198.22 ? 52  DG  J "O5'" 1 
ATOM   5567  C  "C5'" . DG  B  2 126 ? 4.735  70.412  10.679  1.00 201.22 ? 52  DG  J "C5'" 1 
ATOM   5568  C  "C4'" . DG  B  2 126 ? 3.807  70.573  11.866  1.00 209.09 ? 52  DG  J "C4'" 1 
ATOM   5569  O  "O4'" . DG  B  2 126 ? 4.579  70.861  13.068  1.00 206.34 ? 52  DG  J "O4'" 1 
ATOM   5570  C  "C3'" . DG  B  2 126 ? 2.789  71.703  11.733  1.00 216.05 ? 52  DG  J "C3'" 1 
ATOM   5571  O  "O3'" . DG  B  2 126 ? 1.525  71.267  12.234  1.00 224.24 ? 52  DG  J "O3'" 1 
ATOM   5572  C  "C2'" . DG  B  2 126 ? 3.399  72.807  12.599  1.00 213.47 ? 52  DG  J "C2'" 1 
ATOM   5573  C  "C1'" . DG  B  2 126 ? 4.028  71.987  13.715  1.00 209.24 ? 52  DG  J "C1'" 1 
ATOM   5574  N  N9    . DG  B  2 126 ? 5.096  72.688  14.432  1.00 202.09 ? 52  DG  J N9    1 
ATOM   5575  C  C8    . DG  B  2 126 ? 6.185  73.309  13.873  1.00 195.96 ? 52  DG  J C8    1 
ATOM   5576  N  N7    . DG  B  2 126 ? 6.978  73.859  14.748  1.00 193.30 ? 52  DG  J N7    1 
ATOM   5577  C  C5    . DG  B  2 126 ? 6.385  73.581  15.973  1.00 196.83 ? 52  DG  J C5    1 
ATOM   5578  C  C6    . DG  B  2 126 ? 6.802  73.927  17.281  1.00 194.23 ? 52  DG  J C6    1 
ATOM   5579  O  O6    . DG  B  2 126 ? 7.809  74.564  17.615  1.00 187.74 ? 52  DG  J O6    1 
ATOM   5580  N  N1    . DG  B  2 126 ? 5.919  73.456  18.250  1.00 199.61 ? 52  DG  J N1    1 
ATOM   5581  C  C2    . DG  B  2 126 ? 4.774  72.739  17.989  1.00 206.39 ? 52  DG  J C2    1 
ATOM   5582  N  N2    . DG  B  2 126 ? 4.045  72.370  19.056  1.00 212.06 ? 52  DG  J N2    1 
ATOM   5583  N  N3    . DG  B  2 126 ? 4.368  72.407  16.760  1.00 207.70 ? 52  DG  J N3    1 
ATOM   5584  C  C4    . DG  B  2 126 ? 5.223  72.862  15.803  1.00 202.65 ? 52  DG  J C4    1 
ATOM   5585  P  P     . DT  B  2 127 ? 0.167  72.022  11.819  1.00 232.42 ? 53  DT  J P     1 
ATOM   5586  O  OP1   . DT  B  2 127 ? -0.763 71.003  11.281  1.00 236.87 ? 53  DT  J OP1   1 
ATOM   5587  O  OP2   . DT  B  2 127 ? 0.530  73.194  10.990  1.00 231.26 ? 53  DT  J OP2   1 
ATOM   5588  O  "O5'" . DT  B  2 127 ? -0.398 72.552  13.220  1.00 232.94 ? 53  DT  J "O5'" 1 
ATOM   5589  C  "C5'" . DT  B  2 127 ? 0.509  72.733  14.294  1.00 224.10 ? 53  DT  J "C5'" 1 
ATOM   5590  C  "C4'" . DT  B  2 127 ? -0.167 73.256  15.538  1.00 223.95 ? 53  DT  J "C4'" 1 
ATOM   5591  O  "O4'" . DT  B  2 127 ? 0.860  73.701  16.463  1.00 218.18 ? 53  DT  J "O4'" 1 
ATOM   5592  C  "C3'" . DT  B  2 127 ? -1.057 74.469  15.334  1.00 225.87 ? 53  DT  J "C3'" 1 
ATOM   5593  O  "O3'" . DT  B  2 127 ? -1.995 74.543  16.408  1.00 228.04 ? 53  DT  J "O3'" 1 
ATOM   5594  C  "C2'" . DT  B  2 127 ? -0.041 75.603  15.393  1.00 221.92 ? 53  DT  J "C2'" 1 
ATOM   5595  C  "C1'" . DT  B  2 127 ? 0.884  75.117  16.505  1.00 219.37 ? 53  DT  J "C1'" 1 
ATOM   5596  N  N1    . DT  B  2 127 ? 2.296  75.591  16.366  1.00 214.71 ? 53  DT  J N1    1 
ATOM   5597  C  C2    . DT  B  2 127 ? 3.010  75.908  17.498  1.00 212.63 ? 53  DT  J C2    1 
ATOM   5598  O  O2    . DT  B  2 127 ? 2.554  75.810  18.623  1.00 215.88 ? 53  DT  J O2    1 
ATOM   5599  N  N3    . DT  B  2 127 ? 4.289  76.341  17.268  1.00 205.76 ? 53  DT  J N3    1 
ATOM   5600  C  C4    . DT  B  2 127 ? 4.913  76.492  16.044  1.00 200.64 ? 53  DT  J C4    1 
ATOM   5601  O  O4    . DT  B  2 127 ? 6.071  76.890  15.942  1.00 193.10 ? 53  DT  J O4    1 
ATOM   5602  C  C5    . DT  B  2 127 ? 4.107  76.148  14.894  1.00 204.80 ? 53  DT  J C5    1 
ATOM   5603  C  C7    . DT  B  2 127 ? 4.674  76.273  13.511  1.00 200.59 ? 53  DT  J C7    1 
ATOM   5604  C  C6    . DT  B  2 127 ? 2.851  75.722  15.108  1.00 211.82 ? 53  DT  J C6    1 
ATOM   5605  P  P     . DA  B  2 128 ? -3.142 75.671  16.445  1.00 231.12 ? 54  DA  J P     1 
ATOM   5606  O  OP1   . DA  B  2 128 ? -4.433 74.960  16.583  1.00 236.69 ? 54  DA  J OP1   1 
ATOM   5607  O  OP2   . DA  B  2 128 ? -2.948 76.609  15.317  1.00 228.94 ? 54  DA  J OP2   1 
ATOM   5608  O  "O5'" . DA  B  2 128 ? -2.841 76.456  17.807  1.00 227.63 ? 54  DA  J "O5'" 1 
ATOM   5609  C  "C5'" . DA  B  2 128 ? -1.722 76.072  18.598  1.00 218.77 ? 54  DA  J "C5'" 1 
ATOM   5610  C  "C4'" . DA  B  2 128 ? -1.515 77.005  19.776  1.00 218.10 ? 54  DA  J "C4'" 1 
ATOM   5611  O  "O4'" . DA  B  2 128 ? -0.112 77.376  19.860  1.00 211.35 ? 54  DA  J "O4'" 1 
ATOM   5612  C  "C3'" . DA  B  2 128 ? -2.284 78.317  19.723  1.00 222.20 ? 54  DA  J "C3'" 1 
ATOM   5613  O  "O3'" . DA  B  2 128 ? -2.594 78.721  21.051  1.00 222.80 ? 54  DA  J "O3'" 1 
ATOM   5614  C  "C2'" . DA  B  2 128 ? -1.277 79.257  19.064  1.00 218.93 ? 54  DA  J "C2'" 1 
ATOM   5615  C  "C1'" . DA  B  2 128 ? 0.033  78.771  19.669  1.00 213.80 ? 54  DA  J "C1'" 1 
ATOM   5616  N  N9    . DA  B  2 128 ? 1.199  78.999  18.815  1.00 211.10 ? 54  DA  J N9    1 
ATOM   5617  C  C8    . DA  B  2 128 ? 1.295  78.766  17.470  1.00 210.87 ? 54  DA  J C8    1 
ATOM   5618  N  N7    . DA  B  2 128 ? 2.471  79.059  16.963  1.00 204.86 ? 54  DA  J N7    1 
ATOM   5619  C  C5    . DA  B  2 128 ? 3.199  79.513  18.052  1.00 201.48 ? 54  DA  J C5    1 
ATOM   5620  C  C6    . DA  B  2 128 ? 4.526  79.979  18.182  1.00 192.99 ? 54  DA  J C6    1 
ATOM   5621  N  N6    . DA  B  2 128 ? 5.382  80.063  17.158  1.00 185.27 ? 54  DA  J N6    1 
ATOM   5622  N  N1    . DA  B  2 128 ? 4.939  80.356  19.412  1.00 193.26 ? 54  DA  J N1    1 
ATOM   5623  C  C2    . DA  B  2 128 ? 4.078  80.271  20.434  1.00 199.51 ? 54  DA  J C2    1 
ATOM   5624  N  N3    . DA  B  2 128 ? 2.813  79.848  20.435  1.00 206.24 ? 54  DA  J N3    1 
ATOM   5625  C  C4    . DA  B  2 128 ? 2.431  79.481  19.201  1.00 206.72 ? 54  DA  J C4    1 
ATOM   5626  P  P     . DG  B  2 129 ? -3.497 80.018  21.340  1.00 224.23 ? 55  DG  J P     1 
ATOM   5627  O  OP1   . DG  B  2 129 ? -4.555 79.604  22.288  1.00 231.05 ? 55  DG  J OP1   1 
ATOM   5628  O  OP2   . DG  B  2 129 ? -3.877 80.644  20.055  1.00 226.01 ? 55  DG  J OP2   1 
ATOM   5629  O  "O5'" . DG  B  2 129 ? -2.490 80.999  22.101  1.00 220.28 ? 55  DG  J "O5'" 1 
ATOM   5630  C  "C5'" . DG  B  2 129 ? -1.670 80.487  23.144  1.00 216.72 ? 55  DG  J "C5'" 1 
ATOM   5631  C  "C4'" . DG  B  2 129 ? -0.569 81.466  23.506  1.00 214.24 ? 55  DG  J "C4'" 1 
ATOM   5632  O  "O4'" . DG  B  2 129 ? 0.417  81.521  22.442  1.00 208.22 ? 55  DG  J "O4'" 1 
ATOM   5633  C  "C3'" . DG  B  2 129 ? -1.030 82.912  23.735  1.00 221.06 ? 55  DG  J "C3'" 1 
ATOM   5634  O  "O3'" . DG  B  2 129 ? -0.502 83.391  24.962  1.00 223.46 ? 55  DG  J "O3'" 1 
ATOM   5635  C  "C2'" . DG  B  2 129 ? -0.437 83.666  22.541  1.00 216.36 ? 55  DG  J "C2'" 1 
ATOM   5636  C  "C1'" . DG  B  2 129 ? 0.819  82.856  22.287  1.00 206.24 ? 55  DG  J "C1'" 1 
ATOM   5637  N  N9    . DG  B  2 129 ? 1.390  83.036  20.955  1.00 198.65 ? 55  DG  J N9    1 
ATOM   5638  C  C8    . DG  B  2 129 ? 0.772  82.825  19.745  1.00 200.53 ? 55  DG  J C8    1 
ATOM   5639  N  N7    . DG  B  2 129 ? 1.542  83.075  18.720  1.00 195.34 ? 55  DG  J N7    1 
ATOM   5640  C  C5    . DG  B  2 129 ? 2.746  83.475  19.288  1.00 189.68 ? 55  DG  J C5    1 
ATOM   5641  C  C6    . DG  B  2 129 ? 3.961  83.873  18.676  1.00 182.74 ? 55  DG  J C6    1 
ATOM   5642  O  O6    . DG  B  2 129 ? 4.223  83.953  17.468  1.00 181.28 ? 55  DG  J O6    1 
ATOM   5643  N  N1    . DG  B  2 129 ? 4.932  84.199  19.622  1.00 178.83 ? 55  DG  J N1    1 
ATOM   5644  C  C2    . DG  B  2 129 ? 4.751  84.145  20.985  1.00 181.28 ? 55  DG  J C2    1 
ATOM   5645  N  N2    . DG  B  2 129 ? 5.796  84.496  21.746  1.00 176.85 ? 55  DG  J N2    1 
ATOM   5646  N  N3    . DG  B  2 129 ? 3.620  83.775  21.566  1.00 187.74 ? 55  DG  J N3    1 
ATOM   5647  C  C4    . DG  B  2 129 ? 2.666  83.456  20.661  1.00 191.64 ? 55  DG  J C4    1 
ATOM   5648  P  P     . DG  B  2 130 ? -1.269 84.537  25.787  1.00 221.19 ? 56  DG  J P     1 
ATOM   5649  O  OP1   . DG  B  2 130 ? -2.360 83.893  26.552  1.00 227.73 ? 56  DG  J OP1   1 
ATOM   5650  O  OP2   . DG  B  2 130 ? -1.583 85.637  24.848  1.00 223.06 ? 56  DG  J OP2   1 
ATOM   5651  O  "O5'" . DG  B  2 130 ? -0.162 85.070  26.810  1.00 216.80 ? 56  DG  J "O5'" 1 
ATOM   5652  C  "C5'" . DG  B  2 130 ? 0.382  86.373  26.650  1.00 215.05 ? 56  DG  J "C5'" 1 
ATOM   5653  C  "C4'" . DG  B  2 130 ? 1.900  86.335  26.639  1.00 206.46 ? 56  DG  J "C4'" 1 
ATOM   5654  O  "O4'" . DG  B  2 130 ? 2.365  85.837  25.351  1.00 201.64 ? 56  DG  J "O4'" 1 
ATOM   5655  C  "C3'" . DG  B  2 130 ? 2.564  87.697  26.819  1.00 204.72 ? 56  DG  J "C3'" 1 
ATOM   5656  O  "O3'" . DG  B  2 130 ? 3.780  87.572  27.550  1.00 198.77 ? 56  DG  J "O3'" 1 
ATOM   5657  C  "C2'" . DG  B  2 130 ? 2.817  88.129  25.386  1.00 202.06 ? 56  DG  J "C2'" 1 
ATOM   5658  C  "C1'" . DG  B  2 130 ? 3.187  86.808  24.736  1.00 197.51 ? 56  DG  J "C1'" 1 
ATOM   5659  N  N9    . DG  B  2 130 ? 2.949  86.788  23.294  1.00 197.05 ? 56  DG  J N9    1 
ATOM   5660  C  C8    . DG  B  2 130 ? 1.785  86.440  22.653  1.00 202.31 ? 56  DG  J C8    1 
ATOM   5661  N  N7    . DG  B  2 130 ? 1.863  86.521  21.354  1.00 200.46 ? 56  DG  J N7    1 
ATOM   5662  C  C5    . DG  B  2 130 ? 3.161  86.954  21.117  1.00 193.53 ? 56  DG  J C5    1 
ATOM   5663  C  C6    . DG  B  2 130 ? 3.821  87.220  19.895  1.00 188.85 ? 56  DG  J C6    1 
ATOM   5664  O  O6    . DG  B  2 130 ? 3.371  87.122  18.746  1.00 189.93 ? 56  DG  J O6    1 
ATOM   5665  N  N1    . DG  B  2 130 ? 5.134  87.638  20.098  1.00 182.46 ? 56  DG  J N1    1 
ATOM   5666  C  C2    . DG  B  2 130 ? 5.734  87.780  21.328  1.00 180.79 ? 56  DG  J C2    1 
ATOM   5667  N  N2    . DG  B  2 130 ? 7.010  88.194  21.328  1.00 174.48 ? 56  DG  J N2    1 
ATOM   5668  N  N3    . DG  B  2 130 ? 5.125  87.533  22.482  1.00 185.10 ? 56  DG  J N3    1 
ATOM   5669  C  C4    . DG  B  2 130 ? 3.844  87.124  22.300  1.00 191.36 ? 56  DG  J C4    1 
ATOM   5670  P  P     . DA  B  2 131 ? 4.318  88.808  28.426  1.00 156.06 ? 57  DA  J P     1 
ATOM   5671  O  OP1   . DA  B  2 131 ? 5.176  88.260  29.499  1.00 155.63 ? 57  DA  J OP1   1 
ATOM   5672  O  OP2   . DA  B  2 131 ? 3.147  89.639  28.781  1.00 156.59 ? 57  DA  J OP2   1 
ATOM   5673  O  "O5'" . DA  B  2 131 ? 5.223  89.652  27.406  1.00 158.87 ? 57  DA  J "O5'" 1 
ATOM   5674  C  "C5'" . DA  B  2 131 ? 6.618  89.362  27.276  1.00 158.05 ? 57  DA  J "C5'" 1 
ATOM   5675  C  "C4'" . DA  B  2 131 ? 7.327  90.375  26.380  1.00 156.39 ? 57  DA  J "C4'" 1 
ATOM   5676  O  "O4'" . DA  B  2 131 ? 6.897  90.216  25.000  1.00 158.54 ? 57  DA  J "O4'" 1 
ATOM   5677  C  "C3'" . DA  B  2 131 ? 7.077  91.845  26.707  1.00 153.24 ? 57  DA  J "C3'" 1 
ATOM   5678  O  "O3'" . DA  B  2 131 ? 8.210  92.604  26.312  1.00 141.78 ? 57  DA  J "O3'" 1 
ATOM   5679  C  "C2'" . DA  B  2 131 ? 5.891  92.156  25.805  1.00 158.23 ? 57  DA  J "C2'" 1 
ATOM   5680  C  "C1'" . DA  B  2 131 ? 6.335  91.434  24.545  1.00 159.42 ? 57  DA  J "C1'" 1 
ATOM   5681  N  N9    . DA  B  2 131 ? 5.259  91.113  23.618  1.00 161.95 ? 57  DA  J N9    1 
ATOM   5682  C  C8    . DA  B  2 131 ? 4.017  90.653  23.930  1.00 164.34 ? 57  DA  J C8    1 
ATOM   5683  N  N7    . DA  B  2 131 ? 3.258  90.419  22.887  1.00 164.10 ? 57  DA  J N7    1 
ATOM   5684  C  C5    . DA  B  2 131 ? 4.064  90.750  21.814  1.00 161.66 ? 57  DA  J C5    1 
ATOM   5685  C  C6    . DA  B  2 131 ? 3.847  90.730  20.424  1.00 161.18 ? 57  DA  J C6    1 
ATOM   5686  N  N6    . DA  B  2 131 ? 2.697  90.343  19.862  1.00 162.14 ? 57  DA  J N6    1 
ATOM   5687  N  N1    . DA  B  2 131 ? 4.862  91.124  19.631  1.00 160.17 ? 57  DA  J N1    1 
ATOM   5688  C  C2    . DA  B  2 131 ? 6.012  91.511  20.194  1.00 158.15 ? 57  DA  J C2    1 
ATOM   5689  N  N3    . DA  B  2 131 ? 6.332  91.572  21.484  1.00 156.59 ? 57  DA  J N3    1 
ATOM   5690  C  C4    . DA  B  2 131 ? 5.304  91.175  22.247  1.00 160.08 ? 57  DA  J C4    1 
ATOM   5691  P  P     . DC  B  2 132 ? 9.163  93.303  27.398  1.00 140.14 ? 58  DC  J P     1 
ATOM   5692  O  OP1   . DC  B  2 132 ? 9.566  92.277  28.383  1.00 139.44 ? 58  DC  J OP1   1 
ATOM   5693  O  OP2   . DC  B  2 132 ? 8.488  94.536  27.856  1.00 140.51 ? 58  DC  J OP2   1 
ATOM   5694  O  "O5'" . DC  B  2 132 ? 10.443 93.745  26.545  1.00 132.54 ? 58  DC  J "O5'" 1 
ATOM   5695  C  "C5'" . DC  B  2 132 ? 11.120 92.790  25.732  1.00 131.91 ? 58  DC  J "C5'" 1 
ATOM   5696  C  "C4'" . DC  B  2 132 ? 11.489 93.382  24.380  1.00 134.13 ? 58  DC  J "C4'" 1 
ATOM   5697  O  "O4'" . DC  B  2 132 ? 10.343 93.328  23.491  1.00 134.42 ? 58  DC  J "O4'" 1 
ATOM   5698  C  "C3'" . DC  B  2 132 ? 11.939 94.839  24.404  1.00 136.20 ? 58  DC  J "C3'" 1 
ATOM   5699  O  "O3'" . DC  B  2 132 ? 12.981 95.035  23.458  1.00 137.14 ? 58  DC  J "O3'" 1 
ATOM   5700  C  "C2'" . DC  B  2 132 ? 10.672 95.601  24.017  1.00 133.61 ? 58  DC  J "C2'" 1 
ATOM   5701  C  "C1'" . DC  B  2 132 ? 9.997  94.630  23.057  1.00 131.03 ? 58  DC  J "C1'" 1 
ATOM   5702  N  N1    . DC  B  2 132 ? 8.511  94.730  23.057  1.00 126.65 ? 58  DC  J N1    1 
ATOM   5703  C  C2    . DC  B  2 132 ? 7.804  94.581  21.857  1.00 123.34 ? 58  DC  J C2    1 
ATOM   5704  O  O2    . DC  B  2 132 ? 8.429  94.378  20.809  1.00 123.38 ? 58  DC  J O2    1 
ATOM   5705  N  N3    . DC  B  2 132 ? 6.451  94.667  21.880  1.00 119.86 ? 58  DC  J N3    1 
ATOM   5706  C  C4    . DC  B  2 132 ? 5.815  94.886  23.032  1.00 123.20 ? 58  DC  J C4    1 
ATOM   5707  N  N4    . DC  B  2 132 ? 4.481  94.967  23.005  1.00 121.74 ? 58  DC  J N4    1 
ATOM   5708  C  C5    . DC  B  2 132 ? 6.520  95.046  24.260  1.00 125.03 ? 58  DC  J C5    1 
ATOM   5709  C  C6    . DC  B  2 132 ? 7.852  94.953  24.228  1.00 126.14 ? 58  DC  J C6    1 
ATOM   5710  P  P     . DC  B  2 133 ? 13.797 96.418  23.421  1.00 130.16 ? 59  DC  J P     1 
ATOM   5711  O  OP1   . DC  B  2 133 ? 15.221 96.086  23.191  1.00 131.46 ? 59  DC  J OP1   1 
ATOM   5712  O  OP2   . DC  B  2 133 ? 13.410 97.208  24.612  1.00 131.37 ? 59  DC  J OP2   1 
ATOM   5713  O  "O5'" . DC  B  2 133 ? 13.229 97.156  22.120  1.00 128.62 ? 59  DC  J "O5'" 1 
ATOM   5714  C  "C5'" . DC  B  2 133 ? 13.369 96.541  20.844  1.00 125.56 ? 59  DC  J "C5'" 1 
ATOM   5715  C  "C4'" . DC  B  2 133 ? 12.491 97.217  19.805  1.00 123.34 ? 59  DC  J "C4'" 1 
ATOM   5716  O  "O4'" . DC  B  2 133 ? 11.086 96.937  20.076  1.00 123.40 ? 59  DC  J "O4'" 1 
ATOM   5717  C  "C3'" . DC  B  2 133 ? 12.598 98.747  19.747  1.00 121.21 ? 59  DC  J "C3'" 1 
ATOM   5718  O  "O3'" . DC  B  2 133 ? 12.492 99.169  18.395  1.00 115.04 ? 59  DC  J "O3'" 1 
ATOM   5719  C  "C2'" . DC  B  2 133 ? 11.362 99.172  20.528  1.00 123.57 ? 59  DC  J "C2'" 1 
ATOM   5720  C  "C1'" . DC  B  2 133 ? 10.387 98.152  19.982  1.00 124.89 ? 59  DC  J "C1'" 1 
ATOM   5721  N  N1    . DC  B  2 133 ? 9.092  98.062  20.717  1.00 131.34 ? 59  DC  J N1    1 
ATOM   5722  C  C2    . DC  B  2 133 ? 7.899  97.986  19.986  1.00 133.80 ? 59  DC  J C2    1 
ATOM   5723  O  O2    . DC  B  2 133 ? 7.956  97.982  18.749  1.00 132.26 ? 59  DC  J O2    1 
ATOM   5724  N  N3    . DC  B  2 133 ? 6.721  97.913  20.654  1.00 136.06 ? 59  DC  J N3    1 
ATOM   5725  C  C4    . DC  B  2 133 ? 6.713  97.920  21.989  1.00 137.41 ? 59  DC  J C4    1 
ATOM   5726  N  N4    . DC  B  2 133 ? 5.531  97.850  22.608  1.00 142.64 ? 59  DC  J N4    1 
ATOM   5727  C  C5    . DC  B  2 133 ? 7.919  98.004  22.750  1.00 134.33 ? 59  DC  J C5    1 
ATOM   5728  C  C6    . DC  B  2 133 ? 9.074  98.076  22.079  1.00 132.68 ? 59  DC  J C6    1 
ATOM   5729  P  P     . DA  B  2 134 ? 13.725 99.875  17.645  1.00 122.03 ? 60  DA  J P     1 
ATOM   5730  O  OP1   . DA  B  2 134 ? 14.802 98.868  17.511  1.00 124.49 ? 60  DA  J OP1   1 
ATOM   5731  O  OP2   . DA  B  2 134 ? 13.998 101.162 18.322  1.00 121.67 ? 60  DA  J OP2   1 
ATOM   5732  O  "O5'" . DA  B  2 134 ? 13.134 100.205 16.194  1.00 111.57 ? 60  DA  J "O5'" 1 
ATOM   5733  C  "C5'" . DA  B  2 134 ? 12.603 99.157  15.387  1.00 106.03 ? 60  DA  J "C5'" 1 
ATOM   5734  C  "C4'" . DA  B  2 134 ? 11.323 99.588  14.678  1.00 113.98 ? 60  DA  J "C4'" 1 
ATOM   5735  O  "O4'" . DA  B  2 134 ? 10.206 99.562  15.606  1.00 121.79 ? 60  DA  J "O4'" 1 
ATOM   5736  C  "C3'" . DA  B  2 134 ? 11.329 100.993 14.088  1.00 117.60 ? 60  DA  J "C3'" 1 
ATOM   5737  O  "O3'" . DA  B  2 134 ? 10.510 101.013 12.929  1.00 123.22 ? 60  DA  J "O3'" 1 
ATOM   5738  C  "C2'" . DA  B  2 134 ? 10.711 101.818 15.212  1.00 119.90 ? 60  DA  J "C2'" 1 
ATOM   5739  C  "C1'" . DA  B  2 134 ? 9.645  100.858 15.718  1.00 125.74 ? 60  DA  J "C1'" 1 
ATOM   5740  N  N9    . DA  B  2 134 ? 9.273  101.057 17.114  1.00 135.76 ? 60  DA  J N9    1 
ATOM   5741  C  C8    . DA  B  2 134 ? 10.114 101.263 18.170  1.00 139.31 ? 60  DA  J C8    1 
ATOM   5742  N  N7    . DA  B  2 134 ? 9.496  101.387 19.321  1.00 143.64 ? 60  DA  J N7    1 
ATOM   5743  C  C5    . DA  B  2 134 ? 8.159  101.238 18.999  1.00 142.65 ? 60  DA  J C5    1 
ATOM   5744  C  C6    . DA  B  2 134 ? 6.988  101.264 19.778  1.00 145.37 ? 60  DA  J C6    1 
ATOM   5745  N  N6    . DA  B  2 134 ? 6.989  101.456 21.101  1.00 148.62 ? 60  DA  J N6    1 
ATOM   5746  N  N1    . DA  B  2 134 ? 5.811  101.085 19.144  1.00 145.72 ? 60  DA  J N1    1 
ATOM   5747  C  C2    . DA  B  2 134 ? 5.815  100.896 17.820  1.00 142.37 ? 60  DA  J C2    1 
ATOM   5748  N  N3    . DA  B  2 134 ? 6.849  100.848 16.983  1.00 139.13 ? 60  DA  J N3    1 
ATOM   5749  C  C4    . DA  B  2 134 ? 8.003  101.029 17.643  1.00 139.85 ? 60  DA  J C4    1 
ATOM   5750  P  P     . DG  B  2 135 ? 10.838 102.005 11.710  1.00 118.87 ? 61  DG  J P     1 
ATOM   5751  O  OP1   . DG  B  2 135 ? 10.818 101.190 10.474  1.00 114.02 ? 61  DG  J OP1   1 
ATOM   5752  O  OP2   . DG  B  2 135 ? 12.046 102.785 12.060  1.00 117.83 ? 61  DG  J OP2   1 
ATOM   5753  O  "O5'" . DG  B  2 135 ? 9.585  103.000 11.688  1.00 123.60 ? 61  DG  J "O5'" 1 
ATOM   5754  C  "C5'" . DG  B  2 135 ? 8.293  102.492 11.388  1.00 127.23 ? 61  DG  J "C5'" 1 
ATOM   5755  C  "C4'" . DG  B  2 135 ? 7.207  103.319 12.056  1.00 133.56 ? 61  DG  J "C4'" 1 
ATOM   5756  O  "O4'" . DG  B  2 135 ? 7.279  103.167 13.498  1.00 138.85 ? 61  DG  J "O4'" 1 
ATOM   5757  C  "C3'" . DG  B  2 135 ? 7.264  104.831 11.786  1.00 134.06 ? 61  DG  J "C3'" 1 
ATOM   5758  O  "O3'" . DG  B  2 135 ? 5.985  105.281 11.355  1.00 133.15 ? 61  DG  J "O3'" 1 
ATOM   5759  C  "C2'" . DG  B  2 135 ? 7.630  105.420 13.154  1.00 138.28 ? 61  DG  J "C2'" 1 
ATOM   5760  C  "C1'" . DG  B  2 135 ? 6.975  104.409 14.073  1.00 142.38 ? 61  DG  J "C1'" 1 
ATOM   5761  N  N9    . DG  B  2 135 ? 7.453  104.438 15.454  1.00 146.76 ? 61  DG  J N9    1 
ATOM   5762  C  C8    . DG  B  2 135 ? 8.754  104.473 15.895  1.00 146.57 ? 61  DG  J C8    1 
ATOM   5763  N  N7    . DG  B  2 135 ? 8.861  104.492 17.198  1.00 146.92 ? 61  DG  J N7    1 
ATOM   5764  C  C5    . DG  B  2 135 ? 7.544  104.467 17.645  1.00 150.07 ? 61  DG  J C5    1 
ATOM   5765  C  C6    . DG  B  2 135 ? 7.020  104.472 18.964  1.00 154.21 ? 61  DG  J C6    1 
ATOM   5766  O  O6    . DG  B  2 135 ? 7.635  104.499 20.040  1.00 153.83 ? 61  DG  J O6    1 
ATOM   5767  N  N1    . DG  B  2 135 ? 5.626  104.440 18.962  1.00 157.73 ? 61  DG  J N1    1 
ATOM   5768  C  C2    . DG  B  2 135 ? 4.842  104.408 17.832  1.00 157.06 ? 61  DG  J C2    1 
ATOM   5769  N  N2    . DG  B  2 135 ? 3.516  104.379 18.017  1.00 160.77 ? 61  DG  J N2    1 
ATOM   5770  N  N3    . DG  B  2 135 ? 5.321  104.403 16.600  1.00 152.57 ? 61  DG  J N3    1 
ATOM   5771  C  C4    . DG  B  2 135 ? 6.672  104.433 16.582  1.00 149.67 ? 61  DG  J C4    1 
ATOM   5772  P  P     . DG  B  2 136 ? 5.824  106.655 10.537  1.00 127.84 ? 62  DG  J P     1 
ATOM   5773  O  OP1   . DG  B  2 136 ? 5.833  106.323 9.096   1.00 123.28 ? 62  DG  J OP1   1 
ATOM   5774  O  OP2   . DG  B  2 136 ? 6.793  107.638 11.070  1.00 127.45 ? 62  DG  J OP2   1 
ATOM   5775  O  "O5'" . DG  B  2 136 ? 4.360  107.156 10.938  1.00 133.31 ? 62  DG  J "O5'" 1 
ATOM   5776  C  "C5'" . DG  B  2 136 ? 3.578  106.394 11.852  1.00 143.40 ? 62  DG  J "C5'" 1 
ATOM   5777  C  "C4'" . DG  B  2 136 ? 2.943  107.292 12.898  1.00 154.34 ? 62  DG  J "C4'" 1 
ATOM   5778  O  "O4'" . DG  B  2 136 ? 3.477  106.970 14.202  1.00 158.91 ? 62  DG  J "O4'" 1 
ATOM   5779  C  "C3'" . DG  B  2 136 ? 3.177  108.791 12.690  1.00 159.03 ? 62  DG  J "C3'" 1 
ATOM   5780  O  "O3'" . DG  B  2 136 ? 1.929  109.452 12.499  1.00 164.90 ? 62  DG  J "O3'" 1 
ATOM   5781  C  "C2'" . DG  B  2 136 ? 3.890  109.257 13.971  1.00 160.89 ? 62  DG  J "C2'" 1 
ATOM   5782  C  "C1'" . DG  B  2 136 ? 3.587  108.144 14.964  1.00 162.45 ? 62  DG  J "C1'" 1 
ATOM   5783  N  N9    . DG  B  2 136 ? 4.647  107.946 15.949  1.00 165.05 ? 62  DG  J N9    1 
ATOM   5784  C  C8    . DG  B  2 136 ? 5.979  107.726 15.690  1.00 163.51 ? 62  DG  J C8    1 
ATOM   5785  N  N7    . DG  B  2 136 ? 6.701  107.581 16.765  1.00 163.71 ? 62  DG  J N7    1 
ATOM   5786  C  C5    . DG  B  2 136 ? 5.791  107.708 17.807  1.00 167.41 ? 62  DG  J C5    1 
ATOM   5787  C  C6    . DG  B  2 136 ? 5.996  107.641 19.205  1.00 171.93 ? 62  DG  J C6    1 
ATOM   5788  O  O6    . DG  B  2 136 ? 7.058  107.449 19.814  1.00 170.96 ? 62  DG  J O6    1 
ATOM   5789  N  N1    . DG  B  2 136 ? 4.809  107.823 19.911  1.00 177.13 ? 62  DG  J N1    1 
ATOM   5790  C  C2    . DG  B  2 136 ? 3.578  108.043 19.336  1.00 175.85 ? 62  DG  J C2    1 
ATOM   5791  N  N2    . DG  B  2 136 ? 2.543  108.197 20.177  1.00 176.80 ? 62  DG  J N2    1 
ATOM   5792  N  N3    . DG  B  2 136 ? 3.373  108.109 18.023  1.00 172.57 ? 62  DG  J N3    1 
ATOM   5793  C  C4    . DG  B  2 136 ? 4.521  107.933 17.323  1.00 168.39 ? 62  DG  J C4    1 
ATOM   5794  P  P     . DT  B  2 137 ? 1.843  111.057 12.458  1.00 159.85 ? 63  DT  J P     1 
ATOM   5795  O  OP1   . DT  B  2 137 ? 0.659  111.409 11.643  1.00 159.62 ? 63  DT  J OP1   1 
ATOM   5796  O  OP2   . DT  B  2 137 ? 3.167  111.598 12.079  1.00 159.15 ? 63  DT  J OP2   1 
ATOM   5797  O  "O5'" . DT  B  2 137 ? 1.545  111.452 13.978  1.00 168.40 ? 63  DT  J "O5'" 1 
ATOM   5798  C  "C5'" . DT  B  2 137 ? 0.598  110.696 14.726  1.00 172.71 ? 63  DT  J "C5'" 1 
ATOM   5799  C  "C4'" . DT  B  2 137 ? 0.295  111.361 16.056  1.00 177.29 ? 63  DT  J "C4'" 1 
ATOM   5800  O  "O4'" . DT  B  2 137 ? 1.272  110.949 17.046  1.00 179.24 ? 63  DT  J "O4'" 1 
ATOM   5801  C  "C3'" . DT  B  2 137 ? 0.314  112.887 16.034  1.00 177.37 ? 63  DT  J "C3'" 1 
ATOM   5802  O  "O3'" . DT  B  2 137 ? -0.820 113.390 16.721  1.00 176.75 ? 63  DT  J "O3'" 1 
ATOM   5803  C  "C2'" . DT  B  2 137 ? 1.619  113.246 16.748  1.00 178.75 ? 63  DT  J "C2'" 1 
ATOM   5804  C  "C1'" . DT  B  2 137 ? 1.790  112.079 17.710  1.00 181.09 ? 63  DT  J "C1'" 1 
ATOM   5805  N  N1    . DT  B  2 137 ? 3.212  111.792 18.051  1.00 181.72 ? 63  DT  J N1    1 
ATOM   5806  C  C2    . DT  B  2 137 ? 3.584  111.679 19.374  1.00 183.84 ? 63  DT  J C2    1 
ATOM   5807  O  O2    . DT  B  2 137 ? 2.806  111.812 20.302  1.00 186.48 ? 63  DT  J O2    1 
ATOM   5808  N  N3    . DT  B  2 137 ? 4.913  111.405 19.570  1.00 182.67 ? 63  DT  J N3    1 
ATOM   5809  C  C4    . DT  B  2 137 ? 5.883  111.233 18.597  1.00 179.49 ? 63  DT  J C4    1 
ATOM   5810  O  O4    . DT  B  2 137 ? 7.053  110.989 18.869  1.00 177.91 ? 63  DT  J O4    1 
ATOM   5811  C  C5    . DT  B  2 137 ? 5.422  111.361 17.235  1.00 177.77 ? 63  DT  J C5    1 
ATOM   5812  C  C7    . DT  B  2 137 ? 6.383  111.196 16.096  1.00 174.42 ? 63  DT  J C7    1 
ATOM   5813  C  C6    . DT  B  2 137 ? 4.125  111.630 17.032  1.00 179.45 ? 63  DT  J C6    1 
ATOM   5814  P  P     . DG  B  2 138 ? -1.259 114.924 16.546  1.00 177.20 ? 64  DG  J P     1 
ATOM   5815  O  OP1   . DG  B  2 138 ? -2.738 114.972 16.541  1.00 176.86 ? 64  DG  J OP1   1 
ATOM   5816  O  OP2   . DG  B  2 138 ? -0.497 115.486 15.409  1.00 173.01 ? 64  DG  J OP2   1 
ATOM   5817  O  "O5'" . DG  B  2 138 ? -0.730 115.618 17.884  1.00 180.00 ? 64  DG  J "O5'" 1 
ATOM   5818  C  "C5'" . DG  B  2 138 ? -1.115 115.096 19.148  1.00 181.71 ? 64  DG  J "C5'" 1 
ATOM   5819  C  "C4'" . DG  B  2 138 ? -0.391 115.815 20.269  1.00 182.82 ? 64  DG  J "C4'" 1 
ATOM   5820  O  "O4'" . DG  B  2 138 ? 0.930  115.238 20.445  1.00 181.63 ? 64  DG  J "O4'" 1 
ATOM   5821  C  "C3'" . DG  B  2 138 ? -0.181 117.313 20.041  1.00 182.87 ? 64  DG  J "C3'" 1 
ATOM   5822  O  "O3'" . DG  B  2 138 ? -0.465 118.026 21.234  1.00 181.90 ? 64  DG  J "O3'" 1 
ATOM   5823  C  "C2'" . DG  B  2 138 ? 1.296  117.408 19.664  1.00 182.19 ? 64  DG  J "C2'" 1 
ATOM   5824  C  "C1'" . DG  B  2 138 ? 1.896  116.262 20.461  1.00 182.73 ? 64  DG  J "C1'" 1 
ATOM   5825  N  N9    . DG  B  2 138 ? 3.129  115.744 19.877  1.00 182.50 ? 64  DG  J N9    1 
ATOM   5826  C  C8    . DG  B  2 138 ? 3.428  115.651 18.540  1.00 181.13 ? 64  DG  J C8    1 
ATOM   5827  N  N7    . DG  B  2 138 ? 4.608  115.151 18.305  1.00 179.95 ? 64  DG  J N7    1 
ATOM   5828  C  C5    . DG  B  2 138 ? 5.127  114.895 19.566  1.00 180.20 ? 64  DG  J C5    1 
ATOM   5829  C  C6    . DG  B  2 138 ? 6.375  114.349 19.940  1.00 178.58 ? 64  DG  J C6    1 
ATOM   5830  O  O6    . DG  B  2 138 ? 7.298  113.972 19.206  1.00 176.24 ? 64  DG  J O6    1 
ATOM   5831  N  N1    . DG  B  2 138 ? 6.505  114.258 21.323  1.00 179.29 ? 64  DG  J N1    1 
ATOM   5832  C  C2    . DG  B  2 138 ? 5.550  114.646 22.230  1.00 180.71 ? 64  DG  J C2    1 
ATOM   5833  N  N2    . DG  B  2 138 ? 5.862  114.480 23.523  1.00 181.34 ? 64  DG  J N2    1 
ATOM   5834  N  N3    . DG  B  2 138 ? 4.372  115.161 21.894  1.00 182.61 ? 64  DG  J N3    1 
ATOM   5835  C  C4    . DG  B  2 138 ? 4.230  115.256 20.548  1.00 182.20 ? 64  DG  J C4    1 
ATOM   5836  P  P     . DG  B  2 139 ? -0.606 119.627 21.220  1.00 199.04 ? 65  DG  J P     1 
ATOM   5837  O  OP1   . DG  B  2 139 ? -1.980 119.950 21.664  1.00 200.85 ? 65  DG  J OP1   1 
ATOM   5838  O  OP2   . DG  B  2 139 ? -0.119 120.145 19.922  1.00 196.58 ? 65  DG  J OP2   1 
ATOM   5839  O  "O5'" . DG  B  2 139 ? 0.417  120.094 22.353  1.00 196.86 ? 65  DG  J "O5'" 1 
ATOM   5840  C  "C5'" . DG  B  2 139 ? 0.391  119.456 23.620  1.00 194.86 ? 65  DG  J "C5'" 1 
ATOM   5841  C  "C4'" . DG  B  2 139 ? 1.776  119.418 24.238  1.00 190.62 ? 65  DG  J "C4'" 1 
ATOM   5842  O  "O4'" . DG  B  2 139 ? 2.669  118.632 23.406  1.00 183.56 ? 65  DG  J "O4'" 1 
ATOM   5843  C  "C3'" . DG  B  2 139 ? 2.447  120.785 24.411  1.00 191.60 ? 65  DG  J "C3'" 1 
ATOM   5844  O  "O3'" . DG  B  2 139 ? 2.970  120.891 25.723  1.00 197.71 ? 65  DG  J "O3'" 1 
ATOM   5845  C  "C2'" . DG  B  2 139 ? 3.562  120.768 23.363  1.00 184.82 ? 65  DG  J "C2'" 1 
ATOM   5846  C  "C1'" . DG  B  2 139 ? 3.907  119.291 23.332  1.00 179.11 ? 65  DG  J "C1'" 1 
ATOM   5847  N  N9    . DG  B  2 139 ? 4.602  118.867 22.118  1.00 169.25 ? 65  DG  J N9    1 
ATOM   5848  C  C8    . DG  B  2 139 ? 4.127  118.908 20.829  1.00 165.37 ? 65  DG  J C8    1 
ATOM   5849  N  N7    . DG  B  2 139 ? 4.978  118.456 19.948  1.00 160.68 ? 65  DG  J N7    1 
ATOM   5850  C  C5    . DG  B  2 139 ? 6.087  118.093 20.701  1.00 162.65 ? 65  DG  J C5    1 
ATOM   5851  C  C6    . DG  B  2 139 ? 7.327  117.539 20.295  1.00 161.94 ? 65  DG  J C6    1 
ATOM   5852  O  O6    . DG  B  2 139 ? 7.702  117.250 19.150  1.00 159.51 ? 65  DG  J O6    1 
ATOM   5853  N  N1    . DG  B  2 139 ? 8.174  117.321 21.381  1.00 163.23 ? 65  DG  J N1    1 
ATOM   5854  C  C2    . DG  B  2 139 ? 7.861  117.602 22.691  1.00 163.74 ? 65  DG  J C2    1 
ATOM   5855  N  N2    . DG  B  2 139 ? 8.800  117.328 23.607  1.00 161.80 ? 65  DG  J N2    1 
ATOM   5856  N  N3    . DG  B  2 139 ? 6.705  118.121 23.081  1.00 166.46 ? 65  DG  J N3    1 
ATOM   5857  C  C4    . DG  B  2 139 ? 5.870  118.338 22.038  1.00 165.80 ? 65  DG  J C4    1 
ATOM   5858  P  P     . DA  B  2 140 ? 3.221  122.331 26.389  1.00 176.25 ? 66  DA  J P     1 
ATOM   5859  O  OP1   . DA  B  2 140 ? 2.233  122.503 27.478  1.00 178.36 ? 66  DA  J OP1   1 
ATOM   5860  O  OP2   . DA  B  2 140 ? 3.301  123.332 25.303  1.00 176.42 ? 66  DA  J OP2   1 
ATOM   5861  O  "O5'" . DA  B  2 140 ? 4.677  122.191 27.028  1.00 174.15 ? 66  DA  J "O5'" 1 
ATOM   5862  C  "C5'" . DA  B  2 140 ? 5.076  120.959 27.613  1.00 170.81 ? 66  DA  J "C5'" 1 
ATOM   5863  C  "C4'" . DA  B  2 140 ? 6.587  120.864 27.676  1.00 166.22 ? 66  DA  J "C4'" 1 
ATOM   5864  O  "O4'" . DA  B  2 140 ? 7.092  120.285 26.445  1.00 164.02 ? 66  DA  J "O4'" 1 
ATOM   5865  C  "C3'" . DA  B  2 140 ? 7.302  122.198 27.863  1.00 163.57 ? 66  DA  J "C3'" 1 
ATOM   5866  O  "O3'" . DA  B  2 140 ? 8.278  122.081 28.889  1.00 158.85 ? 66  DA  J "O3'" 1 
ATOM   5867  C  "C2'" . DA  B  2 140 ? 7.927  122.486 26.493  1.00 163.84 ? 66  DA  J "C2'" 1 
ATOM   5868  C  "C1'" . DA  B  2 140 ? 8.105  121.097 25.894  1.00 164.44 ? 66  DA  J "C1'" 1 
ATOM   5869  N  N9    . DA  B  2 140 ? 7.954  121.070 24.439  1.00 166.67 ? 66  DA  J N9    1 
ATOM   5870  C  C8    . DA  B  2 140 ? 6.864  121.476 23.721  1.00 168.98 ? 66  DA  J C8    1 
ATOM   5871  N  N7    . DA  B  2 140 ? 6.996  121.332 22.424  1.00 167.52 ? 66  DA  J N7    1 
ATOM   5872  C  C5    . DA  B  2 140 ? 8.261  120.790 22.277  1.00 165.82 ? 66  DA  J C5    1 
ATOM   5873  C  C6    . DA  B  2 140 ? 9.000  120.399 21.142  1.00 164.29 ? 66  DA  J C6    1 
ATOM   5874  N  N6    . DA  B  2 140 ? 8.541  120.506 19.889  1.00 163.62 ? 66  DA  J N6    1 
ATOM   5875  N  N1    . DA  B  2 140 ? 10.234 119.892 21.344  1.00 162.51 ? 66  DA  J N1    1 
ATOM   5876  C  C2    . DA  B  2 140 ? 10.690 119.784 22.598  1.00 162.93 ? 66  DA  J C2    1 
ATOM   5877  N  N3    . DA  B  2 140 ? 10.090 120.117 23.742  1.00 165.04 ? 66  DA  J N3    1 
ATOM   5878  C  C4    . DA  B  2 140 ? 8.867  120.618 23.509  1.00 165.87 ? 66  DA  J C4    1 
ATOM   5879  P  P     . DT  B  2 141 ? 9.224  123.323 29.268  1.00 169.31 ? 67  DT  J P     1 
ATOM   5880  O  OP1   . DT  B  2 141 ? 9.482  123.251 30.723  1.00 172.69 ? 67  DT  J OP1   1 
ATOM   5881  O  OP2   . DT  B  2 141 ? 8.644  124.559 28.695  1.00 168.69 ? 67  DT  J OP2   1 
ATOM   5882  O  "O5'" . DT  B  2 141 ? 10.580 122.992 28.493  1.00 164.46 ? 67  DT  J "O5'" 1 
ATOM   5883  C  "C5'" . DT  B  2 141 ? 11.054 121.652 28.466  1.00 160.31 ? 67  DT  J "C5'" 1 
ATOM   5884  C  "C4'" . DT  B  2 141 ? 12.298 121.530 27.609  1.00 154.76 ? 67  DT  J "C4'" 1 
ATOM   5885  O  "O4'" . DT  B  2 141 ? 11.928 121.435 26.210  1.00 154.93 ? 67  DT  J "O4'" 1 
ATOM   5886  C  "C3'" . DT  B  2 141 ? 13.281 122.696 27.720  1.00 149.99 ? 67  DT  J "C3'" 1 
ATOM   5887  O  "O3'" . DT  B  2 141 ? 14.596 122.183 27.939  1.00 142.10 ? 67  DT  J "O3'" 1 
ATOM   5888  C  "C2'" . DT  B  2 141 ? 13.146 123.411 26.369  1.00 151.68 ? 67  DT  J "C2'" 1 
ATOM   5889  C  "C1'" . DT  B  2 141 ? 12.772 122.263 25.448  1.00 152.97 ? 67  DT  J "C1'" 1 
ATOM   5890  N  N1    . DT  B  2 141 ? 12.027 122.689 24.224  1.00 152.68 ? 67  DT  J N1    1 
ATOM   5891  C  C2    . DT  B  2 141 ? 12.562 122.432 22.979  1.00 149.02 ? 67  DT  J C2    1 
ATOM   5892  O  O2    . DT  B  2 141 ? 13.631 121.872 22.813  1.00 146.78 ? 67  DT  J O2    1 
ATOM   5893  N  N3    . DT  B  2 141 ? 11.789 122.857 21.927  1.00 147.78 ? 67  DT  J N3    1 
ATOM   5894  C  C4    . DT  B  2 141 ? 10.564 123.497 21.996  1.00 148.91 ? 67  DT  J C4    1 
ATOM   5895  O  O4    . DT  B  2 141 ? 9.944  123.842 20.996  1.00 146.27 ? 67  DT  J O4    1 
ATOM   5896  C  C5    . DT  B  2 141 ? 10.064 123.733 23.329  1.00 153.59 ? 67  DT  J C5    1 
ATOM   5897  C  C7    . DT  B  2 141 ? 8.746  124.420 23.527  1.00 156.49 ? 67  DT  J C7    1 
ATOM   5898  C  C6    . DT  B  2 141 ? 10.809 123.321 24.365  1.00 154.85 ? 67  DT  J C6    1 
ATOM   5899  P  P     . DA  B  2 142 ? 15.900 123.080 27.659  1.00 150.26 ? 68  DA  J P     1 
ATOM   5900  O  OP1   . DA  B  2 142 ? 17.016 122.456 28.403  1.00 145.96 ? 68  DA  J OP1   1 
ATOM   5901  O  OP2   . DA  B  2 142 ? 15.578 124.506 27.892  1.00 150.35 ? 68  DA  J OP2   1 
ATOM   5902  O  "O5'" . DA  B  2 142 ? 16.176 122.862 26.102  1.00 143.10 ? 68  DA  J "O5'" 1 
ATOM   5903  C  "C5'" . DA  B  2 142 ? 16.482 121.564 25.618  1.00 136.66 ? 68  DA  J "C5'" 1 
ATOM   5904  C  "C4'" . DA  B  2 142 ? 17.405 121.634 24.416  1.00 125.80 ? 68  DA  J "C4'" 1 
ATOM   5905  O  "O4'" . DA  B  2 142 ? 16.670 122.106 23.261  1.00 125.26 ? 68  DA  J "O4'" 1 
ATOM   5906  C  "C3'" . DA  B  2 142 ? 18.595 122.574 24.558  1.00 125.20 ? 68  DA  J "C3'" 1 
ATOM   5907  O  "O3'" . DA  B  2 142 ? 19.685 122.052 23.808  1.00 122.53 ? 68  DA  J "O3'" 1 
ATOM   5908  C  "C2'" . DA  B  2 142 ? 18.062 123.877 23.959  1.00 125.76 ? 68  DA  J "C2'" 1 
ATOM   5909  C  "C1'" . DA  B  2 142 ? 17.175 123.358 22.837  1.00 124.84 ? 68  DA  J "C1'" 1 
ATOM   5910  N  N9    . DA  B  2 142 ? 16.035 124.216 22.530  1.00 128.14 ? 68  DA  J N9    1 
ATOM   5911  C  C8    . DA  B  2 142 ? 15.233 124.883 23.415  1.00 128.98 ? 68  DA  J C8    1 
ATOM   5912  N  N7    . DA  B  2 142 ? 14.267 125.565 22.841  1.00 129.75 ? 68  DA  J N7    1 
ATOM   5913  C  C5    . DA  B  2 142 ? 14.447 125.318 21.488  1.00 127.41 ? 68  DA  J C5    1 
ATOM   5914  C  C6    . DA  B  2 142 ? 13.751 125.749 20.338  1.00 126.88 ? 68  DA  J C6    1 
ATOM   5915  N  N6    . DA  B  2 142 ? 12.685 126.555 20.377  1.00 128.77 ? 68  DA  J N6    1 
ATOM   5916  N  N1    . DA  B  2 142 ? 14.197 125.313 19.140  1.00 124.95 ? 68  DA  J N1    1 
ATOM   5917  C  C2    . DA  B  2 142 ? 15.265 124.512 19.104  1.00 124.70 ? 68  DA  J C2    1 
ATOM   5918  N  N3    . DA  B  2 142 ? 15.993 124.039 20.110  1.00 125.68 ? 68  DA  J N3    1 
ATOM   5919  C  C4    . DA  B  2 142 ? 15.529 124.485 21.285  1.00 129.34 ? 68  DA  J C4    1 
ATOM   5920  P  P     . DT  B  2 143 ? 21.127 122.761 23.824  1.00 117.83 ? 69  DT  J P     1 
ATOM   5921  O  OP1   . DT  B  2 143 ? 22.105 121.734 24.242  1.00 116.69 ? 69  DT  J OP1   1 
ATOM   5922  O  OP2   . DT  B  2 143 ? 21.048 124.031 24.577  1.00 119.81 ? 69  DT  J OP2   1 
ATOM   5923  O  "O5'" . DT  B  2 143 ? 21.376 123.114 22.283  1.00 120.35 ? 69  DT  J "O5'" 1 
ATOM   5924  C  "C5'" . DT  B  2 143 ? 20.451 122.653 21.297  1.00 122.81 ? 69  DT  J "C5'" 1 
ATOM   5925  C  "C4'" . DT  B  2 143 ? 20.694 123.325 19.958  1.00 122.53 ? 69  DT  J "C4'" 1 
ATOM   5926  O  "O4'" . DT  B  2 143 ? 19.471 123.949 19.498  1.00 123.96 ? 69  DT  J "O4'" 1 
ATOM   5927  C  "C3'" . DT  B  2 143 ? 21.771 124.410 19.967  1.00 123.21 ? 69  DT  J "C3'" 1 
ATOM   5928  O  "O3'" . DT  B  2 143 ? 22.771 124.100 19.005  1.00 122.31 ? 69  DT  J "O3'" 1 
ATOM   5929  C  "C2'" . DT  B  2 143 ? 21.025 125.703 19.620  1.00 123.97 ? 69  DT  J "C2'" 1 
ATOM   5930  C  "C1'" . DT  B  2 143 ? 19.750 125.212 18.947  1.00 125.14 ? 69  DT  J "C1'" 1 
ATOM   5931  N  N1    . DT  B  2 143 ? 18.583 126.096 19.218  1.00 128.71 ? 69  DT  J N1    1 
ATOM   5932  C  C2    . DT  B  2 143 ? 17.780 126.520 18.176  1.00 131.61 ? 69  DT  J C2    1 
ATOM   5933  O  O2    . DT  B  2 143 ? 17.968 126.206 17.012  1.00 131.42 ? 69  DT  J O2    1 
ATOM   5934  N  N3    . DT  B  2 143 ? 16.737 127.332 18.556  1.00 130.13 ? 69  DT  J N3    1 
ATOM   5935  C  C4    . DT  B  2 143 ? 16.431 127.748 19.843  1.00 127.01 ? 69  DT  J C4    1 
ATOM   5936  O  O4    . DT  B  2 143 ? 15.478 128.476 20.093  1.00 125.46 ? 69  DT  J O4    1 
ATOM   5937  C  C5    . DT  B  2 143 ? 17.314 127.267 20.876  1.00 127.46 ? 69  DT  J C5    1 
ATOM   5938  C  C7    . DT  B  2 143 ? 17.080 127.652 22.305  1.00 128.05 ? 69  DT  J C7    1 
ATOM   5939  C  C6    . DT  B  2 143 ? 18.333 126.477 20.519  1.00 127.98 ? 69  DT  J C6    1 
HETATM 5940  P  P     . G47 B  2 144 ? 24.051 125.054 18.811  1.00 126.72 ? 70  G47 J P     1 
HETATM 5941  O  O1P   . G47 B  2 144 ? 24.090 126.040 19.920  1.00 129.42 ? 70  G47 J O1P   1 
HETATM 5942  O  O2P   . G47 B  2 144 ? 25.227 124.179 18.578  1.00 127.68 ? 70  G47 J O2P   1 
HETATM 5943  O  "O5'" . G47 B  2 144 ? 23.746 125.821 17.450  1.00 119.12 ? 70  G47 J "O5'" 1 
HETATM 5944  C  "C5'" . G47 B  2 144 ? 23.456 125.087 16.260  1.00 106.96 ? 70  G47 J "C5'" 1 
HETATM 5945  C  "C4'" . G47 B  2 144 ? 22.746 125.966 15.257  1.00 105.82 ? 70  G47 J "C4'" 1 
HETATM 5946  O  "O4'" . G47 B  2 144 ? 21.578 126.567 15.867  1.00 108.41 ? 70  G47 J "O4'" 1 
HETATM 5947  C  "C3'" . G47 B  2 144 ? 23.583 127.124 14.706  1.00 104.82 ? 70  G47 J "C3'" 1 
HETATM 5948  O  "O3'" . G47 B  2 144 ? 23.360 127.236 13.296  1.00 109.50 ? 70  G47 J "O3'" 1 
HETATM 5949  C  "C2'" . G47 B  2 144 ? 23.007 128.342 15.405  1.00 107.23 ? 70  G47 J "C2'" 1 
HETATM 5950  C  "C1'" . G47 B  2 144 ? 21.554 127.947 15.551  1.00 108.90 ? 70  G47 J "C1'" 1 
HETATM 5951  N  N9    . G47 B  2 144 ? 20.842 128.629 16.594  1.00 111.62 ? 70  G47 J N9    1 
HETATM 5952  C  C8    . G47 B  2 144 ? 21.170 128.690 17.927  1.00 113.12 ? 70  G47 J C8    1 
HETATM 5953  N  N7    . G47 B  2 144 ? 20.324 129.392 18.632  1.00 115.58 ? 70  G47 J N7    1 
HETATM 5954  C  C5    . G47 B  2 144 ? 19.383 129.821 17.707  1.00 115.71 ? 70  G47 J C5    1 
HETATM 5955  C  C6    . G47 B  2 144 ? 18.199 130.631 17.865  1.00 117.91 ? 70  G47 J C6    1 
HETATM 5956  O  O6    . G47 B  2 144 ? 17.746 131.142 18.896  1.00 120.26 ? 70  G47 J O6    1 
HETATM 5957  N  N1    . G47 B  2 144 ? 17.540 130.817 16.654  1.00 123.65 ? 70  G47 J N1    1 
HETATM 5958  C  C2    . G47 B  2 144 ? 17.943 130.304 15.450  1.00 123.19 ? 70  G47 J C2    1 
HETATM 5959  N  N2    . G47 B  2 144 ? 17.170 130.598 14.393  1.00 126.06 ? 70  G47 J N2    1 
HETATM 5960  N  N3    . G47 B  2 144 ? 19.022 129.560 15.283  1.00 118.59 ? 70  G47 J N3    1 
HETATM 5961  C  C4    . G47 B  2 144 ? 19.687 129.359 16.442  1.00 114.54 ? 70  G47 J C4    1 
HETATM 5962  C  C6A   . G47 B  2 144 ? 17.173 131.789 13.699  1.00 131.17 ? 70  G47 J C6A   1 
HETATM 5963  C  C7A   . G47 B  2 144 ? 17.588 131.606 12.312  1.00 138.78 ? 70  G47 J C7A   1 
HETATM 5964  S  SG    . G47 B  2 144 ? 16.429 130.773 11.080  1.00 150.68 ? 70  G47 J SG    1 
ATOM   5965  P  P     . DG  B  2 145 ? 24.163 128.320 12.422  1.00 101.84 ? 71  DG  J P     1 
ATOM   5966  O  OP1   . DG  B  2 145 ? 24.059 127.906 11.004  1.00 99.82  ? 71  DG  J OP1   1 
ATOM   5967  O  OP2   . DG  B  2 145 ? 25.488 128.505 13.053  1.00 101.24 ? 71  DG  J OP2   1 
ATOM   5968  O  "O5'" . DG  B  2 145 ? 23.330 129.674 12.614  1.00 103.96 ? 71  DG  J "O5'" 1 
ATOM   5969  C  "C5'" . DG  B  2 145 ? 21.999 129.763 12.122  1.00 104.94 ? 71  DG  J "C5'" 1 
ATOM   5970  C  "C4'" . DG  B  2 145 ? 21.496 131.203 12.122  1.00 106.51 ? 71  DG  J "C4'" 1 
ATOM   5971  O  "O4'" . DG  B  2 145 ? 21.129 131.598 13.468  1.00 109.02 ? 71  DG  J "O4'" 1 
ATOM   5972  C  "C3'" . DG  B  2 145 ? 22.490 132.252 11.638  1.00 105.39 ? 71  DG  J "C3'" 1 
ATOM   5973  O  "O3'" . DG  B  2 145 ? 21.797 133.317 10.995  1.00 106.12 ? 71  DG  J "O3'" 1 
ATOM   5974  C  "C2'" . DG  B  2 145 ? 23.139 132.719 12.935  1.00 106.65 ? 71  DG  J "C2'" 1 
ATOM   5975  C  "C1'" . DG  B  2 145 ? 21.974 132.640 13.916  1.00 109.32 ? 71  DG  J "C1'" 1 
ATOM   5976  N  N9    . DG  B  2 145 ? 22.385 132.327 15.278  1.00 111.99 ? 71  DG  J N9    1 
ATOM   5977  C  C8    . DG  B  2 145 ? 23.546 131.704 15.666  1.00 113.26 ? 71  DG  J C8    1 
ATOM   5978  N  N7    . DG  B  2 145 ? 23.644 131.547 16.956  1.00 119.22 ? 71  DG  J N7    1 
ATOM   5979  C  C5    . DG  B  2 145 ? 22.470 132.094 17.456  1.00 123.04 ? 71  DG  J C5    1 
ATOM   5980  C  C6    . DG  B  2 145 ? 22.016 132.209 18.790  1.00 149.20 ? 71  DG  J C6    1 
ATOM   5981  O  O6    . DG  B  2 145 ? 22.582 131.836 19.828  1.00 202.04 ? 71  DG  J O6    1 
ATOM   5982  N  N1    . DG  B  2 145 ? 20.770 132.829 18.861  1.00 131.67 ? 71  DG  J N1    1 
ATOM   5983  C  C2    . DG  B  2 145 ? 20.053 133.279 17.777  1.00 119.06 ? 71  DG  J C2    1 
ATOM   5984  N  N2    . DG  B  2 145 ? 18.869 133.854 18.046  1.00 119.60 ? 71  DG  J N2    1 
ATOM   5985  N  N3    . DG  B  2 145 ? 20.468 133.179 16.519  1.00 115.06 ? 71  DG  J N3    1 
ATOM   5986  C  C4    . DG  B  2 145 ? 21.681 132.577 16.435  1.00 114.33 ? 71  DG  J C4    1 
ATOM   5987  P  P     . DA  B  2 146 ? 22.585 134.335 10.032  1.00 109.15 ? 72  DA  J P     1 
ATOM   5988  O  OP1   . DA  B  2 146 ? 23.068 133.571 8.860   1.00 110.36 ? 72  DA  J OP1   1 
ATOM   5989  O  OP2   . DA  B  2 146 ? 23.545 135.096 10.862  1.00 105.88 ? 72  DA  J OP2   1 
ATOM   5990  O  "O5'" . DA  B  2 146 ? 21.455 135.363 9.562   1.00 106.11 ? 72  DA  J "O5'" 1 
ATOM   5991  C  "C5'" . DA  B  2 146 ? 20.083 135.051 9.761   1.00 108.92 ? 72  DA  J "C5'" 1 
ATOM   5992  C  "C4'" . DA  B  2 146 ? 19.360 136.210 10.426  1.00 117.79 ? 72  DA  J "C4'" 1 
ATOM   5993  O  "O4'" . DA  B  2 146 ? 19.306 135.998 11.862  1.00 123.05 ? 72  DA  J "O4'" 1 
ATOM   5994  C  "C3'" . DA  B  2 146 ? 20.006 137.579 10.217  1.00 122.12 ? 72  DA  J "C3'" 1 
ATOM   5995  O  "O3'" . DA  B  2 146 ? 19.002 138.547 9.931   1.00 128.05 ? 72  DA  J "O3'" 1 
ATOM   5996  C  "C2'" . DA  B  2 146 ? 20.700 137.852 11.554  1.00 123.53 ? 72  DA  J "C2'" 1 
ATOM   5997  C  "C1'" . DA  B  2 146 ? 19.777 137.146 12.536  1.00 125.69 ? 72  DA  J "C1'" 1 
ATOM   5998  N  N9    . DA  B  2 146 ? 20.446 136.709 13.762  1.00 127.29 ? 72  DA  J N9    1 
ATOM   5999  C  C8    . DA  B  2 146 ? 21.607 135.995 13.853  1.00 124.79 ? 72  DA  J C8    1 
ATOM   6000  N  N7    . DA  B  2 146 ? 21.974 135.731 15.086  1.00 123.88 ? 72  DA  J N7    1 
ATOM   6001  C  C5    . DA  B  2 146 ? 20.980 136.308 15.860  1.00 127.68 ? 72  DA  J C5    1 
ATOM   6002  C  C6    . DA  B  2 146 ? 20.786 136.380 17.256  1.00 129.52 ? 72  DA  J C6    1 
ATOM   6003  N  N6    . DA  B  2 146 ? 21.627 135.840 18.144  1.00 127.91 ? 72  DA  J N6    1 
ATOM   6004  N  N1    . DA  B  2 146 ? 19.688 137.029 17.706  1.00 134.64 ? 72  DA  J N1    1 
ATOM   6005  C  C2    . DA  B  2 146 ? 18.851 137.569 16.809  1.00 138.55 ? 72  DA  J C2    1 
ATOM   6006  N  N3    . DA  B  2 146 ? 18.929 137.566 15.476  1.00 135.14 ? 72  DA  J N3    1 
ATOM   6007  C  C4    . DA  B  2 146 ? 20.027 136.913 15.062  1.00 129.85 ? 72  DA  J C4    1 
ATOM   6008  P  P     . DT  B  2 147 ? 19.383 140.102 9.790   1.00 130.93 ? 73  DT  J P     1 
ATOM   6009  O  OP1   . DT  B  2 147 ? 18.339 140.744 8.961   1.00 133.70 ? 73  DT  J OP1   1 
ATOM   6010  O  OP2   . DT  B  2 147 ? 20.804 140.201 9.387   1.00 124.66 ? 73  DT  J OP2   1 
ATOM   6011  O  "O5'" . DT  B  2 147 ? 19.248 140.656 11.281  1.00 133.92 ? 73  DT  J "O5'" 1 
ATOM   6012  C  "C5'" . DT  B  2 147 ? 18.033 140.472 11.995  1.00 134.38 ? 73  DT  J "C5'" 1 
ATOM   6013  C  "C4'" . DT  B  2 147 ? 18.027 141.304 13.261  1.00 135.56 ? 73  DT  J "C4'" 1 
ATOM   6014  O  "O4'" . DT  B  2 147 ? 18.716 140.583 14.318  1.00 135.33 ? 73  DT  J "O4'" 1 
ATOM   6015  C  "C3'" . DT  B  2 147 ? 18.730 142.658 13.141  1.00 135.59 ? 73  DT  J "C3'" 1 
ATOM   6016  O  "O3'" . DT  B  2 147 ? 17.984 143.656 13.825  1.00 138.71 ? 73  DT  J "O3'" 1 
ATOM   6017  C  "C2'" . DT  B  2 147 ? 20.076 142.406 13.813  1.00 134.41 ? 73  DT  J "C2'" 1 
ATOM   6018  C  "C1'" . DT  B  2 147 ? 19.679 141.427 14.902  1.00 135.99 ? 73  DT  J "C1'" 1 
ATOM   6019  N  N1    . DT  B  2 147 ? 20.806 140.590 15.411  1.00 136.78 ? 73  DT  J N1    1 
ATOM   6020  C  C2    . DT  B  2 147 ? 20.925 140.393 16.763  1.00 137.31 ? 73  DT  J C2    1 
ATOM   6021  O  O2    . DT  B  2 147 ? 20.152 140.868 17.576  1.00 137.59 ? 73  DT  J O2    1 
ATOM   6022  N  N3    . DT  B  2 147 ? 21.983 139.616 17.141  1.00 138.11 ? 73  DT  J N3    1 
ATOM   6023  C  C4    . DT  B  2 147 ? 22.922 139.024 16.319  1.00 137.21 ? 73  DT  J C4    1 
ATOM   6024  O  O4    . DT  B  2 147 ? 23.840 138.340 16.763  1.00 136.41 ? 73  DT  J O4    1 
ATOM   6025  C  C5    . DT  B  2 147 ? 22.745 139.268 14.905  1.00 136.21 ? 73  DT  J C5    1 
ATOM   6026  C  C7    . DT  B  2 147 ? 23.702 138.678 13.912  1.00 134.07 ? 73  DT  J C7    1 
ATOM   6027  C  C6    . DT  B  2 147 ? 21.705 140.031 14.522  1.00 136.49 ? 73  DT  J C6    1 
ATOM   6028  N  N     . HIS C  3 39  ? 81.531 126.468 0.206   1.00 128.31 ? 39  HIS A N     1 
ATOM   6029  C  CA    . HIS C  3 39  ? 80.690 125.314 -0.098  1.00 128.75 ? 39  HIS A CA    1 
ATOM   6030  C  C     . HIS C  3 39  ? 80.846 124.901 -1.548  1.00 128.75 ? 39  HIS A C     1 
ATOM   6031  O  O     . HIS C  3 39  ? 81.896 125.121 -2.158  1.00 130.22 ? 39  HIS A O     1 
ATOM   6032  C  CB    . HIS C  3 39  ? 79.225 125.628 0.210   1.00 130.23 ? 39  HIS A CB    1 
ATOM   6033  C  CG    . HIS C  3 39  ? 78.564 124.614 1.090   1.00 133.84 ? 39  HIS A CG    1 
ATOM   6034  N  ND1   . HIS C  3 39  ? 77.509 124.923 1.921   1.00 133.82 ? 39  HIS A ND1   1 
ATOM   6035  C  CD2   . HIS C  3 39  ? 78.809 123.294 1.269   1.00 135.26 ? 39  HIS A CD2   1 
ATOM   6036  C  CE1   . HIS C  3 39  ? 77.132 123.838 2.574   1.00 133.72 ? 39  HIS A CE1   1 
ATOM   6037  N  NE2   . HIS C  3 39  ? 77.905 122.835 2.196   1.00 134.22 ? 39  HIS A NE2   1 
ATOM   6038  N  N     . CYS C  3 40  ? 79.788 124.298 -2.093  1.00 132.11 ? 40  CYS A N     1 
ATOM   6039  C  CA    . CYS C  3 40  ? 79.785 123.877 -3.463  1.00 127.47 ? 40  CYS A CA    1 
ATOM   6040  C  C     . CYS C  3 40  ? 78.391 123.573 -4.013  1.00 120.82 ? 40  CYS A C     1 
ATOM   6041  O  O     . CYS C  3 40  ? 77.930 124.211 -4.960  1.00 120.58 ? 40  CYS A O     1 
ATOM   6042  C  CB    . CYS C  3 40  ? 80.660 122.581 -3.680  1.00 123.51 ? 40  CYS A CB    1 
ATOM   6043  S  SG    . CYS C  3 40  ? 81.543 122.516 -5.283  0.52 120.71 ? 40  CYS A SG    1 
ATOM   6044  N  N     . TYR C  3 41  ? 77.727 122.579 -3.435  1.00 117.52 ? 41  TYR A N     1 
ATOM   6045  C  CA    . TYR C  3 41  ? 76.427 122.134 -3.908  1.00 108.03 ? 41  TYR A CA    1 
ATOM   6046  C  C     . TYR C  3 41  ? 75.309 122.751 -3.079  1.00 103.98 ? 41  TYR A C     1 
ATOM   6047  O  O     . TYR C  3 41  ? 75.450 122.975 -1.875  1.00 107.02 ? 41  TYR A O     1 
ATOM   6048  C  CB    . TYR C  3 41  ? 76.327 120.606 -3.867  1.00 104.93 ? 41  TYR A CB    1 
ATOM   6049  C  CG    . TYR C  3 41  ? 77.022 119.929 -5.024  1.00 104.38 ? 41  TYR A CG    1 
ATOM   6050  C  CD1   . TYR C  3 41  ? 76.461 119.941 -6.293  1.00 107.87 ? 41  TYR A CD1   1 
ATOM   6051  C  CD2   . TYR C  3 41  ? 78.237 119.280 -4.850  1.00 103.73 ? 41  TYR A CD2   1 
ATOM   6052  C  CE1   . TYR C  3 41  ? 77.089 119.328 -7.356  1.00 112.75 ? 41  TYR A CE1   1 
ATOM   6053  C  CE2   . TYR C  3 41  ? 78.874 118.662 -5.909  1.00 108.10 ? 41  TYR A CE2   1 
ATOM   6054  C  CZ    . TYR C  3 41  ? 78.294 118.690 -7.161  1.00 115.20 ? 41  TYR A CZ    1 
ATOM   6055  O  OH    . TYR C  3 41  ? 78.920 118.078 -8.223  1.00 120.64 ? 41  TYR A OH    1 
ATOM   6056  N  N     . ARG C  3 42  ? 74.189 123.022 -3.742  1.00 95.42  ? 42  ARG A N     1 
ATOM   6057  C  CA    . ARG C  3 42  ? 73.044 123.618 -3.081  1.00 98.89  ? 42  ARG A CA    1 
ATOM   6058  C  C     . ARG C  3 42  ? 72.273 122.557 -2.295  1.00 98.80  ? 42  ARG A C     1 
ATOM   6059  O  O     . ARG C  3 42  ? 72.344 121.368 -2.615  1.00 105.00 ? 42  ARG A O     1 
ATOM   6060  C  CB    . ARG C  3 42  ? 72.134 124.288 -4.106  1.00 103.46 ? 42  ARG A CB    1 
ATOM   6061  C  CG    . ARG C  3 42  ? 72.878 125.277 -4.998  1.00 113.08 ? 42  ARG A CG    1 
ATOM   6062  C  CD    . ARG C  3 42  ? 72.048 126.513 -5.291  1.00 117.91 ? 42  ARG A CD    1 
ATOM   6063  N  NE    . ARG C  3 42  ? 71.432 126.496 -6.616  1.00 122.58 ? 42  ARG A NE    1 
ATOM   6064  C  CZ    . ARG C  3 42  ? 70.280 125.899 -6.909  1.00 125.43 ? 42  ARG A CZ    1 
ATOM   6065  N  NH1   . ARG C  3 42  ? 69.605 125.248 -5.969  1.00 124.58 ? 42  ARG A NH1   1 
ATOM   6066  N  NH2   . ARG C  3 42  ? 69.807 125.954 -8.150  1.00 126.88 ? 42  ARG A NH2   1 
ATOM   6067  N  N     . PRO C  3 43  ? 71.555 122.963 -1.246  1.00 99.00  ? 43  PRO A N     1 
ATOM   6068  C  CA    . PRO C  3 43  ? 70.842 121.985 -0.412  1.00 95.23  ? 43  PRO A CA    1 
ATOM   6069  C  C     . PRO C  3 43  ? 69.855 121.159 -1.226  1.00 99.96  ? 43  PRO A C     1 
ATOM   6070  O  O     . PRO C  3 43  ? 69.078 121.692 -2.021  1.00 96.95  ? 43  PRO A O     1 
ATOM   6071  C  CB    . PRO C  3 43  ? 70.128 122.860 0.624   1.00 92.85  ? 43  PRO A CB    1 
ATOM   6072  C  CG    . PRO C  3 43  ? 70.959 124.096 0.701   1.00 93.77  ? 43  PRO A CG    1 
ATOM   6073  C  CD    . PRO C  3 43  ? 71.475 124.325 -0.689  1.00 96.16  ? 43  PRO A CD    1 
ATOM   6074  N  N     . GLY C  3 44  ? 69.897 119.844 -1.021  1.00 95.04  ? 44  GLY A N     1 
ATOM   6075  C  CA    . GLY C  3 44  ? 69.015 118.921 -1.700  1.00 95.80  ? 44  GLY A CA    1 
ATOM   6076  C  C     . GLY C  3 44  ? 69.624 118.207 -2.888  1.00 98.34  ? 44  GLY A C     1 
ATOM   6077  O  O     . GLY C  3 44  ? 68.979 117.309 -3.444  1.00 102.88 ? 44  GLY A O     1 
ATOM   6078  N  N     . THR C  3 45  ? 70.842 118.571 -3.292  1.00 99.43  ? 45  THR A N     1 
ATOM   6079  C  CA    . THR C  3 45  ? 71.462 117.946 -4.456  1.00 90.35  ? 45  THR A CA    1 
ATOM   6080  C  C     . THR C  3 45  ? 72.125 116.621 -4.088  1.00 89.60  ? 45  THR A C     1 
ATOM   6081  O  O     . THR C  3 45  ? 71.809 115.574 -4.664  1.00 97.50  ? 45  THR A O     1 
ATOM   6082  C  CB    . THR C  3 45  ? 72.476 118.902 -5.090  1.00 88.25  ? 45  THR A CB    1 
ATOM   6083  O  OG1   . THR C  3 45  ? 71.830 120.141 -5.409  1.00 86.51  ? 45  THR A OG1   1 
ATOM   6084  C  CG2   . THR C  3 45  ? 73.049 118.298 -6.362  1.00 84.74  ? 45  THR A CG2   1 
ATOM   6085  N  N     . VAL C  3 46  ? 73.053 116.648 -3.126  1.00 87.57  ? 46  VAL A N     1 
ATOM   6086  C  CA    . VAL C  3 46  ? 73.661 115.408 -2.659  1.00 89.01  ? 46  VAL A CA    1 
ATOM   6087  C  C     . VAL C  3 46  ? 72.641 114.539 -1.927  1.00 84.94  ? 46  VAL A C     1 
ATOM   6088  O  O     . VAL C  3 46  ? 72.812 113.317 -1.849  1.00 85.71  ? 46  VAL A O     1 
ATOM   6089  C  CB    . VAL C  3 46  ? 74.910 115.729 -1.805  1.00 89.92  ? 46  VAL A CB    1 
ATOM   6090  C  CG1   . VAL C  3 46  ? 74.645 116.885 -0.880  1.00 87.88  ? 46  VAL A CG1   1 
ATOM   6091  C  CG2   . VAL C  3 46  ? 75.405 114.510 -1.026  1.00 92.99  ? 46  VAL A CG2   1 
ATOM   6092  N  N     . ALA C  3 47  ? 71.556 115.132 -1.422  1.00 79.82  ? 47  ALA A N     1 
ATOM   6093  C  CA    . ALA C  3 47  ? 70.444 114.330 -0.919  1.00 81.08  ? 47  ALA A CA    1 
ATOM   6094  C  C     . ALA C  3 47  ? 69.859 113.459 -2.026  1.00 85.61  ? 47  ALA A C     1 
ATOM   6095  O  O     . ALA C  3 47  ? 69.640 112.256 -1.837  1.00 92.37  ? 47  ALA A O     1 
ATOM   6096  C  CB    . ALA C  3 47  ? 69.370 115.236 -0.316  1.00 77.37  ? 47  ALA A CB    1 
ATOM   6097  N  N     . LEU C  3 48  ? 69.597 114.056 -3.193  1.00 79.86  ? 48  LEU A N     1 
ATOM   6098  C  CA    . LEU C  3 48  ? 69.198 113.273 -4.359  1.00 73.09  ? 48  LEU A CA    1 
ATOM   6099  C  C     . LEU C  3 48  ? 70.268 112.252 -4.723  1.00 72.52  ? 48  LEU A C     1 
ATOM   6100  O  O     . LEU C  3 48  ? 69.957 111.101 -5.060  1.00 73.77  ? 48  LEU A O     1 
ATOM   6101  C  CB    . LEU C  3 48  ? 68.930 114.202 -5.544  1.00 74.02  ? 48  LEU A CB    1 
ATOM   6102  C  CG    . LEU C  3 48  ? 67.489 114.595 -5.867  1.00 79.80  ? 48  LEU A CG    1 
ATOM   6103  C  CD1   . LEU C  3 48  ? 66.741 115.000 -4.614  1.00 81.18  ? 48  LEU A CD1   1 
ATOM   6104  C  CD2   . LEU C  3 48  ? 67.485 115.724 -6.882  1.00 86.30  ? 48  LEU A CD2   1 
ATOM   6105  N  N     . ARG C  3 49  ? 71.536 112.665 -4.661  1.00 73.23  ? 49  ARG A N     1 
ATOM   6106  C  CA    . ARG C  3 49  ? 72.644 111.769 -4.974  1.00 75.19  ? 49  ARG A CA    1 
ATOM   6107  C  C     . ARG C  3 49  ? 72.599 110.512 -4.115  1.00 81.79  ? 49  ARG A C     1 
ATOM   6108  O  O     . ARG C  3 49  ? 72.857 109.405 -4.602  1.00 85.01  ? 49  ARG A O     1 
ATOM   6109  C  CB    . ARG C  3 49  ? 73.964 112.510 -4.774  1.00 73.42  ? 49  ARG A CB    1 
ATOM   6110  C  CG    . ARG C  3 49  ? 75.032 112.195 -5.785  1.00 78.63  ? 49  ARG A CG    1 
ATOM   6111  C  CD    . ARG C  3 49  ? 75.922 113.406 -5.998  1.00 88.93  ? 49  ARG A CD    1 
ATOM   6112  N  NE    . ARG C  3 49  ? 76.594 113.815 -4.769  1.00 95.07  ? 49  ARG A NE    1 
ATOM   6113  C  CZ    . ARG C  3 49  ? 77.139 115.012 -4.580  1.00 97.36  ? 49  ARG A CZ    1 
ATOM   6114  N  NH1   . ARG C  3 49  ? 77.082 115.925 -5.540  1.00 95.81  ? 49  ARG A NH1   1 
ATOM   6115  N  NH2   . ARG C  3 49  ? 77.734 115.299 -3.430  1.00 99.28  ? 49  ARG A NH2   1 
ATOM   6116  N  N     . GLU C  3 50  ? 72.264 110.664 -2.833  1.00 78.20  ? 50  GLU A N     1 
ATOM   6117  C  CA    . GLU C  3 50  ? 72.200 109.520 -1.934  1.00 76.08  ? 50  GLU A CA    1 
ATOM   6118  C  C     . GLU C  3 50  ? 70.896 108.750 -2.084  1.00 70.48  ? 50  GLU A C     1 
ATOM   6119  O  O     . GLU C  3 50  ? 70.867 107.541 -1.828  1.00 78.86  ? 50  GLU A O     1 
ATOM   6120  C  CB    . GLU C  3 50  ? 72.390 109.983 -0.490  1.00 75.93  ? 50  GLU A CB    1 
ATOM   6121  C  CG    . GLU C  3 50  ? 73.777 110.537 -0.215  1.00 80.09  ? 50  GLU A CG    1 
ATOM   6122  C  CD    . GLU C  3 50  ? 73.862 111.275 1.104   1.00 83.51  ? 50  GLU A CD    1 
ATOM   6123  O  OE1   . GLU C  3 50  ? 72.799 111.567 1.692   1.00 84.87  ? 50  GLU A OE1   1 
ATOM   6124  O  OE2   . GLU C  3 50  ? 74.993 111.564 1.550   1.00 85.64  ? 50  GLU A OE2   1 
ATOM   6125  N  N     . ILE C  3 51  ? 69.813 109.421 -2.486  1.00 66.45  ? 51  ILE A N     1 
ATOM   6126  C  CA    . ILE C  3 51  ? 68.603 108.699 -2.873  1.00 62.35  ? 51  ILE A CA    1 
ATOM   6127  C  C     . ILE C  3 51  ? 68.927 107.708 -3.982  1.00 57.19  ? 51  ILE A C     1 
ATOM   6128  O  O     . ILE C  3 51  ? 68.558 106.528 -3.920  1.00 59.27  ? 51  ILE A O     1 
ATOM   6129  C  CB    . ILE C  3 51  ? 67.496 109.680 -3.302  1.00 57.75  ? 51  ILE A CB    1 
ATOM   6130  C  CG1   . ILE C  3 51  ? 66.941 110.434 -2.092  1.00 63.57  ? 51  ILE A CG1   1 
ATOM   6131  C  CG2   . ILE C  3 51  ? 66.382 108.942 -4.032  1.00 51.20  ? 51  ILE A CG2   1 
ATOM   6132  C  CD1   . ILE C  3 51  ? 65.821 111.394 -2.437  1.00 64.04  ? 51  ILE A CD1   1 
ATOM   6133  N  N     . ARG C  3 52  ? 69.647 108.172 -5.005  1.00 55.95  ? 52  ARG A N     1 
ATOM   6134  C  CA    . ARG C  3 52  ? 70.052 107.274 -6.080  1.00 66.59  ? 52  ARG A CA    1 
ATOM   6135  C  C     . ARG C  3 52  ? 71.014 106.207 -5.569  1.00 74.20  ? 52  ARG A C     1 
ATOM   6136  O  O     . ARG C  3 52  ? 70.813 105.013 -5.818  1.00 79.81  ? 52  ARG A O     1 
ATOM   6137  C  CB    . ARG C  3 52  ? 70.668 108.078 -7.226  1.00 76.78  ? 52  ARG A CB    1 
ATOM   6138  C  CG    . ARG C  3 52  ? 69.695 109.079 -7.833  1.00 84.06  ? 52  ARG A CG    1 
ATOM   6139  C  CD    . ARG C  3 52  ? 70.239 109.741 -9.088  1.00 87.93  ? 52  ARG A CD    1 
ATOM   6140  N  NE    . ARG C  3 52  ? 69.231 110.597 -9.710  1.00 90.58  ? 52  ARG A NE    1 
ATOM   6141  C  CZ    . ARG C  3 52  ? 69.125 111.905 -9.500  1.00 91.07  ? 52  ARG A CZ    1 
ATOM   6142  N  NH1   . ARG C  3 52  ? 69.974 112.519 -8.686  1.00 91.59  ? 52  ARG A NH1   1 
ATOM   6143  N  NH2   . ARG C  3 52  ? 68.172 112.600 -10.106 1.00 89.13  ? 52  ARG A NH2   1 
ATOM   6144  N  N     . ARG C  3 53  ? 72.046 106.615 -4.821  1.00 71.24  ? 53  ARG A N     1 
ATOM   6145  C  CA    . ARG C  3 53  ? 73.040 105.666 -4.323  1.00 71.28  ? 53  ARG A CA    1 
ATOM   6146  C  C     . ARG C  3 53  ? 72.386 104.508 -3.575  1.00 66.90  ? 53  ARG A C     1 
ATOM   6147  O  O     . ARG C  3 53  ? 72.601 103.336 -3.902  1.00 70.81  ? 53  ARG A O     1 
ATOM   6148  C  CB    . ARG C  3 53  ? 74.049 106.368 -3.412  1.00 75.81  ? 53  ARG A CB    1 
ATOM   6149  C  CG    . ARG C  3 53  ? 74.928 105.379 -2.650  1.00 81.50  ? 53  ARG A CG    1 
ATOM   6150  C  CD    . ARG C  3 53  ? 75.812 106.043 -1.607  1.00 89.86  ? 53  ARG A CD    1 
ATOM   6151  N  NE    . ARG C  3 53  ? 76.575 105.047 -0.857  1.00 91.52  ? 53  ARG A NE    1 
ATOM   6152  C  CZ    . ARG C  3 53  ? 77.469 105.333 0.083   1.00 90.27  ? 53  ARG A CZ    1 
ATOM   6153  N  NH1   . ARG C  3 53  ? 77.724 106.596 0.399   1.00 88.81  ? 53  ARG A NH1   1 
ATOM   6154  N  NH2   . ARG C  3 53  ? 78.111 104.355 0.709   1.00 89.88  ? 53  ARG A NH2   1 
ATOM   6155  N  N     . TYR C  3 54  ? 71.581 104.822 -2.561  1.00 63.49  ? 54  TYR A N     1 
ATOM   6156  C  CA    . TYR C  3 54  ? 70.988 103.773 -1.742  1.00 59.22  ? 54  TYR A CA    1 
ATOM   6157  C  C     . TYR C  3 54  ? 69.798 103.101 -2.412  1.00 59.04  ? 54  TYR A C     1 
ATOM   6158  O  O     . TYR C  3 54  ? 69.397 102.014 -1.980  1.00 54.91  ? 54  TYR A O     1 
ATOM   6159  C  CB    . TYR C  3 54  ? 70.585 104.337 -0.378  1.00 57.52  ? 54  TYR A CB    1 
ATOM   6160  C  CG    . TYR C  3 54  ? 71.774 104.792 0.432   1.00 66.37  ? 54  TYR A CG    1 
ATOM   6161  C  CD1   . TYR C  3 54  ? 72.718 103.879 0.883   1.00 75.61  ? 54  TYR A CD1   1 
ATOM   6162  C  CD2   . TYR C  3 54  ? 71.962 106.133 0.735   1.00 71.41  ? 54  TYR A CD2   1 
ATOM   6163  C  CE1   . TYR C  3 54  ? 73.814 104.288 1.617   1.00 80.64  ? 54  TYR A CE1   1 
ATOM   6164  C  CE2   . TYR C  3 54  ? 73.054 106.553 1.469   1.00 77.97  ? 54  TYR A CE2   1 
ATOM   6165  C  CZ    . TYR C  3 54  ? 73.977 105.626 1.907   1.00 81.45  ? 54  TYR A CZ    1 
ATOM   6166  O  OH    . TYR C  3 54  ? 75.068 106.038 2.639   1.00 81.38  ? 54  TYR A OH    1 
ATOM   6167  N  N     . GLN C  3 55  ? 69.227 103.707 -3.456  1.00 54.62  ? 55  GLN A N     1 
ATOM   6168  C  CA    . GLN C  3 55  ? 68.204 102.996 -4.213  1.00 60.87  ? 55  GLN A CA    1 
ATOM   6169  C  C     . GLN C  3 55  ? 68.809 101.978 -5.174  1.00 69.35  ? 55  GLN A C     1 
ATOM   6170  O  O     . GLN C  3 55  ? 68.146 100.993 -5.516  1.00 72.18  ? 55  GLN A O     1 
ATOM   6171  C  CB    . GLN C  3 55  ? 67.311 103.980 -4.971  1.00 56.20  ? 55  GLN A CB    1 
ATOM   6172  C  CG    . GLN C  3 55  ? 66.090 104.425 -4.179  1.00 53.73  ? 55  GLN A CG    1 
ATOM   6173  C  CD    . GLN C  3 55  ? 65.118 105.243 -5.006  1.00 59.48  ? 55  GLN A CD    1 
ATOM   6174  O  OE1   . GLN C  3 55  ? 65.270 105.369 -6.219  1.00 71.62  ? 55  GLN A OE1   1 
ATOM   6175  N  NE2   . GLN C  3 55  ? 64.112 105.805 -4.350  1.00 60.89  ? 55  GLN A NE2   1 
ATOM   6176  N  N     . LYS C  3 56  ? 70.057 102.181 -5.610  1.00 61.36  ? 56  LYS A N     1 
ATOM   6177  C  CA    . LYS C  3 56  ? 70.677 101.185 -6.481  1.00 70.86  ? 56  LYS A CA    1 
ATOM   6178  C  C     . LYS C  3 56  ? 71.160 99.966  -5.704  1.00 73.43  ? 56  LYS A C     1 
ATOM   6179  O  O     . LYS C  3 56  ? 71.158 98.855  -6.245  1.00 71.69  ? 56  LYS A O     1 
ATOM   6180  C  CB    . LYS C  3 56  ? 71.858 101.779 -7.257  1.00 82.08  ? 56  LYS A CB    1 
ATOM   6181  C  CG    . LYS C  3 56  ? 71.611 103.110 -7.958  1.00 92.76  ? 56  LYS A CG    1 
ATOM   6182  C  CD    . LYS C  3 56  ? 70.242 103.216 -8.609  1.00 100.46 ? 56  LYS A CD    1 
ATOM   6183  C  CE    . LYS C  3 56  ? 69.951 104.667 -8.971  1.00 104.68 ? 56  LYS A CE    1 
ATOM   6184  N  NZ    . LYS C  3 56  ? 68.551 104.888 -9.418  1.00 105.53 ? 56  LYS A NZ    1 
ATOM   6185  N  N     . SER C  3 57  ? 71.576 100.145 -4.453  1.00 66.01  ? 57  SER A N     1 
ATOM   6186  C  CA    . SER C  3 57  ? 72.193 99.069  -3.692  1.00 67.52  ? 57  SER A CA    1 
ATOM   6187  C  C     . SER C  3 57  ? 71.149 98.286  -2.898  1.00 64.35  ? 57  SER A C     1 
ATOM   6188  O  O     . SER C  3 57  ? 69.981 98.667  -2.801  1.00 63.37  ? 57  SER A O     1 
ATOM   6189  C  CB    . SER C  3 57  ? 73.264 99.621  -2.749  1.00 72.72  ? 57  SER A CB    1 
ATOM   6190  O  OG    . SER C  3 57  ? 72.689 100.076 -1.537  1.00 77.49  ? 57  SER A OG    1 
ATOM   6191  N  N     . THR C  3 58  ? 71.595 97.165  -2.322  1.00 63.48  ? 58  THR A N     1 
ATOM   6192  C  CA    . THR C  3 58  ? 70.738 96.309  -1.514  1.00 61.98  ? 58  THR A CA    1 
ATOM   6193  C  C     . THR C  3 58  ? 71.309 96.009  -0.135  1.00 65.56  ? 58  THR A C     1 
ATOM   6194  O  O     . THR C  3 58  ? 70.691 95.246  0.616   1.00 65.89  ? 58  THR A O     1 
ATOM   6195  C  CB    . THR C  3 58  ? 70.466 94.979  -2.232  1.00 56.31  ? 58  THR A CB    1 
ATOM   6196  O  OG1   . THR C  3 58  ? 71.703 94.291  -2.453  1.00 56.78  ? 58  THR A OG1   1 
ATOM   6197  C  CG2   . THR C  3 58  ? 69.784 95.222  -3.563  1.00 53.91  ? 58  THR A CG2   1 
ATOM   6198  N  N     . GLU C  3 59  ? 72.462 96.573  0.216   1.00 66.17  ? 59  GLU A N     1 
ATOM   6199  C  CA    . GLU C  3 59  ? 73.056 96.323  1.519   1.00 73.23  ? 59  GLU A CA    1 
ATOM   6200  C  C     . GLU C  3 59  ? 72.140 96.828  2.630   1.00 66.93  ? 59  GLU A C     1 
ATOM   6201  O  O     . GLU C  3 59  ? 71.261 97.667  2.418   1.00 63.00  ? 59  GLU A O     1 
ATOM   6202  C  CB    . GLU C  3 59  ? 74.422 96.999  1.623   1.00 84.07  ? 59  GLU A CB    1 
ATOM   6203  C  CG    . GLU C  3 59  ? 74.365 98.517  1.530   1.00 91.41  ? 59  GLU A CG    1 
ATOM   6204  C  CD    . GLU C  3 59  ? 75.706 99.172  1.798   1.00 101.93 ? 59  GLU A CD    1 
ATOM   6205  O  OE1   . GLU C  3 59  ? 75.888 100.340 1.396   1.00 104.55 ? 59  GLU A OE1   1 
ATOM   6206  O  OE2   . GLU C  3 59  ? 76.577 98.518  2.411   1.00 106.97 ? 59  GLU A OE2   1 
ATOM   6207  N  N     . LEU C  3 60  ? 72.351 96.298  3.831   1.00 68.90  ? 60  LEU A N     1 
ATOM   6208  C  CA    . LEU C  3 60  ? 71.586 96.749  4.982   1.00 65.95  ? 60  LEU A CA    1 
ATOM   6209  C  C     . LEU C  3 60  ? 72.175 98.043  5.529   1.00 65.30  ? 60  LEU A C     1 
ATOM   6210  O  O     . LEU C  3 60  ? 73.386 98.278  5.469   1.00 65.96  ? 60  LEU A O     1 
ATOM   6211  C  CB    . LEU C  3 60  ? 71.547 95.669  6.063   1.00 64.42  ? 60  LEU A CB    1 
ATOM   6212  C  CG    . LEU C  3 60  ? 70.742 94.428  5.667   1.00 65.34  ? 60  LEU A CG    1 
ATOM   6213  C  CD1   . LEU C  3 60  ? 70.461 93.550  6.872   1.00 58.60  ? 60  LEU A CD1   1 
ATOM   6214  C  CD2   . LEU C  3 60  ? 69.443 94.829  4.977   1.00 66.53  ? 60  LEU A CD2   1 
ATOM   6215  N  N     . LEU C  3 61  ? 71.296 98.893  6.063   1.00 60.80  ? 61  LEU A N     1 
ATOM   6216  C  CA    . LEU C  3 61  ? 71.641 100.277 6.351   1.00 61.48  ? 61  LEU A CA    1 
ATOM   6217  C  C     . LEU C  3 61  ? 71.847 100.581 7.827   1.00 64.70  ? 61  LEU A C     1 
ATOM   6218  O  O     . LEU C  3 61  ? 72.406 101.634 8.146   1.00 65.74  ? 61  LEU A O     1 
ATOM   6219  C  CB    . LEU C  3 61  ? 70.560 101.216 5.794   1.00 60.15  ? 61  LEU A CB    1 
ATOM   6220  C  CG    . LEU C  3 61  ? 70.723 101.720 4.355   1.00 61.89  ? 61  LEU A CG    1 
ATOM   6221  C  CD1   . LEU C  3 61  ? 71.428 100.711 3.461   1.00 57.81  ? 61  LEU A CD1   1 
ATOM   6222  C  CD2   . LEU C  3 61  ? 69.369 102.081 3.767   1.00 63.46  ? 61  LEU A CD2   1 
ATOM   6223  N  N     . ILE C  3 62  ? 71.412 99.707  8.728   1.00 63.60  ? 62  ILE A N     1 
ATOM   6224  C  CA    . ILE C  3 62  ? 71.671 99.861  10.155  1.00 60.57  ? 62  ILE A CA    1 
ATOM   6225  C  C     . ILE C  3 62  ? 72.870 98.999  10.516  1.00 64.24  ? 62  ILE A C     1 
ATOM   6226  O  O     . ILE C  3 62  ? 72.979 97.849  10.069  1.00 67.54  ? 62  ILE A O     1 
ATOM   6227  C  CB    . ILE C  3 62  ? 70.438 99.481  10.998  1.00 59.84  ? 62  ILE A CB    1 
ATOM   6228  C  CG1   . ILE C  3 62  ? 69.210 100.265 10.532  1.00 58.32  ? 62  ILE A CG1   1 
ATOM   6229  C  CG2   . ILE C  3 62  ? 70.700 99.740  12.476  1.00 62.49  ? 62  ILE A CG2   1 
ATOM   6230  C  CD1   . ILE C  3 62  ? 67.919 99.821  11.186  1.00 53.11  ? 62  ILE A CD1   1 
ATOM   6231  N  N     . ARG C  3 63  ? 73.780 99.559  11.309  1.00 63.20  ? 63  ARG A N     1 
ATOM   6232  C  CA    . ARG C  3 63  ? 74.966 98.822  11.724  1.00 66.01  ? 63  ARG A CA    1 
ATOM   6233  C  C     . ARG C  3 63  ? 74.563 97.556  12.472  1.00 67.34  ? 63  ARG A C     1 
ATOM   6234  O  O     . ARG C  3 63  ? 73.647 97.571  13.300  1.00 64.87  ? 63  ARG A O     1 
ATOM   6235  C  CB    . ARG C  3 63  ? 75.854 99.707  12.598  1.00 69.38  ? 63  ARG A CB    1 
ATOM   6236  C  CG    . ARG C  3 63  ? 76.109 101.086 12.005  1.00 74.68  ? 63  ARG A CG    1 
ATOM   6237  C  CD    . ARG C  3 63  ? 75.971 102.168 13.062  1.00 85.11  ? 63  ARG A CD    1 
ATOM   6238  N  NE    . ARG C  3 63  ? 77.181 102.321 13.864  1.00 99.31  ? 63  ARG A NE    1 
ATOM   6239  C  CZ    . ARG C  3 63  ? 77.210 102.881 15.068  1.00 105.72 ? 63  ARG A CZ    1 
ATOM   6240  N  NH1   . ARG C  3 63  ? 76.090 103.328 15.618  1.00 105.55 ? 63  ARG A NH1   1 
ATOM   6241  N  NH2   . ARG C  3 63  ? 78.356 102.988 15.727  1.00 109.16 ? 63  ARG A NH2   1 
ATOM   6242  N  N     . LYS C  3 64  ? 75.253 96.453  12.166  1.00 64.25  ? 64  LYS A N     1 
ATOM   6243  C  CA    . LYS C  3 64  ? 74.832 95.139  12.648  1.00 68.65  ? 64  LYS A CA    1 
ATOM   6244  C  C     . LYS C  3 64  ? 74.777 95.085  14.170  1.00 73.85  ? 64  LYS A C     1 
ATOM   6245  O  O     . LYS C  3 64  ? 73.753 94.706  14.752  1.00 76.53  ? 64  LYS A O     1 
ATOM   6246  C  CB    . LYS C  3 64  ? 75.774 94.058  12.112  1.00 72.73  ? 64  LYS A CB    1 
ATOM   6247  C  CG    . LYS C  3 64  ? 75.486 93.605  10.689  1.00 75.95  ? 64  LYS A CG    1 
ATOM   6248  C  CD    . LYS C  3 64  ? 76.528 92.597  10.222  1.00 79.90  ? 64  LYS A CD    1 
ATOM   6249  C  CE    . LYS C  3 64  ? 76.531 91.340  11.084  1.00 82.52  ? 64  LYS A CE    1 
ATOM   6250  N  NZ    . LYS C  3 64  ? 75.545 90.323  10.613  1.00 82.18  ? 64  LYS A NZ    1 
ATOM   6251  N  N     . LEU C  3 65  ? 75.872 95.458  14.833  1.00 76.38  ? 65  LEU A N     1 
ATOM   6252  C  CA    . LEU C  3 65  ? 75.965 95.262  16.279  1.00 74.46  ? 65  LEU A CA    1 
ATOM   6253  C  C     . LEU C  3 65  ? 74.906 96.027  17.064  1.00 77.87  ? 65  LEU A C     1 
ATOM   6254  O  O     . LEU C  3 65  ? 74.253 95.413  17.926  1.00 83.60  ? 65  LEU A O     1 
ATOM   6255  C  CB    . LEU C  3 65  ? 77.378 95.613  16.757  1.00 71.58  ? 65  LEU A CB    1 
ATOM   6256  C  CG    . LEU C  3 65  ? 77.645 95.336  18.237  1.00 75.58  ? 65  LEU A CG    1 
ATOM   6257  C  CD1   . LEU C  3 65  ? 77.448 93.861  18.544  1.00 70.62  ? 65  LEU A CD1   1 
ATOM   6258  C  CD2   . LEU C  3 65  ? 79.044 95.787  18.628  1.00 83.85  ? 65  LEU A CD2   1 
ATOM   6259  N  N     . PRO C  3 66  ? 74.680 97.332  16.845  1.00 75.76  ? 66  PRO A N     1 
ATOM   6260  C  CA    . PRO C  3 66  ? 73.618 98.008  17.614  1.00 73.65  ? 66  PRO A CA    1 
ATOM   6261  C  C     . PRO C  3 66  ? 72.246 97.395  17.404  1.00 68.76  ? 66  PRO A C     1 
ATOM   6262  O  O     . PRO C  3 66  ? 71.463 97.288  18.358  1.00 74.27  ? 66  PRO A O     1 
ATOM   6263  C  CB    . PRO C  3 66  ? 73.681 99.455  17.103  1.00 75.36  ? 66  PRO A CB    1 
ATOM   6264  C  CG    . PRO C  3 66  ? 75.060 99.609  16.568  1.00 79.19  ? 66  PRO A CG    1 
ATOM   6265  C  CD    . PRO C  3 66  ? 75.399 98.280  15.973  1.00 77.10  ? 66  PRO A CD    1 
ATOM   6266  N  N     . PHE C  3 67  ? 71.934 96.980  16.174  1.00 64.54  ? 67  PHE A N     1 
ATOM   6267  C  CA    . PHE C  3 67  ? 70.665 96.308  15.923  1.00 57.59  ? 67  PHE A CA    1 
ATOM   6268  C  C     . PHE C  3 67  ? 70.578 94.996  16.694  1.00 61.12  ? 67  PHE A C     1 
ATOM   6269  O  O     . PHE C  3 67  ? 69.521 94.656  17.241  1.00 60.21  ? 67  PHE A O     1 
ATOM   6270  C  CB    . PHE C  3 67  ? 70.489 96.065  14.423  1.00 49.31  ? 67  PHE A CB    1 
ATOM   6271  C  CG    . PHE C  3 67  ? 69.160 95.475  14.061  1.00 55.67  ? 67  PHE A CG    1 
ATOM   6272  C  CD1   . PHE C  3 67  ? 68.065 96.293  13.839  1.00 55.30  ? 67  PHE A CD1   1 
ATOM   6273  C  CD2   . PHE C  3 67  ? 69.001 94.104  13.947  1.00 60.38  ? 67  PHE A CD2   1 
ATOM   6274  C  CE1   . PHE C  3 67  ? 66.837 95.755  13.511  1.00 55.41  ? 67  PHE A CE1   1 
ATOM   6275  C  CE2   . PHE C  3 67  ? 67.776 93.560  13.621  1.00 59.18  ? 67  PHE A CE2   1 
ATOM   6276  C  CZ    . PHE C  3 67  ? 66.691 94.386  13.402  1.00 55.90  ? 67  PHE A CZ    1 
ATOM   6277  N  N     . GLN C  3 68  ? 71.682 94.247  16.747  1.00 60.88  ? 68  GLN A N     1 
ATOM   6278  C  CA    . GLN C  3 68  ? 71.694 93.000  17.504  1.00 67.61  ? 68  GLN A CA    1 
ATOM   6279  C  C     . GLN C  3 68  ? 71.458 93.255  18.989  1.00 72.78  ? 68  GLN A C     1 
ATOM   6280  O  O     . GLN C  3 68  ? 70.674 92.545  19.633  1.00 73.06  ? 68  GLN A O     1 
ATOM   6281  C  CB    . GLN C  3 68  ? 73.018 92.269  17.277  1.00 75.74  ? 68  GLN A CB    1 
ATOM   6282  C  CG    . GLN C  3 68  ? 73.148 90.952  18.023  1.00 87.40  ? 68  GLN A CG    1 
ATOM   6283  C  CD    . GLN C  3 68  ? 74.333 90.133  17.549  1.00 91.12  ? 68  GLN A CD    1 
ATOM   6284  O  OE1   . GLN C  3 68  ? 74.498 89.897  16.352  1.00 91.13  ? 68  GLN A OE1   1 
ATOM   6285  N  NE2   . GLN C  3 68  ? 75.169 89.701  18.488  1.00 91.54  ? 68  GLN A NE2   1 
ATOM   6286  N  N     . ARG C  3 69  ? 72.123 94.272  19.547  1.00 73.52  ? 69  ARG A N     1 
ATOM   6287  C  CA    . ARG C  3 69  ? 71.879 94.642  20.938  1.00 71.62  ? 69  ARG A CA    1 
ATOM   6288  C  C     . ARG C  3 69  ? 70.416 95.003  21.164  1.00 66.79  ? 69  ARG A C     1 
ATOM   6289  O  O     . ARG C  3 69  ? 69.820 94.603  22.173  1.00 65.77  ? 69  ARG A O     1 
ATOM   6290  C  CB    . ARG C  3 69  ? 72.780 95.809  21.345  1.00 73.33  ? 69  ARG A CB    1 
ATOM   6291  C  CG    . ARG C  3 69  ? 74.160 95.401  21.834  1.00 77.90  ? 69  ARG A CG    1 
ATOM   6292  C  CD    . ARG C  3 69  ? 74.860 96.566  22.516  1.00 79.87  ? 69  ARG A CD    1 
ATOM   6293  N  NE    . ARG C  3 69  ? 75.184 97.639  21.580  1.00 78.71  ? 69  ARG A NE    1 
ATOM   6294  C  CZ    . ARG C  3 69  ? 76.385 97.817  21.038  1.00 83.40  ? 69  ARG A CZ    1 
ATOM   6295  N  NH1   . ARG C  3 69  ? 77.379 96.994  21.342  1.00 85.11  ? 69  ARG A NH1   1 
ATOM   6296  N  NH2   . ARG C  3 69  ? 76.593 98.819  20.194  1.00 85.19  ? 69  ARG A NH2   1 
ATOM   6297  N  N     . LEU C  3 70  ? 69.821 95.759  20.238  1.00 66.07  ? 70  LEU A N     1 
ATOM   6298  C  CA    . LEU C  3 70  ? 68.414 96.121  20.374  1.00 59.63  ? 70  LEU A CA    1 
ATOM   6299  C  C     . LEU C  3 70  ? 67.530 94.881  20.391  1.00 59.48  ? 70  LEU A C     1 
ATOM   6300  O  O     . LEU C  3 70  ? 66.623 94.759  21.225  1.00 63.53  ? 70  LEU A O     1 
ATOM   6301  C  CB    . LEU C  3 70  ? 67.996 97.059  19.243  1.00 52.14  ? 70  LEU A CB    1 
ATOM   6302  C  CG    . LEU C  3 70  ? 66.550 97.547  19.351  1.00 54.97  ? 70  LEU A CG    1 
ATOM   6303  C  CD1   . LEU C  3 70  ? 66.416 98.565  20.473  1.00 60.83  ? 70  LEU A CD1   1 
ATOM   6304  C  CD2   . LEU C  3 70  ? 66.058 98.120  18.035  1.00 49.71  ? 70  LEU A CD2   1 
ATOM   6305  N  N     . VAL C  3 71  ? 67.785 93.944  19.475  1.00 57.29  ? 71  VAL A N     1 
ATOM   6306  C  CA    . VAL C  3 71  ? 66.986 92.723  19.414  1.00 56.02  ? 71  VAL A CA    1 
ATOM   6307  C  C     . VAL C  3 71  ? 67.108 91.936  20.712  1.00 57.94  ? 71  VAL A C     1 
ATOM   6308  O  O     . VAL C  3 71  ? 66.108 91.447  21.254  1.00 57.59  ? 71  VAL A O     1 
ATOM   6309  C  CB    . VAL C  3 71  ? 67.397 91.876  18.195  1.00 54.30  ? 71  VAL A CB    1 
ATOM   6310  C  CG1   . VAL C  3 71  ? 66.865 90.457  18.326  1.00 55.52  ? 71  VAL A CG1   1 
ATOM   6311  C  CG2   . VAL C  3 71  ? 66.892 92.517  16.916  1.00 42.02  ? 71  VAL A CG2   1 
ATOM   6312  N  N     . ARG C  3 72  ? 68.328 91.811  21.241  1.00 60.35  ? 72  ARG A N     1 
ATOM   6313  C  CA    . ARG C  3 72  ? 68.512 91.047  22.472  1.00 62.95  ? 72  ARG A CA    1 
ATOM   6314  C  C     . ARG C  3 72  ? 67.828 91.724  23.656  1.00 62.20  ? 72  ARG A C     1 
ATOM   6315  O  O     . ARG C  3 72  ? 67.224 91.048  24.499  1.00 62.11  ? 72  ARG A O     1 
ATOM   6316  C  CB    . ARG C  3 72  ? 70.001 90.842  22.745  1.00 69.06  ? 72  ARG A CB    1 
ATOM   6317  C  CG    . ARG C  3 72  ? 70.704 90.031  21.668  1.00 79.04  ? 72  ARG A CG    1 
ATOM   6318  C  CD    . ARG C  3 72  ? 72.156 89.758  22.018  1.00 88.38  ? 72  ARG A CD    1 
ATOM   6319  N  NE    . ARG C  3 72  ? 72.852 89.087  20.925  1.00 90.15  ? 72  ARG A NE    1 
ATOM   6320  C  CZ    . ARG C  3 72  ? 72.822 87.776  20.712  1.00 94.71  ? 72  ARG A CZ    1 
ATOM   6321  N  NH1   . ARG C  3 72  ? 72.127 86.986  21.520  1.00 96.49  ? 72  ARG A NH1   1 
ATOM   6322  N  NH2   . ARG C  3 72  ? 73.485 87.254  19.690  1.00 97.69  ? 72  ARG A NH2   1 
ATOM   6323  N  N     . GLU C  3 73  ? 67.901 93.056  23.733  1.00 62.00  ? 73  GLU A N     1 
ATOM   6324  C  CA    . GLU C  3 73  ? 67.225 93.769  24.813  1.00 64.64  ? 73  GLU A CA    1 
ATOM   6325  C  C     . GLU C  3 73  ? 65.714 93.586  24.731  1.00 62.86  ? 73  GLU A C     1 
ATOM   6326  O  O     . GLU C  3 73  ? 65.053 93.319  25.742  1.00 59.01  ? 73  GLU A O     1 
ATOM   6327  C  CB    . GLU C  3 73  ? 67.582 95.255  24.778  1.00 74.00  ? 73  GLU A CB    1 
ATOM   6328  C  CG    . GLU C  3 73  ? 66.751 96.094  25.740  1.00 85.33  ? 73  GLU A CG    1 
ATOM   6329  C  CD    . GLU C  3 73  ? 66.894 97.585  25.505  1.00 96.84  ? 73  GLU A CD    1 
ATOM   6330  O  OE1   . GLU C  3 73  ? 67.919 98.161  25.925  1.00 100.20 ? 73  GLU A OE1   1 
ATOM   6331  O  OE2   . GLU C  3 73  ? 65.980 98.181  24.895  1.00 100.68 ? 73  GLU A OE2   1 
ATOM   6332  N  N     . ILE C  3 74  ? 65.148 93.729  23.530  1.00 61.56  ? 74  ILE A N     1 
ATOM   6333  C  CA    . ILE C  3 74  ? 63.703 93.592  23.370  1.00 57.65  ? 74  ILE A CA    1 
ATOM   6334  C  C     . ILE C  3 74  ? 63.260 92.166  23.677  1.00 60.85  ? 74  ILE A C     1 
ATOM   6335  O  O     . ILE C  3 74  ? 62.198 91.946  24.273  1.00 64.28  ? 74  ILE A O     1 
ATOM   6336  C  CB    . ILE C  3 74  ? 63.284 94.034  21.956  1.00 56.96  ? 74  ILE A CB    1 
ATOM   6337  C  CG1   . ILE C  3 74  ? 63.445 95.549  21.807  1.00 54.65  ? 74  ILE A CG1   1 
ATOM   6338  C  CG2   . ILE C  3 74  ? 61.853 93.613  21.652  1.00 61.38  ? 74  ILE A CG2   1 
ATOM   6339  C  CD1   . ILE C  3 74  ? 63.090 96.071  20.434  1.00 54.96  ? 74  ILE A CD1   1 
ATOM   6340  N  N     . ALA C  3 75  ? 64.072 91.176  23.296  1.00 55.21  ? 75  ALA A N     1 
ATOM   6341  C  CA    . ALA C  3 75  ? 63.716 89.787  23.570  1.00 58.89  ? 75  ALA A CA    1 
ATOM   6342  C  C     . ALA C  3 75  ? 63.848 89.448  25.050  1.00 63.04  ? 75  ALA A C     1 
ATOM   6343  O  O     . ALA C  3 75  ? 63.129 88.573  25.547  1.00 58.17  ? 75  ALA A O     1 
ATOM   6344  C  CB    . ALA C  3 75  ? 64.583 88.847  22.733  1.00 52.62  ? 75  ALA A CB    1 
ATOM   6345  N  N     . GLN C  3 76  ? 64.750 90.128  25.767  1.00 62.79  ? 76  GLN A N     1 
ATOM   6346  C  CA    . GLN C  3 76  ? 64.956 89.829  27.181  1.00 67.24  ? 76  GLN A CA    1 
ATOM   6347  C  C     . GLN C  3 76  ? 63.696 90.072  28.006  1.00 74.54  ? 76  GLN A C     1 
ATOM   6348  O  O     . GLN C  3 76  ? 63.493 89.416  29.033  1.00 79.22  ? 76  GLN A O     1 
ATOM   6349  C  CB    . GLN C  3 76  ? 66.121 90.658  27.727  1.00 68.63  ? 76  GLN A CB    1 
ATOM   6350  C  CG    . GLN C  3 76  ? 66.443 90.422  29.200  1.00 77.80  ? 76  GLN A CG    1 
ATOM   6351  C  CD    . GLN C  3 76  ? 67.086 89.069  29.463  1.00 82.38  ? 76  GLN A CD    1 
ATOM   6352  O  OE1   . GLN C  3 76  ? 67.286 88.271  28.547  1.00 86.99  ? 76  GLN A OE1   1 
ATOM   6353  N  NE2   . GLN C  3 76  ? 67.418 88.808  30.722  1.00 78.50  ? 76  GLN A NE2   1 
ATOM   6354  N  N     . ASP C  3 77  ? 62.835 90.995  27.571  1.00 70.75  ? 77  ASP A N     1 
ATOM   6355  C  CA    . ASP C  3 77  ? 61.598 91.255  28.294  1.00 67.98  ? 77  ASP A CA    1 
ATOM   6356  C  C     . ASP C  3 77  ? 60.609 90.098  28.210  1.00 68.49  ? 77  ASP A C     1 
ATOM   6357  O  O     . ASP C  3 77  ? 59.776 89.951  29.112  1.00 67.56  ? 77  ASP A O     1 
ATOM   6358  C  CB    . ASP C  3 77  ? 60.937 92.529  27.766  1.00 72.89  ? 77  ASP A CB    1 
ATOM   6359  C  CG    . ASP C  3 77  ? 61.828 93.741  27.910  1.00 85.35  ? 77  ASP A CG    1 
ATOM   6360  O  OD1   . ASP C  3 77  ? 62.624 93.778  28.871  1.00 94.59  ? 77  ASP A OD1   1 
ATOM   6361  O  OD2   . ASP C  3 77  ? 61.733 94.651  27.060  1.00 86.44  ? 77  ASP A OD2   1 
ATOM   6362  N  N     . PHE C  3 78  ? 60.675 89.280  27.158  1.00 61.51  ? 78  PHE A N     1 
ATOM   6363  C  CA    . PHE C  3 78  ? 59.741 88.176  26.964  1.00 59.95  ? 78  PHE A CA    1 
ATOM   6364  C  C     . PHE C  3 78  ? 60.262 86.844  27.486  1.00 63.92  ? 78  PHE A C     1 
ATOM   6365  O  O     . PHE C  3 78  ? 59.460 85.996  27.893  1.00 63.64  ? 78  PHE A O     1 
ATOM   6366  C  CB    . PHE C  3 78  ? 59.394 88.029  25.475  1.00 55.66  ? 78  PHE A CB    1 
ATOM   6367  C  CG    . PHE C  3 78  ? 58.882 89.294  24.846  1.00 57.91  ? 78  PHE A CG    1 
ATOM   6368  C  CD1   . PHE C  3 78  ? 58.057 90.147  25.558  1.00 57.50  ? 78  PHE A CD1   1 
ATOM   6369  C  CD2   . PHE C  3 78  ? 59.239 89.642  23.551  1.00 51.18  ? 78  PHE A CD2   1 
ATOM   6370  C  CE1   . PHE C  3 78  ? 57.589 91.318  24.994  1.00 63.57  ? 78  PHE A CE1   1 
ATOM   6371  C  CE2   . PHE C  3 78  ? 58.774 90.815  22.980  1.00 51.16  ? 78  PHE A CE2   1 
ATOM   6372  C  CZ    . PHE C  3 78  ? 57.947 91.652  23.702  1.00 57.08  ? 78  PHE A CZ    1 
ATOM   6373  N  N     . LYS C  3 79  ? 61.577 86.637  27.478  1.00 65.79  ? 79  LYS A N     1 
ATOM   6374  C  CA    . LYS C  3 79  ? 62.176 85.423  28.015  1.00 67.81  ? 79  LYS A CA    1 
ATOM   6375  C  C     . LYS C  3 79  ? 63.645 85.701  28.303  1.00 76.25  ? 79  LYS A C     1 
ATOM   6376  O  O     . LYS C  3 79  ? 64.308 86.404  27.537  1.00 78.99  ? 79  LYS A O     1 
ATOM   6377  C  CB    . LYS C  3 79  ? 62.028 84.242  27.046  1.00 67.55  ? 79  LYS A CB    1 
ATOM   6378  C  CG    . LYS C  3 79  ? 62.609 82.934  27.563  1.00 75.32  ? 79  LYS A CG    1 
ATOM   6379  C  CD    . LYS C  3 79  ? 62.037 82.580  28.925  1.00 81.70  ? 79  LYS A CD    1 
ATOM   6380  C  CE    . LYS C  3 79  ? 62.749 81.379  29.524  1.00 80.28  ? 79  LYS A CE    1 
ATOM   6381  N  NZ    . LYS C  3 79  ? 62.278 81.091  30.907  1.00 79.45  ? 79  LYS A NZ    1 
ATOM   6382  N  N     . THR C  3 80  ? 64.141 85.150  29.407  1.00 78.91  ? 80  THR A N     1 
ATOM   6383  C  CA    . THR C  3 80  ? 65.494 85.421  29.866  1.00 82.92  ? 80  THR A CA    1 
ATOM   6384  C  C     . THR C  3 80  ? 66.470 84.359  29.364  1.00 87.34  ? 80  THR A C     1 
ATOM   6385  O  O     . THR C  3 80  ? 66.090 83.230  29.045  1.00 83.41  ? 80  THR A O     1 
ATOM   6386  C  CB    . THR C  3 80  ? 65.537 85.488  31.393  1.00 88.69  ? 80  THR A CB    1 
ATOM   6387  O  OG1   . THR C  3 80  ? 65.092 84.239  31.937  1.00 95.38  ? 80  THR A OG1   1 
ATOM   6388  C  CG2   . THR C  3 80  ? 64.637 86.605  31.900  1.00 83.47  ? 80  THR A CG2   1 
ATOM   6389  N  N     . ASP C  3 81  ? 67.745 84.750  29.295  1.00 89.99  ? 81  ASP A N     1 
ATOM   6390  C  CA    . ASP C  3 81  ? 68.836 83.860  28.888  1.00 97.49  ? 81  ASP A CA    1 
ATOM   6391  C  C     . ASP C  3 81  ? 68.592 83.278  27.497  1.00 93.21  ? 81  ASP A C     1 
ATOM   6392  O  O     . ASP C  3 81  ? 68.877 82.108  27.231  1.00 98.74  ? 81  ASP A O     1 
ATOM   6393  C  CB    . ASP C  3 81  ? 69.057 82.749  29.918  1.00 102.07 ? 81  ASP A CB    1 
ATOM   6394  C  CG    . ASP C  3 81  ? 70.396 82.054  29.749  1.00 108.93 ? 81  ASP A CG    1 
ATOM   6395  O  OD1   . ASP C  3 81  ? 71.285 82.628  29.086  1.00 110.73 ? 81  ASP A OD1   1 
ATOM   6396  O  OD2   . ASP C  3 81  ? 70.559 80.937  30.284  1.00 110.82 ? 81  ASP A OD2   1 
ATOM   6397  N  N     . LEU C  3 82  ? 68.061 84.103  26.600  1.00 88.53  ? 82  LEU A N     1 
ATOM   6398  C  CA    . LEU C  3 82  ? 67.800 83.689  25.229  1.00 77.33  ? 82  LEU A CA    1 
ATOM   6399  C  C     . LEU C  3 82  ? 69.012 83.963  24.350  1.00 71.76  ? 82  LEU A C     1 
ATOM   6400  O  O     . LEU C  3 82  ? 69.628 85.029  24.435  1.00 77.81  ? 82  LEU A O     1 
ATOM   6401  C  CB    . LEU C  3 82  ? 66.580 84.418  24.663  1.00 69.50  ? 82  LEU A CB    1 
ATOM   6402  C  CG    . LEU C  3 82  ? 65.226 83.714  24.738  1.00 63.93  ? 82  LEU A CG    1 
ATOM   6403  C  CD1   . LEU C  3 82  ? 64.147 84.599  24.141  1.00 63.56  ? 82  LEU A CD1   1 
ATOM   6404  C  CD2   . LEU C  3 82  ? 65.280 82.378  24.017  1.00 57.62  ? 82  LEU A CD2   1 
ATOM   6405  N  N     . ARG C  3 83  ? 69.350 82.993  23.509  1.00 65.20  ? 83  ARG A N     1 
ATOM   6406  C  CA    . ARG C  3 83  ? 70.365 83.171  22.485  1.00 72.11  ? 83  ARG A CA    1 
ATOM   6407  C  C     . ARG C  3 83  ? 69.725 83.101  21.104  1.00 69.92  ? 83  ARG A C     1 
ATOM   6408  O  O     . ARG C  3 83  ? 68.620 82.581  20.930  1.00 67.67  ? 83  ARG A O     1 
ATOM   6409  C  CB    . ARG C  3 83  ? 71.483 82.130  22.619  1.00 77.83  ? 83  ARG A CB    1 
ATOM   6410  C  CG    . ARG C  3 83  ? 71.053 80.775  23.148  1.00 82.36  ? 83  ARG A CG    1 
ATOM   6411  C  CD    . ARG C  3 83  ? 72.237 80.076  23.800  1.00 89.28  ? 83  ARG A CD    1 
ATOM   6412  N  NE    . ARG C  3 83  ? 72.640 80.746  25.034  1.00 97.93  ? 83  ARG A NE    1 
ATOM   6413  C  CZ    . ARG C  3 83  ? 73.864 80.703  25.549  1.00 102.26 ? 83  ARG A CZ    1 
ATOM   6414  N  NH1   . ARG C  3 83  ? 74.823 80.029  24.927  1.00 101.81 ? 83  ARG A NH1   1 
ATOM   6415  N  NH2   . ARG C  3 83  ? 74.132 81.344  26.680  1.00 99.77  ? 83  ARG A NH2   1 
ATOM   6416  N  N     . PHE C  3 84  ? 70.430 83.651  20.120  1.00 68.79  ? 84  PHE A N     1 
ATOM   6417  C  CA    . PHE C  3 84  ? 69.913 83.801  18.769  1.00 62.04  ? 84  PHE A CA    1 
ATOM   6418  C  C     . PHE C  3 84  ? 70.844 83.142  17.764  1.00 65.74  ? 84  PHE A C     1 
ATOM   6419  O  O     . PHE C  3 84  ? 72.068 83.281  17.853  1.00 69.98  ? 84  PHE A O     1 
ATOM   6420  C  CB    . PHE C  3 84  ? 69.752 85.280  18.397  1.00 59.19  ? 84  PHE A CB    1 
ATOM   6421  C  CG    . PHE C  3 84  ? 68.536 85.931  18.986  1.00 56.06  ? 84  PHE A CG    1 
ATOM   6422  C  CD1   . PHE C  3 84  ? 68.553 86.426  20.279  1.00 59.74  ? 84  PHE A CD1   1 
ATOM   6423  C  CD2   . PHE C  3 84  ? 67.379 86.067  18.236  1.00 42.43  ? 84  PHE A CD2   1 
ATOM   6424  C  CE1   . PHE C  3 84  ? 67.435 87.034  20.818  1.00 59.66  ? 84  PHE A CE1   1 
ATOM   6425  C  CE2   . PHE C  3 84  ? 66.258 86.674  18.768  1.00 46.75  ? 84  PHE A CE2   1 
ATOM   6426  C  CZ    . PHE C  3 84  ? 66.286 87.158  20.061  1.00 58.03  ? 84  PHE A CZ    1 
ATOM   6427  N  N     . GLN C  3 85  ? 70.259 82.426  16.808  1.00 59.26  ? 85  GLN A N     1 
ATOM   6428  C  CA    . GLN C  3 85  ? 70.990 82.099  15.594  1.00 60.78  ? 85  GLN A CA    1 
ATOM   6429  C  C     . GLN C  3 85  ? 71.286 83.385  14.836  1.00 67.20  ? 85  GLN A C     1 
ATOM   6430  O  O     . GLN C  3 85  ? 70.469 84.309  14.814  1.00 75.66  ? 85  GLN A O     1 
ATOM   6431  C  CB    . GLN C  3 85  ? 70.181 81.142  14.715  1.00 54.50  ? 85  GLN A CB    1 
ATOM   6432  C  CG    . GLN C  3 85  ? 69.989 79.748  15.288  1.00 56.94  ? 85  GLN A CG    1 
ATOM   6433  C  CD    . GLN C  3 85  ? 69.264 78.825  14.324  1.00 62.10  ? 85  GLN A CD    1 
ATOM   6434  O  OE1   . GLN C  3 85  ? 68.614 79.280  13.379  1.00 64.01  ? 85  GLN A OE1   1 
ATOM   6435  N  NE2   . GLN C  3 85  ? 69.381 77.519  14.551  1.00 60.68  ? 85  GLN A NE2   1 
ATOM   6436  N  N     . SER C  3 86  ? 72.473 83.453  14.227  1.00 64.16  ? 86  SER A N     1 
ATOM   6437  C  CA    . SER C  3 86  ? 72.825 84.635  13.446  1.00 68.68  ? 86  SER A CA    1 
ATOM   6438  C  C     . SER C  3 86  ? 71.811 84.877  12.335  1.00 66.96  ? 86  SER A C     1 
ATOM   6439  O  O     . SER C  3 86  ? 71.459 86.027  12.039  1.00 70.04  ? 86  SER A O     1 
ATOM   6440  C  CB    . SER C  3 86  ? 74.231 84.484  12.865  1.00 77.64  ? 86  SER A CB    1 
ATOM   6441  O  OG    . SER C  3 86  ? 74.247 83.530  11.816  1.00 81.24  ? 86  SER A OG    1 
ATOM   6442  N  N     . SER C  3 87  ? 71.319 83.797  11.721  1.00 63.69  ? 87  SER A N     1 
ATOM   6443  C  CA    . SER C  3 87  ? 70.328 83.922  10.659  1.00 61.07  ? 87  SER A CA    1 
ATOM   6444  C  C     . SER C  3 87  ? 69.037 84.555  11.160  1.00 60.46  ? 87  SER A C     1 
ATOM   6445  O  O     . SER C  3 87  ? 68.362 85.264  10.405  1.00 64.21  ? 87  SER A O     1 
ATOM   6446  C  CB    . SER C  3 87  ? 70.049 82.548  10.049  1.00 60.21  ? 87  SER A CB    1 
ATOM   6447  O  OG    . SER C  3 87  ? 69.830 81.578  11.061  1.00 59.98  ? 87  SER A OG    1 
ATOM   6448  N  N     . ALA C  3 88  ? 68.676 84.316  12.423  1.00 59.60  ? 88  ALA A N     1 
ATOM   6449  C  CA    . ALA C  3 88  ? 67.477 84.941  12.973  1.00 57.91  ? 88  ALA A CA    1 
ATOM   6450  C  C     . ALA C  3 88  ? 67.655 86.448  13.106  1.00 63.10  ? 88  ALA A C     1 
ATOM   6451  O  O     . ALA C  3 88  ? 66.739 87.219  12.791  1.00 71.98  ? 88  ALA A O     1 
ATOM   6452  C  CB    . ALA C  3 88  ? 67.132 84.318  14.325  1.00 45.59  ? 88  ALA A CB    1 
ATOM   6453  N  N     . VAL C  3 89  ? 68.829 86.887  13.561  1.00 56.60  ? 89  VAL A N     1 
ATOM   6454  C  CA    . VAL C  3 89  ? 69.086 88.317  13.700  1.00 56.18  ? 89  VAL A CA    1 
ATOM   6455  C  C     . VAL C  3 89  ? 69.119 88.986  12.331  1.00 66.34  ? 89  VAL A C     1 
ATOM   6456  O  O     . VAL C  3 89  ? 68.496 90.034  12.119  1.00 68.57  ? 89  VAL A O     1 
ATOM   6457  C  CB    . VAL C  3 89  ? 70.394 88.554  14.476  1.00 52.46  ? 89  VAL A CB    1 
ATOM   6458  C  CG1   . VAL C  3 89  ? 70.587 90.038  14.747  1.00 50.64  ? 89  VAL A CG1   1 
ATOM   6459  C  CG2   . VAL C  3 89  ? 70.392 87.763  15.772  1.00 42.38  ? 89  VAL A CG2   1 
ATOM   6460  N  N     . MET C  3 90  ? 69.841 88.386  11.378  1.00 65.77  ? 90  MET A N     1 
ATOM   6461  C  CA    . MET C  3 90  ? 69.906 88.961  10.037  1.00 75.26  ? 90  MET A CA    1 
ATOM   6462  C  C     . MET C  3 90  ? 68.528 89.002  9.385   1.00 67.09  ? 90  MET A C     1 
ATOM   6463  O  O     . MET C  3 90  ? 68.204 89.951  8.662   1.00 65.86  ? 90  MET A O     1 
ATOM   6464  C  CB    . MET C  3 90  ? 70.888 88.173  9.170   1.00 84.85  ? 90  MET A CB    1 
ATOM   6465  C  CG    . MET C  3 90  ? 72.334 88.260  9.631   1.00 96.34  ? 90  MET A CG    1 
ATOM   6466  S  SD    . MET C  3 90  ? 73.476 87.494  8.464   1.00 105.61 ? 90  MET A SD    1 
ATOM   6467  C  CE    . MET C  3 90  ? 72.789 85.844  8.356   1.00 101.51 ? 90  MET A CE    1 
ATOM   6468  N  N     . ALA C  3 91  ? 67.702 87.983  9.634   1.00 65.38  ? 91  ALA A N     1 
ATOM   6469  C  CA    . ALA C  3 91  ? 66.340 87.989  9.110   1.00 57.40  ? 91  ALA A CA    1 
ATOM   6470  C  C     . ALA C  3 91  ? 65.527 89.124  9.722   1.00 59.58  ? 91  ALA A C     1 
ATOM   6471  O  O     . ALA C  3 91  ? 64.818 89.853  9.014   1.00 61.92  ? 91  ALA A O     1 
ATOM   6472  C  CB    . ALA C  3 91  ? 65.672 86.639  9.372   1.00 50.44  ? 91  ALA A CB    1 
ATOM   6473  N  N     . LEU C  3 92  ? 65.625 89.290  11.046  1.00 61.38  ? 92  LEU A N     1 
ATOM   6474  C  CA    . LEU C  3 92  ? 64.953 90.404  11.707  1.00 59.60  ? 92  LEU A CA    1 
ATOM   6475  C  C     . LEU C  3 92  ? 65.393 91.740  11.123  1.00 64.07  ? 92  LEU A C     1 
ATOM   6476  O  O     . LEU C  3 92  ? 64.582 92.665  10.993  1.00 70.40  ? 92  LEU A O     1 
ATOM   6477  C  CB    . LEU C  3 92  ? 65.224 90.364  13.212  1.00 56.35  ? 92  LEU A CB    1 
ATOM   6478  C  CG    . LEU C  3 92  ? 64.446 89.342  14.042  1.00 55.80  ? 92  LEU A CG    1 
ATOM   6479  C  CD1   . LEU C  3 92  ? 65.039 89.228  15.434  1.00 64.08  ? 92  LEU A CD1   1 
ATOM   6480  C  CD2   . LEU C  3 92  ? 62.979 89.732  14.124  1.00 48.96  ? 92  LEU A CD2   1 
ATOM   6481  N  N     . GLN C  3 93  ? 66.671 91.860  10.755  1.00 62.87  ? 93  GLN A N     1 
ATOM   6482  C  CA    . GLN C  3 93  ? 67.151 93.121  10.199  1.00 59.51  ? 93  GLN A CA    1 
ATOM   6483  C  C     . GLN C  3 93  ? 66.629 93.338  8.784   1.00 64.78  ? 93  GLN A C     1 
ATOM   6484  O  O     . GLN C  3 93  ? 66.253 94.460  8.423   1.00 69.10  ? 93  GLN A O     1 
ATOM   6485  C  CB    . GLN C  3 93  ? 68.678 93.168  10.228  1.00 45.22  ? 93  GLN A CB    1 
ATOM   6486  C  CG    . GLN C  3 93  ? 69.234 94.580  10.145  1.00 47.92  ? 93  GLN A CG    1 
ATOM   6487  C  CD    . GLN C  3 93  ? 70.738 94.636  10.327  1.00 56.31  ? 93  GLN A CD    1 
ATOM   6488  O  OE1   . GLN C  3 93  ? 71.362 93.661  10.747  1.00 60.37  ? 93  GLN A OE1   1 
ATOM   6489  N  NE2   . GLN C  3 93  ? 71.328 95.784  10.012  1.00 46.66  ? 93  GLN A NE2   1 
ATOM   6490  N  N     . GLU C  3 94  ? 66.600 92.281  7.969   1.00 55.91  ? 94  GLU A N     1 
ATOM   6491  C  CA    . GLU C  3 94  ? 66.018 92.391  6.634   1.00 54.80  ? 94  GLU A CA    1 
ATOM   6492  C  C     . GLU C  3 94  ? 64.568 92.854  6.708   1.00 56.21  ? 94  GLU A C     1 
ATOM   6493  O  O     . GLU C  3 94  ? 64.179 93.834  6.057   1.00 59.51  ? 94  GLU A O     1 
ATOM   6494  C  CB    . GLU C  3 94  ? 66.114 91.049  5.906   1.00 54.36  ? 94  GLU A CB    1 
ATOM   6495  C  CG    . GLU C  3 94  ? 67.511 90.675  5.439   1.00 59.49  ? 94  GLU A CG    1 
ATOM   6496  C  CD    . GLU C  3 94  ? 67.952 91.466  4.222   1.00 65.45  ? 94  GLU A CD    1 
ATOM   6497  O  OE1   . GLU C  3 94  ? 69.170 91.705  4.078   1.00 70.74  ? 94  GLU A OE1   1 
ATOM   6498  O  OE2   . GLU C  3 94  ? 67.080 91.847  3.411   1.00 65.07  ? 94  GLU A OE2   1 
ATOM   6499  N  N     . ALA C  3 95  ? 63.753 92.166  7.514   1.00 53.06  ? 95  ALA A N     1 
ATOM   6500  C  CA    . ALA C  3 95  ? 62.343 92.529  7.619   1.00 52.78  ? 95  ALA A CA    1 
ATOM   6501  C  C     . ALA C  3 95  ? 62.168 93.929  8.194   1.00 56.33  ? 95  ALA A C     1 
ATOM   6502  O  O     . ALA C  3 95  ? 61.293 94.686  7.753   1.00 57.16  ? 95  ALA A O     1 
ATOM   6503  C  CB    . ALA C  3 95  ? 61.603 91.502  8.473   1.00 45.93  ? 95  ALA A CB    1 
ATOM   6504  N  N     . SER C  3 96  ? 62.995 94.292  9.177   1.00 51.48  ? 96  SER A N     1 
ATOM   6505  C  CA    . SER C  3 96  ? 62.865 95.599  9.813   1.00 51.47  ? 96  SER A CA    1 
ATOM   6506  C  C     . SER C  3 96  ? 63.189 96.723  8.838   1.00 49.38  ? 96  SER A C     1 
ATOM   6507  O  O     . SER C  3 96  ? 62.415 97.677  8.693   1.00 50.77  ? 96  SER A O     1 
ATOM   6508  C  CB    . SER C  3 96  ? 63.774 95.677  11.038  1.00 60.02  ? 96  SER A CB    1 
ATOM   6509  O  OG    . SER C  3 96  ? 63.560 94.572  11.894  1.00 65.94  ? 96  SER A OG    1 
ATOM   6510  N  N     . GLU C  3 97  ? 64.333 96.627  8.156   1.00 51.53  ? 97  GLU A N     1 
ATOM   6511  C  CA    . GLU C  3 97  ? 64.726 97.691  7.240   1.00 46.70  ? 97  GLU A CA    1 
ATOM   6512  C  C     . GLU C  3 97  ? 63.811 97.752  6.023   1.00 35.92  ? 97  GLU A C     1 
ATOM   6513  O  O     . GLU C  3 97  ? 63.557 98.843  5.499   1.00 36.13  ? 97  GLU A O     1 
ATOM   6514  C  CB    . GLU C  3 97  ? 66.185 97.510  6.822   1.00 49.62  ? 97  GLU A CB    1 
ATOM   6515  C  CG    . GLU C  3 97  ? 67.152 97.553  7.997   1.00 60.67  ? 97  GLU A CG    1 
ATOM   6516  C  CD    . GLU C  3 97  ? 68.606 97.551  7.566   1.00 76.16  ? 97  GLU A CD    1 
ATOM   6517  O  OE1   . GLU C  3 97  ? 68.871 97.793  6.371   1.00 82.72  ? 97  GLU A OE1   1 
ATOM   6518  O  OE2   . GLU C  3 97  ? 69.482 97.310  8.424   1.00 81.00  ? 97  GLU A OE2   1 
ATOM   6519  N  N     . ALA C  3 98  ? 63.295 96.606  5.570   1.00 39.55  ? 98  ALA A N     1 
ATOM   6520  C  CA    . ALA C  3 98  ? 62.283 96.628  4.518   1.00 40.21  ? 98  ALA A CA    1 
ATOM   6521  C  C     . ALA C  3 98  ? 61.037 97.377  4.980   1.00 48.31  ? 98  ALA A C     1 
ATOM   6522  O  O     . ALA C  3 98  ? 60.546 98.284  4.291   1.00 53.07  ? 98  ALA A O     1 
ATOM   6523  C  CB    . ALA C  3 98  ? 61.932 95.201  4.096   1.00 31.85  ? 98  ALA A CB    1 
ATOM   6524  N  N     . TYR C  3 99  ? 60.521 97.017  6.161   1.00 49.21  ? 99  TYR A N     1 
ATOM   6525  C  CA    . TYR C  3 99  ? 59.346 97.690  6.708   1.00 43.61  ? 99  TYR A CA    1 
ATOM   6526  C  C     . TYR C  3 99  ? 59.565 99.193  6.820   1.00 48.87  ? 99  TYR A C     1 
ATOM   6527  O  O     . TYR C  3 99  ? 58.683 99.986  6.466   1.00 61.88  ? 99  TYR A O     1 
ATOM   6528  C  CB    . TYR C  3 99  ? 58.998 97.095  8.074   1.00 39.23  ? 99  TYR A CB    1 
ATOM   6529  C  CG    . TYR C  3 99  ? 57.979 97.893  8.855   1.00 39.11  ? 99  TYR A CG    1 
ATOM   6530  C  CD1   . TYR C  3 99  ? 56.618 97.713  8.643   1.00 37.10  ? 99  TYR A CD1   1 
ATOM   6531  C  CD2   . TYR C  3 99  ? 58.378 98.819  9.811   1.00 43.45  ? 99  TYR A CD2   1 
ATOM   6532  C  CE1   . TYR C  3 99  ? 55.681 98.439  9.358   1.00 33.60  ? 99  TYR A CE1   1 
ATOM   6533  C  CE2   . TYR C  3 99  ? 57.451 99.550  10.527  1.00 46.19  ? 99  TYR A CE2   1 
ATOM   6534  C  CZ    . TYR C  3 99  ? 56.105 99.357  10.297  1.00 43.33  ? 99  TYR A CZ    1 
ATOM   6535  O  OH    . TYR C  3 99  ? 55.181 100.083 11.011  1.00 42.97  ? 99  TYR A OH    1 
ATOM   6536  N  N     . LEU C  3 100 ? 60.736 99.606  7.310   1.00 42.22  ? 100 LEU A N     1 
ATOM   6537  C  CA    . LEU C  3 100 ? 60.996 101.029 7.494   1.00 45.20  ? 100 LEU A CA    1 
ATOM   6538  C  C     . LEU C  3 100 ? 61.121 101.753 6.159   1.00 54.86  ? 100 LEU A C     1 
ATOM   6539  O  O     . LEU C  3 100 ? 60.629 102.877 6.014   1.00 60.47  ? 100 LEU A O     1 
ATOM   6540  C  CB    . LEU C  3 100 ? 62.254 101.233 8.337   1.00 47.00  ? 100 LEU A CB    1 
ATOM   6541  C  CG    . LEU C  3 100 ? 62.109 100.984 9.840   1.00 47.13  ? 100 LEU A CG    1 
ATOM   6542  C  CD1   . LEU C  3 100 ? 63.402 101.324 10.562  1.00 50.35  ? 100 LEU A CD1   1 
ATOM   6543  C  CD2   . LEU C  3 100 ? 60.945 101.780 10.412  1.00 48.21  ? 100 LEU A CD2   1 
ATOM   6544  N  N     . VAL C  3 101 ? 61.776 101.131 5.174   1.00 57.28  ? 101 VAL A N     1 
ATOM   6545  C  CA    . VAL C  3 101 ? 61.899 101.762 3.861   1.00 55.29  ? 101 VAL A CA    1 
ATOM   6546  C  C     . VAL C  3 101 ? 60.525 101.964 3.234   1.00 49.29  ? 101 VAL A C     1 
ATOM   6547  O  O     . VAL C  3 101 ? 60.218 103.044 2.709   1.00 44.05  ? 101 VAL A O     1 
ATOM   6548  C  CB    . VAL C  3 101 ? 62.829 100.937 2.950   1.00 49.21  ? 101 VAL A CB    1 
ATOM   6549  C  CG1   . VAL C  3 101 ? 62.684 101.380 1.506   1.00 45.17  ? 101 VAL A CG1   1 
ATOM   6550  C  CG2   . VAL C  3 101 ? 64.276 101.088 3.398   1.00 45.14  ? 101 VAL A CG2   1 
ATOM   6551  N  N     . ALA C  3 102 ? 59.667 100.939 3.291   1.00 47.65  ? 102 ALA A N     1 
ATOM   6552  C  CA    . ALA C  3 102 ? 58.310 101.097 2.774   1.00 44.63  ? 102 ALA A CA    1 
ATOM   6553  C  C     . ALA C  3 102 ? 57.556 102.189 3.524   1.00 51.10  ? 102 ALA A C     1 
ATOM   6554  O  O     . ALA C  3 102 ? 56.875 103.026 2.911   1.00 58.16  ? 102 ALA A O     1 
ATOM   6555  C  CB    . ALA C  3 102 ? 57.559 99.769  2.860   1.00 42.24  ? 102 ALA A CB    1 
ATOM   6556  N  N     . LEU C  3 103 ? 57.675 102.202 4.856   1.00 47.18  ? 103 LEU A N     1 
ATOM   6557  C  CA    . LEU C  3 103 ? 57.008 103.230 5.649   1.00 44.83  ? 103 LEU A CA    1 
ATOM   6558  C  C     . LEU C  3 103 ? 57.506 104.624 5.293   1.00 45.45  ? 103 LEU A C     1 
ATOM   6559  O  O     . LEU C  3 103 ? 56.757 105.599 5.419   1.00 45.59  ? 103 LEU A O     1 
ATOM   6560  C  CB    . LEU C  3 103 ? 57.207 102.961 7.141   1.00 42.09  ? 103 LEU A CB    1 
ATOM   6561  C  CG    . LEU C  3 103 ? 56.421 103.890 8.069   1.00 39.81  ? 103 LEU A CG    1 
ATOM   6562  C  CD1   . LEU C  3 103 ? 54.925 103.696 7.880   1.00 33.23  ? 103 LEU A CD1   1 
ATOM   6563  C  CD2   . LEU C  3 103 ? 56.818 103.679 9.519   1.00 47.66  ? 103 LEU A CD2   1 
ATOM   6564  N  N     . PHE C  3 104 ? 58.759 104.745 4.852   1.00 44.41  ? 104 PHE A N     1 
ATOM   6565  C  CA    . PHE C  3 104 ? 59.253 106.038 4.397   1.00 45.69  ? 104 PHE A CA    1 
ATOM   6566  C  C     . PHE C  3 104 ? 58.765 106.368 2.994   1.00 46.08  ? 104 PHE A C     1 
ATOM   6567  O  O     . PHE C  3 104 ? 58.654 107.550 2.647   1.00 46.60  ? 104 PHE A O     1 
ATOM   6568  C  CB    . PHE C  3 104 ? 60.781 106.078 4.451   1.00 50.81  ? 104 PHE A CB    1 
ATOM   6569  C  CG    . PHE C  3 104 ? 61.328 106.379 5.818   1.00 50.38  ? 104 PHE A CG    1 
ATOM   6570  C  CD1   . PHE C  3 104 ? 60.990 107.555 6.467   1.00 51.20  ? 104 PHE A CD1   1 
ATOM   6571  C  CD2   . PHE C  3 104 ? 62.185 105.494 6.449   1.00 50.21  ? 104 PHE A CD2   1 
ATOM   6572  C  CE1   . PHE C  3 104 ? 61.488 107.839 7.724   1.00 54.22  ? 104 PHE A CE1   1 
ATOM   6573  C  CE2   . PHE C  3 104 ? 62.688 105.772 7.705   1.00 55.07  ? 104 PHE A CE2   1 
ATOM   6574  C  CZ    . PHE C  3 104 ? 62.339 106.946 8.344   1.00 55.93  ? 104 PHE A CZ    1 
ATOM   6575  N  N     . GLU C  3 105 ? 58.477 105.355 2.174   1.00 44.65  ? 105 GLU A N     1 
ATOM   6576  C  CA    . GLU C  3 105 ? 57.799 105.612 0.908   1.00 52.17  ? 105 GLU A CA    1 
ATOM   6577  C  C     . GLU C  3 105 ? 56.430 106.237 1.155   1.00 52.55  ? 105 GLU A C     1 
ATOM   6578  O  O     . GLU C  3 105 ? 56.134 107.343 0.680   1.00 56.91  ? 105 GLU A O     1 
ATOM   6579  C  CB    . GLU C  3 105 ? 57.659 104.317 0.104   1.00 51.33  ? 105 GLU A CB    1 
ATOM   6580  C  CG    . GLU C  3 105 ? 58.968 103.628 -0.236  1.00 58.72  ? 105 GLU A CG    1 
ATOM   6581  C  CD    . GLU C  3 105 ? 58.757 102.328 -0.991  1.00 68.36  ? 105 GLU A CD    1 
ATOM   6582  O  OE1   . GLU C  3 105 ? 57.721 102.200 -1.678  1.00 74.73  ? 105 GLU A OE1   1 
ATOM   6583  O  OE2   . GLU C  3 105 ? 59.624 101.433 -0.893  1.00 68.86  ? 105 GLU A OE2   1 
ATOM   6584  N  N     . ASP C  3 106 ? 55.583 105.540 1.920   1.00 47.51  ? 106 ASP A N     1 
ATOM   6585  C  CA    . ASP C  3 106 ? 54.248 106.065 2.194   1.00 48.87  ? 106 ASP A CA    1 
ATOM   6586  C  C     . ASP C  3 106 ? 54.306 107.375 2.973   1.00 52.46  ? 106 ASP A C     1 
ATOM   6587  O  O     . ASP C  3 106 ? 53.463 108.258 2.769   1.00 50.25  ? 106 ASP A O     1 
ATOM   6588  C  CB    . ASP C  3 106 ? 53.425 105.023 2.951   1.00 49.56  ? 106 ASP A CB    1 
ATOM   6589  C  CG    . ASP C  3 106 ? 53.222 103.753 2.151   1.00 61.86  ? 106 ASP A CG    1 
ATOM   6590  O  OD1   . ASP C  3 106 ? 53.372 103.803 0.913   1.00 69.94  ? 106 ASP A OD1   1 
ATOM   6591  O  OD2   . ASP C  3 106 ? 52.911 102.706 2.758   1.00 66.54  ? 106 ASP A OD2   1 
ATOM   6592  N  N     . THR C  3 107 ? 55.293 107.520 3.859   1.00 48.00  ? 107 THR A N     1 
ATOM   6593  C  CA    . THR C  3 107 ? 55.460 108.766 4.601   1.00 46.58  ? 107 THR A CA    1 
ATOM   6594  C  C     . THR C  3 107 ? 55.778 109.921 3.661   1.00 46.65  ? 107 THR A C     1 
ATOM   6595  O  O     . THR C  3 107 ? 55.184 111.002 3.760   1.00 40.46  ? 107 THR A O     1 
ATOM   6596  C  CB    . THR C  3 107 ? 56.565 108.609 5.646   1.00 50.23  ? 107 THR A CB    1 
ATOM   6597  O  OG1   . THR C  3 107 ? 56.166 107.650 6.633   1.00 59.06  ? 107 THR A OG1   1 
ATOM   6598  C  CG2   . THR C  3 107 ? 56.856 109.941 6.321   1.00 49.63  ? 107 THR A CG2   1 
ATOM   6599  N  N     . ASN C  3 108 ? 56.725 109.709 2.743   1.00 53.47  ? 108 ASN A N     1 
ATOM   6600  C  CA    . ASN C  3 108 ? 57.061 110.743 1.770   1.00 45.72  ? 108 ASN A CA    1 
ATOM   6601  C  C     . ASN C  3 108 ? 55.850 111.109 0.925   1.00 46.11  ? 108 ASN A C     1 
ATOM   6602  O  O     . ASN C  3 108 ? 55.613 112.292 0.643   1.00 53.53  ? 108 ASN A O     1 
ATOM   6603  C  CB    . ASN C  3 108 ? 58.214 110.271 0.884   1.00 47.92  ? 108 ASN A CB    1 
ATOM   6604  C  CG    . ASN C  3 108 ? 58.896 111.412 0.158   1.00 56.41  ? 108 ASN A CG    1 
ATOM   6605  O  OD1   . ASN C  3 108 ? 58.922 112.545 0.641   1.00 63.82  ? 108 ASN A OD1   1 
ATOM   6606  N  ND2   . ASN C  3 108 ? 59.455 111.119 -1.010  1.00 57.12  ? 108 ASN A ND2   1 
ATOM   6607  N  N     . LEU C  3 109 ? 55.060 110.108 0.524   1.00 40.79  ? 109 LEU A N     1 
ATOM   6608  C  CA    . LEU C  3 109 ? 53.822 110.397 -0.193  1.00 43.02  ? 109 LEU A CA    1 
ATOM   6609  C  C     . LEU C  3 109 ? 52.885 111.258 0.646   1.00 49.62  ? 109 LEU A C     1 
ATOM   6610  O  O     . LEU C  3 109 ? 52.246 112.181 0.125   1.00 48.98  ? 109 LEU A O     1 
ATOM   6611  C  CB    . LEU C  3 109 ? 53.134 109.095 -0.595  1.00 48.03  ? 109 LEU A CB    1 
ATOM   6612  C  CG    . LEU C  3 109 ? 53.866 108.289 -1.665  1.00 52.56  ? 109 LEU A CG    1 
ATOM   6613  C  CD1   . LEU C  3 109 ? 53.286 106.893 -1.758  1.00 49.87  ? 109 LEU A CD1   1 
ATOM   6614  C  CD2   . LEU C  3 109 ? 53.786 108.999 -3.007  1.00 48.76  ? 109 LEU A CD2   1 
ATOM   6615  N  N     . ALA C  3 110 ? 52.795 110.977 1.948   1.00 51.61  ? 110 ALA A N     1 
ATOM   6616  C  CA    . ALA C  3 110 ? 51.948 111.786 2.819   1.00 48.08  ? 110 ALA A CA    1 
ATOM   6617  C  C     . ALA C  3 110 ? 52.444 113.226 2.889   1.00 49.21  ? 110 ALA A C     1 
ATOM   6618  O  O     . ALA C  3 110 ? 51.644 114.168 2.848   1.00 51.01  ? 110 ALA A O     1 
ATOM   6619  C  CB    . ALA C  3 110 ? 51.887 111.168 4.215   1.00 47.28  ? 110 ALA A CB    1 
ATOM   6620  N  N     . ALA C  3 111 ? 53.762 113.416 2.992   1.00 40.28  ? 111 ALA A N     1 
ATOM   6621  C  CA    . ALA C  3 111 ? 54.312 114.768 3.007   1.00 43.24  ? 111 ALA A CA    1 
ATOM   6622  C  C     . ALA C  3 111 ? 54.013 115.500 1.705   1.00 56.79  ? 111 ALA A C     1 
ATOM   6623  O  O     . ALA C  3 111 ? 53.719 116.701 1.711   1.00 60.30  ? 111 ALA A O     1 
ATOM   6624  C  CB    . ALA C  3 111 ? 55.818 114.720 3.260   1.00 45.10  ? 111 ALA A CB    1 
ATOM   6625  N  N     . ILE C  3 112 ? 54.081 114.790 0.576   1.00 57.78  ? 112 ILE A N     1 
ATOM   6626  C  CA    . ILE C  3 112 ? 53.808 115.425 -0.709  1.00 54.06  ? 112 ILE A CA    1 
ATOM   6627  C  C     . ILE C  3 112 ? 52.322 115.736 -0.858  1.00 56.85  ? 112 ILE A C     1 
ATOM   6628  O  O     . ILE C  3 112 ? 51.947 116.695 -1.547  1.00 53.87  ? 112 ILE A O     1 
ATOM   6629  C  CB    . ILE C  3 112 ? 54.336 114.534 -1.850  1.00 47.99  ? 112 ILE A CB    1 
ATOM   6630  C  CG1   . ILE C  3 112 ? 55.857 114.404 -1.750  1.00 43.66  ? 112 ILE A CG1   1 
ATOM   6631  C  CG2   . ILE C  3 112 ? 53.949 115.093 -3.211  1.00 43.64  ? 112 ILE A CG2   1 
ATOM   6632  C  CD1   . ILE C  3 112 ? 56.470 113.532 -2.820  1.00 46.57  ? 112 ILE A CD1   1 
ATOM   6633  N  N     . HIS C  3 113 ? 51.454 114.955 -0.208  1.00 50.84  ? 113 HIS A N     1 
ATOM   6634  C  CA    . HIS C  3 113 ? 50.022 115.232 -0.274  1.00 44.14  ? 113 HIS A CA    1 
ATOM   6635  C  C     . HIS C  3 113 ? 49.695 116.590 0.334   1.00 48.82  ? 113 HIS A C     1 
ATOM   6636  O  O     . HIS C  3 113 ? 48.792 117.290 -0.141  1.00 48.44  ? 113 HIS A O     1 
ATOM   6637  C  CB    . HIS C  3 113 ? 49.238 114.128 0.433   1.00 41.95  ? 113 HIS A CB    1 
ATOM   6638  C  CG    . HIS C  3 113 ? 47.753 114.272 0.316   1.00 51.51  ? 113 HIS A CG    1 
ATOM   6639  N  ND1   . HIS C  3 113 ? 47.079 114.083 -0.872  1.00 53.17  ? 113 HIS A ND1   1 
ATOM   6640  C  CD2   . HIS C  3 113 ? 46.810 114.582 1.238   1.00 52.53  ? 113 HIS A CD2   1 
ATOM   6641  C  CE1   . HIS C  3 113 ? 45.786 114.272 -0.677  1.00 49.54  ? 113 HIS A CE1   1 
ATOM   6642  N  NE2   . HIS C  3 113 ? 45.596 114.576 0.594   1.00 47.55  ? 113 HIS A NE2   1 
ATOM   6643  N  N     . ALA C  3 114 ? 50.419 116.979 1.385   1.00 53.14  ? 114 ALA A N     1 
ATOM   6644  C  CA    . ALA C  3 114 ? 50.246 118.278 2.023   1.00 52.04  ? 114 ALA A CA    1 
ATOM   6645  C  C     . ALA C  3 114 ? 51.127 119.355 1.404   1.00 57.68  ? 114 ALA A C     1 
ATOM   6646  O  O     . ALA C  3 114 ? 51.466 120.336 2.080   1.00 56.09  ? 114 ALA A O     1 
ATOM   6647  C  CB    . ALA C  3 114 ? 50.511 118.166 3.525   1.00 48.83  ? 114 ALA A CB    1 
ATOM   6648  N  N     . LYS C  3 115 ? 51.509 119.189 0.135   1.00 56.92  ? 115 LYS A N     1 
ATOM   6649  C  CA    . LYS C  3 115 ? 52.294 120.181 -0.603  1.00 58.29  ? 115 LYS A CA    1 
ATOM   6650  C  C     . LYS C  3 115 ? 53.614 120.487 0.100   1.00 56.17  ? 115 LYS A C     1 
ATOM   6651  O  O     . LYS C  3 115 ? 54.051 121.638 0.166   1.00 65.92  ? 115 LYS A O     1 
ATOM   6652  C  CB    . LYS C  3 115 ? 51.488 121.463 -0.829  1.00 66.20  ? 115 LYS A CB    1 
ATOM   6653  C  CG    . LYS C  3 115 ? 50.070 121.225 -1.327  1.00 69.60  ? 115 LYS A CG    1 
ATOM   6654  C  CD    . LYS C  3 115 ? 49.833 121.868 -2.685  1.00 76.39  ? 115 LYS A CD    1 
ATOM   6655  C  CE    . LYS C  3 115 ? 48.392 121.683 -3.131  1.00 79.16  ? 115 LYS A CE    1 
ATOM   6656  N  NZ    . LYS C  3 115 ? 48.137 122.304 -4.459  1.00 81.23  ? 115 LYS A NZ    1 
ATOM   6657  N  N     . ARG C  3 116 ? 54.255 119.450 0.633   1.00 55.70  ? 116 ARG A N     1 
ATOM   6658  C  CA    . ARG C  3 116 ? 55.523 119.601 1.329   1.00 55.74  ? 116 ARG A CA    1 
ATOM   6659  C  C     . ARG C  3 116 ? 56.547 118.620 0.774   1.00 55.96  ? 116 ARG A C     1 
ATOM   6660  O  O     . ARG C  3 116 ? 56.214 117.660 0.077   1.00 59.96  ? 116 ARG A O     1 
ATOM   6661  C  CB    . ARG C  3 116 ? 55.377 119.385 2.841   1.00 58.46  ? 116 ARG A CB    1 
ATOM   6662  C  CG    . ARG C  3 116 ? 54.499 120.404 3.548   1.00 64.71  ? 116 ARG A CG    1 
ATOM   6663  C  CD    . ARG C  3 116 ? 54.747 120.370 5.049   1.00 64.30  ? 116 ARG A CD    1 
ATOM   6664  N  NE    . ARG C  3 116 ? 54.991 119.010 5.521   1.00 69.16  ? 116 ARG A NE    1 
ATOM   6665  C  CZ    . ARG C  3 116 ? 54.039 118.177 5.925   1.00 68.37  ? 116 ARG A CZ    1 
ATOM   6666  N  NH1   . ARG C  3 116 ? 52.771 118.563 5.923   1.00 72.51  ? 116 ARG A NH1   1 
ATOM   6667  N  NH2   . ARG C  3 116 ? 54.357 116.957 6.337   1.00 61.24  ? 116 ARG A NH2   1 
ATOM   6668  N  N     . VAL C  3 117 ? 57.807 118.889 1.103   1.00 58.98  ? 117 VAL A N     1 
ATOM   6669  C  CA    . VAL C  3 117 ? 58.914 118.020 0.731   1.00 60.14  ? 117 VAL A CA    1 
ATOM   6670  C  C     . VAL C  3 117 ? 59.561 117.356 1.943   1.00 62.45  ? 117 VAL A C     1 
ATOM   6671  O  O     . VAL C  3 117 ? 60.126 116.260 1.800   1.00 70.77  ? 117 VAL A O     1 
ATOM   6672  C  CB    . VAL C  3 117 ? 59.966 118.801 -0.089  1.00 70.74  ? 117 VAL A CB    1 
ATOM   6673  C  CG1   . VAL C  3 117 ? 61.154 117.924 -0.471  1.00 79.37  ? 117 VAL A CG1   1 
ATOM   6674  C  CG2   . VAL C  3 117 ? 59.323 119.395 -1.333  1.00 74.17  ? 117 VAL A CG2   1 
ATOM   6675  N  N     . THR C  3 118 ? 59.467 117.954 3.126   1.00 61.01  ? 118 THR A N     1 
ATOM   6676  C  CA    . THR C  3 118 ? 60.062 117.400 4.337   1.00 63.02  ? 118 THR A CA    1 
ATOM   6677  C  C     . THR C  3 118 ? 59.074 116.454 5.009   1.00 66.28  ? 118 THR A C     1 
ATOM   6678  O  O     . THR C  3 118 ? 57.947 116.848 5.326   1.00 71.21  ? 118 THR A O     1 
ATOM   6679  C  CB    . THR C  3 118 ? 60.455 118.521 5.299   1.00 66.54  ? 118 THR A CB    1 
ATOM   6680  O  OG1   . THR C  3 118 ? 61.226 119.504 4.598   1.00 67.00  ? 118 THR A OG1   1 
ATOM   6681  C  CG2   . THR C  3 118 ? 61.270 117.972 6.457   1.00 70.83  ? 118 THR A CG2   1 
ATOM   6682  N  N     . ILE C  3 119 ? 59.495 115.206 5.228   1.00 63.50  ? 119 ILE A N     1 
ATOM   6683  C  CA    . ILE C  3 119 ? 58.682 114.286 6.013   1.00 62.74  ? 119 ILE A CA    1 
ATOM   6684  C  C     . ILE C  3 119 ? 58.681 114.739 7.466   1.00 63.47  ? 119 ILE A C     1 
ATOM   6685  O  O     . ILE C  3 119 ? 59.702 115.193 7.999   1.00 63.57  ? 119 ILE A O     1 
ATOM   6686  C  CB    . ILE C  3 119 ? 59.193 112.842 5.880   1.00 56.75  ? 119 ILE A CB    1 
ATOM   6687  C  CG1   . ILE C  3 119 ? 60.654 112.742 6.327   1.00 55.47  ? 119 ILE A CG1   1 
ATOM   6688  C  CG2   . ILE C  3 119 ? 59.022 112.345 4.455   1.00 54.57  ? 119 ILE A CG2   1 
ATOM   6689  C  CD1   . ILE C  3 119 ? 61.127 111.323 6.555   1.00 53.99  ? 119 ILE A CD1   1 
ATOM   6690  N  N     . MET C  3 120 ? 57.528 114.637 8.109   1.00 57.81  ? 120 MET A N     1 
ATOM   6691  C  CA    . MET C  3 120 ? 57.345 115.062 9.486   1.00 58.12  ? 120 MET A CA    1 
ATOM   6692  C  C     . MET C  3 120 ? 56.615 113.967 10.246  1.00 53.21  ? 120 MET A C     1 
ATOM   6693  O  O     . MET C  3 120 ? 55.940 113.128 9.641   1.00 56.49  ? 120 MET A O     1 
ATOM   6694  C  CB    . MET C  3 120 ? 56.564 116.384 9.554   1.00 57.53  ? 120 MET A CB    1 
ATOM   6695  C  CG    . MET C  3 120 ? 57.184 117.487 8.702   1.00 61.98  ? 120 MET A CG    1 
ATOM   6696  S  SD    . MET C  3 120 ? 56.840 119.160 9.272   1.00 71.63  ? 120 MET A SD    1 
ATOM   6697  C  CE    . MET C  3 120 ? 55.078 119.255 9.004   1.00 63.46  ? 120 MET A CE    1 
ATOM   6698  N  N     . PRO C  3 121 ? 56.759 113.927 11.577  1.00 48.42  ? 121 PRO A N     1 
ATOM   6699  C  CA    . PRO C  3 121 ? 56.098 112.867 12.362  1.00 52.20  ? 121 PRO A CA    1 
ATOM   6700  C  C     . PRO C  3 121 ? 54.628 112.657 12.031  1.00 57.31  ? 121 PRO A C     1 
ATOM   6701  O  O     . PRO C  3 121 ? 54.159 111.512 12.050  1.00 55.90  ? 121 PRO A O     1 
ATOM   6702  C  CB    . PRO C  3 121 ? 56.291 113.350 13.804  1.00 59.42  ? 121 PRO A CB    1 
ATOM   6703  C  CG    . PRO C  3 121 ? 57.593 114.070 13.766  1.00 63.54  ? 121 PRO A CG    1 
ATOM   6704  C  CD    . PRO C  3 121 ? 57.679 114.729 12.404  1.00 56.50  ? 121 PRO A CD    1 
ATOM   6705  N  N     . LYS C  3 122 ? 53.888 113.722 11.711  1.00 56.53  ? 122 LYS A N     1 
ATOM   6706  C  CA    . LYS C  3 122 ? 52.481 113.557 11.368  1.00 57.04  ? 122 LYS A CA    1 
ATOM   6707  C  C     . LYS C  3 122 ? 52.287 112.819 10.049  1.00 50.73  ? 122 LYS A C     1 
ATOM   6708  O  O     . LYS C  3 122 ? 51.214 112.248 9.827   1.00 51.99  ? 122 LYS A O     1 
ATOM   6709  C  CB    . LYS C  3 122 ? 51.782 114.918 11.325  1.00 66.78  ? 122 LYS A CB    1 
ATOM   6710  C  CG    . LYS C  3 122 ? 52.228 115.838 10.206  1.00 76.92  ? 122 LYS A CG    1 
ATOM   6711  C  CD    . LYS C  3 122 ? 51.613 117.222 10.378  1.00 92.36  ? 122 LYS A CD    1 
ATOM   6712  C  CE    . LYS C  3 122 ? 51.766 118.063 9.124   1.00 98.13  ? 122 LYS A CE    1 
ATOM   6713  N  NZ    . LYS C  3 122 ? 51.355 119.476 9.358   1.00 104.69 ? 122 LYS A NZ    1 
ATOM   6714  N  N     . ASP C  3 123 ? 53.299 112.807 9.177   1.00 48.54  ? 123 ASP A N     1 
ATOM   6715  C  CA    . ASP C  3 123 ? 53.214 112.004 7.961   1.00 49.33  ? 123 ASP A CA    1 
ATOM   6716  C  C     . ASP C  3 123 ? 53.347 110.521 8.280   1.00 46.11  ? 123 ASP A C     1 
ATOM   6717  O  O     . ASP C  3 123 ? 52.573 109.695 7.779   1.00 47.35  ? 123 ASP A O     1 
ATOM   6718  C  CB    . ASP C  3 123 ? 54.288 112.438 6.964   1.00 50.08  ? 123 ASP A CB    1 
ATOM   6719  C  CG    . ASP C  3 123 ? 54.169 113.896 6.578   1.00 53.48  ? 123 ASP A CG    1 
ATOM   6720  O  OD1   . ASP C  3 123 ? 53.026 114.388 6.465   1.00 52.81  ? 123 ASP A OD1   1 
ATOM   6721  O  OD2   . ASP C  3 123 ? 55.217 114.551 6.394   1.00 53.86  ? 123 ASP A OD2   1 
ATOM   6722  N  N     . ILE C  3 124 ? 54.332 110.164 9.110   1.00 45.17  ? 124 ILE A N     1 
ATOM   6723  C  CA    . ILE C  3 124 ? 54.454 108.785 9.576   1.00 45.09  ? 124 ILE A CA    1 
ATOM   6724  C  C     . ILE C  3 124 ? 53.174 108.354 10.278  1.00 49.44  ? 124 ILE A C     1 
ATOM   6725  O  O     . ILE C  3 124 ? 52.672 107.244 10.063  1.00 46.66  ? 124 ILE A O     1 
ATOM   6726  C  CB    . ILE C  3 124 ? 55.680 108.632 10.496  1.00 42.40  ? 124 ILE A CB    1 
ATOM   6727  C  CG1   . ILE C  3 124 ? 56.974 108.922 9.734   1.00 49.63  ? 124 ILE A CG1   1 
ATOM   6728  C  CG2   . ILE C  3 124 ? 55.725 107.239 11.103  1.00 36.41  ? 124 ILE A CG2   1 
ATOM   6729  C  CD1   . ILE C  3 124 ? 58.232 108.639 10.531  1.00 53.01  ? 124 ILE A CD1   1 
ATOM   6730  N  N     . GLN C  3 125 ? 52.622 109.233 11.120  1.00 45.89  ? 125 GLN A N     1 
ATOM   6731  C  CA    . GLN C  3 125 ? 51.391 108.910 11.834  1.00 51.74  ? 125 GLN A CA    1 
ATOM   6732  C  C     . GLN C  3 125 ? 50.230 108.697 10.872  1.00 49.30  ? 125 GLN A C     1 
ATOM   6733  O  O     . GLN C  3 125 ? 49.447 107.754 11.035  1.00 58.30  ? 125 GLN A O     1 
ATOM   6734  C  CB    . GLN C  3 125 ? 51.057 110.018 12.831  1.00 61.12  ? 125 GLN A CB    1 
ATOM   6735  C  CG    . GLN C  3 125 ? 52.059 110.169 13.957  1.00 60.34  ? 125 GLN A CG    1 
ATOM   6736  C  CD    . GLN C  3 125 ? 51.885 111.473 14.706  1.00 67.16  ? 125 GLN A CD    1 
ATOM   6737  O  OE1   . GLN C  3 125 ? 50.852 112.134 14.591  1.00 69.69  ? 125 GLN A OE1   1 
ATOM   6738  N  NE2   . GLN C  3 125 ? 52.900 111.856 15.474  1.00 72.30  ? 125 GLN A NE2   1 
ATOM   6739  N  N     . LEU C  3 126 ? 50.097 109.567 9.867   1.00 45.76  ? 126 LEU A N     1 
ATOM   6740  C  CA    . LEU C  3 126 ? 49.028 109.393 8.889   1.00 43.80  ? 126 LEU A CA    1 
ATOM   6741  C  C     . LEU C  3 126 ? 49.178 108.075 8.142   1.00 44.28  ? 126 LEU A C     1 
ATOM   6742  O  O     . LEU C  3 126 ? 48.200 107.341 7.963   1.00 46.40  ? 126 LEU A O     1 
ATOM   6743  C  CB    . LEU C  3 126 ? 49.009 110.562 7.905   1.00 40.63  ? 126 LEU A CB    1 
ATOM   6744  C  CG    . LEU C  3 126 ? 47.906 110.476 6.846   1.00 45.79  ? 126 LEU A CG    1 
ATOM   6745  C  CD1   . LEU C  3 126 ? 46.544 110.816 7.440   1.00 43.85  ? 126 LEU A CD1   1 
ATOM   6746  C  CD2   . LEU C  3 126 ? 48.216 111.369 5.654   1.00 41.35  ? 126 LEU A CD2   1 
ATOM   6747  N  N     . ALA C  3 127 ? 50.399 107.754 7.708   1.00 42.36  ? 127 ALA A N     1 
ATOM   6748  C  CA    . ALA C  3 127 ? 50.625 106.502 6.992   1.00 33.68  ? 127 ALA A CA    1 
ATOM   6749  C  C     . ALA C  3 127 ? 50.285 105.299 7.864   1.00 43.80  ? 127 ALA A C     1 
ATOM   6750  O  O     . ALA C  3 127 ? 49.619 104.360 7.414   1.00 44.00  ? 127 ALA A O     1 
ATOM   6751  C  CB    . ALA C  3 127 ? 52.074 106.429 6.510   1.00 31.46  ? 127 ALA A CB    1 
ATOM   6752  N  N     . ARG C  3 128 ? 50.729 105.315 9.124   1.00 43.97  ? 128 ARG A N     1 
ATOM   6753  C  CA    . ARG C  3 128 ? 50.459 104.189 10.014  1.00 45.76  ? 128 ARG A CA    1 
ATOM   6754  C  C     . ARG C  3 128 ? 48.978 104.072 10.350  1.00 40.82  ? 128 ARG A C     1 
ATOM   6755  O  O     . ARG C  3 128 ? 48.482 102.962 10.576  1.00 42.01  ? 128 ARG A O     1 
ATOM   6756  C  CB    . ARG C  3 128 ? 51.279 104.319 11.296  1.00 39.72  ? 128 ARG A CB    1 
ATOM   6757  C  CG    . ARG C  3 128 ? 52.776 104.149 11.106  1.00 46.71  ? 128 ARG A CG    1 
ATOM   6758  C  CD    . ARG C  3 128 ? 53.325 103.215 12.167  1.00 57.32  ? 128 ARG A CD    1 
ATOM   6759  N  NE    . ARG C  3 128 ? 52.676 103.443 13.454  1.00 61.59  ? 128 ARG A NE    1 
ATOM   6760  C  CZ    . ARG C  3 128 ? 52.680 102.572 14.457  1.00 64.68  ? 128 ARG A CZ    1 
ATOM   6761  N  NH1   . ARG C  3 128 ? 53.297 101.407 14.321  1.00 67.35  ? 128 ARG A NH1   1 
ATOM   6762  N  NH2   . ARG C  3 128 ? 52.060 102.862 15.591  1.00 74.09  ? 128 ARG A NH2   1 
ATOM   6763  N  N     . ARG C  3 129 ? 48.259 105.195 10.393  1.00 42.19  ? 129 ARG A N     1 
ATOM   6764  C  CA    . ARG C  3 129 ? 46.828 105.144 10.669  1.00 45.18  ? 129 ARG A CA    1 
ATOM   6765  C  C     . ARG C  3 129 ? 46.053 104.619 9.465   1.00 52.26  ? 129 ARG A C     1 
ATOM   6766  O  O     . ARG C  3 129 ? 45.150 103.788 9.619   1.00 46.09  ? 129 ARG A O     1 
ATOM   6767  C  CB    . ARG C  3 129 ? 46.328 106.529 11.084  1.00 47.47  ? 129 ARG A CB    1 
ATOM   6768  C  CG    . ARG C  3 129 ? 44.842 106.763 10.877  1.00 54.18  ? 129 ARG A CG    1 
ATOM   6769  C  CD    . ARG C  3 129 ? 43.975 105.862 11.743  1.00 70.72  ? 129 ARG A CD    1 
ATOM   6770  N  NE    . ARG C  3 129 ? 42.575 105.918 11.329  1.00 82.41  ? 129 ARG A NE    1 
ATOM   6771  C  CZ    . ARG C  3 129 ? 42.076 105.250 10.293  1.00 87.81  ? 129 ARG A CZ    1 
ATOM   6772  N  NH1   . ARG C  3 129 ? 42.863 104.474 9.559   1.00 87.28  ? 129 ARG A NH1   1 
ATOM   6773  N  NH2   . ARG C  3 129 ? 40.790 105.361 9.987   1.00 90.25  ? 129 ARG A NH2   1 
ATOM   6774  N  N     . ILE C  3 130 ? 46.390 105.087 8.260   1.00 56.11  ? 130 ILE A N     1 
ATOM   6775  C  CA    . ILE C  3 130 ? 45.729 104.577 7.061   1.00 51.04  ? 130 ILE A CA    1 
ATOM   6776  C  C     . ILE C  3 130 ? 46.023 103.092 6.884   1.00 41.59  ? 130 ILE A C     1 
ATOM   6777  O  O     . ILE C  3 130 ? 45.130 102.303 6.550   1.00 40.97  ? 130 ILE A O     1 
ATOM   6778  C  CB    . ILE C  3 130 ? 46.158 105.385 5.821   1.00 43.49  ? 130 ILE A CB    1 
ATOM   6779  C  CG1   . ILE C  3 130 ? 45.869 106.875 6.008   1.00 42.06  ? 130 ILE A CG1   1 
ATOM   6780  C  CG2   . ILE C  3 130 ? 45.450 104.863 4.582   1.00 38.09  ? 130 ILE A CG2   1 
ATOM   6781  C  CD1   . ILE C  3 130 ? 44.408 107.213 6.077   1.00 51.90  ? 130 ILE A CD1   1 
ATOM   6782  N  N     . ARG C  3 131 ? 47.278 102.690 7.110   1.00 37.89  ? 131 ARG A N     1 
ATOM   6783  C  CA    . ARG C  3 131 ? 47.662 101.288 6.968   1.00 37.31  ? 131 ARG A CA    1 
ATOM   6784  C  C     . ARG C  3 131 ? 46.846 100.376 7.872   1.00 46.03  ? 131 ARG A C     1 
ATOM   6785  O  O     . ARG C  3 131 ? 46.655 99.197  7.554   1.00 51.26  ? 131 ARG A O     1 
ATOM   6786  C  CB    . ARG C  3 131 ? 49.145 101.109 7.290   1.00 35.67  ? 131 ARG A CB    1 
ATOM   6787  C  CG    . ARG C  3 131 ? 50.121 101.458 6.188   1.00 33.77  ? 131 ARG A CG    1 
ATOM   6788  C  CD    . ARG C  3 131 ? 51.525 101.054 6.627   1.00 46.09  ? 131 ARG A CD    1 
ATOM   6789  N  NE    . ARG C  3 131 ? 52.541 101.264 5.602   1.00 49.08  ? 131 ARG A NE    1 
ATOM   6790  C  CZ    . ARG C  3 131 ? 53.774 100.774 5.677   1.00 55.29  ? 131 ARG A CZ    1 
ATOM   6791  N  NH1   . ARG C  3 131 ? 54.131 100.045 6.725   1.00 54.82  ? 131 ARG A NH1   1 
ATOM   6792  N  NH2   . ARG C  3 131 ? 54.646 101.006 4.708   1.00 59.46  ? 131 ARG A NH2   1 
ATOM   6793  N  N     . GLY C  3 132 ? 46.368 100.893 8.998   1.00 49.26  ? 132 GLY A N     1 
ATOM   6794  C  CA    . GLY C  3 132 ? 45.732 100.061 9.996   1.00 55.38  ? 132 GLY A CA    1 
ATOM   6795  C  C     . GLY C  3 132 ? 46.654 99.579  11.089  1.00 64.82  ? 132 GLY A C     1 
ATOM   6796  O  O     . GLY C  3 132 ? 46.342 98.579  11.746  1.00 81.04  ? 132 GLY A O     1 
ATOM   6797  N  N     . GLU C  3 133 ? 47.789 100.247 11.297  1.00 59.83  ? 133 GLU A N     1 
ATOM   6798  C  CA    . GLU C  3 133 ? 48.708 99.900  12.374  1.00 58.41  ? 133 GLU A CA    1 
ATOM   6799  C  C     . GLU C  3 133 ? 48.412 100.696 13.640  1.00 68.76  ? 133 GLU A C     1 
ATOM   6800  O  O     . GLU C  3 133 ? 48.308 100.120 14.727  1.00 75.21  ? 133 GLU A O     1 
ATOM   6801  C  CB    . GLU C  3 133 ? 50.156 100.131 11.929  1.00 51.26  ? 133 GLU A CB    1 
ATOM   6802  C  CG    . GLU C  3 133 ? 50.618 99.213  10.809  1.00 54.00  ? 133 GLU A CG    1 
ATOM   6803  C  CD    . GLU C  3 133 ? 52.044 99.500  10.370  1.00 58.99  ? 133 GLU A CD    1 
ATOM   6804  O  OE1   . GLU C  3 133 ? 52.764 100.209 11.108  1.00 62.22  ? 133 GLU A OE1   1 
ATOM   6805  O  OE2   . GLU C  3 133 ? 52.442 99.022  9.285   1.00 56.17  ? 133 GLU A OE2   1 
ATOM   6806  N  N     . ARG C  3 134 ? 48.272 102.012 13.514  1.00 66.51  ? 134 ARG A N     1 
ATOM   6807  C  CA    . ARG C  3 134 ? 47.936 102.857 14.654  1.00 72.33  ? 134 ARG A CA    1 
ATOM   6808  C  C     . ARG C  3 134 ? 46.578 102.481 15.236  1.00 82.09  ? 134 ARG A C     1 
ATOM   6809  O  O     . ARG C  3 134 ? 45.581 102.412 14.517  1.00 82.68  ? 134 ARG A O     1 
ATOM   6810  C  CB    . ARG C  3 134 ? 47.945 104.332 14.249  1.00 69.99  ? 134 ARG A CB    1 
ATOM   6811  C  CG    . ARG C  3 134 ? 48.009 105.297 15.422  1.00 78.04  ? 134 ARG A CG    1 
ATOM   6812  C  CD    . ARG C  3 134 ? 46.843 105.088 16.374  1.00 89.55  ? 134 ARG A CD    1 
ATOM   6813  N  NE    . ARG C  3 134 ? 45.595 105.624 15.838  1.00 88.42  ? 134 ARG A NE    1 
ATOM   6814  C  CZ    . ARG C  3 134 ? 44.427 104.994 15.891  1.00 88.64  ? 134 ARG A CZ    1 
ATOM   6815  N  NH1   . ARG C  3 134 ? 44.342 103.798 16.458  1.00 87.52  ? 134 ARG A NH1   1 
ATOM   6816  N  NH2   . ARG C  3 134 ? 43.342 105.558 15.378  1.00 89.28  ? 134 ARG A NH2   1 
ATOM   6817  N  N     . ASN D  4 26  ? 70.638 101.703 23.372  1.00 70.37  ? 25  ASN B N     1 
ATOM   6818  C  CA    . ASN D  4 26  ? 70.249 100.591 22.511  1.00 74.67  ? 25  ASN B CA    1 
ATOM   6819  C  C     . ASN D  4 26  ? 69.361 101.054 21.363  1.00 78.66  ? 25  ASN B C     1 
ATOM   6820  O  O     . ASN D  4 26  ? 69.750 100.965 20.200  1.00 79.24  ? 25  ASN B O     1 
ATOM   6821  C  CB    . ASN D  4 26  ? 69.537 99.508  23.322  1.00 76.60  ? 25  ASN B CB    1 
ATOM   6822  C  CG    . ASN D  4 26  ? 70.503 98.626  24.084  1.00 81.49  ? 25  ASN B CG    1 
ATOM   6823  O  OD1   . ASN D  4 26  ? 71.674 98.512  23.722  1.00 83.48  ? 25  ASN B OD1   1 
ATOM   6824  N  ND2   . ASN D  4 26  ? 70.017 97.989  25.141  1.00 84.10  ? 25  ASN B ND2   1 
ATOM   6825  N  N     . ILE D  4 27  ? 68.160 101.537 21.691  1.00 78.44  ? 26  ILE B N     1 
ATOM   6826  C  CA    . ILE D  4 27  ? 67.301 102.104 20.657  1.00 74.71  ? 26  ILE B CA    1 
ATOM   6827  C  C     . ILE D  4 27  ? 67.902 103.394 20.125  1.00 77.21  ? 26  ILE B C     1 
ATOM   6828  O  O     . ILE D  4 27  ? 67.708 103.747 18.954  1.00 82.30  ? 26  ILE B O     1 
ATOM   6829  C  CB    . ILE D  4 27  ? 65.871 102.309 21.196  1.00 72.57  ? 26  ILE B CB    1 
ATOM   6830  C  CG1   . ILE D  4 27  ? 64.931 102.759 20.075  1.00 73.87  ? 26  ILE B CG1   1 
ATOM   6831  C  CG2   . ILE D  4 27  ? 65.865 103.309 22.344  1.00 74.66  ? 26  ILE B CG2   1 
ATOM   6832  C  CD1   . ILE D  4 27  ? 64.867 101.796 18.905  1.00 73.47  ? 26  ILE B CD1   1 
ATOM   6833  N  N     . GLN D  4 28  ? 68.653 104.111 20.960  1.00 76.42  ? 27  GLN B N     1 
ATOM   6834  C  CA    . GLN D  4 28  ? 69.446 105.240 20.484  1.00 78.52  ? 27  GLN B CA    1 
ATOM   6835  C  C     . GLN D  4 28  ? 70.683 104.798 19.717  1.00 83.38  ? 27  GLN B C     1 
ATOM   6836  O  O     . GLN D  4 28  ? 71.320 105.636 19.066  1.00 77.04  ? 27  GLN B O     1 
ATOM   6837  C  CB    . GLN D  4 28  ? 69.851 106.127 21.662  1.00 78.45  ? 27  GLN B CB    1 
ATOM   6838  C  CG    . GLN D  4 28  ? 68.671 106.760 22.385  1.00 81.38  ? 27  GLN B CG    1 
ATOM   6839  C  CD    . GLN D  4 28  ? 67.888 107.712 21.499  1.00 87.27  ? 27  GLN B CD    1 
ATOM   6840  O  OE1   . GLN D  4 28  ? 68.452 108.367 20.622  1.00 88.51  ? 27  GLN B OE1   1 
ATOM   6841  N  NE2   . GLN D  4 28  ? 66.579 107.789 21.721  1.00 89.94  ? 27  GLN B NE2   1 
ATOM   6842  N  N     . GLY D  4 29  ? 71.043 103.512 19.775  1.00 86.99  ? 28  GLY B N     1 
ATOM   6843  C  CA    . GLY D  4 29  ? 72.164 103.033 18.987  1.00 87.92  ? 28  GLY B CA    1 
ATOM   6844  C  C     . GLY D  4 29  ? 71.856 103.000 17.505  1.00 82.34  ? 28  GLY B C     1 
ATOM   6845  O  O     . GLY D  4 29  ? 72.764 103.029 16.670  1.00 86.69  ? 28  GLY B O     1 
ATOM   6846  N  N     . ILE D  4 30  ? 70.574 102.926 17.153  1.00 84.33  ? 29  ILE B N     1 
ATOM   6847  C  CA    . ILE D  4 30  ? 70.148 103.097 15.768  1.00 71.55  ? 29  ILE B CA    1 
ATOM   6848  C  C     . ILE D  4 30  ? 70.195 104.597 15.497  1.00 69.64  ? 29  ILE B C     1 
ATOM   6849  O  O     . ILE D  4 30  ? 69.315 105.345 15.927  1.00 66.81  ? 29  ILE B O     1 
ATOM   6850  C  CB    . ILE D  4 30  ? 68.759 102.513 15.504  1.00 67.69  ? 29  ILE B CB    1 
ATOM   6851  C  CG1   . ILE D  4 30  ? 68.716 101.025 15.871  1.00 72.58  ? 29  ILE B CG1   1 
ATOM   6852  C  CG2   . ILE D  4 30  ? 68.390 102.701 14.048  1.00 67.53  ? 29  ILE B CG2   1 
ATOM   6853  C  CD1   . ILE D  4 30  ? 68.279 100.757 17.293  1.00 77.02  ? 29  ILE B CD1   1 
ATOM   6854  N  N     . THR D  4 31  ? 71.227 105.039 14.789  1.00 67.91  ? 30  THR B N     1 
ATOM   6855  C  CA    . THR D  4 31  ? 71.590 106.445 14.775  1.00 76.64  ? 30  THR B CA    1 
ATOM   6856  C  C     . THR D  4 31  ? 70.778 107.232 13.750  1.00 76.18  ? 30  THR B C     1 
ATOM   6857  O  O     . THR D  4 31  ? 70.125 106.675 12.864  1.00 76.01  ? 30  THR B O     1 
ATOM   6858  C  CB    . THR D  4 31  ? 73.079 106.603 14.476  1.00 87.12  ? 30  THR B CB    1 
ATOM   6859  O  OG1   . THR D  4 31  ? 73.346 106.164 13.139  1.00 94.92  ? 30  THR B OG1   1 
ATOM   6860  C  CG2   . THR D  4 31  ? 73.899 105.774 15.446  1.00 86.26  ? 30  THR B CG2   1 
ATOM   6861  N  N     . LYS D  4 32  ? 70.831 108.557 13.894  1.00 78.64  ? 31  LYS B N     1 
ATOM   6862  C  CA    . LYS D  4 32  ? 70.220 109.440 12.905  1.00 74.17  ? 31  LYS B CA    1 
ATOM   6863  C  C     . LYS D  4 32  ? 70.785 109.252 11.501  1.00 75.07  ? 31  LYS B C     1 
ATOM   6864  O  O     . LYS D  4 32  ? 69.991 109.278 10.544  1.00 74.33  ? 31  LYS B O     1 
ATOM   6865  C  CB    . LYS D  4 32  ? 70.355 110.902 13.359  1.00 72.23  ? 31  LYS B CB    1 
ATOM   6866  C  CG    . LYS D  4 32  ? 70.539 111.899 12.222  1.00 74.36  ? 31  LYS B CG    1 
ATOM   6867  C  CD    . LYS D  4 32  ? 70.509 113.335 12.715  1.00 76.56  ? 31  LYS B CD    1 
ATOM   6868  C  CE    . LYS D  4 32  ? 70.803 114.305 11.579  1.00 74.45  ? 31  LYS B CE    1 
ATOM   6869  N  NZ    . LYS D  4 32  ? 70.603 115.725 11.983  1.00 75.84  ? 31  LYS B NZ    1 
ATOM   6870  N  N     . PRO D  4 33  ? 72.100 109.083 11.291  1.00 76.38  ? 32  PRO B N     1 
ATOM   6871  C  CA    . PRO D  4 33  ? 72.568 108.775 9.928   1.00 76.74  ? 32  PRO B CA    1 
ATOM   6872  C  C     . PRO D  4 33  ? 71.939 107.523 9.337   1.00 75.48  ? 32  PRO B C     1 
ATOM   6873  O  O     . PRO D  4 33  ? 71.565 107.524 8.158   1.00 77.76  ? 32  PRO B O     1 
ATOM   6874  C  CB    . PRO D  4 33  ? 74.084 108.622 10.112  1.00 78.24  ? 32  PRO B CB    1 
ATOM   6875  C  CG    . PRO D  4 33  ? 74.399 109.502 11.258  1.00 79.49  ? 32  PRO B CG    1 
ATOM   6876  C  CD    . PRO D  4 33  ? 73.231 109.381 12.193  1.00 75.47  ? 32  PRO B CD    1 
ATOM   6877  N  N     . ALA D  4 34  ? 71.803 106.455 10.127  1.00 75.89  ? 33  ALA B N     1 
ATOM   6878  C  CA    . ALA D  4 34  ? 71.204 105.225 9.616   1.00 70.33  ? 33  ALA B CA    1 
ATOM   6879  C  C     . ALA D  4 34  ? 69.748 105.446 9.224   1.00 71.04  ? 33  ALA B C     1 
ATOM   6880  O  O     . ALA D  4 34  ? 69.310 105.023 8.146   1.00 72.39  ? 33  ALA B O     1 
ATOM   6881  C  CB    . ALA D  4 34  ? 71.320 104.112 10.657  1.00 66.18  ? 33  ALA B CB    1 
ATOM   6882  N  N     . ILE D  4 35  ? 68.982 106.108 10.094  1.00 70.12  ? 34  ILE B N     1 
ATOM   6883  C  CA    . ILE D  4 35  ? 67.595 106.437 9.772   1.00 66.16  ? 34  ILE B CA    1 
ATOM   6884  C  C     . ILE D  4 35  ? 67.532 107.283 8.506   1.00 64.42  ? 34  ILE B C     1 
ATOM   6885  O  O     . ILE D  4 35  ? 66.622 107.130 7.680   1.00 68.04  ? 34  ILE B O     1 
ATOM   6886  C  CB    . ILE D  4 35  ? 66.928 107.147 10.967  1.00 62.77  ? 34  ILE B CB    1 
ATOM   6887  C  CG1   . ILE D  4 35  ? 66.905 106.228 12.192  1.00 54.52  ? 34  ILE B CG1   1 
ATOM   6888  C  CG2   . ILE D  4 35  ? 65.520 107.597 10.609  1.00 63.32  ? 34  ILE B CG2   1 
ATOM   6889  C  CD1   . ILE D  4 35  ? 66.262 106.847 13.412  1.00 55.00  ? 34  ILE B CD1   1 
ATOM   6890  N  N     . ARG D  4 36  ? 68.506 108.179 8.328   1.00 55.78  ? 35  ARG B N     1 
ATOM   6891  C  CA    . ARG D  4 36  ? 68.564 108.981 7.112   1.00 60.60  ? 35  ARG B CA    1 
ATOM   6892  C  C     . ARG D  4 36  ? 68.758 108.100 5.885   1.00 66.72  ? 35  ARG B C     1 
ATOM   6893  O  O     . ARG D  4 36  ? 68.060 108.262 4.880   1.00 72.00  ? 35  ARG B O     1 
ATOM   6894  C  CB    . ARG D  4 36  ? 69.685 110.017 7.211   1.00 65.28  ? 35  ARG B CB    1 
ATOM   6895  C  CG    . ARG D  4 36  ? 70.135 110.555 5.858   1.00 67.26  ? 35  ARG B CG    1 
ATOM   6896  C  CD    . ARG D  4 36  ? 71.128 111.698 5.992   1.00 77.62  ? 35  ARG B CD    1 
ATOM   6897  N  NE    . ARG D  4 36  ? 70.462 112.984 6.188   1.00 83.61  ? 35  ARG B NE    1 
ATOM   6898  C  CZ    . ARG D  4 36  ? 70.260 113.550 7.373   1.00 85.14  ? 35  ARG B CZ    1 
ATOM   6899  N  NH1   . ARG D  4 36  ? 70.675 112.947 8.478   1.00 87.15  ? 35  ARG B NH1   1 
ATOM   6900  N  NH2   . ARG D  4 36  ? 69.645 114.723 7.452   1.00 82.29  ? 35  ARG B NH2   1 
ATOM   6901  N  N     . ARG D  4 37  ? 69.707 107.160 5.947   1.00 63.07  ? 36  ARG B N     1 
ATOM   6902  C  CA    . ARG D  4 37  ? 69.948 106.283 4.804   1.00 63.06  ? 36  ARG B CA    1 
ATOM   6903  C  C     . ARG D  4 37  ? 68.712 105.452 4.478   1.00 63.09  ? 36  ARG B C     1 
ATOM   6904  O  O     . ARG D  4 37  ? 68.350 105.293 3.303   1.00 65.69  ? 36  ARG B O     1 
ATOM   6905  C  CB    . ARG D  4 37  ? 71.153 105.382 5.076   1.00 62.93  ? 36  ARG B CB    1 
ATOM   6906  C  CG    . ARG D  4 37  ? 72.406 106.146 5.482   1.00 72.78  ? 36  ARG B CG    1 
ATOM   6907  C  CD    . ARG D  4 37  ? 73.668 105.309 5.333   1.00 78.51  ? 36  ARG B CD    1 
ATOM   6908  N  NE    . ARG D  4 37  ? 73.690 104.138 6.205   1.00 77.29  ? 36  ARG B NE    1 
ATOM   6909  C  CZ    . ARG D  4 37  ? 74.169 104.141 7.445   1.00 74.10  ? 36  ARG B CZ    1 
ATOM   6910  N  NH1   . ARG D  4 37  ? 74.658 105.257 7.965   1.00 69.96  ? 36  ARG B NH1   1 
ATOM   6911  N  NH2   . ARG D  4 37  ? 74.157 103.029 8.166   1.00 75.98  ? 36  ARG B NH2   1 
ATOM   6912  N  N     . LEU D  4 38  ? 68.046 104.924 5.509   1.00 63.38  ? 37  LEU B N     1 
ATOM   6913  C  CA    . LEU D  4 38  ? 66.796 104.201 5.292   1.00 54.98  ? 37  LEU B CA    1 
ATOM   6914  C  C     . LEU D  4 38  ? 65.763 105.084 4.605   1.00 58.48  ? 37  LEU B C     1 
ATOM   6915  O  O     . LEU D  4 38  ? 65.083 104.647 3.670   1.00 58.44  ? 37  LEU B O     1 
ATOM   6916  C  CB    . LEU D  4 38  ? 66.255 103.680 6.624   1.00 51.70  ? 37  LEU B CB    1 
ATOM   6917  C  CG    . LEU D  4 38  ? 67.007 102.520 7.278   1.00 51.83  ? 37  LEU B CG    1 
ATOM   6918  C  CD1   . LEU D  4 38  ? 66.445 102.239 8.664   1.00 52.77  ? 37  LEU B CD1   1 
ATOM   6919  C  CD2   . LEU D  4 38  ? 66.927 101.276 6.410   1.00 47.27  ? 37  LEU B CD2   1 
ATOM   6920  N  N     . ALA D  4 39  ? 65.636 106.337 5.051   1.00 60.09  ? 38  ALA B N     1 
ATOM   6921  C  CA    . ALA D  4 39  ? 64.673 107.244 4.437   1.00 58.71  ? 38  ALA B CA    1 
ATOM   6922  C  C     . ALA D  4 39  ? 65.049 107.579 2.998   1.00 59.62  ? 38  ALA B C     1 
ATOM   6923  O  O     . ALA D  4 39  ? 64.164 107.806 2.166   1.00 61.59  ? 38  ALA B O     1 
ATOM   6924  C  CB    . ALA D  4 39  ? 64.552 108.521 5.270   1.00 57.73  ? 38  ALA B CB    1 
ATOM   6925  N  N     . ARG D  4 40  ? 66.345 107.609 2.683   1.00 61.32  ? 39  ARG B N     1 
ATOM   6926  C  CA    . ARG D  4 40  ? 66.778 107.915 1.326   1.00 57.75  ? 39  ARG B CA    1 
ATOM   6927  C  C     . ARG D  4 40  ? 66.510 106.751 0.381   1.00 53.13  ? 39  ARG B C     1 
ATOM   6928  O  O     . ARG D  4 40  ? 66.143 106.970 -0.781  1.00 57.53  ? 39  ARG B O     1 
ATOM   6929  C  CB    . ARG D  4 40  ? 68.260 108.290 1.319   1.00 57.20  ? 39  ARG B CB    1 
ATOM   6930  C  CG    . ARG D  4 40  ? 68.570 109.548 2.107   1.00 55.40  ? 39  ARG B CG    1 
ATOM   6931  C  CD    . ARG D  4 40  ? 69.333 110.555 1.276   1.00 58.77  ? 39  ARG B CD    1 
ATOM   6932  N  NE    . ARG D  4 40  ? 69.558 111.794 2.012   1.00 66.61  ? 39  ARG B NE    1 
ATOM   6933  C  CZ    . ARG D  4 40  ? 68.674 112.782 2.093   1.00 74.38  ? 39  ARG B CZ    1 
ATOM   6934  N  NH1   . ARG D  4 40  ? 67.501 112.675 1.482   1.00 73.16  ? 39  ARG B NH1   1 
ATOM   6935  N  NH2   . ARG D  4 40  ? 68.961 113.876 2.785   1.00 79.24  ? 39  ARG B NH2   1 
ATOM   6936  N  N     . ARG D  4 41  ? 66.691 105.512 0.856   1.00 47.71  ? 40  ARG B N     1 
ATOM   6937  C  CA    . ARG D  4 41  ? 66.265 104.356 0.072   1.00 48.29  ? 40  ARG B CA    1 
ATOM   6938  C  C     . ARG D  4 41  ? 64.771 104.403 -0.220  1.00 56.62  ? 40  ARG B C     1 
ATOM   6939  O  O     . ARG D  4 41  ? 64.336 104.020 -1.314  1.00 60.59  ? 40  ARG B O     1 
ATOM   6940  C  CB    . ARG D  4 41  ? 66.629 103.056 0.795   1.00 45.22  ? 40  ARG B CB    1 
ATOM   6941  C  CG    . ARG D  4 41  ? 66.123 101.803 0.095   1.00 45.88  ? 40  ARG B CG    1 
ATOM   6942  C  CD    . ARG D  4 41  ? 66.848 100.579 0.607   1.00 46.80  ? 40  ARG B CD    1 
ATOM   6943  N  NE    . ARG D  4 41  ? 68.250 100.582 0.200   1.00 52.08  ? 40  ARG B NE    1 
ATOM   6944  C  CZ    . ARG D  4 41  ? 69.190 99.820  0.747   1.00 61.45  ? 40  ARG B CZ    1 
ATOM   6945  N  NH1   . ARG D  4 41  ? 68.884 98.997  1.741   1.00 62.24  ? 40  ARG B NH1   1 
ATOM   6946  N  NH2   . ARG D  4 41  ? 70.440 99.888  0.306   1.00 65.61  ? 40  ARG B NH2   1 
ATOM   6947  N  N     . GLY D  4 42  ? 63.977 104.876 0.735   1.00 56.34  ? 41  GLY B N     1 
ATOM   6948  C  CA    . GLY D  4 42  ? 62.585 105.222 0.563   1.00 51.30  ? 41  GLY B CA    1 
ATOM   6949  C  C     . GLY D  4 42  ? 62.321 106.467 -0.260  1.00 55.32  ? 41  GLY B C     1 
ATOM   6950  O  O     . GLY D  4 42  ? 61.164 106.882 -0.353  1.00 57.00  ? 41  GLY B O     1 
ATOM   6951  N  N     . GLY D  4 43  ? 63.345 107.084 -0.853  1.00 48.70  ? 42  GLY B N     1 
ATOM   6952  C  CA    . GLY D  4 43  ? 63.117 108.228 -1.724  1.00 46.42  ? 42  GLY B CA    1 
ATOM   6953  C  C     . GLY D  4 43  ? 62.754 109.529 -1.037  1.00 54.45  ? 42  GLY B C     1 
ATOM   6954  O  O     . GLY D  4 43  ? 62.073 110.371 -1.640  1.00 60.89  ? 42  GLY B O     1 
ATOM   6955  N  N     . VAL D  4 44  ? 63.198 109.731 0.200   1.00 57.94  ? 43  VAL B N     1 
ATOM   6956  C  CA    . VAL D  4 44  ? 62.901 110.948 0.951   1.00 58.90  ? 43  VAL B CA    1 
ATOM   6957  C  C     . VAL D  4 44  ? 64.054 111.925 0.784   1.00 54.74  ? 43  VAL B C     1 
ATOM   6958  O  O     . VAL D  4 44  ? 65.228 111.548 0.894   1.00 58.69  ? 43  VAL B O     1 
ATOM   6959  C  CB    . VAL D  4 44  ? 62.640 110.641 2.439   1.00 60.15  ? 43  VAL B CB    1 
ATOM   6960  C  CG1   . VAL D  4 44  ? 62.425 111.929 3.215   1.00 58.45  ? 43  VAL B CG1   1 
ATOM   6961  C  CG2   . VAL D  4 44  ? 61.430 109.726 2.584   1.00 58.14  ? 43  VAL B CG2   1 
ATOM   6962  N  N     . LYS D  4 45  ? 63.720 113.187 0.519   1.00 53.05  ? 44  LYS B N     1 
ATOM   6963  C  CA    . LYS D  4 45  ? 64.709 114.214 0.214   1.00 61.31  ? 44  LYS B CA    1 
ATOM   6964  C  C     . LYS D  4 45  ? 65.065 115.089 1.409   1.00 71.54  ? 44  LYS B C     1 
ATOM   6965  O  O     . LYS D  4 45  ? 66.240 115.409 1.603   1.00 78.01  ? 44  LYS B O     1 
ATOM   6966  C  CB    . LYS D  4 45  ? 64.211 115.100 -0.932  1.00 63.86  ? 44  LYS B CB    1 
ATOM   6967  C  CG    . LYS D  4 45  ? 65.198 116.175 -1.354  1.00 68.27  ? 44  LYS B CG    1 
ATOM   6968  C  CD    . LYS D  4 45  ? 64.643 117.022 -2.485  1.00 66.48  ? 44  LYS B CD    1 
ATOM   6969  C  CE    . LYS D  4 45  ? 65.646 118.074 -2.930  1.00 63.69  ? 44  LYS B CE    1 
ATOM   6970  N  NZ    . LYS D  4 45  ? 65.177 118.824 -4.125  1.00 63.44  ? 44  LYS B NZ    1 
ATOM   6971  N  N     . ARG D  4 46  ? 64.082 115.496 2.211   1.00 70.59  ? 45  ARG B N     1 
ATOM   6972  C  CA    . ARG D  4 46  ? 64.324 116.343 3.371   1.00 70.54  ? 45  ARG B CA    1 
ATOM   6973  C  C     . ARG D  4 46  ? 63.623 115.747 4.584   1.00 65.97  ? 45  ARG B C     1 
ATOM   6974  O  O     . ARG D  4 46  ? 62.509 115.228 4.474   1.00 66.25  ? 45  ARG B O     1 
ATOM   6975  C  CB    . ARG D  4 46  ? 63.848 117.779 3.120   1.00 70.43  ? 45  ARG B CB    1 
ATOM   6976  C  CG    . ARG D  4 46  ? 64.302 118.781 4.167   1.00 78.37  ? 45  ARG B CG    1 
ATOM   6977  C  CD    . ARG D  4 46  ? 64.246 120.204 3.627   1.00 83.43  ? 45  ARG B CD    1 
ATOM   6978  N  NE    . ARG D  4 46  ? 64.340 121.199 4.692   1.00 89.68  ? 45  ARG B NE    1 
ATOM   6979  C  CZ    . ARG D  4 46  ? 63.295 121.839 5.208   1.00 93.36  ? 45  ARG B CZ    1 
ATOM   6980  N  NH1   . ARG D  4 46  ? 62.074 121.595 4.753   1.00 97.61  ? 45  ARG B NH1   1 
ATOM   6981  N  NH2   . ARG D  4 46  ? 63.471 122.729 6.176   1.00 92.61  ? 45  ARG B NH2   1 
ATOM   6982  N  N     . ILE D  4 47  ? 64.280 115.827 5.741   1.00 69.20  ? 46  ILE B N     1 
ATOM   6983  C  CA    . ILE D  4 47  ? 63.875 115.096 6.936   1.00 68.03  ? 46  ILE B CA    1 
ATOM   6984  C  C     . ILE D  4 47  ? 63.767 116.062 8.109   1.00 71.12  ? 46  ILE B C     1 
ATOM   6985  O  O     . ILE D  4 47  ? 64.705 116.820 8.383   1.00 73.72  ? 46  ILE B O     1 
ATOM   6986  C  CB    . ILE D  4 47  ? 64.869 113.965 7.260   1.00 67.31  ? 46  ILE B CB    1 
ATOM   6987  C  CG1   . ILE D  4 47  ? 64.872 112.922 6.139   1.00 65.78  ? 46  ILE B CG1   1 
ATOM   6988  C  CG2   . ILE D  4 47  ? 64.546 113.332 8.603   1.00 69.38  ? 46  ILE B CG2   1 
ATOM   6989  C  CD1   . ILE D  4 47  ? 66.024 111.948 6.218   1.00 67.40  ? 46  ILE B CD1   1 
ATOM   6990  N  N     . SER D  4 48  ? 62.631 116.023 8.806   1.00 70.66  ? 47  SER B N     1 
ATOM   6991  C  CA    . SER D  4 48  ? 62.433 116.849 9.988   1.00 68.86  ? 47  SER B CA    1 
ATOM   6992  C  C     . SER D  4 48  ? 63.299 116.352 11.136  1.00 68.40  ? 47  SER B C     1 
ATOM   6993  O  O     . SER D  4 48  ? 63.663 115.174 11.204  1.00 65.33  ? 47  SER B O     1 
ATOM   6994  C  CB    . SER D  4 48  ? 60.965 116.837 10.412  1.00 64.72  ? 47  SER B CB    1 
ATOM   6995  O  OG    . SER D  4 48  ? 60.812 117.384 11.709  1.00 68.80  ? 47  SER B OG    1 
ATOM   6996  N  N     . GLY D  4 49  ? 63.628 117.263 12.051  1.00 68.24  ? 48  GLY B N     1 
ATOM   6997  C  CA    . GLY D  4 49  ? 64.508 116.899 13.151  1.00 70.54  ? 48  GLY B CA    1 
ATOM   6998  C  C     . GLY D  4 49  ? 63.849 115.955 14.135  1.00 71.35  ? 48  GLY B C     1 
ATOM   6999  O  O     . GLY D  4 49  ? 64.531 115.212 14.846  1.00 69.75  ? 48  GLY B O     1 
ATOM   7000  N  N     . LEU D  4 50  ? 62.524 115.962 14.186  1.00 66.35  ? 49  LEU B N     1 
ATOM   7001  C  CA    . LEU D  4 50  ? 61.790 115.084 15.087  1.00 67.96  ? 49  LEU B CA    1 
ATOM   7002  C  C     . LEU D  4 50  ? 61.543 113.705 14.495  1.00 75.22  ? 49  LEU B C     1 
ATOM   7003  O  O     . LEU D  4 50  ? 61.004 112.843 15.194  1.00 79.04  ? 49  LEU B O     1 
ATOM   7004  C  CB    . LEU D  4 50  ? 60.454 115.723 15.473  1.00 60.52  ? 49  LEU B CB    1 
ATOM   7005  C  CG    . LEU D  4 50  ? 60.488 116.855 16.501  1.00 64.05  ? 49  LEU B CG    1 
ATOM   7006  C  CD1   . LEU D  4 50  ? 59.088 117.407 16.723  1.00 62.87  ? 49  LEU B CD1   1 
ATOM   7007  C  CD2   . LEU D  4 50  ? 61.085 116.363 17.812  1.00 68.18  ? 49  LEU B CD2   1 
ATOM   7008  N  N     . ILE D  4 51  ? 61.935 113.477 13.238  1.00 59.78  ? 50  ILE B N     1 
ATOM   7009  C  CA    . ILE D  4 51  ? 61.634 112.210 12.574  1.00 59.00  ? 50  ILE B CA    1 
ATOM   7010  C  C     . ILE D  4 51  ? 62.330 111.051 13.276  1.00 60.53  ? 50  ILE B C     1 
ATOM   7011  O  O     . ILE D  4 51  ? 61.775 109.952 13.390  1.00 68.31  ? 50  ILE B O     1 
ATOM   7012  C  CB    . ILE D  4 51  ? 62.024 112.292 11.086  1.00 61.09  ? 50  ILE B CB    1 
ATOM   7013  C  CG1   . ILE D  4 51  ? 60.939 113.021 10.293  1.00 63.94  ? 50  ILE B CG1   1 
ATOM   7014  C  CG2   . ILE D  4 51  ? 62.284 110.906 10.506  1.00 59.15  ? 50  ILE B CG2   1 
ATOM   7015  C  CD1   . ILE D  4 51  ? 59.635 112.266 10.230  1.00 65.07  ? 50  ILE B CD1   1 
ATOM   7016  N  N     . TYR D  4 52  ? 63.540 111.284 13.783  1.00 59.71  ? 51  TYR B N     1 
ATOM   7017  C  CA    . TYR D  4 52  ? 64.378 110.181 14.244  1.00 58.83  ? 51  TYR B CA    1 
ATOM   7018  C  C     . TYR D  4 52  ? 63.786 109.490 15.470  1.00 68.48  ? 51  TYR B C     1 
ATOM   7019  O  O     . TYR D  4 52  ? 63.801 108.255 15.558  1.00 75.53  ? 51  TYR B O     1 
ATOM   7020  C  CB    . TYR D  4 52  ? 65.789 110.701 14.511  1.00 53.38  ? 51  TYR B CB    1 
ATOM   7021  C  CG    . TYR D  4 52  ? 66.311 111.529 13.355  1.00 62.31  ? 51  TYR B CG    1 
ATOM   7022  C  CD1   . TYR D  4 52  ? 66.755 110.922 12.187  1.00 66.97  ? 51  TYR B CD1   1 
ATOM   7023  C  CD2   . TYR D  4 52  ? 66.332 112.918 13.420  1.00 64.91  ? 51  TYR B CD2   1 
ATOM   7024  C  CE1   . TYR D  4 52  ? 67.218 111.671 11.121  1.00 67.92  ? 51  TYR B CE1   1 
ATOM   7025  C  CE2   . TYR D  4 52  ? 66.796 113.676 12.358  1.00 66.81  ? 51  TYR B CE2   1 
ATOM   7026  C  CZ    . TYR D  4 52  ? 67.238 113.046 11.213  1.00 68.78  ? 51  TYR B CZ    1 
ATOM   7027  O  OH    . TYR D  4 52  ? 67.700 113.794 10.155  1.00 72.24  ? 51  TYR B OH    1 
ATOM   7028  N  N     . GLU D  4 53  ? 63.243 110.261 16.415  1.00 69.41  ? 52  GLU B N     1 
ATOM   7029  C  CA    . GLU D  4 53  ? 62.612 109.657 17.586  1.00 68.97  ? 52  GLU B CA    1 
ATOM   7030  C  C     . GLU D  4 53  ? 61.378 108.851 17.195  1.00 62.44  ? 52  GLU B C     1 
ATOM   7031  O  O     . GLU D  4 53  ? 61.201 107.709 17.640  1.00 63.07  ? 52  GLU B O     1 
ATOM   7032  C  CB    . GLU D  4 53  ? 62.248 110.738 18.605  1.00 75.68  ? 52  GLU B CB    1 
ATOM   7033  C  CG    . GLU D  4 53  ? 63.405 111.178 19.482  1.00 80.72  ? 52  GLU B CG    1 
ATOM   7034  C  CD    . GLU D  4 53  ? 64.070 110.012 20.188  1.00 81.33  ? 52  GLU B CD    1 
ATOM   7035  O  OE1   . GLU D  4 53  ? 65.075 109.488 19.660  1.00 79.78  ? 52  GLU B OE1   1 
ATOM   7036  O  OE2   . GLU D  4 53  ? 63.581 109.611 21.264  1.00 83.73  ? 52  GLU B OE2   1 
ATOM   7037  N  N     . GLU D  4 54  ? 60.510 109.436 16.364  1.00 60.48  ? 53  GLU B N     1 
ATOM   7038  C  CA    . GLU D  4 54  ? 59.328 108.723 15.888  1.00 54.19  ? 53  GLU B CA    1 
ATOM   7039  C  C     . GLU D  4 54  ? 59.717 107.420 15.199  1.00 57.51  ? 53  GLU B C     1 
ATOM   7040  O  O     . GLU D  4 54  ? 59.068 106.383 15.392  1.00 62.48  ? 53  GLU B O     1 
ATOM   7041  C  CB    . GLU D  4 54  ? 58.536 109.621 14.937  1.00 42.61  ? 53  GLU B CB    1 
ATOM   7042  C  CG    . GLU D  4 54  ? 57.062 109.273 14.802  1.00 51.68  ? 53  GLU B CG    1 
ATOM   7043  C  CD    . GLU D  4 54  ? 56.230 109.802 15.954  1.00 69.38  ? 53  GLU B CD    1 
ATOM   7044  O  OE1   . GLU D  4 54  ? 55.379 109.048 16.470  1.00 76.74  ? 53  GLU B OE1   1 
ATOM   7045  O  OE2   . GLU D  4 54  ? 56.431 110.971 16.347  1.00 76.93  ? 53  GLU B OE2   1 
ATOM   7046  N  N     . THR D  4 55  ? 60.789 107.454 14.405  1.00 53.55  ? 54  THR B N     1 
ATOM   7047  C  CA    . THR D  4 55  ? 61.249 106.258 13.712  1.00 53.87  ? 54  THR B CA    1 
ATOM   7048  C  C     . THR D  4 55  ? 61.742 105.206 14.696  1.00 49.20  ? 54  THR B C     1 
ATOM   7049  O  O     . THR D  4 55  ? 61.445 104.016 14.538  1.00 55.86  ? 54  THR B O     1 
ATOM   7050  C  CB    . THR D  4 55  ? 62.352 106.619 12.716  1.00 57.68  ? 54  THR B CB    1 
ATOM   7051  O  OG1   . THR D  4 55  ? 61.883 107.642 11.828  1.00 57.45  ? 54  THR B OG1   1 
ATOM   7052  C  CG2   . THR D  4 55  ? 62.755 105.400 11.901  1.00 54.05  ? 54  THR B CG2   1 
ATOM   7053  N  N     . ARG D  4 56  ? 62.499 105.621 15.715  1.00 55.05  ? 55  ARG B N     1 
ATOM   7054  C  CA    . ARG D  4 56  ? 62.937 104.667 16.730  1.00 56.56  ? 55  ARG B CA    1 
ATOM   7055  C  C     . ARG D  4 56  ? 61.745 104.024 17.432  1.00 55.70  ? 55  ARG B C     1 
ATOM   7056  O  O     . ARG D  4 56  ? 61.755 102.817 17.710  1.00 58.03  ? 55  ARG B O     1 
ATOM   7057  C  CB    . ARG D  4 56  ? 63.857 105.356 17.739  1.00 53.41  ? 55  ARG B CB    1 
ATOM   7058  C  CG    . ARG D  4 56  ? 65.177 105.822 17.140  1.00 59.90  ? 55  ARG B CG    1 
ATOM   7059  C  CD    . ARG D  4 56  ? 66.093 106.427 18.193  1.00 69.40  ? 55  ARG B CD    1 
ATOM   7060  N  NE    . ARG D  4 56  ? 67.351 106.896 17.616  1.00 68.56  ? 55  ARG B NE    1 
ATOM   7061  C  CZ    . ARG D  4 56  ? 67.586 108.154 17.260  1.00 68.92  ? 55  ARG B CZ    1 
ATOM   7062  N  NH1   . ARG D  4 56  ? 66.649 109.078 17.426  1.00 65.39  ? 55  ARG B NH1   1 
ATOM   7063  N  NH2   . ARG D  4 56  ? 68.760 108.491 16.742  1.00 69.69  ? 55  ARG B NH2   1 
ATOM   7064  N  N     . GLY D  4 57  ? 60.701 104.809 17.709  1.00 45.56  ? 56  GLY B N     1 
ATOM   7065  C  CA    . GLY D  4 57  ? 59.504 104.237 18.307  1.00 39.15  ? 56  GLY B CA    1 
ATOM   7066  C  C     . GLY D  4 57  ? 58.828 103.222 17.403  1.00 48.58  ? 56  GLY B C     1 
ATOM   7067  O  O     . GLY D  4 57  ? 58.447 102.132 17.844  1.00 50.10  ? 56  GLY B O     1 
ATOM   7068  N  N     . VAL D  4 58  ? 58.678 103.564 16.120  1.00 48.60  ? 57  VAL B N     1 
ATOM   7069  C  CA    . VAL D  4 58  ? 58.034 102.655 15.173  1.00 48.86  ? 57  VAL B CA    1 
ATOM   7070  C  C     . VAL D  4 58  ? 58.816 101.350 15.068  1.00 48.17  ? 57  VAL B C     1 
ATOM   7071  O  O     . VAL D  4 58  ? 58.248 100.250 15.150  1.00 51.43  ? 57  VAL B O     1 
ATOM   7072  C  CB    . VAL D  4 58  ? 57.882 103.333 13.800  1.00 46.40  ? 57  VAL B CB    1 
ATOM   7073  C  CG1   . VAL D  4 58  ? 57.634 102.294 12.724  1.00 50.81  ? 57  VAL B CG1   1 
ATOM   7074  C  CG2   . VAL D  4 58  ? 56.751 104.350 13.837  1.00 39.01  ? 57  VAL B CG2   1 
ATOM   7075  N  N     . LEU D  4 59  ? 60.135 101.455 14.888  1.00 42.99  ? 58  LEU B N     1 
ATOM   7076  C  CA    . LEU D  4 59  ? 60.976 100.264 14.825  1.00 45.98  ? 58  LEU B CA    1 
ATOM   7077  C  C     . LEU D  4 59  ? 60.850 99.433  16.095  1.00 58.76  ? 58  LEU B C     1 
ATOM   7078  O  O     . LEU D  4 59  ? 60.818 98.197  16.037  1.00 66.96  ? 58  LEU B O     1 
ATOM   7079  C  CB    . LEU D  4 59  ? 62.433 100.662 14.589  1.00 38.69  ? 58  LEU B CB    1 
ATOM   7080  C  CG    . LEU D  4 59  ? 63.456 99.526  14.654  1.00 38.71  ? 58  LEU B CG    1 
ATOM   7081  C  CD1   . LEU D  4 59  ? 63.197 98.495  13.568  1.00 36.87  ? 58  LEU B CD1   1 
ATOM   7082  C  CD2   . LEU D  4 59  ? 64.879 100.065 14.565  1.00 45.01  ? 58  LEU B CD2   1 
ATOM   7083  N  N     . LYS D  4 60  ? 60.759 100.095 17.252  1.00 55.46  ? 59  LYS B N     1 
ATOM   7084  C  CA    . LYS D  4 60  ? 60.653 99.352  18.503  1.00 51.65  ? 59  LYS B CA    1 
ATOM   7085  C  C     . LYS D  4 60  ? 59.329 98.602  18.595  1.00 49.64  ? 59  LYS B C     1 
ATOM   7086  O  O     . LYS D  4 60  ? 59.292 97.465  19.076  1.00 53.46  ? 59  LYS B O     1 
ATOM   7087  C  CB    . LYS D  4 60  ? 60.828 100.288 19.698  1.00 53.66  ? 59  LYS B CB    1 
ATOM   7088  C  CG    . LYS D  4 60  ? 61.538 99.629  20.872  1.00 63.75  ? 59  LYS B CG    1 
ATOM   7089  C  CD    . LYS D  4 60  ? 61.752 100.597 22.020  1.00 80.77  ? 59  LYS B CD    1 
ATOM   7090  C  CE    . LYS D  4 60  ? 60.528 100.669 22.918  1.00 91.94  ? 59  LYS B CE    1 
ATOM   7091  N  NZ    . LYS D  4 60  ? 60.259 99.364  23.584  1.00 96.63  ? 59  LYS B NZ    1 
ATOM   7092  N  N     . VAL D  4 61  ? 58.231 99.212  18.139  1.00 43.16  ? 60  VAL B N     1 
ATOM   7093  C  CA    . VAL D  4 61  ? 56.948 98.508  18.137  1.00 43.72  ? 60  VAL B CA    1 
ATOM   7094  C  C     . VAL D  4 61  ? 57.008 97.300  17.208  1.00 47.82  ? 60  VAL B C     1 
ATOM   7095  O  O     . VAL D  4 61  ? 56.608 96.185  17.575  1.00 55.05  ? 60  VAL B O     1 
ATOM   7096  C  CB    . VAL D  4 61  ? 55.808 99.465  17.744  1.00 44.39  ? 60  VAL B CB    1 
ATOM   7097  C  CG1   . VAL D  4 61  ? 54.517 98.688  17.527  1.00 43.13  ? 60  VAL B CG1   1 
ATOM   7098  C  CG2   . VAL D  4 61  ? 55.619 100.530 18.810  1.00 46.90  ? 60  VAL B CG2   1 
ATOM   7099  N  N     . PHE D  4 62  ? 57.516 97.509  15.989  1.00 39.19  ? 61  PHE B N     1 
ATOM   7100  C  CA    . PHE D  4 62  ? 57.649 96.423  15.020  1.00 38.08  ? 61  PHE B CA    1 
ATOM   7101  C  C     . PHE D  4 62  ? 58.422 95.246  15.608  1.00 44.41  ? 61  PHE B C     1 
ATOM   7102  O  O     . PHE D  4 62  ? 57.938 94.102  15.623  1.00 44.74  ? 61  PHE B O     1 
ATOM   7103  C  CB    . PHE D  4 62  ? 58.339 96.960  13.761  1.00 41.87  ? 61  PHE B CB    1 
ATOM   7104  C  CG    . PHE D  4 62  ? 58.488 95.949  12.662  1.00 37.01  ? 61  PHE B CG    1 
ATOM   7105  C  CD1   . PHE D  4 62  ? 57.455 95.718  11.771  1.00 39.81  ? 61  PHE B CD1   1 
ATOM   7106  C  CD2   . PHE D  4 62  ? 59.670 95.243  12.507  1.00 33.06  ? 61  PHE B CD2   1 
ATOM   7107  C  CE1   . PHE D  4 62  ? 57.594 94.793  10.755  1.00 37.79  ? 61  PHE B CE1   1 
ATOM   7108  C  CE2   . PHE D  4 62  ? 59.813 94.317  11.494  1.00 31.68  ? 61  PHE B CE2   1 
ATOM   7109  C  CZ    . PHE D  4 62  ? 58.773 94.091  10.618  1.00 33.43  ? 61  PHE B CZ    1 
ATOM   7110  N  N     . LEU D  4 63  ? 59.626 95.519  16.120  1.00 47.16  ? 62  LEU B N     1 
ATOM   7111  C  CA    . LEU D  4 63  ? 60.446 94.460  16.698  1.00 51.77  ? 62  LEU B CA    1 
ATOM   7112  C  C     . LEU D  4 63  ? 59.799 93.850  17.934  1.00 47.38  ? 62  LEU B C     1 
ATOM   7113  O  O     . LEU D  4 63  ? 60.022 92.671  18.229  1.00 50.53  ? 62  LEU B O     1 
ATOM   7114  C  CB    . LEU D  4 63  ? 61.835 94.999  17.035  1.00 53.62  ? 62  LEU B CB    1 
ATOM   7115  C  CG    . LEU D  4 63  ? 62.689 95.342  15.816  1.00 52.90  ? 62  LEU B CG    1 
ATOM   7116  C  CD1   . LEU D  4 63  ? 64.087 95.750  16.233  1.00 53.09  ? 62  LEU B CD1   1 
ATOM   7117  C  CD2   . LEU D  4 63  ? 62.734 94.153  14.877  1.00 56.06  ? 62  LEU B CD2   1 
ATOM   7118  N  N     . GLU D  4 64  ? 59.000 94.626  18.667  1.00 36.85  ? 63  GLU B N     1 
ATOM   7119  C  CA    . GLU D  4 64  ? 58.332 94.083  19.845  1.00 47.64  ? 63  GLU B CA    1 
ATOM   7120  C  C     . GLU D  4 64  ? 57.296 93.038  19.454  1.00 44.62  ? 63  GLU B C     1 
ATOM   7121  O  O     . GLU D  4 64  ? 57.255 91.944  20.030  1.00 44.47  ? 63  GLU B O     1 
ATOM   7122  C  CB    . GLU D  4 64  ? 57.689 95.210  20.652  1.00 54.95  ? 63  GLU B CB    1 
ATOM   7123  C  CG    . GLU D  4 64  ? 58.621 95.853  21.665  1.00 50.25  ? 63  GLU B CG    1 
ATOM   7124  C  CD    . GLU D  4 64  ? 57.995 97.053  22.344  1.00 62.04  ? 63  GLU B CD    1 
ATOM   7125  O  OE1   . GLU D  4 64  ? 56.883 97.452  21.937  1.00 62.62  ? 63  GLU B OE1   1 
ATOM   7126  O  OE2   . GLU D  4 64  ? 58.613 97.596  23.284  1.00 73.71  ? 63  GLU B OE2   1 
ATOM   7127  N  N     . ASN D  4 65  ? 56.451 93.353  18.469  1.00 40.18  ? 64  ASN B N     1 
ATOM   7128  C  CA    . ASN D  4 65  ? 55.456 92.380  18.025  1.00 40.22  ? 64  ASN B CA    1 
ATOM   7129  C  C     . ASN D  4 65  ? 56.124 91.150  17.417  1.00 45.27  ? 64  ASN B C     1 
ATOM   7130  O  O     . ASN D  4 65  ? 55.862 90.009  17.837  1.00 53.67  ? 64  ASN B O     1 
ATOM   7131  C  CB    . ASN D  4 65  ? 54.500 93.035  17.026  1.00 38.84  ? 64  ASN B CB    1 
ATOM   7132  C  CG    . ASN D  4 65  ? 53.700 94.170  17.642  1.00 47.03  ? 64  ASN B CG    1 
ATOM   7133  O  OD1   . ASN D  4 65  ? 53.102 94.017  18.706  1.00 62.41  ? 64  ASN B OD1   1 
ATOM   7134  N  ND2   . ASN D  4 65  ? 53.697 95.320  16.980  1.00 48.13  ? 64  ASN B ND2   1 
ATOM   7135  N  N     . VAL D  4 66  ? 57.011 91.365  16.439  1.00 29.54  ? 65  VAL B N     1 
ATOM   7136  C  CA    . VAL D  4 66  ? 57.632 90.239  15.742  1.00 38.55  ? 65  VAL B CA    1 
ATOM   7137  C  C     . VAL D  4 66  ? 58.401 89.360  16.723  1.00 37.26  ? 65  VAL B C     1 
ATOM   7138  O  O     . VAL D  4 66  ? 58.214 88.138  16.769  1.00 46.92  ? 65  VAL B O     1 
ATOM   7139  C  CB    . VAL D  4 66  ? 58.538 90.741  14.604  1.00 46.27  ? 65  VAL B CB    1 
ATOM   7140  C  CG1   . VAL D  4 66  ? 59.301 89.581  13.985  1.00 43.67  ? 65  VAL B CG1   1 
ATOM   7141  C  CG2   . VAL D  4 66  ? 57.710 91.458  13.547  1.00 48.13  ? 65  VAL B CG2   1 
ATOM   7142  N  N     . ILE D  4 67  ? 59.274 89.972  17.527  1.00 38.58  ? 66  ILE B N     1 
ATOM   7143  C  CA    . ILE D  4 67  ? 60.071 89.209  18.483  1.00 42.76  ? 66  ILE B CA    1 
ATOM   7144  C  C     . ILE D  4 67  ? 59.182 88.531  19.519  1.00 50.44  ? 66  ILE B C     1 
ATOM   7145  O  O     . ILE D  4 67  ? 59.492 87.428  19.984  1.00 48.04  ? 66  ILE B O     1 
ATOM   7146  C  CB    . ILE D  4 67  ? 61.129 90.121  19.139  1.00 43.87  ? 66  ILE B CB    1 
ATOM   7147  C  CG1   . ILE D  4 67  ? 62.225 90.468  18.129  1.00 46.74  ? 66  ILE B CG1   1 
ATOM   7148  C  CG2   . ILE D  4 67  ? 61.744 89.457  20.365  1.00 45.36  ? 66  ILE B CG2   1 
ATOM   7149  C  CD1   . ILE D  4 67  ? 63.278 91.406  18.675  1.00 55.01  ? 66  ILE B CD1   1 
ATOM   7150  N  N     . ARG D  4 68  ? 58.061 89.159  19.886  1.00 47.05  ? 67  ARG B N     1 
ATOM   7151  C  CA    . ARG D  4 68  ? 57.133 88.512  20.808  1.00 48.19  ? 67  ARG B CA    1 
ATOM   7152  C  C     . ARG D  4 68  ? 56.628 87.193  20.236  1.00 50.94  ? 67  ARG B C     1 
ATOM   7153  O  O     . ARG D  4 68  ? 56.694 86.148  20.898  1.00 47.45  ? 67  ARG B O     1 
ATOM   7154  C  CB    . ARG D  4 68  ? 55.959 89.438  21.128  1.00 54.71  ? 67  ARG B CB    1 
ATOM   7155  C  CG    . ARG D  4 68  ? 54.928 88.790  22.047  1.00 64.72  ? 67  ARG B CG    1 
ATOM   7156  C  CD    . ARG D  4 68  ? 53.632 89.585  22.130  1.00 73.24  ? 67  ARG B CD    1 
ATOM   7157  N  NE    . ARG D  4 68  ? 53.810 90.878  22.783  1.00 84.08  ? 67  ARG B NE    1 
ATOM   7158  C  CZ    . ARG D  4 68  ? 53.812 92.042  22.143  1.00 85.34  ? 67  ARG B CZ    1 
ATOM   7159  N  NH1   . ARG D  4 68  ? 53.639 92.076  20.829  1.00 78.51  ? 67  ARG B NH1   1 
ATOM   7160  N  NH2   . ARG D  4 68  ? 53.979 93.172  22.816  1.00 89.55  ? 67  ARG B NH2   1 
ATOM   7161  N  N     . ASP D  4 69  ? 56.132 87.218  18.994  1.00 57.37  ? 68  ASP B N     1 
ATOM   7162  C  CA    . ASP D  4 69  ? 55.625 85.980  18.403  1.00 50.21  ? 68  ASP B CA    1 
ATOM   7163  C  C     . ASP D  4 69  ? 56.740 84.959  18.194  1.00 45.69  ? 68  ASP B C     1 
ATOM   7164  O  O     . ASP D  4 69  ? 56.552 83.761  18.454  1.00 40.87  ? 68  ASP B O     1 
ATOM   7165  C  CB    . ASP D  4 69  ? 54.906 86.285  17.090  1.00 52.26  ? 68  ASP B CB    1 
ATOM   7166  C  CG    . ASP D  4 69  ? 53.591 87.012  17.305  1.00 60.93  ? 68  ASP B CG    1 
ATOM   7167  O  OD1   . ASP D  4 69  ? 53.450 87.685  18.349  1.00 61.23  ? 68  ASP B OD1   1 
ATOM   7168  O  OD2   . ASP D  4 69  ? 52.698 86.911  16.437  1.00 62.29  ? 68  ASP B OD2   1 
ATOM   7169  N  N     . ALA D  4 70  ? 57.913 85.413  17.743  1.00 49.24  ? 69  ALA B N     1 
ATOM   7170  C  CA    . ALA D  4 70  ? 59.028 84.496  17.522  1.00 44.77  ? 69  ALA B CA    1 
ATOM   7171  C  C     . ALA D  4 70  ? 59.441 83.801  18.813  1.00 52.73  ? 69  ALA B C     1 
ATOM   7172  O  O     . ALA D  4 70  ? 59.694 82.590  18.821  1.00 59.36  ? 69  ALA B O     1 
ATOM   7173  C  CB    . ALA D  4 70  ? 60.214 85.245  16.915  1.00 38.05  ? 69  ALA B CB    1 
ATOM   7174  N  N     . VAL D  4 71  ? 59.512 84.550  19.917  1.00 55.81  ? 70  VAL B N     1 
ATOM   7175  C  CA    . VAL D  4 71  ? 59.878 83.955  21.199  1.00 47.86  ? 70  VAL B CA    1 
ATOM   7176  C  C     . VAL D  4 71  ? 58.764 83.048  21.708  1.00 47.83  ? 70  VAL B C     1 
ATOM   7177  O  O     . VAL D  4 71  ? 59.031 82.055  22.395  1.00 48.12  ? 70  VAL B O     1 
ATOM   7178  C  CB    . VAL D  4 71  ? 60.238 85.060  22.211  1.00 43.52  ? 70  VAL B CB    1 
ATOM   7179  C  CG1   . VAL D  4 71  ? 60.406 84.488  23.614  1.00 49.17  ? 70  VAL B CG1   1 
ATOM   7180  C  CG2   . VAL D  4 71  ? 61.512 85.766  21.780  1.00 40.86  ? 70  VAL B CG2   1 
ATOM   7181  N  N     . THR D  4 72  ? 57.506 83.352  21.378  1.00 44.07  ? 71  THR B N     1 
ATOM   7182  C  CA    . THR D  4 72  ? 56.439 82.393  21.652  1.00 42.42  ? 71  THR B CA    1 
ATOM   7183  C  C     . THR D  4 72  ? 56.710 81.067  20.949  1.00 49.12  ? 71  THR B C     1 
ATOM   7184  O  O     . THR D  4 72  ? 56.568 79.992  21.549  1.00 53.04  ? 71  THR B O     1 
ATOM   7185  C  CB    . THR D  4 72  ? 55.087 82.964  21.221  1.00 42.02  ? 71  THR B CB    1 
ATOM   7186  O  OG1   . THR D  4 72  ? 54.849 84.203  21.900  1.00 49.43  ? 71  THR B OG1   1 
ATOM   7187  C  CG2   . THR D  4 72  ? 53.969 81.991  21.552  1.00 38.15  ? 71  THR B CG2   1 
ATOM   7188  N  N     . TYR D  4 73  ? 57.127 81.127  19.679  1.00 58.00  ? 72  TYR B N     1 
ATOM   7189  C  CA    . TYR D  4 73  ? 57.476 79.908  18.955  1.00 54.72  ? 72  TYR B CA    1 
ATOM   7190  C  C     . TYR D  4 73  ? 58.660 79.194  19.597  1.00 57.90  ? 72  TYR B C     1 
ATOM   7191  O  O     . TYR D  4 73  ? 58.659 77.962  19.716  1.00 60.36  ? 72  TYR B O     1 
ATOM   7192  C  CB    . TYR D  4 73  ? 57.781 80.237  17.494  1.00 48.07  ? 72  TYR B CB    1 
ATOM   7193  C  CG    . TYR D  4 73  ? 56.550 80.385  16.635  1.00 42.56  ? 72  TYR B CG    1 
ATOM   7194  C  CD1   . TYR D  4 73  ? 55.568 79.403  16.622  1.00 43.06  ? 72  TYR B CD1   1 
ATOM   7195  C  CD2   . TYR D  4 73  ? 56.365 81.509  15.842  1.00 38.24  ? 72  TYR B CD2   1 
ATOM   7196  C  CE1   . TYR D  4 73  ? 54.441 79.531  15.838  1.00 45.29  ? 72  TYR B CE1   1 
ATOM   7197  C  CE2   . TYR D  4 73  ? 55.239 81.650  15.058  1.00 39.20  ? 72  TYR B CE2   1 
ATOM   7198  C  CZ    . TYR D  4 73  ? 54.281 80.657  15.057  1.00 40.94  ? 72  TYR B CZ    1 
ATOM   7199  O  OH    . TYR D  4 73  ? 53.155 80.793  14.277  1.00 31.43  ? 72  TYR B OH    1 
ATOM   7200  N  N     . THR D  4 74  ? 59.684 79.948  20.009  1.00 55.47  ? 73  THR B N     1 
ATOM   7201  C  CA    . THR D  4 74  ? 60.845 79.333  20.647  1.00 57.16  ? 73  THR B CA    1 
ATOM   7202  C  C     . THR D  4 74  ? 60.456 78.623  21.937  1.00 68.69  ? 73  THR B C     1 
ATOM   7203  O  O     . THR D  4 74  ? 60.891 77.492  22.186  1.00 77.95  ? 73  THR B O     1 
ATOM   7204  C  CB    . THR D  4 74  ? 61.915 80.392  20.925  1.00 51.27  ? 73  THR B CB    1 
ATOM   7205  O  OG1   . THR D  4 74  ? 62.430 80.895  19.686  1.00 52.33  ? 73  THR B OG1   1 
ATOM   7206  C  CG2   . THR D  4 74  ? 63.056 79.800  21.740  1.00 48.64  ? 73  THR B CG2   1 
ATOM   7207  N  N     . GLU D  4 75  ? 59.631 79.267  22.767  1.00 63.70  ? 74  GLU B N     1 
ATOM   7208  C  CA    . GLU D  4 75  ? 59.212 78.647  24.018  1.00 66.25  ? 74  GLU B CA    1 
ATOM   7209  C  C     . GLU D  4 75  ? 58.370 77.404  23.766  1.00 61.05  ? 74  GLU B C     1 
ATOM   7210  O  O     . GLU D  4 75  ? 58.533 76.391  24.456  1.00 67.02  ? 74  GLU B O     1 
ATOM   7211  C  CB    . GLU D  4 75  ? 58.438 79.646  24.877  1.00 76.39  ? 74  GLU B CB    1 
ATOM   7212  C  CG    . GLU D  4 75  ? 59.279 80.780  25.429  1.00 89.46  ? 74  GLU B CG    1 
ATOM   7213  C  CD    . GLU D  4 75  ? 58.651 81.420  26.650  1.00 100.56 ? 74  GLU B CD    1 
ATOM   7214  O  OE1   . GLU D  4 75  ? 57.827 80.754  27.314  1.00 105.08 ? 74  GLU B OE1   1 
ATOM   7215  O  OE2   . GLU D  4 75  ? 58.980 82.588  26.946  1.00 103.51 ? 74  GLU B OE2   1 
ATOM   7216  N  N     . HIS D  4 76  ? 57.460 77.460  22.788  1.00 59.52  ? 75  HIS B N     1 
ATOM   7217  C  CA    . HIS D  4 76  ? 56.633 76.289  22.509  1.00 55.59  ? 75  HIS B CA    1 
ATOM   7218  C  C     . HIS D  4 76  ? 57.486 75.096  22.097  1.00 63.35  ? 75  HIS B C     1 
ATOM   7219  O  O     . HIS D  4 76  ? 57.171 73.950  22.439  1.00 68.57  ? 75  HIS B O     1 
ATOM   7220  C  CB    . HIS D  4 76  ? 55.602 76.596  21.425  1.00 45.85  ? 75  HIS B CB    1 
ATOM   7221  C  CG    . HIS D  4 76  ? 54.697 75.441  21.124  1.00 49.43  ? 75  HIS B CG    1 
ATOM   7222  N  ND1   . HIS D  4 76  ? 53.574 75.162  21.871  1.00 52.40  ? 75  HIS B ND1   1 
ATOM   7223  C  CD2   . HIS D  4 76  ? 54.765 74.479  20.174  1.00 50.18  ? 75  HIS B CD2   1 
ATOM   7224  C  CE1   . HIS D  4 76  ? 52.981 74.086  21.387  1.00 53.84  ? 75  HIS B CE1   1 
ATOM   7225  N  NE2   . HIS D  4 76  ? 53.684 73.651  20.357  1.00 55.53  ? 75  HIS B NE2   1 
ATOM   7226  N  N     . ALA D  4 77  ? 58.570 75.342  21.365  1.00 60.36  ? 76  ALA B N     1 
ATOM   7227  C  CA    . ALA D  4 77  ? 59.478 74.279  20.956  1.00 59.52  ? 76  ALA B CA    1 
ATOM   7228  C  C     . ALA D  4 77  ? 60.368 73.790  22.090  1.00 63.54  ? 76  ALA B C     1 
ATOM   7229  O  O     . ALA D  4 77  ? 61.223 72.929  21.851  1.00 64.10  ? 76  ALA B O     1 
ATOM   7230  C  CB    . ALA D  4 77  ? 60.346 74.748  19.787  1.00 59.98  ? 76  ALA B CB    1 
ATOM   7231  N  N     . LYS D  4 78  ? 60.192 74.315  23.305  1.00 58.84  ? 77  LYS B N     1 
ATOM   7232  C  CA    . LYS D  4 78  ? 60.992 73.920  24.465  1.00 59.22  ? 77  LYS B CA    1 
ATOM   7233  C  C     . LYS D  4 78  ? 62.482 74.135  24.205  1.00 64.27  ? 77  LYS B C     1 
ATOM   7234  O  O     . LYS D  4 78  ? 63.318 73.288  24.522  1.00 66.16  ? 77  LYS B O     1 
ATOM   7235  C  CB    . LYS D  4 78  ? 60.711 72.469  24.863  1.00 55.64  ? 77  LYS B CB    1 
ATOM   7236  C  CG    . LYS D  4 78  ? 59.251 72.182  25.172  1.00 66.80  ? 77  LYS B CG    1 
ATOM   7237  C  CD    . LYS D  4 78  ? 59.006 70.689  25.332  1.00 78.14  ? 77  LYS B CD    1 
ATOM   7238  C  CE    . LYS D  4 78  ? 57.580 70.405  25.787  1.00 85.94  ? 77  LYS B CE    1 
ATOM   7239  N  NZ    . LYS D  4 78  ? 57.347 68.944  25.969  1.00 89.56  ? 77  LYS B NZ    1 
ATOM   7240  N  N     . ARG D  4 79  ? 62.814 75.282  23.614  1.00 64.53  ? 78  ARG B N     1 
ATOM   7241  C  CA    . ARG D  4 79  ? 64.183 75.613  23.258  1.00 63.88  ? 78  ARG B CA    1 
ATOM   7242  C  C     . ARG D  4 79  ? 64.569 76.946  23.881  1.00 59.87  ? 78  ARG B C     1 
ATOM   7243  O  O     . ARG D  4 79  ? 63.719 77.717  24.334  1.00 62.95  ? 78  ARG B O     1 
ATOM   7244  C  CB    . ARG D  4 79  ? 64.369 75.673  21.733  1.00 68.87  ? 78  ARG B CB    1 
ATOM   7245  C  CG    . ARG D  4 79  ? 64.166 74.342  21.026  1.00 72.37  ? 78  ARG B CG    1 
ATOM   7246  C  CD    . ARG D  4 79  ? 64.505 74.433  19.540  1.00 67.54  ? 78  ARG B CD    1 
ATOM   7247  N  NE    . ARG D  4 79  ? 63.444 75.064  18.757  1.00 55.06  ? 78  ARG B NE    1 
ATOM   7248  C  CZ    . ARG D  4 79  ? 63.419 76.349  18.417  1.00 49.59  ? 78  ARG B CZ    1 
ATOM   7249  N  NH1   . ARG D  4 79  ? 64.403 77.157  18.788  1.00 50.35  ? 78  ARG B NH1   1 
ATOM   7250  N  NH2   . ARG D  4 79  ? 62.408 76.826  17.703  1.00 37.77  ? 78  ARG B NH2   1 
ATOM   7251  N  N     . LYS D  4 80  ? 65.877 77.212  23.898  1.00 59.30  ? 79  LYS B N     1 
ATOM   7252  C  CA    . LYS D  4 80  ? 66.416 78.461  24.423  1.00 65.28  ? 79  LYS B CA    1 
ATOM   7253  C  C     . LYS D  4 80  ? 67.138 79.274  23.357  1.00 69.27  ? 79  LYS B C     1 
ATOM   7254  O  O     . LYS D  4 80  ? 67.766 80.288  23.684  1.00 65.86  ? 79  LYS B O     1 
ATOM   7255  C  CB    . LYS D  4 80  ? 67.360 78.187  25.598  1.00 69.08  ? 79  LYS B CB    1 
ATOM   7256  C  CG    . LYS D  4 80  ? 66.791 77.241  26.640  1.00 65.94  ? 79  LYS B CG    1 
ATOM   7257  C  CD    . LYS D  4 80  ? 67.585 77.290  27.930  1.00 71.66  ? 79  LYS B CD    1 
ATOM   7258  C  CE    . LYS D  4 80  ? 67.441 78.644  28.607  1.00 76.89  ? 79  LYS B CE    1 
ATOM   7259  N  NZ    . LYS D  4 80  ? 68.072 78.666  29.956  1.00 82.73  ? 79  LYS B NZ    1 
ATOM   7260  N  N     . THR D  4 81  ? 67.072 78.856  22.094  1.00 65.38  ? 80  THR B N     1 
ATOM   7261  C  CA    . THR D  4 81  ? 67.739 79.543  20.993  1.00 68.54  ? 80  THR B CA    1 
ATOM   7262  C  C     . THR D  4 81  ? 66.690 79.933  19.960  1.00 67.21  ? 80  THR B C     1 
ATOM   7263  O  O     . THR D  4 81  ? 66.085 79.062  19.325  1.00 78.24  ? 80  THR B O     1 
ATOM   7264  C  CB    . THR D  4 81  ? 68.818 78.662  20.364  1.00 74.11  ? 80  THR B CB    1 
ATOM   7265  O  OG1   . THR D  4 81  ? 69.691 78.164  21.386  1.00 81.59  ? 80  THR B OG1   1 
ATOM   7266  C  CG2   . THR D  4 81  ? 69.634 79.457  19.353  1.00 76.38  ? 80  THR B CG2   1 
ATOM   7267  N  N     . VAL D  4 82  ? 66.473 81.237  19.795  1.00 66.34  ? 81  VAL B N     1 
ATOM   7268  C  CA    . VAL D  4 82  ? 65.561 81.721  18.765  1.00 56.09  ? 81  VAL B CA    1 
ATOM   7269  C  C     . VAL D  4 82  ? 66.172 81.432  17.400  1.00 55.99  ? 81  VAL B C     1 
ATOM   7270  O  O     . VAL D  4 82  ? 67.258 81.924  17.074  1.00 62.34  ? 81  VAL B O     1 
ATOM   7271  C  CB    . VAL D  4 82  ? 65.271 83.216  18.940  1.00 50.41  ? 81  VAL B CB    1 
ATOM   7272  C  CG1   . VAL D  4 82  ? 64.466 83.738  17.761  1.00 44.99  ? 81  VAL B CG1   1 
ATOM   7273  C  CG2   . VAL D  4 82  ? 64.530 83.461  20.246  1.00 51.75  ? 81  VAL B CG2   1 
ATOM   7274  N  N     . THR D  4 83  ? 65.478 80.631  16.602  1.00 53.95  ? 82  THR B N     1 
ATOM   7275  C  CA    . THR D  4 83  ? 65.965 80.246  15.288  1.00 51.22  ? 82  THR B CA    1 
ATOM   7276  C  C     . THR D  4 83  ? 65.417 81.181  14.216  1.00 55.65  ? 82  THR B C     1 
ATOM   7277  O  O     . THR D  4 83  ? 64.457 81.925  14.433  1.00 59.78  ? 82  THR B O     1 
ATOM   7278  C  CB    . THR D  4 83  ? 65.573 78.803  14.966  1.00 48.15  ? 82  THR B CB    1 
ATOM   7279  O  OG1   . THR D  4 83  ? 64.144 78.685  14.953  1.00 49.80  ? 82  THR B OG1   1 
ATOM   7280  C  CG2   . THR D  4 83  ? 66.147 77.852  16.001  1.00 39.20  ? 82  THR B CG2   1 
ATOM   7281  N  N     . ALA D  4 84  ? 66.052 81.135  13.043  1.00 57.29  ? 83  ALA B N     1 
ATOM   7282  C  CA    . ALA D  4 84  ? 65.570 81.926  11.917  1.00 53.09  ? 83  ALA B CA    1 
ATOM   7283  C  C     . ALA D  4 84  ? 64.170 81.502  11.500  1.00 52.69  ? 83  ALA B C     1 
ATOM   7284  O  O     . ALA D  4 84  ? 63.386 82.333  11.028  1.00 54.10  ? 83  ALA B O     1 
ATOM   7285  C  CB    . ALA D  4 84  ? 66.535 81.807  10.738  1.00 51.56  ? 83  ALA B CB    1 
ATOM   7286  N  N     . MET D  4 85  ? 63.834 80.221  11.674  1.00 51.20  ? 84  MET B N     1 
ATOM   7287  C  CA    . MET D  4 85  ? 62.493 79.762  11.333  1.00 45.62  ? 84  MET B CA    1 
ATOM   7288  C  C     . MET D  4 85  ? 61.443 80.343  12.268  1.00 49.84  ? 84  MET B C     1 
ATOM   7289  O  O     . MET D  4 85  ? 60.310 80.586  11.842  1.00 47.14  ? 84  MET B O     1 
ATOM   7290  C  CB    . MET D  4 85  ? 62.431 78.235  11.351  1.00 46.03  ? 84  MET B CB    1 
ATOM   7291  C  CG    . MET D  4 85  ? 63.153 77.581  10.188  1.00 58.13  ? 84  MET B CG    1 
ATOM   7292  S  SD    . MET D  4 85  ? 62.671 78.287  8.600   1.00 64.26  ? 84  MET B SD    1 
ATOM   7293  C  CE    . MET D  4 85  ? 60.921 77.910  8.560   1.00 61.84  ? 84  MET B CE    1 
ATOM   7294  N  N     . ASP D  4 86  ? 61.789 80.565  13.539  1.00 52.06  ? 85  ASP B N     1 
ATOM   7295  C  CA    . ASP D  4 86  ? 60.858 81.239  14.439  1.00 53.10  ? 85  ASP B CA    1 
ATOM   7296  C  C     . ASP D  4 86  ? 60.565 82.652  13.953  1.00 49.51  ? 85  ASP B C     1 
ATOM   7297  O  O     . ASP D  4 86  ? 59.409 83.098  13.965  1.00 52.71  ? 85  ASP B O     1 
ATOM   7298  C  CB    . ASP D  4 86  ? 61.421 81.264  15.861  1.00 60.74  ? 85  ASP B CB    1 
ATOM   7299  C  CG    . ASP D  4 86  ? 61.555 79.876  16.462  1.00 63.70  ? 85  ASP B CG    1 
ATOM   7300  O  OD1   . ASP D  4 86  ? 60.933 78.931  15.930  1.00 64.67  ? 85  ASP B OD1   1 
ATOM   7301  O  OD2   . ASP D  4 86  ? 62.278 79.732  17.471  1.00 59.92  ? 85  ASP B OD2   1 
ATOM   7302  N  N     . VAL D  4 87  ? 61.600 83.366  13.506  1.00 46.04  ? 86  VAL B N     1 
ATOM   7303  C  CA    . VAL D  4 87  ? 61.410 84.703  12.952  1.00 43.85  ? 86  VAL B CA    1 
ATOM   7304  C  C     . VAL D  4 87  ? 60.578 84.638  11.678  1.00 53.50  ? 86  VAL B C     1 
ATOM   7305  O  O     . VAL D  4 87  ? 59.740 85.510  11.422  1.00 61.99  ? 86  VAL B O     1 
ATOM   7306  C  CB    . VAL D  4 87  ? 62.775 85.373  12.706  1.00 43.51  ? 86  VAL B CB    1 
ATOM   7307  C  CG1   . VAL D  4 87  ? 62.596 86.747  12.085  1.00 47.33  ? 86  VAL B CG1   1 
ATOM   7308  C  CG2   . VAL D  4 87  ? 63.560 85.469  14.005  1.00 37.21  ? 86  VAL B CG2   1 
ATOM   7309  N  N     . VAL D  4 88  ? 60.789 83.603  10.863  1.00 47.24  ? 87  VAL B N     1 
ATOM   7310  C  CA    . VAL D  4 88  ? 60.067 83.489  9.598   1.00 46.28  ? 87  VAL B CA    1 
ATOM   7311  C  C     . VAL D  4 88  ? 58.586 83.224  9.847   1.00 37.53  ? 87  VAL B C     1 
ATOM   7312  O  O     . VAL D  4 88  ? 57.715 83.849  9.230   1.00 39.14  ? 87  VAL B O     1 
ATOM   7313  C  CB    . VAL D  4 88  ? 60.703 82.396  8.718   1.00 56.55  ? 87  VAL B CB    1 
ATOM   7314  C  CG1   . VAL D  4 88  ? 59.775 82.018  7.576   1.00 58.05  ? 87  VAL B CG1   1 
ATOM   7315  C  CG2   . VAL D  4 88  ? 62.044 82.868  8.177   1.00 55.06  ? 87  VAL B CG2   1 
ATOM   7316  N  N     . TYR D  4 89  ? 58.278 82.294  10.754  1.00 38.75  ? 88  TYR B N     1 
ATOM   7317  C  CA    . TYR D  4 89  ? 56.886 82.020  11.098  1.00 42.93  ? 88  TYR B CA    1 
ATOM   7318  C  C     . TYR D  4 89  ? 56.222 83.249  11.703  1.00 41.85  ? 88  TYR B C     1 
ATOM   7319  O  O     . TYR D  4 89  ? 55.110 83.629  11.310  1.00 49.57  ? 88  TYR B O     1 
ATOM   7320  C  CB    . TYR D  4 89  ? 56.808 80.842  12.071  1.00 47.38  ? 88  TYR B CB    1 
ATOM   7321  C  CG    . TYR D  4 89  ? 57.299 79.525  11.515  1.00 56.32  ? 88  TYR B CG    1 
ATOM   7322  C  CD1   . TYR D  4 89  ? 57.063 79.171  10.194  1.00 60.76  ? 88  TYR B CD1   1 
ATOM   7323  C  CD2   . TYR D  4 89  ? 57.999 78.633  12.316  1.00 55.52  ? 88  TYR B CD2   1 
ATOM   7324  C  CE1   . TYR D  4 89  ? 57.510 77.965  9.688   1.00 63.03  ? 88  TYR B CE1   1 
ATOM   7325  C  CE2   . TYR D  4 89  ? 58.450 77.428  11.820  1.00 60.18  ? 88  TYR B CE2   1 
ATOM   7326  C  CZ    . TYR D  4 89  ? 58.203 77.097  10.507  1.00 64.16  ? 88  TYR B CZ    1 
ATOM   7327  O  OH    . TYR D  4 89  ? 58.652 75.895  10.009  1.00 71.33  ? 88  TYR B OH    1 
ATOM   7328  N  N     . ALA D  4 90  ? 56.896 83.885  12.666  1.00 45.05  ? 89  ALA B N     1 
ATOM   7329  C  CA    . ALA D  4 90  ? 56.351 85.087  13.288  1.00 46.06  ? 89  ALA B CA    1 
ATOM   7330  C  C     . ALA D  4 90  ? 56.046 86.152  12.242  1.00 46.30  ? 89  ALA B C     1 
ATOM   7331  O  O     . ALA D  4 90  ? 54.942 86.705  12.208  1.00 48.13  ? 89  ALA B O     1 
ATOM   7332  C  CB    . ALA D  4 90  ? 57.326 85.622  14.338  1.00 42.23  ? 89  ALA B CB    1 
ATOM   7333  N  N     . LEU D  4 91  ? 57.011 86.432  11.363  1.00 39.25  ? 90  LEU B N     1 
ATOM   7334  C  CA    . LEU D  4 91  ? 56.801 87.425  10.314  1.00 37.31  ? 90  LEU B CA    1 
ATOM   7335  C  C     . LEU D  4 91  ? 55.646 87.035  9.399   1.00 44.03  ? 90  LEU B C     1 
ATOM   7336  O  O     . LEU D  4 91  ? 54.863 87.895  8.978   1.00 44.54  ? 90  LEU B O     1 
ATOM   7337  C  CB    . LEU D  4 91  ? 58.082 87.608  9.501   1.00 31.19  ? 90  LEU B CB    1 
ATOM   7338  C  CG    . LEU D  4 91  ? 59.216 88.403  10.145  1.00 40.16  ? 90  LEU B CG    1 
ATOM   7339  C  CD1   . LEU D  4 91  ? 60.508 88.167  9.393   1.00 32.75  ? 90  LEU B CD1   1 
ATOM   7340  C  CD2   . LEU D  4 91  ? 58.868 89.880  10.180  1.00 44.85  ? 90  LEU B CD2   1 
ATOM   7341  N  N     . LYS D  4 92  ? 55.525 85.745  9.077   1.00 45.13  ? 91  LYS B N     1 
ATOM   7342  C  CA    . LYS D  4 92  ? 54.452 85.308  8.188   1.00 50.69  ? 91  LYS B CA    1 
ATOM   7343  C  C     . LYS D  4 92  ? 53.088 85.555  8.817   1.00 50.43  ? 91  LYS B C     1 
ATOM   7344  O  O     . LYS D  4 92  ? 52.173 86.067  8.161   1.00 48.61  ? 91  LYS B O     1 
ATOM   7345  C  CB    . LYS D  4 92  ? 54.614 83.831  7.829   1.00 45.87  ? 91  LYS B CB    1 
ATOM   7346  C  CG    . LYS D  4 92  ? 53.482 83.310  6.949   1.00 45.17  ? 91  LYS B CG    1 
ATOM   7347  C  CD    . LYS D  4 92  ? 53.505 81.798  6.795   1.00 62.01  ? 91  LYS B CD    1 
ATOM   7348  C  CE    . LYS D  4 92  ? 54.583 81.345  5.828   1.00 72.73  ? 91  LYS B CE    1 
ATOM   7349  N  NZ    . LYS D  4 92  ? 54.497 79.881  5.575   1.00 77.69  ? 91  LYS B NZ    1 
ATOM   7350  N  N     . ARG D  4 93  ? 52.929 85.199  10.095  1.00 43.06  ? 92  ARG B N     1 
ATOM   7351  C  CA    . ARG D  4 93  ? 51.641 85.431  10.739  1.00 45.12  ? 92  ARG B CA    1 
ATOM   7352  C  C     . ARG D  4 93  ? 51.385 86.911  10.997  1.00 43.47  ? 92  ARG B C     1 
ATOM   7353  O  O     . ARG D  4 93  ? 50.222 87.315  11.105  1.00 39.13  ? 92  ARG B O     1 
ATOM   7354  C  CB    . ARG D  4 93  ? 51.537 84.632  12.039  1.00 48.38  ? 92  ARG B CB    1 
ATOM   7355  C  CG    . ARG D  4 93  ? 52.308 85.196  13.212  1.00 45.39  ? 92  ARG B CG    1 
ATOM   7356  C  CD    . ARG D  4 93  ? 51.895 84.483  14.487  1.00 52.36  ? 92  ARG B CD    1 
ATOM   7357  N  NE    . ARG D  4 93  ? 50.443 84.342  14.563  1.00 51.42  ? 92  ARG B NE    1 
ATOM   7358  C  CZ    . ARG D  4 93  ? 49.626 85.271  15.046  1.00 49.51  ? 92  ARG B CZ    1 
ATOM   7359  N  NH1   . ARG D  4 93  ? 50.117 86.415  15.505  1.00 52.98  ? 92  ARG B NH1   1 
ATOM   7360  N  NH2   . ARG D  4 93  ? 48.318 85.058  15.072  1.00 46.45  ? 92  ARG B NH2   1 
ATOM   7361  N  N     . GLN D  4 94  ? 52.438 87.730  11.087  1.00 42.65  ? 93  GLN B N     1 
ATOM   7362  C  CA    . GLN D  4 94  ? 52.272 89.180  11.109  1.00 42.33  ? 93  GLN B CA    1 
ATOM   7363  C  C     . GLN D  4 94  ? 51.884 89.742  9.749   1.00 44.65  ? 93  GLN B C     1 
ATOM   7364  O  O     . GLN D  4 94  ? 51.697 90.958  9.633   1.00 44.15  ? 93  GLN B O     1 
ATOM   7365  C  CB    . GLN D  4 94  ? 53.558 89.864  11.584  1.00 46.41  ? 93  GLN B CB    1 
ATOM   7366  C  CG    . GLN D  4 94  ? 54.016 89.486  12.986  1.00 51.86  ? 93  GLN B CG    1 
ATOM   7367  C  CD    . GLN D  4 94  ? 53.178 90.112  14.077  1.00 55.06  ? 93  GLN B CD    1 
ATOM   7368  O  OE1   . GLN D  4 94  ? 52.808 91.283  14.001  1.00 64.11  ? 93  GLN B OE1   1 
ATOM   7369  N  NE2   . GLN D  4 94  ? 52.875 89.330  15.107  1.00 48.09  ? 93  GLN B NE2   1 
ATOM   7370  N  N     . GLY D  4 95  ? 51.769 88.898  8.725   1.00 43.65  ? 94  GLY B N     1 
ATOM   7371  C  CA    . GLY D  4 95  ? 51.468 89.372  7.391   1.00 43.00  ? 94  GLY B CA    1 
ATOM   7372  C  C     . GLY D  4 95  ? 52.647 89.942  6.640   1.00 45.64  ? 94  GLY B C     1 
ATOM   7373  O  O     . GLY D  4 95  ? 52.450 90.669  5.661   1.00 42.23  ? 94  GLY B O     1 
ATOM   7374  N  N     . ARG D  4 96  ? 53.873 89.640  7.069   1.00 42.89  ? 95  ARG B N     1 
ATOM   7375  C  CA    . ARG D  4 96  ? 55.083 90.164  6.436   1.00 46.03  ? 95  ARG B CA    1 
ATOM   7376  C  C     . ARG D  4 96  ? 56.056 89.015  6.162   1.00 51.00  ? 95  ARG B C     1 
ATOM   7377  O  O     . ARG D  4 96  ? 57.152 88.955  6.718   1.00 53.55  ? 95  ARG B O     1 
ATOM   7378  C  CB    . ARG D  4 96  ? 55.749 91.233  7.305   1.00 41.38  ? 95  ARG B CB    1 
ATOM   7379  C  CG    . ARG D  4 96  ? 54.786 92.151  8.032   1.00 41.86  ? 95  ARG B CG    1 
ATOM   7380  C  CD    . ARG D  4 96  ? 55.432 93.485  8.371   1.00 42.39  ? 95  ARG B CD    1 
ATOM   7381  N  NE    . ARG D  4 96  ? 55.399 94.410  7.240   1.00 51.56  ? 95  ARG B NE    1 
ATOM   7382  C  CZ    . ARG D  4 96  ? 56.397 94.585  6.380   1.00 61.49  ? 95  ARG B CZ    1 
ATOM   7383  N  NH1   . ARG D  4 96  ? 57.526 93.900  6.517   1.00 64.17  ? 95  ARG B NH1   1 
ATOM   7384  N  NH2   . ARG D  4 96  ? 56.267 95.451  5.381   1.00 59.14  ? 95  ARG B NH2   1 
ATOM   7385  N  N     . THR D  4 97  ? 55.652 88.097  5.283   1.00 44.81  ? 96  THR B N     1 
ATOM   7386  C  CA    . THR D  4 97  ? 56.480 86.931  5.001   1.00 42.50  ? 96  THR B CA    1 
ATOM   7387  C  C     . THR D  4 97  ? 57.797 87.351  4.361   1.00 44.32  ? 96  THR B C     1 
ATOM   7388  O  O     . THR D  4 97  ? 57.872 88.335  3.620   1.00 46.81  ? 96  THR B O     1 
ATOM   7389  C  CB    . THR D  4 97  ? 55.752 85.947  4.082   1.00 38.61  ? 96  THR B CB    1 
ATOM   7390  O  OG1   . THR D  4 97  ? 55.812 86.419  2.733   1.00 59.35  ? 96  THR B OG1   1 
ATOM   7391  C  CG2   . THR D  4 97  ? 54.303 85.800  4.495   1.00 39.31  ? 96  THR B CG2   1 
ATOM   7392  N  N     . LEU D  4 98  ? 58.844 86.586  4.657   1.00 49.33  ? 97  LEU B N     1 
ATOM   7393  C  CA    . LEU D  4 98  ? 60.201 86.895  4.229   1.00 46.13  ? 97  LEU B CA    1 
ATOM   7394  C  C     . LEU D  4 98  ? 60.806 85.677  3.547   1.00 45.22  ? 97  LEU B C     1 
ATOM   7395  O  O     . LEU D  4 98  ? 60.825 84.584  4.124   1.00 44.03  ? 97  LEU B O     1 
ATOM   7396  C  CB    . LEU D  4 98  ? 61.060 87.321  5.424   1.00 39.20  ? 97  LEU B CB    1 
ATOM   7397  C  CG    . LEU D  4 98  ? 62.562 87.523  5.220   1.00 41.96  ? 97  LEU B CG    1 
ATOM   7398  C  CD1   . LEU D  4 98  ? 62.845 88.735  4.353   1.00 37.62  ? 97  LEU B CD1   1 
ATOM   7399  C  CD2   . LEU D  4 98  ? 63.256 87.654  6.570   1.00 43.59  ? 97  LEU B CD2   1 
ATOM   7400  N  N     . TYR D  4 99  ? 61.291 85.865  2.324   1.00 40.94  ? 98  TYR B N     1 
ATOM   7401  C  CA    . TYR D  4 99  ? 61.975 84.809  1.593   1.00 48.38  ? 98  TYR B CA    1 
ATOM   7402  C  C     . TYR D  4 99  ? 63.474 84.864  1.863   1.00 62.16  ? 98  TYR B C     1 
ATOM   7403  O  O     . TYR D  4 99  ? 64.054 85.940  2.037   1.00 61.42  ? 98  TYR B O     1 
ATOM   7404  C  CB    . TYR D  4 99  ? 61.733 84.931  0.087   1.00 42.02  ? 98  TYR B CB    1 
ATOM   7405  C  CG    . TYR D  4 99  ? 60.321 84.643  -0.387  1.00 42.05  ? 98  TYR B CG    1 
ATOM   7406  C  CD1   . TYR D  4 99  ? 59.387 84.031  0.443   1.00 44.91  ? 98  TYR B CD1   1 
ATOM   7407  C  CD2   . TYR D  4 99  ? 59.930 84.978  -1.680  1.00 42.42  ? 98  TYR B CD2   1 
ATOM   7408  C  CE1   . TYR D  4 99  ? 58.100 83.768  -0.003  1.00 49.16  ? 98  TYR B CE1   1 
ATOM   7409  C  CE2   . TYR D  4 99  ? 58.651 84.721  -2.133  1.00 42.11  ? 98  TYR B CE2   1 
ATOM   7410  C  CZ    . TYR D  4 99  ? 57.740 84.115  -1.294  1.00 57.76  ? 98  TYR B CZ    1 
ATOM   7411  O  OH    . TYR D  4 99  ? 56.467 83.858  -1.751  1.00 56.60  ? 98  TYR B OH    1 
ATOM   7412  N  N     . GLY D  4 100 ? 64.099 83.690  1.889   1.00 64.72  ? 99  GLY B N     1 
ATOM   7413  C  CA    . GLY D  4 100 ? 65.540 83.586  1.958   1.00 60.59  ? 99  GLY B CA    1 
ATOM   7414  C  C     . GLY D  4 100 ? 66.127 83.161  3.289   1.00 61.23  ? 99  GLY B C     1 
ATOM   7415  O  O     . GLY D  4 100 ? 67.352 83.222  3.447   1.00 67.59  ? 99  GLY B O     1 
ATOM   7416  N  N     . PHE D  4 101 ? 65.306 82.735  4.251   1.00 60.69  ? 100 PHE B N     1 
ATOM   7417  C  CA    . PHE D  4 101 ? 65.820 82.281  5.538   1.00 56.37  ? 100 PHE B CA    1 
ATOM   7418  C  C     . PHE D  4 101 ? 65.130 80.999  5.988   1.00 60.65  ? 100 PHE B C     1 
ATOM   7419  O  O     . PHE D  4 101 ? 64.967 80.766  7.191   1.00 72.01  ? 100 PHE B O     1 
ATOM   7420  C  CB    . PHE D  4 101 ? 65.663 83.364  6.609   1.00 57.05  ? 100 PHE B CB    1 
ATOM   7421  C  CG    . PHE D  4 101 ? 66.546 84.560  6.396   1.00 55.46  ? 100 PHE B CG    1 
ATOM   7422  C  CD1   . PHE D  4 101 ? 66.125 85.617  5.607   1.00 53.75  ? 100 PHE B CD1   1 
ATOM   7423  C  CD2   . PHE D  4 101 ? 67.797 84.628  6.988   1.00 55.13  ? 100 PHE B CD2   1 
ATOM   7424  C  CE1   . PHE D  4 101 ? 66.936 86.718  5.410   1.00 53.03  ? 100 PHE B CE1   1 
ATOM   7425  C  CE2   . PHE D  4 101 ? 68.613 85.729  6.794   1.00 51.42  ? 100 PHE B CE2   1 
ATOM   7426  C  CZ    . PHE D  4 101 ? 68.181 86.774  6.004   1.00 54.21  ? 100 PHE B CZ    1 
ATOM   7427  N  N     . GLY D  4 102 ? 64.727 80.163  5.045   1.00 56.03  ? 101 GLY B N     1 
ATOM   7428  C  CA    . GLY D  4 102 ? 64.003 78.944  5.336   1.00 60.28  ? 101 GLY B CA    1 
ATOM   7429  C  C     . GLY D  4 102 ? 62.541 79.049  4.935   1.00 75.02  ? 101 GLY B C     1 
ATOM   7430  O  O     . GLY D  4 102 ? 62.040 80.102  4.539   1.00 77.54  ? 101 GLY B O     1 
ATOM   7431  N  N     . GLY D  4 103 ? 61.857 77.915  5.047   1.00 71.71  ? 102 GLY B N     1 
ATOM   7432  C  CA    . GLY D  4 103 ? 60.453 77.834  4.688   1.00 75.50  ? 102 GLY B CA    1 
ATOM   7433  C  C     . GLY D  4 103 ? 60.225 77.920  3.192   1.00 79.95  ? 102 GLY B C     1 
ATOM   7434  O  O     . GLY D  4 103 ? 59.465 78.763  2.718   1.00 81.60  ? 102 GLY B O     1 
ATOM   7435  N  N     . LYS E  5 15  ? 27.007 61.896  32.622  1.00 91.81  ? 15  LYS C N     1 
ATOM   7436  C  CA    . LYS E  5 15  ? 27.670 63.182  32.805  1.00 92.59  ? 15  LYS C CA    1 
ATOM   7437  C  C     . LYS E  5 15  ? 28.453 63.578  31.554  1.00 85.59  ? 15  LYS C C     1 
ATOM   7438  O  O     . LYS E  5 15  ? 29.315 62.834  31.083  1.00 88.59  ? 15  LYS C O     1 
ATOM   7439  C  CB    . LYS E  5 15  ? 28.598 63.137  34.024  1.00 99.01  ? 15  LYS C CB    1 
ATOM   7440  C  CG    . LYS E  5 15  ? 29.555 61.953  34.039  1.00 105.62 ? 15  LYS C CG    1 
ATOM   7441  C  CD    . LYS E  5 15  ? 30.528 62.039  35.201  1.00 108.11 ? 15  LYS C CD    1 
ATOM   7442  C  CE    . LYS E  5 15  ? 31.625 60.992  35.079  1.00 110.19 ? 15  LYS C CE    1 
ATOM   7443  N  NZ    . LYS E  5 15  ? 31.074 59.610  35.003  1.00 113.28 ? 15  LYS C NZ    1 
ATOM   7444  N  N     . THR E  5 16  ? 28.142 64.753  31.012  1.00 82.26  ? 16  THR C N     1 
ATOM   7445  C  CA    . THR E  5 16  ? 28.834 65.229  29.826  1.00 70.39  ? 16  THR C CA    1 
ATOM   7446  C  C     . THR E  5 16  ? 30.238 65.711  30.181  1.00 65.32  ? 16  THR C C     1 
ATOM   7447  O  O     . THR E  5 16  ? 30.554 65.998  31.339  1.00 65.30  ? 16  THR C O     1 
ATOM   7448  C  CB    . THR E  5 16  ? 28.053 66.361  29.157  1.00 66.77  ? 16  THR C CB    1 
ATOM   7449  O  OG1   . THR E  5 16  ? 28.008 67.497  30.030  1.00 69.82  ? 16  THR C OG1   1 
ATOM   7450  C  CG2   . THR E  5 16  ? 26.632 65.917  28.837  1.00 69.44  ? 16  THR C CG2   1 
ATOM   7451  N  N     . ARG E  5 17  ? 31.089 65.795  29.157  1.00 61.76  ? 17  ARG C N     1 
ATOM   7452  C  CA    . ARG E  5 17  ? 32.437 66.310  29.369  1.00 63.07  ? 17  ARG C CA    1 
ATOM   7453  C  C     . ARG E  5 17  ? 32.424 67.801  29.676  1.00 67.28  ? 17  ARG C C     1 
ATOM   7454  O  O     . ARG E  5 17  ? 33.343 68.305  30.331  1.00 66.51  ? 17  ARG C O     1 
ATOM   7455  C  CB    . ARG E  5 17  ? 33.312 66.020  28.150  1.00 58.14  ? 17  ARG C CB    1 
ATOM   7456  C  CG    . ARG E  5 17  ? 33.764 64.573  28.051  1.00 59.93  ? 17  ARG C CG    1 
ATOM   7457  C  CD    . ARG E  5 17  ? 34.835 64.395  26.987  1.00 60.61  ? 17  ARG C CD    1 
ATOM   7458  N  NE    . ARG E  5 17  ? 34.283 64.414  25.637  1.00 66.01  ? 17  ARG C NE    1 
ATOM   7459  C  CZ    . ARG E  5 17  ? 35.020 64.383  24.532  1.00 67.78  ? 17  ARG C CZ    1 
ATOM   7460  N  NH1   . ARG E  5 17  ? 36.343 64.337  24.618  1.00 67.39  ? 17  ARG C NH1   1 
ATOM   7461  N  NH2   . ARG E  5 17  ? 34.434 64.399  23.342  1.00 69.72  ? 17  ARG C NH2   1 
ATOM   7462  N  N     . SER E  5 18  ? 31.396 68.519  29.216  1.00 63.39  ? 18  SER C N     1 
ATOM   7463  C  CA    . SER E  5 18  ? 31.269 69.932  29.557  1.00 57.27  ? 18  SER C CA    1 
ATOM   7464  C  C     . SER E  5 18  ? 31.078 70.112  31.058  1.00 59.60  ? 18  SER C C     1 
ATOM   7465  O  O     . SER E  5 18  ? 31.759 70.929  31.689  1.00 59.00  ? 18  SER C O     1 
ATOM   7466  C  CB    . SER E  5 18  ? 30.107 70.553  28.782  1.00 49.65  ? 18  SER C CB    1 
ATOM   7467  O  OG    . SER E  5 18  ? 30.264 70.354  27.388  1.00 50.61  ? 18  SER C OG    1 
ATOM   7468  N  N     . SER E  5 19  ? 30.148 69.354  31.647  1.00 59.35  ? 19  SER C N     1 
ATOM   7469  C  CA    . SER E  5 19  ? 29.999 69.361  33.099  1.00 64.02  ? 19  SER C CA    1 
ATOM   7470  C  C     . SER E  5 19  ? 31.271 68.873  33.780  1.00 55.47  ? 19  SER C C     1 
ATOM   7471  O  O     . SER E  5 19  ? 31.658 69.389  34.835  1.00 47.61  ? 19  SER C O     1 
ATOM   7472  C  CB    . SER E  5 19  ? 28.806 68.496  33.511  1.00 72.88  ? 19  SER C CB    1 
ATOM   7473  O  OG    . SER E  5 19  ? 27.577 69.109  33.161  1.00 80.19  ? 19  SER C OG    1 
ATOM   7474  N  N     . ARG E  5 20  ? 31.936 67.880  33.183  1.00 53.10  ? 20  ARG C N     1 
ATOM   7475  C  CA    . ARG E  5 20  ? 33.186 67.369  33.734  1.00 49.73  ? 20  ARG C CA    1 
ATOM   7476  C  C     . ARG E  5 20  ? 34.264 68.445  33.776  1.00 50.02  ? 20  ARG C C     1 
ATOM   7477  O  O     . ARG E  5 20  ? 35.151 68.404  34.637  1.00 42.81  ? 20  ARG C O     1 
ATOM   7478  C  CB    . ARG E  5 20  ? 33.650 66.164  32.910  1.00 56.62  ? 20  ARG C CB    1 
ATOM   7479  C  CG    . ARG E  5 20  ? 34.964 65.538  33.346  1.00 66.18  ? 20  ARG C CG    1 
ATOM   7480  C  CD    . ARG E  5 20  ? 34.812 64.036  33.544  1.00 79.22  ? 20  ARG C CD    1 
ATOM   7481  N  NE    . ARG E  5 20  ? 34.059 63.400  32.465  1.00 88.39  ? 20  ARG C NE    1 
ATOM   7482  C  CZ    . ARG E  5 20  ? 34.605 62.675  31.493  1.00 92.21  ? 20  ARG C CZ    1 
ATOM   7483  N  NH1   . ARG E  5 20  ? 35.916 62.484  31.458  1.00 94.01  ? 20  ARG C NH1   1 
ATOM   7484  N  NH2   . ARG E  5 20  ? 33.836 62.134  30.557  1.00 91.12  ? 20  ARG C NH2   1 
ATOM   7485  N  N     . ALA E  5 21  ? 34.200 69.418  32.867  1.00 56.58  ? 21  ALA C N     1 
ATOM   7486  C  CA    . ALA E  5 21  ? 35.164 70.508  32.810  1.00 54.61  ? 21  ALA C CA    1 
ATOM   7487  C  C     . ALA E  5 21  ? 34.617 71.816  33.367  1.00 55.02  ? 21  ALA C C     1 
ATOM   7488  O  O     . ALA E  5 21  ? 35.326 72.827  33.342  1.00 49.69  ? 21  ALA C O     1 
ATOM   7489  C  CB    . ALA E  5 21  ? 35.635 70.723  31.368  1.00 54.24  ? 21  ALA C CB    1 
ATOM   7490  N  N     . GLY E  5 22  ? 33.385 71.825  33.866  1.00 56.60  ? 22  GLY C N     1 
ATOM   7491  C  CA    . GLY E  5 22  ? 32.805 73.056  34.377  1.00 55.17  ? 22  GLY C CA    1 
ATOM   7492  C  C     . GLY E  5 22  ? 32.558 74.095  33.306  1.00 54.74  ? 22  GLY C C     1 
ATOM   7493  O  O     . GLY E  5 22  ? 32.825 75.284  33.521  1.00 59.18  ? 22  GLY C O     1 
ATOM   7494  N  N     . LEU E  5 23  ? 32.053 73.671  32.148  1.00 58.53  ? 23  LEU C N     1 
ATOM   7495  C  CA    . LEU E  5 23  ? 31.850 74.558  31.013  1.00 48.97  ? 23  LEU C CA    1 
ATOM   7496  C  C     . LEU E  5 23  ? 30.424 74.440  30.498  1.00 43.99  ? 23  LEU C C     1 
ATOM   7497  O  O     . LEU E  5 23  ? 29.767 73.409  30.663  1.00 48.06  ? 23  LEU C O     1 
ATOM   7498  C  CB    . LEU E  5 23  ? 32.825 74.244  29.872  1.00 44.53  ? 23  LEU C CB    1 
ATOM   7499  C  CG    . LEU E  5 23  ? 34.319 74.253  30.196  1.00 42.16  ? 23  LEU C CG    1 
ATOM   7500  C  CD1   . LEU E  5 23  ? 35.133 73.904  28.956  1.00 48.16  ? 23  LEU C CD1   1 
ATOM   7501  C  CD2   . LEU E  5 23  ? 34.743 75.601  30.756  1.00 42.33  ? 23  LEU C CD2   1 
ATOM   7502  N  N     . GLN E  5 24  ? 29.954 75.516  29.870  1.00 38.57  ? 24  GLN C N     1 
ATOM   7503  C  CA    . GLN E  5 24  ? 28.669 75.505  29.186  1.00 44.44  ? 24  GLN C CA    1 
ATOM   7504  C  C     . GLN E  5 24  ? 28.797 75.104  27.723  1.00 50.97  ? 24  GLN C C     1 
ATOM   7505  O  O     . GLN E  5 24  ? 27.860 74.528  27.161  1.00 51.92  ? 24  GLN C O     1 
ATOM   7506  C  CB    . GLN E  5 24  ? 28.009 76.883  29.279  1.00 39.24  ? 24  GLN C CB    1 
ATOM   7507  C  CG    . GLN E  5 24  ? 27.881 77.426  30.690  1.00 44.50  ? 24  GLN C CG    1 
ATOM   7508  C  CD    . GLN E  5 24  ? 26.852 76.678  31.516  1.00 55.40  ? 24  GLN C CD    1 
ATOM   7509  O  OE1   . GLN E  5 24  ? 25.743 76.408  31.052  1.00 58.60  ? 24  GLN C OE1   1 
ATOM   7510  N  NE2   . GLN E  5 24  ? 27.216 76.337  32.749  1.00 55.63  ? 24  GLN C NE2   1 
ATOM   7511  N  N     . PHE E  5 25  ? 29.944 75.388  27.100  1.00 47.11  ? 25  PHE C N     1 
ATOM   7512  C  CA    . PHE E  5 25  ? 30.182 75.096  25.696  1.00 51.35  ? 25  PHE C CA    1 
ATOM   7513  C  C     . PHE E  5 25  ? 30.455 73.606  25.486  1.00 55.15  ? 25  PHE C C     1 
ATOM   7514  O  O     . PHE E  5 25  ? 31.034 72.944  26.351  1.00 64.39  ? 25  PHE C O     1 
ATOM   7515  C  CB    . PHE E  5 25  ? 31.355 75.922  25.177  1.00 41.96  ? 25  PHE C CB    1 
ATOM   7516  C  CG    . PHE E  5 25  ? 30.946 77.246  24.601  1.00 38.91  ? 25  PHE C CG    1 
ATOM   7517  C  CD1   . PHE E  5 25  ? 30.145 78.112  25.326  1.00 37.74  ? 25  PHE C CD1   1 
ATOM   7518  C  CD2   . PHE E  5 25  ? 31.359 77.623  23.334  1.00 47.47  ? 25  PHE C CD2   1 
ATOM   7519  C  CE1   . PHE E  5 25  ? 29.762 79.329  24.796  1.00 45.00  ? 25  PHE C CE1   1 
ATOM   7520  C  CE2   . PHE E  5 25  ? 30.982 78.840  22.800  1.00 40.67  ? 25  PHE C CE2   1 
ATOM   7521  C  CZ    . PHE E  5 25  ? 30.181 79.693  23.530  1.00 42.62  ? 25  PHE C CZ    1 
ATOM   7522  N  N     . PRO E  5 26  ? 30.051 73.058  24.338  1.00 47.24  ? 26  PRO C N     1 
ATOM   7523  C  CA    . PRO E  5 26  ? 30.102 71.603  24.132  1.00 48.37  ? 26  PRO C CA    1 
ATOM   7524  C  C     . PRO E  5 26  ? 31.516 71.125  23.838  1.00 56.23  ? 26  PRO C C     1 
ATOM   7525  O  O     . PRO E  5 26  ? 32.091 71.438  22.791  1.00 64.27  ? 26  PRO C O     1 
ATOM   7526  C  CB    . PRO E  5 26  ? 29.166 71.394  22.934  1.00 48.64  ? 26  PRO C CB    1 
ATOM   7527  C  CG    . PRO E  5 26  ? 29.300 72.659  22.154  1.00 48.70  ? 26  PRO C CG    1 
ATOM   7528  C  CD    . PRO E  5 26  ? 29.498 73.761  23.165  1.00 44.66  ? 26  PRO C CD    1 
ATOM   7529  N  N     . VAL E  5 27  ? 32.077 70.348  24.766  1.00 53.92  ? 27  VAL C N     1 
ATOM   7530  C  CA    . VAL E  5 27  ? 33.408 69.787  24.558  1.00 49.35  ? 27  VAL C CA    1 
ATOM   7531  C  C     . VAL E  5 27  ? 33.385 68.752  23.439  1.00 54.10  ? 27  VAL C C     1 
ATOM   7532  O  O     . VAL E  5 27  ? 34.290 68.710  22.595  1.00 63.30  ? 27  VAL C O     1 
ATOM   7533  C  CB    . VAL E  5 27  ? 33.946 69.192  25.872  1.00 47.58  ? 27  VAL C CB    1 
ATOM   7534  C  CG1   . VAL E  5 27  ? 35.228 68.414  25.620  1.00 50.97  ? 27  VAL C CG1   1 
ATOM   7535  C  CG2   . VAL E  5 27  ? 34.176 70.292  26.899  1.00 47.50  ? 27  VAL C CG2   1 
ATOM   7536  N  N     . GLY E  5 28  ? 32.350 67.909  23.406  1.00 55.52  ? 28  GLY C N     1 
ATOM   7537  C  CA    . GLY E  5 28  ? 32.273 66.886  22.374  1.00 59.86  ? 28  GLY C CA    1 
ATOM   7538  C  C     . GLY E  5 28  ? 32.178 67.464  20.975  1.00 59.01  ? 28  GLY C C     1 
ATOM   7539  O  O     . GLY E  5 28  ? 32.809 66.962  20.040  1.00 63.82  ? 28  GLY C O     1 
ATOM   7540  N  N     . ARG E  5 29  ? 31.392 68.531  20.812  1.00 56.74  ? 29  ARG C N     1 
ATOM   7541  C  CA    . ARG E  5 29  ? 31.277 69.160  19.501  1.00 48.55  ? 29  ARG C CA    1 
ATOM   7542  C  C     . ARG E  5 29  ? 32.588 69.808  19.083  1.00 55.30  ? 29  ARG C C     1 
ATOM   7543  O  O     . ARG E  5 29  ? 32.983 69.716  17.917  1.00 66.10  ? 29  ARG C O     1 
ATOM   7544  C  CB    . ARG E  5 29  ? 30.149 70.191  19.498  1.00 39.55  ? 29  ARG C CB    1 
ATOM   7545  C  CG    . ARG E  5 29  ? 29.976 70.881  18.153  1.00 40.26  ? 29  ARG C CG    1 
ATOM   7546  C  CD    . ARG E  5 29  ? 28.874 71.921  18.180  1.00 39.15  ? 29  ARG C CD    1 
ATOM   7547  N  NE    . ARG E  5 29  ? 27.556 71.324  18.360  1.00 44.81  ? 29  ARG C NE    1 
ATOM   7548  C  CZ    . ARG E  5 29  ? 26.416 71.968  18.141  1.00 58.20  ? 29  ARG C CZ    1 
ATOM   7549  N  NH1   . ARG E  5 29  ? 26.437 73.226  17.726  1.00 64.96  ? 29  ARG C NH1   1 
ATOM   7550  N  NH2   . ARG E  5 29  ? 25.255 71.356  18.329  1.00 62.98  ? 29  ARG C NH2   1 
ATOM   7551  N  N     . VAL E  5 30  ? 33.275 70.470  20.015  1.00 46.38  ? 30  VAL C N     1 
ATOM   7552  C  CA    . VAL E  5 30  ? 34.564 71.075  19.691  1.00 46.47  ? 30  VAL C CA    1 
ATOM   7553  C  C     . VAL E  5 30  ? 35.576 70.001  19.307  1.00 53.81  ? 30  VAL C C     1 
ATOM   7554  O  O     . VAL E  5 30  ? 36.417 70.207  18.424  1.00 56.53  ? 30  VAL C O     1 
ATOM   7555  C  CB    . VAL E  5 30  ? 35.059 71.938  20.868  1.00 34.24  ? 30  VAL C CB    1 
ATOM   7556  C  CG1   . VAL E  5 30  ? 36.498 72.369  20.650  1.00 30.17  ? 30  VAL C CG1   1 
ATOM   7557  C  CG2   . VAL E  5 30  ? 34.168 73.156  21.031  1.00 35.84  ? 30  VAL C CG2   1 
ATOM   7558  N  N     . HIS E  5 31  ? 35.502 68.836  19.953  1.00 53.26  ? 31  HIS C N     1 
ATOM   7559  C  CA    . HIS E  5 31  ? 36.374 67.721  19.596  1.00 54.66  ? 31  HIS C CA    1 
ATOM   7560  C  C     . HIS E  5 31  ? 36.089 67.240  18.176  1.00 53.15  ? 31  HIS C C     1 
ATOM   7561  O  O     . HIS E  5 31  ? 36.984 67.198  17.318  1.00 49.55  ? 31  HIS C O     1 
ATOM   7562  C  CB    . HIS E  5 31  ? 36.178 66.586  20.603  1.00 50.57  ? 31  HIS C CB    1 
ATOM   7563  C  CG    . HIS E  5 31  ? 37.375 65.705  20.773  1.00 60.45  ? 31  HIS C CG    1 
ATOM   7564  N  ND1   . HIS E  5 31  ? 37.533 64.873  21.860  1.00 63.60  ? 31  HIS C ND1   1 
ATOM   7565  C  CD2   . HIS E  5 31  ? 38.472 65.525  19.999  1.00 64.37  ? 31  HIS C CD2   1 
ATOM   7566  C  CE1   . HIS E  5 31  ? 38.675 64.219  21.751  1.00 66.02  ? 31  HIS C CE1   1 
ATOM   7567  N  NE2   . HIS E  5 31  ? 39.264 64.595  20.629  1.00 63.99  ? 31  HIS C NE2   1 
ATOM   7568  N  N     . ARG E  5 32  ? 34.826 66.887  17.913  1.00 53.03  ? 32  ARG C N     1 
ATOM   7569  C  CA    . ARG E  5 32  ? 34.441 66.373  16.602  1.00 54.95  ? 32  ARG C CA    1 
ATOM   7570  C  C     . ARG E  5 32  ? 34.743 67.380  15.499  1.00 55.47  ? 32  ARG C C     1 
ATOM   7571  O  O     . ARG E  5 32  ? 35.113 66.996  14.384  1.00 63.60  ? 32  ARG C O     1 
ATOM   7572  C  CB    . ARG E  5 32  ? 32.961 65.993  16.607  1.00 55.07  ? 32  ARG C CB    1 
ATOM   7573  C  CG    . ARG E  5 32  ? 32.216 66.339  15.331  1.00 58.43  ? 32  ARG C CG    1 
ATOM   7574  C  CD    . ARG E  5 32  ? 30.770 65.883  15.397  1.00 65.90  ? 32  ARG C CD    1 
ATOM   7575  N  NE    . ARG E  5 32  ? 29.951 66.547  14.388  1.00 74.53  ? 32  ARG C NE    1 
ATOM   7576  C  CZ    . ARG E  5 32  ? 29.146 67.575  14.638  1.00 76.79  ? 32  ARG C CZ    1 
ATOM   7577  N  NH1   . ARG E  5 32  ? 29.044 68.055  15.871  1.00 67.81  ? 32  ARG C NH1   1 
ATOM   7578  N  NH2   . ARG E  5 32  ? 28.439 68.118  13.656  1.00 81.65  ? 32  ARG C NH2   1 
ATOM   7579  N  N     . LEU E  5 33  ? 34.597 68.674  15.790  1.00 46.75  ? 33  LEU C N     1 
ATOM   7580  C  CA    . LEU E  5 33  ? 34.953 69.697  14.811  1.00 45.32  ? 33  LEU C CA    1 
ATOM   7581  C  C     . LEU E  5 33  ? 36.461 69.811  14.646  1.00 44.93  ? 33  LEU C C     1 
ATOM   7582  O  O     . LEU E  5 33  ? 36.942 70.104  13.546  1.00 54.11  ? 33  LEU C O     1 
ATOM   7583  C  CB    . LEU E  5 33  ? 34.366 71.049  15.217  1.00 35.13  ? 33  LEU C CB    1 
ATOM   7584  C  CG    . LEU E  5 33  ? 32.847 71.217  15.163  1.00 54.34  ? 33  LEU C CG    1 
ATOM   7585  C  CD1   . LEU E  5 33  ? 32.454 72.613  15.631  1.00 45.51  ? 33  LEU C CD1   1 
ATOM   7586  C  CD2   . LEU E  5 33  ? 32.314 70.943  13.768  1.00 37.27  ? 33  LEU C CD2   1 
ATOM   7587  N  N     . LEU E  5 34  ? 37.218 69.586  15.723  1.00 48.78  ? 34  LEU C N     1 
ATOM   7588  C  CA    . LEU E  5 34  ? 38.672 69.660  15.638  1.00 50.51  ? 34  LEU C CA    1 
ATOM   7589  C  C     . LEU E  5 34  ? 39.233 68.562  14.741  1.00 64.68  ? 34  LEU C C     1 
ATOM   7590  O  O     . LEU E  5 34  ? 40.156 68.814  13.959  1.00 75.77  ? 34  LEU C O     1 
ATOM   7591  C  CB    . LEU E  5 34  ? 39.290 69.585  17.033  1.00 45.71  ? 34  LEU C CB    1 
ATOM   7592  C  CG    . LEU E  5 34  ? 39.504 70.918  17.752  1.00 50.94  ? 34  LEU C CG    1 
ATOM   7593  C  CD1   . LEU E  5 34  ? 39.954 70.666  19.183  1.00 44.10  ? 34  LEU C CD1   1 
ATOM   7594  C  CD2   . LEU E  5 34  ? 40.513 71.782  17.008  1.00 32.55  ? 34  LEU C CD2   1 
ATOM   7595  N  N     . ARG E  5 35  ? 38.695 67.339  14.830  1.00 62.23  ? 35  ARG C N     1 
ATOM   7596  C  CA    . ARG E  5 35  ? 39.159 66.306  13.911  1.00 65.60  ? 35  ARG C CA    1 
ATOM   7597  C  C     . ARG E  5 35  ? 38.481 66.362  12.545  1.00 65.49  ? 35  ARG C C     1 
ATOM   7598  O  O     . ARG E  5 35  ? 39.092 65.949  11.551  1.00 76.83  ? 35  ARG C O     1 
ATOM   7599  C  CB    . ARG E  5 35  ? 38.983 64.904  14.505  1.00 70.92  ? 35  ARG C CB    1 
ATOM   7600  C  CG    . ARG E  5 35  ? 37.854 64.748  15.490  1.00 73.59  ? 35  ARG C CG    1 
ATOM   7601  C  CD    . ARG E  5 35  ? 37.690 63.283  15.845  1.00 78.95  ? 35  ARG C CD    1 
ATOM   7602  N  NE    . ARG E  5 35  ? 36.984 63.094  17.107  1.00 86.04  ? 35  ARG C NE    1 
ATOM   7603  C  CZ    . ARG E  5 35  ? 37.574 62.752  18.247  1.00 93.92  ? 35  ARG C CZ    1 
ATOM   7604  N  NH1   . ARG E  5 35  ? 38.886 62.552  18.285  1.00 96.77  ? 35  ARG C NH1   1 
ATOM   7605  N  NH2   . ARG E  5 35  ? 36.850 62.601  19.349  1.00 93.60  ? 35  ARG C NH2   1 
ATOM   7606  N  N     . LYS E  5 36  ? 37.244 66.862  12.463  1.00 65.43  ? 36  LYS C N     1 
ATOM   7607  C  CA    . LYS E  5 36  ? 36.555 66.981  11.180  1.00 59.24  ? 36  LYS C CA    1 
ATOM   7608  C  C     . LYS E  5 36  ? 37.200 68.005  10.249  1.00 55.65  ? 36  LYS C C     1 
ATOM   7609  O  O     . LYS E  5 36  ? 37.051 67.889  9.027   1.00 59.30  ? 36  LYS C O     1 
ATOM   7610  C  CB    . LYS E  5 36  ? 35.084 67.351  11.398  1.00 65.59  ? 36  LYS C CB    1 
ATOM   7611  C  CG    . LYS E  5 36  ? 34.199 67.146  10.170  1.00 76.65  ? 36  LYS C CG    1 
ATOM   7612  C  CD    . LYS E  5 36  ? 32.777 67.619  10.422  1.00 82.18  ? 36  LYS C CD    1 
ATOM   7613  C  CE    . LYS E  5 36  ? 32.735 69.123  10.624  1.00 80.22  ? 36  LYS C CE    1 
ATOM   7614  N  NZ    . LYS E  5 36  ? 31.345 69.617  10.812  1.00 79.13  ? 36  LYS C NZ    1 
ATOM   7615  N  N     . GLY E  5 37  ? 37.893 69.005  10.791  1.00 50.62  ? 37  GLY C N     1 
ATOM   7616  C  CA    . GLY E  5 37  ? 38.537 70.013  9.965   1.00 50.17  ? 37  GLY C CA    1 
ATOM   7617  C  C     . GLY E  5 37  ? 39.997 69.742  9.658   1.00 60.87  ? 37  GLY C C     1 
ATOM   7618  O  O     . GLY E  5 37  ? 40.728 70.650  9.258   1.00 66.56  ? 37  GLY C O     1 
ATOM   7619  N  N     . ASN E  5 38  ? 40.408 68.478  9.834   1.00 57.30  ? 38  ASN C N     1 
ATOM   7620  C  CA    . ASN E  5 38  ? 41.770 67.975  9.658   1.00 67.25  ? 38  ASN C CA    1 
ATOM   7621  C  C     . ASN E  5 38  ? 42.857 69.017  9.903   1.00 61.99  ? 38  ASN C C     1 
ATOM   7622  O  O     . ASN E  5 38  ? 43.649 69.323  9.008   1.00 62.13  ? 38  ASN C O     1 
ATOM   7623  C  CB    . ASN E  5 38  ? 41.934 67.350  8.264   1.00 82.85  ? 38  ASN C CB    1 
ATOM   7624  C  CG    . ASN E  5 38  ? 41.472 68.260  7.137   1.00 96.54  ? 38  ASN C CG    1 
ATOM   7625  O  OD1   . ASN E  5 38  ? 41.773 69.454  7.112   1.00 103.50 ? 38  ASN C OD1   1 
ATOM   7626  N  ND2   . ASN E  5 38  ? 40.752 67.684  6.181   1.00 97.39  ? 38  ASN C ND2   1 
ATOM   7627  N  N     . TYR E  5 39  ? 42.910 69.557  11.122  1.00 64.73  ? 39  TYR C N     1 
ATOM   7628  C  CA    . TYR E  5 39  ? 44.018 70.429  11.487  1.00 51.13  ? 39  TYR C CA    1 
ATOM   7629  C  C     . TYR E  5 39  ? 45.270 69.628  11.815  1.00 48.34  ? 39  TYR C C     1 
ATOM   7630  O  O     . TYR E  5 39  ? 46.386 70.140  11.673  1.00 49.63  ? 39  TYR C O     1 
ATOM   7631  C  CB    . TYR E  5 39  ? 43.619 71.318  12.664  1.00 37.68  ? 39  TYR C CB    1 
ATOM   7632  C  CG    . TYR E  5 39  ? 42.435 72.209  12.360  1.00 41.18  ? 39  TYR C CG    1 
ATOM   7633  C  CD1   . TYR E  5 39  ? 41.136 71.776  12.595  1.00 41.13  ? 39  TYR C CD1   1 
ATOM   7634  C  CD2   . TYR E  5 39  ? 42.616 73.481  11.831  1.00 38.64  ? 39  TYR C CD2   1 
ATOM   7635  C  CE1   . TYR E  5 39  ? 40.052 72.585  12.318  1.00 40.08  ? 39  TYR C CE1   1 
ATOM   7636  C  CE2   . TYR E  5 39  ? 41.536 74.297  11.550  1.00 37.09  ? 39  TYR C CE2   1 
ATOM   7637  C  CZ    . TYR E  5 39  ? 40.257 73.843  11.795  1.00 43.90  ? 39  TYR C CZ    1 
ATOM   7638  O  OH    . TYR E  5 39  ? 39.180 74.649  11.516  1.00 54.48  ? 39  TYR C OH    1 
ATOM   7639  N  N     . ALA E  5 40  ? 45.106 68.377  12.236  1.00 50.35  ? 40  ALA C N     1 
ATOM   7640  C  CA    . ALA E  5 40  ? 46.223 67.473  12.475  1.00 57.37  ? 40  ALA C CA    1 
ATOM   7641  C  C     . ALA E  5 40  ? 45.694 66.047  12.396  1.00 59.34  ? 40  ALA C C     1 
ATOM   7642  O  O     . ALA E  5 40  ? 44.490 65.817  12.247  1.00 58.83  ? 40  ALA C O     1 
ATOM   7643  C  CB    . ALA E  5 40  ? 46.896 67.749  13.820  1.00 53.66  ? 40  ALA C CB    1 
ATOM   7644  N  N     . GLU E  5 41  ? 46.609 65.082  12.502  1.00 60.53  ? 41  GLU C N     1 
ATOM   7645  C  CA    . GLU E  5 41  ? 46.206 63.684  12.408  1.00 63.21  ? 41  GLU C CA    1 
ATOM   7646  C  C     . GLU E  5 41  ? 45.427 63.246  13.641  1.00 65.62  ? 41  GLU C C     1 
ATOM   7647  O  O     . GLU E  5 41  ? 44.400 62.568  13.525  1.00 71.86  ? 41  GLU C O     1 
ATOM   7648  C  CB    . GLU E  5 41  ? 47.430 62.794  12.199  1.00 69.64  ? 41  GLU C CB    1 
ATOM   7649  C  CG    . GLU E  5 41  ? 47.085 61.332  11.984  1.00 87.40  ? 41  GLU C CG    1 
ATOM   7650  C  CD    . GLU E  5 41  ? 46.043 61.140  10.898  1.00 105.16 ? 41  GLU C CD    1 
ATOM   7651  O  OE1   . GLU E  5 41  ? 46.167 61.777  9.829   1.00 110.11 ? 41  GLU C OE1   1 
ATOM   7652  O  OE2   . GLU E  5 41  ? 45.093 60.361  11.121  1.00 112.08 ? 41  GLU C OE2   1 
ATOM   7653  N  N     . ARG E  5 42  ? 45.892 63.626  14.829  1.00 61.11  ? 42  ARG C N     1 
ATOM   7654  C  CA    . ARG E  5 42  ? 45.235 63.255  16.072  1.00 60.51  ? 42  ARG C CA    1 
ATOM   7655  C  C     . ARG E  5 42  ? 44.995 64.493  16.926  1.00 53.59  ? 42  ARG C C     1 
ATOM   7656  O  O     . ARG E  5 42  ? 45.691 65.505  16.805  1.00 57.05  ? 42  ARG C O     1 
ATOM   7657  C  CB    . ARG E  5 42  ? 46.055 62.216  16.853  1.00 73.15  ? 42  ARG C CB    1 
ATOM   7658  C  CG    . ARG E  5 42  ? 47.543 62.235  16.569  1.00 81.97  ? 42  ARG C CG    1 
ATOM   7659  C  CD    . ARG E  5 42  ? 48.272 61.224  17.440  1.00 89.04  ? 42  ARG C CD    1 
ATOM   7660  N  NE    . ARG E  5 42  ? 47.921 59.844  17.117  1.00 91.98  ? 42  ARG C NE    1 
ATOM   7661  C  CZ    . ARG E  5 42  ? 48.246 58.799  17.870  1.00 94.25  ? 42  ARG C CZ    1 
ATOM   7662  N  NH1   . ARG E  5 42  ? 48.922 58.979  18.997  1.00 97.60  ? 42  ARG C NH1   1 
ATOM   7663  N  NH2   . ARG E  5 42  ? 47.890 57.575  17.503  1.00 91.95  ? 42  ARG C NH2   1 
ATOM   7664  N  N     . VAL E  5 43  ? 43.987 64.400  17.791  1.00 58.05  ? 43  VAL C N     1 
ATOM   7665  C  CA    . VAL E  5 43  ? 43.574 65.498  18.659  1.00 57.44  ? 43  VAL C CA    1 
ATOM   7666  C  C     . VAL E  5 43  ? 43.496 64.972  20.086  1.00 58.55  ? 43  VAL C C     1 
ATOM   7667  O  O     . VAL E  5 43  ? 42.676 64.095  20.382  1.00 63.37  ? 43  VAL C O     1 
ATOM   7668  C  CB    . VAL E  5 43  ? 42.223 66.095  18.231  1.00 60.37  ? 43  VAL C CB    1 
ATOM   7669  C  CG1   . VAL E  5 43  ? 41.795 67.192  19.197  1.00 35.80  ? 43  VAL C CG1   1 
ATOM   7670  C  CG2   . VAL E  5 43  ? 42.301 66.628  16.806  1.00 51.35  ? 43  VAL C CG2   1 
ATOM   7671  N  N     . GLY E  5 44  ? 44.341 65.509  20.965  1.00 54.36  ? 44  GLY C N     1 
ATOM   7672  C  CA    . GLY E  5 44  ? 44.330 65.087  22.352  1.00 59.44  ? 44  GLY C CA    1 
ATOM   7673  C  C     . GLY E  5 44  ? 43.020 65.412  23.043  1.00 62.06  ? 44  GLY C C     1 
ATOM   7674  O  O     . GLY E  5 44  ? 42.234 66.250  22.600  1.00 60.38  ? 44  GLY C O     1 
ATOM   7675  N  N     . ALA E  5 45  ? 42.791 64.724  24.165  1.00 60.17  ? 45  ALA C N     1 
ATOM   7676  C  CA    . ALA E  5 45  ? 41.527 64.867  24.878  1.00 57.42  ? 45  ALA C CA    1 
ATOM   7677  C  C     . ALA E  5 45  ? 41.384 66.241  25.521  1.00 54.28  ? 45  ALA C C     1 
ATOM   7678  O  O     . ALA E  5 45  ? 40.260 66.726  25.695  1.00 59.24  ? 45  ALA C O     1 
ATOM   7679  C  CB    . ALA E  5 45  ? 41.393 63.770  25.935  1.00 60.49  ? 45  ALA C CB    1 
ATOM   7680  N  N     . GLY E  5 46  ? 42.499 66.885  25.878  1.00 46.44  ? 46  GLY C N     1 
ATOM   7681  C  CA    . GLY E  5 46  ? 42.429 68.188  26.518  1.00 52.35  ? 46  GLY C CA    1 
ATOM   7682  C  C     . GLY E  5 46  ? 42.241 69.351  25.569  1.00 56.71  ? 46  GLY C C     1 
ATOM   7683  O  O     . GLY E  5 46  ? 41.782 70.417  25.997  1.00 61.06  ? 46  GLY C O     1 
ATOM   7684  N  N     . ALA E  5 47  ? 42.581 69.169  24.291  1.00 49.94  ? 47  ALA C N     1 
ATOM   7685  C  CA    . ALA E  5 47  ? 42.462 70.260  23.325  1.00 42.50  ? 47  ALA C CA    1 
ATOM   7686  C  C     . ALA E  5 47  ? 41.034 70.775  23.174  1.00 33.46  ? 47  ALA C C     1 
ATOM   7687  O  O     . ALA E  5 47  ? 40.842 72.003  23.213  1.00 38.10  ? 47  ALA C O     1 
ATOM   7688  C  CB    . ALA E  5 47  ? 43.048 69.819  21.979  1.00 50.11  ? 47  ALA C CB    1 
ATOM   7689  N  N     . PRO E  5 48  ? 40.004 69.936  22.999  1.00 31.27  ? 48  PRO C N     1 
ATOM   7690  C  CA    . PRO E  5 48  ? 38.644 70.494  22.910  1.00 37.86  ? 48  PRO C CA    1 
ATOM   7691  C  C     . PRO E  5 48  ? 38.159 71.104  24.212  1.00 47.32  ? 48  PRO C C     1 
ATOM   7692  O  O     . PRO E  5 48  ? 37.347 72.037  24.178  1.00 47.74  ? 48  PRO C O     1 
ATOM   7693  C  CB    . PRO E  5 48  ? 37.792 69.286  22.501  1.00 43.58  ? 48  PRO C CB    1 
ATOM   7694  C  CG    . PRO E  5 48  ? 38.550 68.116  22.995  1.00 42.59  ? 48  PRO C CG    1 
ATOM   7695  C  CD    . PRO E  5 48  ? 39.994 68.473  22.816  1.00 36.46  ? 48  PRO C CD    1 
ATOM   7696  N  N     . VAL E  5 49  ? 38.621 70.599  25.358  1.00 45.41  ? 49  VAL C N     1 
ATOM   7697  C  CA    . VAL E  5 49  ? 38.277 71.216  26.637  1.00 43.66  ? 49  VAL C CA    1 
ATOM   7698  C  C     . VAL E  5 49  ? 38.827 72.636  26.700  1.00 39.51  ? 49  VAL C C     1 
ATOM   7699  O  O     . VAL E  5 49  ? 38.092 73.599  26.958  1.00 39.64  ? 49  VAL C O     1 
ATOM   7700  C  CB    . VAL E  5 49  ? 38.802 70.359  27.803  1.00 53.67  ? 49  VAL C CB    1 
ATOM   7701  C  CG1   . VAL E  5 49  ? 38.595 71.079  29.125  1.00 51.62  ? 49  VAL C CG1   1 
ATOM   7702  C  CG2   . VAL E  5 49  ? 38.120 69.000  27.818  1.00 55.85  ? 49  VAL C CG2   1 
ATOM   7703  N  N     . TYR E  5 50  ? 40.133 72.780  26.456  1.00 33.04  ? 50  TYR C N     1 
ATOM   7704  C  CA    . TYR E  5 50  ? 40.766 74.095  26.477  1.00 27.85  ? 50  TYR C CA    1 
ATOM   7705  C  C     . TYR E  5 50  ? 40.124 75.036  25.463  1.00 39.67  ? 50  TYR C C     1 
ATOM   7706  O  O     . TYR E  5 50  ? 39.819 76.192  25.781  1.00 43.20  ? 50  TYR C O     1 
ATOM   7707  C  CB    . TYR E  5 50  ? 42.261 73.939  26.199  1.00 27.98  ? 50  TYR C CB    1 
ATOM   7708  C  CG    . TYR E  5 50  ? 43.133 75.093  26.639  1.00 40.01  ? 50  TYR C CG    1 
ATOM   7709  C  CD1   . TYR E  5 50  ? 43.042 76.336  26.029  1.00 43.61  ? 50  TYR C CD1   1 
ATOM   7710  C  CD2   . TYR E  5 50  ? 44.074 74.925  27.646  1.00 48.58  ? 50  TYR C CD2   1 
ATOM   7711  C  CE1   . TYR E  5 50  ? 43.850 77.384  26.423  1.00 48.90  ? 50  TYR C CE1   1 
ATOM   7712  C  CE2   . TYR E  5 50  ? 44.885 75.967  28.048  1.00 54.63  ? 50  TYR C CE2   1 
ATOM   7713  C  CZ    . TYR E  5 50  ? 44.768 77.194  27.434  1.00 55.88  ? 50  TYR C CZ    1 
ATOM   7714  O  OH    . TYR E  5 50  ? 45.575 78.235  27.829  1.00 56.72  ? 50  TYR C OH    1 
ATOM   7715  N  N     . LEU E  5 51  ? 39.901 74.551  24.238  1.00 44.06  ? 51  LEU C N     1 
ATOM   7716  C  CA    . LEU E  5 51  ? 39.357 75.405  23.185  1.00 42.09  ? 51  LEU C CA    1 
ATOM   7717  C  C     . LEU E  5 51  ? 37.932 75.844  23.501  1.00 40.77  ? 51  LEU C C     1 
ATOM   7718  O  O     . LEU E  5 51  ? 37.591 77.023  23.339  1.00 37.50  ? 51  LEU C O     1 
ATOM   7719  C  CB    . LEU E  5 51  ? 39.414 74.675  21.843  1.00 44.46  ? 51  LEU C CB    1 
ATOM   7720  C  CG    . LEU E  5 51  ? 38.894 75.438  20.626  1.00 44.47  ? 51  LEU C CG    1 
ATOM   7721  C  CD1   . LEU E  5 51  ? 39.559 76.800  20.526  1.00 41.44  ? 51  LEU C CD1   1 
ATOM   7722  C  CD2   . LEU E  5 51  ? 39.130 74.632  19.363  1.00 45.04  ? 51  LEU C CD2   1 
ATOM   7723  N  N     . ALA E  5 52  ? 37.085 74.913  23.949  1.00 37.39  ? 52  ALA C N     1 
ATOM   7724  C  CA    . ALA E  5 52  ? 35.730 75.284  24.343  1.00 38.11  ? 52  ALA C CA    1 
ATOM   7725  C  C     . ALA E  5 52  ? 35.741 76.267  25.505  1.00 46.02  ? 52  ALA C C     1 
ATOM   7726  O  O     . ALA E  5 52  ? 34.890 77.163  25.569  1.00 51.71  ? 52  ALA C O     1 
ATOM   7727  C  CB    . ALA E  5 52  ? 34.924 74.037  24.706  1.00 36.54  ? 52  ALA C CB    1 
ATOM   7728  N  N     . ALA E  5 53  ? 36.699 76.121  26.424  1.00 44.80  ? 53  ALA C N     1 
ATOM   7729  C  CA    . ALA E  5 53  ? 36.825 77.072  27.524  1.00 42.51  ? 53  ALA C CA    1 
ATOM   7730  C  C     . ALA E  5 53  ? 37.157 78.467  27.009  1.00 40.33  ? 53  ALA C C     1 
ATOM   7731  O  O     . ALA E  5 53  ? 36.542 79.458  27.421  1.00 46.87  ? 53  ALA C O     1 
ATOM   7732  C  CB    . ALA E  5 53  ? 37.891 76.594  28.509  1.00 40.83  ? 53  ALA C CB    1 
ATOM   7733  N  N     . VAL E  5 54  ? 38.133 78.562  26.102  1.00 38.09  ? 54  VAL C N     1 
ATOM   7734  C  CA    . VAL E  5 54  ? 38.527 79.865  25.566  1.00 37.27  ? 54  VAL C CA    1 
ATOM   7735  C  C     . VAL E  5 54  ? 37.363 80.508  24.821  1.00 40.53  ? 54  VAL C C     1 
ATOM   7736  O  O     . VAL E  5 54  ? 37.024 81.677  25.051  1.00 43.64  ? 54  VAL C O     1 
ATOM   7737  C  CB    . VAL E  5 54  ? 39.765 79.724  24.664  1.00 28.70  ? 54  VAL C CB    1 
ATOM   7738  C  CG1   . VAL E  5 54  ? 40.095 81.055  24.005  1.00 27.07  ? 54  VAL C CG1   1 
ATOM   7739  C  CG2   . VAL E  5 54  ? 40.948 79.215  25.468  1.00 26.78  ? 54  VAL C CG2   1 
ATOM   7740  N  N     . LEU E  5 55  ? 36.734 79.751  23.917  1.00 38.97  ? 55  LEU C N     1 
ATOM   7741  C  CA    . LEU E  5 55  ? 35.582 80.264  23.180  1.00 39.14  ? 55  LEU C CA    1 
ATOM   7742  C  C     . LEU E  5 55  ? 34.505 80.765  24.134  1.00 47.68  ? 55  LEU C C     1 
ATOM   7743  O  O     . LEU E  5 55  ? 33.946 81.854  23.948  1.00 42.31  ? 55  LEU C O     1 
ATOM   7744  C  CB    . LEU E  5 55  ? 35.021 79.182  22.258  1.00 39.65  ? 55  LEU C CB    1 
ATOM   7745  C  CG    . LEU E  5 55  ? 35.920 78.662  21.134  1.00 38.09  ? 55  LEU C CG    1 
ATOM   7746  C  CD1   . LEU E  5 55  ? 35.233 77.534  20.379  1.00 39.33  ? 55  LEU C CD1   1 
ATOM   7747  C  CD2   . LEU E  5 55  ? 36.304 79.785  20.187  1.00 26.86  ? 55  LEU C CD2   1 
ATOM   7748  N  N     . GLU E  5 56  ? 34.218 79.984  25.181  1.00 45.36  ? 56  GLU C N     1 
ATOM   7749  C  CA    . GLU E  5 56  ? 33.209 80.387  26.155  1.00 37.08  ? 56  GLU C CA    1 
ATOM   7750  C  C     . GLU E  5 56  ? 33.596 81.687  26.852  1.00 33.97  ? 56  GLU C C     1 
ATOM   7751  O  O     . GLU E  5 56  ? 32.744 82.555  27.084  1.00 31.06  ? 56  GLU C O     1 
ATOM   7752  C  CB    . GLU E  5 56  ? 32.996 79.272  27.175  1.00 42.68  ? 56  GLU C CB    1 
ATOM   7753  C  CG    . GLU E  5 56  ? 32.042 79.633  28.292  1.00 49.18  ? 56  GLU C CG    1 
ATOM   7754  C  CD    . GLU E  5 56  ? 31.936 78.545  29.340  1.00 69.38  ? 56  GLU C CD    1 
ATOM   7755  O  OE1   . GLU E  5 56  ? 31.191 77.569  29.114  1.00 76.04  ? 56  GLU C OE1   1 
ATOM   7756  O  OE2   . GLU E  5 56  ? 32.605 78.664  30.389  1.00 82.28  ? 56  GLU C OE2   1 
ATOM   7757  N  N     . TYR E  5 57  ? 34.880 81.844  27.187  1.00 35.52  ? 57  TYR C N     1 
ATOM   7758  C  CA    . TYR E  5 57  ? 35.327 83.084  27.815  1.00 37.60  ? 57  TYR C CA    1 
ATOM   7759  C  C     . TYR E  5 57  ? 35.139 84.278  26.884  1.00 48.98  ? 57  TYR C C     1 
ATOM   7760  O  O     . TYR E  5 57  ? 34.679 85.343  27.315  1.00 51.45  ? 57  TYR C O     1 
ATOM   7761  C  CB    . TYR E  5 57  ? 36.790 82.969  28.242  1.00 31.64  ? 57  TYR C CB    1 
ATOM   7762  C  CG    . TYR E  5 57  ? 37.444 84.313  28.470  1.00 42.21  ? 57  TYR C CG    1 
ATOM   7763  C  CD1   . TYR E  5 57  ? 37.069 85.117  29.539  1.00 49.14  ? 57  TYR C CD1   1 
ATOM   7764  C  CD2   . TYR E  5 57  ? 38.431 84.783  27.613  1.00 44.90  ? 57  TYR C CD2   1 
ATOM   7765  C  CE1   . TYR E  5 57  ? 37.657 86.351  29.748  1.00 50.73  ? 57  TYR C CE1   1 
ATOM   7766  C  CE2   . TYR E  5 57  ? 39.027 86.015  27.815  1.00 49.60  ? 57  TYR C CE2   1 
ATOM   7767  C  CZ    . TYR E  5 57  ? 38.634 86.794  28.883  1.00 55.32  ? 57  TYR C CZ    1 
ATOM   7768  O  OH    . TYR E  5 57  ? 39.225 88.020  29.086  1.00 63.30  ? 57  TYR C OH    1 
ATOM   7769  N  N     . LEU E  5 58  ? 35.489 84.121  25.604  1.00 40.49  ? 58  LEU C N     1 
ATOM   7770  C  CA    . LEU E  5 58  ? 35.341 85.230  24.664  1.00 34.06  ? 58  LEU C CA    1 
ATOM   7771  C  C     . LEU E  5 58  ? 33.876 85.609  24.477  1.00 35.26  ? 58  LEU C C     1 
ATOM   7772  O  O     . LEU E  5 58  ? 33.532 86.801  24.481  1.00 30.29  ? 58  LEU C O     1 
ATOM   7773  C  CB    . LEU E  5 58  ? 35.986 84.872  23.327  1.00 35.52  ? 58  LEU C CB    1 
ATOM   7774  C  CG    . LEU E  5 58  ? 37.506 84.710  23.383  1.00 31.43  ? 58  LEU C CG    1 
ATOM   7775  C  CD1   . LEU E  5 58  ? 38.074 84.427  22.005  1.00 26.13  ? 58  LEU C CD1   1 
ATOM   7776  C  CD2   . LEU E  5 58  ? 38.160 85.944  23.985  1.00 26.35  ? 58  LEU C CD2   1 
ATOM   7777  N  N     . THR E  5 59  ? 32.997 84.612  24.321  1.00 34.96  ? 59  THR C N     1 
ATOM   7778  C  CA    . THR E  5 59  ? 31.570 84.905  24.227  1.00 31.98  ? 59  THR C CA    1 
ATOM   7779  C  C     . THR E  5 59  ? 31.072 85.613  25.479  1.00 39.17  ? 59  THR C C     1 
ATOM   7780  O  O     . THR E  5 59  ? 30.275 86.553  25.390  1.00 38.69  ? 59  THR C O     1 
ATOM   7781  C  CB    . THR E  5 59  ? 30.769 83.624  23.995  1.00 27.38  ? 59  THR C CB    1 
ATOM   7782  O  OG1   . THR E  5 59  ? 30.899 82.763  25.133  1.00 57.28  ? 59  THR C OG1   1 
ATOM   7783  C  CG2   . THR E  5 59  ? 31.273 82.905  22.766  1.00 27.69  ? 59  THR C CG2   1 
ATOM   7784  N  N     . ALA E  5 60  ? 31.534 85.182  26.657  1.00 30.94  ? 60  ALA C N     1 
ATOM   7785  C  CA    . ALA E  5 60  ? 31.122 85.847  27.890  1.00 34.89  ? 60  ALA C CA    1 
ATOM   7786  C  C     . ALA E  5 60  ? 31.570 87.304  27.908  1.00 36.09  ? 60  ALA C C     1 
ATOM   7787  O  O     . ALA E  5 60  ? 30.815 88.191  28.328  1.00 34.30  ? 60  ALA C O     1 
ATOM   7788  C  CB    . ALA E  5 60  ? 31.675 85.098  29.102  1.00 38.03  ? 60  ALA C CB    1 
ATOM   7789  N  N     . GLU E  5 61  ? 32.795 87.570  27.444  1.00 27.40  ? 61  GLU C N     1 
ATOM   7790  C  CA    . GLU E  5 61  ? 33.311 88.936  27.428  1.00 29.76  ? 61  GLU C CA    1 
ATOM   7791  C  C     . GLU E  5 61  ? 32.486 89.827  26.502  1.00 36.37  ? 61  GLU C C     1 
ATOM   7792  O  O     . GLU E  5 61  ? 31.965 90.874  26.920  1.00 51.28  ? 61  GLU C O     1 
ATOM   7793  C  CB    . GLU E  5 61  ? 34.781 88.925  27.004  1.00 29.83  ? 61  GLU C CB    1 
ATOM   7794  C  CG    . GLU E  5 61  ? 35.430 90.296  26.910  1.00 45.04  ? 61  GLU C CG    1 
ATOM   7795  C  CD    . GLU E  5 61  ? 35.940 90.798  28.246  1.00 69.67  ? 61  GLU C CD    1 
ATOM   7796  O  OE1   . GLU E  5 61  ? 36.028 89.987  29.193  1.00 79.42  ? 61  GLU C OE1   1 
ATOM   7797  O  OE2   . GLU E  5 61  ? 36.254 92.004  28.348  1.00 77.65  ? 61  GLU C OE2   1 
ATOM   7798  N  N     . ILE E  5 62  ? 32.346 89.417  25.237  1.00 38.27  ? 62  ILE C N     1 
ATOM   7799  C  CA    . ILE E  5 62  ? 31.631 90.260  24.285  1.00 41.77  ? 62  ILE C CA    1 
ATOM   7800  C  C     . ILE E  5 62  ? 30.162 90.399  24.674  1.00 35.07  ? 62  ILE C C     1 
ATOM   7801  O  O     . ILE E  5 62  ? 29.564 91.462  24.482  1.00 37.27  ? 62  ILE C O     1 
ATOM   7802  C  CB    . ILE E  5 62  ? 31.793 89.717  22.851  1.00 42.55  ? 62  ILE C CB    1 
ATOM   7803  C  CG1   . ILE E  5 62  ? 31.062 90.618  21.853  1.00 41.58  ? 62  ILE C CG1   1 
ATOM   7804  C  CG2   . ILE E  5 62  ? 31.289 88.288  22.752  1.00 56.22  ? 62  ILE C CG2   1 
ATOM   7805  C  CD1   . ILE E  5 62  ? 31.180 90.169  20.416  1.00 59.48  ? 62  ILE C CD1   1 
ATOM   7806  N  N     . LEU E  5 63  ? 29.560 89.349  25.238  1.00 28.52  ? 63  LEU C N     1 
ATOM   7807  C  CA    . LEU E  5 63  ? 28.166 89.452  25.655  1.00 32.43  ? 63  LEU C CA    1 
ATOM   7808  C  C     . LEU E  5 63  ? 28.007 90.357  26.869  1.00 39.03  ? 63  LEU C C     1 
ATOM   7809  O  O     . LEU E  5 63  ? 26.963 90.997  27.028  1.00 42.47  ? 63  LEU C O     1 
ATOM   7810  C  CB    . LEU E  5 63  ? 27.591 88.065  25.943  1.00 29.77  ? 63  LEU C CB    1 
ATOM   7811  C  CG    . LEU E  5 63  ? 27.312 87.194  24.716  1.00 28.40  ? 63  LEU C CG    1 
ATOM   7812  C  CD1   . LEU E  5 63  ? 26.647 85.896  25.123  1.00 35.50  ? 63  LEU C CD1   1 
ATOM   7813  C  CD2   . LEU E  5 63  ? 26.466 87.942  23.692  1.00 26.42  ? 63  LEU C CD2   1 
ATOM   7814  N  N     . GLU E  5 64  ? 29.019 90.421  27.735  1.00 29.11  ? 64  GLU C N     1 
ATOM   7815  C  CA    . GLU E  5 64  ? 28.987 91.379  28.835  1.00 36.08  ? 64  GLU C CA    1 
ATOM   7816  C  C     . GLU E  5 64  ? 29.021 92.808  28.305  1.00 34.94  ? 64  GLU C C     1 
ATOM   7817  O  O     . GLU E  5 64  ? 28.137 93.624  28.604  1.00 43.01  ? 64  GLU C O     1 
ATOM   7818  C  CB    . GLU E  5 64  ? 30.158 91.123  29.785  1.00 43.12  ? 64  GLU C CB    1 
ATOM   7819  C  CG    . GLU E  5 64  ? 30.285 92.128  30.924  1.00 53.55  ? 64  GLU C CG    1 
ATOM   7820  C  CD    . GLU E  5 64  ? 29.336 91.846  32.077  1.00 71.48  ? 64  GLU C CD    1 
ATOM   7821  O  OE1   . GLU E  5 64  ? 29.044 92.784  32.852  1.00 78.10  ? 64  GLU C OE1   1 
ATOM   7822  O  OE2   . GLU E  5 64  ? 28.889 90.687  32.214  1.00 77.71  ? 64  GLU C OE2   1 
ATOM   7823  N  N     . LEU E  5 65  ? 30.039 93.125  27.497  1.00 43.86  ? 65  LEU C N     1 
ATOM   7824  C  CA    . LEU E  5 65  ? 30.165 94.488  26.984  1.00 42.49  ? 65  LEU C CA    1 
ATOM   7825  C  C     . LEU E  5 65  ? 28.952 94.882  26.145  1.00 44.18  ? 65  LEU C C     1 
ATOM   7826  O  O     . LEU E  5 65  ? 28.489 96.030  26.203  1.00 35.42  ? 65  LEU C O     1 
ATOM   7827  C  CB    . LEU E  5 65  ? 31.454 94.622  26.174  1.00 37.74  ? 65  LEU C CB    1 
ATOM   7828  C  CG    . LEU E  5 65  ? 32.755 94.413  26.950  1.00 38.76  ? 65  LEU C CG    1 
ATOM   7829  C  CD1   . LEU E  5 65  ? 33.949 94.433  26.014  1.00 38.66  ? 65  LEU C CD1   1 
ATOM   7830  C  CD2   . LEU E  5 65  ? 32.902 95.470  28.037  1.00 31.46  ? 65  LEU C CD2   1 
ATOM   7831  N  N     . ALA E  5 66  ? 28.412 93.935  25.374  1.00 46.16  ? 66  ALA C N     1 
ATOM   7832  C  CA    . ALA E  5 66  ? 27.255 94.226  24.535  1.00 41.47  ? 66  ALA C CA    1 
ATOM   7833  C  C     . ALA E  5 66  ? 25.995 94.409  25.369  1.00 40.68  ? 66  ALA C C     1 
ATOM   7834  O  O     . ALA E  5 66  ? 25.180 95.293  25.084  1.00 38.84  ? 66  ALA C O     1 
ATOM   7835  C  CB    . ALA E  5 66  ? 27.058 93.114  23.507  1.00 41.57  ? 66  ALA C CB    1 
ATOM   7836  N  N     . GLY E  5 67  ? 25.807 93.573  26.392  1.00 35.61  ? 67  GLY C N     1 
ATOM   7837  C  CA    . GLY E  5 67  ? 24.687 93.776  27.295  1.00 43.01  ? 67  GLY C CA    1 
ATOM   7838  C  C     . GLY E  5 67  ? 24.728 95.138  27.959  1.00 42.70  ? 67  GLY C C     1 
ATOM   7839  O  O     . GLY E  5 67  ? 23.694 95.791  28.132  1.00 35.29  ? 67  GLY C O     1 
ATOM   7840  N  N     . ASN E  5 68  ? 25.929 95.593  28.327  1.00 45.69  ? 68  ASN C N     1 
ATOM   7841  C  CA    . ASN E  5 68  ? 26.062 96.952  28.841  1.00 43.46  ? 68  ASN C CA    1 
ATOM   7842  C  C     . ASN E  5 68  ? 25.713 97.980  27.772  1.00 42.46  ? 68  ASN C C     1 
ATOM   7843  O  O     . ASN E  5 68  ? 25.088 99.005  28.070  1.00 35.63  ? 68  ASN C O     1 
ATOM   7844  C  CB    . ASN E  5 68  ? 27.476 97.180  29.370  1.00 42.74  ? 68  ASN C CB    1 
ATOM   7845  C  CG    . ASN E  5 68  ? 27.762 96.374  30.616  1.00 50.29  ? 68  ASN C CG    1 
ATOM   7846  O  OD1   . ASN E  5 68  ? 26.849 96.041  31.376  1.00 50.56  ? 68  ASN C OD1   1 
ATOM   7847  N  ND2   . ASN E  5 68  ? 29.033 96.055  30.837  1.00 59.82  ? 68  ASN C ND2   1 
ATOM   7848  N  N     . ALA E  5 69  ? 26.100 97.721  26.520  1.00 51.18  ? 69  ALA C N     1 
ATOM   7849  C  CA    . ALA E  5 69  ? 25.731 98.629  25.437  1.00 54.99  ? 69  ALA C CA    1 
ATOM   7850  C  C     . ALA E  5 69  ? 24.216 98.732  25.294  1.00 45.53  ? 69  ALA C C     1 
ATOM   7851  O  O     . ALA E  5 69  ? 23.679 99.823  25.067  1.00 45.33  ? 69  ALA C O     1 
ATOM   7852  C  CB    . ALA E  5 69  ? 26.365 98.169  24.124  1.00 63.74  ? 69  ALA C CB    1 
ATOM   7853  N  N     . ALA E  5 70  ? 23.510 97.607  25.429  1.00 37.21  ? 70  ALA C N     1 
ATOM   7854  C  CA    . ALA E  5 70  ? 22.055 97.625  25.333  1.00 34.90  ? 70  ALA C CA    1 
ATOM   7855  C  C     . ALA E  5 70  ? 21.433 98.346  26.520  1.00 50.57  ? 70  ALA C C     1 
ATOM   7856  O  O     . ALA E  5 70  ? 20.453 99.083  26.361  1.00 54.76  ? 70  ALA C O     1 
ATOM   7857  C  CB    . ALA E  5 70  ? 21.518 96.198  25.229  1.00 30.74  ? 70  ALA C CB    1 
ATOM   7858  N  N     . ARG E  5 71  ? 21.989 98.144  27.720  1.00 56.41  ? 71  ARG C N     1 
ATOM   7859  C  CA    . ARG E  5 71  ? 21.487 98.854  28.893  1.00 53.14  ? 71  ARG C CA    1 
ATOM   7860  C  C     . ARG E  5 71  ? 21.677 100.359 28.753  1.00 47.26  ? 71  ARG C C     1 
ATOM   7861  O  O     . ARG E  5 71  ? 20.809 101.142 29.160  1.00 52.06  ? 71  ARG C O     1 
ATOM   7862  C  CB    . ARG E  5 71  ? 22.179 98.332  30.152  1.00 61.34  ? 71  ARG C CB    1 
ATOM   7863  C  CG    . ARG E  5 71  ? 22.058 99.240  31.362  1.00 72.62  ? 71  ARG C CG    1 
ATOM   7864  C  CD    . ARG E  5 71  ? 22.315 98.465  32.640  1.00 87.69  ? 71  ARG C CD    1 
ATOM   7865  N  NE    . ARG E  5 71  ? 21.189 97.597  32.970  1.00 99.09  ? 71  ARG C NE    1 
ATOM   7866  C  CZ    . ARG E  5 71  ? 21.224 96.644  33.894  1.00 105.68 ? 71  ARG C CZ    1 
ATOM   7867  N  NH1   . ARG E  5 71  ? 22.337 96.426  34.582  1.00 110.46 ? 71  ARG C NH1   1 
ATOM   7868  N  NH2   . ARG E  5 71  ? 20.149 95.903  34.126  1.00 104.96 ? 71  ARG C NH2   1 
ATOM   7869  N  N     . ASP E  5 72  ? 22.800 100.785 28.168  1.00 46.22  ? 72  ASP C N     1 
ATOM   7870  C  CA    . ASP E  5 72  ? 23.035 102.211 27.968  1.00 51.83  ? 72  ASP C CA    1 
ATOM   7871  C  C     . ASP E  5 72  ? 22.022 102.828 27.013  1.00 55.06  ? 72  ASP C C     1 
ATOM   7872  O  O     . ASP E  5 72  ? 21.625 103.984 27.200  1.00 61.81  ? 72  ASP C O     1 
ATOM   7873  C  CB    . ASP E  5 72  ? 24.455 102.443 27.450  1.00 55.31  ? 72  ASP C CB    1 
ATOM   7874  C  CG    . ASP E  5 72  ? 25.511 102.014 28.445  1.00 67.36  ? 72  ASP C CG    1 
ATOM   7875  O  OD1   . ASP E  5 72  ? 25.246 102.088 29.662  1.00 68.99  ? 72  ASP C OD1   1 
ATOM   7876  O  OD2   . ASP E  5 72  ? 26.606 101.601 28.006  1.00 68.74  ? 72  ASP C OD2   1 
ATOM   7877  N  N     . ASN E  5 73  ? 21.594 102.087 25.993  1.00 59.53  ? 73  ASN C N     1 
ATOM   7878  C  CA    . ASN E  5 73  ? 20.604 102.572 25.039  1.00 64.70  ? 73  ASN C CA    1 
ATOM   7879  C  C     . ASN E  5 73  ? 19.174 102.292 25.481  1.00 61.56  ? 73  ASN C C     1 
ATOM   7880  O  O     . ASN E  5 73  ? 18.257 102.390 24.660  1.00 62.15  ? 73  ASN C O     1 
ATOM   7881  C  CB    . ASN E  5 73  ? 20.850 101.951 23.659  1.00 74.00  ? 73  ASN C CB    1 
ATOM   7882  C  CG    . ASN E  5 73  ? 22.201 102.328 23.087  1.00 78.94  ? 73  ASN C CG    1 
ATOM   7883  O  OD1   . ASN E  5 73  ? 23.204 102.346 23.800  1.00 76.12  ? 73  ASN C OD1   1 
ATOM   7884  N  ND2   . ASN E  5 73  ? 22.232 102.650 21.798  1.00 82.73  ? 73  ASN C ND2   1 
ATOM   7885  N  N     . LYS E  5 74  ? 18.969 101.952 26.757  1.00 63.97  ? 74  LYS C N     1 
ATOM   7886  C  CA    . LYS E  5 74  ? 17.640 101.665 27.301  1.00 64.93  ? 74  LYS C CA    1 
ATOM   7887  C  C     . LYS E  5 74  ? 16.935 100.570 26.501  1.00 56.93  ? 74  LYS C C     1 
ATOM   7888  O  O     . LYS E  5 74  ? 15.753 100.676 26.169  1.00 55.87  ? 74  LYS C O     1 
ATOM   7889  C  CB    . LYS E  5 74  ? 16.786 102.934 27.372  1.00 73.45  ? 74  LYS C CB    1 
ATOM   7890  C  CG    . LYS E  5 74  ? 17.492 104.104 28.043  1.00 74.93  ? 74  LYS C CG    1 
ATOM   7891  C  CD    . LYS E  5 74  ? 16.611 105.343 28.099  1.00 74.19  ? 74  LYS C CD    1 
ATOM   7892  C  CE    . LYS E  5 74  ? 15.605 105.264 29.237  1.00 77.39  ? 74  LYS C CE    1 
ATOM   7893  N  NZ    . LYS E  5 74  ? 16.263 105.374 30.572  1.00 80.13  ? 74  LYS C NZ    1 
ATOM   7894  N  N     . LYS E  5 75  ? 17.676 99.510  26.182  1.00 58.74  ? 75  LYS C N     1 
ATOM   7895  C  CA    . LYS E  5 75  ? 17.158 98.351  25.474  1.00 59.98  ? 75  LYS C CA    1 
ATOM   7896  C  C     . LYS E  5 75  ? 17.401 97.103  26.311  1.00 55.70  ? 75  LYS C C     1 
ATOM   7897  O  O     . LYS E  5 75  ? 18.374 97.023  27.065  1.00 62.22  ? 75  LYS C O     1 
ATOM   7898  C  CB    . LYS E  5 75  ? 17.828 98.185  24.101  1.00 59.69  ? 75  LYS C CB    1 
ATOM   7899  C  CG    . LYS E  5 75  ? 17.966 99.464  23.285  1.00 56.26  ? 75  LYS C CG    1 
ATOM   7900  C  CD    . LYS E  5 75  ? 16.689 99.789  22.530  1.00 55.52  ? 75  LYS C CD    1 
ATOM   7901  C  CE    . LYS E  5 75  ? 16.948 100.825 21.452  1.00 69.69  ? 75  LYS C CE    1 
ATOM   7902  N  NZ    . LYS E  5 75  ? 18.008 100.364 20.503  1.00 77.21  ? 75  LYS C NZ    1 
ATOM   7903  N  N     . THR E  5 76  ? 16.511 96.121  26.170  1.00 48.99  ? 76  THR C N     1 
ATOM   7904  C  CA    . THR E  5 76  ? 16.638 94.854  26.881  1.00 56.02  ? 76  THR C CA    1 
ATOM   7905  C  C     . THR E  5 76  ? 17.004 93.695  25.966  1.00 50.22  ? 76  THR C C     1 
ATOM   7906  O  O     . THR E  5 76  ? 17.233 92.585  26.455  1.00 53.61  ? 76  THR C O     1 
ATOM   7907  C  CB    . THR E  5 76  ? 15.347 94.528  27.636  1.00 59.59  ? 76  THR C CB    1 
ATOM   7908  O  OG1   . THR E  5 76  ? 14.236 94.562  26.729  1.00 60.25  ? 76  THR C OG1   1 
ATOM   7909  C  CG2   . THR E  5 76  ? 15.112 95.530  28.760  1.00 50.00  ? 76  THR C CG2   1 
ATOM   7910  N  N     . ARG E  5 77  ? 17.061 93.916  24.654  1.00 54.08  ? 77  ARG C N     1 
ATOM   7911  C  CA    . ARG E  5 77  ? 17.422 92.876  23.699  1.00 49.24  ? 77  ARG C CA    1 
ATOM   7912  C  C     . ARG E  5 77  ? 18.625 93.346  22.894  1.00 44.49  ? 77  ARG C C     1 
ATOM   7913  O  O     . ARG E  5 77  ? 18.570 94.397  22.245  1.00 57.07  ? 77  ARG C O     1 
ATOM   7914  C  CB    . ARG E  5 77  ? 16.247 92.544  22.775  1.00 56.73  ? 77  ARG C CB    1 
ATOM   7915  C  CG    . ARG E  5 77  ? 16.550 91.425  21.795  1.00 69.05  ? 77  ARG C CG    1 
ATOM   7916  C  CD    . ARG E  5 77  ? 15.357 91.104  20.907  1.00 72.57  ? 77  ARG C CD    1 
ATOM   7917  N  NE    . ARG E  5 77  ? 14.225 90.565  21.657  1.00 82.41  ? 77  ARG C NE    1 
ATOM   7918  C  CZ    . ARG E  5 77  ? 13.028 91.138  21.725  1.00 87.72  ? 77  ARG C CZ    1 
ATOM   7919  N  NH1   . ARG E  5 77  ? 12.796 92.274  21.080  1.00 88.07  ? 77  ARG C NH1   1 
ATOM   7920  N  NH2   . ARG E  5 77  ? 12.059 90.570  22.429  1.00 89.74  ? 77  ARG C NH2   1 
ATOM   7921  N  N     . ILE E  5 78  ? 19.708 92.571  22.942  1.00 37.31  ? 78  ILE C N     1 
ATOM   7922  C  CA    . ILE E  5 78  ? 20.928 92.928  22.226  1.00 40.33  ? 78  ILE C CA    1 
ATOM   7923  C  C     . ILE E  5 78  ? 20.697 92.802  20.727  1.00 40.84  ? 78  ILE C C     1 
ATOM   7924  O  O     . ILE E  5 78  ? 20.169 91.791  20.245  1.00 43.04  ? 78  ILE C O     1 
ATOM   7925  C  CB    . ILE E  5 78  ? 22.099 92.044  22.682  1.00 40.95  ? 78  ILE C CB    1 
ATOM   7926  C  CG1   . ILE E  5 78  ? 22.394 92.266  24.166  1.00 41.08  ? 78  ILE C CG1   1 
ATOM   7927  C  CG2   . ILE E  5 78  ? 23.336 92.321  21.842  1.00 48.18  ? 78  ILE C CG2   1 
ATOM   7928  C  CD1   . ILE E  5 78  ? 23.531 91.417  24.694  1.00 37.30  ? 78  ILE C CD1   1 
ATOM   7929  N  N     . ILE E  5 79  ? 21.084 93.834  19.984  1.00 37.09  ? 79  ILE C N     1 
ATOM   7930  C  CA    . ILE E  5 79  ? 21.025 93.822  18.524  1.00 42.83  ? 79  ILE C CA    1 
ATOM   7931  C  C     . ILE E  5 79  ? 22.445 94.028  18.005  1.00 39.94  ? 79  ILE C C     1 
ATOM   7932  O  O     . ILE E  5 79  ? 23.337 94.371  18.794  1.00 46.04  ? 79  ILE C O     1 
ATOM   7933  C  CB    . ILE E  5 79  ? 20.049 94.888  17.995  1.00 34.99  ? 79  ILE C CB    1 
ATOM   7934  C  CG1   . ILE E  5 79  ? 20.563 96.295  18.303  1.00 30.55  ? 79  ILE C CG1   1 
ATOM   7935  C  CG2   . ILE E  5 79  ? 18.659 94.678  18.584  1.00 34.44  ? 79  ILE C CG2   1 
ATOM   7936  C  CD1   . ILE E  5 79  ? 19.660 97.393  17.787  1.00 31.16  ? 79  ILE C CD1   1 
ATOM   7937  N  N     . PRO E  5 80  ? 22.712 93.814  16.712  1.00 40.62  ? 80  PRO C N     1 
ATOM   7938  C  CA    . PRO E  5 80  ? 24.081 94.014  16.199  1.00 33.88  ? 80  PRO C CA    1 
ATOM   7939  C  C     . PRO E  5 80  ? 24.701 95.363  16.536  1.00 35.38  ? 80  PRO C C     1 
ATOM   7940  O  O     . PRO E  5 80  ? 25.926 95.437  16.701  1.00 34.92  ? 80  PRO C O     1 
ATOM   7941  C  CB    . PRO E  5 80  ? 23.901 93.843  14.687  1.00 28.16  ? 80  PRO C CB    1 
ATOM   7942  C  CG    . PRO E  5 80  ? 22.797 92.859  14.568  1.00 29.00  ? 80  PRO C CG    1 
ATOM   7943  C  CD    . PRO E  5 80  ? 21.849 93.157  15.711  1.00 42.86  ? 80  PRO C CD    1 
ATOM   7944  N  N     . ARG E  5 81  ? 23.904 96.430  16.639  1.00 35.16  ? 81  ARG C N     1 
ATOM   7945  C  CA    . ARG E  5 81  ? 24.453 97.729  17.018  1.00 33.91  ? 81  ARG C CA    1 
ATOM   7946  C  C     . ARG E  5 81  ? 25.171 97.653  18.360  1.00 37.97  ? 81  ARG C C     1 
ATOM   7947  O  O     . ARG E  5 81  ? 26.225 98.274  18.546  1.00 36.52  ? 81  ARG C O     1 
ATOM   7948  C  CB    . ARG E  5 81  ? 23.340 98.776  17.065  1.00 34.14  ? 81  ARG C CB    1 
ATOM   7949  C  CG    . ARG E  5 81  ? 23.784 100.153 17.525  1.00 29.01  ? 81  ARG C CG    1 
ATOM   7950  C  CD    . ARG E  5 81  ? 24.877 100.712 16.638  1.00 30.08  ? 81  ARG C CD    1 
ATOM   7951  N  NE    . ARG E  5 81  ? 25.181 102.106 16.952  1.00 30.93  ? 81  ARG C NE    1 
ATOM   7952  C  CZ    . ARG E  5 81  ? 26.114 102.825 16.335  1.00 37.32  ? 81  ARG C CZ    1 
ATOM   7953  N  NH1   . ARG E  5 81  ? 26.840 102.281 15.365  1.00 32.76  ? 81  ARG C NH1   1 
ATOM   7954  N  NH2   . ARG E  5 81  ? 26.321 104.088 16.689  1.00 43.31  ? 81  ARG C NH2   1 
ATOM   7955  N  N     . HIS E  5 82  ? 24.624 96.882  19.302  1.00 36.71  ? 82  HIS C N     1 
ATOM   7956  C  CA    . HIS E  5 82  ? 25.247 96.763  20.616  1.00 34.21  ? 82  HIS C CA    1 
ATOM   7957  C  C     . HIS E  5 82  ? 26.525 95.935  20.549  1.00 37.96  ? 82  HIS C C     1 
ATOM   7958  O  O     . HIS E  5 82  ? 27.506 96.243  21.237  1.00 35.57  ? 82  HIS C O     1 
ATOM   7959  C  CB    . HIS E  5 82  ? 24.254 96.154  21.603  1.00 29.80  ? 82  HIS C CB    1 
ATOM   7960  C  CG    . HIS E  5 82  ? 22.923 96.839  21.613  1.00 34.72  ? 82  HIS C CG    1 
ATOM   7961  N  ND1   . HIS E  5 82  ? 21.738 96.162  21.802  1.00 37.81  ? 82  HIS C ND1   1 
ATOM   7962  C  CD2   . HIS E  5 82  ? 22.590 98.141  21.451  1.00 39.65  ? 82  HIS C CD2   1 
ATOM   7963  C  CE1   . HIS E  5 82  ? 20.732 97.017  21.757  1.00 41.36  ? 82  HIS C CE1   1 
ATOM   7964  N  NE2   . HIS E  5 82  ? 21.222 98.225  21.546  1.00 43.05  ? 82  HIS C NE2   1 
ATOM   7965  N  N     . LEU E  5 83  ? 26.532 94.879  19.732  1.00 42.08  ? 83  LEU C N     1 
ATOM   7966  C  CA    . LEU E  5 83  ? 27.753 94.103  19.542  1.00 33.00  ? 83  LEU C CA    1 
ATOM   7967  C  C     . LEU E  5 83  ? 28.853 94.959  18.930  1.00 27.98  ? 83  LEU C C     1 
ATOM   7968  O  O     . LEU E  5 83  ? 30.022 94.858  19.322  1.00 32.76  ? 83  LEU C O     1 
ATOM   7969  C  CB    . LEU E  5 83  ? 27.469 92.882  18.667  1.00 30.05  ? 83  LEU C CB    1 
ATOM   7970  C  CG    . LEU E  5 83  ? 26.443 91.890  19.221  1.00 35.59  ? 83  LEU C CG    1 
ATOM   7971  C  CD1   . LEU E  5 83  ? 26.052 90.873  18.162  1.00 34.42  ? 83  LEU C CD1   1 
ATOM   7972  C  CD2   . LEU E  5 83  ? 26.983 91.188  20.452  1.00 38.46  ? 83  LEU C CD2   1 
ATOM   7973  N  N     . GLN E  5 84  ? 28.494 95.821  17.977  1.00 30.33  ? 84  GLN C N     1 
ATOM   7974  C  CA    . GLN E  5 84  ? 29.479 96.711  17.372  1.00 27.48  ? 84  GLN C CA    1 
ATOM   7975  C  C     . GLN E  5 84  ? 29.991 97.732  18.379  1.00 31.73  ? 84  GLN C C     1 
ATOM   7976  O  O     . GLN E  5 84  ? 31.200 97.973  18.472  1.00 29.18  ? 84  GLN C O     1 
ATOM   7977  C  CB    . GLN E  5 84  ? 28.876 97.414  16.159  1.00 25.11  ? 84  GLN C CB    1 
ATOM   7978  C  CG    . GLN E  5 84  ? 29.744 98.527  15.586  1.00 34.94  ? 84  GLN C CG    1 
ATOM   7979  C  CD    . GLN E  5 84  ? 30.836 98.018  14.667  1.00 33.10  ? 84  GLN C CD    1 
ATOM   7980  O  OE1   . GLN E  5 84  ? 31.483 97.007  14.941  1.00 36.47  ? 84  GLN C OE1   1 
ATOM   7981  N  NE2   . GLN E  5 84  ? 31.043 98.719  13.560  1.00 31.38  ? 84  GLN C NE2   1 
ATOM   7982  N  N     . LEU E  5 85  ? 29.081 98.356  19.133  1.00 32.78  ? 85  LEU C N     1 
ATOM   7983  C  CA    . LEU E  5 85  ? 29.503 99.313  20.151  1.00 32.88  ? 85  LEU C CA    1 
ATOM   7984  C  C     . LEU E  5 85  ? 30.440 98.662  21.158  1.00 29.76  ? 85  LEU C C     1 
ATOM   7985  O  O     . LEU E  5 85  ? 31.442 99.262  21.565  1.00 25.94  ? 85  LEU C O     1 
ATOM   7986  C  CB    . LEU E  5 85  ? 28.285 99.906  20.860  1.00 39.79  ? 85  LEU C CB    1 
ATOM   7987  C  CG    . LEU E  5 85  ? 27.422 100.864 20.038  1.00 47.13  ? 85  LEU C CG    1 
ATOM   7988  C  CD1   . LEU E  5 85  ? 26.276 101.412 20.874  1.00 48.39  ? 85  LEU C CD1   1 
ATOM   7989  C  CD2   . LEU E  5 85  ? 28.269 101.994 19.479  1.00 47.37  ? 85  LEU C CD2   1 
ATOM   7990  N  N     . ALA E  5 86  ? 30.137 97.427  21.561  1.00 29.54  ? 86  ALA C N     1 
ATOM   7991  C  CA    . ALA E  5 86  ? 30.995 96.718  22.503  1.00 26.10  ? 86  ALA C CA    1 
ATOM   7992  C  C     . ALA E  5 86  ? 32.363 96.434  21.895  1.00 38.30  ? 86  ALA C C     1 
ATOM   7993  O  O     . ALA E  5 86  ? 33.399 96.692  22.518  1.00 48.58  ? 86  ALA C O     1 
ATOM   7994  C  CB    . ALA E  5 86  ? 30.322 95.418  22.940  1.00 29.85  ? 86  ALA C CB    1 
ATOM   7995  N  N     . VAL E  5 87  ? 32.383 95.907  20.669  1.00 43.43  ? 87  VAL C N     1 
ATOM   7996  C  CA    . VAL E  5 87  ? 33.644 95.522  20.037  1.00 39.50  ? 87  VAL C CA    1 
ATOM   7997  C  C     . VAL E  5 87  ? 34.531 96.742  19.821  1.00 41.07  ? 87  VAL C C     1 
ATOM   7998  O  O     . VAL E  5 87  ? 35.693 96.772  20.245  1.00 44.11  ? 87  VAL C O     1 
ATOM   7999  C  CB    . VAL E  5 87  ? 33.375 94.779  18.717  1.00 33.47  ? 87  VAL C CB    1 
ATOM   8000  C  CG1   . VAL E  5 87  ? 34.651 94.665  17.900  1.00 33.94  ? 87  VAL C CG1   1 
ATOM   8001  C  CG2   . VAL E  5 87  ? 32.795 93.400  18.990  1.00 26.66  ? 87  VAL C CG2   1 
ATOM   8002  N  N     . ARG E  5 88  ? 33.995 97.772  19.165  1.00 38.63  ? 88  ARG C N     1 
ATOM   8003  C  CA    . ARG E  5 88  ? 34.812 98.904  18.742  1.00 38.84  ? 88  ARG C CA    1 
ATOM   8004  C  C     . ARG E  5 88  ? 35.203 99.830  19.886  1.00 37.28  ? 88  ARG C C     1 
ATOM   8005  O  O     . ARG E  5 88  ? 36.105 100.656 19.702  1.00 37.82  ? 88  ARG C O     1 
ATOM   8006  C  CB    . ARG E  5 88  ? 34.080 99.694  17.656  1.00 40.94  ? 88  ARG C CB    1 
ATOM   8007  C  CG    . ARG E  5 88  ? 33.771 98.863  16.420  1.00 39.71  ? 88  ARG C CG    1 
ATOM   8008  C  CD    . ARG E  5 88  ? 34.995 98.073  15.991  1.00 28.75  ? 88  ARG C CD    1 
ATOM   8009  N  NE    . ARG E  5 88  ? 34.655 96.971  15.097  1.00 28.52  ? 88  ARG C NE    1 
ATOM   8010  C  CZ    . ARG E  5 88  ? 35.519 96.048  14.688  1.00 31.77  ? 88  ARG C CZ    1 
ATOM   8011  N  NH1   . ARG E  5 88  ? 36.780 96.092  15.098  1.00 38.62  ? 88  ARG C NH1   1 
ATOM   8012  N  NH2   . ARG E  5 88  ? 35.125 95.078  13.873  1.00 26.12  ? 88  ARG C NH2   1 
ATOM   8013  N  N     . ASN E  5 89  ? 34.563 99.724  21.050  1.00 42.87  ? 89  ASN C N     1 
ATOM   8014  C  CA    . ASN E  5 89  ? 34.961 100.525 22.199  1.00 37.56  ? 89  ASN C CA    1 
ATOM   8015  C  C     . ASN E  5 89  ? 35.917 99.799  23.133  1.00 32.02  ? 89  ASN C C     1 
ATOM   8016  O  O     . ASN E  5 89  ? 36.587 100.456 23.937  1.00 34.54  ? 89  ASN C O     1 
ATOM   8017  C  CB    . ASN E  5 89  ? 33.730 100.986 22.985  1.00 23.27  ? 89  ASN C CB    1 
ATOM   8018  C  CG    . ASN E  5 89  ? 33.166 102.294 22.463  1.00 32.22  ? 89  ASN C CG    1 
ATOM   8019  O  OD1   . ASN E  5 89  ? 33.913 103.235 22.174  1.00 38.34  ? 89  ASN C OD1   1 
ATOM   8020  N  ND2   . ASN E  5 89  ? 31.845 102.359 22.328  1.00 25.05  ? 89  ASN C ND2   1 
ATOM   8021  N  N     . ASP E  5 90  ? 36.001 98.474  23.045  1.00 23.90  ? 90  ASP C N     1 
ATOM   8022  C  CA    . ASP E  5 90  ? 37.010 97.712  23.765  1.00 23.26  ? 90  ASP C CA    1 
ATOM   8023  C  C     . ASP E  5 90  ? 38.240 97.575  22.878  1.00 33.06  ? 90  ASP C C     1 
ATOM   8024  O  O     . ASP E  5 90  ? 38.173 96.952  21.814  1.00 57.54  ? 90  ASP C O     1 
ATOM   8025  C  CB    . ASP E  5 90  ? 36.480 96.333  24.163  1.00 36.76  ? 90  ASP C CB    1 
ATOM   8026  C  CG    . ASP E  5 90  ? 37.517 95.504  24.899  1.00 54.58  ? 90  ASP C CG    1 
ATOM   8027  O  OD1   . ASP E  5 90  ? 38.330 94.836  24.227  1.00 62.21  ? 90  ASP C OD1   1 
ATOM   8028  O  OD2   . ASP E  5 90  ? 37.519 95.521  26.148  1.00 58.72  ? 90  ASP C OD2   1 
ATOM   8029  N  N     . GLU E  5 91  ? 39.355 98.160  23.319  1.00 35.70  ? 91  GLU C N     1 
ATOM   8030  C  CA    . GLU E  5 91  ? 40.576 98.160  22.517  1.00 43.01  ? 91  GLU C CA    1 
ATOM   8031  C  C     . GLU E  5 91  ? 40.997 96.748  22.128  1.00 49.30  ? 91  GLU C C     1 
ATOM   8032  O  O     . GLU E  5 91  ? 41.379 96.498  20.977  1.00 56.75  ? 91  GLU C O     1 
ATOM   8033  C  CB    . GLU E  5 91  ? 41.694 98.862  23.292  1.00 48.24  ? 91  GLU C CB    1 
ATOM   8034  C  CG    . GLU E  5 91  ? 43.013 98.968  22.551  1.00 65.12  ? 91  GLU C CG    1 
ATOM   8035  C  CD    . GLU E  5 91  ? 44.021 99.830  23.290  1.00 81.76  ? 91  GLU C CD    1 
ATOM   8036  O  OE1   . GLU E  5 91  ? 43.653 100.413 24.333  1.00 85.19  ? 91  GLU C OE1   1 
ATOM   8037  O  OE2   . GLU E  5 91  ? 45.179 99.925  22.828  1.00 89.58  ? 91  GLU C OE2   1 
ATOM   8038  N  N     . GLU E  5 92  ? 40.910 95.806  23.068  1.00 47.31  ? 92  GLU C N     1 
ATOM   8039  C  CA    . GLU E  5 92  ? 41.385 94.452  22.805  1.00 46.32  ? 92  GLU C CA    1 
ATOM   8040  C  C     . GLU E  5 92  ? 40.450 93.707  21.859  1.00 35.32  ? 92  GLU C C     1 
ATOM   8041  O  O     . GLU E  5 92  ? 40.904 93.072  20.900  1.00 27.23  ? 92  GLU C O     1 
ATOM   8042  C  CB    . GLU E  5 92  ? 41.553 93.695  24.122  1.00 46.40  ? 92  GLU C CB    1 
ATOM   8043  C  CG    . GLU E  5 92  ? 42.499 94.385  25.091  1.00 66.60  ? 92  GLU C CG    1 
ATOM   8044  C  CD    . GLU E  5 92  ? 43.576 93.461  25.620  1.00 85.07  ? 92  GLU C CD    1 
ATOM   8045  O  OE1   . GLU E  5 92  ? 43.397 92.228  25.541  1.00 90.80  ? 92  GLU C OE1   1 
ATOM   8046  O  OE2   . GLU E  5 92  ? 44.605 93.970  26.113  1.00 91.30  ? 92  GLU C OE2   1 
ATOM   8047  N  N     . LEU E  5 93  ? 39.139 93.768  22.110  1.00 33.99  ? 93  LEU C N     1 
ATOM   8048  C  CA    . LEU E  5 93  ? 38.193 93.146  21.188  1.00 34.66  ? 93  LEU C CA    1 
ATOM   8049  C  C     . LEU E  5 93  ? 38.246 93.806  19.816  1.00 45.06  ? 93  LEU C C     1 
ATOM   8050  O  O     . LEU E  5 93  ? 38.116 93.132  18.787  1.00 43.55  ? 93  LEU C O     1 
ATOM   8051  C  CB    . LEU E  5 93  ? 36.773 93.209  21.752  1.00 23.32  ? 93  LEU C CB    1 
ATOM   8052  C  CG    . LEU E  5 93  ? 36.341 92.087  22.698  1.00 26.42  ? 93  LEU C CG    1 
ATOM   8053  C  CD1   . LEU E  5 93  ? 34.828 92.094  22.875  1.00 15.25  ? 93  LEU C CD1   1 
ATOM   8054  C  CD2   . LEU E  5 93  ? 36.820 90.738  22.192  1.00 16.88  ? 93  LEU C CD2   1 
ATOM   8055  N  N     . ASN E  5 94  ? 38.437 95.128  19.782  1.00 36.25  ? 94  ASN C N     1 
ATOM   8056  C  CA    . ASN E  5 94  ? 38.549 95.823  18.504  1.00 39.87  ? 94  ASN C CA    1 
ATOM   8057  C  C     . ASN E  5 94  ? 39.766 95.343  17.724  1.00 40.77  ? 94  ASN C C     1 
ATOM   8058  O  O     . ASN E  5 94  ? 39.683 95.118  16.511  1.00 53.62  ? 94  ASN C O     1 
ATOM   8059  C  CB    . ASN E  5 94  ? 38.620 97.332  18.727  1.00 40.10  ? 94  ASN C CB    1 
ATOM   8060  C  CG    . ASN E  5 94  ? 38.673 98.109  17.428  1.00 42.02  ? 94  ASN C CG    1 
ATOM   8061  O  OD1   . ASN E  5 94  ? 38.139 97.671  16.408  1.00 35.44  ? 94  ASN C OD1   1 
ATOM   8062  N  ND2   . ASN E  5 94  ? 39.322 99.270  17.457  1.00 46.74  ? 94  ASN C ND2   1 
ATOM   8063  N  N     . LYS E  5 95  ? 40.905 95.180  18.403  1.00 36.88  ? 95  LYS C N     1 
ATOM   8064  C  CA    . LYS E  5 95  ? 42.091 94.655  17.733  1.00 28.09  ? 95  LYS C CA    1 
ATOM   8065  C  C     . LYS E  5 95  ? 41.879 93.214  17.282  1.00 40.78  ? 95  LYS C C     1 
ATOM   8066  O  O     . LYS E  5 95  ? 42.340 92.822  16.203  1.00 55.89  ? 95  LYS C O     1 
ATOM   8067  C  CB    . LYS E  5 95  ? 43.304 94.752  18.657  1.00 35.29  ? 95  LYS C CB    1 
ATOM   8068  C  CG    . LYS E  5 95  ? 44.546 94.047  18.130  1.00 39.09  ? 95  LYS C CG    1 
ATOM   8069  C  CD    . LYS E  5 95  ? 45.574 95.034  17.600  1.00 52.64  ? 95  LYS C CD    1 
ATOM   8070  C  CE    . LYS E  5 95  ? 46.740 94.310  16.942  1.00 62.38  ? 95  LYS C CE    1 
ATOM   8071  N  NZ    . LYS E  5 95  ? 46.296 93.525  15.755  1.00 67.78  ? 95  LYS C NZ    1 
ATOM   8072  N  N     . LEU E  5 96  ? 41.185 92.413  18.093  1.00 38.93  ? 96  LEU C N     1 
ATOM   8073  C  CA    . LEU E  5 96  ? 40.927 91.024  17.725  1.00 45.03  ? 96  LEU C CA    1 
ATOM   8074  C  C     . LEU E  5 96  ? 40.073 90.943  16.466  1.00 50.90  ? 96  LEU C C     1 
ATOM   8075  O  O     . LEU E  5 96  ? 40.364 90.164  15.551  1.00 54.23  ? 96  LEU C O     1 
ATOM   8076  C  CB    . LEU E  5 96  ? 40.251 90.292  18.884  1.00 45.01  ? 96  LEU C CB    1 
ATOM   8077  C  CG    . LEU E  5 96  ? 39.877 88.830  18.631  1.00 37.35  ? 96  LEU C CG    1 
ATOM   8078  C  CD1   . LEU E  5 96  ? 41.102 88.030  18.234  1.00 30.45  ? 96  LEU C CD1   1 
ATOM   8079  C  CD2   . LEU E  5 96  ? 39.206 88.222  19.855  1.00 35.10  ? 96  LEU C CD2   1 
ATOM   8080  N  N     . LEU E  5 97  ? 39.011 91.744  16.404  1.00 54.97  ? 97  LEU C N     1 
ATOM   8081  C  CA    . LEU E  5 97  ? 38.147 91.835  15.229  1.00 44.87  ? 97  LEU C CA    1 
ATOM   8082  C  C     . LEU E  5 97  ? 38.515 93.029  14.357  1.00 44.01  ? 97  LEU C C     1 
ATOM   8083  O  O     . LEU E  5 97  ? 37.640 93.745  13.861  1.00 36.18  ? 97  LEU C O     1 
ATOM   8084  C  CB    . LEU E  5 97  ? 36.685 91.908  15.656  1.00 37.43  ? 97  LEU C CB    1 
ATOM   8085  C  CG    . LEU E  5 97  ? 36.246 90.860  16.681  1.00 38.15  ? 97  LEU C CG    1 
ATOM   8086  C  CD1   . LEU E  5 97  ? 34.784 91.042  17.051  1.00 33.78  ? 97  LEU C CD1   1 
ATOM   8087  C  CD2   . LEU E  5 97  ? 36.500 89.457  16.158  1.00 44.22  ? 97  LEU C CD2   1 
ATOM   8088  N  N     . GLY E  5 98  ? 39.815 93.261  14.158  1.00 41.29  ? 98  GLY C N     1 
ATOM   8089  C  CA    . GLY E  5 98  ? 40.249 94.441  13.431  1.00 42.80  ? 98  GLY C CA    1 
ATOM   8090  C  C     . GLY E  5 98  ? 39.911 94.410  11.955  1.00 33.23  ? 98  GLY C C     1 
ATOM   8091  O  O     . GLY E  5 98  ? 39.740 95.463  11.335  1.00 33.76  ? 98  GLY C O     1 
ATOM   8092  N  N     . ARG E  5 99  ? 39.815 93.217  11.372  1.00 33.57  ? 99  ARG C N     1 
ATOM   8093  C  CA    . ARG E  5 99  ? 39.528 93.048  9.953   1.00 34.68  ? 99  ARG C CA    1 
ATOM   8094  C  C     . ARG E  5 99  ? 38.196 92.333  9.754   1.00 33.13  ? 99  ARG C C     1 
ATOM   8095  O  O     . ARG E  5 99  ? 38.024 91.537  8.828   1.00 36.03  ? 99  ARG C O     1 
ATOM   8096  C  CB    . ARG E  5 99  ? 40.660 92.298  9.254   1.00 38.15  ? 99  ARG C CB    1 
ATOM   8097  C  CG    . ARG E  5 99  ? 42.039 92.880  9.518   1.00 45.36  ? 99  ARG C CG    1 
ATOM   8098  C  CD    . ARG E  5 99  ? 42.802 93.088  8.227   1.00 70.57  ? 99  ARG C CD    1 
ATOM   8099  N  NE    . ARG E  5 99  ? 42.286 94.226  7.470   1.00 83.58  ? 99  ARG C NE    1 
ATOM   8100  C  CZ    . ARG E  5 99  ? 42.447 94.388  6.160   1.00 85.23  ? 99  ARG C CZ    1 
ATOM   8101  N  NH1   . ARG E  5 99  ? 43.103 93.477  5.452   1.00 90.76  ? 99  ARG C NH1   1 
ATOM   8102  N  NH2   . ARG E  5 99  ? 41.946 95.458  5.553   1.00 74.85  ? 99  ARG C NH2   1 
ATOM   8103  N  N     . VAL E  5 100 ? 37.236 92.619  10.630  1.00 30.39  ? 100 VAL C N     1 
ATOM   8104  C  CA    . VAL E  5 100 ? 35.911 92.012  10.601  1.00 30.16  ? 100 VAL C CA    1 
ATOM   8105  C  C     . VAL E  5 100 ? 34.878 93.130  10.601  1.00 28.09  ? 100 VAL C C     1 
ATOM   8106  O  O     . VAL E  5 100 ? 35.056 94.146  11.282  1.00 39.34  ? 100 VAL C O     1 
ATOM   8107  C  CB    . VAL E  5 100 ? 35.698 91.067  11.805  1.00 27.93  ? 100 VAL C CB    1 
ATOM   8108  C  CG1   . VAL E  5 100 ? 34.293 90.480  11.798  1.00 27.27  ? 100 VAL C CG1   1 
ATOM   8109  C  CG2   . VAL E  5 100 ? 36.744 89.961  11.809  1.00 29.55  ? 100 VAL C CG2   1 
ATOM   8110  N  N     . THR E  5 101 ? 33.806 92.955  9.831   1.00 27.77  ? 101 THR C N     1 
ATOM   8111  C  CA    . THR E  5 101 ? 32.707 93.913  9.800   1.00 37.35  ? 101 THR C CA    1 
ATOM   8112  C  C     . THR E  5 101 ? 31.435 93.233  10.282  1.00 37.53  ? 101 THR C C     1 
ATOM   8113  O  O     . THR E  5 101 ? 31.065 92.167  9.779   1.00 39.68  ? 101 THR C O     1 
ATOM   8114  C  CB    . THR E  5 101 ? 32.500 94.499  8.399   1.00 31.70  ? 101 THR C CB    1 
ATOM   8115  O  OG1   . THR E  5 101 ? 31.399 93.841  7.761   1.00 40.00  ? 101 THR C OG1   1 
ATOM   8116  C  CG2   . THR E  5 101 ? 33.751 94.322  7.552   1.00 29.92  ? 101 THR C CG2   1 
ATOM   8117  N  N     . ILE E  5 102 ? 30.777 93.852  11.259  1.00 33.47  ? 102 ILE C N     1 
ATOM   8118  C  CA    . ILE E  5 102 ? 29.556 93.321  11.853  1.00 28.08  ? 102 ILE C CA    1 
ATOM   8119  C  C     . ILE E  5 102 ? 28.365 93.883  11.088  1.00 23.14  ? 102 ILE C C     1 
ATOM   8120  O  O     . ILE E  5 102 ? 28.168 95.102  11.037  1.00 22.98  ? 102 ILE C O     1 
ATOM   8121  C  CB    . ILE E  5 102 ? 29.476 93.669  13.348  1.00 29.96  ? 102 ILE C CB    1 
ATOM   8122  C  CG1   . ILE E  5 102 ? 30.539 92.894  14.131  1.00 28.53  ? 102 ILE C CG1   1 
ATOM   8123  C  CG2   . ILE E  5 102 ? 28.084 93.399  13.895  1.00 21.67  ? 102 ILE C CG2   1 
ATOM   8124  C  CD1   . ILE E  5 102 ? 30.871 93.490  15.478  1.00 20.95  ? 102 ILE C CD1   1 
ATOM   8125  N  N     . ALA E  5 103 ? 27.575 92.994  10.488  1.00 23.90  ? 103 ALA C N     1 
ATOM   8126  C  CA    . ALA E  5 103 ? 26.434 93.422  9.689   1.00 27.66  ? 103 ALA C CA    1 
ATOM   8127  C  C     . ALA E  5 103 ? 25.442 94.189  10.553  1.00 35.14  ? 103 ALA C C     1 
ATOM   8128  O  O     . ALA E  5 103 ? 25.123 93.775  11.671  1.00 50.33  ? 103 ALA C O     1 
ATOM   8129  C  CB    . ALA E  5 103 ? 25.756 92.216  9.039   1.00 25.79  ? 103 ALA C CB    1 
ATOM   8130  N  N     . GLN E  5 104 ? 24.959 95.317  10.027  1.00 30.21  ? 104 GLN C N     1 
ATOM   8131  C  CA    . GLN E  5 104 ? 24.082 96.238  10.747  1.00 35.39  ? 104 GLN C CA    1 
ATOM   8132  C  C     . GLN E  5 104 ? 24.723 96.768  12.027  1.00 40.56  ? 104 GLN C C     1 
ATOM   8133  O  O     . GLN E  5 104 ? 24.020 97.184  12.955  1.00 44.20  ? 104 GLN C O     1 
ATOM   8134  C  CB    . GLN E  5 104 ? 22.727 95.591  11.060  1.00 31.79  ? 104 GLN C CB    1 
ATOM   8135  C  CG    . GLN E  5 104 ? 21.809 95.473  9.861   1.00 55.18  ? 104 GLN C CG    1 
ATOM   8136  C  CD    . GLN E  5 104 ? 21.375 96.829  9.330   1.00 68.79  ? 104 GLN C CD    1 
ATOM   8137  O  OE1   . GLN E  5 104 ? 20.544 97.509  9.936   1.00 72.89  ? 104 GLN C OE1   1 
ATOM   8138  N  NE2   . GLN E  5 104 ? 21.941 97.231  8.195   1.00 66.36  ? 104 GLN C NE2   1 
ATOM   8139  N  N     . GLY E  5 105 ? 26.055 96.764  12.095  1.00 36.45  ? 105 GLY C N     1 
ATOM   8140  C  CA    . GLY E  5 105 ? 26.730 97.267  13.276  1.00 29.94  ? 105 GLY C CA    1 
ATOM   8141  C  C     . GLY E  5 105 ? 26.877 98.771  13.300  1.00 38.79  ? 105 GLY C C     1 
ATOM   8142  O  O     . GLY E  5 105 ? 26.943 99.369  14.378  1.00 40.76  ? 105 GLY C O     1 
ATOM   8143  N  N     . GLY E  5 106 ? 26.922 99.402  12.131  1.00 45.60  ? 106 GLY C N     1 
ATOM   8144  C  CA    . GLY E  5 106 ? 27.132 100.833 12.050  1.00 35.42  ? 106 GLY C CA    1 
ATOM   8145  C  C     . GLY E  5 106 ? 28.556 101.231 12.392  1.00 36.12  ? 106 GLY C C     1 
ATOM   8146  O  O     . GLY E  5 106 ? 29.503 100.432 12.345  1.00 44.76  ? 106 GLY C O     1 
ATOM   8147  N  N     . VAL E  5 107 ? 28.699 102.499 12.764  1.00 38.37  ? 107 VAL C N     1 
ATOM   8148  C  CA    . VAL E  5 107 ? 29.996 103.100 13.031  1.00 42.23  ? 107 VAL C CA    1 
ATOM   8149  C  C     . VAL E  5 107 ? 29.931 103.815 14.374  1.00 33.64  ? 107 VAL C C     1 
ATOM   8150  O  O     . VAL E  5 107 ? 28.855 104.136 14.887  1.00 37.00  ? 107 VAL C O     1 
ATOM   8151  C  CB    . VAL E  5 107 ? 30.415 104.071 11.905  1.00 43.74  ? 107 VAL C CB    1 
ATOM   8152  C  CG1   . VAL E  5 107 ? 29.708 105.412 12.060  1.00 41.27  ? 107 VAL C CG1   1 
ATOM   8153  C  CG2   . VAL E  5 107 ? 31.932 104.244 11.850  1.00 54.00  ? 107 VAL C CG2   1 
ATOM   8154  N  N     . LEU E  5 108 ? 31.104 104.044 14.952  1.00 36.42  ? 108 LEU C N     1 
ATOM   8155  C  CA    . LEU E  5 108 ? 31.181 104.814 16.180  1.00 42.24  ? 108 LEU C CA    1 
ATOM   8156  C  C     . LEU E  5 108 ? 30.974 106.296 15.876  1.00 50.09  ? 108 LEU C C     1 
ATOM   8157  O  O     . LEU E  5 108 ? 31.522 106.809 14.894  1.00 62.23  ? 108 LEU C O     1 
ATOM   8158  C  CB    . LEU E  5 108 ? 32.532 104.612 16.873  1.00 31.69  ? 108 LEU C CB    1 
ATOM   8159  C  CG    . LEU E  5 108 ? 32.803 103.275 17.566  1.00 27.33  ? 108 LEU C CG    1 
ATOM   8160  C  CD1   . LEU E  5 108 ? 34.101 103.350 18.351  1.00 20.61  ? 108 LEU C CD1   1 
ATOM   8161  C  CD2   . LEU E  5 108 ? 31.651 102.894 18.468  1.00 22.10  ? 108 LEU C CD2   1 
ATOM   8162  N  N     . PRO E  5 109 ? 30.170 107.000 16.672  1.00 47.95  ? 109 PRO C N     1 
ATOM   8163  C  CA    . PRO E  5 109 ? 30.076 108.460 16.520  1.00 42.53  ? 109 PRO C CA    1 
ATOM   8164  C  C     . PRO E  5 109 ? 31.435 109.099 16.757  1.00 43.45  ? 109 PRO C C     1 
ATOM   8165  O  O     . PRO E  5 109 ? 32.006 109.002 17.846  1.00 54.55  ? 109 PRO C O     1 
ATOM   8166  C  CB    . PRO E  5 109 ? 29.056 108.862 17.590  1.00 29.89  ? 109 PRO C CB    1 
ATOM   8167  C  CG    . PRO E  5 109 ? 28.257 107.620 17.836  1.00 37.09  ? 109 PRO C CG    1 
ATOM   8168  C  CD    . PRO E  5 109 ? 29.223 106.482 17.672  1.00 42.86  ? 109 PRO C CD    1 
ATOM   8169  N  N     . ASN E  5 110 ? 31.965 109.739 15.717  1.00 48.21  ? 110 ASN C N     1 
ATOM   8170  C  CA    . ASN E  5 110 ? 33.288 110.352 15.803  1.00 60.19  ? 110 ASN C CA    1 
ATOM   8171  C  C     . ASN E  5 110 ? 33.399 111.415 14.720  1.00 54.81  ? 110 ASN C C     1 
ATOM   8172  O  O     . ASN E  5 110 ? 33.407 111.085 13.530  1.00 53.40  ? 110 ASN C O     1 
ATOM   8173  C  CB    . ASN E  5 110 ? 34.383 109.301 15.654  1.00 69.08  ? 110 ASN C CB    1 
ATOM   8174  C  CG    . ASN E  5 110 ? 35.775 109.904 15.677  1.00 74.76  ? 110 ASN C CG    1 
ATOM   8175  O  OD1   . ASN E  5 110 ? 35.995 110.969 16.256  1.00 77.92  ? 110 ASN C OD1   1 
ATOM   8176  N  ND2   . ASN E  5 110 ? 36.723 109.223 15.042  1.00 75.08  ? 110 ASN C ND2   1 
ATOM   8177  N  N     . ILE E  5 111 ? 33.483 112.677 15.133  1.00 55.57  ? 111 ILE C N     1 
ATOM   8178  C  CA    . ILE E  5 111 ? 33.717 113.800 14.234  1.00 45.73  ? 111 ILE C CA    1 
ATOM   8179  C  C     . ILE E  5 111 ? 35.105 114.350 14.523  1.00 48.96  ? 111 ILE C C     1 
ATOM   8180  O  O     . ILE E  5 111 ? 35.452 114.591 15.685  1.00 62.57  ? 111 ILE C O     1 
ATOM   8181  C  CB    . ILE E  5 111 ? 32.651 114.896 14.405  1.00 46.14  ? 111 ILE C CB    1 
ATOM   8182  C  CG1   . ILE E  5 111 ? 31.259 114.344 14.098  1.00 49.63  ? 111 ILE C CG1   1 
ATOM   8183  C  CG2   . ILE E  5 111 ? 32.967 116.091 13.520  1.00 51.99  ? 111 ILE C CG2   1 
ATOM   8184  C  CD1   . ILE E  5 111 ? 30.150 115.356 14.295  1.00 51.82  ? 111 ILE C CD1   1 
ATOM   8185  N  N     . GLN E  5 112 ? 35.901 114.532 13.473  1.00 66.02  ? 112 GLN C N     1 
ATOM   8186  C  CA    . GLN E  5 112 ? 37.206 115.155 13.639  1.00 60.78  ? 112 GLN C CA    1 
ATOM   8187  C  C     . GLN E  5 112 ? 37.031 116.580 14.144  1.00 65.86  ? 112 GLN C C     1 
ATOM   8188  O  O     . GLN E  5 112 ? 36.190 117.330 13.641  1.00 67.91  ? 112 GLN C O     1 
ATOM   8189  C  CB    . GLN E  5 112 ? 37.975 115.135 12.319  1.00 50.50  ? 112 GLN C CB    1 
ATOM   8190  C  CG    . GLN E  5 112 ? 38.318 113.734 11.837  1.00 45.29  ? 112 GLN C CG    1 
ATOM   8191  C  CD    . GLN E  5 112 ? 39.164 112.967 12.837  1.00 47.54  ? 112 GLN C CD    1 
ATOM   8192  O  OE1   . GLN E  5 112 ? 40.277 113.378 13.171  1.00 47.45  ? 112 GLN C OE1   1 
ATOM   8193  N  NE2   . GLN E  5 112 ? 38.634 111.850 13.329  1.00 44.13  ? 112 GLN C NE2   1 
ATOM   8194  N  N     . SER E  5 113 ? 37.831 116.946 15.151  1.00 63.81  ? 113 SER C N     1 
ATOM   8195  C  CA    . SER E  5 113 ? 37.611 118.198 15.869  1.00 65.72  ? 113 SER C CA    1 
ATOM   8196  C  C     . SER E  5 113 ? 37.683 119.412 14.952  1.00 65.26  ? 113 SER C C     1 
ATOM   8197  O  O     . SER E  5 113 ? 36.972 120.399 15.175  1.00 73.89  ? 113 SER C O     1 
ATOM   8198  C  CB    . SER E  5 113 ? 38.624 118.331 17.007  1.00 70.52  ? 113 SER C CB    1 
ATOM   8199  O  OG    . SER E  5 113 ? 39.951 118.224 16.522  1.00 77.07  ? 113 SER C OG    1 
ATOM   8200  N  N     . VAL E  5 114 ? 38.524 119.360 13.916  1.00 60.72  ? 114 VAL C N     1 
ATOM   8201  C  CA    . VAL E  5 114 ? 38.659 120.490 13.003  1.00 62.61  ? 114 VAL C CA    1 
ATOM   8202  C  C     . VAL E  5 114 ? 37.361 120.764 12.252  1.00 65.76  ? 114 VAL C C     1 
ATOM   8203  O  O     . VAL E  5 114 ? 37.128 121.894 11.808  1.00 70.63  ? 114 VAL C O     1 
ATOM   8204  C  CB    . VAL E  5 114 ? 39.835 120.240 12.032  1.00 64.32  ? 114 VAL C CB    1 
ATOM   8205  C  CG1   . VAL E  5 114 ? 39.547 119.043 11.133  1.00 64.46  ? 114 VAL C CG1   1 
ATOM   8206  C  CG2   . VAL E  5 114 ? 40.139 121.485 11.208  1.00 63.36  ? 114 VAL C CG2   1 
ATOM   8207  N  N     . LEU E  5 115 ? 36.493 119.760 12.116  1.00 62.88  ? 115 LEU C N     1 
ATOM   8208  C  CA    . LEU E  5 115 ? 35.233 119.929 11.402  1.00 59.60  ? 115 LEU C CA    1 
ATOM   8209  C  C     . LEU E  5 115 ? 34.165 120.630 12.232  1.00 62.39  ? 115 LEU C C     1 
ATOM   8210  O  O     . LEU E  5 115 ? 33.099 120.951 11.695  1.00 62.86  ? 115 LEU C O     1 
ATOM   8211  C  CB    . LEU E  5 115 ? 34.711 118.567 10.937  1.00 55.72  ? 115 LEU C CB    1 
ATOM   8212  C  CG    . LEU E  5 115 ? 35.673 117.749 10.074  1.00 52.81  ? 115 LEU C CG    1 
ATOM   8213  C  CD1   . LEU E  5 115 ? 35.020 116.456 9.619   1.00 49.31  ? 115 LEU C CD1   1 
ATOM   8214  C  CD2   . LEU E  5 115 ? 36.147 118.559 8.885   1.00 53.68  ? 115 LEU C CD2   1 
ATOM   8215  N  N     . LEU E  5 116 ? 34.419 120.873 13.513  1.00 64.36  ? 116 LEU C N     1 
ATOM   8216  C  CA    . LEU E  5 116 ? 33.453 121.547 14.363  1.00 67.80  ? 116 LEU C CA    1 
ATOM   8217  C  C     . LEU E  5 116 ? 33.587 123.064 14.227  1.00 71.62  ? 116 LEU C C     1 
ATOM   8218  O  O     . LEU E  5 116 ? 34.677 123.576 13.957  1.00 72.22  ? 116 LEU C O     1 
ATOM   8219  C  CB    . LEU E  5 116 ? 33.650 121.134 15.818  1.00 67.77  ? 116 LEU C CB    1 
ATOM   8220  C  CG    . LEU E  5 116 ? 33.565 119.632 16.100  1.00 67.60  ? 116 LEU C CG    1 
ATOM   8221  C  CD1   . LEU E  5 116 ? 33.873 119.338 17.560  1.00 65.06  ? 116 LEU C CD1   1 
ATOM   8222  C  CD2   . LEU E  5 116 ? 32.193 119.095 15.721  1.00 62.46  ? 116 LEU C CD2   1 
ATOM   8223  N  N     . PRO E  5 117 ? 32.494 123.805 14.406  1.00 75.98  ? 117 PRO C N     1 
ATOM   8224  C  CA    . PRO E  5 117 ? 32.562 125.267 14.284  1.00 83.82  ? 117 PRO C CA    1 
ATOM   8225  C  C     . PRO E  5 117 ? 33.311 125.887 15.454  1.00 97.33  ? 117 PRO C C     1 
ATOM   8226  O  O     . PRO E  5 117 ? 33.574 125.249 16.475  1.00 87.23  ? 117 PRO C O     1 
ATOM   8227  C  CB    . PRO E  5 117 ? 31.092 125.690 14.273  1.00 79.51  ? 117 PRO C CB    1 
ATOM   8228  C  CG    . PRO E  5 117 ? 30.397 124.613 15.037  1.00 77.40  ? 117 PRO C CG    1 
ATOM   8229  C  CD    . PRO E  5 117 ? 31.127 123.341 14.703  1.00 73.12  ? 117 PRO C CD    1 
ATOM   8230  N  N     . LYS E  5 118 ? 33.653 127.164 15.290  1.00 104.20 ? 118 LYS C N     1 
ATOM   8231  C  CA    . LYS E  5 118 ? 34.372 127.895 16.325  1.00 129.55 ? 118 LYS C CA    1 
ATOM   8232  C  C     . LYS E  5 118 ? 34.331 129.385 16.014  1.00 144.96 ? 118 LYS C C     1 
ATOM   8233  O  O     . LYS E  5 118 ? 34.219 129.786 14.851  1.00 154.49 ? 118 LYS C O     1 
ATOM   8234  C  CB    . LYS E  5 118 ? 35.826 127.412 16.444  1.00 138.41 ? 118 LYS C CB    1 
ATOM   8235  C  CG    . LYS E  5 118 ? 36.548 127.887 17.698  1.00 148.08 ? 118 LYS C CG    1 
ATOM   8236  C  CD    . LYS E  5 118 ? 35.709 127.653 18.948  1.00 154.62 ? 118 LYS C CD    1 
ATOM   8237  C  CE    . LYS E  5 118 ? 35.490 126.170 19.215  1.00 154.27 ? 118 LYS C CE    1 
ATOM   8238  N  NZ    . LYS E  5 118 ? 34.533 125.950 20.333  1.00 156.17 ? 118 LYS C NZ    1 
ATOM   8239  N  N     . LYS E  5 119 ? 34.418 130.192 17.074  1.00 154.83 ? 119 LYS C N     1 
ATOM   8240  C  CA    . LYS E  5 119 ? 34.459 131.653 16.991  1.00 156.65 ? 119 LYS C CA    1 
ATOM   8241  C  C     . LYS E  5 119 ? 33.234 132.200 16.252  1.00 162.90 ? 119 LYS C C     1 
ATOM   8242  O  O     . LYS E  5 119 ? 33.341 132.927 15.261  1.00 165.85 ? 119 LYS C O     1 
ATOM   8243  C  CB    . LYS E  5 119 ? 35.762 132.133 16.340  1.00 149.63 ? 119 LYS C CB    1 
ATOM   8244  C  CG    . LYS E  5 119 ? 36.100 133.588 16.647  1.00 150.84 ? 119 LYS C CG    1 
ATOM   8245  C  CD    . LYS E  5 119 ? 37.329 134.062 15.888  1.00 147.15 ? 119 LYS C CD    1 
ATOM   8246  C  CE    . LYS E  5 119 ? 37.647 135.514 16.220  1.00 148.30 ? 119 LYS C CE    1 
ATOM   8247  N  NZ    . LYS E  5 119 ? 38.795 136.038 15.431  1.00 146.87 ? 119 LYS C NZ    1 
ATOM   8248  N  N     . THR E  5 120 ? 32.061 131.834 16.766  1.00 163.82 ? 120 THR C N     1 
ATOM   8249  C  CA    . THR E  5 120 ? 30.778 132.288 16.230  1.00 161.51 ? 120 THR C CA    1 
ATOM   8250  C  C     . THR E  5 120 ? 30.679 132.024 14.726  1.00 158.50 ? 120 THR C C     1 
ATOM   8251  O  O     . THR E  5 120 ? 29.629 132.216 14.112  1.00 158.20 ? 120 THR C O     1 
ATOM   8252  C  CB    . THR E  5 120 ? 30.552 133.791 16.507  1.00 162.64 ? 120 THR C CB    1 
ATOM   8253  O  OG1   . THR E  5 120 ? 31.110 134.131 17.782  1.00 163.51 ? 120 THR C OG1   1 
ATOM   8254  C  CG2   . THR E  5 120 ? 29.066 134.119 16.520  1.00 163.25 ? 120 THR C CG2   1 
ATOM   8255  N  N     . LYS F  6 28  ? 15.799 66.655  5.928   1.00 106.11 ? 28  LYS D N     1 
ATOM   8256  C  CA    . LYS F  6 28  ? 16.505 67.926  6.048   1.00 113.70 ? 28  LYS D CA    1 
ATOM   8257  C  C     . LYS F  6 28  ? 17.738 67.781  6.933   1.00 117.84 ? 28  LYS D C     1 
ATOM   8258  O  O     . LYS F  6 28  ? 17.624 67.505  8.128   1.00 112.44 ? 28  LYS D O     1 
ATOM   8259  C  CB    . LYS F  6 28  ? 15.576 69.005  6.610   1.00 113.03 ? 28  LYS D CB    1 
ATOM   8260  C  CG    . LYS F  6 28  ? 15.396 70.213  5.703   1.00 108.62 ? 28  LYS D CG    1 
ATOM   8261  C  CD    . LYS F  6 28  ? 16.718 70.920  5.450   1.00 105.39 ? 28  LYS D CD    1 
ATOM   8262  C  CE    . LYS F  6 28  ? 16.514 72.215  4.678   1.00 107.87 ? 28  LYS D CE    1 
ATOM   8263  N  NZ    . LYS F  6 28  ? 15.845 71.985  3.365   1.00 111.52 ? 28  LYS D NZ    1 
ATOM   8264  N  N     . THR F  6 29  ? 18.915 67.966  6.337   1.00 111.54 ? 29  THR D N     1 
ATOM   8265  C  CA    . THR F  6 29  ? 20.159 67.843  7.084   1.00 112.57 ? 29  THR D CA    1 
ATOM   8266  C  C     . THR F  6 29  ? 20.231 68.898  8.181   1.00 115.00 ? 29  THR D C     1 
ATOM   8267  O  O     . THR F  6 29  ? 19.896 70.066  7.968   1.00 116.58 ? 29  THR D O     1 
ATOM   8268  C  CB    . THR F  6 29  ? 21.361 67.973  6.147   1.00 107.14 ? 29  THR D CB    1 
ATOM   8269  O  OG1   . THR F  6 29  ? 21.217 69.149  5.341   1.00 107.96 ? 29  THR D OG1   1 
ATOM   8270  C  CG2   . THR F  6 29  ? 21.469 66.752  5.247   1.00 103.15 ? 29  THR D CG2   1 
ATOM   8271  N  N     . ARG F  6 30  ? 20.672 68.475  9.362   1.00 111.40 ? 30  ARG D N     1 
ATOM   8272  C  CA    . ARG F  6 30  ? 20.725 69.369  10.509  1.00 102.49 ? 30  ARG D CA    1 
ATOM   8273  C  C     . ARG F  6 30  ? 21.832 70.402  10.344  1.00 88.29  ? 30  ARG D C     1 
ATOM   8274  O  O     . ARG F  6 30  ? 22.919 70.101  9.843   1.00 89.73  ? 30  ARG D O     1 
ATOM   8275  C  CB    . ARG F  6 30  ? 20.944 68.570  11.791  1.00 110.04 ? 30  ARG D CB    1 
ATOM   8276  C  CG    . ARG F  6 30  ? 22.087 67.570  11.712  1.00 116.39 ? 30  ARG D CG    1 
ATOM   8277  C  CD    . ARG F  6 30  ? 22.748 67.409  13.066  1.00 121.92 ? 30  ARG D CD    1 
ATOM   8278  N  NE    . ARG F  6 30  ? 21.764 67.222  14.126  1.00 128.69 ? 30  ARG D NE    1 
ATOM   8279  C  CZ    . ARG F  6 30  ? 22.010 67.427  15.416  1.00 132.45 ? 30  ARG D CZ    1 
ATOM   8280  N  NH1   . ARG F  6 30  ? 23.210 67.833  15.806  1.00 131.65 ? 30  ARG D NH1   1 
ATOM   8281  N  NH2   . ARG F  6 30  ? 21.054 67.233  16.314  1.00 135.46 ? 30  ARG D NH2   1 
ATOM   8282  N  N     . LYS F  6 31  ? 21.548 71.629  10.773  1.00 88.19  ? 31  LYS D N     1 
ATOM   8283  C  CA    . LYS F  6 31  ? 22.513 72.725  10.757  1.00 80.43  ? 31  LYS D CA    1 
ATOM   8284  C  C     . LYS F  6 31  ? 22.831 73.080  12.207  1.00 82.75  ? 31  LYS D C     1 
ATOM   8285  O  O     . LYS F  6 31  ? 22.066 73.791  12.865  1.00 82.73  ? 31  LYS D O     1 
ATOM   8286  C  CB    . LYS F  6 31  ? 21.966 73.925  9.989   1.00 75.23  ? 31  LYS D CB    1 
ATOM   8287  C  CG    . LYS F  6 31  ? 22.950 75.076  9.855   1.00 81.41  ? 31  LYS D CG    1 
ATOM   8288  C  CD    . LYS F  6 31  ? 24.271 74.602  9.266   1.00 92.89  ? 31  LYS D CD    1 
ATOM   8289  C  CE    . LYS F  6 31  ? 25.190 75.771  8.948   1.00 99.83  ? 31  LYS D CE    1 
ATOM   8290  N  NZ    . LYS F  6 31  ? 25.469 76.608  10.149  1.00 104.32 ? 31  LYS D NZ    1 
ATOM   8291  N  N     . GLU F  6 32  ? 23.958 72.575  12.702  1.00 75.63  ? 32  GLU D N     1 
ATOM   8292  C  CA    . GLU F  6 32  ? 24.360 72.836  14.074  1.00 75.00  ? 32  GLU D CA    1 
ATOM   8293  C  C     . GLU F  6 32  ? 24.804 74.286  14.237  1.00 66.29  ? 32  GLU D C     1 
ATOM   8294  O  O     . GLU F  6 32  ? 25.089 74.992  13.264  1.00 69.21  ? 32  GLU D O     1 
ATOM   8295  C  CB    . GLU F  6 32  ? 25.490 71.895  14.488  1.00 84.05  ? 32  GLU D CB    1 
ATOM   8296  C  CG    . GLU F  6 32  ? 26.804 72.167  13.777  1.00 91.16  ? 32  GLU D CG    1 
ATOM   8297  C  CD    . GLU F  6 32  ? 27.881 71.172  14.152  1.00 99.80  ? 32  GLU D CD    1 
ATOM   8298  O  OE1   . GLU F  6 32  ? 27.550 70.156  14.800  1.00 106.15 ? 32  GLU D OE1   1 
ATOM   8299  O  OE2   . GLU F  6 32  ? 29.057 71.405  13.801  1.00 99.87  ? 32  GLU D OE2   1 
ATOM   8300  N  N     . SER F  6 33  ? 24.871 74.725  15.491  1.00 61.75  ? 33  SER D N     1 
ATOM   8301  C  CA    . SER F  6 33  ? 25.236 76.100  15.798  1.00 59.51  ? 33  SER D CA    1 
ATOM   8302  C  C     . SER F  6 33  ? 25.599 76.198  17.273  1.00 51.03  ? 33  SER D C     1 
ATOM   8303  O  O     . SER F  6 33  ? 25.384 75.266  18.051  1.00 52.95  ? 33  SER D O     1 
ATOM   8304  C  CB    . SER F  6 33  ? 24.098 77.064  15.450  1.00 62.83  ? 33  SER D CB    1 
ATOM   8305  O  OG    . SER F  6 33  ? 23.087 77.043  16.441  1.00 69.59  ? 33  SER D OG    1 
ATOM   8306  N  N     . TYR F  6 34  ? 26.150 77.350  17.649  1.00 43.59  ? 34  TYR D N     1 
ATOM   8307  C  CA    . TYR F  6 34  ? 26.516 77.634  19.029  1.00 54.82  ? 34  TYR D CA    1 
ATOM   8308  C  C     . TYR F  6 34  ? 25.457 78.447  19.765  1.00 54.73  ? 34  TYR D C     1 
ATOM   8309  O  O     . TYR F  6 34  ? 25.730 78.947  20.860  1.00 53.57  ? 34  TYR D O     1 
ATOM   8310  C  CB    . TYR F  6 34  ? 27.856 78.374  19.079  1.00 54.69  ? 34  TYR D CB    1 
ATOM   8311  C  CG    . TYR F  6 34  ? 29.051 77.542  18.674  1.00 55.32  ? 34  TYR D CG    1 
ATOM   8312  C  CD1   . TYR F  6 34  ? 29.663 76.684  19.578  1.00 54.51  ? 34  TYR D CD1   1 
ATOM   8313  C  CD2   . TYR F  6 34  ? 29.576 77.622  17.391  1.00 51.39  ? 34  TYR D CD2   1 
ATOM   8314  C  CE1   . TYR F  6 34  ? 30.757 75.924  19.214  1.00 54.86  ? 34  TYR D CE1   1 
ATOM   8315  C  CE2   . TYR F  6 34  ? 30.672 76.867  17.020  1.00 53.61  ? 34  TYR D CE2   1 
ATOM   8316  C  CZ    . TYR F  6 34  ? 31.258 76.021  17.935  1.00 49.30  ? 34  TYR D CZ    1 
ATOM   8317  O  OH    . TYR F  6 34  ? 32.348 75.266  17.569  1.00 53.38  ? 34  TYR D OH    1 
ATOM   8318  N  N     . ALA F  6 35  ? 24.255 78.579  19.196  1.00 54.47  ? 35  ALA D N     1 
ATOM   8319  C  CA    . ALA F  6 35  ? 23.276 79.525  19.728  1.00 52.02  ? 35  ALA D CA    1 
ATOM   8320  C  C     . ALA F  6 35  ? 22.786 79.123  21.116  1.00 52.42  ? 35  ALA D C     1 
ATOM   8321  O  O     . ALA F  6 35  ? 22.532 79.990  21.961  1.00 44.11  ? 35  ALA D O     1 
ATOM   8322  C  CB    . ALA F  6 35  ? 22.099 79.656  18.761  1.00 49.80  ? 35  ALA D CB    1 
ATOM   8323  N  N     . ILE F  6 36  ? 22.629 77.821  21.366  1.00 57.09  ? 36  ILE D N     1 
ATOM   8324  C  CA    . ILE F  6 36  ? 22.211 77.361  22.690  1.00 54.25  ? 36  ILE D CA    1 
ATOM   8325  C  C     . ILE F  6 36  ? 23.227 77.788  23.742  1.00 58.47  ? 36  ILE D C     1 
ATOM   8326  O  O     . ILE F  6 36  ? 22.877 78.355  24.787  1.00 63.88  ? 36  ILE D O     1 
ATOM   8327  C  CB    . ILE F  6 36  ? 22.012 75.834  22.688  1.00 50.29  ? 36  ILE D CB    1 
ATOM   8328  C  CG1   . ILE F  6 36  ? 20.647 75.466  22.104  1.00 51.46  ? 36  ILE D CG1   1 
ATOM   8329  C  CG2   . ILE F  6 36  ? 22.178 75.262  24.089  1.00 65.20  ? 36  ILE D CG2   1 
ATOM   8330  C  CD1   . ILE F  6 36  ? 20.293 73.996  22.265  1.00 55.76  ? 36  ILE D CD1   1 
ATOM   8331  N  N     . TYR F  6 37  ? 24.507 77.537  23.468  1.00 59.63  ? 37  TYR D N     1 
ATOM   8332  C  CA    . TYR F  6 37  ? 25.552 77.810  24.446  1.00 54.97  ? 37  TYR D CA    1 
ATOM   8333  C  C     . TYR F  6 37  ? 25.778 79.308  24.606  1.00 52.31  ? 37  TYR D C     1 
ATOM   8334  O  O     . TYR F  6 37  ? 25.991 79.799  25.725  1.00 53.70  ? 37  TYR D O     1 
ATOM   8335  C  CB    . TYR F  6 37  ? 26.825 77.081  24.023  1.00 46.22  ? 37  TYR D CB    1 
ATOM   8336  C  CG    . TYR F  6 37  ? 26.539 75.656  23.592  1.00 45.31  ? 37  TYR D CG    1 
ATOM   8337  C  CD1   . TYR F  6 37  ? 26.393 74.645  24.530  1.00 39.39  ? 37  TYR D CD1   1 
ATOM   8338  C  CD2   . TYR F  6 37  ? 26.379 75.328  22.251  1.00 50.16  ? 37  TYR D CD2   1 
ATOM   8339  C  CE1   . TYR F  6 37  ? 26.117 73.346  24.149  1.00 39.54  ? 37  TYR D CE1   1 
ATOM   8340  C  CE2   . TYR F  6 37  ? 26.101 74.030  21.860  1.00 54.01  ? 37  TYR D CE2   1 
ATOM   8341  C  CZ    . TYR F  6 37  ? 25.972 73.044  22.815  1.00 56.20  ? 37  TYR D CZ    1 
ATOM   8342  O  OH    . TYR F  6 37  ? 25.698 71.749  22.437  1.00 69.06  ? 37  TYR D OH    1 
ATOM   8343  N  N     . VAL F  6 38  ? 25.713 80.053  23.498  1.00 47.68  ? 38  VAL D N     1 
ATOM   8344  C  CA    . VAL F  6 38  ? 25.762 81.509  23.571  1.00 42.94  ? 38  VAL D CA    1 
ATOM   8345  C  C     . VAL F  6 38  ? 24.606 82.036  24.412  1.00 39.41  ? 38  VAL D C     1 
ATOM   8346  O  O     . VAL F  6 38  ? 24.750 83.024  25.144  1.00 43.45  ? 38  VAL D O     1 
ATOM   8347  C  CB    . VAL F  6 38  ? 25.759 82.117  22.156  1.00 40.37  ? 38  VAL D CB    1 
ATOM   8348  C  CG1   . VAL F  6 38  ? 25.569 83.625  22.218  1.00 41.73  ? 38  VAL D CG1   1 
ATOM   8349  C  CG2   . VAL F  6 38  ? 27.049 81.776  21.428  1.00 36.82  ? 38  VAL D CG2   1 
ATOM   8350  N  N     . TYR F  6 39  ? 23.446 81.380  24.335  1.00 35.81  ? 39  TYR D N     1 
ATOM   8351  C  CA    . TYR F  6 39  ? 22.308 81.831  25.129  1.00 43.10  ? 39  TYR D CA    1 
ATOM   8352  C  C     . TYR F  6 39  ? 22.508 81.526  26.608  1.00 49.36  ? 39  TYR D C     1 
ATOM   8353  O  O     . TYR F  6 39  ? 22.145 82.339  27.466  1.00 45.14  ? 39  TYR D O     1 
ATOM   8354  C  CB    . TYR F  6 39  ? 21.013 81.200  24.619  1.00 48.92  ? 39  TYR D CB    1 
ATOM   8355  C  CG    . TYR F  6 39  ? 19.776 81.868  25.180  1.00 59.53  ? 39  TYR D CG    1 
ATOM   8356  C  CD1   . TYR F  6 39  ? 19.374 83.117  24.723  1.00 61.19  ? 39  TYR D CD1   1 
ATOM   8357  C  CD2   . TYR F  6 39  ? 19.020 81.260  26.175  1.00 66.05  ? 39  TYR D CD2   1 
ATOM   8358  C  CE1   . TYR F  6 39  ? 18.250 83.740  25.235  1.00 67.99  ? 39  TYR D CE1   1 
ATOM   8359  C  CE2   . TYR F  6 39  ? 17.891 81.874  26.692  1.00 69.63  ? 39  TYR D CE2   1 
ATOM   8360  C  CZ    . TYR F  6 39  ? 17.512 83.114  26.219  1.00 73.14  ? 39  TYR D CZ    1 
ATOM   8361  O  OH    . TYR F  6 39  ? 16.391 83.731  26.729  1.00 76.46  ? 39  TYR D OH    1 
ATOM   8362  N  N     . LYS F  6 40  ? 23.080 80.362  26.932  1.00 44.60  ? 40  LYS D N     1 
ATOM   8363  C  CA    . LYS F  6 40  ? 23.383 80.065  28.331  1.00 47.87  ? 40  LYS D CA    1 
ATOM   8364  C  C     . LYS F  6 40  ? 24.352 81.093  28.907  1.00 50.81  ? 40  LYS D C     1 
ATOM   8365  O  O     . LYS F  6 40  ? 24.083 81.705  29.952  1.00 59.05  ? 40  LYS D O     1 
ATOM   8366  C  CB    . LYS F  6 40  ? 23.954 78.653  28.468  1.00 41.03  ? 40  LYS D CB    1 
ATOM   8367  C  CG    . LYS F  6 40  ? 22.987 77.537  28.116  1.00 40.95  ? 40  LYS D CG    1 
ATOM   8368  C  CD    . LYS F  6 40  ? 23.565 76.180  28.496  1.00 50.00  ? 40  LYS D CD    1 
ATOM   8369  C  CE    . LYS F  6 40  ? 23.016 75.066  27.614  1.00 62.26  ? 40  LYS D CE    1 
ATOM   8370  N  NZ    . LYS F  6 40  ? 21.531 74.973  27.667  1.00 73.82  ? 40  LYS D NZ    1 
ATOM   8371  N  N     . VAL F  6 41  ? 25.481 81.313  28.225  1.00 48.95  ? 41  VAL D N     1 
ATOM   8372  C  CA    . VAL F  6 41  ? 26.444 82.294  28.714  1.00 46.90  ? 41  VAL D CA    1 
ATOM   8373  C  C     . VAL F  6 41  ? 25.887 83.710  28.648  1.00 57.08  ? 41  VAL D C     1 
ATOM   8374  O  O     . VAL F  6 41  ? 26.432 84.613  29.294  1.00 67.08  ? 41  VAL D O     1 
ATOM   8375  C  CB    . VAL F  6 41  ? 27.777 82.198  27.945  1.00 34.57  ? 41  VAL D CB    1 
ATOM   8376  C  CG1   . VAL F  6 41  ? 28.280 80.759  27.939  1.00 32.84  ? 41  VAL D CG1   1 
ATOM   8377  C  CG2   . VAL F  6 41  ? 27.627 82.728  26.534  1.00 61.34  ? 41  VAL D CG2   1 
ATOM   8378  N  N     . LEU F  6 42  ? 24.810 83.934  27.889  1.00 53.29  ? 42  LEU D N     1 
ATOM   8379  C  CA    . LEU F  6 42  ? 24.147 85.233  27.918  1.00 48.74  ? 42  LEU D CA    1 
ATOM   8380  C  C     . LEU F  6 42  ? 23.287 85.387  29.164  1.00 51.60  ? 42  LEU D C     1 
ATOM   8381  O  O     . LEU F  6 42  ? 23.306 86.443  29.807  1.00 51.72  ? 42  LEU D O     1 
ATOM   8382  C  CB    . LEU F  6 42  ? 23.294 85.428  26.665  1.00 38.86  ? 42  LEU D CB    1 
ATOM   8383  C  CG    . LEU F  6 42  ? 22.402 86.674  26.696  1.00 37.31  ? 42  LEU D CG    1 
ATOM   8384  C  CD1   . LEU F  6 42  ? 23.237 87.942  26.790  1.00 35.99  ? 42  LEU D CD1   1 
ATOM   8385  C  CD2   . LEU F  6 42  ? 21.482 86.722  25.487  1.00 35.29  ? 42  LEU D CD2   1 
ATOM   8386  N  N     . LYS F  6 43  ? 22.527 84.349  29.523  1.00 45.88  ? 43  LYS D N     1 
ATOM   8387  C  CA    . LYS F  6 43  ? 21.716 84.429  30.731  1.00 42.73  ? 43  LYS D CA    1 
ATOM   8388  C  C     . LYS F  6 43  ? 22.569 84.393  31.991  1.00 51.50  ? 43  LYS D C     1 
ATOM   8389  O  O     . LYS F  6 43  ? 22.084 84.772  33.063  1.00 51.76  ? 43  LYS D O     1 
ATOM   8390  C  CB    . LYS F  6 43  ? 20.680 83.300  30.768  1.00 39.67  ? 43  LYS D CB    1 
ATOM   8391  C  CG    . LYS F  6 43  ? 19.825 83.154  29.503  1.00 53.38  ? 43  LYS D CG    1 
ATOM   8392  C  CD    . LYS F  6 43  ? 19.451 84.500  28.877  1.00 62.25  ? 43  LYS D CD    1 
ATOM   8393  C  CE    . LYS F  6 43  ? 18.457 85.280  29.717  1.00 68.50  ? 43  LYS D CE    1 
ATOM   8394  N  NZ    . LYS F  6 43  ? 18.410 86.709  29.289  1.00 70.76  ? 43  LYS D NZ    1 
ATOM   8395  N  N     . GLN F  6 44  ? 23.825 83.950  31.888  1.00 53.91  ? 44  GLN D N     1 
ATOM   8396  C  CA    . GLN F  6 44  ? 24.720 84.045  33.038  1.00 36.63  ? 44  GLN D CA    1 
ATOM   8397  C  C     . GLN F  6 44  ? 25.154 85.486  33.292  1.00 37.43  ? 44  GLN D C     1 
ATOM   8398  O  O     . GLN F  6 44  ? 25.162 85.939  34.442  1.00 44.64  ? 44  GLN D O     1 
ATOM   8399  C  CB    . GLN F  6 44  ? 25.941 83.151  32.836  1.00 35.45  ? 44  GLN D CB    1 
ATOM   8400  C  CG    . GLN F  6 44  ? 25.686 81.680  33.085  1.00 36.88  ? 44  GLN D CG    1 
ATOM   8401  C  CD    . GLN F  6 44  ? 26.953 80.854  32.989  1.00 48.96  ? 44  GLN D CD    1 
ATOM   8402  O  OE1   . GLN F  6 44  ? 27.099 79.837  33.668  1.00 51.42  ? 44  GLN D OE1   1 
ATOM   8403  N  NE2   . GLN F  6 44  ? 27.879 81.289  32.141  1.00 39.87  ? 44  GLN D NE2   1 
ATOM   8404  N  N     . VAL F  6 45  ? 25.516 86.223  32.240  1.00 37.41  ? 45  VAL D N     1 
ATOM   8405  C  CA    . VAL F  6 45  ? 26.092 87.551  32.437  1.00 37.48  ? 45  VAL D CA    1 
ATOM   8406  C  C     . VAL F  6 45  ? 25.001 88.599  32.638  1.00 40.67  ? 45  VAL D C     1 
ATOM   8407  O  O     . VAL F  6 45  ? 25.068 89.411  33.568  1.00 56.03  ? 45  VAL D O     1 
ATOM   8408  C  CB    . VAL F  6 45  ? 27.032 87.915  31.270  1.00 39.02  ? 45  VAL D CB    1 
ATOM   8409  C  CG1   . VAL F  6 45  ? 28.280 87.050  31.312  1.00 31.33  ? 45  VAL D CG1   1 
ATOM   8410  C  CG2   . VAL F  6 45  ? 26.332 87.762  29.928  1.00 35.21  ? 45  VAL D CG2   1 
ATOM   8411  N  N     . HIS F  6 46  ? 23.985 88.606  31.776  1.00 45.86  ? 46  HIS D N     1 
ATOM   8412  C  CA    . HIS F  6 46  ? 22.858 89.532  31.881  1.00 49.55  ? 46  HIS D CA    1 
ATOM   8413  C  C     . HIS F  6 46  ? 21.580 88.706  31.891  1.00 50.84  ? 46  HIS D C     1 
ATOM   8414  O  O     . HIS F  6 46  ? 21.023 88.388  30.832  1.00 50.80  ? 46  HIS D O     1 
ATOM   8415  C  CB    . HIS F  6 46  ? 22.855 90.546  30.739  1.00 39.96  ? 46  HIS D CB    1 
ATOM   8416  C  CG    . HIS F  6 46  ? 24.016 91.492  30.762  1.00 41.64  ? 46  HIS D CG    1 
ATOM   8417  N  ND1   . HIS F  6 46  ? 25.144 91.304  29.995  1.00 42.86  ? 46  HIS D ND1   1 
ATOM   8418  C  CD2   . HIS F  6 46  ? 24.219 92.636  31.456  1.00 44.44  ? 46  HIS D CD2   1 
ATOM   8419  C  CE1   . HIS F  6 46  ? 25.993 92.292  30.214  1.00 39.43  ? 46  HIS D CE1   1 
ATOM   8420  N  NE2   . HIS F  6 46  ? 25.455 93.114  31.096  1.00 41.16  ? 46  HIS D NE2   1 
ATOM   8421  N  N     . PRO F  6 47  ? 21.083 88.342  33.075  1.00 47.48  ? 47  PRO D N     1 
ATOM   8422  C  CA    . PRO F  6 47  ? 19.951 87.403  33.139  1.00 52.78  ? 47  PRO D CA    1 
ATOM   8423  C  C     . PRO F  6 47  ? 18.648 87.956  32.586  1.00 53.21  ? 47  PRO D C     1 
ATOM   8424  O  O     . PRO F  6 47  ? 17.786 87.164  32.187  1.00 50.10  ? 47  PRO D O     1 
ATOM   8425  C  CB    . PRO F  6 47  ? 19.828 87.100  34.640  1.00 50.94  ? 47  PRO D CB    1 
ATOM   8426  C  CG    . PRO F  6 47  ? 21.145 87.514  35.233  1.00 47.45  ? 47  PRO D CG    1 
ATOM   8427  C  CD    . PRO F  6 47  ? 21.605 88.672  34.411  1.00 41.00  ? 47  PRO D CD    1 
ATOM   8428  N  N     . ASP F  6 48  ? 18.467 89.276  32.549  1.00 44.82  ? 48  ASP D N     1 
ATOM   8429  C  CA    . ASP F  6 48  ? 17.228 89.882  32.075  1.00 55.74  ? 48  ASP D CA    1 
ATOM   8430  C  C     . ASP F  6 48  ? 17.396 90.541  30.709  1.00 63.61  ? 48  ASP D C     1 
ATOM   8431  O  O     . ASP F  6 48  ? 16.677 91.488  30.378  1.00 74.74  ? 48  ASP D O     1 
ATOM   8432  C  CB    . ASP F  6 48  ? 16.707 90.897  33.091  1.00 63.58  ? 48  ASP D CB    1 
ATOM   8433  C  CG    . ASP F  6 48  ? 16.421 90.275  34.444  1.00 67.83  ? 48  ASP D CG    1 
ATOM   8434  O  OD1   . ASP F  6 48  ? 16.021 89.092  34.483  1.00 68.41  ? 48  ASP D OD1   1 
ATOM   8435  O  OD2   . ASP F  6 48  ? 16.597 90.970  35.467  1.00 68.42  ? 48  ASP D OD2   1 
ATOM   8436  N  N     . THR F  6 49  ? 18.335 90.049  29.904  1.00 53.93  ? 49  THR D N     1 
ATOM   8437  C  CA    . THR F  6 49  ? 18.631 90.634  28.603  1.00 41.79  ? 49  THR D CA    1 
ATOM   8438  C  C     . THR F  6 49  ? 18.577 89.548  27.540  1.00 45.14  ? 49  THR D C     1 
ATOM   8439  O  O     . THR F  6 49  ? 19.284 88.540  27.642  1.00 47.98  ? 49  THR D O     1 
ATOM   8440  C  CB    . THR F  6 49  ? 20.003 91.315  28.602  1.00 45.84  ? 49  THR D CB    1 
ATOM   8441  O  OG1   . THR F  6 49  ? 19.986 92.428  29.504  1.00 48.01  ? 49  THR D OG1   1 
ATOM   8442  C  CG2   . THR F  6 49  ? 20.354 91.805  27.206  1.00 48.11  ? 49  THR D CG2   1 
ATOM   8443  N  N     . GLY F  6 50  ? 17.743 89.756  26.523  1.00 43.14  ? 50  GLY D N     1 
ATOM   8444  C  CA    . GLY F  6 50  ? 17.658 88.856  25.395  1.00 49.01  ? 50  GLY D CA    1 
ATOM   8445  C  C     . GLY F  6 50  ? 18.623 89.243  24.291  1.00 48.31  ? 50  GLY D C     1 
ATOM   8446  O  O     . GLY F  6 50  ? 19.439 90.157  24.423  1.00 46.97  ? 50  GLY D O     1 
ATOM   8447  N  N     . ILE F  6 51  ? 18.522 88.524  23.177  1.00 44.59  ? 51  ILE D N     1 
ATOM   8448  C  CA    . ILE F  6 51  ? 19.390 88.768  22.029  1.00 48.11  ? 51  ILE D CA    1 
ATOM   8449  C  C     . ILE F  6 51  ? 18.588 88.522  20.758  1.00 48.19  ? 51  ILE D C     1 
ATOM   8450  O  O     . ILE F  6 51  ? 17.724 87.640  20.713  1.00 47.73  ? 51  ILE D O     1 
ATOM   8451  C  CB    . ILE F  6 51  ? 20.661 87.892  22.089  1.00 50.05  ? 51  ILE D CB    1 
ATOM   8452  C  CG1   . ILE F  6 51  ? 21.652 88.303  20.998  1.00 40.88  ? 51  ILE D CG1   1 
ATOM   8453  C  CG2   . ILE F  6 51  ? 20.310 86.414  21.980  1.00 48.89  ? 51  ILE D CG2   1 
ATOM   8454  C  CD1   . ILE F  6 51  ? 22.962 87.548  21.043  1.00 33.91  ? 51  ILE D CD1   1 
ATOM   8455  N  N     . SER F  6 52  ? 18.870 89.314  19.728  1.00 54.87  ? 52  SER D N     1 
ATOM   8456  C  CA    . SER F  6 52  ? 18.108 89.238  18.494  1.00 44.89  ? 52  SER D CA    1 
ATOM   8457  C  C     . SER F  6 52  ? 18.647 88.138  17.583  1.00 42.33  ? 52  SER D C     1 
ATOM   8458  O  O     . SER F  6 52  ? 19.778 87.669  17.732  1.00 49.64  ? 52  SER D O     1 
ATOM   8459  C  CB    . SER F  6 52  ? 18.132 90.582  17.762  1.00 37.11  ? 52  SER D CB    1 
ATOM   8460  O  OG    . SER F  6 52  ? 19.424 90.875  17.265  1.00 42.08  ? 52  SER D OG    1 
ATOM   8461  N  N     . SER F  6 53  ? 17.806 87.724  16.629  1.00 41.30  ? 53  SER D N     1 
ATOM   8462  C  CA    . SER F  6 53  ? 18.206 86.697  15.669  1.00 53.30  ? 53  SER D CA    1 
ATOM   8463  C  C     . SER F  6 53  ? 19.470 87.107  14.924  1.00 55.25  ? 53  SER D C     1 
ATOM   8464  O  O     . SER F  6 53  ? 20.410 86.313  14.785  1.00 59.57  ? 53  SER D O     1 
ATOM   8465  C  CB    . SER F  6 53  ? 17.068 86.425  14.683  1.00 59.78  ? 53  SER D CB    1 
ATOM   8466  O  OG    . SER F  6 53  ? 15.974 85.787  15.318  1.00 76.58  ? 53  SER D OG    1 
ATOM   8467  N  N     . LYS F  6 54  ? 19.513 88.351  14.443  1.00 38.13  ? 54  LYS D N     1 
ATOM   8468  C  CA    . LYS F  6 54  ? 20.706 88.838  13.760  1.00 42.11  ? 54  LYS D CA    1 
ATOM   8469  C  C     . LYS F  6 54  ? 21.908 88.840  14.697  1.00 43.45  ? 54  LYS D C     1 
ATOM   8470  O  O     . LYS F  6 54  ? 22.971 88.311  14.358  1.00 50.35  ? 54  LYS D O     1 
ATOM   8471  C  CB    . LYS F  6 54  ? 20.455 90.235  13.190  1.00 56.46  ? 54  LYS D CB    1 
ATOM   8472  C  CG    . LYS F  6 54  ? 19.501 90.258  12.005  1.00 66.78  ? 54  LYS D CG    1 
ATOM   8473  C  CD    . LYS F  6 54  ? 19.477 91.623  11.338  1.00 75.04  ? 54  LYS D CD    1 
ATOM   8474  C  CE    . LYS F  6 54  ? 18.655 91.593  10.058  1.00 84.49  ? 54  LYS D CE    1 
ATOM   8475  N  NZ    . LYS F  6 54  ? 18.759 92.873  9.301   1.00 88.47  ? 54  LYS D NZ    1 
ATOM   8476  N  N     . ALA F  6 55  ? 21.749 89.415  15.893  1.00 53.81  ? 55  ALA D N     1 
ATOM   8477  C  CA    . ALA F  6 55  ? 22.858 89.471  16.842  1.00 44.01  ? 55  ALA D CA    1 
ATOM   8478  C  C     . ALA F  6 55  ? 23.350 88.075  17.208  1.00 31.24  ? 55  ALA D C     1 
ATOM   8479  O  O     . ALA F  6 55  ? 24.562 87.840  17.305  1.00 27.28  ? 55  ALA D O     1 
ATOM   8480  C  CB    . ALA F  6 55  ? 22.440 90.241  18.094  1.00 38.80  ? 55  ALA D CB    1 
ATOM   8481  N  N     . MET F  6 56  ? 22.425 87.132  17.408  1.00 32.21  ? 56  MET D N     1 
ATOM   8482  C  CA    . MET F  6 56  ? 22.829 85.753  17.659  1.00 43.54  ? 56  MET D CA    1 
ATOM   8483  C  C     . MET F  6 56  ? 23.598 85.182  16.473  1.00 49.86  ? 56  MET D C     1 
ATOM   8484  O  O     . MET F  6 56  ? 24.566 84.434  16.654  1.00 58.67  ? 56  MET D O     1 
ATOM   8485  C  CB    . MET F  6 56  ? 21.606 84.889  17.971  1.00 44.40  ? 56  MET D CB    1 
ATOM   8486  C  CG    . MET F  6 56  ? 21.937 83.414  18.159  1.00 50.70  ? 56  MET D CG    1 
ATOM   8487  S  SD    . MET F  6 56  ? 23.156 83.141  19.464  1.00 59.01  ? 56  MET D SD    1 
ATOM   8488  C  CE    . MET F  6 56  ? 22.124 83.301  20.924  1.00 52.67  ? 56  MET D CE    1 
ATOM   8489  N  N     . SER F  6 57  ? 23.185 85.529  15.250  1.00 48.29  ? 57  SER D N     1 
ATOM   8490  C  CA    . SER F  6 57  ? 23.923 85.074  14.076  1.00 45.58  ? 57  SER D CA    1 
ATOM   8491  C  C     . SER F  6 57  ? 25.344 85.627  14.070  1.00 37.30  ? 57  SER D C     1 
ATOM   8492  O  O     . SER F  6 57  ? 26.302 84.891  13.795  1.00 38.59  ? 57  SER D O     1 
ATOM   8493  C  CB    . SER F  6 57  ? 23.181 85.476  12.799  1.00 46.84  ? 57  SER D CB    1 
ATOM   8494  O  OG    . SER F  6 57  ? 23.799 84.917  11.654  1.00 50.42  ? 57  SER D OG    1 
ATOM   8495  N  N     . ILE F  6 58  ? 25.501 86.918  14.380  1.00 28.73  ? 58  ILE D N     1 
ATOM   8496  C  CA    . ILE F  6 58  ? 26.837 87.500  14.490  1.00 34.46  ? 58  ILE D CA    1 
ATOM   8497  C  C     . ILE F  6 58  ? 27.655 86.751  15.533  1.00 37.16  ? 58  ILE D C     1 
ATOM   8498  O  O     . ILE F  6 58  ? 28.849 86.493  15.336  1.00 29.48  ? 58  ILE D O     1 
ATOM   8499  C  CB    . ILE F  6 58  ? 26.753 89.005  14.810  1.00 32.33  ? 58  ILE D CB    1 
ATOM   8500  C  CG1   . ILE F  6 58  ? 26.567 89.826  13.532  1.00 40.20  ? 58  ILE D CG1   1 
ATOM   8501  C  CG2   . ILE F  6 58  ? 28.013 89.473  15.527  1.00 22.45  ? 58  ILE D CG2   1 
ATOM   8502  C  CD1   . ILE F  6 58  ? 25.138 90.167  13.209  1.00 56.85  ? 58  ILE D CD1   1 
ATOM   8503  N  N     . MET F  6 59  ? 27.027 86.380  16.654  1.00 37.57  ? 59  MET D N     1 
ATOM   8504  C  CA    . MET F  6 59  ? 27.739 85.613  17.673  1.00 38.93  ? 59  MET D CA    1 
ATOM   8505  C  C     . MET F  6 59  ? 28.177 84.255  17.137  1.00 35.38  ? 59  MET D C     1 
ATOM   8506  O  O     . MET F  6 59  ? 29.285 83.788  17.432  1.00 30.79  ? 59  MET D O     1 
ATOM   8507  C  CB    . MET F  6 59  ? 26.863 85.448  18.913  1.00 39.61  ? 59  MET D CB    1 
ATOM   8508  C  CG    . MET F  6 59  ? 26.614 86.743  19.664  1.00 33.76  ? 59  MET D CG    1 
ATOM   8509  S  SD    . MET F  6 59  ? 28.151 87.492  20.233  1.00 43.10  ? 59  MET D SD    1 
ATOM   8510  C  CE    . MET F  6 59  ? 28.810 86.156  21.229  1.00 36.47  ? 59  MET D CE    1 
ATOM   8511  N  N     . ASN F  6 60  ? 27.323 83.612  16.338  1.00 34.79  ? 60  ASN D N     1 
ATOM   8512  C  CA    . ASN F  6 60  ? 27.685 82.340  15.721  1.00 35.35  ? 60  ASN D CA    1 
ATOM   8513  C  C     . ASN F  6 60  ? 28.905 82.498  14.822  1.00 39.38  ? 60  ASN D C     1 
ATOM   8514  O  O     . ASN F  6 60  ? 29.863 81.716  14.904  1.00 42.55  ? 60  ASN D O     1 
ATOM   8515  C  CB    . ASN F  6 60  ? 26.500 81.801  14.925  1.00 42.16  ? 60  ASN D CB    1 
ATOM   8516  C  CG    . ASN F  6 60  ? 26.316 80.315  15.092  1.00 49.98  ? 60  ASN D CG    1 
ATOM   8517  O  OD1   . ASN F  6 60  ? 25.229 79.791  14.866  1.00 70.43  ? 60  ASN D OD1   1 
ATOM   8518  N  ND2   . ASN F  6 60  ? 27.375 79.626  15.503  1.00 32.40  ? 60  ASN D ND2   1 
ATOM   8519  N  N     . SER F  6 61  ? 28.884 83.515  13.953  1.00 24.87  ? 61  SER D N     1 
ATOM   8520  C  CA    . SER F  6 61  ? 30.032 83.774  13.093  1.00 37.65  ? 61  SER D CA    1 
ATOM   8521  C  C     . SER F  6 61  ? 31.280 84.087  13.906  1.00 28.37  ? 61  SER D C     1 
ATOM   8522  O  O     . SER F  6 61  ? 32.391 83.729  13.498  1.00 37.79  ? 61  SER D O     1 
ATOM   8523  C  CB    . SER F  6 61  ? 29.718 84.926  12.134  1.00 45.08  ? 61  SER D CB    1 
ATOM   8524  O  OG    . SER F  6 61  ? 28.664 84.585  11.248  1.00 42.64  ? 61  SER D OG    1 
ATOM   8525  N  N     . PHE F  6 62  ? 31.119 84.752  15.052  1.00 29.62  ? 62  PHE D N     1 
ATOM   8526  C  CA    . PHE F  6 62  ? 32.266 85.066  15.896  1.00 33.51  ? 62  PHE D CA    1 
ATOM   8527  C  C     . PHE F  6 62  ? 32.880 83.802  16.481  1.00 30.76  ? 62  PHE D C     1 
ATOM   8528  O  O     . PHE F  6 62  ? 34.104 83.624  16.451  1.00 37.91  ? 62  PHE D O     1 
ATOM   8529  C  CB    . PHE F  6 62  ? 31.847 86.029  17.009  1.00 28.18  ? 62  PHE D CB    1 
ATOM   8530  C  CG    . PHE F  6 62  ? 32.914 86.268  18.039  1.00 29.64  ? 62  PHE D CG    1 
ATOM   8531  C  CD1   . PHE F  6 62  ? 34.017 87.049  17.744  1.00 34.28  ? 62  PHE D CD1   1 
ATOM   8532  C  CD2   . PHE F  6 62  ? 32.807 85.721  19.307  1.00 35.51  ? 62  PHE D CD2   1 
ATOM   8533  C  CE1   . PHE F  6 62  ? 35.000 87.273  18.691  1.00 33.11  ? 62  PHE D CE1   1 
ATOM   8534  C  CE2   . PHE F  6 62  ? 33.785 85.943  20.259  1.00 26.52  ? 62  PHE D CE2   1 
ATOM   8535  C  CZ    . PHE F  6 62  ? 34.883 86.719  19.950  1.00 30.27  ? 62  PHE D CZ    1 
ATOM   8536  N  N     . VAL F  6 63  ? 32.044 82.907  17.015  1.00 22.38  ? 63  VAL D N     1 
ATOM   8537  C  CA    . VAL F  6 63  ? 32.563 81.688  17.632  1.00 31.32  ? 63  VAL D CA    1 
ATOM   8538  C  C     . VAL F  6 63  ? 33.215 80.795  16.583  1.00 38.92  ? 63  VAL D C     1 
ATOM   8539  O  O     . VAL F  6 63  ? 34.315 80.271  16.792  1.00 47.22  ? 63  VAL D O     1 
ATOM   8540  C  CB    . VAL F  6 63  ? 31.448 80.946  18.390  1.00 36.08  ? 63  VAL D CB    1 
ATOM   8541  C  CG1   . VAL F  6 63  ? 32.000 79.687  19.043  1.00 32.15  ? 63  VAL D CG1   1 
ATOM   8542  C  CG2   . VAL F  6 63  ? 30.828 81.851  19.433  1.00 27.31  ? 63  VAL D CG2   1 
ATOM   8543  N  N     . ASN F  6 64  ? 32.548 80.605  15.440  1.00 36.40  ? 64  ASN D N     1 
ATOM   8544  C  CA    . ASN F  6 64  ? 33.145 79.801  14.375  1.00 32.32  ? 64  ASN D CA    1 
ATOM   8545  C  C     . ASN F  6 64  ? 34.449 80.418  13.883  1.00 28.34  ? 64  ASN D C     1 
ATOM   8546  O  O     . ASN F  6 64  ? 35.434 79.706  13.639  1.00 30.83  ? 64  ASN D O     1 
ATOM   8547  C  CB    . ASN F  6 64  ? 32.156 79.639  13.221  1.00 36.62  ? 64  ASN D CB    1 
ATOM   8548  C  CG    . ASN F  6 64  ? 31.240 78.447  13.404  1.00 52.73  ? 64  ASN D CG    1 
ATOM   8549  O  OD1   . ASN F  6 64  ? 30.294 78.489  14.187  1.00 61.73  ? 64  ASN D OD1   1 
ATOM   8550  N  ND2   . ASN F  6 64  ? 31.516 77.374  12.674  1.00 67.64  ? 64  ASN D ND2   1 
ATOM   8551  N  N     . ASP F  6 65  ? 34.478 81.744  13.748  1.00 23.87  ? 65  ASP D N     1 
ATOM   8552  C  CA    . ASP F  6 65  ? 35.685 82.433  13.306  1.00 25.76  ? 65  ASP D CA    1 
ATOM   8553  C  C     . ASP F  6 65  ? 36.841 82.182  14.269  1.00 31.04  ? 65  ASP D C     1 
ATOM   8554  O  O     . ASP F  6 65  ? 37.885 81.647  13.880  1.00 29.55  ? 65  ASP D O     1 
ATOM   8555  C  CB    . ASP F  6 65  ? 35.400 83.929  13.165  1.00 30.05  ? 65  ASP D CB    1 
ATOM   8556  C  CG    . ASP F  6 65  ? 36.566 84.696  12.574  1.00 34.83  ? 65  ASP D CG    1 
ATOM   8557  O  OD1   . ASP F  6 65  ? 37.462 84.060  11.977  1.00 42.14  ? 65  ASP D OD1   1 
ATOM   8558  O  OD2   . ASP F  6 65  ? 36.578 85.939  12.695  1.00 39.06  ? 65  ASP D OD2   1 
ATOM   8559  N  N     . VAL F  6 66  ? 36.662 82.552  15.542  1.00 34.31  ? 66  VAL D N     1 
ATOM   8560  C  CA    . VAL F  6 66  ? 37.728 82.374  16.527  1.00 35.55  ? 66  VAL D CA    1 
ATOM   8561  C  C     . VAL F  6 66  ? 38.151 80.912  16.603  1.00 35.10  ? 66  VAL D C     1 
ATOM   8562  O  O     . VAL F  6 66  ? 39.343 80.601  16.721  1.00 31.81  ? 66  VAL D O     1 
ATOM   8563  C  CB    . VAL F  6 66  ? 37.283 82.909  17.901  1.00 27.77  ? 66  VAL D CB    1 
ATOM   8564  C  CG1   . VAL F  6 66  ? 38.341 82.613  18.952  1.00 28.83  ? 66  VAL D CG1   1 
ATOM   8565  C  CG2   . VAL F  6 66  ? 37.010 84.403  17.823  1.00 25.05  ? 66  VAL D CG2   1 
ATOM   8566  N  N     . PHE F  6 67  ? 37.184 79.994  16.525  1.00 27.71  ? 67  PHE D N     1 
ATOM   8567  C  CA    . PHE F  6 67  ? 37.500 78.571  16.453  1.00 32.16  ? 67  PHE D CA    1 
ATOM   8568  C  C     . PHE F  6 67  ? 38.497 78.291  15.336  1.00 41.12  ? 67  PHE D C     1 
ATOM   8569  O  O     . PHE F  6 67  ? 39.549 77.677  15.560  1.00 42.12  ? 67  PHE D O     1 
ATOM   8570  C  CB    . PHE F  6 67  ? 36.215 77.762  16.243  1.00 36.64  ? 67  PHE D CB    1 
ATOM   8571  C  CG    . PHE F  6 67  ? 36.440 76.277  16.095  1.00 41.42  ? 67  PHE D CG    1 
ATOM   8572  C  CD1   . PHE F  6 67  ? 36.747 75.722  14.861  1.00 44.81  ? 67  PHE D CD1   1 
ATOM   8573  C  CD2   . PHE F  6 67  ? 36.333 75.434  17.189  1.00 35.92  ? 67  PHE D CD2   1 
ATOM   8574  C  CE1   . PHE F  6 67  ? 36.955 74.363  14.726  1.00 48.72  ? 67  PHE D CE1   1 
ATOM   8575  C  CE2   . PHE F  6 67  ? 36.533 74.072  17.056  1.00 37.87  ? 67  PHE D CE2   1 
ATOM   8576  C  CZ    . PHE F  6 67  ? 36.847 73.537  15.825  1.00 42.76  ? 67  PHE D CZ    1 
ATOM   8577  N  N     . GLU F  6 68  ? 38.182 78.746  14.120  1.00 32.13  ? 68  GLU D N     1 
ATOM   8578  C  CA    . GLU F  6 68  ? 39.045 78.453  12.980  1.00 37.27  ? 68  GLU D CA    1 
ATOM   8579  C  C     . GLU F  6 68  ? 40.414 79.109  13.126  1.00 28.08  ? 68  GLU D C     1 
ATOM   8580  O  O     . GLU F  6 68  ? 41.428 78.519  12.740  1.00 31.94  ? 68  GLU D O     1 
ATOM   8581  C  CB    . GLU F  6 68  ? 38.366 78.893  11.683  1.00 55.87  ? 68  GLU D CB    1 
ATOM   8582  C  CG    . GLU F  6 68  ? 37.136 78.070  11.329  1.00 71.69  ? 68  GLU D CG    1 
ATOM   8583  C  CD    . GLU F  6 68  ? 36.355 78.655  10.170  1.00 89.75  ? 68  GLU D CD    1 
ATOM   8584  O  OE1   . GLU F  6 68  ? 35.573 77.912  9.540   1.00 98.63  ? 68  GLU D OE1   1 
ATOM   8585  O  OE2   . GLU F  6 68  ? 36.528 79.860  9.890   1.00 93.42  ? 68  GLU D OE2   1 
ATOM   8586  N  N     . ARG F  6 69  ? 40.468 80.323  13.678  1.00 24.39  ? 69  ARG D N     1 
ATOM   8587  C  CA    . ARG F  6 69  ? 41.759 80.979  13.878  1.00 44.20  ? 69  ARG D CA    1 
ATOM   8588  C  C     . ARG F  6 69  ? 42.625 80.192  14.860  1.00 53.36  ? 69  ARG D C     1 
ATOM   8589  O  O     . ARG F  6 69  ? 43.793 79.892  14.575  1.00 61.30  ? 69  ARG D O     1 
ATOM   8590  C  CB    . ARG F  6 69  ? 41.550 82.415  14.365  1.00 38.48  ? 69  ARG D CB    1 
ATOM   8591  C  CG    . ARG F  6 69  ? 40.498 83.194  13.583  1.00 26.67  ? 69  ARG D CG    1 
ATOM   8592  C  CD    . ARG F  6 69  ? 41.088 84.303  12.728  1.00 30.19  ? 69  ARG D CD    1 
ATOM   8593  N  NE    . ARG F  6 69  ? 41.374 85.511  13.498  1.00 33.85  ? 69  ARG D NE    1 
ATOM   8594  C  CZ    . ARG F  6 69  ? 40.461 86.416  13.839  1.00 27.63  ? 69  ARG D CZ    1 
ATOM   8595  N  NH1   . ARG F  6 69  ? 39.193 86.247  13.491  1.00 22.53  ? 69  ARG D NH1   1 
ATOM   8596  N  NH2   . ARG F  6 69  ? 40.814 87.488  14.537  1.00 33.16  ? 69  ARG D NH2   1 
ATOM   8597  N  N     . ILE F  6 70  ? 42.059 79.839  16.019  1.00 41.89  ? 70  ILE D N     1 
ATOM   8598  C  CA    . ILE F  6 70  ? 42.804 79.081  17.025  1.00 40.87  ? 70  ILE D CA    1 
ATOM   8599  C  C     . ILE F  6 70  ? 43.284 77.756  16.443  1.00 43.63  ? 70  ILE D C     1 
ATOM   8600  O  O     . ILE F  6 70  ? 44.484 77.462  16.424  1.00 42.67  ? 70  ILE D O     1 
ATOM   8601  C  CB    . ILE F  6 70  ? 41.945 78.850  18.282  1.00 41.85  ? 70  ILE D CB    1 
ATOM   8602  C  CG1   . ILE F  6 70  ? 41.516 80.177  18.914  1.00 40.57  ? 70  ILE D CG1   1 
ATOM   8603  C  CG2   . ILE F  6 70  ? 42.712 78.008  19.290  1.00 33.16  ? 70  ILE D CG2   1 
ATOM   8604  C  CD1   . ILE F  6 70  ? 42.604 80.870  19.693  1.00 45.90  ? 70  ILE D CD1   1 
ATOM   8605  N  N     . ALA F  6 71  ? 42.344 76.939  15.956  1.00 43.57  ? 71  ALA D N     1 
ATOM   8606  C  CA    . ALA F  6 71  ? 42.699 75.612  15.458  1.00 45.19  ? 71  ALA D CA    1 
ATOM   8607  C  C     . ALA F  6 71  ? 43.657 75.687  14.275  1.00 46.37  ? 71  ALA D C     1 
ATOM   8608  O  O     . ALA F  6 71  ? 44.459 74.769  14.068  1.00 48.27  ? 71  ALA D O     1 
ATOM   8609  C  CB    . ALA F  6 71  ? 41.435 74.843  15.074  1.00 42.47  ? 71  ALA D CB    1 
ATOM   8610  N  N     . GLY F  6 72  ? 43.593 76.766  13.495  1.00 44.70  ? 72  GLY D N     1 
ATOM   8611  C  CA    . GLY F  6 72  ? 44.527 76.920  12.391  1.00 42.60  ? 72  GLY D CA    1 
ATOM   8612  C  C     . GLY F  6 72  ? 45.935 77.224  12.867  1.00 41.06  ? 72  GLY D C     1 
ATOM   8613  O  O     . GLY F  6 72  ? 46.905 76.604  12.413  1.00 47.94  ? 72  GLY D O     1 
ATOM   8614  N  N     . GLU F  6 73  ? 46.067 78.183  13.791  1.00 39.34  ? 73  GLU D N     1 
ATOM   8615  C  CA    . GLU F  6 73  ? 47.383 78.473  14.349  1.00 38.16  ? 73  GLU D CA    1 
ATOM   8616  C  C     . GLU F  6 73  ? 47.960 77.263  15.073  1.00 47.12  ? 73  GLU D C     1 
ATOM   8617  O  O     . GLU F  6 73  ? 49.177 77.042  15.041  1.00 54.67  ? 73  GLU D O     1 
ATOM   8618  C  CB    . GLU F  6 73  ? 47.304 79.671  15.299  1.00 43.40  ? 73  GLU D CB    1 
ATOM   8619  C  CG    . GLU F  6 73  ? 48.653 80.296  15.608  1.00 52.55  ? 73  GLU D CG    1 
ATOM   8620  C  CD    . GLU F  6 73  ? 49.172 81.152  14.465  1.00 59.29  ? 73  GLU D CD    1 
ATOM   8621  O  OE1   . GLU F  6 73  ? 48.600 82.240  14.231  1.00 50.62  ? 73  GLU D OE1   1 
ATOM   8622  O  OE2   . GLU F  6 73  ? 50.143 80.732  13.796  1.00 63.66  ? 73  GLU D OE2   1 
ATOM   8623  N  N     . ALA F  6 74  ? 47.106 76.465  15.720  1.00 46.76  ? 74  ALA D N     1 
ATOM   8624  C  CA    . ALA F  6 74  ? 47.579 75.248  16.371  1.00 48.16  ? 74  ALA D CA    1 
ATOM   8625  C  C     . ALA F  6 74  ? 48.009 74.205  15.347  1.00 49.69  ? 74  ALA D C     1 
ATOM   8626  O  O     . ALA F  6 74  ? 48.988 73.483  15.564  1.00 50.44  ? 74  ALA D O     1 
ATOM   8627  C  CB    . ALA F  6 74  ? 46.494 74.684  17.288  1.00 51.34  ? 74  ALA D CB    1 
ATOM   8628  N  N     . SER F  6 75  ? 47.280 74.101  14.233  1.00 53.40  ? 75  SER D N     1 
ATOM   8629  C  CA    . SER F  6 75  ? 47.688 73.202  13.157  1.00 47.31  ? 75  SER D CA    1 
ATOM   8630  C  C     . SER F  6 75  ? 49.070 73.574  12.637  1.00 45.41  ? 75  SER D C     1 
ATOM   8631  O  O     . SER F  6 75  ? 49.967 72.724  12.542  1.00 50.43  ? 75  SER D O     1 
ATOM   8632  C  CB    . SER F  6 75  ? 46.657 73.243  12.029  1.00 46.94  ? 75  SER D CB    1 
ATOM   8633  O  OG    . SER F  6 75  ? 47.015 72.370  10.972  1.00 58.65  ? 75  SER D OG    1 
ATOM   8634  N  N     . ARG F  6 76  ? 49.260 74.855  12.304  1.00 47.10  ? 76  ARG D N     1 
ATOM   8635  C  CA    . ARG F  6 76  ? 50.575 75.326  11.883  1.00 47.41  ? 76  ARG D CA    1 
ATOM   8636  C  C     . ARG F  6 76  ? 51.626 75.057  12.952  1.00 56.21  ? 76  ARG D C     1 
ATOM   8637  O  O     . ARG F  6 76  ? 52.768 74.713  12.634  1.00 58.35  ? 76  ARG D O     1 
ATOM   8638  C  CB    . ARG F  6 76  ? 50.512 76.817  11.549  1.00 42.24  ? 76  ARG D CB    1 
ATOM   8639  C  CG    . ARG F  6 76  ? 50.363 77.104  10.066  1.00 46.68  ? 76  ARG D CG    1 
ATOM   8640  C  CD    . ARG F  6 76  ? 49.824 78.501  9.800   1.00 41.36  ? 76  ARG D CD    1 
ATOM   8641  N  NE    . ARG F  6 76  ? 48.419 78.467  9.398   1.00 46.35  ? 76  ARG D NE    1 
ATOM   8642  C  CZ    . ARG F  6 76  ? 47.424 79.011  10.091  1.00 46.19  ? 76  ARG D CZ    1 
ATOM   8643  N  NH1   . ARG F  6 76  ? 47.673 79.653  11.225  1.00 46.19  ? 76  ARG D NH1   1 
ATOM   8644  N  NH2   . ARG F  6 76  ? 46.178 78.923  9.643   1.00 47.16  ? 76  ARG D NH2   1 
ATOM   8645  N  N     . LEU F  6 77  ? 51.254 75.193  14.227  1.00 49.80  ? 77  LEU D N     1 
ATOM   8646  C  CA    . LEU F  6 77  ? 52.205 74.960  15.310  1.00 55.91  ? 77  LEU D CA    1 
ATOM   8647  C  C     . LEU F  6 77  ? 52.668 73.509  15.337  1.00 58.99  ? 77  LEU D C     1 
ATOM   8648  O  O     . LEU F  6 77  ? 53.873 73.229  15.368  1.00 58.19  ? 77  LEU D O     1 
ATOM   8649  C  CB    . LEU F  6 77  ? 51.576 75.346  16.646  1.00 59.71  ? 77  LEU D CB    1 
ATOM   8650  C  CG    . LEU F  6 77  ? 51.960 76.717  17.192  1.00 62.99  ? 77  LEU D CG    1 
ATOM   8651  C  CD1   . LEU F  6 77  ? 50.988 77.117  18.280  1.00 68.54  ? 77  LEU D CD1   1 
ATOM   8652  C  CD2   . LEU F  6 77  ? 53.385 76.691  17.721  1.00 59.50  ? 77  LEU D CD2   1 
ATOM   8653  N  N     . ALA F  6 78  ? 51.719 72.570  15.337  1.00 57.57  ? 78  ALA D N     1 
ATOM   8654  C  CA    . ALA F  6 78  ? 52.077 71.156  15.337  1.00 53.79  ? 78  ALA D CA    1 
ATOM   8655  C  C     . ALA F  6 78  ? 52.906 70.801  14.111  1.00 59.20  ? 78  ALA D C     1 
ATOM   8656  O  O     . ALA F  6 78  ? 53.840 69.995  14.198  1.00 63.65  ? 78  ALA D O     1 
ATOM   8657  C  CB    . ALA F  6 78  ? 50.816 70.294  15.401  1.00 56.47  ? 78  ALA D CB    1 
ATOM   8658  N  N     . HIS F  6 79  ? 52.590 71.403  12.961  1.00 62.90  ? 79  HIS D N     1 
ATOM   8659  C  CA    . HIS F  6 79  ? 53.360 71.105  11.757  1.00 62.46  ? 79  HIS D CA    1 
ATOM   8660  C  C     . HIS F  6 79  ? 54.785 71.642  11.859  1.00 50.20  ? 79  HIS D C     1 
ATOM   8661  O  O     . HIS F  6 79  ? 55.736 70.965  11.452  1.00 51.33  ? 79  HIS D O     1 
ATOM   8662  C  CB    . HIS F  6 79  ? 52.659 71.673  10.525  1.00 79.75  ? 79  HIS D CB    1 
ATOM   8663  C  CG    . HIS F  6 79  ? 52.968 70.929  9.264   1.00 100.12 ? 79  HIS D CG    1 
ATOM   8664  N  ND1   . HIS F  6 79  ? 54.211 70.956  8.668   1.00 105.50 ? 79  HIS D ND1   1 
ATOM   8665  C  CD2   . HIS F  6 79  ? 52.197 70.130  8.489   1.00 106.25 ? 79  HIS D CD2   1 
ATOM   8666  C  CE1   . HIS F  6 79  ? 54.191 70.208  7.579   1.00 109.25 ? 79  HIS D CE1   1 
ATOM   8667  N  NE2   . HIS F  6 79  ? 52.981 69.696  7.447   1.00 109.13 ? 79  HIS D NE2   1 
ATOM   8668  N  N     . TYR F  6 80  ? 54.952 72.853  12.401  1.00 51.39  ? 80  TYR D N     1 
ATOM   8669  C  CA    . TYR F  6 80  ? 56.286 73.438  12.519  1.00 52.33  ? 80  TYR D CA    1 
ATOM   8670  C  C     . TYR F  6 80  ? 57.197 72.574  13.381  1.00 53.26  ? 80  TYR D C     1 
ATOM   8671  O  O     . TYR F  6 80  ? 58.396 72.453  13.104  1.00 50.81  ? 80  TYR D O     1 
ATOM   8672  C  CB    . TYR F  6 80  ? 56.208 74.850  13.107  1.00 53.87  ? 80  TYR D CB    1 
ATOM   8673  C  CG    . TYR F  6 80  ? 55.437 75.866  12.289  1.00 57.34  ? 80  TYR D CG    1 
ATOM   8674  C  CD1   . TYR F  6 80  ? 55.144 75.647  10.949  1.00 60.05  ? 80  TYR D CD1   1 
ATOM   8675  C  CD2   . TYR F  6 80  ? 55.002 77.053  12.866  1.00 54.80  ? 80  TYR D CD2   1 
ATOM   8676  C  CE1   . TYR F  6 80  ? 54.435 76.582  10.212  1.00 61.20  ? 80  TYR D CE1   1 
ATOM   8677  C  CE2   . TYR F  6 80  ? 54.298 77.991  12.138  1.00 57.56  ? 80  TYR D CE2   1 
ATOM   8678  C  CZ    . TYR F  6 80  ? 54.017 77.752  10.812  1.00 61.35  ? 80  TYR D CZ    1 
ATOM   8679  O  OH    . TYR F  6 80  ? 53.316 78.687  10.086  1.00 66.50  ? 80  TYR D OH    1 
ATOM   8680  N  N     . ASN F  6 81  ? 56.649 71.974  14.437  1.00 59.70  ? 81  ASN D N     1 
ATOM   8681  C  CA    . ASN F  6 81  ? 57.427 71.178  15.375  1.00 62.30  ? 81  ASN D CA    1 
ATOM   8682  C  C     . ASN F  6 81  ? 57.346 69.683  15.092  1.00 68.43  ? 81  ASN D C     1 
ATOM   8683  O  O     . ASN F  6 81  ? 57.771 68.882  15.931  1.00 72.49  ? 81  ASN D O     1 
ATOM   8684  C  CB    . ASN F  6 81  ? 56.978 71.466  16.808  1.00 60.49  ? 81  ASN D CB    1 
ATOM   8685  C  CG    . ASN F  6 81  ? 57.323 72.874  17.250  1.00 56.13  ? 81  ASN D CG    1 
ATOM   8686  O  OD1   . ASN F  6 81  ? 58.471 73.165  17.584  1.00 58.41  ? 81  ASN D OD1   1 
ATOM   8687  N  ND2   . ASN F  6 81  ? 56.330 73.756  17.253  1.00 51.50  ? 81  ASN D ND2   1 
ATOM   8688  N  N     . LYS F  6 82  ? 56.806 69.295  13.933  1.00 72.18  ? 82  LYS D N     1 
ATOM   8689  C  CA    . LYS F  6 82  ? 56.775 67.898  13.493  1.00 66.60  ? 82  LYS D CA    1 
ATOM   8690  C  C     . LYS F  6 82  ? 56.112 66.988  14.523  1.00 62.74  ? 82  LYS D C     1 
ATOM   8691  O  O     . LYS F  6 82  ? 56.600 65.897  14.827  1.00 64.19  ? 82  LYS D O     1 
ATOM   8692  C  CB    . LYS F  6 82  ? 58.180 67.405  13.143  1.00 64.56  ? 82  LYS D CB    1 
ATOM   8693  C  CG    . LYS F  6 82  ? 58.743 68.070  11.903  1.00 71.77  ? 82  LYS D CG    1 
ATOM   8694  C  CD    . LYS F  6 82  ? 60.250 67.934  11.810  1.00 79.67  ? 82  LYS D CD    1 
ATOM   8695  C  CE    . LYS F  6 82  ? 60.815 69.011  10.899  1.00 86.77  ? 82  LYS D CE    1 
ATOM   8696  N  NZ    . LYS F  6 82  ? 60.403 70.370  11.359  1.00 89.21  ? 82  LYS D NZ    1 
ATOM   8697  N  N     . ARG F  6 83  ? 54.993 67.449  15.074  1.00 58.30  ? 83  ARG D N     1 
ATOM   8698  C  CA    . ARG F  6 83  ? 54.117 66.630  15.899  1.00 66.28  ? 83  ARG D CA    1 
ATOM   8699  C  C     . ARG F  6 83  ? 52.824 66.376  15.136  1.00 60.92  ? 83  ARG D C     1 
ATOM   8700  O  O     . ARG F  6 83  ? 52.351 67.243  14.395  1.00 67.03  ? 83  ARG D O     1 
ATOM   8701  C  CB    . ARG F  6 83  ? 53.803 67.306  17.235  1.00 78.75  ? 83  ARG D CB    1 
ATOM   8702  C  CG    . ARG F  6 83  ? 55.010 67.746  18.043  1.00 88.92  ? 83  ARG D CG    1 
ATOM   8703  C  CD    . ARG F  6 83  ? 54.571 68.199  19.429  1.00 95.99  ? 83  ARG D CD    1 
ATOM   8704  N  NE    . ARG F  6 83  ? 55.395 69.283  19.955  1.00 101.92 ? 83  ARG D NE    1 
ATOM   8705  C  CZ    . ARG F  6 83  ? 56.396 69.117  20.813  1.00 106.03 ? 83  ARG D CZ    1 
ATOM   8706  N  NH1   . ARG F  6 83  ? 56.705 67.904  21.249  1.00 109.66 ? 83  ARG D NH1   1 
ATOM   8707  N  NH2   . ARG F  6 83  ? 57.086 70.168  21.238  1.00 104.45 ? 83  ARG D NH2   1 
ATOM   8708  N  N     . SER F  6 84  ? 52.256 65.185  15.314  1.00 56.29  ? 84  SER D N     1 
ATOM   8709  C  CA    . SER F  6 84  ? 51.012 64.823  14.653  1.00 54.59  ? 84  SER D CA    1 
ATOM   8710  C  C     . SER F  6 84  ? 49.790 65.009  15.541  1.00 55.69  ? 84  SER D C     1 
ATOM   8711  O  O     . SER F  6 84  ? 48.664 64.809  15.072  1.00 58.79  ? 84  SER D O     1 
ATOM   8712  C  CB    . SER F  6 84  ? 51.079 63.373  14.162  1.00 61.91  ? 84  SER D CB    1 
ATOM   8713  O  OG    . SER F  6 84  ? 51.492 62.504  15.200  1.00 65.45  ? 84  SER D OG    1 
ATOM   8714  N  N     . THR F  6 85  ? 49.978 65.396  16.799  1.00 54.43  ? 85  THR D N     1 
ATOM   8715  C  CA    . THR F  6 85  ? 48.889 65.553  17.751  1.00 54.15  ? 85  THR D CA    1 
ATOM   8716  C  C     . THR F  6 85  ? 48.704 67.022  18.103  1.00 53.70  ? 85  THR D C     1 
ATOM   8717  O  O     . THR F  6 85  ? 49.679 67.738  18.348  1.00 63.39  ? 85  THR D O     1 
ATOM   8718  C  CB    . THR F  6 85  ? 49.156 64.760  19.034  1.00 58.34  ? 85  THR D CB    1 
ATOM   8719  O  OG1   . THR F  6 85  ? 49.872 63.561  18.719  1.00 65.27  ? 85  THR D OG1   1 
ATOM   8720  C  CG2   . THR F  6 85  ? 47.841 64.397  19.712  1.00 58.37  ? 85  THR D CG2   1 
ATOM   8721  N  N     . ILE F  6 86  ? 47.451 67.464  18.127  1.00 47.62  ? 86  ILE D N     1 
ATOM   8722  C  CA    . ILE F  6 86  ? 47.085 68.768  18.666  1.00 50.05  ? 86  ILE D CA    1 
ATOM   8723  C  C     . ILE F  6 86  ? 46.634 68.546  20.103  1.00 53.01  ? 86  ILE D C     1 
ATOM   8724  O  O     . ILE F  6 86  ? 45.587 67.937  20.350  1.00 58.23  ? 86  ILE D O     1 
ATOM   8725  C  CB    . ILE F  6 86  ? 45.992 69.453  17.835  1.00 48.73  ? 86  ILE D CB    1 
ATOM   8726  C  CG1   . ILE F  6 86  ? 46.571 69.994  16.529  1.00 55.39  ? 86  ILE D CG1   1 
ATOM   8727  C  CG2   . ILE F  6 86  ? 45.351 70.586  18.622  1.00 46.55  ? 86  ILE D CG2   1 
ATOM   8728  C  CD1   . ILE F  6 86  ? 45.590 70.816  15.720  1.00 60.39  ? 86  ILE D CD1   1 
ATOM   8729  N  N     . THR F  6 87  ? 47.432 69.020  21.051  1.00 51.60  ? 87  THR D N     1 
ATOM   8730  C  CA    . THR F  6 87  ? 47.124 68.895  22.464  1.00 53.09  ? 87  THR D CA    1 
ATOM   8731  C  C     . THR F  6 87  ? 46.635 70.236  23.001  1.00 49.43  ? 87  THR D C     1 
ATOM   8732  O  O     . THR F  6 87  ? 46.528 71.228  22.276  1.00 54.04  ? 87  THR D O     1 
ATOM   8733  C  CB    . THR F  6 87  ? 48.349 68.403  23.239  1.00 54.79  ? 87  THR D CB    1 
ATOM   8734  O  OG1   . THR F  6 87  ? 49.322 69.452  23.320  1.00 66.32  ? 87  THR D OG1   1 
ATOM   8735  C  CG2   . THR F  6 87  ? 48.971 67.201  22.542  1.00 46.28  ? 87  THR D CG2   1 
ATOM   8736  N  N     . SER F  6 88  ? 46.325 70.258  24.298  1.00 49.34  ? 88  SER D N     1 
ATOM   8737  C  CA    . SER F  6 88  ? 45.952 71.511  24.943  1.00 49.12  ? 88  SER D CA    1 
ATOM   8738  C  C     . SER F  6 88  ? 47.086 72.525  24.881  1.00 50.40  ? 88  SER D C     1 
ATOM   8739  O  O     . SER F  6 88  ? 46.838 73.736  24.859  1.00 52.02  ? 88  SER D O     1 
ATOM   8740  C  CB    . SER F  6 88  ? 45.545 71.252  26.393  1.00 51.56  ? 88  SER D CB    1 
ATOM   8741  O  OG    . SER F  6 88  ? 46.560 70.550  27.091  1.00 53.33  ? 88  SER D OG    1 
ATOM   8742  N  N     . ARG F  6 89  ? 48.333 72.049  24.835  1.00 52.96  ? 89  ARG D N     1 
ATOM   8743  C  CA    . ARG F  6 89  ? 49.476 72.954  24.812  1.00 51.90  ? 89  ARG D CA    1 
ATOM   8744  C  C     . ARG F  6 89  ? 49.520 73.763  23.520  1.00 56.63  ? 89  ARG D C     1 
ATOM   8745  O  O     . ARG F  6 89  ? 49.752 74.979  23.550  1.00 62.08  ? 89  ARG D O     1 
ATOM   8746  C  CB    . ARG F  6 89  ? 50.766 72.158  25.005  1.00 43.00  ? 89  ARG D CB    1 
ATOM   8747  C  CG    . ARG F  6 89  ? 51.956 73.001  25.411  1.00 49.63  ? 89  ARG D CG    1 
ATOM   8748  C  CD    . ARG F  6 89  ? 53.130 72.134  25.823  1.00 59.05  ? 89  ARG D CD    1 
ATOM   8749  N  NE    . ARG F  6 89  ? 54.358 72.915  25.915  1.00 71.82  ? 89  ARG D NE    1 
ATOM   8750  C  CZ    . ARG F  6 89  ? 55.162 73.157  24.885  1.00 80.51  ? 89  ARG D CZ    1 
ATOM   8751  N  NH1   . ARG F  6 89  ? 54.865 72.672  23.687  1.00 80.00  ? 89  ARG D NH1   1 
ATOM   8752  N  NH2   . ARG F  6 89  ? 56.260 73.881  25.050  1.00 87.70  ? 89  ARG D NH2   1 
ATOM   8753  N  N     . GLU F  6 90  ? 49.295 73.109  22.376  1.00 55.90  ? 90  GLU D N     1 
ATOM   8754  C  CA    . GLU F  6 90  ? 49.240 73.837  21.111  1.00 49.39  ? 90  GLU D CA    1 
ATOM   8755  C  C     . GLU F  6 90  ? 48.091 74.837  21.102  1.00 45.94  ? 90  GLU D C     1 
ATOM   8756  O  O     . GLU F  6 90  ? 48.225 75.940  20.559  1.00 45.96  ? 90  GLU D O     1 
ATOM   8757  C  CB    . GLU F  6 90  ? 49.104 72.866  19.938  1.00 45.93  ? 90  GLU D CB    1 
ATOM   8758  C  CG    . GLU F  6 90  ? 50.407 72.237  19.479  1.00 48.05  ? 90  GLU D CG    1 
ATOM   8759  C  CD    . GLU F  6 90  ? 50.692 70.917  20.158  1.00 55.88  ? 90  GLU D CD    1 
ATOM   8760  O  OE1   . GLU F  6 90  ? 50.561 70.841  21.396  1.00 61.92  ? 90  GLU D OE1   1 
ATOM   8761  O  OE2   . GLU F  6 90  ? 51.040 69.951  19.451  1.00 65.37  ? 90  GLU D OE2   1 
ATOM   8762  N  N     . ILE F  6 91  ? 46.952 74.467  21.691  1.00 39.90  ? 91  ILE D N     1 
ATOM   8763  C  CA    . ILE F  6 91  ? 45.837 75.404  21.798  1.00 40.07  ? 91  ILE D CA    1 
ATOM   8764  C  C     . ILE F  6 91  ? 46.247 76.616  22.622  1.00 46.71  ? 91  ILE D C     1 
ATOM   8765  O  O     . ILE F  6 91  ? 45.878 77.755  22.308  1.00 54.92  ? 91  ILE D O     1 
ATOM   8766  C  CB    . ILE F  6 91  ? 44.603 74.701  22.396  1.00 44.71  ? 91  ILE D CB    1 
ATOM   8767  C  CG1   . ILE F  6 91  ? 44.200 73.504  21.532  1.00 45.18  ? 91  ILE D CG1   1 
ATOM   8768  C  CG2   . ILE F  6 91  ? 43.443 75.674  22.530  1.00 40.54  ? 91  ILE D CG2   1 
ATOM   8769  C  CD1   . ILE F  6 91  ? 43.791 73.883  20.126  1.00 40.99  ? 91  ILE D CD1   1 
ATOM   8770  N  N     . GLN F  6 92  ? 47.035 76.395  23.676  1.00 48.04  ? 92  GLN D N     1 
ATOM   8771  C  CA    . GLN F  6 92  ? 47.481 77.505  24.512  1.00 49.11  ? 92  GLN D CA    1 
ATOM   8772  C  C     . GLN F  6 92  ? 48.427 78.427  23.750  1.00 44.00  ? 92  GLN D C     1 
ATOM   8773  O  O     . GLN F  6 92  ? 48.218 79.647  23.705  1.00 41.98  ? 92  GLN D O     1 
ATOM   8774  C  CB    . GLN F  6 92  ? 48.148 76.972  25.780  1.00 52.39  ? 92  GLN D CB    1 
ATOM   8775  C  CG    . GLN F  6 92  ? 48.620 78.062  26.725  1.00 54.64  ? 92  GLN D CG    1 
ATOM   8776  C  CD    . GLN F  6 92  ? 48.992 77.528  28.086  1.00 57.50  ? 92  GLN D CD    1 
ATOM   8777  O  OE1   . GLN F  6 92  ? 48.140 77.380  28.961  1.00 67.43  ? 92  GLN D OE1   1 
ATOM   8778  N  NE2   . GLN F  6 92  ? 50.272 77.233  28.275  1.00 54.43  ? 92  GLN D NE2   1 
ATOM   8779  N  N     . THR F  6 93  ? 49.477 77.863  23.144  1.00 43.81  ? 93  THR D N     1 
ATOM   8780  C  CA    . THR F  6 93  ? 50.407 78.681  22.369  1.00 39.65  ? 93  THR D CA    1 
ATOM   8781  C  C     . THR F  6 93  ? 49.684 79.425  21.252  1.00 44.56  ? 93  THR D C     1 
ATOM   8782  O  O     . THR F  6 93  ? 50.025 80.571  20.936  1.00 52.29  ? 93  THR D O     1 
ATOM   8783  C  CB    . THR F  6 93  ? 51.527 77.810  21.796  1.00 40.41  ? 93  THR D CB    1 
ATOM   8784  O  OG1   . THR F  6 93  ? 52.141 77.057  22.849  1.00 53.54  ? 93  THR D OG1   1 
ATOM   8785  C  CG2   . THR F  6 93  ? 52.587 78.674  21.126  1.00 40.46  ? 93  THR D CG2   1 
ATOM   8786  N  N     . ALA F  6 94  ? 48.672 78.792  20.653  1.00 39.85  ? 94  ALA D N     1 
ATOM   8787  C  CA    . ALA F  6 94  ? 47.876 79.465  19.632  1.00 39.39  ? 94  ALA D CA    1 
ATOM   8788  C  C     . ALA F  6 94  ? 47.091 80.629  20.221  1.00 45.27  ? 94  ALA D C     1 
ATOM   8789  O  O     . ALA F  6 94  ? 46.966 81.684  19.587  1.00 45.55  ? 94  ALA D O     1 
ATOM   8790  C  CB    . ALA F  6 94  ? 46.934 78.468  18.958  1.00 40.00  ? 94  ALA D CB    1 
ATOM   8791  N  N     . VAL F  6 95  ? 46.552 80.457  21.431  1.00 49.93  ? 95  VAL D N     1 
ATOM   8792  C  CA    . VAL F  6 95  ? 45.857 81.557  22.096  1.00 45.29  ? 95  VAL D CA    1 
ATOM   8793  C  C     . VAL F  6 95  ? 46.813 82.715  22.349  1.00 40.38  ? 95  VAL D C     1 
ATOM   8794  O  O     . VAL F  6 95  ? 46.472 83.883  22.121  1.00 35.57  ? 95  VAL D O     1 
ATOM   8795  C  CB    . VAL F  6 95  ? 45.200 81.065  23.399  1.00 44.03  ? 95  VAL D CB    1 
ATOM   8796  C  CG1   . VAL F  6 95  ? 44.796 82.245  24.273  1.00 40.19  ? 95  VAL D CG1   1 
ATOM   8797  C  CG2   . VAL F  6 95  ? 43.986 80.203  23.083  1.00 45.03  ? 95  VAL D CG2   1 
ATOM   8798  N  N     . ARG F  6 96  ? 48.029 82.413  22.810  1.00 38.31  ? 96  ARG D N     1 
ATOM   8799  C  CA    . ARG F  6 96  ? 48.998 83.471  23.078  1.00 44.14  ? 96  ARG D CA    1 
ATOM   8800  C  C     . ARG F  6 96  ? 49.424 84.176  21.795  1.00 44.28  ? 96  ARG D C     1 
ATOM   8801  O  O     . ARG F  6 96  ? 49.643 85.393  21.794  1.00 47.26  ? 96  ARG D O     1 
ATOM   8802  C  CB    . ARG F  6 96  ? 50.209 82.898  23.814  1.00 50.59  ? 96  ARG D CB    1 
ATOM   8803  C  CG    . ARG F  6 96  ? 50.118 83.046  25.324  1.00 61.21  ? 96  ARG D CG    1 
ATOM   8804  C  CD    . ARG F  6 96  ? 51.025 82.076  26.059  1.00 71.40  ? 96  ARG D CD    1 
ATOM   8805  N  NE    . ARG F  6 96  ? 50.919 82.248  27.506  1.00 85.10  ? 96  ARG D NE    1 
ATOM   8806  C  CZ    . ARG F  6 96  ? 51.280 81.332  28.399  1.00 84.41  ? 96  ARG D CZ    1 
ATOM   8807  N  NH1   . ARG F  6 96  ? 51.764 80.164  27.997  1.00 82.33  ? 96  ARG D NH1   1 
ATOM   8808  N  NH2   . ARG F  6 96  ? 51.148 81.580  29.696  1.00 79.97  ? 96  ARG D NH2   1 
ATOM   8809  N  N     . LEU F  6 97  ? 49.541 83.432  20.693  1.00 46.70  ? 97  LEU D N     1 
ATOM   8810  C  CA    . LEU F  6 97  ? 49.897 84.054  19.422  1.00 47.22  ? 97  LEU D CA    1 
ATOM   8811  C  C     . LEU F  6 97  ? 48.760 84.899  18.864  1.00 47.78  ? 97  LEU D C     1 
ATOM   8812  O  O     . LEU F  6 97  ? 49.010 85.922  18.216  1.00 50.36  ? 97  LEU D O     1 
ATOM   8813  C  CB    . LEU F  6 97  ? 50.294 82.985  18.403  1.00 47.01  ? 97  LEU D CB    1 
ATOM   8814  C  CG    . LEU F  6 97  ? 51.656 82.308  18.553  1.00 48.93  ? 97  LEU D CG    1 
ATOM   8815  C  CD1   . LEU F  6 97  ? 51.766 81.149  17.578  1.00 36.23  ? 97  LEU D CD1   1 
ATOM   8816  C  CD2   . LEU F  6 97  ? 52.778 83.307  18.321  1.00 50.15  ? 97  LEU D CD2   1 
ATOM   8817  N  N     . LEU F  6 98  ? 47.513 84.498  19.107  1.00 43.77  ? 98  LEU D N     1 
ATOM   8818  C  CA    . LEU F  6 98  ? 46.368 85.117  18.449  1.00 42.41  ? 98  LEU D CA    1 
ATOM   8819  C  C     . LEU F  6 98  ? 45.734 86.227  19.282  1.00 44.62  ? 98  LEU D C     1 
ATOM   8820  O  O     . LEU F  6 98  ? 45.472 87.319  18.767  1.00 46.66  ? 98  LEU D O     1 
ATOM   8821  C  CB    . LEU F  6 98  ? 45.321 84.051  18.118  1.00 44.89  ? 98  LEU D CB    1 
ATOM   8822  C  CG    . LEU F  6 98  ? 44.156 84.531  17.250  1.00 51.72  ? 98  LEU D CG    1 
ATOM   8823  C  CD1   . LEU F  6 98  ? 44.522 84.452  15.776  1.00 47.76  ? 98  LEU D CD1   1 
ATOM   8824  C  CD2   . LEU F  6 98  ? 42.890 83.744  17.542  1.00 57.75  ? 98  LEU D CD2   1 
ATOM   8825  N  N     . LEU F  6 99  ? 45.472 85.965  20.573  1.00 46.26  ? 99  LEU D N     1 
ATOM   8826  C  CA    . LEU F  6 99  ? 44.715 86.982  21.288  1.00 42.58  ? 99  LEU D CA    1 
ATOM   8827  C  C     . LEU F  6 99  ? 45.634 88.068  21.841  1.00 40.17  ? 99  LEU D C     1 
ATOM   8828  O  O     . LEU F  6 99  ? 46.782 87.796  22.207  1.00 41.84  ? 99  LEU D O     1 
ATOM   8829  C  CB    . LEU F  6 99  ? 43.926 86.354  22.435  1.00 43.83  ? 99  LEU D CB    1 
ATOM   8830  C  CG    . LEU F  6 99  ? 42.872 85.307  22.064  1.00 40.53  ? 99  LEU D CG    1 
ATOM   8831  C  CD1   . LEU F  6 99  ? 41.864 85.137  23.195  1.00 41.75  ? 99  LEU D CD1   1 
ATOM   8832  C  CD2   . LEU F  6 99  ? 42.170 85.662  20.759  1.00 41.63  ? 99  LEU D CD2   1 
ATOM   8833  N  N     . PRO F  6 100 ? 45.144 89.302  21.905  1.00 40.89  ? 100 PRO D N     1 
ATOM   8834  C  CA    . PRO F  6 100 ? 45.931 90.381  22.509  1.00 41.14  ? 100 PRO D CA    1 
ATOM   8835  C  C     . PRO F  6 100 ? 45.969 90.287  24.026  1.00 52.62  ? 100 PRO D C     1 
ATOM   8836  O  O     . PRO F  6 100 ? 45.027 89.819  24.670  1.00 55.77  ? 100 PRO D O     1 
ATOM   8837  C  CB    . PRO F  6 100 ? 45.198 91.652  22.057  1.00 41.95  ? 100 PRO D CB    1 
ATOM   8838  C  CG    . PRO F  6 100 ? 43.803 91.208  21.789  1.00 45.21  ? 100 PRO D CG    1 
ATOM   8839  C  CD    . PRO F  6 100 ? 43.905 89.799  21.279  1.00 46.13  ? 100 PRO D CD    1 
ATOM   8840  N  N     . GLY F  6 101 ? 47.094 90.749  24.578  1.00 57.14  ? 101 GLY D N     1 
ATOM   8841  C  CA    . GLY F  6 101 ? 47.406 90.805  25.999  1.00 58.29  ? 101 GLY D CA    1 
ATOM   8842  C  C     . GLY F  6 101 ? 46.430 90.243  27.014  1.00 54.74  ? 101 GLY D C     1 
ATOM   8843  O  O     . GLY F  6 101 ? 46.480 89.052  27.343  1.00 52.82  ? 101 GLY D O     1 
ATOM   8844  N  N     . GLU F  6 102 ? 45.537 91.098  27.523  1.00 51.51  ? 102 GLU D N     1 
ATOM   8845  C  CA    . GLU F  6 102 ? 44.691 90.709  28.648  1.00 53.72  ? 102 GLU D CA    1 
ATOM   8846  C  C     . GLU F  6 102 ? 43.735 89.584  28.273  1.00 52.86  ? 102 GLU D C     1 
ATOM   8847  O  O     . GLU F  6 102 ? 43.538 88.642  29.053  1.00 59.61  ? 102 GLU D O     1 
ATOM   8848  C  CB    . GLU F  6 102 ? 43.917 91.920  29.167  1.00 62.29  ? 102 GLU D CB    1 
ATOM   8849  C  CG    . GLU F  6 102 ? 44.676 92.743  30.196  1.00 74.11  ? 102 GLU D CG    1 
ATOM   8850  C  CD    . GLU F  6 102 ? 45.196 91.900  31.345  1.00 85.96  ? 102 GLU D CD    1 
ATOM   8851  O  OE1   . GLU F  6 102 ? 46.366 91.467  31.286  1.00 90.56  ? 102 GLU D OE1   1 
ATOM   8852  O  OE2   . GLU F  6 102 ? 44.430 91.659  32.302  1.00 91.62  ? 102 GLU D OE2   1 
ATOM   8853  N  N     . LEU F  6 103 ? 43.121 89.670  27.089  1.00 46.73  ? 103 LEU D N     1 
ATOM   8854  C  CA    . LEU F  6 103 ? 42.277 88.578  26.616  1.00 36.37  ? 103 LEU D CA    1 
ATOM   8855  C  C     . LEU F  6 103 ? 43.054 87.270  26.569  1.00 41.58  ? 103 LEU D C     1 
ATOM   8856  O  O     . LEU F  6 103 ? 42.521 86.207  26.913  1.00 51.53  ? 103 LEU D O     1 
ATOM   8857  C  CB    . LEU F  6 103 ? 41.704 88.908  25.238  1.00 40.75  ? 103 LEU D CB    1 
ATOM   8858  C  CG    . LEU F  6 103 ? 40.590 89.952  25.157  1.00 42.04  ? 103 LEU D CG    1 
ATOM   8859  C  CD1   . LEU F  6 103 ? 40.246 90.236  23.704  1.00 39.56  ? 103 LEU D CD1   1 
ATOM   8860  C  CD2   . LEU F  6 103 ? 39.363 89.491  25.922  1.00 30.79  ? 103 LEU D CD2   1 
ATOM   8861  N  N     . ALA F  6 104 ? 44.323 87.331  26.159  1.00 39.55  ? 104 ALA D N     1 
ATOM   8862  C  CA    . ALA F  6 104 ? 45.151 86.132  26.133  1.00 40.28  ? 104 ALA D CA    1 
ATOM   8863  C  C     . ALA F  6 104 ? 45.401 85.602  27.538  1.00 49.17  ? 104 ALA D C     1 
ATOM   8864  O  O     . ALA F  6 104 ? 45.342 84.389  27.767  1.00 54.07  ? 104 ALA D O     1 
ATOM   8865  C  CB    . ALA F  6 104 ? 46.474 86.424  25.425  1.00 36.64  ? 104 ALA D CB    1 
ATOM   8866  N  N     . LYS F  6 105 ? 45.672 86.494  28.494  1.00 48.72  ? 105 LYS D N     1 
ATOM   8867  C  CA    . LYS F  6 105 ? 45.942 86.050  29.858  1.00 53.84  ? 105 LYS D CA    1 
ATOM   8868  C  C     . LYS F  6 105 ? 44.717 85.381  30.472  1.00 43.98  ? 105 LYS D C     1 
ATOM   8869  O  O     . LYS F  6 105 ? 44.804 84.265  30.999  1.00 49.52  ? 105 LYS D O     1 
ATOM   8870  C  CB    . LYS F  6 105 ? 46.403 87.229  30.716  1.00 67.86  ? 105 LYS D CB    1 
ATOM   8871  C  CG    . LYS F  6 105 ? 47.586 87.988  30.135  1.00 80.79  ? 105 LYS D CG    1 
ATOM   8872  C  CD    . LYS F  6 105 ? 48.380 88.700  31.220  1.00 86.40  ? 105 LYS D CD    1 
ATOM   8873  C  CE    . LYS F  6 105 ? 49.446 89.603  30.622  1.00 89.59  ? 105 LYS D CE    1 
ATOM   8874  N  NZ    . LYS F  6 105 ? 48.840 90.767  29.913  1.00 88.69  ? 105 LYS D NZ    1 
ATOM   8875  N  N     . HIS F  6 106 ? 43.561 86.046  30.404  1.00 39.01  ? 106 HIS D N     1 
ATOM   8876  C  CA    . HIS F  6 106 ? 42.357 85.483  31.008  1.00 45.55  ? 106 HIS D CA    1 
ATOM   8877  C  C     . HIS F  6 106 ? 41.903 84.223  30.278  1.00 50.23  ? 106 HIS D C     1 
ATOM   8878  O  O     . HIS F  6 106 ? 41.419 83.274  30.910  1.00 54.37  ? 106 HIS D O     1 
ATOM   8879  C  CB    . HIS F  6 106 ? 41.244 86.528  31.030  1.00 50.23  ? 106 HIS D CB    1 
ATOM   8880  C  CG    . HIS F  6 106 ? 41.514 87.678  31.950  1.00 63.33  ? 106 HIS D CG    1 
ATOM   8881  N  ND1   . HIS F  6 106 ? 42.397 87.597  33.005  1.00 66.03  ? 106 HIS D ND1   1 
ATOM   8882  C  CD2   . HIS F  6 106 ? 41.018 88.938  31.971  1.00 66.89  ? 106 HIS D CD2   1 
ATOM   8883  C  CE1   . HIS F  6 106 ? 42.435 88.757  33.636  1.00 68.95  ? 106 HIS D CE1   1 
ATOM   8884  N  NE2   . HIS F  6 106 ? 41.607 89.588  33.029  1.00 66.68  ? 106 HIS D NE2   1 
ATOM   8885  N  N     . ALA F  6 107 ? 42.054 84.192  28.951  1.00 49.75  ? 107 ALA D N     1 
ATOM   8886  C  CA    . ALA F  6 107 ? 41.685 82.998  28.198  1.00 43.37  ? 107 ALA D CA    1 
ATOM   8887  C  C     . ALA F  6 107 ? 42.577 81.819  28.561  1.00 47.06  ? 107 ALA D C     1 
ATOM   8888  O  O     . ALA F  6 107 ? 42.091 80.696  28.743  1.00 52.41  ? 107 ALA D O     1 
ATOM   8889  C  CB    . ALA F  6 107 ? 41.753 83.282  26.698  1.00 45.20  ? 107 ALA D CB    1 
ATOM   8890  N  N     . VAL F  6 108 ? 43.886 82.055  28.672  1.00 50.36  ? 108 VAL D N     1 
ATOM   8891  C  CA    . VAL F  6 108 ? 44.804 81.000  29.095  1.00 50.95  ? 108 VAL D CA    1 
ATOM   8892  C  C     . VAL F  6 108 ? 44.453 80.523  30.499  1.00 52.98  ? 108 VAL D C     1 
ATOM   8893  O  O     . VAL F  6 108 ? 44.495 79.320  30.794  1.00 49.60  ? 108 VAL D O     1 
ATOM   8894  C  CB    . VAL F  6 108 ? 46.260 81.494  29.004  1.00 47.67  ? 108 VAL D CB    1 
ATOM   8895  C  CG1   . VAL F  6 108 ? 47.187 80.591  29.800  1.00 37.08  ? 108 VAL D CG1   1 
ATOM   8896  C  CG2   . VAL F  6 108 ? 46.709 81.556  27.550  1.00 44.85  ? 108 VAL D CG2   1 
ATOM   8897  N  N     . SER F  6 109 ? 44.087 81.456  31.381  1.00 52.63  ? 109 SER D N     1 
ATOM   8898  C  CA    . SER F  6 109 ? 43.685 81.088  32.735  1.00 54.49  ? 109 SER D CA    1 
ATOM   8899  C  C     . SER F  6 109 ? 42.468 80.169  32.722  1.00 58.24  ? 109 SER D C     1 
ATOM   8900  O  O     . SER F  6 109 ? 42.487 79.086  33.321  1.00 53.54  ? 109 SER D O     1 
ATOM   8901  C  CB    . SER F  6 109 ? 43.400 82.348  33.553  1.00 53.33  ? 109 SER D CB    1 
ATOM   8902  O  OG    . SER F  6 109 ? 42.514 82.071  34.622  1.00 61.36  ? 109 SER D OG    1 
ATOM   8903  N  N     . GLU F  6 110 ? 41.396 80.585  32.039  1.00 58.30  ? 110 GLU D N     1 
ATOM   8904  C  CA    . GLU F  6 110 ? 40.175 79.782  32.026  1.00 58.06  ? 110 GLU D CA    1 
ATOM   8905  C  C     . GLU F  6 110 ? 40.401 78.434  31.354  1.00 50.37  ? 110 GLU D C     1 
ATOM   8906  O  O     . GLU F  6 110 ? 39.838 77.417  31.778  1.00 51.53  ? 110 GLU D O     1 
ATOM   8907  C  CB    . GLU F  6 110 ? 39.047 80.545  31.332  1.00 63.51  ? 110 GLU D CB    1 
ATOM   8908  C  CG    . GLU F  6 110 ? 38.183 81.364  32.276  1.00 79.35  ? 110 GLU D CG    1 
ATOM   8909  C  CD    . GLU F  6 110 ? 36.766 81.540  31.760  1.00 88.05  ? 110 GLU D CD    1 
ATOM   8910  O  OE1   . GLU F  6 110 ? 36.176 82.618  31.985  1.00 87.55  ? 110 GLU D OE1   1 
ATOM   8911  O  OE2   . GLU F  6 110 ? 36.245 80.597  31.124  1.00 88.86  ? 110 GLU D OE2   1 
ATOM   8912  N  N     . GLY F  6 111 ? 41.219 78.404  30.302  1.00 43.15  ? 111 GLY D N     1 
ATOM   8913  C  CA    . GLY F  6 111 ? 41.516 77.137  29.654  1.00 48.72  ? 111 GLY D CA    1 
ATOM   8914  C  C     . GLY F  6 111 ? 42.259 76.183  30.568  1.00 53.94  ? 111 GLY D C     1 
ATOM   8915  O  O     . GLY F  6 111 ? 41.886 75.014  30.704  1.00 57.69  ? 111 GLY D O     1 
ATOM   8916  N  N     . THR F  6 112 ? 43.324 76.673  31.209  1.00 59.56  ? 112 THR D N     1 
ATOM   8917  C  CA    . THR F  6 112 ? 44.069 75.846  32.155  1.00 53.92  ? 112 THR D CA    1 
ATOM   8918  C  C     . THR F  6 112 ? 43.157 75.329  33.262  1.00 54.67  ? 112 THR D C     1 
ATOM   8919  O  O     . THR F  6 112 ? 43.166 74.135  33.584  1.00 51.74  ? 112 THR D O     1 
ATOM   8920  C  CB    . THR F  6 112 ? 45.233 76.644  32.745  1.00 51.94  ? 112 THR D CB    1 
ATOM   8921  O  OG1   . THR F  6 112 ? 46.081 77.109  31.687  1.00 60.82  ? 112 THR D OG1   1 
ATOM   8922  C  CG2   . THR F  6 112 ? 46.045 75.779  33.696  1.00 49.57  ? 112 THR D CG2   1 
ATOM   8923  N  N     . LYS F  6 113 ? 42.353 76.220  33.849  1.00 40.41  ? 113 LYS D N     1 
ATOM   8924  C  CA    . LYS F  6 113 ? 41.403 75.807  34.878  1.00 59.75  ? 113 LYS D CA    1 
ATOM   8925  C  C     . LYS F  6 113 ? 40.478 74.707  34.369  1.00 53.10  ? 113 LYS D C     1 
ATOM   8926  O  O     . LYS F  6 113 ? 40.220 73.722  35.075  1.00 51.29  ? 113 LYS D O     1 
ATOM   8927  C  CB    . LYS F  6 113 ? 40.593 77.017  35.346  1.00 55.13  ? 113 LYS D CB    1 
ATOM   8928  C  CG    . LYS F  6 113 ? 39.524 76.708  36.380  1.00 57.29  ? 113 LYS D CG    1 
ATOM   8929  C  CD    . LYS F  6 113 ? 38.544 77.865  36.514  1.00 67.58  ? 113 LYS D CD    1 
ATOM   8930  C  CE    . LYS F  6 113 ? 39.239 79.146  36.952  1.00 78.70  ? 113 LYS D CE    1 
ATOM   8931  N  NZ    . LYS F  6 113 ? 39.769 79.046  38.342  1.00 85.57  ? 113 LYS D NZ    1 
ATOM   8932  N  N     . ALA F  6 114 ? 39.988 74.846  33.135  1.00 56.44  ? 114 ALA D N     1 
ATOM   8933  C  CA    . ALA F  6 114 ? 39.047 73.870  32.596  1.00 54.70  ? 114 ALA D CA    1 
ATOM   8934  C  C     . ALA F  6 114 ? 39.708 72.517  32.366  1.00 54.25  ? 114 ALA D C     1 
ATOM   8935  O  O     . ALA F  6 114 ? 39.089 71.473  32.605  1.00 53.93  ? 114 ALA D O     1 
ATOM   8936  C  CB    . ALA F  6 114 ? 38.434 74.394  31.299  1.00 53.43  ? 114 ALA D CB    1 
ATOM   8937  N  N     . VAL F  6 115 ? 40.959 72.505  31.899  1.00 54.63  ? 115 VAL D N     1 
ATOM   8938  C  CA    . VAL F  6 115 ? 41.594 71.217  31.633  1.00 62.10  ? 115 VAL D CA    1 
ATOM   8939  C  C     . VAL F  6 115 ? 42.050 70.551  32.927  1.00 60.80  ? 115 VAL D C     1 
ATOM   8940  O  O     . VAL F  6 115 ? 42.055 69.318  33.019  1.00 68.99  ? 115 VAL D O     1 
ATOM   8941  C  CB    . VAL F  6 115 ? 42.755 71.364  30.632  1.00 67.13  ? 115 VAL D CB    1 
ATOM   8942  C  CG1   . VAL F  6 115 ? 42.285 72.086  29.376  1.00 65.88  ? 115 VAL D CG1   1 
ATOM   8943  C  CG2   . VAL F  6 115 ? 43.942 72.080  31.261  1.00 72.71  ? 115 VAL D CG2   1 
ATOM   8944  N  N     . THR F  6 116 ? 42.428 71.332  33.945  1.00 61.67  ? 116 THR D N     1 
ATOM   8945  C  CA    . THR F  6 116 ? 42.768 70.723  35.227  1.00 63.44  ? 116 THR D CA    1 
ATOM   8946  C  C     . THR F  6 116 ? 41.527 70.157  35.905  1.00 52.30  ? 116 THR D C     1 
ATOM   8947  O  O     . THR F  6 116 ? 41.568 69.053  36.463  1.00 52.98  ? 116 THR D O     1 
ATOM   8948  C  CB    . THR F  6 116 ? 43.463 71.733  36.140  1.00 74.53  ? 116 THR D CB    1 
ATOM   8949  O  OG1   . THR F  6 116 ? 42.590 72.843  36.387  1.00 87.18  ? 116 THR D OG1   1 
ATOM   8950  C  CG2   . THR F  6 116 ? 44.754 72.230  35.502  1.00 74.59  ? 116 THR D CG2   1 
ATOM   8951  N  N     . LYS F  6 117 ? 40.412 70.893  35.861  1.00 48.26  ? 117 LYS D N     1 
ATOM   8952  C  CA    . LYS F  6 117 ? 39.163 70.352  36.390  1.00 50.05  ? 117 LYS D CA    1 
ATOM   8953  C  C     . LYS F  6 117 ? 38.726 69.121  35.606  1.00 57.01  ? 117 LYS D C     1 
ATOM   8954  O  O     . LYS F  6 117 ? 38.187 68.168  36.181  1.00 67.84  ? 117 LYS D O     1 
ATOM   8955  C  CB    . LYS F  6 117 ? 38.066 71.416  36.365  1.00 49.26  ? 117 LYS D CB    1 
ATOM   8956  C  CG    . LYS F  6 117 ? 36.739 70.941  36.948  1.00 54.29  ? 117 LYS D CG    1 
ATOM   8957  C  CD    . LYS F  6 117 ? 35.643 71.979  36.772  1.00 59.54  ? 117 LYS D CD    1 
ATOM   8958  C  CE    . LYS F  6 117 ? 34.329 71.510  37.382  1.00 64.57  ? 117 LYS D CE    1 
ATOM   8959  N  NZ    . LYS F  6 117 ? 34.396 71.444  38.869  1.00 63.45  ? 117 LYS D NZ    1 
ATOM   8960  N  N     . TYR F  6 118 ? 38.958 69.119  34.292  1.00 60.95  ? 118 TYR D N     1 
ATOM   8961  C  CA    . TYR F  6 118 ? 38.575 67.974  33.473  1.00 60.93  ? 118 TYR D CA    1 
ATOM   8962  C  C     . TYR F  6 118 ? 39.391 66.740  33.837  1.00 63.29  ? 118 TYR D C     1 
ATOM   8963  O  O     . TYR F  6 118 ? 38.832 65.663  34.076  1.00 68.25  ? 118 TYR D O     1 
ATOM   8964  C  CB    . TYR F  6 118 ? 38.737 68.306  31.989  1.00 57.84  ? 118 TYR D CB    1 
ATOM   8965  C  CG    . TYR F  6 118 ? 38.479 67.127  31.078  1.00 55.46  ? 118 TYR D CG    1 
ATOM   8966  C  CD1   . TYR F  6 118 ? 37.187 66.793  30.693  1.00 63.95  ? 118 TYR D CD1   1 
ATOM   8967  C  CD2   . TYR F  6 118 ? 39.526 66.343  30.609  1.00 51.87  ? 118 TYR D CD2   1 
ATOM   8968  C  CE1   . TYR F  6 118 ? 36.944 65.714  29.863  1.00 68.79  ? 118 TYR D CE1   1 
ATOM   8969  C  CE2   . TYR F  6 118 ? 39.292 65.262  29.779  1.00 63.24  ? 118 TYR D CE2   1 
ATOM   8970  C  CZ    . TYR F  6 118 ? 38.000 64.953  29.410  1.00 71.88  ? 118 TYR D CZ    1 
ATOM   8971  O  OH    . TYR F  6 118 ? 37.764 63.878  28.585  1.00 82.02  ? 118 TYR D OH    1 
ATOM   8972  N  N     . THR F  6 119 ? 40.719 66.875  33.880  1.00 65.70  ? 119 THR D N     1 
ATOM   8973  C  CA    . THR F  6 119 ? 41.564 65.726  34.186  1.00 74.54  ? 119 THR D CA    1 
ATOM   8974  C  C     . THR F  6 119 ? 41.491 65.323  35.653  1.00 73.47  ? 119 THR D C     1 
ATOM   8975  O  O     . THR F  6 119 ? 41.902 64.210  35.995  1.00 73.16  ? 119 THR D O     1 
ATOM   8976  C  CB    . THR F  6 119 ? 43.017 66.011  33.802  1.00 76.75  ? 119 THR D CB    1 
ATOM   8977  O  OG1   . THR F  6 119 ? 43.510 67.117  34.568  1.00 84.69  ? 119 THR D OG1   1 
ATOM   8978  C  CG2   . THR F  6 119 ? 43.121 66.339  32.319  1.00 71.40  ? 119 THR D CG2   1 
ATOM   8979  N  N     . SER F  6 120 ? 40.975 66.195  36.525  1.00 72.59  ? 120 SER D N     1 
ATOM   8980  C  CA    . SER F  6 120 ? 40.855 65.843  37.935  1.00 79.92  ? 120 SER D CA    1 
ATOM   8981  C  C     . SER F  6 120 ? 39.835 64.737  38.171  1.00 90.19  ? 120 SER D C     1 
ATOM   8982  O  O     . SER F  6 120 ? 39.863 64.100  39.230  1.00 92.98  ? 120 SER D O     1 
ATOM   8983  C  CB    . SER F  6 120 ? 40.481 67.074  38.763  1.00 74.92  ? 120 SER D CB    1 
ATOM   8984  O  OG    . SER F  6 120 ? 39.106 67.387  38.620  1.00 74.00  ? 120 SER D OG    1 
ATOM   8985  N  N     . ALA F  6 121 ? 38.938 64.497  37.219  1.00 87.95  ? 121 ALA D N     1 
ATOM   8986  C  CA    . ALA F  6 121 ? 37.944 63.440  37.354  1.00 92.05  ? 121 ALA D CA    1 
ATOM   8987  C  C     . ALA F  6 121 ? 38.487 62.116  36.827  1.00 100.89 ? 121 ALA D C     1 
ATOM   8988  O  O     . ALA F  6 121 ? 39.592 62.060  36.288  1.00 105.34 ? 121 ALA D O     1 
ATOM   8989  C  CB    . ALA F  6 121 ? 36.666 63.818  36.624  1.00 82.68  ? 121 ALA D CB    1 
ATOM   8990  N  N     . HIS G  3 39  ? 19.743 129.942 3.819   1.00 127.37 ? 39  HIS E N     1 
ATOM   8991  C  CA    . HIS G  3 39  ? 19.830 131.232 4.500   1.00 129.75 ? 39  HIS E CA    1 
ATOM   8992  C  C     . HIS G  3 39  ? 19.663 131.086 6.017   1.00 122.81 ? 39  HIS E C     1 
ATOM   8993  O  O     . HIS G  3 39  ? 20.213 131.870 6.795   1.00 119.65 ? 39  HIS E O     1 
ATOM   8994  C  CB    . HIS G  3 39  ? 18.785 132.211 3.935   1.00 139.81 ? 39  HIS E CB    1 
ATOM   8995  C  CG    . HIS G  3 39  ? 17.403 131.635 3.802   1.00 145.71 ? 39  HIS E CG    1 
ATOM   8996  N  ND1   . HIS G  3 39  ? 16.753 130.994 4.838   1.00 146.14 ? 39  HIS E ND1   1 
ATOM   8997  C  CD2   . HIS G  3 39  ? 16.540 131.628 2.758   1.00 149.19 ? 39  HIS E CD2   1 
ATOM   8998  C  CE1   . HIS G  3 39  ? 15.558 130.603 4.432   1.00 148.80 ? 39  HIS E CE1   1 
ATOM   8999  N  NE2   . HIS G  3 39  ? 15.403 130.978 3.175   1.00 150.92 ? 39  HIS E NE2   1 
ATOM   9000  N  N     . CYS G  3 40  ? 18.903 130.069 6.429   1.00 126.13 ? 40  CYS E N     1 
ATOM   9001  C  CA    . CYS G  3 40  ? 18.655 129.859 7.849   1.00 120.18 ? 40  CYS E CA    1 
ATOM   9002  C  C     . CYS G  3 40  ? 19.849 129.210 8.531   1.00 109.90 ? 40  CYS E C     1 
ATOM   9003  O  O     . CYS G  3 40  ? 20.162 129.544 9.677   1.00 114.11 ? 40  CYS E O     1 
ATOM   9004  C  CB    . CYS G  3 40  ? 17.401 129.009 8.046   1.00 120.41 ? 40  CYS E CB    1 
ATOM   9005  S  SG    . CYS G  3 40  ? 16.592 129.271 9.648   0.86 120.53 ? 40  CYS E SG    1 
ATOM   9006  N  N     . TYR G  3 41  ? 20.513 128.275 7.860   1.00 106.91 ? 41  TYR E N     1 
ATOM   9007  C  CA    . TYR G  3 41  ? 21.649 127.568 8.428   1.00 92.12  ? 41  TYR E CA    1 
ATOM   9008  C  C     . TYR G  3 41  ? 22.879 127.810 7.566   1.00 85.89  ? 41  TYR E C     1 
ATOM   9009  O  O     . TYR G  3 41  ? 22.841 127.602 6.349   1.00 86.75  ? 41  TYR E O     1 
ATOM   9010  C  CB    . TYR G  3 41  ? 21.356 126.071 8.555   1.00 89.03  ? 41  TYR E CB    1 
ATOM   9011  C  CG    . TYR G  3 41  ? 20.337 125.758 9.626   1.00 93.59  ? 41  TYR E CG    1 
ATOM   9012  C  CD1   . TYR G  3 41  ? 20.712 125.657 10.958  1.00 89.09  ? 41  TYR E CD1   1 
ATOM   9013  C  CD2   . TYR G  3 41  ? 18.999 125.571 9.307   1.00 98.17  ? 41  TYR E CD2   1 
ATOM   9014  C  CE1   . TYR G  3 41  ? 19.786 125.378 11.941  1.00 89.13  ? 41  TYR E CE1   1 
ATOM   9015  C  CE2   . TYR G  3 41  ? 18.064 125.290 10.283  1.00 97.77  ? 41  TYR E CE2   1 
ATOM   9016  C  CZ    . TYR G  3 41  ? 18.463 125.194 11.599  1.00 92.66  ? 41  TYR E CZ    1 
ATOM   9017  O  OH    . TYR G  3 41  ? 17.537 124.916 12.580  1.00 92.66  ? 41  TYR E OH    1 
ATOM   9018  N  N     . ARG G  3 42  ? 23.957 128.260 8.204   1.00 80.17  ? 42  ARG E N     1 
ATOM   9019  C  CA    . ARG G  3 42  ? 25.209 128.509 7.514   1.00 83.45  ? 42  ARG E CA    1 
ATOM   9020  C  C     . ARG G  3 42  ? 25.722 127.214 6.879   1.00 75.09  ? 42  ARG E C     1 
ATOM   9021  O  O     . ARG G  3 42  ? 25.531 126.130 7.431   1.00 74.93  ? 42  ARG E O     1 
ATOM   9022  C  CB    . ARG G  3 42  ? 26.238 129.059 8.498   1.00 93.63  ? 42  ARG E CB    1 
ATOM   9023  C  CG    . ARG G  3 42  ? 27.524 129.540 7.872   1.00 102.63 ? 42  ARG E CG    1 
ATOM   9024  C  CD    . ARG G  3 42  ? 28.736 128.998 8.611   1.00 104.18 ? 42  ARG E CD    1 
ATOM   9025  N  NE    . ARG G  3 42  ? 28.755 129.407 10.012  1.00 104.27 ? 42  ARG E NE    1 
ATOM   9026  C  CZ    . ARG G  3 42  ? 29.099 130.620 10.434  1.00 105.99 ? 42  ARG E CZ    1 
ATOM   9027  N  NH1   . ARG G  3 42  ? 29.090 130.897 11.730  1.00 109.07 ? 42  ARG E NH1   1 
ATOM   9028  N  NH2   . ARG G  3 42  ? 29.447 131.559 9.563   1.00 103.44 ? 42  ARG E NH2   1 
ATOM   9029  N  N     . PRO G  3 43  ? 26.356 127.306 5.698   1.00 75.29  ? 43  PRO E N     1 
ATOM   9030  C  CA    . PRO G  3 43  ? 26.931 126.105 5.072   1.00 73.55  ? 43  PRO E CA    1 
ATOM   9031  C  C     . PRO G  3 43  ? 27.814 125.301 6.011   1.00 76.90  ? 43  PRO E C     1 
ATOM   9032  O  O     . PRO G  3 43  ? 28.831 125.797 6.511   1.00 83.28  ? 43  PRO E O     1 
ATOM   9033  C  CB    . PRO G  3 43  ? 27.735 126.682 3.901   1.00 70.17  ? 43  PRO E CB    1 
ATOM   9034  C  CG    . PRO G  3 43  ? 26.990 127.917 3.522   1.00 72.92  ? 43  PRO E CG    1 
ATOM   9035  C  CD    . PRO G  3 43  ? 26.418 128.477 4.804   1.00 78.08  ? 43  PRO E CD    1 
ATOM   9036  N  N     . GLY G  3 44  ? 27.417 124.052 6.270   1.00 67.22  ? 44  GLY E N     1 
ATOM   9037  C  CA    . GLY G  3 44  ? 28.158 123.136 7.125   1.00 62.11  ? 44  GLY E CA    1 
ATOM   9038  C  C     . GLY G  3 44  ? 27.347 122.607 8.292   1.00 62.37  ? 44  GLY E C     1 
ATOM   9039  O  O     . GLY G  3 44  ? 27.606 121.497 8.768   1.00 65.56  ? 44  GLY E O     1 
ATOM   9040  N  N     . THR G  3 45  ? 26.362 123.380 8.756   1.00 63.52  ? 45  THR E N     1 
ATOM   9041  C  CA    . THR G  3 45  ? 25.570 122.965 9.911   1.00 60.20  ? 45  THR E CA    1 
ATOM   9042  C  C     . THR G  3 45  ? 24.753 121.715 9.602   1.00 64.04  ? 45  THR E C     1 
ATOM   9043  O  O     . THR G  3 45  ? 24.782 120.738 10.361  1.00 69.41  ? 45  THR E O     1 
ATOM   9044  C  CB    . THR G  3 45  ? 24.656 124.107 10.354  1.00 66.70  ? 45  THR E CB    1 
ATOM   9045  O  OG1   . THR G  3 45  ? 25.446 125.257 10.681  1.00 71.78  ? 45  THR E OG1   1 
ATOM   9046  C  CG2   . THR G  3 45  ? 23.852 123.693 11.566  1.00 63.05  ? 45  THR E CG2   1 
ATOM   9047  N  N     . VAL G  3 46  ? 24.019 121.727 8.485   1.00 65.23  ? 46  VAL E N     1 
ATOM   9048  C  CA    . VAL G  3 46  ? 23.225 120.563 8.102   1.00 59.95  ? 46  VAL E CA    1 
ATOM   9049  C  C     . VAL G  3 46  ? 24.126 119.370 7.812   1.00 54.28  ? 46  VAL E C     1 
ATOM   9050  O  O     . VAL G  3 46  ? 23.729 118.217 8.020   1.00 55.78  ? 46  VAL E O     1 
ATOM   9051  C  CB    . VAL G  3 46  ? 22.323 120.907 6.899   1.00 54.05  ? 46  VAL E CB    1 
ATOM   9052  C  CG1   . VAL G  3 46  ? 21.434 119.725 6.527   1.00 54.48  ? 46  VAL E CG1   1 
ATOM   9053  C  CG2   . VAL G  3 46  ? 21.480 122.136 7.207   1.00 54.25  ? 46  VAL E CG2   1 
ATOM   9054  N  N     . ALA G  3 47  ? 25.353 119.619 7.345   1.00 56.46  ? 47  ALA E N     1 
ATOM   9055  C  CA    . ALA G  3 47  ? 26.286 118.522 7.105   1.00 54.56  ? 47  ALA E CA    1 
ATOM   9056  C  C     . ALA G  3 47  ? 26.692 117.846 8.409   1.00 52.01  ? 47  ALA E C     1 
ATOM   9057  O  O     . ALA G  3 47  ? 26.748 116.613 8.483   1.00 52.61  ? 47  ALA E O     1 
ATOM   9058  C  CB    . ALA G  3 47  ? 27.516 119.030 6.353   1.00 43.50  ? 47  ALA E CB    1 
ATOM   9059  N  N     . LEU G  3 48  ? 26.986 118.635 9.446   1.00 42.10  ? 48  LEU E N     1 
ATOM   9060  C  CA    . LEU G  3 48  ? 27.280 118.056 10.754  1.00 47.90  ? 48  LEU E CA    1 
ATOM   9061  C  C     . LEU G  3 48  ? 26.066 117.322 11.309  1.00 48.99  ? 48  LEU E C     1 
ATOM   9062  O  O     . LEU G  3 48  ? 26.195 116.228 11.876  1.00 54.39  ? 48  LEU E O     1 
ATOM   9063  C  CB    . LEU G  3 48  ? 27.740 119.147 11.721  1.00 43.59  ? 48  LEU E CB    1 
ATOM   9064  C  CG    . LEU G  3 48  ? 29.143 119.708 11.490  1.00 46.77  ? 48  LEU E CG    1 
ATOM   9065  C  CD1   . LEU G  3 48  ? 29.366 120.958 12.321  1.00 47.60  ? 48  LEU E CD1   1 
ATOM   9066  C  CD2   . LEU G  3 48  ? 30.189 118.654 11.817  1.00 41.65  ? 48  LEU E CD2   1 
ATOM   9067  N  N     . ARG G  3 49  ? 24.877 117.910 11.149  1.00 43.64  ? 49  ARG E N     1 
ATOM   9068  C  CA    . ARG G  3 49  ? 23.645 117.237 11.549  1.00 46.65  ? 49  ARG E CA    1 
ATOM   9069  C  C     . ARG G  3 49  ? 23.518 115.873 10.878  1.00 50.85  ? 49  ARG E C     1 
ATOM   9070  O  O     . ARG G  3 49  ? 23.133 114.886 11.519  1.00 58.16  ? 49  ARG E O     1 
ATOM   9071  C  CB    . ARG G  3 49  ? 22.449 118.126 11.208  1.00 50.53  ? 49  ARG E CB    1 
ATOM   9072  C  CG    . ARG G  3 49  ? 21.094 117.576 11.603  1.00 57.54  ? 49  ARG E CG    1 
ATOM   9073  C  CD    . ARG G  3 49  ? 19.993 118.488 11.085  1.00 66.71  ? 49  ARG E CD    1 
ATOM   9074  N  NE    . ARG G  3 49  ? 20.174 119.867 11.534  1.00 70.41  ? 49  ARG E NE    1 
ATOM   9075  C  CZ    . ARG G  3 49  ? 19.632 120.925 10.938  1.00 76.39  ? 49  ARG E CZ    1 
ATOM   9076  N  NH1   . ARG G  3 49  ? 18.880 120.767 9.857   1.00 80.75  ? 49  ARG E NH1   1 
ATOM   9077  N  NH2   . ARG G  3 49  ? 19.849 122.143 11.417  1.00 73.14  ? 49  ARG E NH2   1 
ATOM   9078  N  N     . GLU G  3 50  ? 23.855 115.795 9.589   1.00 51.64  ? 50  GLU E N     1 
ATOM   9079  C  CA    . GLU G  3 50  ? 23.779 114.525 8.877   1.00 50.95  ? 50  GLU E CA    1 
ATOM   9080  C  C     . GLU G  3 50  ? 24.859 113.557 9.349   1.00 50.33  ? 50  GLU E C     1 
ATOM   9081  O  O     . GLU G  3 50  ? 24.624 112.345 9.417   1.00 55.08  ? 50  GLU E O     1 
ATOM   9082  C  CB    . GLU G  3 50  ? 23.883 114.766 7.371   1.00 38.53  ? 50  GLU E CB    1 
ATOM   9083  C  CG    . GLU G  3 50  ? 22.672 115.462 6.768   1.00 39.34  ? 50  GLU E CG    1 
ATOM   9084  C  CD    . GLU G  3 50  ? 22.875 115.837 5.306   1.00 58.39  ? 50  GLU E CD    1 
ATOM   9085  O  OE1   . GLU G  3 50  ? 22.488 116.962 4.919   1.00 63.45  ? 50  GLU E OE1   1 
ATOM   9086  O  OE2   . GLU G  3 50  ? 23.426 115.010 4.544   1.00 60.22  ? 50  GLU E OE2   1 
ATOM   9087  N  N     . ILE G  3 51  ? 26.046 114.072 9.682   1.00 45.36  ? 51  ILE E N     1 
ATOM   9088  C  CA    . ILE G  3 51  ? 27.102 113.213 10.214  1.00 47.66  ? 51  ILE E CA    1 
ATOM   9089  C  C     . ILE G  3 51  ? 26.654 112.566 11.517  1.00 44.06  ? 51  ILE E C     1 
ATOM   9090  O  O     . ILE G  3 51  ? 26.887 111.373 11.749  1.00 44.85  ? 51  ILE E O     1 
ATOM   9091  C  CB    . ILE G  3 51  ? 28.407 114.010 10.403  1.00 41.21  ? 51  ILE E CB    1 
ATOM   9092  C  CG1   . ILE G  3 51  ? 29.010 114.389 9.051   1.00 36.25  ? 51  ILE E CG1   1 
ATOM   9093  C  CG2   . ILE G  3 51  ? 29.413 113.202 11.213  1.00 37.09  ? 51  ILE E CG2   1 
ATOM   9094  C  CD1   . ILE G  3 51  ? 30.334 115.116 9.165   1.00 33.74  ? 51  ILE E CD1   1 
ATOM   9095  N  N     . ARG G  3 52  ? 26.001 113.337 12.389  1.00 33.15  ? 52  ARG E N     1 
ATOM   9096  C  CA    . ARG G  3 52  ? 25.493 112.756 13.627  1.00 42.58  ? 52  ARG E CA    1 
ATOM   9097  C  C     . ARG G  3 52  ? 24.374 111.759 13.348  1.00 53.53  ? 52  ARG E C     1 
ATOM   9098  O  O     . ARG G  3 52  ? 24.354 110.660 13.921  1.00 59.58  ? 52  ARG E O     1 
ATOM   9099  C  CB    . ARG G  3 52  ? 25.021 113.864 14.568  1.00 34.84  ? 52  ARG E CB    1 
ATOM   9100  C  CG    . ARG G  3 52  ? 26.088 114.913 14.825  1.00 39.06  ? 52  ARG E CG    1 
ATOM   9101  C  CD    . ARG G  3 52  ? 25.780 115.767 16.037  1.00 46.22  ? 52  ARG E CD    1 
ATOM   9102  N  NE    . ARG G  3 52  ? 26.935 116.581 16.404  1.00 52.45  ? 52  ARG E NE    1 
ATOM   9103  C  CZ    . ARG G  3 52  ? 27.121 117.837 16.013  1.00 56.09  ? 52  ARG E CZ    1 
ATOM   9104  N  NH1   . ARG G  3 52  ? 26.219 118.434 15.244  1.00 45.11  ? 52  ARG E NH1   1 
ATOM   9105  N  NH2   . ARG G  3 52  ? 28.206 118.498 16.396  1.00 65.59  ? 52  ARG E NH2   1 
ATOM   9106  N  N     . ARG G  3 53  ? 23.449 112.118 12.452  1.00 51.60  ? 53  ARG E N     1 
ATOM   9107  C  CA    . ARG G  3 53  ? 22.338 111.231 12.117  1.00 43.21  ? 53  ARG E CA    1 
ATOM   9108  C  C     . ARG G  3 53  ? 22.837 109.874 11.636  1.00 46.99  ? 53  ARG E C     1 
ATOM   9109  O  O     . ARG G  3 53  ? 22.527 108.835 12.230  1.00 50.18  ? 53  ARG E O     1 
ATOM   9110  C  CB    . ARG G  3 53  ? 21.445 111.885 11.059  1.00 37.68  ? 53  ARG E CB    1 
ATOM   9111  C  CG    . ARG G  3 53  ? 20.554 110.907 10.306  1.00 47.91  ? 53  ARG E CG    1 
ATOM   9112  C  CD    . ARG G  3 53  ? 19.138 111.438 10.148  1.00 59.66  ? 53  ARG E CD    1 
ATOM   9113  N  NE    . ARG G  3 53  ? 18.298 110.528 9.373   1.00 62.98  ? 53  ARG E NE    1 
ATOM   9114  C  CZ    . ARG G  3 53  ? 17.823 110.796 8.160   1.00 63.90  ? 53  ARG E CZ    1 
ATOM   9115  N  NH1   . ARG G  3 53  ? 18.094 111.958 7.581   1.00 68.00  ? 53  ARG E NH1   1 
ATOM   9116  N  NH2   . ARG G  3 53  ? 17.069 109.906 7.532   1.00 67.35  ? 53  ARG E NH2   1 
ATOM   9117  N  N     . TYR G  3 54  ? 23.624 109.863 10.559  1.00 53.33  ? 54  TYR E N     1 
ATOM   9118  C  CA    . TYR G  3 54  ? 24.028 108.589 9.973   1.00 49.27  ? 54  TYR E CA    1 
ATOM   9119  C  C     . TYR G  3 54  ? 25.093 107.893 10.808  1.00 43.43  ? 54  TYR E C     1 
ATOM   9120  O  O     . TYR G  3 54  ? 25.151 106.659 10.827  1.00 49.32  ? 54  TYR E O     1 
ATOM   9121  C  CB    . TYR G  3 54  ? 24.506 108.803 8.539   1.00 39.41  ? 54  TYR E CB    1 
ATOM   9122  C  CG    . TYR G  3 54  ? 23.414 109.335 7.641   1.00 38.17  ? 54  TYR E CG    1 
ATOM   9123  C  CD1   . TYR G  3 54  ? 22.311 108.553 7.322   1.00 37.89  ? 54  TYR E CD1   1 
ATOM   9124  C  CD2   . TYR G  3 54  ? 23.478 110.619 7.117   1.00 39.23  ? 54  TYR E CD2   1 
ATOM   9125  C  CE1   . TYR G  3 54  ? 21.305 109.033 6.506   1.00 37.34  ? 54  TYR E CE1   1 
ATOM   9126  C  CE2   . TYR G  3 54  ? 22.475 111.108 6.300   1.00 36.13  ? 54  TYR E CE2   1 
ATOM   9127  C  CZ    . TYR G  3 54  ? 21.393 110.311 6.001   1.00 37.89  ? 54  TYR E CZ    1 
ATOM   9128  O  OH    . TYR G  3 54  ? 20.394 110.791 5.190   1.00 51.66  ? 54  TYR E OH    1 
ATOM   9129  N  N     . GLN G  3 55  ? 25.931 108.657 11.511  1.00 38.21  ? 55  GLN E N     1 
ATOM   9130  C  CA    . GLN G  3 55  ? 26.892 108.041 12.417  1.00 38.00  ? 55  GLN E CA    1 
ATOM   9131  C  C     . GLN G  3 55  ? 26.216 107.410 13.624  1.00 47.54  ? 55  GLN E C     1 
ATOM   9132  O  O     . GLN G  3 55  ? 26.844 106.604 14.318  1.00 59.93  ? 55  GLN E O     1 
ATOM   9133  C  CB    . GLN G  3 55  ? 27.933 109.062 12.878  1.00 28.40  ? 55  GLN E CB    1 
ATOM   9134  C  CG    . GLN G  3 55  ? 29.218 109.049 12.056  1.00 34.46  ? 55  GLN E CG    1 
ATOM   9135  C  CD    . GLN G  3 55  ? 30.323 109.876 12.685  1.00 42.95  ? 55  GLN E CD    1 
ATOM   9136  O  OE1   . GLN G  3 55  ? 30.190 110.357 13.810  1.00 51.96  ? 55  GLN E OE1   1 
ATOM   9137  N  NE2   . GLN G  3 55  ? 31.422 110.046 11.959  1.00 40.86  ? 55  GLN E NE2   1 
ATOM   9138  N  N     . LYS G  3 56  ? 24.953 107.748 13.888  1.00 46.72  ? 56  LYS E N     1 
ATOM   9139  C  CA    . LYS G  3 56  ? 24.238 107.139 15.001  1.00 45.91  ? 56  LYS E CA    1 
ATOM   9140  C  C     . LYS G  3 56  ? 23.443 105.898 14.607  1.00 47.88  ? 56  LYS E C     1 
ATOM   9141  O  O     . LYS G  3 56  ? 23.061 105.123 15.490  1.00 56.15  ? 56  LYS E O     1 
ATOM   9142  C  CB    . LYS G  3 56  ? 23.297 108.167 15.640  1.00 53.23  ? 56  LYS E CB    1 
ATOM   9143  C  CG    . LYS G  3 56  ? 22.843 107.827 17.053  1.00 69.27  ? 56  LYS E CG    1 
ATOM   9144  C  CD    . LYS G  3 56  ? 23.988 107.927 18.058  1.00 78.18  ? 56  LYS E CD    1 
ATOM   9145  C  CE    . LYS G  3 56  ? 24.434 106.551 18.534  1.00 80.15  ? 56  LYS E CE    1 
ATOM   9146  N  NZ    . LYS G  3 56  ? 25.469 106.639 19.597  1.00 82.48  ? 56  LYS E NZ    1 
ATOM   9147  N  N     . SER G  3 57  ? 23.202 105.676 13.317  1.00 47.56  ? 57  SER E N     1 
ATOM   9148  C  CA    . SER G  3 57  ? 22.325 104.608 12.856  1.00 41.52  ? 57  SER E CA    1 
ATOM   9149  C  C     . SER G  3 57  ? 23.104 103.560 12.065  1.00 42.35  ? 57  SER E C     1 
ATOM   9150  O  O     . SER G  3 57  ? 24.281 103.734 11.736  1.00 31.90  ? 57  SER E O     1 
ATOM   9151  C  CB    . SER G  3 57  ? 21.186 105.180 12.005  1.00 47.93  ? 57  SER E CB    1 
ATOM   9152  O  OG    . SER G  3 57  ? 21.693 105.846 10.862  1.00 50.10  ? 57  SER E OG    1 
ATOM   9153  N  N     . THR G  3 58  ? 22.416 102.456 11.755  1.00 39.51  ? 58  THR E N     1 
ATOM   9154  C  CA    . THR G  3 58  ? 23.023 101.316 11.077  1.00 42.53  ? 58  THR E CA    1 
ATOM   9155  C  C     . THR G  3 58  ? 22.386 100.984 9.735   1.00 46.66  ? 58  THR E C     1 
ATOM   9156  O  O     . THR G  3 58  ? 22.830 100.033 9.078   1.00 47.41  ? 58  THR E O     1 
ATOM   9157  C  CB    . THR G  3 58  ? 22.958 100.064 11.963  1.00 41.25  ? 58  THR E CB    1 
ATOM   9158  O  OG1   . THR G  3 58  ? 21.687 99.424  11.793  1.00 38.97  ? 58  THR E OG1   1 
ATOM   9159  C  CG2   . THR G  3 58  ? 23.144 100.424 13.427  1.00 43.83  ? 58  THR E CG2   1 
ATOM   9160  N  N     . GLU G  3 59  ? 21.364 101.723 9.309   1.00 41.44  ? 59  GLU E N     1 
ATOM   9161  C  CA    . GLU G  3 59  ? 20.660 101.384 8.081   1.00 33.74  ? 59  GLU E CA    1 
ATOM   9162  C  C     . GLU G  3 59  ? 21.604 101.453 6.887   1.00 43.31  ? 59  GLU E C     1 
ATOM   9163  O  O     . GLU G  3 59  ? 22.608 102.173 6.895   1.00 37.18  ? 59  GLU E O     1 
ATOM   9164  C  CB    . GLU G  3 59  ? 19.473 102.326 7.869   1.00 33.58  ? 59  GLU E CB    1 
ATOM   9165  C  CG    . GLU G  3 59  ? 19.830 103.646 7.200   1.00 47.68  ? 59  GLU E CG    1 
ATOM   9166  C  CD    . GLU G  3 59  ? 19.327 104.850 7.971   1.00 61.26  ? 59  GLU E CD    1 
ATOM   9167  O  OE1   . GLU G  3 59  ? 19.919 105.174 9.022   1.00 64.35  ? 59  GLU E OE1   1 
ATOM   9168  O  OE2   . GLU G  3 59  ? 18.335 105.467 7.529   1.00 69.23  ? 59  GLU E OE2   1 
ATOM   9169  N  N     . LEU G  3 60  ? 21.289 100.669 5.859   1.00 42.34  ? 60  LEU E N     1 
ATOM   9170  C  CA    . LEU G  3 60  ? 22.029 100.757 4.608   1.00 39.88  ? 60  LEU E CA    1 
ATOM   9171  C  C     . LEU G  3 60  ? 21.700 102.072 3.912   1.00 38.13  ? 60  LEU E C     1 
ATOM   9172  O  O     . LEU G  3 60  ? 20.569 102.562 3.977   1.00 45.77  ? 60  LEU E O     1 
ATOM   9173  C  CB    . LEU G  3 60  ? 21.699 99.572  3.702   1.00 45.48  ? 60  LEU E CB    1 
ATOM   9174  C  CG    . LEU G  3 60  ? 22.240 98.203  4.129   1.00 41.59  ? 60  LEU E CG    1 
ATOM   9175  C  CD1   . LEU G  3 60  ? 21.583 97.099  3.321   1.00 37.70  ? 60  LEU E CD1   1 
ATOM   9176  C  CD2   . LEU G  3 60  ? 23.751 98.141  3.974   1.00 37.53  ? 60  LEU E CD2   1 
ATOM   9177  N  N     . LEU G  3 61  ? 22.702 102.652 3.251   1.00 27.84  ? 61  LEU E N     1 
ATOM   9178  C  CA    . LEU G  3 61  ? 22.565 103.980 2.677   1.00 42.58  ? 61  LEU E CA    1 
ATOM   9179  C  C     . LEU G  3 61  ? 22.439 103.991 1.160   1.00 46.02  ? 61  LEU E C     1 
ATOM   9180  O  O     . LEU G  3 61  ? 22.030 105.013 0.600   1.00 51.41  ? 61  LEU E O     1 
ATOM   9181  C  CB    . LEU G  3 61  ? 23.756 104.853 3.097   1.00 42.79  ? 61  LEU E CB    1 
ATOM   9182  C  CG    . LEU G  3 61  ? 23.939 104.847 4.618   1.00 38.51  ? 61  LEU E CG    1 
ATOM   9183  C  CD1   . LEU G  3 61  ? 25.150 105.658 5.044   1.00 32.88  ? 61  LEU E CD1   1 
ATOM   9184  C  CD2   . LEU G  3 61  ? 22.676 105.356 5.303   1.00 28.31  ? 61  LEU E CD2   1 
ATOM   9185  N  N     . ILE G  3 62  ? 22.774 102.896 0.489   1.00 44.38  ? 62  ILE E N     1 
ATOM   9186  C  CA    . ILE G  3 62  ? 22.530 102.750 -0.940  1.00 40.50  ? 62  ILE E CA    1 
ATOM   9187  C  C     . ILE G  3 62  ? 21.178 102.074 -1.126  1.00 40.47  ? 62  ILE E C     1 
ATOM   9188  O  O     . ILE G  3 62  ? 20.871 101.088 -0.444  1.00 34.65  ? 62  ILE E O     1 
ATOM   9189  C  CB    . ILE G  3 62  ? 23.653 101.941 -1.610  1.00 38.08  ? 62  ILE E CB    1 
ATOM   9190  C  CG1   . ILE G  3 62  ? 24.983 102.691 -1.510  1.00 35.93  ? 62  ILE E CG1   1 
ATOM   9191  C  CG2   . ILE G  3 62  ? 23.313 101.642 -3.063  1.00 33.85  ? 62  ILE E CG2   1 
ATOM   9192  C  CD1   . ILE G  3 62  ? 26.142 101.973 -2.171  1.00 37.44  ? 62  ILE E CD1   1 
ATOM   9193  N  N     . ARG G  3 63  ? 20.365 102.610 -2.036  1.00 39.70  ? 63  ARG E N     1 
ATOM   9194  C  CA    . ARG G  3 63  ? 19.058 102.024 -2.304  1.00 40.93  ? 63  ARG E CA    1 
ATOM   9195  C  C     . ARG G  3 63  ? 19.212 100.573 -2.745  1.00 38.51  ? 63  ARG E C     1 
ATOM   9196  O  O     . ARG G  3 63  ? 20.117 100.233 -3.511  1.00 37.72  ? 63  ARG E O     1 
ATOM   9197  C  CB    . ARG G  3 63  ? 18.320 102.836 -3.369  1.00 49.22  ? 63  ARG E CB    1 
ATOM   9198  C  CG    . ARG G  3 63  ? 17.943 104.249 -2.930  1.00 49.63  ? 63  ARG E CG    1 
ATOM   9199  C  CD    . ARG G  3 63  ? 16.495 104.337 -2.457  1.00 56.97  ? 63  ARG E CD    1 
ATOM   9200  N  NE    . ARG G  3 63  ? 16.199 103.410 -1.368  1.00 71.36  ? 63  ARG E NE    1 
ATOM   9201  C  CZ    . ARG G  3 63  ? 16.368 103.687 -0.078  1.00 78.87  ? 63  ARG E CZ    1 
ATOM   9202  N  NH1   . ARG G  3 63  ? 16.838 104.872 0.292   1.00 76.93  ? 63  ARG E NH1   1 
ATOM   9203  N  NH2   . ARG G  3 63  ? 16.070 102.779 0.843   1.00 79.87  ? 63  ARG E NH2   1 
ATOM   9204  N  N     . LYS G  3 64  ? 18.316 99.716  -2.252  1.00 43.09  ? 64  LYS E N     1 
ATOM   9205  C  CA    . LYS G  3 64  ? 18.498 98.274  -2.401  1.00 51.52  ? 64  LYS E CA    1 
ATOM   9206  C  C     . LYS G  3 64  ? 18.431 97.844  -3.862  1.00 45.04  ? 64  LYS E C     1 
ATOM   9207  O  O     . LYS G  3 64  ? 19.354 97.198  -4.374  1.00 39.49  ? 64  LYS E O     1 
ATOM   9208  C  CB    . LYS G  3 64  ? 17.452 97.523  -1.576  1.00 59.46  ? 64  LYS E CB    1 
ATOM   9209  C  CG    . LYS G  3 64  ? 17.441 96.028  -1.858  1.00 71.76  ? 64  LYS E CG    1 
ATOM   9210  C  CD    . LYS G  3 64  ? 16.330 95.310  -1.119  1.00 77.53  ? 64  LYS E CD    1 
ATOM   9211  C  CE    . LYS G  3 64  ? 16.262 93.852  -1.547  1.00 79.88  ? 64  LYS E CE    1 
ATOM   9212  N  NZ    . LYS G  3 64  ? 15.258 93.075  -0.770  1.00 83.10  ? 64  LYS E NZ    1 
ATOM   9213  N  N     . LEU G  3 65  ? 17.337 98.179  -4.545  1.00 44.26  ? 65  LEU E N     1 
ATOM   9214  C  CA    . LEU G  3 65  ? 17.144 97.703  -5.915  1.00 42.20  ? 65  LEU E CA    1 
ATOM   9215  C  C     . LEU G  3 65  ? 18.261 98.134  -6.859  1.00 45.02  ? 65  LEU E C     1 
ATOM   9216  O  O     . LEU G  3 65  ? 18.772 97.275  -7.600  1.00 46.35  ? 65  LEU E O     1 
ATOM   9217  C  CB    . LEU G  3 65  ? 15.771 98.151  -6.428  1.00 39.44  ? 65  LEU E CB    1 
ATOM   9218  C  CG    . LEU G  3 65  ? 15.370 97.634  -7.813  1.00 44.81  ? 65  LEU E CG    1 
ATOM   9219  C  CD1   . LEU G  3 65  ? 14.958 96.170  -7.748  1.00 41.03  ? 65  LEU E CD1   1 
ATOM   9220  C  CD2   . LEU G  3 65  ? 14.255 98.482  -8.406  1.00 43.47  ? 65  LEU E CD2   1 
ATOM   9221  N  N     . PRO G  3 66  ? 18.687 99.405  -6.901  1.00 40.18  ? 66  PRO E N     1 
ATOM   9222  C  CA    . PRO G  3 66  ? 19.807 99.750  -7.797  1.00 45.48  ? 66  PRO E CA    1 
ATOM   9223  C  C     . PRO G  3 66  ? 21.076 98.974  -7.494  1.00 47.41  ? 66  PRO E C     1 
ATOM   9224  O  O     . PRO G  3 66  ? 21.789 98.572  -8.425  1.00 48.77  ? 66  PRO E O     1 
ATOM   9225  C  CB    . PRO G  3 66  ? 19.989 101.257 -7.566  1.00 42.36  ? 66  PRO E CB    1 
ATOM   9226  C  CG    . PRO G  3 66  ? 18.663 101.725 -7.090  1.00 42.25  ? 66  PRO E CG    1 
ATOM   9227  C  CD    . PRO G  3 66  ? 18.135 100.605 -6.245  1.00 40.84  ? 66  PRO E CD    1 
ATOM   9228  N  N     . PHE G  3 67  ? 21.379 98.745  -6.213  1.00 41.84  ? 67  PHE E N     1 
ATOM   9229  C  CA    . PHE G  3 67  ? 22.544 97.934  -5.871  1.00 39.03  ? 67  PHE E CA    1 
ATOM   9230  C  C     . PHE G  3 67  ? 22.381 96.505  -6.371  1.00 41.85  ? 67  PHE E C     1 
ATOM   9231  O  O     . PHE G  3 67  ? 23.348 95.885  -6.832  1.00 51.36  ? 67  PHE E O     1 
ATOM   9232  C  CB    . PHE G  3 67  ? 22.777 97.950  -4.360  1.00 34.92  ? 67  PHE E CB    1 
ATOM   9233  C  CG    . PHE G  3 67  ? 24.066 97.301  -3.943  1.00 29.96  ? 67  PHE E CG    1 
ATOM   9234  C  CD1   . PHE G  3 67  ? 24.125 95.941  -3.689  1.00 29.35  ? 67  PHE E CD1   1 
ATOM   9235  C  CD2   . PHE G  3 67  ? 25.221 98.052  -3.812  1.00 29.65  ? 67  PHE E CD2   1 
ATOM   9236  C  CE1   . PHE G  3 67  ? 25.309 95.343  -3.310  1.00 28.45  ? 67  PHE E CE1   1 
ATOM   9237  C  CE2   . PHE G  3 67  ? 26.410 97.459  -3.435  1.00 28.79  ? 67  PHE E CE2   1 
ATOM   9238  C  CZ    . PHE G  3 67  ? 26.454 96.103  -3.181  1.00 28.19  ? 67  PHE E CZ    1 
ATOM   9239  N  N     . GLN G  3 68  ? 21.163 95.964  -6.287  1.00 38.09  ? 68  GLN E N     1 
ATOM   9240  C  CA    . GLN G  3 68  ? 20.916 94.624  -6.806  1.00 41.81  ? 68  GLN E CA    1 
ATOM   9241  C  C     . GLN G  3 68  ? 21.144 94.571  -8.313  1.00 46.16  ? 68  GLN E C     1 
ATOM   9242  O  O     . GLN G  3 68  ? 21.767 93.631  -8.823  1.00 37.75  ? 68  GLN E O     1 
ATOM   9243  C  CB    . GLN G  3 68  ? 19.496 94.178  -6.453  1.00 39.33  ? 68  GLN E CB    1 
ATOM   9244  C  CG    . GLN G  3 68  ? 19.261 92.683  -6.604  1.00 53.99  ? 68  GLN E CG    1 
ATOM   9245  C  CD    . GLN G  3 68  ? 17.844 92.272  -6.248  1.00 67.70  ? 68  GLN E CD    1 
ATOM   9246  O  OE1   . GLN G  3 68  ? 17.632 91.296  -5.528  1.00 75.99  ? 68  GLN E OE1   1 
ATOM   9247  N  NE2   . GLN G  3 68  ? 16.867 93.015  -6.754  1.00 66.80  ? 68  GLN E NE2   1 
ATOM   9248  N  N     . ARG G  3 69  ? 20.656 95.580  -9.042  1.00 36.53  ? 69  ARG E N     1 
ATOM   9249  C  CA    . ARG G  3 69  ? 20.909 95.640  -10.479 1.00 47.97  ? 69  ARG E CA    1 
ATOM   9250  C  C     . ARG G  3 69  ? 22.401 95.710  -10.774 1.00 46.44  ? 69  ARG E C     1 
ATOM   9251  O  O     . ARG G  3 69  ? 22.893 95.031  -11.682 1.00 50.49  ? 69  ARG E O     1 
ATOM   9252  C  CB    . ARG G  3 69  ? 20.193 96.842  -11.096 1.00 39.81  ? 69  ARG E CB    1 
ATOM   9253  C  CG    . ARG G  3 69  ? 18.703 96.657  -11.304 1.00 41.16  ? 69  ARG E CG    1 
ATOM   9254  C  CD    . ARG G  3 69  ? 18.149 97.761  -12.193 1.00 44.51  ? 69  ARG E CD    1 
ATOM   9255  N  NE    . ARG G  3 69  ? 18.314 99.082  -11.593 1.00 45.98  ? 69  ARG E NE    1 
ATOM   9256  C  CZ    . ARG G  3 69  ? 17.313 99.821  -11.127 1.00 54.94  ? 69  ARG E CZ    1 
ATOM   9257  N  NH1   . ARG G  3 69  ? 16.066 99.374  -11.206 1.00 52.38  ? 69  ARG E NH1   1 
ATOM   9258  N  NH2   . ARG G  3 69  ? 17.558 101.012 -10.594 1.00 43.52  ? 69  ARG E NH2   1 
ATOM   9259  N  N     . LEU G  3 70  ? 23.136 96.530  -10.019 1.00 47.35  ? 70  LEU E N     1 
ATOM   9260  C  CA    . LEU G  3 70  ? 24.580 96.610  -10.211 1.00 43.01  ? 70  LEU E CA    1 
ATOM   9261  C  C     . LEU G  3 70  ? 25.235 95.250  -10.009 1.00 39.44  ? 70  LEU E C     1 
ATOM   9262  O  O     . LEU G  3 70  ? 26.097 94.841  -10.799 1.00 36.29  ? 70  LEU E O     1 
ATOM   9263  C  CB    . LEU G  3 70  ? 25.180 97.643  -9.256  1.00 35.47  ? 70  LEU E CB    1 
ATOM   9264  C  CG    . LEU G  3 70  ? 26.698 97.800  -9.335  1.00 41.85  ? 70  LEU E CG    1 
ATOM   9265  C  CD1   . LEU G  3 70  ? 27.117 98.190  -10.748 1.00 45.83  ? 70  LEU E CD1   1 
ATOM   9266  C  CD2   . LEU G  3 70  ? 27.186 98.817  -8.329  1.00 34.55  ? 70  LEU E CD2   1 
ATOM   9267  N  N     . VAL G  3 71  ? 24.825 94.530  -8.962  1.00 38.25  ? 71  VAL E N     1 
ATOM   9268  C  CA    . VAL G  3 71  ? 25.382 93.205  -8.701  1.00 35.46  ? 71  VAL E CA    1 
ATOM   9269  C  C     . VAL G  3 71  ? 25.092 92.267  -9.865  1.00 39.18  ? 71  VAL E C     1 
ATOM   9270  O  O     . VAL G  3 71  ? 25.979 91.550  -10.342 1.00 49.71  ? 71  VAL E O     1 
ATOM   9271  C  CB    . VAL G  3 71  ? 24.837 92.645  -7.376  1.00 33.84  ? 71  VAL E CB    1 
ATOM   9272  C  CG1   . VAL G  3 71  ? 25.045 91.141  -7.309  1.00 31.70  ? 71  VAL E CG1   1 
ATOM   9273  C  CG2   . VAL G  3 71  ? 25.518 93.327  -6.206  1.00 36.69  ? 71  VAL E CG2   1 
ATOM   9274  N  N     . ARG G  3 72  ? 23.848 92.265  -10.348 1.00 35.61  ? 72  ARG E N     1 
ATOM   9275  C  CA    . ARG G  3 72  ? 23.494 91.349  -11.428 1.00 40.33  ? 72  ARG E CA    1 
ATOM   9276  C  C     . ARG G  3 72  ? 24.198 91.712  -12.730 1.00 44.47  ? 72  ARG E C     1 
ATOM   9277  O  O     . ARG G  3 72  ? 24.423 90.838  -13.575 1.00 39.48  ? 72  ARG E O     1 
ATOM   9278  C  CB    . ARG G  3 72  ? 21.979 91.321  -11.619 1.00 41.73  ? 72  ARG E CB    1 
ATOM   9279  C  CG    . ARG G  3 72  ? 21.229 90.892  -10.366 1.00 49.73  ? 72  ARG E CG    1 
ATOM   9280  C  CD    . ARG G  3 72  ? 19.751 90.673  -10.635 1.00 62.38  ? 72  ARG E CD    1 
ATOM   9281  N  NE    . ARG G  3 72  ? 19.031 90.358  -9.406  1.00 65.73  ? 72  ARG E NE    1 
ATOM   9282  C  CZ    . ARG G  3 72  ? 18.994 89.152  -8.849  1.00 61.77  ? 72  ARG E CZ    1 
ATOM   9283  N  NH1   . ARG G  3 72  ? 19.638 88.138  -9.412  1.00 51.34  ? 72  ARG E NH1   1 
ATOM   9284  N  NH2   . ARG G  3 72  ? 18.316 88.960  -7.727  1.00 65.36  ? 72  ARG E NH2   1 
ATOM   9285  N  N     . GLU G  3 73  ? 24.559 92.983  -12.906 1.00 38.94  ? 73  GLU E N     1 
ATOM   9286  C  CA    . GLU G  3 73  ? 25.330 93.384  -14.078 1.00 40.64  ? 73  GLU E CA    1 
ATOM   9287  C  C     . GLU G  3 73  ? 26.771 92.895  -13.975 1.00 48.10  ? 73  GLU E C     1 
ATOM   9288  O  O     . GLU G  3 73  ? 27.263 92.171  -14.854 1.00 52.53  ? 73  GLU E O     1 
ATOM   9289  C  CB    . GLU G  3 73  ? 25.280 94.906  -14.231 1.00 41.41  ? 73  GLU E CB    1 
ATOM   9290  C  CG    . GLU G  3 73  ? 26.009 95.439  -15.450 1.00 53.64  ? 73  GLU E CG    1 
ATOM   9291  C  CD    . GLU G  3 73  ? 26.087 96.956  -15.463 1.00 61.32  ? 73  GLU E CD    1 
ATOM   9292  O  OE1   . GLU G  3 73  ? 27.214 97.495  -15.516 1.00 66.10  ? 73  GLU E OE1   1 
ATOM   9293  O  OE2   . GLU G  3 73  ? 25.023 97.608  -15.408 1.00 63.43  ? 73  GLU E OE2   1 
ATOM   9294  N  N     . ILE G  3 74  ? 27.460 93.280  -12.892 1.00 41.86  ? 74  ILE E N     1 
ATOM   9295  C  CA    . ILE G  3 74  ? 28.847 92.857  -12.684 1.00 40.10  ? 74  ILE E CA    1 
ATOM   9296  C  C     . ILE G  3 74  ? 28.962 91.341  -12.795 1.00 47.25  ? 74  ILE E C     1 
ATOM   9297  O  O     . ILE G  3 74  ? 29.837 90.810  -13.490 1.00 53.64  ? 74  ILE E O     1 
ATOM   9298  C  CB    . ILE G  3 74  ? 29.364 93.353  -11.321 1.00 40.74  ? 74  ILE E CB    1 
ATOM   9299  C  CG1   . ILE G  3 74  ? 29.259 94.879  -11.208 1.00 45.52  ? 74  ILE E CG1   1 
ATOM   9300  C  CG2   . ILE G  3 74  ? 30.800 92.890  -11.100 1.00 36.76  ? 74  ILE E CG2   1 
ATOM   9301  C  CD1   . ILE G  3 74  ? 30.459 95.629  -11.745 1.00 52.42  ? 74  ILE E CD1   1 
ATOM   9302  N  N     . ALA G  3 75  ? 28.068 90.624  -12.112 1.00 47.49  ? 75  ALA E N     1 
ATOM   9303  C  CA    . ALA G  3 75  ? 28.096 89.167  -12.142 1.00 46.87  ? 75  ALA E CA    1 
ATOM   9304  C  C     . ALA G  3 75  ? 27.740 88.634  -13.522 1.00 43.21  ? 75  ALA E C     1 
ATOM   9305  O  O     . ALA G  3 75  ? 28.306 87.628  -13.965 1.00 40.87  ? 75  ALA E O     1 
ATOM   9306  C  CB    . ALA G  3 75  ? 27.149 88.598  -11.090 1.00 44.42  ? 75  ALA E CB    1 
ATOM   9307  N  N     . GLN G  3 76  ? 26.803 89.290  -14.213 1.00 46.81  ? 76  GLN E N     1 
ATOM   9308  C  CA    . GLN G  3 76  ? 26.417 88.834  -15.544 1.00 42.66  ? 76  GLN E CA    1 
ATOM   9309  C  C     . GLN G  3 76  ? 27.580 88.916  -16.521 1.00 43.56  ? 76  GLN E C     1 
ATOM   9310  O  O     . GLN G  3 76  ? 27.672 88.101  -17.447 1.00 48.20  ? 76  GLN E O     1 
ATOM   9311  C  CB    . GLN G  3 76  ? 25.232 89.646  -16.063 1.00 43.31  ? 76  GLN E CB    1 
ATOM   9312  C  CG    . GLN G  3 76  ? 24.591 89.070  -17.310 1.00 44.93  ? 76  GLN E CG    1 
ATOM   9313  C  CD    . GLN G  3 76  ? 23.284 89.751  -17.658 1.00 57.46  ? 76  GLN E CD    1 
ATOM   9314  O  OE1   . GLN G  3 76  ? 23.089 90.932  -17.365 1.00 63.94  ? 76  GLN E OE1   1 
ATOM   9315  N  NE2   . GLN G  3 76  ? 22.378 89.008  -18.282 1.00 57.10  ? 76  GLN E NE2   1 
ATOM   9316  N  N     . ASP G  3 77  ? 28.483 89.879  -16.331 1.00 43.55  ? 77  ASP E N     1 
ATOM   9317  C  CA    . ASP G  3 77  ? 29.654 89.964  -17.193 1.00 45.38  ? 77  ASP E CA    1 
ATOM   9318  C  C     . ASP G  3 77  ? 30.693 88.885  -16.907 1.00 45.12  ? 77  ASP E C     1 
ATOM   9319  O  O     . ASP G  3 77  ? 31.492 88.566  -17.795 1.00 64.20  ? 77  ASP E O     1 
ATOM   9320  C  CB    . ASP G  3 77  ? 30.292 91.347  -17.067 1.00 45.72  ? 77  ASP E CB    1 
ATOM   9321  C  CG    . ASP G  3 77  ? 29.368 92.448  -17.540 1.00 56.58  ? 77  ASP E CG    1 
ATOM   9322  O  OD1   . ASP G  3 77  ? 28.162 92.176  -17.719 1.00 75.45  ? 77  ASP E OD1   1 
ATOM   9323  O  OD2   . ASP G  3 77  ? 29.845 93.587  -17.727 1.00 71.93  ? 77  ASP E OD2   1 
ATOM   9324  N  N     . PHE G  3 78  ? 30.705 88.316  -15.700 1.00 50.56  ? 78  PHE E N     1 
ATOM   9325  C  CA    . PHE G  3 78  ? 31.635 87.231  -15.397 1.00 44.77  ? 78  PHE E CA    1 
ATOM   9326  C  C     . PHE G  3 78  ? 31.091 85.882  -15.853 1.00 51.54  ? 78  PHE E C     1 
ATOM   9327  O  O     . PHE G  3 78  ? 31.835 85.066  -16.409 1.00 44.74  ? 78  PHE E O     1 
ATOM   9328  C  CB    . PHE G  3 78  ? 31.938 87.197  -13.898 1.00 40.74  ? 78  PHE E CB    1 
ATOM   9329  C  CG    . PHE G  3 78  ? 32.916 88.242  -13.452 1.00 53.83  ? 78  PHE E CG    1 
ATOM   9330  C  CD1   . PHE G  3 78  ? 34.154 88.356  -14.065 1.00 56.12  ? 78  PHE E CD1   1 
ATOM   9331  C  CD2   . PHE G  3 78  ? 32.598 89.117  -12.426 1.00 47.26  ? 78  PHE E CD2   1 
ATOM   9332  C  CE1   . PHE G  3 78  ? 35.059 89.319  -13.658 1.00 57.14  ? 78  PHE E CE1   1 
ATOM   9333  C  CE2   . PHE G  3 78  ? 33.497 90.084  -12.015 1.00 48.76  ? 78  PHE E CE2   1 
ATOM   9334  C  CZ    . PHE G  3 78  ? 34.729 90.186  -12.633 1.00 49.43  ? 78  PHE E CZ    1 
ATOM   9335  N  N     . LYS G  3 79  ? 29.805 85.631  -15.619 1.00 49.38  ? 79  LYS E N     1 
ATOM   9336  C  CA    . LYS G  3 79  ? 29.171 84.376  -16.001 1.00 52.46  ? 79  LYS E CA    1 
ATOM   9337  C  C     . LYS G  3 79  ? 27.689 84.629  -16.225 1.00 56.72  ? 79  LYS E C     1 
ATOM   9338  O  O     . LYS G  3 79  ? 27.018 85.200  -15.359 1.00 61.84  ? 79  LYS E O     1 
ATOM   9339  C  CB    . LYS G  3 79  ? 29.369 83.302  -14.925 1.00 56.00  ? 79  LYS E CB    1 
ATOM   9340  C  CG    . LYS G  3 79  ? 28.468 82.089  -15.085 1.00 67.63  ? 79  LYS E CG    1 
ATOM   9341  C  CD    . LYS G  3 79  ? 29.262 80.843  -15.440 1.00 72.18  ? 79  LYS E CD    1 
ATOM   9342  C  CE    . LYS G  3 79  ? 28.341 79.656  -15.672 1.00 73.34  ? 79  LYS E CE    1 
ATOM   9343  N  NZ    . LYS G  3 79  ? 29.101 78.401  -15.924 1.00 76.54  ? 79  LYS E NZ    1 
ATOM   9344  N  N     . THR G  3 80  ? 27.185 84.210  -17.381 1.00 58.47  ? 80  THR E N     1 
ATOM   9345  C  CA    . THR G  3 80  ? 25.776 84.392  -17.685 1.00 63.14  ? 80  THR E CA    1 
ATOM   9346  C  C     . THR G  3 80  ? 24.932 83.341  -16.969 1.00 67.93  ? 80  THR E C     1 
ATOM   9347  O  O     . THR G  3 80  ? 25.435 82.320  -16.490 1.00 59.54  ? 80  THR E O     1 
ATOM   9348  C  CB    . THR G  3 80  ? 25.534 84.318  -19.194 1.00 70.20  ? 80  THR E CB    1 
ATOM   9349  O  OG1   . THR G  3 80  ? 26.074 83.094  -19.709 1.00 66.63  ? 80  THR E OG1   1 
ATOM   9350  C  CG2   . THR G  3 80  ? 26.195 85.496  -19.896 1.00 74.51  ? 80  THR E CG2   1 
ATOM   9351  N  N     . ASP G  3 81  ? 23.627 83.615  -16.894 1.00 72.28  ? 81  ASP E N     1 
ATOM   9352  C  CA    . ASP G  3 81  ? 22.647 82.695  -16.313 1.00 82.00  ? 81  ASP E CA    1 
ATOM   9353  C  C     . ASP G  3 81  ? 22.976 82.370  -14.855 1.00 70.59  ? 81  ASP E C     1 
ATOM   9354  O  O     . ASP G  3 81  ? 23.052 81.207  -14.453 1.00 73.31  ? 81  ASP E O     1 
ATOM   9355  C  CB    . ASP G  3 81  ? 22.536 81.418  -17.149 1.00 96.87  ? 81  ASP E CB    1 
ATOM   9356  C  CG    . ASP G  3 81  ? 22.250 81.704  -18.609 1.00 113.39 ? 81  ASP E CG    1 
ATOM   9357  O  OD1   . ASP G  3 81  ? 21.504 82.665  -18.892 1.00 118.62 ? 81  ASP E OD1   1 
ATOM   9358  O  OD2   . ASP G  3 81  ? 22.773 80.969  -19.473 1.00 121.60 ? 81  ASP E OD2   1 
ATOM   9359  N  N     . LEU G  3 82  ? 23.172 83.417  -14.059 1.00 67.07  ? 82  LEU E N     1 
ATOM   9360  C  CA    . LEU G  3 82  ? 23.439 83.283  -12.635 1.00 60.31  ? 82  LEU E CA    1 
ATOM   9361  C  C     . LEU G  3 82  ? 22.229 83.735  -11.831 1.00 55.95  ? 82  LEU E C     1 
ATOM   9362  O  O     . LEU G  3 82  ? 21.553 84.703  -12.195 1.00 52.55  ? 82  LEU E O     1 
ATOM   9363  C  CB    . LEU G  3 82  ? 24.667 84.099  -12.216 1.00 50.57  ? 82  LEU E CB    1 
ATOM   9364  C  CG    . LEU G  3 82  ? 26.040 83.461  -12.428 1.00 47.98  ? 82  LEU E CG    1 
ATOM   9365  C  CD1   . LEU G  3 82  ? 27.133 84.437  -12.039 1.00 40.44  ? 82  LEU E CD1   1 
ATOM   9366  C  CD2   . LEU G  3 82  ? 26.163 82.170  -11.638 1.00 43.89  ? 82  LEU E CD2   1 
ATOM   9367  N  N     . ARG G  3 83  ? 21.960 83.025  -10.742 1.00 52.97  ? 83  ARG E N     1 
ATOM   9368  C  CA    . ARG G  3 83  ? 20.945 83.410  -9.776  1.00 55.34  ? 83  ARG E CA    1 
ATOM   9369  C  C     . ARG G  3 83  ? 21.611 83.759  -8.452  1.00 55.82  ? 83  ARG E C     1 
ATOM   9370  O  O     . ARG G  3 83  ? 22.746 83.361  -8.176  1.00 51.14  ? 83  ARG E O     1 
ATOM   9371  C  CB    . ARG G  3 83  ? 19.915 82.291  -9.581  1.00 51.19  ? 83  ARG E CB    1 
ATOM   9372  C  CG    . ARG G  3 83  ? 19.008 82.084  -10.780 1.00 62.13  ? 83  ARG E CG    1 
ATOM   9373  C  CD    . ARG G  3 83  ? 18.330 80.724  -10.746 1.00 72.91  ? 83  ARG E CD    1 
ATOM   9374  N  NE    . ARG G  3 83  ? 16.916 80.804  -10.390 1.00 79.41  ? 83  ARG E NE    1 
ATOM   9375  C  CZ    . ARG G  3 83  ? 15.935 80.992  -11.267 1.00 86.22  ? 83  ARG E CZ    1 
ATOM   9376  N  NH1   . ARG G  3 83  ? 16.213 81.129  -12.556 1.00 90.78  ? 83  ARG E NH1   1 
ATOM   9377  N  NH2   . ARG G  3 83  ? 14.675 81.047  -10.854 1.00 87.62  ? 83  ARG E NH2   1 
ATOM   9378  N  N     . PHE G  3 84  ? 20.893 84.525  -7.637  1.00 59.36  ? 84  PHE E N     1 
ATOM   9379  C  CA    . PHE G  3 84  ? 21.392 84.975  -6.347  1.00 47.12  ? 84  PHE E CA    1 
ATOM   9380  C  C     . PHE G  3 84  ? 20.380 84.659  -5.262  1.00 45.58  ? 84  PHE E C     1 
ATOM   9381  O  O     . PHE G  3 84  ? 19.172 84.818  -5.462  1.00 44.48  ? 84  PHE E O     1 
ATOM   9382  C  CB    . PHE G  3 84  ? 21.670 86.483  -6.343  1.00 42.73  ? 84  PHE E CB    1 
ATOM   9383  C  CG    . PHE G  3 84  ? 22.949 86.871  -7.023  1.00 48.13  ? 84  PHE E CG    1 
ATOM   9384  C  CD1   . PHE G  3 84  ? 23.020 86.953  -8.404  1.00 38.59  ? 84  PHE E CD1   1 
ATOM   9385  C  CD2   . PHE G  3 84  ? 24.079 87.170  -6.278  1.00 48.99  ? 84  PHE E CD2   1 
ATOM   9386  C  CE1   . PHE G  3 84  ? 24.196 87.316  -9.029  1.00 36.98  ? 84  PHE E CE1   1 
ATOM   9387  C  CE2   . PHE G  3 84  ? 25.259 87.533  -6.897  1.00 46.90  ? 84  PHE E CE2   1 
ATOM   9388  C  CZ    . PHE G  3 84  ? 25.317 87.605  -8.274  1.00 40.81  ? 84  PHE E CZ    1 
ATOM   9389  N  N     . GLN G  3 85  ? 20.876 84.203  -4.117  1.00 50.28  ? 85  GLN E N     1 
ATOM   9390  C  CA    . GLN G  3 85  ? 20.078 84.265  -2.904  1.00 49.75  ? 85  GLN E CA    1 
ATOM   9391  C  C     . GLN G  3 85  ? 19.944 85.722  -2.481  1.00 43.94  ? 85  GLN E C     1 
ATOM   9392  O  O     . GLN G  3 85  ? 20.866 86.522  -2.667  1.00 38.19  ? 85  GLN E O     1 
ATOM   9393  C  CB    . GLN G  3 85  ? 20.725 83.447  -1.786  1.00 55.88  ? 85  GLN E CB    1 
ATOM   9394  C  CG    . GLN G  3 85  ? 20.836 81.958  -2.066  1.00 57.38  ? 85  GLN E CG    1 
ATOM   9395  C  CD    . GLN G  3 85  ? 21.499 81.206  -0.927  1.00 56.37  ? 85  GLN E CD    1 
ATOM   9396  O  OE1   . GLN G  3 85  ? 22.157 81.803  -0.074  1.00 57.34  ? 85  GLN E OE1   1 
ATOM   9397  N  NE2   . GLN G  3 85  ? 21.325 79.889  -0.905  1.00 53.95  ? 85  GLN E NE2   1 
ATOM   9398  N  N     . SER G  3 86  ? 18.780 86.073  -1.931  1.00 43.38  ? 86  SER E N     1 
ATOM   9399  C  CA    . SER G  3 86  ? 18.573 87.441  -1.465  1.00 44.38  ? 86  SER E CA    1 
ATOM   9400  C  C     . SER G  3 86  ? 19.618 87.833  -0.426  1.00 36.16  ? 86  SER E C     1 
ATOM   9401  O  O     . SER G  3 86  ? 20.110 88.971  -0.421  1.00 41.12  ? 86  SER E O     1 
ATOM   9402  C  CB    . SER G  3 86  ? 17.161 87.589  -0.899  1.00 51.41  ? 86  SER E CB    1 
ATOM   9403  O  OG    . SER G  3 86  ? 16.876 86.557  0.029   1.00 68.48  ? 86  SER E OG    1 
ATOM   9404  N  N     . SER G  3 87  ? 19.987 86.894  0.449   1.00 30.30  ? 87  SER E N     1 
ATOM   9405  C  CA    . SER G  3 87  ? 20.974 87.177  1.483   1.00 44.23  ? 87  SER E CA    1 
ATOM   9406  C  C     . SER G  3 87  ? 22.378 87.336  0.916   1.00 38.25  ? 87  SER E C     1 
ATOM   9407  O  O     . SER G  3 87  ? 23.227 87.950  1.570   1.00 40.69  ? 87  SER E O     1 
ATOM   9408  C  CB    . SER G  3 87  ? 20.959 86.075  2.544   1.00 42.45  ? 87  SER E CB    1 
ATOM   9409  O  OG    . SER G  3 87  ? 21.266 84.814  1.975   1.00 56.31  ? 87  SER E OG    1 
ATOM   9410  N  N     . ALA G  3 88  ? 22.649 86.791  -0.272  1.00 31.99  ? 88  ALA E N     1 
ATOM   9411  C  CA    . ALA G  3 88  ? 23.936 87.046  -0.910  1.00 36.77  ? 88  ALA E CA    1 
ATOM   9412  C  C     . ALA G  3 88  ? 24.035 88.494  -1.371  1.00 39.22  ? 88  ALA E C     1 
ATOM   9413  O  O     . ALA G  3 88  ? 25.068 89.150  -1.175  1.00 38.88  ? 88  ALA E O     1 
ATOM   9414  C  CB    . ALA G  3 88  ? 24.143 86.088  -2.084  1.00 30.56  ? 88  ALA E CB    1 
ATOM   9415  N  N     . VAL G  3 89  ? 22.963 89.013  -1.972  1.00 37.47  ? 89  VAL E N     1 
ATOM   9416  C  CA    . VAL G  3 89  ? 22.945 90.412  -2.376  1.00 39.05  ? 89  VAL E CA    1 
ATOM   9417  C  C     . VAL G  3 89  ? 22.998 91.320  -1.155  1.00 37.15  ? 89  VAL E C     1 
ATOM   9418  O  O     . VAL G  3 89  ? 23.701 92.336  -1.156  1.00 37.61  ? 89  VAL E O     1 
ATOM   9419  C  CB    . VAL G  3 89  ? 21.711 90.706  -3.248  1.00 44.29  ? 89  VAL E CB    1 
ATOM   9420  C  CG1   . VAL G  3 89  ? 21.737 92.149  -3.730  1.00 37.63  ? 89  VAL E CG1   1 
ATOM   9421  C  CG2   . VAL G  3 89  ? 21.655 89.749  -4.427  1.00 43.19  ? 89  VAL E CG2   1 
ATOM   9422  N  N     . MET G  3 90  ? 22.262 90.974  -0.093  1.00 44.94  ? 90  MET E N     1 
ATOM   9423  C  CA    . MET G  3 90  ? 22.334 91.790  1.116   1.00 44.21  ? 90  MET E CA    1 
ATOM   9424  C  C     . MET G  3 90  ? 23.718 91.729  1.754   1.00 33.59  ? 90  MET E C     1 
ATOM   9425  O  O     . MET G  3 90  ? 24.177 92.723  2.331   1.00 37.16  ? 90  MET E O     1 
ATOM   9426  C  CB    . MET G  3 90  ? 21.259 91.360  2.113   1.00 56.69  ? 90  MET E CB    1 
ATOM   9427  C  CG    . MET G  3 90  ? 19.849 91.674  1.642   1.00 79.24  ? 90  MET E CG    1 
ATOM   9428  S  SD    . MET G  3 90  ? 19.687 93.367  1.033   1.00 95.53  ? 90  MET E SD    1 
ATOM   9429  C  CE    . MET G  3 90  ? 19.469 94.270  2.564   1.00 94.45  ? 90  MET E CE    1 
ATOM   9430  N  N     . ALA G  3 91  ? 24.400 90.586  1.652   1.00 29.62  ? 91  ALA E N     1 
ATOM   9431  C  CA    . ALA G  3 91  ? 25.768 90.495  2.152   1.00 31.43  ? 91  ALA E CA    1 
ATOM   9432  C  C     . ALA G  3 91  ? 26.706 91.389  1.350   1.00 36.40  ? 91  ALA E C     1 
ATOM   9433  O  O     . ALA G  3 91  ? 27.539 92.101  1.927   1.00 41.65  ? 91  ALA E O     1 
ATOM   9434  C  CB    . ALA G  3 91  ? 26.246 89.044  2.114   1.00 23.88  ? 91  ALA E CB    1 
ATOM   9435  N  N     . LEU G  3 92  ? 26.584 91.366  0.018   1.00 38.67  ? 92  LEU E N     1 
ATOM   9436  C  CA    . LEU G  3 92  ? 27.374 92.270  -0.813  1.00 33.56  ? 92  LEU E CA    1 
ATOM   9437  C  C     . LEU G  3 92  ? 27.070 93.727  -0.480  1.00 35.36  ? 92  LEU E C     1 
ATOM   9438  O  O     . LEU G  3 92  ? 27.966 94.581  -0.505  1.00 38.67  ? 92  LEU E O     1 
ATOM   9439  C  CB    . LEU G  3 92  ? 27.108 91.985  -2.292  1.00 31.83  ? 92  LEU E CB    1 
ATOM   9440  C  CG    . LEU G  3 92  ? 27.546 90.613  -2.814  1.00 35.39  ? 92  LEU E CG    1 
ATOM   9441  C  CD1   . LEU G  3 92  ? 26.876 90.303  -4.143  1.00 41.79  ? 92  LEU E CD1   1 
ATOM   9442  C  CD2   . LEU G  3 92  ? 29.060 90.551  -2.957  1.00 28.32  ? 92  LEU E CD2   1 
ATOM   9443  N  N     . GLN G  3 93  ? 25.807 94.026  -0.163  1.00 26.02  ? 93  GLN E N     1 
ATOM   9444  C  CA    . GLN G  3 93  ? 25.433 95.355  0.309   1.00 23.92  ? 93  GLN E CA    1 
ATOM   9445  C  C     . GLN G  3 93  ? 26.214 95.730  1.563   1.00 43.82  ? 93  GLN E C     1 
ATOM   9446  O  O     . GLN G  3 93  ? 26.875 96.777  1.612   1.00 52.38  ? 93  GLN E O     1 
ATOM   9447  C  CB    . GLN G  3 93  ? 23.930 95.395  0.590   1.00 25.17  ? 93  GLN E CB    1 
ATOM   9448  C  CG    . GLN G  3 93  ? 23.084 96.087  -0.455  1.00 25.94  ? 93  GLN E CG    1 
ATOM   9449  C  CD    . GLN G  3 93  ? 22.931 97.567  -0.190  1.00 30.07  ? 93  GLN E CD    1 
ATOM   9450  O  OE1   . GLN G  3 93  ? 23.904 98.264  0.089   1.00 37.42  ? 93  GLN E OE1   1 
ATOM   9451  N  NE2   . GLN G  3 93  ? 21.700 98.056  -0.272  1.00 27.45  ? 93  GLN E NE2   1 
ATOM   9452  N  N     . GLU G  3 94  ? 26.147 94.879  2.592   1.00 34.93  ? 94  GLU E N     1 
ATOM   9453  C  CA    . GLU G  3 94  ? 26.807 95.174  3.861   1.00 30.12  ? 94  GLU E CA    1 
ATOM   9454  C  C     . GLU G  3 94  ? 28.307 95.372  3.674   1.00 36.52  ? 94  GLU E C     1 
ATOM   9455  O  O     . GLU G  3 94  ? 28.881 96.363  4.148   1.00 41.50  ? 94  GLU E O     1 
ATOM   9456  C  CB    . GLU G  3 94  ? 26.535 94.048  4.859   1.00 36.35  ? 94  GLU E CB    1 
ATOM   9457  C  CG    . GLU G  3 94  ? 25.088 93.937  5.304   1.00 40.41  ? 94  GLU E CG    1 
ATOM   9458  C  CD    . GLU G  3 94  ? 24.685 95.066  6.234   1.00 47.15  ? 94  GLU E CD    1 
ATOM   9459  O  OE1   . GLU G  3 94  ? 23.468 95.313  6.388   1.00 51.90  ? 94  GLU E OE1   1 
ATOM   9460  O  OE2   . GLU G  3 94  ? 25.592 95.706  6.812   1.00 44.30  ? 94  GLU E OE2   1 
ATOM   9461  N  N     . ALA G  3 95  ? 28.958 94.438  2.976   1.00 31.25  ? 95  ALA E N     1 
ATOM   9462  C  CA    . ALA G  3 95  ? 30.398 94.543  2.764   1.00 22.84  ? 95  ALA E CA    1 
ATOM   9463  C  C     . ALA G  3 95  ? 30.750 95.812  2.000   1.00 29.10  ? 95  ALA E C     1 
ATOM   9464  O  O     . ALA G  3 95  ? 31.682 96.538  2.371   1.00 35.66  ? 95  ALA E O     1 
ATOM   9465  C  CB    . ALA G  3 95  ? 30.906 93.310  2.022   1.00 20.49  ? 95  ALA E CB    1 
ATOM   9466  N  N     . SER G  3 96  ? 30.004 96.101  0.931   1.00 29.24  ? 96  SER E N     1 
ATOM   9467  C  CA    . SER G  3 96  ? 30.302 97.270  0.110   1.00 27.13  ? 96  SER E CA    1 
ATOM   9468  C  C     . SER G  3 96  ? 30.178 98.556  0.916   1.00 25.05  ? 96  SER E C     1 
ATOM   9469  O  O     . SER G  3 96  ? 31.060 99.422  0.868   1.00 29.69  ? 96  SER E O     1 
ATOM   9470  C  CB    . SER G  3 96  ? 29.376 97.301  -1.106  1.00 30.62  ? 96  SER E CB    1 
ATOM   9471  O  OG    . SER G  3 96  ? 29.576 96.165  -1.930  1.00 29.93  ? 96  SER E OG    1 
ATOM   9472  N  N     . GLU G  3 97  ? 29.090 98.696  1.676   1.00 27.98  ? 97  GLU E N     1 
ATOM   9473  C  CA    . GLU G  3 97  ? 28.886 99.934  2.422   1.00 27.25  ? 97  GLU E CA    1 
ATOM   9474  C  C     . GLU G  3 97  ? 29.889 100.073 3.561   1.00 25.92  ? 97  GLU E C     1 
ATOM   9475  O  O     . GLU G  3 97  ? 30.342 101.184 3.860   1.00 24.22  ? 97  GLU E O     1 
ATOM   9476  C  CB    . GLU G  3 97  ? 27.452 100.008 2.943   1.00 27.79  ? 97  GLU E CB    1 
ATOM   9477  C  CG    . GLU G  3 97  ? 26.422 100.178 1.839   1.00 42.16  ? 97  GLU E CG    1 
ATOM   9478  C  CD    . GLU G  3 97  ? 25.140 100.821 2.325   1.00 54.16  ? 97  GLU E CD    1 
ATOM   9479  O  OE1   . GLU G  3 97  ? 24.078 100.561 1.723   1.00 58.78  ? 97  GLU E OE1   1 
ATOM   9480  O  OE2   . GLU G  3 97  ? 25.195 101.588 3.309   1.00 59.81  ? 97  GLU E OE2   1 
ATOM   9481  N  N     . ALA G  3 98  ? 30.258 98.963  4.205   1.00 24.60  ? 98  ALA E N     1 
ATOM   9482  C  CA    . ALA G  3 98  ? 31.276 99.031  5.250   1.00 21.15  ? 98  ALA E CA    1 
ATOM   9483  C  C     . ALA G  3 98  ? 32.619 99.468  4.673   1.00 29.95  ? 98  ALA E C     1 
ATOM   9484  O  O     . ALA G  3 98  ? 33.273 100.381 5.200   1.00 35.49  ? 98  ALA E O     1 
ATOM   9485  C  CB    . ALA G  3 98  ? 31.400 97.679  5.952   1.00 23.56  ? 98  ALA E CB    1 
ATOM   9486  N  N     . TYR G  3 99  ? 33.039 98.828  3.576   1.00 33.52  ? 99  TYR E N     1 
ATOM   9487  C  CA    . TYR G  3 99  ? 34.288 99.205  2.921   1.00 30.77  ? 99  TYR E CA    1 
ATOM   9488  C  C     . TYR G  3 99  ? 34.275 100.669 2.493   1.00 36.99  ? 99  TYR E C     1 
ATOM   9489  O  O     . TYR G  3 99  ? 35.268 101.384 2.678   1.00 43.27  ? 99  TYR E O     1 
ATOM   9490  C  CB    . TYR G  3 99  ? 34.542 98.295  1.719   1.00 26.68  ? 99  TYR E CB    1 
ATOM   9491  C  CG    . TYR G  3 99  ? 35.603 98.809  0.772   1.00 31.93  ? 99  TYR E CG    1 
ATOM   9492  C  CD1   . TYR G  3 99  ? 36.949 98.551  1.001   1.00 29.32  ? 99  TYR E CD1   1 
ATOM   9493  C  CD2   . TYR G  3 99  ? 35.256 99.547  -0.356  1.00 31.83  ? 99  TYR E CD2   1 
ATOM   9494  C  CE1   . TYR G  3 99  ? 37.919 99.021  0.141   1.00 34.52  ? 99  TYR E CE1   1 
ATOM   9495  C  CE2   . TYR G  3 99  ? 36.218 100.020 -1.222  1.00 35.80  ? 99  TYR E CE2   1 
ATOM   9496  C  CZ    . TYR G  3 99  ? 37.548 99.753  -0.972  1.00 42.56  ? 99  TYR E CZ    1 
ATOM   9497  O  OH    . TYR G  3 99  ? 38.510 100.221 -1.837  1.00 47.28  ? 99  TYR E OH    1 
ATOM   9498  N  N     . LEU G  3 100 ? 33.159 101.136 1.924   1.00 31.59  ? 100 LEU E N     1 
ATOM   9499  C  CA    . LEU G  3 100 ? 33.098 102.520 1.465   1.00 32.87  ? 100 LEU E CA    1 
ATOM   9500  C  C     . LEU G  3 100 ? 33.101 103.509 2.624   1.00 42.98  ? 100 LEU E C     1 
ATOM   9501  O  O     . LEU G  3 100 ? 33.668 104.600 2.500   1.00 45.03  ? 100 LEU E O     1 
ATOM   9502  C  CB    . LEU G  3 100 ? 31.859 102.733 0.591   1.00 29.25  ? 100 LEU E CB    1 
ATOM   9503  C  CG    . LEU G  3 100 ? 31.904 102.149 -0.825  1.00 36.04  ? 100 LEU E CG    1 
ATOM   9504  C  CD1   . LEU G  3 100 ? 30.717 102.644 -1.638  1.00 36.50  ? 100 LEU E CD1   1 
ATOM   9505  C  CD2   . LEU G  3 100 ? 33.211 102.500 -1.520  1.00 20.43  ? 100 LEU E CD2   1 
ATOM   9506  N  N     . VAL G  3 101 ? 32.476 103.158 3.749   1.00 42.89  ? 101 VAL E N     1 
ATOM   9507  C  CA    . VAL G  3 101 ? 32.469 104.054 4.901   1.00 35.45  ? 101 VAL E CA    1 
ATOM   9508  C  C     . VAL G  3 101 ? 33.870 104.166 5.495   1.00 32.28  ? 101 VAL E C     1 
ATOM   9509  O  O     . VAL G  3 101 ? 34.363 105.272 5.762   1.00 30.06  ? 101 VAL E O     1 
ATOM   9510  C  CB    . VAL G  3 101 ? 31.442 103.580 5.945   1.00 34.08  ? 101 VAL E CB    1 
ATOM   9511  C  CG1   . VAL G  3 101 ? 31.736 104.196 7.308   1.00 25.74  ? 101 VAL E CG1   1 
ATOM   9512  C  CG2   . VAL G  3 101 ? 30.033 103.945 5.498   1.00 28.03  ? 101 VAL E CG2   1 
ATOM   9513  N  N     . ALA G  3 102 ? 34.533 103.024 5.711   1.00 22.68  ? 102 ALA E N     1 
ATOM   9514  C  CA    . ALA G  3 102 ? 35.910 103.070 6.193   1.00 22.43  ? 102 ALA E CA    1 
ATOM   9515  C  C     . ALA G  3 102 ? 36.800 103.856 5.239   1.00 41.93  ? 102 ALA E C     1 
ATOM   9516  O  O     . ALA G  3 102 ? 37.608 104.693 5.671   1.00 45.01  ? 102 ALA E O     1 
ATOM   9517  C  CB    . ALA G  3 102 ? 36.446 101.650 6.383   1.00 18.80  ? 102 ALA E CB    1 
ATOM   9518  N  N     . LEU G  3 103 ? 36.647 103.615 3.933   1.00 44.54  ? 103 LEU E N     1 
ATOM   9519  C  CA    . LEU G  3 103 ? 37.423 104.354 2.944   1.00 33.57  ? 103 LEU E CA    1 
ATOM   9520  C  C     . LEU G  3 103 ? 37.160 105.851 3.039   1.00 27.66  ? 103 LEU E C     1 
ATOM   9521  O  O     . LEU G  3 103 ? 38.079 106.659 2.874   1.00 33.71  ? 103 LEU E O     1 
ATOM   9522  C  CB    . LEU G  3 103 ? 37.106 103.847 1.538   1.00 39.98  ? 103 LEU E CB    1 
ATOM   9523  C  CG    . LEU G  3 103 ? 37.867 104.569 0.425   1.00 39.74  ? 103 LEU E CG    1 
ATOM   9524  C  CD1   . LEU G  3 103 ? 39.362 104.359 0.596   1.00 35.11  ? 103 LEU E CD1   1 
ATOM   9525  C  CD2   . LEU G  3 103 ? 37.408 104.102 -0.939  1.00 40.74  ? 103 LEU E CD2   1 
ATOM   9526  N  N     . PHE G  3 104 ? 35.912 106.242 3.299   1.00 21.28  ? 104 PHE E N     1 
ATOM   9527  C  CA    . PHE G  3 104 ? 35.608 107.661 3.446   1.00 29.91  ? 104 PHE E CA    1 
ATOM   9528  C  C     . PHE G  3 104 ? 36.205 108.234 4.725   1.00 38.94  ? 104 PHE E C     1 
ATOM   9529  O  O     . PHE G  3 104 ? 36.483 109.438 4.792   1.00 33.72  ? 104 PHE E O     1 
ATOM   9530  C  CB    . PHE G  3 104 ? 34.096 107.882 3.411   1.00 36.45  ? 104 PHE E CB    1 
ATOM   9531  C  CG    . PHE G  3 104 ? 33.546 108.072 2.029   1.00 44.89  ? 104 PHE E CG    1 
ATOM   9532  C  CD1   . PHE G  3 104 ? 34.214 108.862 1.109   1.00 52.87  ? 104 PHE E CD1   1 
ATOM   9533  C  CD2   . PHE G  3 104 ? 32.367 107.456 1.645   1.00 43.28  ? 104 PHE E CD2   1 
ATOM   9534  C  CE1   . PHE G  3 104 ? 33.715 109.040 -0.169  1.00 46.56  ? 104 PHE E CE1   1 
ATOM   9535  C  CE2   . PHE G  3 104 ? 31.861 107.630 0.372   1.00 40.98  ? 104 PHE E CE2   1 
ATOM   9536  C  CZ    . PHE G  3 104 ? 32.537 108.422 -0.539  1.00 41.89  ? 104 PHE E CZ    1 
ATOM   9537  N  N     . GLU G  3 105 ? 36.407 107.402 5.748   1.00 42.55  ? 105 GLU E N     1 
ATOM   9538  C  CA    . GLU G  3 105 ? 37.085 107.879 6.951   1.00 43.10  ? 105 GLU E CA    1 
ATOM   9539  C  C     . GLU G  3 105 ? 38.567 108.124 6.683   1.00 40.25  ? 105 GLU E C     1 
ATOM   9540  O  O     . GLU G  3 105 ? 39.094 109.206 6.983   1.00 39.44  ? 105 GLU E O     1 
ATOM   9541  C  CB    . GLU G  3 105 ? 36.887 106.881 8.092   1.00 36.28  ? 105 GLU E CB    1 
ATOM   9542  C  CG    . GLU G  3 105 ? 35.443 106.787 8.555   1.00 44.98  ? 105 GLU E CG    1 
ATOM   9543  C  CD    . GLU G  3 105 ? 35.226 105.722 9.611   1.00 50.19  ? 105 GLU E CD    1 
ATOM   9544  O  OE1   . GLU G  3 105 ? 35.957 104.707 9.599   1.00 43.81  ? 105 GLU E OE1   1 
ATOM   9545  O  OE2   . GLU G  3 105 ? 34.323 105.906 10.456  1.00 58.35  ? 105 GLU E OE2   1 
ATOM   9546  N  N     . ASP G  3 106 ? 39.256 107.133 6.106   1.00 44.68  ? 106 ASP E N     1 
ATOM   9547  C  CA    . ASP G  3 106 ? 40.659 107.327 5.745   1.00 41.78  ? 106 ASP E CA    1 
ATOM   9548  C  C     . ASP G  3 106 ? 40.826 108.495 4.777   1.00 41.15  ? 106 ASP E C     1 
ATOM   9549  O  O     . ASP G  3 106 ? 41.793 109.263 4.871   1.00 36.30  ? 106 ASP E O     1 
ATOM   9550  C  CB    . ASP G  3 106 ? 41.219 106.042 5.138   1.00 38.43  ? 106 ASP E CB    1 
ATOM   9551  C  CG    . ASP G  3 106 ? 41.198 104.883 6.112   1.00 49.68  ? 106 ASP E CG    1 
ATOM   9552  O  OD1   . ASP G  3 106 ? 40.527 105.001 7.159   1.00 53.27  ? 106 ASP E OD1   1 
ATOM   9553  O  OD2   . ASP G  3 106 ? 41.848 103.854 5.827   1.00 53.35  ? 106 ASP E OD2   1 
ATOM   9554  N  N     . THR G  3 107 ? 39.885 108.645 3.843   1.00 39.93  ? 107 THR E N     1 
ATOM   9555  C  CA    . THR G  3 107 ? 39.927 109.751 2.894   1.00 32.60  ? 107 THR E CA    1 
ATOM   9556  C  C     . THR G  3 107 ? 39.763 111.086 3.605   1.00 33.99  ? 107 THR E C     1 
ATOM   9557  O  O     . THR G  3 107 ? 40.493 112.044 3.326   1.00 32.81  ? 107 THR E O     1 
ATOM   9558  C  CB    . THR G  3 107 ? 38.836 109.568 1.835   1.00 34.31  ? 107 THR E CB    1 
ATOM   9559  O  OG1   . THR G  3 107 ? 39.155 108.448 0.999   1.00 45.05  ? 107 THR E OG1   1 
ATOM   9560  C  CG2   . THR G  3 107 ? 38.700 110.817 0.979   1.00 35.63  ? 107 THR E CG2   1 
ATOM   9561  N  N     . ASN G  3 108 ? 38.797 111.170 4.524   1.00 38.87  ? 108 ASN E N     1 
ATOM   9562  C  CA    . ASN G  3 108 ? 38.622 112.393 5.301   1.00 34.19  ? 108 ASN E CA    1 
ATOM   9563  C  C     . ASN G  3 108 ? 39.898 112.744 6.056   1.00 38.10  ? 108 ASN E C     1 
ATOM   9564  O  O     . ASN G  3 108 ? 40.278 113.920 6.140   1.00 41.10  ? 108 ASN E O     1 
ATOM   9565  C  CB    . ASN G  3 108 ? 37.449 112.234 6.268   1.00 35.94  ? 108 ASN E CB    1 
ATOM   9566  C  CG    . ASN G  3 108 ? 36.906 113.562 6.752   1.00 40.52  ? 108 ASN E CG    1 
ATOM   9567  O  OD1   . ASN G  3 108 ? 37.086 114.592 6.102   1.00 46.83  ? 108 ASN E OD1   1 
ATOM   9568  N  ND2   . ASN G  3 108 ? 36.229 113.545 7.894   1.00 42.50  ? 108 ASN E ND2   1 
ATOM   9569  N  N     . LEU G  3 109 ? 40.585 111.732 6.596   1.00 32.81  ? 109 LEU E N     1 
ATOM   9570  C  CA    . LEU G  3 109 ? 41.885 111.981 7.212   1.00 35.88  ? 109 LEU E CA    1 
ATOM   9571  C  C     . LEU G  3 109 ? 42.889 112.506 6.193   1.00 43.91  ? 109 LEU E C     1 
ATOM   9572  O  O     . LEU G  3 109 ? 43.724 113.359 6.519   1.00 54.13  ? 109 LEU E O     1 
ATOM   9573  C  CB    . LEU G  3 109 ? 42.411 110.709 7.876   1.00 32.02  ? 109 LEU E CB    1 
ATOM   9574  C  CG    . LEU G  3 109 ? 41.674 110.254 9.136   1.00 34.34  ? 109 LEU E CG    1 
ATOM   9575  C  CD1   . LEU G  3 109 ? 42.436 109.129 9.818   1.00 29.66  ? 109 LEU E CD1   1 
ATOM   9576  C  CD2   . LEU G  3 109 ? 41.472 111.415 10.088  1.00 21.55  ? 109 LEU E CD2   1 
ATOM   9577  N  N     . ALA G  3 110 ? 42.826 112.012 4.953   1.00 44.99  ? 110 ALA E N     1 
ATOM   9578  C  CA    . ALA G  3 110 ? 43.734 112.509 3.922   1.00 45.88  ? 110 ALA E CA    1 
ATOM   9579  C  C     . ALA G  3 110 ? 43.465 113.975 3.603   1.00 41.27  ? 110 ALA E C     1 
ATOM   9580  O  O     . ALA G  3 110 ? 44.403 114.764 3.439   1.00 35.77  ? 110 ALA E O     1 
ATOM   9581  C  CB    . ALA G  3 110 ? 43.621 111.655 2.660   1.00 46.30  ? 110 ALA E CB    1 
ATOM   9582  N  N     . ALA G  3 111 ? 42.189 114.359 3.511   1.00 35.01  ? 111 ALA E N     1 
ATOM   9583  C  CA    . ALA G  3 111 ? 41.846 115.753 3.253   1.00 38.14  ? 111 ALA E CA    1 
ATOM   9584  C  C     . ALA G  3 111 ? 42.304 116.649 4.396   1.00 50.16  ? 111 ALA E C     1 
ATOM   9585  O  O     . ALA G  3 111 ? 42.906 117.705 4.169   1.00 58.47  ? 111 ALA E O     1 
ATOM   9586  C  CB    . ALA G  3 111 ? 40.340 115.891 3.031   1.00 35.88  ? 111 ALA E CB    1 
ATOM   9587  N  N     . ILE G  3 112 ? 42.025 116.240 5.637   1.00 52.68  ? 112 ILE E N     1 
ATOM   9588  C  CA    . ILE G  3 112 ? 42.426 117.044 6.790   1.00 51.23  ? 112 ILE E CA    1 
ATOM   9589  C  C     . ILE G  3 112 ? 43.942 117.154 6.873   1.00 53.56  ? 112 ILE E C     1 
ATOM   9590  O  O     . ILE G  3 112 ? 44.476 118.189 7.292   1.00 65.17  ? 112 ILE E O     1 
ATOM   9591  C  CB    . ILE G  3 112 ? 41.822 116.456 8.080   1.00 46.14  ? 112 ILE E CB    1 
ATOM   9592  C  CG1   . ILE G  3 112 ? 40.295 116.480 8.001   1.00 39.00  ? 112 ILE E CG1   1 
ATOM   9593  C  CG2   . ILE G  3 112 ? 42.295 117.226 9.301   1.00 39.62  ? 112 ILE E CG2   1 
ATOM   9594  C  CD1   . ILE G  3 112 ? 39.615 115.661 9.069   1.00 34.31  ? 112 ILE E CD1   1 
ATOM   9595  N  N     . HIS G  3 113 ? 44.662 116.107 6.460   1.00 48.69  ? 113 HIS E N     1 
ATOM   9596  C  CA    . HIS G  3 113 ? 46.120 116.162 6.479   1.00 48.21  ? 113 HIS E CA    1 
ATOM   9597  C  C     . HIS G  3 113 ? 46.655 117.243 5.550   1.00 56.93  ? 113 HIS E C     1 
ATOM   9598  O  O     . HIS G  3 113 ? 47.725 117.807 5.805   1.00 59.30  ? 113 HIS E O     1 
ATOM   9599  C  CB    . HIS G  3 113 ? 46.703 114.803 6.098   1.00 46.88  ? 113 HIS E CB    1 
ATOM   9600  C  CG    . HIS G  3 113 ? 48.197 114.754 6.156   1.00 52.91  ? 113 HIS E CG    1 
ATOM   9601  N  ND1   . HIS G  3 113 ? 48.989 114.919 5.041   1.00 58.69  ? 113 HIS E ND1   1 
ATOM   9602  C  CD2   . HIS G  3 113 ? 49.045 114.561 7.195   1.00 58.02  ? 113 HIS E CD2   1 
ATOM   9603  C  CE1   . HIS G  3 113 ? 50.260 114.829 5.389   1.00 60.90  ? 113 HIS E CE1   1 
ATOM   9604  N  NE2   . HIS G  3 113 ? 50.321 114.612 6.690   1.00 56.86  ? 113 HIS E NE2   1 
ATOM   9605  N  N     . ALA G  3 114 ? 45.932 117.542 4.471   1.00 63.65  ? 114 ALA E N     1 
ATOM   9606  C  CA    . ALA G  3 114 ? 46.291 118.616 3.557   1.00 53.62  ? 114 ALA E CA    1 
ATOM   9607  C  C     . ALA G  3 114 ? 45.679 119.953 3.959   1.00 56.90  ? 114 ALA E C     1 
ATOM   9608  O  O     . ALA G  3 114 ? 45.599 120.862 3.123   1.00 55.96  ? 114 ALA E O     1 
ATOM   9609  C  CB    . ALA G  3 114 ? 45.875 118.255 2.130   1.00 48.30  ? 114 ALA E CB    1 
ATOM   9610  N  N     . LYS G  3 115 ? 45.244 120.085 5.214   1.00 53.54  ? 115 LYS E N     1 
ATOM   9611  C  CA    . LYS G  3 115 ? 44.634 121.315 5.721   1.00 51.53  ? 115 LYS E CA    1 
ATOM   9612  C  C     . LYS G  3 115 ? 43.389 121.686 4.918   1.00 48.37  ? 115 LYS E C     1 
ATOM   9613  O  O     . LYS G  3 115 ? 43.167 122.851 4.581   1.00 49.71  ? 115 LYS E O     1 
ATOM   9614  C  CB    . LYS G  3 115 ? 45.644 122.465 5.737   1.00 57.43  ? 115 LYS E CB    1 
ATOM   9615  C  CG    . LYS G  3 115 ? 46.801 122.249 6.697   1.00 58.51  ? 115 LYS E CG    1 
ATOM   9616  C  CD    . LYS G  3 115 ? 47.887 123.295 6.504   1.00 65.24  ? 115 LYS E CD    1 
ATOM   9617  C  CE    . LYS G  3 115 ? 48.690 123.494 7.781   1.00 72.69  ? 115 LYS E CE    1 
ATOM   9618  N  NZ    . LYS G  3 115 ? 49.167 122.205 8.360   1.00 72.57  ? 115 LYS E NZ    1 
ATOM   9619  N  N     . ARG G  3 116 ? 42.566 120.684 4.615   1.00 51.60  ? 116 ARG E N     1 
ATOM   9620  C  CA    . ARG G  3 116 ? 41.341 120.875 3.855   1.00 49.22  ? 116 ARG E CA    1 
ATOM   9621  C  C     . ARG G  3 116 ? 40.168 120.238 4.586   1.00 49.70  ? 116 ARG E C     1 
ATOM   9622  O  O     . ARG G  3 116 ? 40.308 119.203 5.243   1.00 55.74  ? 116 ARG E O     1 
ATOM   9623  C  CB    . ARG G  3 116 ? 41.450 120.274 2.443   1.00 50.55  ? 116 ARG E CB    1 
ATOM   9624  C  CG    . ARG G  3 116 ? 42.339 121.059 1.493   1.00 52.04  ? 116 ARG E CG    1 
ATOM   9625  C  CD    . ARG G  3 116 ? 42.307 120.481 0.082   1.00 47.90  ? 116 ARG E CD    1 
ATOM   9626  N  NE    . ARG G  3 116 ? 43.110 119.267 -0.048  1.00 42.90  ? 116 ARG E NE    1 
ATOM   9627  C  CZ    . ARG G  3 116 ? 42.612 118.035 -0.062  1.00 38.94  ? 116 ARG E CZ    1 
ATOM   9628  N  NH1   . ARG G  3 116 ? 41.305 117.841 0.043   1.00 39.74  ? 116 ARG E NH1   1 
ATOM   9629  N  NH2   . ARG G  3 116 ? 43.423 116.993 -0.185  1.00 34.12  ? 116 ARG E NH2   1 
ATOM   9630  N  N     . VAL G  3 117 ? 39.004 120.880 4.468   1.00 45.87  ? 117 VAL E N     1 
ATOM   9631  C  CA    . VAL G  3 117 ? 37.758 120.308 4.967   1.00 41.94  ? 117 VAL E CA    1 
ATOM   9632  C  C     . VAL G  3 117 ? 37.059 119.476 3.896   1.00 47.03  ? 117 VAL E C     1 
ATOM   9633  O  O     . VAL G  3 117 ? 36.198 118.647 4.225   1.00 53.81  ? 117 VAL E O     1 
ATOM   9634  C  CB    . VAL G  3 117 ? 36.835 121.432 5.481   1.00 48.23  ? 117 VAL E CB    1 
ATOM   9635  C  CG1   . VAL G  3 117 ? 35.600 120.871 6.175   1.00 55.90  ? 117 VAL E CG1   1 
ATOM   9636  C  CG2   . VAL G  3 117 ? 37.600 122.354 6.422   1.00 56.17  ? 117 VAL E CG2   1 
ATOM   9637  N  N     . THR G  3 118 ? 37.433 119.645 2.630   1.00 50.21  ? 118 THR E N     1 
ATOM   9638  C  CA    . THR G  3 118 ? 36.740 119.040 1.502   1.00 52.38  ? 118 THR E CA    1 
ATOM   9639  C  C     . THR G  3 118 ? 37.512 117.819 1.016   1.00 49.40  ? 118 THR E C     1 
ATOM   9640  O  O     . THR G  3 118 ? 38.683 117.932 0.639   1.00 54.50  ? 118 THR E O     1 
ATOM   9641  C  CB    . THR G  3 118 ? 36.588 120.054 0.368   1.00 53.86  ? 118 THR E CB    1 
ATOM   9642  O  OG1   . THR G  3 118 ? 36.068 121.281 0.893   1.00 54.01  ? 118 THR E OG1   1 
ATOM   9643  C  CG2   . THR G  3 118 ? 35.650 119.523 -0.701  1.00 53.57  ? 118 THR E CG2   1 
ATOM   9644  N  N     . ILE G  3 119 ? 36.857 116.655 1.018   1.00 44.71  ? 119 ILE E N     1 
ATOM   9645  C  CA    . ILE G  3 119 ? 37.481 115.466 0.452   1.00 48.91  ? 119 ILE E CA    1 
ATOM   9646  C  C     . ILE G  3 119 ? 37.507 115.586 -1.065  1.00 49.72  ? 119 ILE E C     1 
ATOM   9647  O  O     . ILE G  3 119 ? 36.590 116.143 -1.685  1.00 49.02  ? 119 ILE E O     1 
ATOM   9648  C  CB    . ILE G  3 119 ? 36.759 114.183 0.904   1.00 36.84  ? 119 ILE E CB    1 
ATOM   9649  C  CG1   . ILE G  3 119 ? 35.335 114.123 0.347   1.00 28.91  ? 119 ILE E CG1   1 
ATOM   9650  C  CG2   . ILE G  3 119 ? 36.760 114.080 2.424   1.00 42.32  ? 119 ILE E CG2   1 
ATOM   9651  C  CD1   . ILE G  3 119 ? 34.721 112.740 0.398   1.00 25.68  ? 119 ILE E CD1   1 
ATOM   9652  N  N     . MET G  3 120 ? 38.572 115.081 -1.670  1.00 41.13  ? 120 MET E N     1 
ATOM   9653  C  CA    . MET G  3 120 ? 38.816 115.227 -3.094  1.00 36.87  ? 120 MET E CA    1 
ATOM   9654  C  C     . MET G  3 120 ? 39.350 113.910 -3.633  1.00 40.23  ? 120 MET E C     1 
ATOM   9655  O  O     . MET G  3 120 ? 39.833 113.071 -2.864  1.00 46.04  ? 120 MET E O     1 
ATOM   9656  C  CB    . MET G  3 120 ? 39.807 116.368 -3.369  1.00 33.79  ? 120 MET E CB    1 
ATOM   9657  C  CG    . MET G  3 120 ? 39.346 117.719 -2.832  1.00 40.54  ? 120 MET E CG    1 
ATOM   9658  S  SD    . MET G  3 120 ? 40.451 119.078 -3.240  1.00 54.39  ? 120 MET E SD    1 
ATOM   9659  C  CE    . MET G  3 120 ? 40.283 119.117 -5.022  1.00 62.56  ? 120 MET E CE    1 
ATOM   9660  N  N     . PRO G  3 121 ? 39.251 113.684 -4.950  1.00 48.58  ? 121 PRO E N     1 
ATOM   9661  C  CA    . PRO G  3 121 ? 39.763 112.421 -5.517  1.00 43.06  ? 121 PRO E CA    1 
ATOM   9662  C  C     . PRO G  3 121 ? 41.205 112.112 -5.144  1.00 48.86  ? 121 PRO E C     1 
ATOM   9663  O  O     . PRO G  3 121 ? 41.551 110.938 -4.951  1.00 52.35  ? 121 PRO E O     1 
ATOM   9664  C  CB    . PRO G  3 121 ? 39.599 112.637 -7.026  1.00 31.11  ? 121 PRO E CB    1 
ATOM   9665  C  CG    . PRO G  3 121 ? 38.435 113.554 -7.137  1.00 36.13  ? 121 PRO E CG    1 
ATOM   9666  C  CD    . PRO G  3 121 ? 38.526 114.484 -5.955  1.00 41.93  ? 121 PRO E CD    1 
ATOM   9667  N  N     . LYS G  3 122 ? 42.058 113.134 -5.030  1.00 44.61  ? 122 LYS E N     1 
ATOM   9668  C  CA    . LYS G  3 122 ? 43.439 112.892 -4.626  1.00 46.59  ? 122 LYS E CA    1 
ATOM   9669  C  C     . LYS G  3 122 ? 43.515 112.315 -3.218  1.00 43.75  ? 122 LYS E C     1 
ATOM   9670  O  O     . LYS G  3 122 ? 44.442 111.556 -2.909  1.00 46.06  ? 122 LYS E O     1 
ATOM   9671  C  CB    . LYS G  3 122 ? 44.255 114.183 -4.722  1.00 56.91  ? 122 LYS E CB    1 
ATOM   9672  C  CG    . LYS G  3 122 ? 43.750 115.322 -3.845  1.00 68.35  ? 122 LYS E CG    1 
ATOM   9673  C  CD    . LYS G  3 122 ? 44.710 116.506 -3.866  1.00 70.46  ? 122 LYS E CD    1 
ATOM   9674  C  CE    . LYS G  3 122 ? 44.677 117.236 -5.199  1.00 70.89  ? 122 LYS E CE    1 
ATOM   9675  N  NZ    . LYS G  3 122 ? 43.401 117.978 -5.393  1.00 70.00  ? 122 LYS E NZ    1 
ATOM   9676  N  N     . ASP G  3 123 ? 42.552 112.653 -2.356  1.00 42.70  ? 123 ASP E N     1 
ATOM   9677  C  CA    . ASP G  3 123 ? 42.507 112.061 -1.023  1.00 40.44  ? 123 ASP E CA    1 
ATOM   9678  C  C     . ASP G  3 123 ? 42.203 110.569 -1.099  1.00 49.90  ? 123 ASP E C     1 
ATOM   9679  O  O     . ASP G  3 123 ? 42.889 109.752 -0.471  1.00 52.08  ? 123 ASP E O     1 
ATOM   9680  C  CB    . ASP G  3 123 ? 41.464 112.776 -0.162  1.00 30.67  ? 123 ASP E CB    1 
ATOM   9681  C  CG    . ASP G  3 123 ? 41.751 114.257 0.002   1.00 37.20  ? 123 ASP E CG    1 
ATOM   9682  O  OD1   . ASP G  3 123 ? 42.929 114.619 0.209   1.00 38.03  ? 123 ASP E OD1   1 
ATOM   9683  O  OD2   . ASP G  3 123 ? 40.797 115.061 -0.072  1.00 32.62  ? 123 ASP E OD2   1 
ATOM   9684  N  N     . ILE G  3 124 ? 41.173 110.199 -1.868  1.00 43.65  ? 124 ILE E N     1 
ATOM   9685  C  CA    . ILE G  3 124 ? 40.829 108.789 -2.032  1.00 26.86  ? 124 ILE E CA    1 
ATOM   9686  C  C     . ILE G  3 124 ? 42.007 108.019 -2.607  1.00 39.70  ? 124 ILE E C     1 
ATOM   9687  O  O     . ILE G  3 124 ? 42.332 106.915 -2.151  1.00 46.80  ? 124 ILE E O     1 
ATOM   9688  C  CB    . ILE G  3 124 ? 39.578 108.639 -2.918  1.00 27.74  ? 124 ILE E CB    1 
ATOM   9689  C  CG1   . ILE G  3 124 ? 38.388 109.381 -2.310  1.00 31.76  ? 124 ILE E CG1   1 
ATOM   9690  C  CG2   . ILE G  3 124 ? 39.243 107.171 -3.121  1.00 28.38  ? 124 ILE E CG2   1 
ATOM   9691  C  CD1   . ILE G  3 124 ? 37.066 109.069 -2.990  1.00 34.31  ? 124 ILE E CD1   1 
ATOM   9692  N  N     . GLN G  3 125 ? 42.676 108.596 -3.608  1.00 40.25  ? 125 GLN E N     1 
ATOM   9693  C  CA    . GLN G  3 125 ? 43.791 107.904 -4.245  1.00 46.72  ? 125 GLN E CA    1 
ATOM   9694  C  C     . GLN G  3 125 ? 44.974 107.763 -3.295  1.00 44.04  ? 125 GLN E C     1 
ATOM   9695  O  O     . GLN G  3 125 ? 45.646 106.723 -3.283  1.00 47.17  ? 125 GLN E O     1 
ATOM   9696  C  CB    . GLN G  3 125 ? 44.191 108.640 -5.523  1.00 53.57  ? 125 GLN E CB    1 
ATOM   9697  C  CG    . GLN G  3 125 ? 43.118 108.578 -6.603  1.00 56.71  ? 125 GLN E CG    1 
ATOM   9698  C  CD    . GLN G  3 125 ? 43.191 109.737 -7.576  1.00 62.45  ? 125 GLN E CD    1 
ATOM   9699  O  OE1   . GLN G  3 125 ? 44.122 110.541 -7.536  1.00 63.73  ? 125 GLN E OE1   1 
ATOM   9700  N  NE2   . GLN G  3 125 ? 42.200 109.833 -8.454  1.00 67.74  ? 125 GLN E NE2   1 
ATOM   9701  N  N     . LEU G  3 126 ? 45.240 108.788 -2.481  1.00 47.06  ? 126 LEU E N     1 
ATOM   9702  C  CA    . LEU G  3 126 ? 46.289 108.664 -1.475  1.00 38.80  ? 126 LEU E CA    1 
ATOM   9703  C  C     . LEU G  3 126 ? 45.963 107.553 -0.487  1.00 39.06  ? 126 LEU E C     1 
ATOM   9704  O  O     . LEU G  3 126 ? 46.814 106.712 -0.182  1.00 41.36  ? 126 LEU E O     1 
ATOM   9705  C  CB    . LEU G  3 126 ? 46.492 109.985 -0.735  1.00 29.45  ? 126 LEU E CB    1 
ATOM   9706  C  CG    . LEU G  3 126 ? 47.518 109.846 0.396   1.00 35.23  ? 126 LEU E CG    1 
ATOM   9707  C  CD1   . LEU G  3 126 ? 48.912 109.600 -0.167  1.00 30.62  ? 126 LEU E CD1   1 
ATOM   9708  C  CD2   . LEU G  3 126 ? 47.507 111.047 1.332   1.00 41.33  ? 126 LEU E CD2   1 
ATOM   9709  N  N     . ALA G  3 127 ? 44.727 107.530 0.019   1.00 41.75  ? 127 ALA E N     1 
ATOM   9710  C  CA    . ALA G  3 127 ? 44.330 106.500 0.976   1.00 37.23  ? 127 ALA E CA    1 
ATOM   9711  C  C     . ALA G  3 127 ? 44.500 105.104 0.383   1.00 49.69  ? 127 ALA E C     1 
ATOM   9712  O  O     . ALA G  3 127 ? 45.237 104.268 0.923   1.00 51.47  ? 127 ALA E O     1 
ATOM   9713  C  CB    . ALA G  3 127 ? 42.885 106.731 1.419   1.00 25.54  ? 127 ALA E CB    1 
ATOM   9714  N  N     . ARG G  3 128 ? 43.829 104.842 -0.745  1.00 48.38  ? 128 ARG E N     1 
ATOM   9715  C  CA    . ARG G  3 128 ? 43.911 103.526 -1.370  1.00 40.57  ? 128 ARG E CA    1 
ATOM   9716  C  C     . ARG G  3 128 ? 45.343 103.155 -1.724  1.00 37.84  ? 128 ARG E C     1 
ATOM   9717  O  O     . ARG G  3 128 ? 45.692 101.969 -1.737  1.00 38.04  ? 128 ARG E O     1 
ATOM   9718  C  CB    . ARG G  3 128 ? 43.028 103.478 -2.618  1.00 39.81  ? 128 ARG E CB    1 
ATOM   9719  C  CG    . ARG G  3 128 ? 41.551 103.677 -2.329  1.00 42.58  ? 128 ARG E CG    1 
ATOM   9720  C  CD    . ARG G  3 128 ? 40.690 103.464 -3.564  1.00 46.76  ? 128 ARG E CD    1 
ATOM   9721  N  NE    . ARG G  3 128 ? 40.802 102.108 -4.092  1.00 52.23  ? 128 ARG E NE    1 
ATOM   9722  C  CZ    . ARG G  3 128 ? 41.295 101.810 -5.290  1.00 57.95  ? 128 ARG E CZ    1 
ATOM   9723  N  NH1   . ARG G  3 128 ? 41.713 102.775 -6.098  1.00 50.27  ? 128 ARG E NH1   1 
ATOM   9724  N  NH2   . ARG G  3 128 ? 41.359 100.546 -5.685  1.00 63.06  ? 128 ARG E NH2   1 
ATOM   9725  N  N     . ARG G  3 129 ? 46.188 104.148 -2.008  1.00 39.69  ? 129 ARG E N     1 
ATOM   9726  C  CA    . ARG G  3 129 ? 47.584 103.848 -2.306  1.00 43.67  ? 129 ARG E CA    1 
ATOM   9727  C  C     . ARG G  3 129 ? 48.346 103.469 -1.042  1.00 50.35  ? 129 ARG E C     1 
ATOM   9728  O  O     . ARG G  3 129 ? 49.214 102.590 -1.074  1.00 47.35  ? 129 ARG E O     1 
ATOM   9729  C  CB    . ARG G  3 129 ? 48.237 105.044 -3.000  1.00 47.48  ? 129 ARG E CB    1 
ATOM   9730  C  CG    . ARG G  3 129 ? 49.359 104.676 -3.953  1.00 66.03  ? 129 ARG E CG    1 
ATOM   9731  C  CD    . ARG G  3 129 ? 50.701 105.140 -3.427  1.00 76.73  ? 129 ARG E CD    1 
ATOM   9732  N  NE    . ARG G  3 129 ? 51.101 104.428 -2.216  1.00 78.63  ? 129 ARG E NE    1 
ATOM   9733  C  CZ    . ARG G  3 129 ? 51.989 103.439 -2.190  1.00 86.78  ? 129 ARG E CZ    1 
ATOM   9734  N  NH1   . ARG G  3 129 ? 52.574 103.042 -3.312  1.00 89.77  ? 129 ARG E NH1   1 
ATOM   9735  N  NH2   . ARG G  3 129 ? 52.294 102.848 -1.042  1.00 88.88  ? 129 ARG E NH2   1 
ATOM   9736  N  N     . ILE G  3 130 ? 48.024 104.109 0.085   1.00 47.79  ? 130 ILE E N     1 
ATOM   9737  C  CA    . ILE G  3 130 ? 48.717 103.806 1.332   1.00 43.08  ? 130 ILE E CA    1 
ATOM   9738  C  C     . ILE G  3 130 ? 48.320 102.428 1.846   1.00 40.74  ? 130 ILE E C     1 
ATOM   9739  O  O     . ILE G  3 130 ? 49.167 101.663 2.325   1.00 41.00  ? 130 ILE E O     1 
ATOM   9740  C  CB    . ILE G  3 130 ? 48.451 104.902 2.381   1.00 53.58  ? 130 ILE E CB    1 
ATOM   9741  C  CG1   . ILE G  3 130 ? 49.000 106.250 1.906   1.00 53.10  ? 130 ILE E CG1   1 
ATOM   9742  C  CG2   . ILE G  3 130 ? 49.064 104.521 3.718   1.00 51.53  ? 130 ILE E CG2   1 
ATOM   9743  C  CD1   . ILE G  3 130 ? 50.427 106.199 1.423   1.00 51.02  ? 130 ILE E CD1   1 
ATOM   9744  N  N     . ARG G  3 131 ? 47.033 102.081 1.751   1.00 45.41  ? 131 ARG E N     1 
ATOM   9745  C  CA    . ARG G  3 131 ? 46.592 100.775 2.233   1.00 41.66  ? 131 ARG E CA    1 
ATOM   9746  C  C     . ARG G  3 131 ? 46.797 99.663  1.211   1.00 43.78  ? 131 ARG E C     1 
ATOM   9747  O  O     . ARG G  3 131 ? 46.139 98.620  1.309   1.00 45.11  ? 131 ARG E O     1 
ATOM   9748  C  CB    . ARG G  3 131 ? 45.125 100.836 2.674   1.00 41.91  ? 131 ARG E CB    1 
ATOM   9749  C  CG    . ARG G  3 131 ? 44.183 101.468 1.677   1.00 50.63  ? 131 ARG E CG    1 
ATOM   9750  C  CD    . ARG G  3 131 ? 43.029 102.166 2.389   1.00 44.84  ? 131 ARG E CD    1 
ATOM   9751  N  NE    . ARG G  3 131 ? 41.828 101.338 2.461   1.00 38.39  ? 131 ARG E NE    1 
ATOM   9752  C  CZ    . ARG G  3 131 ? 40.746 101.653 3.166   1.00 42.75  ? 131 ARG E CZ    1 
ATOM   9753  N  NH1   . ARG G  3 131 ? 40.719 102.772 3.875   1.00 38.28  ? 131 ARG E NH1   1 
ATOM   9754  N  NH2   . ARG G  3 131 ? 39.695 100.846 3.174   1.00 48.66  ? 131 ARG E NH2   1 
ATOM   9755  N  N     . GLY G  3 132 ? 47.692 99.857  0.243   1.00 54.28  ? 132 GLY E N     1 
ATOM   9756  C  CA    . GLY G  3 132 ? 48.052 98.802  -0.686  1.00 57.07  ? 132 GLY E CA    1 
ATOM   9757  C  C     . GLY G  3 132 ? 46.918 98.257  -1.522  1.00 52.95  ? 132 GLY E C     1 
ATOM   9758  O  O     . GLY G  3 132 ? 47.003 97.122  -2.000  1.00 55.64  ? 132 GLY E O     1 
ATOM   9759  N  N     . GLU G  3 133 ? 45.849 99.030  -1.711  1.00 49.71  ? 133 GLU E N     1 
ATOM   9760  C  CA    . GLU G  3 133 ? 44.755 98.617  -2.578  1.00 57.65  ? 133 GLU E CA    1 
ATOM   9761  C  C     . GLU G  3 133 ? 45.018 98.898  -4.051  1.00 74.40  ? 133 GLU E C     1 
ATOM   9762  O  O     . GLU G  3 133 ? 44.499 98.175  -4.908  1.00 82.51  ? 133 GLU E O     1 
ATOM   9763  C  CB    . GLU G  3 133 ? 43.455 99.308  -2.162  1.00 57.93  ? 133 GLU E CB    1 
ATOM   9764  C  CG    . GLU G  3 133 ? 42.725 98.591  -1.054  1.00 56.46  ? 133 GLU E CG    1 
ATOM   9765  C  CD    . GLU G  3 133 ? 41.478 99.320  -0.619  1.00 65.06  ? 133 GLU E CD    1 
ATOM   9766  O  OE1   . GLU G  3 133 ? 41.423 99.753  0.551   1.00 69.73  ? 133 GLU E OE1   1 
ATOM   9767  O  OE2   . GLU G  3 133 ? 40.558 99.465  -1.450  1.00 72.91  ? 133 GLU E OE2   1 
ATOM   9768  N  N     . ARG G  3 134 ? 45.801 99.927  -4.371  1.00 65.51  ? 134 ARG E N     1 
ATOM   9769  C  CA    . ARG G  3 134 ? 46.096 100.284 -5.753  1.00 77.86  ? 134 ARG E CA    1 
ATOM   9770  C  C     . ARG G  3 134 ? 47.563 100.032 -6.087  1.00 89.27  ? 134 ARG E C     1 
ATOM   9771  O  O     . ARG G  3 134 ? 47.875 99.350  -7.064  1.00 103.22 ? 134 ARG E O     1 
ATOM   9772  C  CB    . ARG G  3 134 ? 45.741 101.749 -6.016  1.00 84.58  ? 134 ARG E CB    1 
ATOM   9773  C  CG    . ARG G  3 134 ? 46.499 102.372 -7.178  1.00 101.55 ? 134 ARG E CG    1 
ATOM   9774  C  CD    . ARG G  3 134 ? 47.050 103.740 -6.807  1.00 105.88 ? 134 ARG E CD    1 
ATOM   9775  N  NE    . ARG G  3 134 ? 48.253 104.069 -7.566  1.00 111.93 ? 134 ARG E NE    1 
ATOM   9776  C  CZ    . ARG G  3 134 ? 48.883 105.237 -7.498  1.00 113.24 ? 134 ARG E CZ    1 
ATOM   9777  N  NH1   . ARG G  3 134 ? 48.425 106.194 -6.703  1.00 108.55 ? 134 ARG E NH1   1 
ATOM   9778  N  NH2   . ARG G  3 134 ? 49.972 105.449 -8.225  1.00 120.55 ? 134 ARG E NH2   1 
ATOM   9779  N  N     . ALA G  3 135 ? 48.451 100.589 -5.267  1.00 89.83  ? 135 ALA E N     1 
ATOM   9780  C  CA    . ALA G  3 135 ? 49.894 100.445 -5.447  1.00 93.12  ? 135 ALA E CA    1 
ATOM   9781  C  C     . ALA G  3 135 ? 50.335 100.751 -6.876  1.00 89.72  ? 135 ALA E C     1 
ATOM   9782  O  O     . ALA G  3 135 ? 50.984 101.766 -7.131  1.00 85.55  ? 135 ALA E O     1 
ATOM   9783  C  CB    . ALA G  3 135 ? 50.351 99.053  -5.030  1.00 95.66  ? 135 ALA E CB    1 
ATOM   9784  N  N     . ARG H  4 20  ? 13.955 88.931  -20.071 1.00 96.14  ? 19  ARG F N     1 
ATOM   9785  C  CA    . ARG H  4 20  ? 15.204 89.532  -19.618 1.00 94.74  ? 19  ARG F CA    1 
ATOM   9786  C  C     . ARG H  4 20  ? 15.584 90.719  -20.503 1.00 82.79  ? 19  ARG F C     1 
ATOM   9787  O  O     . ARG H  4 20  ? 15.556 90.637  -21.732 1.00 95.52  ? 19  ARG F O     1 
ATOM   9788  C  CB    . ARG H  4 20  ? 16.336 88.485  -19.576 1.00 103.57 ? 19  ARG F CB    1 
ATOM   9789  C  CG    . ARG H  4 20  ? 16.980 88.087  -20.913 1.00 111.30 ? 19  ARG F CG    1 
ATOM   9790  C  CD    . ARG H  4 20  ? 15.983 87.491  -21.896 1.00 118.17 ? 19  ARG F CD    1 
ATOM   9791  N  NE    . ARG H  4 20  ? 15.131 86.481  -21.273 1.00 117.98 ? 19  ARG F NE    1 
ATOM   9792  C  CZ    . ARG H  4 20  ? 13.953 86.101  -21.755 1.00 114.36 ? 19  ARG F CZ    1 
ATOM   9793  N  NH1   . ARG H  4 20  ? 13.480 86.652  -22.865 1.00 113.08 ? 19  ARG F NH1   1 
ATOM   9794  N  NH2   . ARG H  4 20  ? 13.243 85.176  -21.125 1.00 114.24 ? 19  ARG F NH2   1 
ATOM   9795  N  N     . LYS H  4 21  ? 15.904 91.838  -19.864 1.00 74.13  ? 20  LYS F N     1 
ATOM   9796  C  CA    . LYS H  4 21  ? 16.346 93.041  -20.548 1.00 62.56  ? 20  LYS F CA    1 
ATOM   9797  C  C     . LYS H  4 21  ? 17.803 93.310  -20.199 1.00 53.95  ? 20  LYS F C     1 
ATOM   9798  O  O     . LYS H  4 21  ? 18.248 93.042  -19.079 1.00 59.57  ? 20  LYS F O     1 
ATOM   9799  C  CB    . LYS H  4 21  ? 15.480 94.247  -20.168 1.00 70.54  ? 20  LYS F CB    1 
ATOM   9800  C  CG    . LYS H  4 21  ? 15.754 95.492  -20.999 1.00 71.26  ? 20  LYS F CG    1 
ATOM   9801  C  CD    . LYS H  4 21  ? 15.968 96.707  -20.115 1.00 77.98  ? 20  LYS F CD    1 
ATOM   9802  C  CE    . LYS H  4 21  ? 16.381 97.917  -20.934 1.00 84.86  ? 20  LYS F CE    1 
ATOM   9803  N  NZ    . LYS H  4 21  ? 17.637 97.668  -21.702 1.00 86.80  ? 20  LYS F NZ    1 
ATOM   9804  N  N     . VAL H  4 22  ? 18.548 93.839  -21.173 1.00 60.72  ? 21  VAL F N     1 
ATOM   9805  C  CA    . VAL H  4 22  ? 19.978 94.034  -20.978 1.00 59.89  ? 21  VAL F CA    1 
ATOM   9806  C  C     . VAL H  4 22  ? 20.210 95.045  -19.863 1.00 56.88  ? 21  VAL F C     1 
ATOM   9807  O  O     . VAL H  4 22  ? 19.505 96.057  -19.749 1.00 53.83  ? 21  VAL F O     1 
ATOM   9808  C  CB    . VAL H  4 22  ? 20.648 94.455  -22.300 1.00 65.64  ? 21  VAL F CB    1 
ATOM   9809  C  CG1   . VAL H  4 22  ? 20.163 93.558  -23.432 1.00 68.78  ? 21  VAL F CG1   1 
ATOM   9810  C  CG2   . VAL H  4 22  ? 20.376 95.912  -22.630 1.00 72.45  ? 21  VAL F CG2   1 
ATOM   9811  N  N     . LEU H  4 23  ? 21.178 94.744  -19.003 1.00 52.57  ? 22  LEU F N     1 
ATOM   9812  C  CA    . LEU H  4 23  ? 21.519 95.584  -17.865 1.00 52.03  ? 22  LEU F CA    1 
ATOM   9813  C  C     . LEU H  4 23  ? 22.691 96.475  -18.250 1.00 52.80  ? 22  LEU F C     1 
ATOM   9814  O  O     . LEU H  4 23  ? 23.753 95.976  -18.636 1.00 54.10  ? 22  LEU F O     1 
ATOM   9815  C  CB    . LEU H  4 23  ? 21.867 94.733  -16.645 1.00 52.37  ? 22  LEU F CB    1 
ATOM   9816  C  CG    . LEU H  4 23  ? 20.761 93.832  -16.094 1.00 51.93  ? 22  LEU F CG    1 
ATOM   9817  C  CD1   . LEU H  4 23  ? 21.347 92.747  -15.214 1.00 52.96  ? 22  LEU F CD1   1 
ATOM   9818  C  CD2   . LEU H  4 23  ? 19.738 94.652  -15.326 1.00 51.24  ? 22  LEU F CD2   1 
ATOM   9819  N  N     . ARG H  4 24  ? 22.502 97.788  -18.140 1.00 52.47  ? 23  ARG F N     1 
ATOM   9820  C  CA    . ARG H  4 24  ? 23.528 98.730  -18.560 1.00 53.43  ? 23  ARG F CA    1 
ATOM   9821  C  C     . ARG H  4 24  ? 23.478 99.978  -17.693 1.00 53.51  ? 23  ARG F C     1 
ATOM   9822  O  O     . ARG H  4 24  ? 22.397 100.453 -17.333 1.00 52.91  ? 23  ARG F O     1 
ATOM   9823  C  CB    . ARG H  4 24  ? 23.366 99.098  -20.040 1.00 53.89  ? 23  ARG F CB    1 
ATOM   9824  C  CG    . ARG H  4 24  ? 21.923 99.209  -20.502 1.00 56.73  ? 23  ARG F CG    1 
ATOM   9825  C  CD    . ARG H  4 24  ? 21.831 99.153  -22.018 1.00 61.53  ? 23  ARG F CD    1 
ATOM   9826  N  NE    . ARG H  4 24  ? 22.453 100.311 -22.650 1.00 70.54  ? 23  ARG F NE    1 
ATOM   9827  C  CZ    . ARG H  4 24  ? 21.779 101.350 -23.131 1.00 55.93  ? 23  ARG F CZ    1 
ATOM   9828  N  NH1   . ARG H  4 24  ? 20.455 101.378 -23.058 1.00 55.55  ? 23  ARG F NH1   1 
ATOM   9829  N  NH2   . ARG H  4 24  ? 22.432 102.361 -23.686 1.00 57.20  ? 23  ARG F NH2   1 
ATOM   9830  N  N     . ASP H  4 25  ? 24.664 100.489 -17.356 1.00 54.80  ? 24  ASP F N     1 
ATOM   9831  C  CA    . ASP H  4 25  ? 24.834 101.760 -16.650 1.00 56.44  ? 24  ASP F CA    1 
ATOM   9832  C  C     . ASP H  4 25  ? 24.173 101.751 -15.274 1.00 58.50  ? 24  ASP F C     1 
ATOM   9833  O  O     . ASP H  4 25  ? 23.664 102.775 -14.812 1.00 56.33  ? 24  ASP F O     1 
ATOM   9834  C  CB    . ASP H  4 25  ? 24.310 102.932 -17.486 1.00 63.53  ? 24  ASP F CB    1 
ATOM   9835  C  CG    . ASP H  4 25  ? 25.137 104.186 -17.307 1.00 74.72  ? 24  ASP F CG    1 
ATOM   9836  O  OD1   . ASP H  4 25  ? 26.353 104.063 -17.051 1.00 79.35  ? 24  ASP F OD1   1 
ATOM   9837