data_5OQN
# 
_entry.id   5OQN 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.291 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5OQN         
WWPDB D_1200005734 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5OQN 
_pdbx_database_status.recvd_initial_deposition_date   2017-08-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Kschonsak, M.' 1 0000-0002-4392-1614 
'Hassler, M.'   2 0000-0001-9827-3477 
'Haering, C.H.' 3 0000-0001-8301-1722 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            171 
_citation.language                  ? 
_citation.page_first                588 
_citation.page_last                 600.e24 
_citation.title                     'Structural Basis for a Safety-Belt Mechanism That Anchors Condensin to Chromosomes.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2017.09.008 
_citation.pdbx_database_id_PubMed   28988770 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kschonsak, M.' 1 
primary 'Merkel, F.'    2 
primary 'Bisht, S.'     3 
primary 'Metz, J.'      4 
primary 'Rybin, V.'     5 
primary 'Hassler, M.'   6 
primary 'Haering, C.H.' 7 
# 
_cell.entry_id           5OQN 
_cell.length_a           89.149 
_cell.length_b           116.220 
_cell.length_c           155.518 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5OQN 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Condensin complex subunit 3'                                          99715.875 1 ? ? ? 'loop deletion: 499-555' 
2 polymer man 'Condensin complex subunit 2'                                          15124.465 1 ? ? ? 
'384-529 loop deletion: 418-444' 
3 polymer syn 
;DNA (5'-D(*GP*AP*TP*GP*TP*GP*TP*AP*GP*CP*TP*AP*CP*AP*CP*AP*TP*C)-3')
;
5515.590  2 ? ? ? ?                                
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'CAPG homolog'                
2 'Barren homolog,CAPH homolog' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MGIDINTKIFNSVAEVFQKAQGSYAGHRKHIAVLKKIQSKAVEQGYEDAFNFWFDKLVTKILPLKKNEIIGDRIVKLVAA
FIASLERELILAKKQNYKLTNDEEGIFSRFVDQFIRHVLRGVESPDKNVRFRVLQLLAVIMDNIGEIDESLFNLLILSLN
KRIYDREPTVRIQAVFCLTKFQDEEQTEHLTELSDNEENFEATRTLVASIQNDPSAEVRRAAMLNLINDNNTRPYILERA
RDVNIVNRRLVYSRILKSMGRKCFDDIEPHIFDQLIEWGLEDRELSVRNACKRLIAHDWLNALDGDLIELLEKLDVSRSS
VCVKAIEALFQSRPDILSKIKFPESIWKDFTVEIAFLFRAIYLYCLDNNITEMLEENFPEASKLSEHLNHYILLRYHHND
ISNDSQSHFDYNTLEFIIEQLSIAAERYDYSDEVGRRSMLTVVRNMLALTTLSEPLIKIGIRVMKSLSINEKDFVTMAIE
IINDIRDDDIEKQESESDIINNLPPEKEASSATIVLCLTRSSYMLELVNTPLTENILIASLMDTLITPAVRNTAPNIREL
GVKNLGLCCLLDVKLAIDNMYILGMCVSKGNASLKYIALQVIVDIFSVHGNTVVDGEGKVDSISLHKIFYKVLKNNGLPE
CQVIAAEGLCKLFLADVFTDDDLFETLVLSYFSPINSSNEALVQAFAFCIPVYCFSHPAHQQRMSRTAADILLRLCVLWD
DLQSSVIPEVDREAMLKPNIIFQQLLFWTDPRNLVNQTGSTKKDTVQLTFLIDVLKIYAQIEKKEIKKMIITNINAIFLS
SEQDYSTLKELLEYSDDIAENDNLDNVSKNALDKLRNNLNSLIEEINERSETQTKDENNTANDQYSSILGN
;
;MGIDINTKIFNSVAEVFQKAQGSYAGHRKHIAVLKKIQSKAVEQGYEDAFNFWFDKLVTKILPLKKNEIIGDRIVKLVAA
FIASLERELILAKKQNYKLTNDEEGIFSRFVDQFIRHVLRGVESPDKNVRFRVLQLLAVIMDNIGEIDESLFNLLILSLN
KRIYDREPTVRIQAVFCLTKFQDEEQTEHLTELSDNEENFEATRTLVASIQNDPSAEVRRAAMLNLINDNNTRPYILERA
RDVNIVNRRLVYSRILKSMGRKCFDDIEPHIFDQLIEWGLEDRELSVRNACKRLIAHDWLNALDGDLIELLEKLDVSRSS
VCVKAIEALFQSRPDILSKIKFPESIWKDFTVEIAFLFRAIYLYCLDNNITEMLEENFPEASKLSEHLNHYILLRYHHND
ISNDSQSHFDYNTLEFIIEQLSIAAERYDYSDEVGRRSMLTVVRNMLALTTLSEPLIKIGIRVMKSLSINEKDFVTMAIE
IINDIRDDDIEKQESESDIINNLPPEKEASSATIVLCLTRSSYMLELVNTPLTENILIASLMDTLITPAVRNTAPNIREL
GVKNLGLCCLLDVKLAIDNMYILGMCVSKGNASLKYIALQVIVDIFSVHGNTVVDGEGKVDSISLHKIFYKVLKNNGLPE
CQVIAAEGLCKLFLADVFTDDDLFETLVLSYFSPINSSNEALVQAFAFCIPVYCFSHPAHQQRMSRTAADILLRLCVLWD
DLQSSVIPEVDREAMLKPNIIFQQLLFWTDPRNLVNQTGSTKKDTVQLTFLIDVLKIYAQIEKKEIKKMIITNINAIFLS
SEQDYSTLKELLEYSDDIAENDNLDNVSKNALDKLRNNLNSLIEEINERSETQTKDENNTANDQYSSILGN
;
A   ? 
2 'polypeptide(L)'        no no 
;GPLGHMSIFEKDLMAYFDENLNRNWRGREHWKVRNFKKANKSMDTKKKHKQKKVLEIDFFKTDDSFEDKVFASKGRTKID
MPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPGQKMSLFSHRKHT
;
;GPLGHMSIFEKDLMAYFDENLNRNWRGREHWKVRNFKKANKSMDTKKKHKQKKVLEIDFFKTDDSFEDKVFASKGRTKID
MPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPGQKMSLFSHRKHT
;
B   ? 
3 polydeoxyribonucleotide no no '(DG)(DA)(DT)(DG)(DT)(DG)(DT)(DA)(DG)(DC)(DT)(DA)(DC)(DA)(DC)(DA)(DT)(DC)' GATGTGTAGCTACACATC C,D 
? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   ILE n 
1 4   ASP n 
1 5   ILE n 
1 6   ASN n 
1 7   THR n 
1 8   LYS n 
1 9   ILE n 
1 10  PHE n 
1 11  ASN n 
1 12  SER n 
1 13  VAL n 
1 14  ALA n 
1 15  GLU n 
1 16  VAL n 
1 17  PHE n 
1 18  GLN n 
1 19  LYS n 
1 20  ALA n 
1 21  GLN n 
1 22  GLY n 
1 23  SER n 
1 24  TYR n 
1 25  ALA n 
1 26  GLY n 
1 27  HIS n 
1 28  ARG n 
1 29  LYS n 
1 30  HIS n 
1 31  ILE n 
1 32  ALA n 
1 33  VAL n 
1 34  LEU n 
1 35  LYS n 
1 36  LYS n 
1 37  ILE n 
1 38  GLN n 
1 39  SER n 
1 40  LYS n 
1 41  ALA n 
1 42  VAL n 
1 43  GLU n 
1 44  GLN n 
1 45  GLY n 
1 46  TYR n 
1 47  GLU n 
1 48  ASP n 
1 49  ALA n 
1 50  PHE n 
1 51  ASN n 
1 52  PHE n 
1 53  TRP n 
1 54  PHE n 
1 55  ASP n 
1 56  LYS n 
1 57  LEU n 
1 58  VAL n 
1 59  THR n 
1 60  LYS n 
1 61  ILE n 
1 62  LEU n 
1 63  PRO n 
1 64  LEU n 
1 65  LYS n 
1 66  LYS n 
1 67  ASN n 
1 68  GLU n 
1 69  ILE n 
1 70  ILE n 
1 71  GLY n 
1 72  ASP n 
1 73  ARG n 
1 74  ILE n 
1 75  VAL n 
1 76  LYS n 
1 77  LEU n 
1 78  VAL n 
1 79  ALA n 
1 80  ALA n 
1 81  PHE n 
1 82  ILE n 
1 83  ALA n 
1 84  SER n 
1 85  LEU n 
1 86  GLU n 
1 87  ARG n 
1 88  GLU n 
1 89  LEU n 
1 90  ILE n 
1 91  LEU n 
1 92  ALA n 
1 93  LYS n 
1 94  LYS n 
1 95  GLN n 
1 96  ASN n 
1 97  TYR n 
1 98  LYS n 
1 99  LEU n 
1 100 THR n 
1 101 ASN n 
1 102 ASP n 
1 103 GLU n 
1 104 GLU n 
1 105 GLY n 
1 106 ILE n 
1 107 PHE n 
1 108 SER n 
1 109 ARG n 
1 110 PHE n 
1 111 VAL n 
1 112 ASP n 
1 113 GLN n 
1 114 PHE n 
1 115 ILE n 
1 116 ARG n 
1 117 HIS n 
1 118 VAL n 
1 119 LEU n 
1 120 ARG n 
1 121 GLY n 
1 122 VAL n 
1 123 GLU n 
1 124 SER n 
1 125 PRO n 
1 126 ASP n 
1 127 LYS n 
1 128 ASN n 
1 129 VAL n 
1 130 ARG n 
1 131 PHE n 
1 132 ARG n 
1 133 VAL n 
1 134 LEU n 
1 135 GLN n 
1 136 LEU n 
1 137 LEU n 
1 138 ALA n 
1 139 VAL n 
1 140 ILE n 
1 141 MET n 
1 142 ASP n 
1 143 ASN n 
1 144 ILE n 
1 145 GLY n 
1 146 GLU n 
1 147 ILE n 
1 148 ASP n 
1 149 GLU n 
1 150 SER n 
1 151 LEU n 
1 152 PHE n 
1 153 ASN n 
1 154 LEU n 
1 155 LEU n 
1 156 ILE n 
1 157 LEU n 
1 158 SER n 
1 159 LEU n 
1 160 ASN n 
1 161 LYS n 
1 162 ARG n 
1 163 ILE n 
1 164 TYR n 
1 165 ASP n 
1 166 ARG n 
1 167 GLU n 
1 168 PRO n 
1 169 THR n 
1 170 VAL n 
1 171 ARG n 
1 172 ILE n 
1 173 GLN n 
1 174 ALA n 
1 175 VAL n 
1 176 PHE n 
1 177 CYS n 
1 178 LEU n 
1 179 THR n 
1 180 LYS n 
1 181 PHE n 
1 182 GLN n 
1 183 ASP n 
1 184 GLU n 
1 185 GLU n 
1 186 GLN n 
1 187 THR n 
1 188 GLU n 
1 189 HIS n 
1 190 LEU n 
1 191 THR n 
1 192 GLU n 
1 193 LEU n 
1 194 SER n 
1 195 ASP n 
1 196 ASN n 
1 197 GLU n 
1 198 GLU n 
1 199 ASN n 
1 200 PHE n 
1 201 GLU n 
1 202 ALA n 
1 203 THR n 
1 204 ARG n 
1 205 THR n 
1 206 LEU n 
1 207 VAL n 
1 208 ALA n 
1 209 SER n 
1 210 ILE n 
1 211 GLN n 
1 212 ASN n 
1 213 ASP n 
1 214 PRO n 
1 215 SER n 
1 216 ALA n 
1 217 GLU n 
1 218 VAL n 
1 219 ARG n 
1 220 ARG n 
1 221 ALA n 
1 222 ALA n 
1 223 MET n 
1 224 LEU n 
1 225 ASN n 
1 226 LEU n 
1 227 ILE n 
1 228 ASN n 
1 229 ASP n 
1 230 ASN n 
1 231 ASN n 
1 232 THR n 
1 233 ARG n 
1 234 PRO n 
1 235 TYR n 
1 236 ILE n 
1 237 LEU n 
1 238 GLU n 
1 239 ARG n 
1 240 ALA n 
1 241 ARG n 
1 242 ASP n 
1 243 VAL n 
1 244 ASN n 
1 245 ILE n 
1 246 VAL n 
1 247 ASN n 
1 248 ARG n 
1 249 ARG n 
1 250 LEU n 
1 251 VAL n 
1 252 TYR n 
1 253 SER n 
1 254 ARG n 
1 255 ILE n 
1 256 LEU n 
1 257 LYS n 
1 258 SER n 
1 259 MET n 
1 260 GLY n 
1 261 ARG n 
1 262 LYS n 
1 263 CYS n 
1 264 PHE n 
1 265 ASP n 
1 266 ASP n 
1 267 ILE n 
1 268 GLU n 
1 269 PRO n 
1 270 HIS n 
1 271 ILE n 
1 272 PHE n 
1 273 ASP n 
1 274 GLN n 
1 275 LEU n 
1 276 ILE n 
1 277 GLU n 
1 278 TRP n 
1 279 GLY n 
1 280 LEU n 
1 281 GLU n 
1 282 ASP n 
1 283 ARG n 
1 284 GLU n 
1 285 LEU n 
1 286 SER n 
1 287 VAL n 
1 288 ARG n 
1 289 ASN n 
1 290 ALA n 
1 291 CYS n 
1 292 LYS n 
1 293 ARG n 
1 294 LEU n 
1 295 ILE n 
1 296 ALA n 
1 297 HIS n 
1 298 ASP n 
1 299 TRP n 
1 300 LEU n 
1 301 ASN n 
1 302 ALA n 
1 303 LEU n 
1 304 ASP n 
1 305 GLY n 
1 306 ASP n 
1 307 LEU n 
1 308 ILE n 
1 309 GLU n 
1 310 LEU n 
1 311 LEU n 
1 312 GLU n 
1 313 LYS n 
1 314 LEU n 
1 315 ASP n 
1 316 VAL n 
1 317 SER n 
1 318 ARG n 
1 319 SER n 
1 320 SER n 
1 321 VAL n 
1 322 CYS n 
1 323 VAL n 
1 324 LYS n 
1 325 ALA n 
1 326 ILE n 
1 327 GLU n 
1 328 ALA n 
1 329 LEU n 
1 330 PHE n 
1 331 GLN n 
1 332 SER n 
1 333 ARG n 
1 334 PRO n 
1 335 ASP n 
1 336 ILE n 
1 337 LEU n 
1 338 SER n 
1 339 LYS n 
1 340 ILE n 
1 341 LYS n 
1 342 PHE n 
1 343 PRO n 
1 344 GLU n 
1 345 SER n 
1 346 ILE n 
1 347 TRP n 
1 348 LYS n 
1 349 ASP n 
1 350 PHE n 
1 351 THR n 
1 352 VAL n 
1 353 GLU n 
1 354 ILE n 
1 355 ALA n 
1 356 PHE n 
1 357 LEU n 
1 358 PHE n 
1 359 ARG n 
1 360 ALA n 
1 361 ILE n 
1 362 TYR n 
1 363 LEU n 
1 364 TYR n 
1 365 CYS n 
1 366 LEU n 
1 367 ASP n 
1 368 ASN n 
1 369 ASN n 
1 370 ILE n 
1 371 THR n 
1 372 GLU n 
1 373 MET n 
1 374 LEU n 
1 375 GLU n 
1 376 GLU n 
1 377 ASN n 
1 378 PHE n 
1 379 PRO n 
1 380 GLU n 
1 381 ALA n 
1 382 SER n 
1 383 LYS n 
1 384 LEU n 
1 385 SER n 
1 386 GLU n 
1 387 HIS n 
1 388 LEU n 
1 389 ASN n 
1 390 HIS n 
1 391 TYR n 
1 392 ILE n 
1 393 LEU n 
1 394 LEU n 
1 395 ARG n 
1 396 TYR n 
1 397 HIS n 
1 398 HIS n 
1 399 ASN n 
1 400 ASP n 
1 401 ILE n 
1 402 SER n 
1 403 ASN n 
1 404 ASP n 
1 405 SER n 
1 406 GLN n 
1 407 SER n 
1 408 HIS n 
1 409 PHE n 
1 410 ASP n 
1 411 TYR n 
1 412 ASN n 
1 413 THR n 
1 414 LEU n 
1 415 GLU n 
1 416 PHE n 
1 417 ILE n 
1 418 ILE n 
1 419 GLU n 
1 420 GLN n 
1 421 LEU n 
1 422 SER n 
1 423 ILE n 
1 424 ALA n 
1 425 ALA n 
1 426 GLU n 
1 427 ARG n 
1 428 TYR n 
1 429 ASP n 
1 430 TYR n 
1 431 SER n 
1 432 ASP n 
1 433 GLU n 
1 434 VAL n 
1 435 GLY n 
1 436 ARG n 
1 437 ARG n 
1 438 SER n 
1 439 MET n 
1 440 LEU n 
1 441 THR n 
1 442 VAL n 
1 443 VAL n 
1 444 ARG n 
1 445 ASN n 
1 446 MET n 
1 447 LEU n 
1 448 ALA n 
1 449 LEU n 
1 450 THR n 
1 451 THR n 
1 452 LEU n 
1 453 SER n 
1 454 GLU n 
1 455 PRO n 
1 456 LEU n 
1 457 ILE n 
1 458 LYS n 
1 459 ILE n 
1 460 GLY n 
1 461 ILE n 
1 462 ARG n 
1 463 VAL n 
1 464 MET n 
1 465 LYS n 
1 466 SER n 
1 467 LEU n 
1 468 SER n 
1 469 ILE n 
1 470 ASN n 
1 471 GLU n 
1 472 LYS n 
1 473 ASP n 
1 474 PHE n 
1 475 VAL n 
1 476 THR n 
1 477 MET n 
1 478 ALA n 
1 479 ILE n 
1 480 GLU n 
1 481 ILE n 
1 482 ILE n 
1 483 ASN n 
1 484 ASP n 
1 485 ILE n 
1 486 ARG n 
1 487 ASP n 
1 488 ASP n 
1 489 ASP n 
1 490 ILE n 
1 491 GLU n 
1 492 LYS n 
1 493 GLN n 
1 494 GLU n 
1 495 SER n 
1 496 GLU n 
1 497 SER n 
1 498 ASP n 
1 499 ILE n 
1 500 ILE n 
1 501 ASN n 
1 502 ASN n 
1 503 LEU n 
1 504 PRO n 
1 505 PRO n 
1 506 GLU n 
1 507 LYS n 
1 508 GLU n 
1 509 ALA n 
1 510 SER n 
1 511 SER n 
1 512 ALA n 
1 513 THR n 
1 514 ILE n 
1 515 VAL n 
1 516 LEU n 
1 517 CYS n 
1 518 LEU n 
1 519 THR n 
1 520 ARG n 
1 521 SER n 
1 522 SER n 
1 523 TYR n 
1 524 MET n 
1 525 LEU n 
1 526 GLU n 
1 527 LEU n 
1 528 VAL n 
1 529 ASN n 
1 530 THR n 
1 531 PRO n 
1 532 LEU n 
1 533 THR n 
1 534 GLU n 
1 535 ASN n 
1 536 ILE n 
1 537 LEU n 
1 538 ILE n 
1 539 ALA n 
1 540 SER n 
1 541 LEU n 
1 542 MET n 
1 543 ASP n 
1 544 THR n 
1 545 LEU n 
1 546 ILE n 
1 547 THR n 
1 548 PRO n 
1 549 ALA n 
1 550 VAL n 
1 551 ARG n 
1 552 ASN n 
1 553 THR n 
1 554 ALA n 
1 555 PRO n 
1 556 ASN n 
1 557 ILE n 
1 558 ARG n 
1 559 GLU n 
1 560 LEU n 
1 561 GLY n 
1 562 VAL n 
1 563 LYS n 
1 564 ASN n 
1 565 LEU n 
1 566 GLY n 
1 567 LEU n 
1 568 CYS n 
1 569 CYS n 
1 570 LEU n 
1 571 LEU n 
1 572 ASP n 
1 573 VAL n 
1 574 LYS n 
1 575 LEU n 
1 576 ALA n 
1 577 ILE n 
1 578 ASP n 
1 579 ASN n 
1 580 MET n 
1 581 TYR n 
1 582 ILE n 
1 583 LEU n 
1 584 GLY n 
1 585 MET n 
1 586 CYS n 
1 587 VAL n 
1 588 SER n 
1 589 LYS n 
1 590 GLY n 
1 591 ASN n 
1 592 ALA n 
1 593 SER n 
1 594 LEU n 
1 595 LYS n 
1 596 TYR n 
1 597 ILE n 
1 598 ALA n 
1 599 LEU n 
1 600 GLN n 
1 601 VAL n 
1 602 ILE n 
1 603 VAL n 
1 604 ASP n 
1 605 ILE n 
1 606 PHE n 
1 607 SER n 
1 608 VAL n 
1 609 HIS n 
1 610 GLY n 
1 611 ASN n 
1 612 THR n 
1 613 VAL n 
1 614 VAL n 
1 615 ASP n 
1 616 GLY n 
1 617 GLU n 
1 618 GLY n 
1 619 LYS n 
1 620 VAL n 
1 621 ASP n 
1 622 SER n 
1 623 ILE n 
1 624 SER n 
1 625 LEU n 
1 626 HIS n 
1 627 LYS n 
1 628 ILE n 
1 629 PHE n 
1 630 TYR n 
1 631 LYS n 
1 632 VAL n 
1 633 LEU n 
1 634 LYS n 
1 635 ASN n 
1 636 ASN n 
1 637 GLY n 
1 638 LEU n 
1 639 PRO n 
1 640 GLU n 
1 641 CYS n 
1 642 GLN n 
1 643 VAL n 
1 644 ILE n 
1 645 ALA n 
1 646 ALA n 
1 647 GLU n 
1 648 GLY n 
1 649 LEU n 
1 650 CYS n 
1 651 LYS n 
1 652 LEU n 
1 653 PHE n 
1 654 LEU n 
1 655 ALA n 
1 656 ASP n 
1 657 VAL n 
1 658 PHE n 
1 659 THR n 
1 660 ASP n 
1 661 ASP n 
1 662 ASP n 
1 663 LEU n 
1 664 PHE n 
1 665 GLU n 
1 666 THR n 
1 667 LEU n 
1 668 VAL n 
1 669 LEU n 
1 670 SER n 
1 671 TYR n 
1 672 PHE n 
1 673 SER n 
1 674 PRO n 
1 675 ILE n 
1 676 ASN n 
1 677 SER n 
1 678 SER n 
1 679 ASN n 
1 680 GLU n 
1 681 ALA n 
1 682 LEU n 
1 683 VAL n 
1 684 GLN n 
1 685 ALA n 
1 686 PHE n 
1 687 ALA n 
1 688 PHE n 
1 689 CYS n 
1 690 ILE n 
1 691 PRO n 
1 692 VAL n 
1 693 TYR n 
1 694 CYS n 
1 695 PHE n 
1 696 SER n 
1 697 HIS n 
1 698 PRO n 
1 699 ALA n 
1 700 HIS n 
1 701 GLN n 
1 702 GLN n 
1 703 ARG n 
1 704 MET n 
1 705 SER n 
1 706 ARG n 
1 707 THR n 
1 708 ALA n 
1 709 ALA n 
1 710 ASP n 
1 711 ILE n 
1 712 LEU n 
1 713 LEU n 
1 714 ARG n 
1 715 LEU n 
1 716 CYS n 
1 717 VAL n 
1 718 LEU n 
1 719 TRP n 
1 720 ASP n 
1 721 ASP n 
1 722 LEU n 
1 723 GLN n 
1 724 SER n 
1 725 SER n 
1 726 VAL n 
1 727 ILE n 
1 728 PRO n 
1 729 GLU n 
1 730 VAL n 
1 731 ASP n 
1 732 ARG n 
1 733 GLU n 
1 734 ALA n 
1 735 MET n 
1 736 LEU n 
1 737 LYS n 
1 738 PRO n 
1 739 ASN n 
1 740 ILE n 
1 741 ILE n 
1 742 PHE n 
1 743 GLN n 
1 744 GLN n 
1 745 LEU n 
1 746 LEU n 
1 747 PHE n 
1 748 TRP n 
1 749 THR n 
1 750 ASP n 
1 751 PRO n 
1 752 ARG n 
1 753 ASN n 
1 754 LEU n 
1 755 VAL n 
1 756 ASN n 
1 757 GLN n 
1 758 THR n 
1 759 GLY n 
1 760 SER n 
1 761 THR n 
1 762 LYS n 
1 763 LYS n 
1 764 ASP n 
1 765 THR n 
1 766 VAL n 
1 767 GLN n 
1 768 LEU n 
1 769 THR n 
1 770 PHE n 
1 771 LEU n 
1 772 ILE n 
1 773 ASP n 
1 774 VAL n 
1 775 LEU n 
1 776 LYS n 
1 777 ILE n 
1 778 TYR n 
1 779 ALA n 
1 780 GLN n 
1 781 ILE n 
1 782 GLU n 
1 783 LYS n 
1 784 LYS n 
1 785 GLU n 
1 786 ILE n 
1 787 LYS n 
1 788 LYS n 
1 789 MET n 
1 790 ILE n 
1 791 ILE n 
1 792 THR n 
1 793 ASN n 
1 794 ILE n 
1 795 ASN n 
1 796 ALA n 
1 797 ILE n 
1 798 PHE n 
1 799 LEU n 
1 800 SER n 
1 801 SER n 
1 802 GLU n 
1 803 GLN n 
1 804 ASP n 
1 805 TYR n 
1 806 SER n 
1 807 THR n 
1 808 LEU n 
1 809 LYS n 
1 810 GLU n 
1 811 LEU n 
1 812 LEU n 
1 813 GLU n 
1 814 TYR n 
1 815 SER n 
1 816 ASP n 
1 817 ASP n 
1 818 ILE n 
1 819 ALA n 
1 820 GLU n 
1 821 ASN n 
1 822 ASP n 
1 823 ASN n 
1 824 LEU n 
1 825 ASP n 
1 826 ASN n 
1 827 VAL n 
1 828 SER n 
1 829 LYS n 
1 830 ASN n 
1 831 ALA n 
1 832 LEU n 
1 833 ASP n 
1 834 LYS n 
1 835 LEU n 
1 836 ARG n 
1 837 ASN n 
1 838 ASN n 
1 839 LEU n 
1 840 ASN n 
1 841 SER n 
1 842 LEU n 
1 843 ILE n 
1 844 GLU n 
1 845 GLU n 
1 846 ILE n 
1 847 ASN n 
1 848 GLU n 
1 849 ARG n 
1 850 SER n 
1 851 GLU n 
1 852 THR n 
1 853 GLN n 
1 854 THR n 
1 855 LYS n 
1 856 ASP n 
1 857 GLU n 
1 858 ASN n 
1 859 ASN n 
1 860 THR n 
1 861 ALA n 
1 862 ASN n 
1 863 ASP n 
1 864 GLN n 
1 865 TYR n 
1 866 SER n 
1 867 SER n 
1 868 ILE n 
1 869 LEU n 
1 870 GLY n 
1 871 ASN n 
2 1   GLY n 
2 2   PRO n 
2 3   LEU n 
2 4   GLY n 
2 5   HIS n 
2 6   MET n 
2 7   SER n 
2 8   ILE n 
2 9   PHE n 
2 10  GLU n 
2 11  LYS n 
2 12  ASP n 
2 13  LEU n 
2 14  MET n 
2 15  ALA n 
2 16  TYR n 
2 17  PHE n 
2 18  ASP n 
2 19  GLU n 
2 20  ASN n 
2 21  LEU n 
2 22  ASN n 
2 23  ARG n 
2 24  ASN n 
2 25  TRP n 
2 26  ARG n 
2 27  GLY n 
2 28  ARG n 
2 29  GLU n 
2 30  HIS n 
2 31  TRP n 
2 32  LYS n 
2 33  VAL n 
2 34  ARG n 
2 35  ASN n 
2 36  PHE n 
2 37  LYS n 
2 38  LYS n 
2 39  ALA n 
2 40  ASN n 
2 41  LYS n 
2 42  SER n 
2 43  MET n 
2 44  ASP n 
2 45  THR n 
2 46  LYS n 
2 47  LYS n 
2 48  LYS n 
2 49  HIS n 
2 50  LYS n 
2 51  GLN n 
2 52  LYS n 
2 53  LYS n 
2 54  VAL n 
2 55  LEU n 
2 56  GLU n 
2 57  ILE n 
2 58  ASP n 
2 59  PHE n 
2 60  PHE n 
2 61  LYS n 
2 62  THR n 
2 63  ASP n 
2 64  ASP n 
2 65  SER n 
2 66  PHE n 
2 67  GLU n 
2 68  ASP n 
2 69  LYS n 
2 70  VAL n 
2 71  PHE n 
2 72  ALA n 
2 73  SER n 
2 74  LYS n 
2 75  GLY n 
2 76  ARG n 
2 77  THR n 
2 78  LYS n 
2 79  ILE n 
2 80  ASP n 
2 81  MET n 
2 82  PRO n 
2 83  ILE n 
2 84  LYS n 
2 85  ASN n 
2 86  ARG n 
2 87  LYS n 
2 88  ASN n 
2 89  ASP n 
2 90  THR n 
2 91  HIS n 
2 92  TYR n 
2 93  LEU n 
2 94  LEU n 
2 95  PRO n 
2 96  ASP n 
2 97  ASP n 
2 98  PHE n 
2 99  HIS n 
2 100 PHE n 
2 101 SER n 
2 102 THR n 
2 103 ASP n 
2 104 ARG n 
2 105 ILE n 
2 106 THR n 
2 107 ARG n 
2 108 LEU n 
2 109 PHE n 
2 110 ILE n 
2 111 LYS n 
2 112 PRO n 
2 113 GLY n 
2 114 GLN n 
2 115 LYS n 
2 116 MET n 
2 117 SER n 
2 118 LEU n 
2 119 PHE n 
2 120 SER n 
2 121 HIS n 
2 122 ARG n 
2 123 LYS n 
2 124 HIS n 
2 125 THR n 
3 1   DG  n 
3 2   DA  n 
3 3   DT  n 
3 4   DG  n 
3 5   DT  n 
3 6   DG  n 
3 7   DT  n 
3 8   DA  n 
3 9   DG  n 
3 10  DC  n 
3 11  DT  n 
3 12  DA  n 
3 13  DC  n 
3 14  DA  n 
3 15  DC  n 
3 16  DA  n 
3 17  DT  n 
3 18  DC  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 871 
;Baker's yeast
;
? 'YCG1, YCS5, YDR325W'    ? ? ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? ? ? ? ? ? ? 
'Escherichia coli' 83333 ? ? ? ? ? ? K12 'Rosetta (DE3) pLysS' ? ? ? ? ? ? plasmid ? ? ? pETMCN ? ? 
2 1 sample 'Biological sequence' 1 125 
;Baker's yeast
;
? 'BRN1, YBL097W, YBL0830' ? ? ? ? ? ? 'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? ? ? ? ? ? ? 
'Escherichia coli' 83333 ? ? ? ? ? ? K12 'Rosetta (DE3) pLysS' ? ? ? ? ? ? plasmid ? ? ? pETMCN ? ? 
# 
_pdbx_entity_src_syn.entity_id              3 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       18 
_pdbx_entity_src_syn.organism_scientific    'synthetic construct' 
_pdbx_entity_src_syn.organism_common_name   ? 
_pdbx_entity_src_syn.ncbi_taxonomy_id       32630 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CND3_YEAST Q06680 ? 1 
;GIDINTKIFNSVAEVFQKAQGSYAGHRKHIAVLKKIQSKAVEQGYEDAFNFWFDKLVTKILPLKKNEIIGDRIVKLVAAF
IASLERELILAKKQNYKLTNDEEGIFSRFVDQFIRHVLRGVESPDKNVRFRVLQLLAVIMDNIGEIDESLFNLLILSLNK
RIYDREPTVRIQAVFCLTKFQDEEQTEHLTELSDNEENFEATRTLVASIQNDPSAEVRRAAMLNLINDNNTRPYILERAR
DVNIVNRRLVYSRILKSMGRKCFDDIEPHIFDQLIEWGLEDRELSVRNACKRLIAHDWLNALDGDLIELLEKLDVSRSSV
CVKAIEALFQSRPDILSKIKFPESIWKDFTVEIAFLFRAIYLYCLDNNITEMLEENFPEASKLSEHLNHYILLRYHHNDI
SNDSQSHFDYNTLEFIIEQLSIAAERYDYSDEVGRRSMLTVVRNMLALTTLSEPLIKIGIRVMKSLSINEKDFVTMAIEI
INDIRDDDIEKQEQEEKIKSKKINRRNETSVDEEDENGTHNDEVNEDEEDDNISSFHSAVENLVQGNGNVSESDIINNLP
PEKEASSATIVLCLTRSSYMLELVNTPLTENILIASLMDTLITPAVRNTAPNIRELGVKNLGLCCLLDVKLAIDNMYILG
MCVSKGNASLKYIALQVIVDIFSVHGNTVVDGEGKVDSISLHKIFYKVLKNNGLPECQVIAAEGLCKLFLADVFTDDDLF
ETLVLSYFSPINSSNEALVQAFAFCIPVYCFSHPAHQQRMSRTAADILLRLCVLWDDLQSSVIPEVDREAMLKPNIIFQQ
LLFWTDPRNLVNQTGSTKKDTVQLTFLIDVLKIYAQIEKKEIKKMIITNINAIFLSSEQDYSTLKELLEYSDDIAENDNL
DNVSKNALDKLRNNLNSLIEEINERSETQTKDENNTANDQYSSILGN
;
6   
2 UNP CND2_YEAST P38170 ? 2 
;SIFEKDLMAYFDENLNRNWRGREHWKVRNFKKANLVNKESDLLEETRTTIGDTTDKNTTDDKSMDTKKKHKQKKVLEIDF
FKTDDSFEDKVFASKGRTKIDMPIKNRKNDTHYLLPDDFHFSTDRITRLFIKPGQKMSLFSHRKHT
;
384 
3 PDB 5OQN       5OQN   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5OQN A 2 ? 871 ? Q06680 6   ? 932 ? 6   932 
2 2 5OQN B 7 ? 125 ? P38170 384 ? 529 ? 384 529 
3 3 5OQN C 1 ? 18  ? 5OQN   1   ? 18  ? 1   18  
4 3 5OQN D 1 ? 18  ? 5OQN   1   ? 18  ? 1   18  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5OQN MET A 1 ? UNP Q06680 ?   ?   'initiating methionine' 5   1  
1 5OQN ?   A ? ? UNP Q06680 GLN 499 deletion                ?   2  
1 5OQN ?   A ? ? UNP Q06680 GLU 500 deletion                ?   3  
1 5OQN ?   A ? ? UNP Q06680 GLU 501 deletion                ?   4  
1 5OQN ?   A ? ? UNP Q06680 LYS 502 deletion                ?   5  
1 5OQN ?   A ? ? UNP Q06680 ILE 503 deletion                ?   6  
1 5OQN ?   A ? ? UNP Q06680 LYS 504 deletion                ?   7  
1 5OQN ?   A ? ? UNP Q06680 SER 505 deletion                ?   8  
1 5OQN ?   A ? ? UNP Q06680 LYS 506 deletion                ?   9  
1 5OQN ?   A ? ? UNP Q06680 LYS 507 deletion                ?   10 
1 5OQN ?   A ? ? UNP Q06680 ILE 508 deletion                ?   11 
1 5OQN ?   A ? ? UNP Q06680 ASN 509 deletion                ?   12 
1 5OQN ?   A ? ? UNP Q06680 ARG 510 deletion                ?   13 
1 5OQN ?   A ? ? UNP Q06680 ARG 511 deletion                ?   14 
1 5OQN ?   A ? ? UNP Q06680 ASN 512 deletion                ?   15 
1 5OQN ?   A ? ? UNP Q06680 GLU 513 deletion                ?   16 
1 5OQN ?   A ? ? UNP Q06680 THR 514 deletion                ?   17 
1 5OQN ?   A ? ? UNP Q06680 SER 515 deletion                ?   18 
1 5OQN ?   A ? ? UNP Q06680 VAL 516 deletion                ?   19 
1 5OQN ?   A ? ? UNP Q06680 ASP 517 deletion                ?   20 
1 5OQN ?   A ? ? UNP Q06680 GLU 518 deletion                ?   21 
1 5OQN ?   A ? ? UNP Q06680 GLU 519 deletion                ?   22 
1 5OQN ?   A ? ? UNP Q06680 ASP 520 deletion                ?   23 
1 5OQN ?   A ? ? UNP Q06680 GLU 521 deletion                ?   24 
1 5OQN ?   A ? ? UNP Q06680 ASN 522 deletion                ?   25 
1 5OQN ?   A ? ? UNP Q06680 GLY 523 deletion                ?   26 
1 5OQN ?   A ? ? UNP Q06680 THR 524 deletion                ?   27 
1 5OQN ?   A ? ? UNP Q06680 HIS 525 deletion                ?   28 
1 5OQN ?   A ? ? UNP Q06680 ASN 526 deletion                ?   29 
1 5OQN ?   A ? ? UNP Q06680 ASP 527 deletion                ?   30 
1 5OQN ?   A ? ? UNP Q06680 GLU 528 deletion                ?   31 
1 5OQN ?   A ? ? UNP Q06680 VAL 529 deletion                ?   32 
1 5OQN ?   A ? ? UNP Q06680 ASN 530 deletion                ?   33 
1 5OQN ?   A ? ? UNP Q06680 GLU 531 deletion                ?   34 
1 5OQN ?   A ? ? UNP Q06680 ASP 532 deletion                ?   35 
1 5OQN ?   A ? ? UNP Q06680 GLU 533 deletion                ?   36 
1 5OQN ?   A ? ? UNP Q06680 GLU 534 deletion                ?   37 
1 5OQN ?   A ? ? UNP Q06680 ASP 535 deletion                ?   38 
1 5OQN ?   A ? ? UNP Q06680 ASP 536 deletion                ?   39 
1 5OQN ?   A ? ? UNP Q06680 ASN 537 deletion                ?   40 
1 5OQN ?   A ? ? UNP Q06680 ILE 538 deletion                ?   41 
1 5OQN ?   A ? ? UNP Q06680 SER 539 deletion                ?   42 
1 5OQN ?   A ? ? UNP Q06680 SER 540 deletion                ?   43 
1 5OQN ?   A ? ? UNP Q06680 PHE 541 deletion                ?   44 
1 5OQN ?   A ? ? UNP Q06680 HIS 542 deletion                ?   45 
1 5OQN ?   A ? ? UNP Q06680 SER 543 deletion                ?   46 
1 5OQN ?   A ? ? UNP Q06680 ALA 544 deletion                ?   47 
1 5OQN ?   A ? ? UNP Q06680 VAL 545 deletion                ?   48 
1 5OQN ?   A ? ? UNP Q06680 GLU 546 deletion                ?   49 
1 5OQN ?   A ? ? UNP Q06680 ASN 547 deletion                ?   50 
1 5OQN ?   A ? ? UNP Q06680 LEU 548 deletion                ?   51 
1 5OQN ?   A ? ? UNP Q06680 VAL 549 deletion                ?   52 
1 5OQN ?   A ? ? UNP Q06680 GLN 550 deletion                ?   53 
1 5OQN ?   A ? ? UNP Q06680 GLY 551 deletion                ?   54 
1 5OQN ?   A ? ? UNP Q06680 ASN 552 deletion                ?   55 
1 5OQN ?   A ? ? UNP Q06680 GLY 553 deletion                ?   56 
1 5OQN ?   A ? ? UNP Q06680 ASN 554 deletion                ?   57 
1 5OQN ?   A ? ? UNP Q06680 VAL 555 deletion                ?   58 
2 5OQN GLY B 1 ? UNP P38170 ?   ?   'expression tag'        378 59 
2 5OQN PRO B 2 ? UNP P38170 ?   ?   'expression tag'        379 60 
2 5OQN LEU B 3 ? UNP P38170 ?   ?   'expression tag'        380 61 
2 5OQN GLY B 4 ? UNP P38170 ?   ?   'expression tag'        381 62 
2 5OQN HIS B 5 ? UNP P38170 ?   ?   'expression tag'        382 63 
2 5OQN MET B 6 ? UNP P38170 ?   ?   'expression tag'        383 64 
2 5OQN ?   B ? ? UNP P38170 LEU 418 deletion                ?   65 
2 5OQN ?   B ? ? UNP P38170 VAL 419 deletion                ?   66 
2 5OQN ?   B ? ? UNP P38170 ASN 420 deletion                ?   67 
2 5OQN ?   B ? ? UNP P38170 LYS 421 deletion                ?   68 
2 5OQN ?   B ? ? UNP P38170 GLU 422 deletion                ?   69 
2 5OQN ?   B ? ? UNP P38170 SER 423 deletion                ?   70 
2 5OQN ?   B ? ? UNP P38170 ASP 424 deletion                ?   71 
2 5OQN ?   B ? ? UNP P38170 LEU 425 deletion                ?   72 
2 5OQN ?   B ? ? UNP P38170 LEU 426 deletion                ?   73 
2 5OQN ?   B ? ? UNP P38170 GLU 427 deletion                ?   74 
2 5OQN ?   B ? ? UNP P38170 GLU 428 deletion                ?   75 
2 5OQN ?   B ? ? UNP P38170 THR 429 deletion                ?   76 
2 5OQN ?   B ? ? UNP P38170 ARG 430 deletion                ?   77 
2 5OQN ?   B ? ? UNP P38170 THR 431 deletion                ?   78 
2 5OQN ?   B ? ? UNP P38170 THR 432 deletion                ?   79 
2 5OQN ?   B ? ? UNP P38170 ILE 433 deletion                ?   80 
2 5OQN ?   B ? ? UNP P38170 GLY 434 deletion                ?   81 
2 5OQN ?   B ? ? UNP P38170 ASP 435 deletion                ?   82 
2 5OQN ?   B ? ? UNP P38170 THR 436 deletion                ?   83 
2 5OQN ?   B ? ? UNP P38170 THR 437 deletion                ?   84 
2 5OQN ?   B ? ? UNP P38170 ASP 438 deletion                ?   85 
2 5OQN ?   B ? ? UNP P38170 LYS 439 deletion                ?   86 
2 5OQN ?   B ? ? UNP P38170 ASN 440 deletion                ?   87 
2 5OQN ?   B ? ? UNP P38170 THR 441 deletion                ?   88 
2 5OQN ?   B ? ? UNP P38170 THR 442 deletion                ?   89 
2 5OQN ?   B ? ? UNP P38170 ASP 443 deletion                ?   90 
2 5OQN ?   B ? ? UNP P38170 ASP 444 deletion                ?   91 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5OQN 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.20 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.57 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            280 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '4% (w/v) PEG 4000, 0.05 M Na citrate pH 5.6, 5 mM MgSO4' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-11-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5OQN 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.15 
_reflns.d_resolution_low                 48.68 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       28612 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  12.3 
_reflns.pdbx_Rmerge_I_obs                0.198 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.059 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.15 
_reflns_shell.d_res_low                   3.32 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.9 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           4129 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.115 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             8.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.401 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.287 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5OQN 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     28612 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             47.343 
_refine.ls_d_res_high                            3.150 
_refine.ls_percent_reflns_obs                    99.94 
_refine.ls_R_factor_obs                          0.2516 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2494 
_refine.ls_R_factor_R_free                       0.2805 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 6.99 
_refine.ls_number_reflns_R_free                  1999 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      5OQP 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.60 
_refine.pdbx_overall_phase_error                 33.46 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7380 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8112 
_refine_hist.d_res_high                       3.150 
_refine_hist.d_res_low                        47.343 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.003  ? ? 8321  'X-RAY DIFFRACTION' ? 
f_angle_d          0.571  ? ? 11389 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 18.973 ? ? 4956  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.037  ? ? 1316  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 1327  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.1500 3.2288  1867 0.3847 100.00 0.4229 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.2288 3.3161  1882 0.3900 100.00 0.4065 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.3161 3.4136  1867 0.3571 100.00 0.3882 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.4136 3.5238  1867 0.3309 100.00 0.3882 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.5238 3.6497  1875 0.3308 100.00 0.3700 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.6497 3.7957  1866 0.3067 100.00 0.3356 . . 141 . . . . 
'X-RAY DIFFRACTION' . 3.7957 3.9684  1896 0.2671 100.00 0.3685 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.9684 4.1775  1891 0.2420 100.00 0.2955 . . 142 . . . . 
'X-RAY DIFFRACTION' . 4.1775 4.4390  1897 0.2243 100.00 0.2709 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.4390 4.7815  1878 0.2243 100.00 0.2498 . . 141 . . . . 
'X-RAY DIFFRACTION' . 4.7815 5.2621  1921 0.2184 100.00 0.2452 . . 144 . . . . 
'X-RAY DIFFRACTION' . 5.2621 6.0222  1910 0.2525 100.00 0.2963 . . 143 . . . . 
'X-RAY DIFFRACTION' . 6.0222 7.5823  1946 0.2577 100.00 0.2868 . . 147 . . . . 
'X-RAY DIFFRACTION' . 7.5823 47.3485 2050 0.1772 100.00 0.1897 . . 153 . . . . 
# 
_struct.entry_id                     5OQN 
_struct.title                        
'Crystal structure of the S. cerevisiae condensin Ycg1-Brn1 subcomplex bound to DNA (short kleisin loop)' 
_struct.pdbx_descriptor              'Condensin complex subunit 3, Condensin complex subunit 2/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5OQN 
_struct_keywords.text            'kleisin, HEAT repeat, DNA-binding, SMC complex, CELL CYCLE' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLN A 21  ? ASP A 8   GLN A 25  1 ? 18 
HELX_P HELX_P2  AA2 GLY A 26  ? GLN A 44  ? GLY A 30  GLN A 48  1 ? 19 
HELX_P HELX_P3  AA3 TYR A 46  ? ILE A 61  ? TYR A 50  ILE A 65  1 ? 16 
HELX_P HELX_P4  AA4 GLU A 68  ? GLN A 95  ? GLU A 72  GLN A 99  1 ? 28 
HELX_P HELX_P5  AA5 ASP A 102 ? LEU A 119 ? ASP A 106 LEU A 123 1 ? 18 
HELX_P HELX_P6  AA6 ARG A 120 ? VAL A 122 ? ARG A 124 VAL A 126 5 ? 3  
HELX_P HELX_P7  AA7 ASP A 126 ? ASP A 142 ? ASP A 130 ASP A 146 1 ? 17 
HELX_P HELX_P8  AA8 ASP A 148 ? ILE A 163 ? ASP A 152 ILE A 167 1 ? 16 
HELX_P HELX_P9  AA9 GLU A 167 ? LYS A 180 ? GLU A 171 LYS A 184 1 ? 14 
HELX_P HELX_P10 AB1 ALA A 202 ? ASP A 213 ? ALA A 206 ASP A 217 1 ? 12 
HELX_P HELX_P11 AB2 SER A 215 ? ASN A 225 ? SER A 219 ASN A 229 1 ? 11 
HELX_P HELX_P12 AB3 THR A 232 ? ARG A 239 ? THR A 236 ARG A 243 1 ? 8  
HELX_P HELX_P13 AB4 ALA A 240 ? ASP A 242 ? ALA A 244 ASP A 246 5 ? 3  
HELX_P HELX_P14 AB5 ASN A 244 ? GLY A 260 ? ASN A 248 GLY A 264 1 ? 17 
HELX_P HELX_P15 AB6 ARG A 261 ? ILE A 267 ? ARG A 265 ILE A 271 1 ? 7  
HELX_P HELX_P16 AB7 GLU A 268 ? GLU A 281 ? GLU A 272 GLU A 285 1 ? 14 
HELX_P HELX_P17 AB8 GLU A 284 ? LEU A 303 ? GLU A 288 LEU A 307 1 ? 20 
HELX_P HELX_P18 AB9 ASP A 306 ? LEU A 314 ? ASP A 310 LEU A 318 1 ? 9  
HELX_P HELX_P19 AC1 VAL A 321 ? ARG A 333 ? VAL A 325 ARG A 337 1 ? 13 
HELX_P HELX_P20 AC2 ARG A 333 ? ILE A 340 ? ARG A 337 ILE A 344 1 ? 8  
HELX_P HELX_P21 AC3 THR A 351 ? ASN A 369 ? THR A 355 ASN A 373 1 ? 19 
HELX_P HELX_P22 AC4 GLU A 372 ? ASN A 377 ? GLU A 376 ASN A 381 1 ? 6  
HELX_P HELX_P23 AC5 GLU A 380 ? HIS A 397 ? GLU A 384 HIS A 401 1 ? 18 
HELX_P HELX_P24 AC6 SER A 407 ? ARG A 427 ? SER A 411 ARG A 431 1 ? 21 
HELX_P HELX_P25 AC7 ASP A 432 ? ALA A 448 ? ASP A 436 ALA A 452 1 ? 17 
HELX_P HELX_P26 AC8 SER A 453 ? SER A 468 ? SER A 457 SER A 472 1 ? 16 
HELX_P HELX_P27 AC9 ASN A 470 ? GLU A 494 ? ASN A 474 GLU A 498 1 ? 25 
HELX_P HELX_P28 AD1 SER A 510 ? VAL A 528 ? SER A 571 VAL A 589 1 ? 19 
HELX_P HELX_P29 AD2 ASN A 535 ? LEU A 545 ? ASN A 596 LEU A 606 1 ? 11 
HELX_P HELX_P30 AD3 LEU A 545 ? ARG A 551 ? LEU A 606 ARG A 612 1 ? 7  
HELX_P HELX_P31 AD4 ALA A 554 ? LEU A 570 ? ALA A 615 LEU A 631 1 ? 17 
HELX_P HELX_P32 AD5 ASP A 572 ? GLY A 590 ? ASP A 633 GLY A 651 1 ? 19 
HELX_P HELX_P33 AD6 ASN A 591 ? GLY A 610 ? ASN A 652 GLY A 671 1 ? 20 
HELX_P HELX_P34 AD7 ASP A 621 ? ASN A 635 ? ASP A 682 ASN A 696 1 ? 15 
HELX_P HELX_P35 AD8 LEU A 638 ? ALA A 655 ? LEU A 699 ALA A 716 1 ? 18 
HELX_P HELX_P36 AD9 ASP A 660 ? SER A 673 ? ASP A 721 SER A 734 1 ? 14 
HELX_P HELX_P37 AE1 ASN A 679 ? HIS A 697 ? ASN A 740 HIS A 758 1 ? 19 
HELX_P HELX_P38 AE2 HIS A 697 ? SER A 725 ? HIS A 758 SER A 786 1 ? 29 
HELX_P HELX_P39 AE3 ASP A 731 ? MET A 735 ? ASP A 792 MET A 796 5 ? 5  
HELX_P HELX_P40 AE4 LYS A 737 ? THR A 749 ? LYS A 798 THR A 810 1 ? 13 
HELX_P HELX_P41 AE5 ASP A 750 ? LEU A 754 ? ASP A 811 LEU A 815 5 ? 5  
HELX_P HELX_P42 AE6 THR A 765 ? ALA A 779 ? THR A 826 ALA A 840 1 ? 15 
HELX_P HELX_P43 AE7 LYS A 783 ? ASN A 793 ? LYS A 844 ASN A 854 1 ? 11 
HELX_P HELX_P44 AE8 ILE A 794 ? ILE A 797 ? ILE A 855 ILE A 858 5 ? 4  
HELX_P HELX_P45 AE9 ASP A 804 ? ASN A 821 ? ASP A 865 ASN A 882 1 ? 18 
HELX_P HELX_P46 AF1 ASP A 825 ? GLU A 848 ? ASP A 886 GLU A 909 1 ? 24 
HELX_P HELX_P47 AF2 SER B 7   ? LEU B 21  ? SER B 384 LEU B 398 1 ? 15 
HELX_P HELX_P48 AF3 ASP B 63  ? SER B 65  ? ASP B 467 SER B 469 5 ? 3  
HELX_P HELX_P49 AF4 PHE B 66  ? PHE B 71  ? PHE B 470 PHE B 475 1 ? 6  
HELX_P HELX_P50 AF5 SER B 101 ? ARG B 107 ? SER B 505 ARG B 511 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? C DG 1  N2 ? ? ? 1_555 D DC 18 N3 ? ? C DG 1  D DC 18 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog2  hydrog ? ? C DA 2  N1 ? ? ? 1_555 D DT 17 N3 ? ? C DA 2  D DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3  hydrog ? ? C DA 2  N6 ? ? ? 1_555 D DT 17 O4 ? ? C DA 2  D DT 17 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4  hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 16 N1 ? ? C DT 3  D DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5  hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 16 N6 ? ? C DT 3  D DA 16 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6  hydrog ? ? C DG 4  N1 ? ? ? 1_555 D DA 14 N1 ? ? C DG 4  D DA 14 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog7  hydrog ? ? C DG 4  O6 ? ? ? 1_555 D DA 14 N6 ? ? C DG 4  D DA 14 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog8  hydrog ? ? C DT 5  N3 ? ? ? 1_555 D DA 14 N1 ? ? C DT 5  D DA 14 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog9  hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DA 12 N1 ? ? C DG 6  D DA 12 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog10 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DA 12 N6 ? ? C DG 6  D DA 12 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog11 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 13 O2 ? ? C DG 6  D DC 13 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog12 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 13 N3 ? ? C DG 6  D DC 13 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog13 hydrog ? ? C DT 7  N3 ? ? ? 1_555 D DA 12 N1 ? ? C DT 7  D DA 12 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog14 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 11 N3 ? ? C DA 8  D DT 11 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog15 hydrog ? ? C DG 9  N1 ? ? ? 1_555 D DC 10 N3 ? ? C DG 9  D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16 hydrog ? ? C DG 9  N2 ? ? ? 1_555 D DC 10 O2 ? ? C DG 9  D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17 hydrog ? ? C DG 9  O6 ? ? ? 1_555 D DC 10 N4 ? ? C DG 9  D DC 10 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18 hydrog ? ? C DC 10 N3 ? ? ? 1_555 D DG 9  N2 ? ? C DC 10 D DG 9  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog19 hydrog ? ? C DC 10 O2 ? ? ? 1_555 D DG 9  N1 ? ? C DC 10 D DG 9  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog20 hydrog ? ? C DT 11 N3 ? ? ? 1_555 D DA 8  N1 ? ? C DT 11 D DA 8  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog21 hydrog ? ? C DA 12 N1 ? ? ? 1_555 D DG 6  N1 ? ? C DA 12 D DG 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog22 hydrog ? ? C DA 12 N6 ? ? ? 1_555 D DG 6  O6 ? ? C DA 12 D DG 6  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog23 hydrog ? ? C DC 13 N3 ? ? ? 1_555 D DG 6  N2 ? ? C DC 13 D DG 6  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog24 hydrog ? ? C DC 13 O2 ? ? ? 1_555 D DG 6  N1 ? ? C DC 13 D DG 6  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog25 hydrog ? ? C DA 14 N1 ? ? ? 1_555 D DT 5  N3 ? ? C DA 14 D DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26 hydrog ? ? C DA 14 N6 ? ? ? 1_555 D DT 5  O4 ? ? C DA 14 D DT 5  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27 hydrog ? ? C DC 15 N3 ? ? ? 1_555 D DG 4  N1 ? ? C DC 15 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28 hydrog ? ? C DC 15 N4 ? ? ? 1_555 D DG 4  O6 ? ? C DC 15 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29 hydrog ? ? C DC 15 O2 ? ? ? 1_555 D DG 4  N2 ? ? C DC 15 D DG 4  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30 hydrog ? ? C DA 16 N1 ? ? ? 1_555 D DT 3  N3 ? ? C DA 16 D DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31 hydrog ? ? C DA 16 N6 ? ? ? 1_555 D DT 3  O4 ? ? C DA 16 D DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 2  N1 ? ? C DT 17 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 2  N6 ? ? C DT 17 D DA 2  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34 hydrog ? ? C DC 18 N4 ? ? ? 1_555 D DG 1  O6 ? ? C DC 18 D DG 1  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          TYR 
_struct_mon_prot_cis.label_seq_id           97 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           TYR 
_struct_mon_prot_cis.auth_seq_id            101 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   LYS 
_struct_mon_prot_cis.pdbx_label_seq_id_2    98 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    LYS 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     102 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -11.50 
# 
_atom_sites.entry_id                    5OQN 
_atom_sites.fract_transf_matrix[1][1]   0.011217 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008604 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006430 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N      . ILE A 1 3   ? 20.901  -8.760  -85.639 1.00 72.69  ?  7   ILE A N      1 
ATOM 2     C CA     . ILE A 1 3   ? 20.665  -8.222  -84.307 1.00 73.58  ?  7   ILE A CA     1 
ATOM 3     C C      . ILE A 1 3   ? 21.989  -8.131  -83.560 1.00 78.75  ?  7   ILE A C      1 
ATOM 4     O O      . ILE A 1 3   ? 22.910  -8.906  -83.813 1.00 89.37  ?  7   ILE A O      1 
ATOM 5     C CB     . ILE A 1 3   ? 19.639  -9.081  -83.534 1.00 74.13  ?  7   ILE A CB     1 
ATOM 6     C CG1    . ILE A 1 3   ? 19.221  -8.403  -82.226 1.00 62.24  ?  7   ILE A CG1    1 
ATOM 7     C CG2    . ILE A 1 3   ? 20.199  -10.469 -83.250 1.00 96.77  ?  7   ILE A CG2    1 
ATOM 8     C CD1    . ILE A 1 3   ? 18.417  -7.134  -82.416 1.00 64.02  ?  7   ILE A CD1    1 
ATOM 9     H HA     . ILE A 1 3   ? 20.304  -7.325  -84.388 1.00 88.30  ?  7   ILE A HA     1 
ATOM 10    H HB     . ILE A 1 3   ? 18.849  -9.181  -84.088 1.00 88.96  ?  7   ILE A HB     1 
ATOM 11    H HG12   . ILE A 1 3   ? 18.679  -9.023  -81.713 1.00 74.69  ?  7   ILE A HG12   1 
ATOM 12    H HG13   . ILE A 1 3   ? 20.020  -8.174  -81.725 1.00 74.69  ?  7   ILE A HG13   1 
ATOM 13    H HG21   . ILE A 1 3   ? 19.535  -10.984 -82.765 1.00 116.12 ?  7   ILE A HG21   1 
ATOM 14    H HG22   . ILE A 1 3   ? 20.405  -10.904 -84.092 1.00 116.12 ?  7   ILE A HG22   1 
ATOM 15    H HG23   . ILE A 1 3   ? 21.004  -10.381 -82.716 1.00 116.12 ?  7   ILE A HG23   1 
ATOM 16    H HD11   . ILE A 1 3   ? 18.193  -6.769  -81.546 1.00 76.83  ?  7   ILE A HD11   1 
ATOM 17    H HD12   . ILE A 1 3   ? 18.948  -6.496  -82.917 1.00 76.83  ?  7   ILE A HD12   1 
ATOM 18    H HD13   . ILE A 1 3   ? 17.606  -7.346  -82.905 1.00 76.83  ?  7   ILE A HD13   1 
ATOM 19    N N      . ASP A 1 4   ? 22.080  -7.178  -82.637 1.00 84.60  ?  8   ASP A N      1 
ATOM 20    C CA     . ASP A 1 4   ? 23.292  -6.987  -81.857 1.00 88.70  ?  8   ASP A CA     1 
ATOM 21    C C      . ASP A 1 4   ? 23.400  -8.037  -80.759 1.00 82.07  ?  8   ASP A C      1 
ATOM 22    O O      . ASP A 1 4   ? 22.396  -8.552  -80.258 1.00 87.98  ?  8   ASP A O      1 
ATOM 23    C CB     . ASP A 1 4   ? 23.314  -5.589  -81.239 1.00 90.08  ?  8   ASP A CB     1 
ATOM 24    C CG     . ASP A 1 4   ? 24.481  -5.388  -80.293 1.00 94.11  ?  8   ASP A CG     1 
ATOM 25    O OD1    . ASP A 1 4   ? 25.511  -6.073  -80.464 1.00 93.33  ?  8   ASP A OD1    1 
ATOM 26    O OD2    . ASP A 1 4   ? 24.368  -4.548  -79.377 1.00 93.82  -1 8   ASP A OD2    1 
ATOM 27    H H      . ASP A 1 4   ? 21.448  -6.628  -82.444 1.00 101.52 ?  8   ASP A H      1 
ATOM 28    H HA     . ASP A 1 4   ? 24.064  -7.075  -82.438 1.00 106.44 ?  8   ASP A HA     1 
ATOM 29    H HB2    . ASP A 1 4   ? 23.386  -4.931  -81.948 1.00 108.10 ?  8   ASP A HB2    1 
ATOM 30    H HB3    . ASP A 1 4   ? 22.495  -5.451  -80.739 1.00 108.10 ?  8   ASP A HB3    1 
ATOM 31    N N      . ILE A 1 5   ? 24.640  -8.347  -80.380 1.00 82.31  ?  9   ILE A N      1 
ATOM 32    C CA     . ILE A 1 5   ? 24.864  -9.333  -79.330 1.00 74.91  ?  9   ILE A CA     1 
ATOM 33    C C      . ILE A 1 5   ? 24.347  -8.810  -77.998 1.00 78.20  ?  9   ILE A C      1 
ATOM 34    O O      . ILE A 1 5   ? 23.708  -9.542  -77.233 1.00 69.65  ?  9   ILE A O      1 
ATOM 35    C CB     . ILE A 1 5   ? 26.356  -9.705  -79.250 1.00 60.76  ?  9   ILE A CB     1 
ATOM 36    C CG1    . ILE A 1 5   ? 26.869  -10.127 -80.632 1.00 68.36  ?  9   ILE A CG1    1 
ATOM 37    C CG2    . ILE A 1 5   ? 26.561  -10.814 -78.229 1.00 45.38  ?  9   ILE A CG2    1 
ATOM 38    C CD1    . ILE A 1 5   ? 28.313  -10.602 -80.660 1.00 76.78  ?  9   ILE A CD1    1 
ATOM 39    H H      . ILE A 1 5   ? 25.357  -8.005  -80.710 1.00 98.77  ?  9   ILE A H      1 
ATOM 40    H HA     . ILE A 1 5   ? 24.368  -10.139 -79.546 1.00 89.90  ?  9   ILE A HA     1 
ATOM 41    H HB     . ILE A 1 5   ? 26.853  -8.924  -78.962 1.00 72.92  ?  9   ILE A HB     1 
ATOM 42    H HG12   . ILE A 1 5   ? 26.315  -10.853 -80.958 1.00 82.03  ?  9   ILE A HG12   1 
ATOM 43    H HG13   . ILE A 1 5   ? 26.798  -9.368  -81.232 1.00 82.03  ?  9   ILE A HG13   1 
ATOM 44    H HG21   . ILE A 1 5   ? 27.504  -11.037 -78.190 1.00 54.45  ?  9   ILE A HG21   1 
ATOM 45    H HG22   . ILE A 1 5   ? 26.258  -10.504 -77.361 1.00 54.45  ?  9   ILE A HG22   1 
ATOM 46    H HG23   . ILE A 1 5   ? 26.048  -11.592 -78.500 1.00 54.45  ?  9   ILE A HG23   1 
ATOM 47    H HD11   . ILE A 1 5   ? 28.547  -10.845 -81.569 1.00 92.14  ?  9   ILE A HD11   1 
ATOM 48    H HD12   . ILE A 1 5   ? 28.887  -9.883  -80.351 1.00 92.14  ?  9   ILE A HD12   1 
ATOM 49    H HD13   . ILE A 1 5   ? 28.403  -11.371 -80.076 1.00 92.14  ?  9   ILE A HD13   1 
ATOM 50    N N      . ASN A 1 6   ? 24.608  -7.536  -77.701 1.00 72.53  ?  10  ASN A N      1 
ATOM 51    C CA     . ASN A 1 6   ? 24.158  -6.960  -76.440 1.00 60.93  ?  10  ASN A CA     1 
ATOM 52    C C      . ASN A 1 6   ? 22.644  -7.055  -76.307 1.00 61.70  ?  10  ASN A C      1 
ATOM 53    O O      . ASN A 1 6   ? 22.125  -7.469  -75.264 1.00 69.66  ?  10  ASN A O      1 
ATOM 54    C CB     . ASN A 1 6   ? 24.623  -5.506  -76.340 1.00 77.97  ?  10  ASN A CB     1 
ATOM 55    C CG     . ASN A 1 6   ? 24.298  -4.878  -74.997 1.00 85.78  ?  10  ASN A CG     1 
ATOM 56    O OD1    . ASN A 1 6   ? 23.311  -5.230  -74.353 1.00 86.00  ?  10  ASN A OD1    1 
ATOM 57    N ND2    . ASN A 1 6   ? 25.132  -3.938  -74.570 1.00 85.29  ?  10  ASN A ND2    1 
ATOM 58    H H      . ASN A 1 6   ? 25.038  -6.992  -78.209 1.00 87.03  ?  10  ASN A H      1 
ATOM 59    H HA     . ASN A 1 6   ? 24.556  -7.454  -75.706 1.00 73.12  ?  10  ASN A HA     1 
ATOM 60    H HB2    . ASN A 1 6   ? 25.584  -5.473  -76.462 1.00 93.56  ?  10  ASN A HB2    1 
ATOM 61    H HB3    . ASN A 1 6   ? 24.182  -4.986  -77.029 1.00 93.56  ?  10  ASN A HB3    1 
ATOM 62    H HD21   . ASN A 1 6   ? 24.993  -3.551  -73.815 1.00 102.34 ?  10  ASN A HD21   1 
ATOM 63    H HD22   . ASN A 1 6   ? 25.812  -3.717  -75.048 1.00 102.34 ?  10  ASN A HD22   1 
ATOM 64    N N      . THR A 1 7   ? 21.915  -6.674  -77.356 1.00 56.65  ?  11  THR A N      1 
ATOM 65    C CA     . THR A 1 7   ? 20.458  -6.731  -77.298 1.00 57.23  ?  11  THR A CA     1 
ATOM 66    C C      . THR A 1 7   ? 19.971  -8.159  -77.097 1.00 72.86  ?  11  THR A C      1 
ATOM 67    O O      . THR A 1 7   ? 19.008  -8.394  -76.358 1.00 79.61  ?  11  THR A O      1 
ATOM 68    C CB     . THR A 1 7   ? 19.857  -6.138  -78.570 1.00 52.13  ?  11  THR A CB     1 
ATOM 69    O OG1    . THR A 1 7   ? 20.385  -6.818  -79.715 1.00 84.19  ?  11  THR A OG1    1 
ATOM 70    C CG2    . THR A 1 7   ? 20.176  -4.656  -78.667 1.00 59.44  ?  11  THR A CG2    1 
ATOM 71    H H      . THR A 1 7   ? 22.234  -6.384  -78.100 1.00 67.98  ?  11  THR A H      1 
ATOM 72    H HA     . THR A 1 7   ? 20.152  -6.200  -76.546 1.00 68.67  ?  11  THR A HA     1 
ATOM 73    H HB     . THR A 1 7   ? 18.892  -6.243  -78.549 1.00 62.55  ?  11  THR A HB     1 
ATOM 74    H HG1    . THR A 1 7   ? 21.220  -6.732  -79.740 1.00 101.03 ?  11  THR A HG1    1 
ATOM 75    H HG21   . THR A 1 7   ? 19.790  -4.287  -79.477 1.00 71.33  ?  11  THR A HG21   1 
ATOM 76    H HG22   . THR A 1 7   ? 19.809  -4.187  -77.901 1.00 71.33  ?  11  THR A HG22   1 
ATOM 77    H HG23   . THR A 1 7   ? 21.136  -4.525  -78.687 1.00 71.33  ?  11  THR A HG23   1 
ATOM 78    N N      . LYS A 1 8   ? 20.618  -9.127  -77.749 1.00 77.68  ?  12  LYS A N      1 
ATOM 79    C CA     . LYS A 1 8   ? 20.243  -10.523 -77.551 1.00 75.10  ?  12  LYS A CA     1 
ATOM 80    C C      . LYS A 1 8   ? 20.345  -10.907 -76.081 1.00 76.69  ?  12  LYS A C      1 
ATOM 81    O O      . LYS A 1 8   ? 19.427  -11.516 -75.520 1.00 81.71  ?  12  LYS A O      1 
ATOM 82    C CB     . LYS A 1 8   ? 21.123  -11.434 -78.407 1.00 79.38  ?  12  LYS A CB     1 
ATOM 83    C CG     . LYS A 1 8   ? 20.736  -11.471 -79.879 1.00 75.28  ?  12  LYS A CG     1 
ATOM 84    C CD     . LYS A 1 8   ? 21.474  -12.570 -80.638 1.00 77.23  ?  12  LYS A CD     1 
ATOM 85    C CE     . LYS A 1 8   ? 21.007  -13.960 -80.223 1.00 85.00  ?  12  LYS A CE     1 
ATOM 86    N NZ     . LYS A 1 8   ? 21.643  -15.036 -81.033 1.00 76.44  1  12  LYS A NZ     1 
ATOM 87    H H      . LYS A 1 8   ? 21.266  -9.003  -78.301 1.00 93.22  ?  12  LYS A H      1 
ATOM 88    H HA     . LYS A 1 8   ? 19.322  -10.646 -77.830 1.00 90.12  ?  12  LYS A HA     1 
ATOM 89    H HB2    . LYS A 1 8   ? 22.040  -11.123 -78.350 1.00 95.26  ?  12  LYS A HB2    1 
ATOM 90    H HB3    . LYS A 1 8   ? 21.062  -12.339 -78.062 1.00 95.26  ?  12  LYS A HB3    1 
ATOM 91    H HG2    . LYS A 1 8   ? 19.784  -11.639 -79.953 1.00 90.34  ?  12  LYS A HG2    1 
ATOM 92    H HG3    . LYS A 1 8   ? 20.958  -10.620 -80.287 1.00 90.34  ?  12  LYS A HG3    1 
ATOM 93    H HD2    . LYS A 1 8   ? 21.309  -12.466 -81.588 1.00 92.67  ?  12  LYS A HD2    1 
ATOM 94    H HD3    . LYS A 1 8   ? 22.423  -12.502 -80.453 1.00 92.67  ?  12  LYS A HD3    1 
ATOM 95    H HE2    . LYS A 1 8   ? 21.237  -14.107 -79.292 1.00 102.00 ?  12  LYS A HE2    1 
ATOM 96    H HE3    . LYS A 1 8   ? 20.046  -14.021 -80.343 1.00 102.00 ?  12  LYS A HE3    1 
ATOM 97    H HZ1    . LYS A 1 8   ? 21.349  -15.832 -80.765 1.00 91.73  ?  12  LYS A HZ1    1 
ATOM 98    H HZ2    . LYS A 1 8   ? 21.442  -14.928 -81.893 1.00 91.73  ?  12  LYS A HZ2    1 
ATOM 99    H HZ3    . LYS A 1 8   ? 22.527  -15.007 -80.936 1.00 91.73  ?  12  LYS A HZ3    1 
ATOM 100   N N      . ILE A 1 9   ? 21.461  -10.556 -75.439 1.00 68.22  ?  13  ILE A N      1 
ATOM 101   C CA     . ILE A 1 9   ? 21.629  -10.854 -74.020 1.00 53.07  ?  13  ILE A CA     1 
ATOM 102   C C      . ILE A 1 9   ? 20.466  -10.283 -73.222 1.00 56.05  ?  13  ILE A C      1 
ATOM 103   O O      . ILE A 1 9   ? 19.898  -10.951 -72.350 1.00 61.63  ?  13  ILE A O      1 
ATOM 104   C CB     . ILE A 1 9   ? 22.980  -10.315 -73.515 1.00 52.08  ?  13  ILE A CB     1 
ATOM 105   C CG1    . ILE A 1 9   ? 24.132  -11.033 -74.224 1.00 47.66  ?  13  ILE A CG1    1 
ATOM 106   C CG2    . ILE A 1 9   ? 23.096  -10.488 -72.004 1.00 57.93  ?  13  ILE A CG2    1 
ATOM 107   C CD1    . ILE A 1 9   ? 25.511  -10.504 -73.879 1.00 42.79  ?  13  ILE A CD1    1 
ATOM 108   H H      . ILE A 1 9   ? 22.127  -10.149 -75.800 1.00 81.86  ?  13  ILE A H      1 
ATOM 109   H HA     . ILE A 1 9   ? 21.628  -11.817 -73.899 1.00 63.69  ?  13  ILE A HA     1 
ATOM 110   H HB     . ILE A 1 9   ? 23.032  -9.369  -73.723 1.00 62.50  ?  13  ILE A HB     1 
ATOM 111   H HG12   . ILE A 1 9   ? 24.108  -11.972 -73.982 1.00 57.20  ?  13  ILE A HG12   1 
ATOM 112   H HG13   . ILE A 1 9   ? 24.012  -10.940 -75.182 1.00 57.20  ?  13  ILE A HG13   1 
ATOM 113   H HG21   . ILE A 1 9   ? 23.954  -10.142 -71.712 1.00 69.52  ?  13  ILE A HG21   1 
ATOM 114   H HG22   . ILE A 1 9   ? 22.378  -9.998  -71.574 1.00 69.52  ?  13  ILE A HG22   1 
ATOM 115   H HG23   . ILE A 1 9   ? 23.029  -11.431 -71.788 1.00 69.52  ?  13  ILE A HG23   1 
ATOM 116   H HD11   . ILE A 1 9   ? 26.176  -11.012 -74.369 1.00 51.35  ?  13  ILE A HD11   1 
ATOM 117   H HD12   . ILE A 1 9   ? 25.561  -9.567  -74.127 1.00 51.35  ?  13  ILE A HD12   1 
ATOM 118   H HD13   . ILE A 1 9   ? 25.656  -10.601 -72.925 1.00 51.35  ?  13  ILE A HD13   1 
ATOM 119   N N      . PHE A 1 10  ? 20.086  -9.038  -73.516 1.00 68.87  ?  14  PHE A N      1 
ATOM 120   C CA     . PHE A 1 10  ? 19.010  -8.400  -72.767 1.00 65.71  ?  14  PHE A CA     1 
ATOM 121   C C      . PHE A 1 10  ? 17.699  -9.159  -72.926 1.00 66.63  ?  14  PHE A C      1 
ATOM 122   O O      . PHE A 1 10  ? 16.967  -9.357  -71.950 1.00 77.79  ?  14  PHE A O      1 
ATOM 123   C CB     . PHE A 1 10  ? 18.848  -6.950  -73.221 1.00 67.27  ?  14  PHE A CB     1 
ATOM 124   C CG     . PHE A 1 10  ? 17.660  -6.258  -72.623 1.00 62.71  ?  14  PHE A CG     1 
ATOM 125   C CD1    . PHE A 1 10  ? 16.486  -6.127  -73.342 1.00 65.70  ?  14  PHE A CD1    1 
ATOM 126   C CD2    . PHE A 1 10  ? 17.716  -5.741  -71.341 1.00 54.64  ?  14  PHE A CD2    1 
ATOM 127   C CE1    . PHE A 1 10  ? 15.391  -5.492  -72.796 1.00 51.23  ?  14  PHE A CE1    1 
ATOM 128   C CE2    . PHE A 1 10  ? 16.623  -5.104  -70.790 1.00 52.90  ?  14  PHE A CE2    1 
ATOM 129   C CZ     . PHE A 1 10  ? 15.459  -4.980  -71.519 1.00 51.57  ?  14  PHE A CZ     1 
ATOM 130   H H      . PHE A 1 10  ? 20.431  -8.551  -74.134 1.00 82.64  ?  14  PHE A H      1 
ATOM 131   H HA     . PHE A 1 10  ? 19.241  -8.395  -71.825 1.00 78.85  ?  14  PHE A HA     1 
ATOM 132   H HB2    . PHE A 1 10  ? 19.641  -6.452  -72.965 1.00 80.72  ?  14  PHE A HB2    1 
ATOM 133   H HB3    . PHE A 1 10  ? 18.747  -6.934  -74.185 1.00 80.72  ?  14  PHE A HB3    1 
ATOM 134   H HD1    . PHE A 1 10  ? 16.435  -6.471  -74.205 1.00 78.84  ?  14  PHE A HD1    1 
ATOM 135   H HD2    . PHE A 1 10  ? 18.499  -5.822  -70.846 1.00 65.57  ?  14  PHE A HD2    1 
ATOM 136   H HE1    . PHE A 1 10  ? 14.606  -5.409  -73.289 1.00 61.47  ?  14  PHE A HE1    1 
ATOM 137   H HE2    . PHE A 1 10  ? 16.671  -4.760  -69.928 1.00 63.48  ?  14  PHE A HE2    1 
ATOM 138   H HZ     . PHE A 1 10  ? 14.721  -4.552  -71.149 1.00 61.89  ?  14  PHE A HZ     1 
ATOM 139   N N      . ASN A 1 11  ? 17.387  -9.596  -74.147 1.00 64.00  ?  15  ASN A N      1 
ATOM 140   C CA     . ASN A 1 11  ? 16.139  -10.318 -74.373 1.00 70.71  ?  15  ASN A CA     1 
ATOM 141   C C      . ASN A 1 11  ? 16.113  -11.626 -73.596 1.00 75.16  ?  15  ASN A C      1 
ATOM 142   O O      . ASN A 1 11  ? 15.085  -11.995 -73.018 1.00 73.48  ?  15  ASN A O      1 
ATOM 143   C CB     . ASN A 1 11  ? 15.948  -10.586 -75.865 1.00 84.09  ?  15  ASN A CB     1 
ATOM 144   C CG     . ASN A 1 11  ? 15.777  -9.315  -76.669 1.00 90.46  ?  15  ASN A CG     1 
ATOM 145   O OD1    . ASN A 1 11  ? 14.662  -8.825  -76.848 1.00 95.28  ?  15  ASN A OD1    1 
ATOM 146   N ND2    . ASN A 1 11  ? 16.883  -8.775  -77.164 1.00 80.18  ?  15  ASN A ND2    1 
ATOM 147   H H      . ASN A 1 11  ? 17.872  -9.490  -74.849 1.00 76.80  ?  15  ASN A H      1 
ATOM 148   H HA     . ASN A 1 11  ? 15.397  -9.772  -74.068 1.00 84.85  ?  15  ASN A HA     1 
ATOM 149   H HB2    . ASN A 1 11  ? 16.727  -11.053 -76.204 1.00 100.91 ?  15  ASN A HB2    1 
ATOM 150   H HB3    . ASN A 1 11  ? 15.154  -11.129 -75.989 1.00 100.91 ?  15  ASN A HB3    1 
ATOM 151   H HD21   . ASN A 1 11  ? 16.839  -8.053  -77.629 1.00 96.22  ?  15  ASN A HD21   1 
ATOM 152   H HD22   . ASN A 1 11  ? 17.645  -9.148  -77.021 1.00 96.22  ?  15  ASN A HD22   1 
ATOM 153   N N      . SER A 1 12  ? 17.238  -12.341 -73.571 1.00 74.50  ?  16  SER A N      1 
ATOM 154   C CA     . SER A 1 12  ? 17.277  -13.634 -72.897 1.00 79.56  ?  16  SER A CA     1 
ATOM 155   C C      . SER A 1 12  ? 17.038  -13.476 -71.401 1.00 70.00  ?  16  SER A C      1 
ATOM 156   O O      . SER A 1 12  ? 16.148  -14.117 -70.831 1.00 66.98  ?  16  SER A O      1 
ATOM 157   C CB     . SER A 1 12  ? 18.618  -14.319 -73.163 1.00 71.92  ?  16  SER A CB     1 
ATOM 158   O OG     . SER A 1 12  ? 18.914  -14.333 -74.549 1.00 79.43  ?  16  SER A OG     1 
ATOM 159   H H      . SER A 1 12  ? 17.982  -12.103 -73.931 1.00 89.40  ?  16  SER A H      1 
ATOM 160   H HA     . SER A 1 12  ? 16.575  -14.199 -73.256 1.00 95.47  ?  16  SER A HA     1 
ATOM 161   H HB2    . SER A 1 12  ? 19.317  -13.835 -72.697 1.00 86.30  ?  16  SER A HB2    1 
ATOM 162   H HB3    . SER A 1 12  ? 18.575  -15.232 -72.841 1.00 86.30  ?  16  SER A HB3    1 
ATOM 163   H HG     . SER A 1 12  ? 18.953  -13.547 -74.842 1.00 95.31  ?  16  SER A HG     1 
ATOM 164   N N      . VAL A 1 13  ? 17.817  -12.612 -70.749 1.00 69.64  ?  17  VAL A N      1 
ATOM 165   C CA     . VAL A 1 13  ? 17.674  -12.426 -69.308 1.00 65.33  ?  17  VAL A CA     1 
ATOM 166   C C      . VAL A 1 13  ? 16.306  -11.842 -68.982 1.00 51.00  ?  17  VAL A C      1 
ATOM 167   O O      . VAL A 1 13  ? 15.655  -12.253 -68.014 1.00 53.71  ?  17  VAL A O      1 
ATOM 168   C CB     . VAL A 1 13  ? 18.810  -11.538 -68.768 1.00 54.98  ?  17  VAL A CB     1 
ATOM 169   C CG1    . VAL A 1 13  ? 18.662  -11.333 -67.269 1.00 56.10  ?  17  VAL A CG1    1 
ATOM 170   C CG2    . VAL A 1 13  ? 20.160  -12.156 -69.084 1.00 43.88  ?  17  VAL A CG2    1 
ATOM 171   H H      . VAL A 1 13  ? 18.428  -12.128 -71.113 1.00 83.56  ?  17  VAL A H      1 
ATOM 172   H HA     . VAL A 1 13  ? 17.739  -13.290 -68.873 1.00 78.40  ?  17  VAL A HA     1 
ATOM 173   H HB     . VAL A 1 13  ? 18.767  -10.669 -69.198 1.00 65.98  ?  17  VAL A HB     1 
ATOM 174   H HG11   . VAL A 1 13  ? 19.388  -10.772 -66.954 1.00 67.32  ?  17  VAL A HG11   1 
ATOM 175   H HG12   . VAL A 1 13  ? 17.811  -10.903 -67.092 1.00 67.32  ?  17  VAL A HG12   1 
ATOM 176   H HG13   . VAL A 1 13  ? 18.696  -12.196 -66.828 1.00 67.32  ?  17  VAL A HG13   1 
ATOM 177   H HG21   . VAL A 1 13  ? 20.859  -11.581 -68.736 1.00 52.66  ?  17  VAL A HG21   1 
ATOM 178   H HG22   . VAL A 1 13  ? 20.212  -13.030 -68.668 1.00 52.66  ?  17  VAL A HG22   1 
ATOM 179   H HG23   . VAL A 1 13  ? 20.250  -12.241 -70.046 1.00 52.66  ?  17  VAL A HG23   1 
ATOM 180   N N      . ALA A 1 14  ? 15.850  -10.875 -69.777 1.00 52.16  ?  18  ALA A N      1 
ATOM 181   C CA     . ALA A 1 14  ? 14.545  -10.276 -69.529 1.00 60.69  ?  18  ALA A CA     1 
ATOM 182   C C      . ALA A 1 14  ? 13.440  -11.317 -69.632 1.00 67.77  ?  18  ALA A C      1 
ATOM 183   O O      . ALA A 1 14  ? 12.472  -11.285 -68.863 1.00 59.68  ?  18  ALA A O      1 
ATOM 184   C CB     . ALA A 1 14  ? 14.297  -9.133  -70.511 1.00 65.69  ?  18  ALA A CB     1 
ATOM 185   H H      . ALA A 1 14  ? 16.271  -10.553 -70.455 1.00 62.59  ?  18  ALA A H      1 
ATOM 186   H HA     . ALA A 1 14  ? 14.530  -9.909  -68.631 1.00 72.83  ?  18  ALA A HA     1 
ATOM 187   H HB1    . ALA A 1 14  ? 13.426  -8.747  -70.332 1.00 78.82  ?  18  ALA A HB1    1 
ATOM 188   H HB2    . ALA A 1 14  ? 14.988  -8.462  -70.394 1.00 78.82  ?  18  ALA A HB2    1 
ATOM 189   H HB3    . ALA A 1 14  ? 14.325  -9.483  -71.415 1.00 78.82  ?  18  ALA A HB3    1 
ATOM 190   N N      . GLU A 1 15  ? 13.566  -12.248 -70.577 1.00 65.34  ?  19  GLU A N      1 
ATOM 191   C CA     . GLU A 1 15  ? 12.585  -13.321 -70.693 1.00 59.70  ?  19  GLU A CA     1 
ATOM 192   C C      . GLU A 1 15  ? 12.502  -14.114 -69.397 1.00 61.48  ?  19  GLU A C      1 
ATOM 193   O O      . GLU A 1 15  ? 11.408  -14.407 -68.902 1.00 69.99  ?  19  GLU A O      1 
ATOM 194   C CB     . GLU A 1 15  ? 12.951  -14.233 -71.863 1.00 68.82  ?  19  GLU A CB     1 
ATOM 195   C CG     . GLU A 1 15  ? 11.919  -15.304 -72.175 1.00 72.75  ?  19  GLU A CG     1 
ATOM 196   C CD     . GLU A 1 15  ? 10.611  -14.731 -72.683 1.00 92.01  ?  19  GLU A CD     1 
ATOM 197   O OE1    . GLU A 1 15  ? 9.909   -14.056 -71.901 1.00 76.93  ?  19  GLU A OE1    1 
ATOM 198   O OE2    . GLU A 1 15  ? 10.286  -14.950 -73.868 1.00 97.58  -1 19  GLU A OE2    1 
ATOM 199   H H      . GLU A 1 15  ? 14.202  -12.281 -71.155 1.00 78.41  ?  19  GLU A H      1 
ATOM 200   H HA     . GLU A 1 15  ? 11.712  -12.937 -70.869 1.00 71.64  ?  19  GLU A HA     1 
ATOM 201   H HB2    . GLU A 1 15  ? 13.060  -13.689 -72.658 1.00 82.59  ?  19  GLU A HB2    1 
ATOM 202   H HB3    . GLU A 1 15  ? 13.787  -14.681 -71.657 1.00 82.59  ?  19  GLU A HB3    1 
ATOM 203   H HG2    . GLU A 1 15  ? 12.274  -15.894 -72.859 1.00 87.29  ?  19  GLU A HG2    1 
ATOM 204   H HG3    . GLU A 1 15  ? 11.733  -15.808 -71.368 1.00 87.29  ?  19  GLU A HG3    1 
ATOM 205   N N      . VAL A 1 16  ? 13.657  -14.459 -68.826 1.00 64.70  ?  20  VAL A N      1 
ATOM 206   C CA     . VAL A 1 16  ? 13.687  -15.229 -67.584 1.00 49.81  ?  20  VAL A CA     1 
ATOM 207   C C      . VAL A 1 16  ? 12.926  -14.489 -66.491 1.00 50.90  ?  20  VAL A C      1 
ATOM 208   O O      . VAL A 1 16  ? 11.982  -15.018 -65.894 1.00 54.77  ?  20  VAL A O      1 
ATOM 209   C CB     . VAL A 1 16  ? 15.140  -15.509 -67.161 1.00 43.78  ?  20  VAL A CB     1 
ATOM 210   C CG1    . VAL A 1 16  ? 15.180  -16.328 -65.885 1.00 39.79  ?  20  VAL A CG1    1 
ATOM 211   C CG2    . VAL A 1 16  ? 15.892  -16.229 -68.270 1.00 53.17  ?  20  VAL A CG2    1 
ATOM 212   H H      . VAL A 1 16  ? 14.434  -14.261 -69.137 1.00 77.64  ?  20  VAL A H      1 
ATOM 213   H HA     . VAL A 1 16  ? 13.247  -16.081 -67.730 1.00 59.77  ?  20  VAL A HA     1 
ATOM 214   H HB     . VAL A 1 16  ? 15.589  -14.666 -66.992 1.00 52.53  ?  20  VAL A HB     1 
ATOM 215   H HG11   . VAL A 1 16  ? 16.105  -16.489 -65.642 1.00 47.75  ?  20  VAL A HG11   1 
ATOM 216   H HG12   . VAL A 1 16  ? 14.734  -15.833 -65.179 1.00 47.75  ?  20  VAL A HG12   1 
ATOM 217   H HG13   . VAL A 1 16  ? 14.725  -17.171 -66.036 1.00 47.75  ?  20  VAL A HG13   1 
ATOM 218   H HG21   . VAL A 1 16  ? 16.802  -16.393 -67.978 1.00 63.81  ?  20  VAL A HG21   1 
ATOM 219   H HG22   . VAL A 1 16  ? 15.447  -17.070 -68.458 1.00 63.81  ?  20  VAL A HG22   1 
ATOM 220   H HG23   . VAL A 1 16  ? 15.893  -15.671 -69.063 1.00 63.81  ?  20  VAL A HG23   1 
ATOM 221   N N      . PHE A 1 17  ? 13.328  -13.246 -66.221 1.00 55.81  ?  21  PHE A N      1 
ATOM 222   C CA     . PHE A 1 17  ? 12.710  -12.484 -65.142 1.00 42.50  ?  21  PHE A CA     1 
ATOM 223   C C      . PHE A 1 17  ? 11.218  -12.294 -65.380 1.00 57.37  ?  21  PHE A C      1 
ATOM 224   O O      . PHE A 1 17  ? 10.423  -12.330 -64.435 1.00 66.10  ?  21  PHE A O      1 
ATOM 225   C CB     . PHE A 1 17  ? 13.402  -11.131 -64.999 1.00 49.33  ?  21  PHE A CB     1 
ATOM 226   C CG     . PHE A 1 17  ? 14.627  -11.163 -64.136 1.00 42.24  ?  21  PHE A CG     1 
ATOM 227   C CD1    . PHE A 1 17  ? 15.793  -11.763 -64.579 1.00 39.78  ?  21  PHE A CD1    1 
ATOM 228   C CD2    . PHE A 1 17  ? 14.617  -10.579 -62.883 1.00 49.53  ?  21  PHE A CD2    1 
ATOM 229   C CE1    . PHE A 1 17  ? 16.919  -11.785 -63.783 1.00 29.34  ?  21  PHE A CE1    1 
ATOM 230   C CE2    . PHE A 1 17  ? 15.740  -10.600 -62.087 1.00 53.55  ?  21  PHE A CE2    1 
ATOM 231   C CZ     . PHE A 1 17  ? 16.891  -11.204 -62.538 1.00 38.17  ?  21  PHE A CZ     1 
ATOM 232   H H      . PHE A 1 17  ? 13.949  -12.827 -66.643 1.00 66.97  ?  21  PHE A H      1 
ATOM 233   H HA     . PHE A 1 17  ? 12.822  -12.968 -64.309 1.00 50.99  ?  21  PHE A HA     1 
ATOM 234   H HB2    . PHE A 1 17  ? 13.669  -10.822 -65.879 1.00 59.20  ?  21  PHE A HB2    1 
ATOM 235   H HB3    . PHE A 1 17  ? 12.779  -10.501 -64.605 1.00 59.20  ?  21  PHE A HB3    1 
ATOM 236   H HD1    . PHE A 1 17  ? 15.815  -12.158 -65.420 1.00 47.73  ?  21  PHE A HD1    1 
ATOM 237   H HD2    . PHE A 1 17  ? 13.841  -10.170 -62.573 1.00 59.44  ?  21  PHE A HD2    1 
ATOM 238   H HE1    . PHE A 1 17  ? 17.697  -12.194 -64.089 1.00 35.21  ?  21  PHE A HE1    1 
ATOM 239   H HE2    . PHE A 1 17  ? 15.721  -10.206 -61.244 1.00 64.26  ?  21  PHE A HE2    1 
ATOM 240   H HZ     . PHE A 1 17  ? 17.650  -11.218 -62.000 1.00 45.80  ?  21  PHE A HZ     1 
ATOM 241   N N      . GLN A 1 18  ? 10.818  -12.093 -66.636 1.00 56.57  ?  22  GLN A N      1 
ATOM 242   C CA     . GLN A 1 18  ? 9.412   -11.830 -66.922 1.00 59.23  ?  22  GLN A CA     1 
ATOM 243   C C      . GLN A 1 18  ? 8.534   -13.001 -66.499 1.00 63.04  ?  22  GLN A C      1 
ATOM 244   O O      . GLN A 1 18  ? 7.439   -12.803 -65.962 1.00 66.01  ?  22  GLN A O      1 
ATOM 245   C CB     . GLN A 1 18  ? 9.223   -11.533 -68.409 1.00 69.73  ?  22  GLN A CB     1 
ATOM 246   C CG     . GLN A 1 18  ? 7.826   -11.054 -68.763 1.00 56.21  ?  22  GLN A CG     1 
ATOM 247   C CD     . GLN A 1 18  ? 7.507   -9.702  -68.160 1.00 60.99  ?  22  GLN A CD     1 
ATOM 248   O OE1    . GLN A 1 18  ? 8.397   -8.875  -67.963 1.00 62.68  ?  22  GLN A OE1    1 
ATOM 249   N NE2    . GLN A 1 18  ? 6.236   -9.472  -67.855 1.00 70.44  ?  22  GLN A NE2    1 
ATOM 250   H H      . GLN A 1 18  ? 11.330  -12.103 -67.327 1.00 67.89  ?  22  GLN A H      1 
ATOM 251   H HA     . GLN A 1 18  ? 9.129   -11.048 -66.423 1.00 71.07  ?  22  GLN A HA     1 
ATOM 252   H HB2    . GLN A 1 18  ? 9.850   -10.841 -68.672 1.00 83.68  ?  22  GLN A HB2    1 
ATOM 253   H HB3    . GLN A 1 18  ? 9.397   -12.343 -68.915 1.00 83.68  ?  22  GLN A HB3    1 
ATOM 254   H HG2    . GLN A 1 18  ? 7.751   -10.979 -69.727 1.00 67.45  ?  22  GLN A HG2    1 
ATOM 255   H HG3    . GLN A 1 18  ? 7.177   -11.693 -68.428 1.00 67.45  ?  22  GLN A HG3    1 
ATOM 256   H HE21   . GLN A 1 18  ? 5.642   -10.077 -68.003 1.00 84.53  ?  22  GLN A HE21   1 
ATOM 257   H HE22   . GLN A 1 18  ? 6.006   -8.719  -67.510 1.00 84.53  ?  22  GLN A HE22   1 
ATOM 258   N N      . LYS A 1 19  ? 8.992   -14.228 -66.746 1.00 62.24  ?  23  LYS A N      1 
ATOM 259   C CA     . LYS A 1 19  ? 8.234   -15.421 -66.384 1.00 70.07  ?  23  LYS A CA     1 
ATOM 260   C C      . LYS A 1 19  ? 8.473   -15.865 -64.948 1.00 81.71  ?  23  LYS A C      1 
ATOM 261   O O      . LYS A 1 19  ? 7.550   -16.383 -64.308 1.00 83.28  ?  23  LYS A O      1 
ATOM 262   C CB     . LYS A 1 19  ? 8.582   -16.575 -67.331 1.00 71.55  ?  23  LYS A CB     1 
ATOM 263   C CG     . LYS A 1 19  ? 10.062  -16.950 -67.366 1.00 74.98  ?  23  LYS A CG     1 
ATOM 264   C CD     . LYS A 1 19  ? 10.324  -18.171 -68.249 1.00 72.12  ?  23  LYS A CD     1 
ATOM 265   C CE     . LYS A 1 19  ? 9.879   -17.947 -69.686 1.00 82.03  ?  23  LYS A CE     1 
ATOM 266   N NZ     . LYS A 1 19  ? 10.381  -19.016 -70.596 1.00 77.38  1  23  LYS A NZ     1 
ATOM 267   H H      . LYS A 1 19  ? 9.745   -14.396 -67.126 1.00 74.69  ?  23  LYS A H      1 
ATOM 268   H HA     . LYS A 1 19  ? 7.288   -15.231 -66.482 1.00 84.08  ?  23  LYS A HA     1 
ATOM 269   H HB2    . LYS A 1 19  ? 8.086   -17.362 -67.054 1.00 85.86  ?  23  LYS A HB2    1 
ATOM 270   H HB3    . LYS A 1 19  ? 8.320   -16.326 -68.231 1.00 85.86  ?  23  LYS A HB3    1 
ATOM 271   H HG2    . LYS A 1 19  ? 10.571  -16.205 -67.722 1.00 89.98  ?  23  LYS A HG2    1 
ATOM 272   H HG3    . LYS A 1 19  ? 10.360  -17.158 -66.467 1.00 89.98  ?  23  LYS A HG3    1 
ATOM 273   H HD2    . LYS A 1 19  ? 11.276  -18.361 -68.254 1.00 86.55  ?  23  LYS A HD2    1 
ATOM 274   H HD3    . LYS A 1 19  ? 9.834   -18.929 -67.895 1.00 86.55  ?  23  LYS A HD3    1 
ATOM 275   H HE2    . LYS A 1 19  ? 8.909   -17.948 -69.724 1.00 98.44  ?  23  LYS A HE2    1 
ATOM 276   H HE3    . LYS A 1 19  ? 10.225  -17.096 -69.999 1.00 98.44  ?  23  LYS A HE3    1 
ATOM 277   H HZ1    . LYS A 1 19  ? 10.107  -18.860 -71.428 1.00 92.86  ?  23  LYS A HZ1    1 
ATOM 278   H HZ2    . LYS A 1 19  ? 11.271  -19.032 -70.583 1.00 92.86  ?  23  LYS A HZ2    1 
ATOM 279   H HZ3    . LYS A 1 19  ? 10.073  -19.808 -70.332 1.00 92.86  ?  23  LYS A HZ3    1 
ATOM 280   N N      . ALA A 1 20  ? 9.688   -15.685 -64.429 1.00 82.41  ?  24  ALA A N      1 
ATOM 281   C CA     . ALA A 1 20  ? 9.959   -16.054 -63.045 1.00 68.53  ?  24  ALA A CA     1 
ATOM 282   C C      . ALA A 1 20  ? 9.075   -15.282 -62.081 1.00 62.37  ?  24  ALA A C      1 
ATOM 283   O O      . ALA A 1 20  ? 8.700   -15.806 -61.027 1.00 71.50  ?  24  ALA A O      1 
ATOM 284   C CB     . ALA A 1 20  ? 11.431  -15.814 -62.718 1.00 47.32  ?  24  ALA A CB     1 
ATOM 285   H H      . ALA A 1 20  ? 10.361  -15.356 -64.851 1.00 98.89  ?  24  ALA A H      1 
ATOM 286   H HA     . ALA A 1 20  ? 9.776   -16.999 -62.929 1.00 82.23  ?  24  ALA A HA     1 
ATOM 287   H HB1    . ALA A 1 20  ? 11.594  -16.064 -61.796 1.00 56.78  ?  24  ALA A HB1    1 
ATOM 288   H HB2    . ALA A 1 20  ? 11.978  -16.355 -63.310 1.00 56.78  ?  24  ALA A HB2    1 
ATOM 289   H HB3    . ALA A 1 20  ? 11.634  -14.874 -62.848 1.00 56.78  ?  24  ALA A HB3    1 
ATOM 290   N N      . GLN A 1 21  ? 8.725   -14.041 -62.423 1.00 67.66  ?  25  GLN A N      1 
ATOM 291   C CA     . GLN A 1 21  ? 7.885   -13.243 -61.540 1.00 75.25  ?  25  GLN A CA     1 
ATOM 292   C C      . GLN A 1 21  ? 6.514   -13.876 -61.354 1.00 77.45  ?  25  GLN A C      1 
ATOM 293   O O      . GLN A 1 21  ? 5.865   -13.661 -60.324 1.00 75.96  ?  25  GLN A O      1 
ATOM 294   C CB     . GLN A 1 21  ? 7.742   -11.826 -62.098 1.00 75.97  ?  25  GLN A CB     1 
ATOM 295   C CG     . GLN A 1 21  ? 6.528   -11.614 -62.994 1.00 83.37  ?  25  GLN A CG     1 
ATOM 296   C CD     . GLN A 1 21  ? 6.493   -10.227 -63.597 1.00 70.09  ?  25  GLN A CD     1 
ATOM 297   O OE1    . GLN A 1 21  ? 6.495   -9.229  -62.879 1.00 61.26  ?  25  GLN A OE1    1 
ATOM 298   N NE2    . GLN A 1 21  ? 6.466   -10.156 -64.921 1.00 78.00  ?  25  GLN A NE2    1 
ATOM 299   H H      . GLN A 1 21  ? 8.959   -13.646 -63.150 1.00 81.19  ?  25  GLN A H      1 
ATOM 300   H HA     . GLN A 1 21  ? 8.309   -13.182 -60.669 1.00 90.30  ?  25  GLN A HA     1 
ATOM 301   H HB2    . GLN A 1 21  ? 7.670   -11.207 -61.355 1.00 91.17  ?  25  GLN A HB2    1 
ATOM 302   H HB3    . GLN A 1 21  ? 8.532   -11.618 -62.620 1.00 91.17  ?  25  GLN A HB3    1 
ATOM 303   H HG2    . GLN A 1 21  ? 6.554   -12.257 -63.720 1.00 100.04 ?  25  GLN A HG2    1 
ATOM 304   H HG3    . GLN A 1 21  ? 5.722   -11.735 -62.470 1.00 100.04 ?  25  GLN A HG3    1 
ATOM 305   H HE21   . GLN A 1 21  ? 6.469   -10.877 -65.391 1.00 93.60  ?  25  GLN A HE21   1 
ATOM 306   H HE22   . GLN A 1 21  ? 6.446   -9.390  -65.310 1.00 93.60  ?  25  GLN A HE22   1 
ATOM 307   N N      . GLY A 1 22  ? 6.057   -14.655 -62.335 1.00 84.33  ?  26  GLY A N      1 
ATOM 308   C CA     . GLY A 1 22  ? 4.710   -15.191 -62.280 1.00 78.51  ?  26  GLY A CA     1 
ATOM 309   C C      . GLY A 1 22  ? 4.530   -16.299 -61.263 1.00 71.59  ?  26  GLY A C      1 
ATOM 310   O O      . GLY A 1 22  ? 3.464   -16.413 -60.652 1.00 75.31  ?  26  GLY A O      1 
ATOM 311   H H      . GLY A 1 22  ? 6.505   -14.882 -63.033 1.00 101.20 ?  26  GLY A H      1 
ATOM 312   H HA2    . GLY A 1 22  ? 4.092   -14.477 -62.061 1.00 94.22  ?  26  GLY A HA2    1 
ATOM 313   H HA3    . GLY A 1 22  ? 4.471   -15.541 -63.153 1.00 94.22  ?  26  GLY A HA3    1 
ATOM 314   N N      . SER A 1 23  ? 5.552   -17.128 -61.063 1.00 85.70  ?  27  SER A N      1 
ATOM 315   C CA     . SER A 1 23  ? 5.408   -18.283 -60.189 1.00 82.54  ?  27  SER A CA     1 
ATOM 316   C C      . SER A 1 23  ? 6.778   -18.847 -59.849 1.00 79.04  ?  27  SER A C      1 
ATOM 317   O O      . SER A 1 23  ? 7.779   -18.544 -60.503 1.00 77.48  ?  27  SER A O      1 
ATOM 318   C CB     . SER A 1 23  ? 4.545   -19.368 -60.841 1.00 68.70  ?  27  SER A CB     1 
ATOM 319   O OG     . SER A 1 23  ? 4.587   -20.565 -60.089 1.00 62.02  ?  27  SER A OG     1 
ATOM 320   H H      . SER A 1 23  ? 6.331   -17.044 -61.419 1.00 102.84 ?  27  SER A H      1 
ATOM 321   H HA     . SER A 1 23  ? 4.978   -18.009 -59.364 1.00 99.05  ?  27  SER A HA     1 
ATOM 322   H HB2    . SER A 1 23  ? 3.628   -19.056 -60.888 1.00 82.44  ?  27  SER A HB2    1 
ATOM 323   H HB3    . SER A 1 23  ? 4.882   -19.544 -61.734 1.00 82.44  ?  27  SER A HB3    1 
ATOM 324   H HG     . SER A 1 23  ? 4.111   -21.152 -60.456 1.00 74.42  ?  27  SER A HG     1 
ATOM 325   N N      . TYR A 1 24  ? 6.800   -19.682 -58.811 1.00 71.68  ?  28  TYR A N      1 
ATOM 326   C CA     . TYR A 1 24  ? 7.975   -20.474 -58.475 1.00 79.00  ?  28  TYR A CA     1 
ATOM 327   C C      . TYR A 1 24  ? 8.114   -21.711 -59.353 1.00 93.40  ?  28  TYR A C      1 
ATOM 328   O O      . TYR A 1 24  ? 9.019   -22.519 -59.117 1.00 86.00  ?  28  TYR A O      1 
ATOM 329   C CB     . TYR A 1 24  ? 7.918   -20.921 -57.011 1.00 71.12  ?  28  TYR A CB     1 
ATOM 330   C CG     . TYR A 1 24  ? 7.836   -19.810 -55.993 1.00 66.68  ?  28  TYR A CG     1 
ATOM 331   C CD1    . TYR A 1 24  ? 8.355   -18.551 -56.257 1.00 90.50  ?  28  TYR A CD1    1 
ATOM 332   C CD2    . TYR A 1 24  ? 7.241   -20.027 -54.757 1.00 83.32  ?  28  TYR A CD2    1 
ATOM 333   C CE1    . TYR A 1 24  ? 8.280   -17.540 -55.319 1.00 88.05  ?  28  TYR A CE1    1 
ATOM 334   C CE2    . TYR A 1 24  ? 7.162   -19.022 -53.816 1.00 94.87  ?  28  TYR A CE2    1 
ATOM 335   C CZ     . TYR A 1 24  ? 7.683   -17.781 -54.102 1.00 83.39  ?  28  TYR A CZ     1 
ATOM 336   O OH     . TYR A 1 24  ? 7.607   -16.776 -53.168 1.00 65.19  ?  28  TYR A OH     1 
ATOM 337   H H      . TYR A 1 24  ? 6.136   -19.806 -58.279 1.00 86.02  ?  28  TYR A H      1 
ATOM 338   H HA     . TYR A 1 24  ? 8.769   -19.930 -58.594 1.00 94.80  ?  28  TYR A HA     1 
ATOM 339   H HB2    . TYR A 1 24  ? 7.136   -21.483 -56.892 1.00 85.34  ?  28  TYR A HB2    1 
ATOM 340   H HB3    . TYR A 1 24  ? 8.718   -21.435 -56.816 1.00 85.34  ?  28  TYR A HB3    1 
ATOM 341   H HD1    . TYR A 1 24  ? 8.759   -18.385 -57.078 1.00 108.60 ?  28  TYR A HD1    1 
ATOM 342   H HD2    . TYR A 1 24  ? 6.888   -20.865 -54.561 1.00 99.98  ?  28  TYR A HD2    1 
ATOM 343   H HE1    . TYR A 1 24  ? 8.631   -16.700 -55.510 1.00 105.66 ?  28  TYR A HE1    1 
ATOM 344   H HE2    . TYR A 1 24  ? 6.759   -19.182 -52.993 1.00 113.84 ?  28  TYR A HE2    1 
ATOM 345   H HH     . TYR A 1 24  ? 7.222   -17.055 -52.476 1.00 78.23  ?  28  TYR A HH     1 
ATOM 346   N N      . ALA A 1 25  ? 7.246   -21.875 -60.352 1.00 94.34  ?  29  ALA A N      1 
ATOM 347   C CA     . ALA A 1 25  ? 7.161   -23.142 -61.071 1.00 82.18  ?  29  ALA A CA     1 
ATOM 348   C C      . ALA A 1 25  ? 8.479   -23.488 -61.751 1.00 85.05  ?  29  ALA A C      1 
ATOM 349   O O      . ALA A 1 25  ? 8.987   -24.607 -61.611 1.00 98.41  ?  29  ALA A O      1 
ATOM 350   C CB     . ALA A 1 25  ? 6.029   -23.080 -62.096 1.00 74.32  ?  29  ALA A CB     1 
ATOM 351   H H      . ALA A 1 25  ? 6.699   -21.271 -60.630 1.00 113.21 ?  29  ALA A H      1 
ATOM 352   H HA     . ALA A 1 25  ? 6.955   -23.849 -60.440 1.00 98.62  ?  29  ALA A HA     1 
ATOM 353   H HB1    . ALA A 1 25  ? 5.983   -23.927 -62.566 1.00 89.18  ?  29  ALA A HB1    1 
ATOM 354   H HB2    . ALA A 1 25  ? 5.193   -22.912 -61.633 1.00 89.18  ?  29  ALA A HB2    1 
ATOM 355   H HB3    . ALA A 1 25  ? 6.210   -22.362 -62.723 1.00 89.18  ?  29  ALA A HB3    1 
ATOM 356   N N      . GLY A 1 26  ? 9.048   -22.544 -62.493 1.00 74.86  ?  30  GLY A N      1 
ATOM 357   C CA     . GLY A 1 26  ? 10.224  -22.828 -63.290 1.00 74.63  ?  30  GLY A CA     1 
ATOM 358   C C      . GLY A 1 26  ? 11.503  -22.242 -62.734 1.00 67.13  ?  30  GLY A C      1 
ATOM 359   O O      . GLY A 1 26  ? 12.429  -21.940 -63.493 1.00 74.12  ?  30  GLY A O      1 
ATOM 360   H H      . GLY A 1 26  ? 8.769   -21.732 -62.550 1.00 89.83  ?  30  GLY A H      1 
ATOM 361   H HA2    . GLY A 1 26  ? 10.336  -23.789 -63.358 1.00 89.56  ?  30  GLY A HA2    1 
ATOM 362   H HA3    . GLY A 1 26  ? 10.094  -22.475 -64.184 1.00 89.56  ?  30  GLY A HA3    1 
ATOM 363   N N      . HIS A 1 27  ? 11.579  -22.081 -61.412 1.00 63.52  ?  31  HIS A N      1 
ATOM 364   C CA     . HIS A 1 27  ? 12.778  -21.497 -60.819 1.00 78.08  ?  31  HIS A CA     1 
ATOM 365   C C      . HIS A 1 27  ? 14.011  -22.333 -61.132 1.00 75.83  ?  31  HIS A C      1 
ATOM 366   O O      . HIS A 1 27  ? 15.072  -21.786 -61.451 1.00 74.79  ?  31  HIS A O      1 
ATOM 367   C CB     . HIS A 1 27  ? 12.599  -21.340 -59.309 1.00 81.20  ?  31  HIS A CB     1 
ATOM 368   C CG     . HIS A 1 27  ? 12.127  -19.980 -58.899 1.00 85.18  ?  31  HIS A CG     1 
ATOM 369   N ND1    . HIS A 1 27  ? 11.068  -19.344 -59.511 1.00 89.78  ?  31  HIS A ND1    1 
ATOM 370   C CD2    . HIS A 1 27  ? 12.574  -19.131 -57.945 1.00 78.44  ?  31  HIS A CD2    1 
ATOM 371   C CE1    . HIS A 1 27  ? 10.881  -18.164 -58.949 1.00 79.98  ?  31  HIS A CE1    1 
ATOM 372   N NE2    . HIS A 1 27  ? 11.782  -18.009 -57.995 1.00 77.06  ?  31  HIS A NE2    1 
ATOM 373   H H      . HIS A 1 27  ? 10.965  -22.296 -60.850 1.00 76.22  ?  31  HIS A H      1 
ATOM 374   H HA     . HIS A 1 27  ? 12.914  -20.614 -61.195 1.00 93.69  ?  31  HIS A HA     1 
ATOM 375   H HB2    . HIS A 1 27  ? 11.945  -21.987 -59.002 1.00 97.44  ?  31  HIS A HB2    1 
ATOM 376   H HB3    . HIS A 1 27  ? 13.451  -21.502 -58.875 1.00 97.44  ?  31  HIS A HB3    1 
ATOM 377   H HD2    . HIS A 1 27  ? 13.284  -19.279 -57.362 1.00 94.13  ?  31  HIS A HD2    1 
ATOM 378   H HE1    . HIS A 1 27  ? 10.227  -17.546 -59.185 1.00 95.98  ?  31  HIS A HE1    1 
ATOM 379   H HE2    . HIS A 1 27  ? 11.860  -17.319 -57.488 1.00 92.47  ?  31  HIS A HE2    1 
ATOM 380   N N      . ARG A 1 28  ? 13.893  -23.660 -61.060 1.00 73.66  ?  32  ARG A N      1 
ATOM 381   C CA     . ARG A 1 28  ? 15.034  -24.515 -61.374 1.00 63.26  ?  32  ARG A CA     1 
ATOM 382   C C      . ARG A 1 28  ? 15.521  -24.267 -62.794 1.00 64.91  ?  32  ARG A C      1 
ATOM 383   O O      . ARG A 1 28  ? 16.711  -24.024 -63.025 1.00 67.07  ?  32  ARG A O      1 
ATOM 384   C CB     . ARG A 1 28  ? 14.663  -25.985 -61.192 1.00 86.09  ?  32  ARG A CB     1 
ATOM 385   C CG     . ARG A 1 28  ? 14.050  -26.318 -59.847 1.00 86.10  ?  32  ARG A CG     1 
ATOM 386   C CD     . ARG A 1 28  ? 13.985  -27.819 -59.636 1.00 92.22  ?  32  ARG A CD     1 
ATOM 387   N NE     . ARG A 1 28  ? 15.297  -28.446 -59.794 1.00 96.01  ?  32  ARG A NE     1 
ATOM 388   C CZ     . ARG A 1 28  ? 15.702  -29.120 -60.869 1.00 87.15  ?  32  ARG A CZ     1 
ATOM 389   N NH1    . ARG A 1 28  ? 16.923  -29.635 -60.897 1.00 94.52  1  32  ARG A NH1    1 
ATOM 390   N NH2    . ARG A 1 28  ? 14.899  -29.295 -61.911 1.00 73.57  ?  32  ARG A NH2    1 
ATOM 391   H H      . ARG A 1 28  ? 13.177  -24.082 -60.837 1.00 88.39  ?  32  ARG A H      1 
ATOM 392   H HA     . ARG A 1 28  ? 15.761  -24.309 -60.765 1.00 75.91  ?  32  ARG A HA     1 
ATOM 393   H HB2    . ARG A 1 28  ? 14.021  -26.230 -61.877 1.00 103.31 ?  32  ARG A HB2    1 
ATOM 394   H HB3    . ARG A 1 28  ? 15.466  -26.521 -61.290 1.00 103.31 ?  32  ARG A HB3    1 
ATOM 395   H HG2    . ARG A 1 28  ? 14.594  -25.934 -59.142 1.00 103.32 ?  32  ARG A HG2    1 
ATOM 396   H HG3    . ARG A 1 28  ? 13.148  -25.965 -59.809 1.00 103.32 ?  32  ARG A HG3    1 
ATOM 397   H HD2    . ARG A 1 28  ? 13.668  -28.002 -58.738 1.00 110.67 ?  32  ARG A HD2    1 
ATOM 398   H HD3    . ARG A 1 28  ? 13.382  -28.208 -60.290 1.00 110.67 ?  32  ARG A HD3    1 
ATOM 399   H HE     . ARG A 1 28  ? 15.852  -28.372 -59.141 1.00 115.21 ?  32  ARG A HE     1 
ATOM 400   H HH11   . ARG A 1 28  ? 17.449  -29.530 -60.225 1.00 113.42 ?  32  ARG A HH11   1 
ATOM 401   H HH12   . ARG A 1 28  ? 17.188  -30.077 -61.585 1.00 113.42 ?  32  ARG A HH12   1 
ATOM 402   H HH21   . ARG A 1 28  ? 14.106  -28.964 -61.903 1.00 88.29  ?  32  ARG A HH21   1 
ATOM 403   H HH22   . ARG A 1 28  ? 15.174  -29.736 -62.596 1.00 88.29  ?  32  ARG A HH22   1 
ATOM 404   N N      . LYS A 1 29  ? 14.608  -24.334 -63.765 1.00 61.16  ?  33  LYS A N      1 
ATOM 405   C CA     . LYS A 1 29  ? 14.975  -24.088 -65.155 1.00 68.20  ?  33  LYS A CA     1 
ATOM 406   C C      . LYS A 1 29  ? 15.645  -22.731 -65.306 1.00 70.50  ?  33  LYS A C      1 
ATOM 407   O O      . LYS A 1 29  ? 16.732  -22.620 -65.883 1.00 58.64  ?  33  LYS A O      1 
ATOM 408   C CB     . LYS A 1 29  ? 13.731  -24.172 -66.039 1.00 73.73  ?  33  LYS A CB     1 
ATOM 409   C CG     . LYS A 1 29  ? 13.045  -25.528 -66.019 1.00 102.57 ?  33  LYS A CG     1 
ATOM 410   C CD     . LYS A 1 29  ? 11.724  -25.496 -66.774 1.00 107.86 ?  33  LYS A CD     1 
ATOM 411   C CE     . LYS A 1 29  ? 11.170  -26.894 -66.995 1.00 87.10  ?  33  LYS A CE     1 
ATOM 412   N NZ     . LYS A 1 29  ? 12.041  -27.713 -67.883 1.00 70.11  1  33  LYS A NZ     1 
ATOM 413   H H      . LYS A 1 29  ? 13.777  -24.518 -63.644 1.00 73.39  ?  33  LYS A H      1 
ATOM 414   H HA     . LYS A 1 29  ? 15.600  -24.770 -65.445 1.00 81.84  ?  33  LYS A HA     1 
ATOM 415   H HB2    . LYS A 1 29  ? 13.088  -23.511 -65.737 1.00 88.48  ?  33  LYS A HB2    1 
ATOM 416   H HB3    . LYS A 1 29  ? 13.987  -23.984 -66.956 1.00 88.48  ?  33  LYS A HB3    1 
ATOM 417   H HG2    . LYS A 1 29  ? 13.621  -26.184 -66.441 1.00 123.08 ?  33  LYS A HG2    1 
ATOM 418   H HG3    . LYS A 1 29  ? 12.864  -25.781 -65.100 1.00 123.08 ?  33  LYS A HG3    1 
ATOM 419   H HD2    . LYS A 1 29  ? 11.075  -24.990 -66.261 1.00 129.43 ?  33  LYS A HD2    1 
ATOM 420   H HD3    . LYS A 1 29  ? 11.862  -25.083 -67.641 1.00 129.43 ?  33  LYS A HD3    1 
ATOM 421   H HE2    . LYS A 1 29  ? 11.100  -27.347 -66.140 1.00 104.52 ?  33  LYS A HE2    1 
ATOM 422   H HE3    . LYS A 1 29  ? 10.296  -26.827 -67.410 1.00 104.52 ?  33  LYS A HE3    1 
ATOM 423   H HZ1    . LYS A 1 29  ? 11.689  -28.524 -67.991 1.00 84.13  ?  33  LYS A HZ1    1 
ATOM 424   H HZ2    . LYS A 1 29  ? 12.118  -27.322 -68.679 1.00 84.13  ?  33  LYS A HZ2    1 
ATOM 425   H HZ3    . LYS A 1 29  ? 12.851  -27.796 -67.522 1.00 84.13  ?  33  LYS A HZ3    1 
ATOM 426   N N      . HIS A 1 30  ? 15.009  -21.686 -64.777 1.00 73.28  ?  34  HIS A N      1 
ATOM 427   C CA     . HIS A 1 30  ? 15.546  -20.338 -64.912 1.00 54.24  ?  34  HIS A CA     1 
ATOM 428   C C      . HIS A 1 30  ? 16.984  -20.263 -64.418 1.00 51.16  ?  34  HIS A C      1 
ATOM 429   O O      . HIS A 1 30  ? 17.850  -19.691 -65.089 1.00 66.53  ?  34  HIS A O      1 
ATOM 430   C CB     . HIS A 1 30  ? 14.655  -19.357 -64.154 1.00 39.85  ?  34  HIS A CB     1 
ATOM 431   C CG     . HIS A 1 30  ? 13.238  -19.346 -64.633 1.00 43.80  ?  34  HIS A CG     1 
ATOM 432   N ND1    . HIS A 1 30  ? 12.200  -18.838 -63.881 1.00 59.93  ?  34  HIS A ND1    1 
ATOM 433   C CD2    . HIS A 1 30  ? 12.685  -19.788 -65.786 1.00 49.66  ?  34  HIS A CD2    1 
ATOM 434   C CE1    . HIS A 1 30  ? 11.069  -18.966 -64.552 1.00 59.94  ?  34  HIS A CE1    1 
ATOM 435   N NE2    . HIS A 1 30  ? 11.336  -19.539 -65.712 1.00 63.27  ?  34  HIS A NE2    1 
ATOM 436   H H      . HIS A 1 30  ? 14.270  -21.732 -64.339 1.00 87.94  ?  34  HIS A H      1 
ATOM 437   H HA     . HIS A 1 30  ? 15.538  -20.087 -65.849 1.00 65.09  ?  34  HIS A HA     1 
ATOM 438   H HB2    . HIS A 1 30  ? 14.650  -19.601 -63.215 1.00 47.82  ?  34  HIS A HB2    1 
ATOM 439   H HB3    . HIS A 1 30  ? 15.013  -18.462 -64.260 1.00 47.82  ?  34  HIS A HB3    1 
ATOM 440   H HD1    . HIS A 1 30  ? 12.277  -18.492 -63.098 1.00 71.92  ?  34  HIS A HD1    1 
ATOM 441   H HD2    . HIS A 1 30  ? 13.134  -20.185 -66.497 1.00 59.59  ?  34  HIS A HD2    1 
ATOM 442   H HE1    . HIS A 1 30  ? 10.229  -18.697 -64.259 1.00 71.93  ?  34  HIS A HE1    1 
ATOM 443   N N      . ILE A 1 31  ? 17.262  -20.847 -63.252 1.00 42.82  ?  35  ILE A N      1 
ATOM 444   C CA     . ILE A 1 31  ? 18.631  -20.875 -62.745 1.00 39.34  ?  35  ILE A CA     1 
ATOM 445   C C      . ILE A 1 31  ? 19.560  -21.495 -63.781 1.00 50.94  ?  35  ILE A C      1 
ATOM 446   O O      . ILE A 1 31  ? 20.640  -20.969 -64.070 1.00 46.98  ?  35  ILE A O      1 
ATOM 447   C CB     . ILE A 1 31  ? 18.693  -21.635 -61.408 1.00 52.89  ?  35  ILE A CB     1 
ATOM 448   C CG1    . ILE A 1 31  ? 17.870  -20.913 -60.337 1.00 47.02  ?  35  ILE A CG1    1 
ATOM 449   C CG2    . ILE A 1 31  ? 20.136  -21.818 -60.950 1.00 50.74  ?  35  ILE A CG2    1 
ATOM 450   C CD1    . ILE A 1 31  ? 18.419  -19.564 -59.920 1.00 69.82  ?  35  ILE A CD1    1 
ATOM 451   H H      . ILE A 1 31  ? 16.684  -21.229 -62.743 1.00 51.39  ?  35  ILE A H      1 
ATOM 452   H HA     . ILE A 1 31  ? 18.926  -19.965 -62.586 1.00 47.21  ?  35  ILE A HA     1 
ATOM 453   H HB     . ILE A 1 31  ? 18.306  -22.514 -61.544 1.00 63.47  ?  35  ILE A HB     1 
ATOM 454   H HG12   . ILE A 1 31  ? 16.973  -20.773 -60.679 1.00 56.42  ?  35  ILE A HG12   1 
ATOM 455   H HG13   . ILE A 1 31  ? 17.834  -21.473 -59.546 1.00 56.42  ?  35  ILE A HG13   1 
ATOM 456   H HG21   . ILE A 1 31  ? 20.140  -22.299 -60.107 1.00 60.89  ?  35  ILE A HG21   1 
ATOM 457   H HG22   . ILE A 1 31  ? 20.619  -22.324 -61.622 1.00 60.89  ?  35  ILE A HG22   1 
ATOM 458   H HG23   . ILE A 1 31  ? 20.544  -20.946 -60.835 1.00 60.89  ?  35  ILE A HG23   1 
ATOM 459   H HD11   . ILE A 1 31  ? 17.838  -19.183 -59.244 1.00 83.78  ?  35  ILE A HD11   1 
ATOM 460   H HD12   . ILE A 1 31  ? 19.312  -19.684 -59.561 1.00 83.78  ?  35  ILE A HD12   1 
ATOM 461   H HD13   . ILE A 1 31  ? 18.449  -18.983 -60.696 1.00 83.78  ?  35  ILE A HD13   1 
ATOM 462   N N      . ALA A 1 32  ? 19.150  -22.627 -64.356 1.00 64.46  ?  36  ALA A N      1 
ATOM 463   C CA     . ALA A 1 32  ? 19.984  -23.289 -65.353 1.00 66.14  ?  36  ALA A CA     1 
ATOM 464   C C      . ALA A 1 32  ? 20.127  -22.432 -66.602 1.00 65.01  ?  36  ALA A C      1 
ATOM 465   O O      . ALA A 1 32  ? 21.209  -22.363 -67.197 1.00 67.14  ?  36  ALA A O      1 
ATOM 466   C CB     . ALA A 1 32  ? 19.395  -24.654 -65.703 1.00 68.55  ?  36  ALA A CB     1 
ATOM 467   H H      . ALA A 1 32  ? 18.405  -23.024 -64.189 1.00 77.35  ?  36  ALA A H      1 
ATOM 468   H HA     . ALA A 1 32  ? 20.869  -23.429 -64.982 1.00 79.36  ?  36  ALA A HA     1 
ATOM 469   H HB1    . ALA A 1 32  ? 19.961  -25.081 -66.366 1.00 82.26  ?  36  ALA A HB1    1 
ATOM 470   H HB2    . ALA A 1 32  ? 19.359  -25.197 -64.900 1.00 82.26  ?  36  ALA A HB2    1 
ATOM 471   H HB3    . ALA A 1 32  ? 18.502  -24.530 -66.060 1.00 82.26  ?  36  ALA A HB3    1 
ATOM 472   N N      . VAL A 1 33  ? 19.046  -21.770 -67.015 1.00 70.90  ?  37  VAL A N      1 
ATOM 473   C CA     . VAL A 1 33  ? 19.108  -20.895 -68.182 1.00 66.39  ?  37  VAL A CA     1 
ATOM 474   C C      . VAL A 1 33  ? 20.129  -19.788 -67.955 1.00 56.34  ?  37  VAL A C      1 
ATOM 475   O O      . VAL A 1 33  ? 20.987  -19.526 -68.805 1.00 60.20  ?  37  VAL A O      1 
ATOM 476   C CB     . VAL A 1 33  ? 17.714  -20.322 -68.494 1.00 57.01  ?  37  VAL A CB     1 
ATOM 477   C CG1    . VAL A 1 33  ? 17.785  -19.309 -69.625 1.00 46.86  ?  37  VAL A CG1    1 
ATOM 478   C CG2    . VAL A 1 33  ? 16.753  -21.439 -68.859 1.00 81.39  ?  37  VAL A CG2    1 
ATOM 479   H H      . VAL A 1 33  ? 18.272  -21.811 -66.641 1.00 85.08  ?  37  VAL A H      1 
ATOM 480   H HA     . VAL A 1 33  ? 19.396  -21.414 -68.949 1.00 79.67  ?  37  VAL A HA     1 
ATOM 481   H HB     . VAL A 1 33  ? 17.370  -19.872 -67.707 1.00 68.42  ?  37  VAL A HB     1 
ATOM 482   H HG11   . VAL A 1 33  ? 16.894  -18.967 -69.798 1.00 56.24  ?  37  VAL A HG11   1 
ATOM 483   H HG12   . VAL A 1 33  ? 18.373  -18.584 -69.362 1.00 56.24  ?  37  VAL A HG12   1 
ATOM 484   H HG13   . VAL A 1 33  ? 18.132  -19.746 -70.418 1.00 56.24  ?  37  VAL A HG13   1 
ATOM 485   H HG21   . VAL A 1 33  ? 15.883  -21.057 -69.051 1.00 97.67  ?  37  VAL A HG21   1 
ATOM 486   H HG22   . VAL A 1 33  ? 17.092  -21.904 -69.640 1.00 97.67  ?  37  VAL A HG22   1 
ATOM 487   H HG23   . VAL A 1 33  ? 16.687  -22.054 -68.111 1.00 97.67  ?  37  VAL A HG23   1 
ATOM 488   N N      . LEU A 1 34  ? 20.056  -19.127 -66.798 1.00 64.14  ?  38  LEU A N      1 
ATOM 489   C CA     . LEU A 1 34  ? 20.939  -17.996 -66.535 1.00 52.56  ?  38  LEU A CA     1 
ATOM 490   C C      . LEU A 1 34  ? 22.402  -18.411 -66.616 1.00 53.02  ?  38  LEU A C      1 
ATOM 491   O O      . LEU A 1 34  ? 23.206  -17.763 -67.296 1.00 58.52  ?  38  LEU A O      1 
ATOM 492   C CB     . LEU A 1 34  ? 20.621  -17.393 -65.166 1.00 44.55  ?  38  LEU A CB     1 
ATOM 493   C CG     . LEU A 1 34  ? 19.251  -16.729 -65.008 1.00 38.63  ?  38  LEU A CG     1 
ATOM 494   C CD1    . LEU A 1 34  ? 19.079  -16.225 -63.587 1.00 46.62  ?  38  LEU A CD1    1 
ATOM 495   C CD2    . LEU A 1 34  ? 19.069  -15.592 -65.996 1.00 51.86  ?  38  LEU A CD2    1 
ATOM 496   H H      . LEU A 1 34  ? 19.511  -19.312 -66.159 1.00 76.97  ?  38  LEU A H      1 
ATOM 497   H HA     . LEU A 1 34  ? 20.784  -17.313 -67.206 1.00 63.07  ?  38  LEU A HA     1 
ATOM 498   H HB2    . LEU A 1 34  ? 20.676  -18.100 -64.504 1.00 53.46  ?  38  LEU A HB2    1 
ATOM 499   H HB3    . LEU A 1 34  ? 21.291  -16.719 -64.970 1.00 53.46  ?  38  LEU A HB3    1 
ATOM 500   H HG     . LEU A 1 34  ? 18.560  -17.388 -65.178 1.00 46.36  ?  38  LEU A HG     1 
ATOM 501   H HD11   . LEU A 1 34  ? 18.208  -15.808 -63.504 1.00 55.94  ?  38  LEU A HD11   1 
ATOM 502   H HD12   . LEU A 1 34  ? 19.148  -16.975 -62.976 1.00 55.94  ?  38  LEU A HD12   1 
ATOM 503   H HD13   . LEU A 1 34  ? 19.776  -15.577 -63.396 1.00 55.94  ?  38  LEU A HD13   1 
ATOM 504   H HD21   . LEU A 1 34  ? 18.192  -15.199 -65.865 1.00 62.23  ?  38  LEU A HD21   1 
ATOM 505   H HD22   . LEU A 1 34  ? 19.757  -14.927 -65.842 1.00 62.23  ?  38  LEU A HD22   1 
ATOM 506   H HD23   . LEU A 1 34  ? 19.143  -15.943 -66.898 1.00 62.23  ?  38  LEU A HD23   1 
ATOM 507   N N      . LYS A 1 35  ? 22.771  -19.493 -65.928 1.00 57.17  ?  39  LYS A N      1 
ATOM 508   C CA     . LYS A 1 35  ? 24.142  -19.981 -66.018 1.00 46.88  ?  39  LYS A CA     1 
ATOM 509   C C      . LYS A 1 35  ? 24.526  -20.264 -67.463 1.00 61.36  ?  39  LYS A C      1 
ATOM 510   O O      . LYS A 1 35  ? 25.675  -20.047 -67.864 1.00 63.61  ?  39  LYS A O      1 
ATOM 511   C CB     . LYS A 1 35  ? 24.310  -21.237 -65.165 1.00 66.15  ?  39  LYS A CB     1 
ATOM 512   C CG     . LYS A 1 35  ? 24.359  -20.974 -63.670 1.00 51.28  ?  39  LYS A CG     1 
ATOM 513   C CD     . LYS A 1 35  ? 24.502  -22.272 -62.895 1.00 57.03  ?  39  LYS A CD     1 
ATOM 514   C CE     . LYS A 1 35  ? 23.151  -22.879 -62.579 1.00 68.27  ?  39  LYS A CE     1 
ATOM 515   N NZ     . LYS A 1 35  ? 23.258  -24.289 -62.118 1.00 75.59  1  39  LYS A NZ     1 
ATOM 516   H H      . LYS A 1 35  ? 22.256  -19.951 -65.414 1.00 68.61  ?  39  LYS A H      1 
ATOM 517   H HA     . LYS A 1 35  ? 24.743  -19.302 -65.675 1.00 56.26  ?  39  LYS A HA     1 
ATOM 518   H HB2    . LYS A 1 35  ? 23.563  -21.831 -65.335 1.00 79.38  ?  39  LYS A HB2    1 
ATOM 519   H HB3    . LYS A 1 35  ? 25.140  -21.674 -65.414 1.00 79.38  ?  39  LYS A HB3    1 
ATOM 520   H HG2    . LYS A 1 35  ? 25.122  -20.411 -63.467 1.00 61.54  ?  39  LYS A HG2    1 
ATOM 521   H HG3    . LYS A 1 35  ? 23.536  -20.542 -63.393 1.00 61.54  ?  39  LYS A HG3    1 
ATOM 522   H HD2    . LYS A 1 35  ? 25.005  -22.909 -63.426 1.00 68.43  ?  39  LYS A HD2    1 
ATOM 523   H HD3    . LYS A 1 35  ? 24.960  -22.096 -62.058 1.00 68.43  ?  39  LYS A HD3    1 
ATOM 524   H HE2    . LYS A 1 35  ? 22.728  -22.363 -61.875 1.00 81.92  ?  39  LYS A HE2    1 
ATOM 525   H HE3    . LYS A 1 35  ? 22.602  -22.864 -63.378 1.00 81.92  ?  39  LYS A HE3    1 
ATOM 526   H HZ1    . LYS A 1 35  ? 22.449  -24.613 -61.941 1.00 90.71  ?  39  LYS A HZ1    1 
ATOM 527   H HZ2    . LYS A 1 35  ? 23.639  -24.787 -62.750 1.00 90.71  ?  39  LYS A HZ2    1 
ATOM 528   H HZ3    . LYS A 1 35  ? 23.754  -24.330 -61.380 1.00 90.71  ?  39  LYS A HZ3    1 
ATOM 529   N N      . LYS A 1 36  ? 23.574  -20.749 -68.262 1.00 68.38  ?  40  LYS A N      1 
ATOM 530   C CA     . LYS A 1 36  ? 23.840  -20.982 -69.677 1.00 70.89  ?  40  LYS A CA     1 
ATOM 531   C C      . LYS A 1 36  ? 24.019  -19.664 -70.419 1.00 70.67  ?  40  LYS A C      1 
ATOM 532   O O      . LYS A 1 36  ? 24.985  -19.489 -71.171 1.00 73.55  ?  40  LYS A O      1 
ATOM 533   C CB     . LYS A 1 36  ? 22.706  -21.805 -70.290 1.00 75.82  ?  40  LYS A CB     1 
ATOM 534   C CG     . LYS A 1 36  ? 22.758  -21.918 -71.805 1.00 80.20  ?  40  LYS A CG     1 
ATOM 535   C CD     . LYS A 1 36  ? 21.893  -23.067 -72.310 1.00 91.71  ?  40  LYS A CD     1 
ATOM 536   C CE     . LYS A 1 36  ? 20.410  -22.835 -72.048 1.00 88.31  ?  40  LYS A CE     1 
ATOM 537   N NZ     . LYS A 1 36  ? 19.607  -24.070 -72.277 1.00 84.93  1  40  LYS A NZ     1 
ATOM 538   H H      . LYS A 1 36  ? 22.776  -20.949 -68.011 1.00 82.06  ?  40  LYS A H      1 
ATOM 539   H HA     . LYS A 1 36  ? 24.661  -21.490 -69.766 1.00 85.06  ?  40  LYS A HA     1 
ATOM 540   H HB2    . LYS A 1 36  ? 22.743  -22.703 -69.926 1.00 90.98  ?  40  LYS A HB2    1 
ATOM 541   H HB3    . LYS A 1 36  ? 21.861  -21.391 -70.054 1.00 90.98  ?  40  LYS A HB3    1 
ATOM 542   H HG2    . LYS A 1 36  ? 22.429  -21.095 -72.199 1.00 96.25  ?  40  LYS A HG2    1 
ATOM 543   H HG3    . LYS A 1 36  ? 23.673  -22.081 -72.083 1.00 96.25  ?  40  LYS A HG3    1 
ATOM 544   H HD2    . LYS A 1 36  ? 22.018  -23.162 -73.268 1.00 110.05 ?  40  LYS A HD2    1 
ATOM 545   H HD3    . LYS A 1 36  ? 22.155  -23.884 -71.858 1.00 110.05 ?  40  LYS A HD3    1 
ATOM 546   H HE2    . LYS A 1 36  ? 20.288  -22.561 -71.126 1.00 105.97 ?  40  LYS A HE2    1 
ATOM 547   H HE3    . LYS A 1 36  ? 20.084  -22.146 -72.648 1.00 105.97 ?  40  LYS A HE3    1 
ATOM 548   H HZ1    . LYS A 1 36  ? 18.747  -23.907 -72.117 1.00 101.92 ?  40  LYS A HZ1    1 
ATOM 549   H HZ2    . LYS A 1 36  ? 19.698  -24.340 -73.120 1.00 101.92 ?  40  LYS A HZ2    1 
ATOM 550   H HZ3    . LYS A 1 36  ? 19.885  -24.718 -71.733 1.00 101.92 ?  40  LYS A HZ3    1 
ATOM 551   N N      . ILE A 1 37  ? 23.097  -18.720 -70.216 1.00 67.31  ?  41  ILE A N      1 
ATOM 552   C CA     . ILE A 1 37  ? 23.246  -17.398 -70.818 1.00 52.15  ?  41  ILE A CA     1 
ATOM 553   C C      . ILE A 1 37  ? 24.558  -16.768 -70.378 1.00 48.60  ?  41  ILE A C      1 
ATOM 554   O O      . ILE A 1 37  ? 25.268  -16.147 -71.177 1.00 45.91  ?  41  ILE A O      1 
ATOM 555   C CB     . ILE A 1 37  ? 22.042  -16.508 -70.457 1.00 45.33  ?  41  ILE A CB     1 
ATOM 556   C CG1    . ILE A 1 37  ? 20.751  -17.109 -71.017 1.00 63.90  ?  41  ILE A CG1    1 
ATOM 557   C CG2    . ILE A 1 37  ? 22.237  -15.098 -70.997 1.00 55.14  ?  41  ILE A CG2    1 
ATOM 558   C CD1    . ILE A 1 37  ? 19.493  -16.419 -70.539 1.00 58.98  ?  41  ILE A CD1    1 
ATOM 559   H H      . ILE A 1 37  ? 22.388  -18.819 -69.741 1.00 80.77  ?  41  ILE A H      1 
ATOM 560   H HA     . ILE A 1 37  ? 23.269  -17.492 -71.784 1.00 62.58  ?  41  ILE A HA     1 
ATOM 561   H HB     . ILE A 1 37  ? 21.969  -16.463 -69.491 1.00 54.40  ?  41  ILE A HB     1 
ATOM 562   H HG12   . ILE A 1 37  ? 20.772  -17.048 -71.985 1.00 76.68  ?  41  ILE A HG12   1 
ATOM 563   H HG13   . ILE A 1 37  ? 20.698  -18.040 -70.748 1.00 76.68  ?  41  ILE A HG13   1 
ATOM 564   H HG21   . ILE A 1 37  ? 21.467  -14.559 -70.757 1.00 66.17  ?  41  ILE A HG21   1 
ATOM 565   H HG22   . ILE A 1 37  ? 23.041  -14.720 -70.608 1.00 66.17  ?  41  ILE A HG22   1 
ATOM 566   H HG23   . ILE A 1 37  ? 22.324  -15.140 -71.962 1.00 66.17  ?  41  ILE A HG23   1 
ATOM 567   H HD11   . ILE A 1 37  ? 18.723  -16.856 -70.936 1.00 70.78  ?  41  ILE A HD11   1 
ATOM 568   H HD12   . ILE A 1 37  ? 19.447  -16.481 -69.572 1.00 70.78  ?  41  ILE A HD12   1 
ATOM 569   H HD13   . ILE A 1 37  ? 19.521  -15.488 -70.810 1.00 70.78  ?  41  ILE A HD13   1 
ATOM 570   N N      . GLN A 1 38  ? 24.903  -16.922 -69.100 1.00 57.53  ?  42  GLN A N      1 
ATOM 571   C CA     . GLN A 1 38  ? 26.149  -16.362 -68.593 1.00 52.11  ?  42  GLN A CA     1 
ATOM 572   C C      . GLN A 1 38  ? 27.351  -17.036 -69.241 1.00 65.91  ?  42  GLN A C      1 
ATOM 573   O O      . GLN A 1 38  ? 28.293  -16.364 -69.676 1.00 65.03  ?  42  GLN A O      1 
ATOM 574   C CB     . GLN A 1 38  ? 26.198  -16.508 -67.072 1.00 56.30  ?  42  GLN A CB     1 
ATOM 575   C CG     . GLN A 1 38  ? 27.304  -15.722 -66.394 1.00 48.38  ?  42  GLN A CG     1 
ATOM 576   C CD     . GLN A 1 38  ? 27.232  -15.816 -64.883 1.00 51.37  ?  42  GLN A CD     1 
ATOM 577   O OE1    . GLN A 1 38  ? 26.681  -16.769 -64.335 1.00 66.54  ?  42  GLN A OE1    1 
ATOM 578   N NE2    . GLN A 1 38  ? 27.781  -14.820 -64.201 1.00 53.61  ?  42  GLN A NE2    1 
ATOM 579   H H      . GLN A 1 38  ? 24.436  -17.343 -68.513 1.00 69.04  ?  42  GLN A H      1 
ATOM 580   H HA     . GLN A 1 38  ? 26.182  -15.416 -68.806 1.00 62.53  ?  42  GLN A HA     1 
ATOM 581   H HB2    . GLN A 1 38  ? 25.353  -16.203 -66.705 1.00 67.56  ?  42  GLN A HB2    1 
ATOM 582   H HB3    . GLN A 1 38  ? 26.328  -17.445 -66.855 1.00 67.56  ?  42  GLN A HB3    1 
ATOM 583   H HG2    . GLN A 1 38  ? 28.163  -16.073 -66.677 1.00 58.05  ?  42  GLN A HG2    1 
ATOM 584   H HG3    . GLN A 1 38  ? 27.228  -14.787 -66.642 1.00 58.05  ?  42  GLN A HG3    1 
ATOM 585   H HE21   . GLN A 1 38  ? 28.152  -14.166 -64.618 1.00 64.34  ?  42  GLN A HE21   1 
ATOM 586   H HE22   . GLN A 1 38  ? 27.765  -14.827 -63.341 1.00 64.34  ?  42  GLN A HE22   1 
ATOM 587   N N      . SER A 1 39  ? 27.330  -18.368 -69.324 1.00 71.77  ?  43  SER A N      1 
ATOM 588   C CA     . SER A 1 39  ? 28.460  -19.089 -69.897 1.00 63.98  ?  43  SER A CA     1 
ATOM 589   C C      . SER A 1 39  ? 28.666  -18.715 -71.359 1.00 66.78  ?  43  SER A C      1 
ATOM 590   O O      . SER A 1 39  ? 29.805  -18.628 -71.831 1.00 71.53  ?  43  SER A O      1 
ATOM 591   C CB     . SER A 1 39  ? 28.243  -20.594 -69.750 1.00 82.52  ?  43  SER A CB     1 
ATOM 592   O OG     . SER A 1 39  ? 28.048  -20.942 -68.390 1.00 84.91  ?  43  SER A OG     1 
ATOM 593   H H      . SER A 1 39  ? 26.682  -18.868 -69.060 1.00 86.12  ?  43  SER A H      1 
ATOM 594   H HA     . SER A 1 39  ? 29.266  -18.853 -69.411 1.00 76.78  ?  43  SER A HA     1 
ATOM 595   H HB2    . SER A 1 39  ? 27.458  -20.851 -70.257 1.00 99.02  ?  43  SER A HB2    1 
ATOM 596   H HB3    . SER A 1 39  ? 29.024  -21.061 -70.087 1.00 99.02  ?  43  SER A HB3    1 
ATOM 597   H HG     . SER A 1 39  ? 27.375  -20.543 -68.085 1.00 101.89 ?  43  SER A HG     1 
ATOM 598   N N      . LYS A 1 40  ? 27.575  -18.482 -72.090 1.00 65.30  ?  44  LYS A N      1 
ATOM 599   C CA     . LYS A 1 40  ? 27.684  -18.094 -73.491 1.00 73.62  ?  44  LYS A CA     1 
ATOM 600   C C      . LYS A 1 40  ? 28.118  -16.644 -73.644 1.00 73.15  ?  44  LYS A C      1 
ATOM 601   O O      . LYS A 1 40  ? 28.710  -16.282 -74.666 1.00 70.53  ?  44  LYS A O      1 
ATOM 602   C CB     . LYS A 1 40  ? 26.348  -18.320 -74.197 1.00 77.62  ?  44  LYS A CB     1 
ATOM 603   C CG     . LYS A 1 40  ? 26.344  -17.951 -75.672 1.00 79.21  ?  44  LYS A CG     1 
ATOM 604   C CD     . LYS A 1 40  ? 25.082  -18.448 -76.361 1.00 94.03  ?  44  LYS A CD     1 
ATOM 605   C CE     . LYS A 1 40  ? 23.841  -17.698 -75.892 1.00 89.91  ?  44  LYS A CE     1 
ATOM 606   N NZ     . LYS A 1 40  ? 22.591  -18.434 -76.223 1.00 83.79  1  44  LYS A NZ     1 
ATOM 607   H H      . LYS A 1 40  ? 26.768  -18.543 -71.799 1.00 78.37  ?  44  LYS A H      1 
ATOM 608   H HA     . LYS A 1 40  ? 28.349  -18.653 -73.922 1.00 88.35  ?  44  LYS A HA     1 
ATOM 609   H HB2    . LYS A 1 40  ? 26.114  -19.259 -74.128 1.00 93.15  ?  44  LYS A HB2    1 
ATOM 610   H HB3    . LYS A 1 40  ? 25.670  -17.782 -73.758 1.00 93.15  ?  44  LYS A HB3    1 
ATOM 611   H HG2    . LYS A 1 40  ? 26.381  -16.986 -75.762 1.00 95.06  ?  44  LYS A HG2    1 
ATOM 612   H HG3    . LYS A 1 40  ? 27.110  -18.359 -76.107 1.00 95.06  ?  44  LYS A HG3    1 
ATOM 613   H HD2    . LYS A 1 40  ? 25.169  -18.318 -77.318 1.00 112.84 ?  44  LYS A HD2    1 
ATOM 614   H HD3    . LYS A 1 40  ? 24.960  -19.389 -76.161 1.00 112.84 ?  44  LYS A HD3    1 
ATOM 615   H HE2    . LYS A 1 40  ? 23.881  -17.586 -74.930 1.00 107.90 ?  44  LYS A HE2    1 
ATOM 616   H HE3    . LYS A 1 40  ? 23.807  -16.833 -76.329 1.00 107.90 ?  44  LYS A HE3    1 
ATOM 617   H HZ1    . LYS A 1 40  ? 21.884  -17.974 -75.938 1.00 100.55 ?  44  LYS A HZ1    1 
ATOM 618   H HZ2    . LYS A 1 40  ? 22.528  -18.546 -77.103 1.00 100.55 ?  44  LYS A HZ2    1 
ATOM 619   H HZ3    . LYS A 1 40  ? 22.595  -19.232 -75.829 1.00 100.55 ?  44  LYS A HZ3    1 
ATOM 620   N N      . ALA A 1 41  ? 27.826  -15.803 -72.653 1.00 70.95  ?  45  ALA A N      1 
ATOM 621   C CA     . ALA A 1 41  ? 28.256  -14.413 -72.708 1.00 48.00  ?  45  ALA A CA     1 
ATOM 622   C C      . ALA A 1 41  ? 29.736  -14.259 -72.387 1.00 47.13  ?  45  ALA A C      1 
ATOM 623   O O      . ALA A 1 41  ? 30.402  -13.395 -72.964 1.00 64.27  ?  45  ALA A O      1 
ATOM 624   C CB     . ALA A 1 41  ? 27.424  -13.572 -71.743 1.00 43.65  ?  45  ALA A CB     1 
ATOM 625   H H      . ALA A 1 41  ? 27.385  -16.012 -71.945 1.00 85.14  ?  45  ALA A H      1 
ATOM 626   H HA     . ALA A 1 41  ? 28.108  -14.074 -73.605 1.00 57.60  ?  45  ALA A HA     1 
ATOM 627   H HB1    . ALA A 1 41  ? 27.722  -12.650 -71.791 1.00 52.38  ?  45  ALA A HB1    1 
ATOM 628   H HB2    . ALA A 1 41  ? 26.490  -13.632 -71.997 1.00 52.38  ?  45  ALA A HB2    1 
ATOM 629   H HB3    . ALA A 1 41  ? 27.546  -13.913 -70.843 1.00 52.38  ?  45  ALA A HB3    1 
ATOM 630   N N      . VAL A 1 42  ? 30.264  -15.077 -71.478 1.00 43.31  ?  46  VAL A N      1 
ATOM 631   C CA     . VAL A 1 42  ? 31.667  -14.959 -71.100 1.00 48.01  ?  46  VAL A CA     1 
ATOM 632   C C      . VAL A 1 42  ? 32.583  -15.568 -72.155 1.00 60.48  ?  46  VAL A C      1 
ATOM 633   O O      . VAL A 1 42  ? 33.757  -15.193 -72.246 1.00 51.89  ?  46  VAL A O      1 
ATOM 634   C CB     . VAL A 1 42  ? 31.904  -15.605 -69.726 1.00 46.69  ?  46  VAL A CB     1 
ATOM 635   C CG1    . VAL A 1 42  ? 31.059  -14.916 -68.670 1.00 48.78  ?  46  VAL A CG1    1 
ATOM 636   C CG2    . VAL A 1 42  ? 31.603  -17.100 -69.767 1.00 77.35  ?  46  VAL A CG2    1 
ATOM 637   H H      . VAL A 1 42  ? 29.835  -15.701 -71.070 1.00 51.97  ?  46  VAL A H      1 
ATOM 638   H HA     . VAL A 1 42  ? 31.890  -14.018 -71.025 1.00 57.61  ?  46  VAL A HA     1 
ATOM 639   H HB     . VAL A 1 42  ? 32.836  -15.494 -69.482 1.00 56.03  ?  46  VAL A HB     1 
ATOM 640   H HG11   . VAL A 1 42  ? 31.223  -15.337 -67.812 1.00 58.53  ?  46  VAL A HG11   1 
ATOM 641   H HG12   . VAL A 1 42  ? 31.305  -13.979 -68.631 1.00 58.53  ?  46  VAL A HG12   1 
ATOM 642   H HG13   . VAL A 1 42  ? 30.123  -15.003 -68.909 1.00 58.53  ?  46  VAL A HG13   1 
ATOM 643   H HG21   . VAL A 1 42  ? 31.761  -17.477 -68.887 1.00 92.82  ?  46  VAL A HG21   1 
ATOM 644   H HG22   . VAL A 1 42  ? 30.675  -17.228 -70.020 1.00 92.82  ?  46  VAL A HG22   1 
ATOM 645   H HG23   . VAL A 1 42  ? 32.185  -17.521 -70.418 1.00 92.82  ?  46  VAL A HG23   1 
ATOM 646   N N      . GLU A 1 43  ? 32.085  -16.514 -72.954 1.00 69.38  ?  47  GLU A N      1 
ATOM 647   C CA     . GLU A 1 43  ? 32.902  -17.056 -74.034 1.00 69.37  ?  47  GLU A CA     1 
ATOM 648   C C      . GLU A 1 43  ? 33.010  -16.068 -75.186 1.00 64.78  ?  47  GLU A C      1 
ATOM 649   O O      . GLU A 1 43  ? 34.022  -16.049 -75.894 1.00 73.73  ?  47  GLU A O      1 
ATOM 650   C CB     . GLU A 1 43  ? 32.327  -18.389 -74.524 1.00 70.08  ?  47  GLU A CB     1 
ATOM 651   C CG     . GLU A 1 43  ? 31.185  -18.276 -75.538 1.00 77.26  ?  47  GLU A CG     1 
ATOM 652   C CD     . GLU A 1 43  ? 30.718  -19.628 -76.042 1.00 82.80  ?  47  GLU A CD     1 
ATOM 653   O OE1    . GLU A 1 43  ? 31.058  -20.651 -75.412 1.00 106.97 ?  47  GLU A OE1    1 
ATOM 654   O OE2    . GLU A 1 43  ? 30.014  -19.670 -77.073 1.00 68.55  -1 47  GLU A OE2    1 
ATOM 655   H H      . GLU A 1 43  ? 31.296  -16.850 -72.893 1.00 83.25  ?  47  GLU A H      1 
ATOM 656   H HA     . GLU A 1 43  ? 33.797  -17.222 -73.699 1.00 83.25  ?  47  GLU A HA     1 
ATOM 657   H HB2    . GLU A 1 43  ? 33.040  -18.895 -74.944 1.00 84.10  ?  47  GLU A HB2    1 
ATOM 658   H HB3    . GLU A 1 43  ? 31.990  -18.878 -73.758 1.00 84.10  ?  47  GLU A HB3    1 
ATOM 659   H HG2    . GLU A 1 43  ? 30.430  -17.836 -75.116 1.00 92.71  ?  47  GLU A HG2    1 
ATOM 660   H HG3    . GLU A 1 43  ? 31.488  -17.759 -76.300 1.00 92.71  ?  47  GLU A HG3    1 
ATOM 661   N N      . GLN A 1 44  ? 31.985  -15.247 -75.382 1.00 60.42  ?  48  GLN A N      1 
ATOM 662   C CA     . GLN A 1 44  ? 31.982  -14.235 -76.426 1.00 61.05  ?  48  GLN A CA     1 
ATOM 663   C C      . GLN A 1 44  ? 32.590  -12.916 -75.967 1.00 68.97  ?  48  GLN A C      1 
ATOM 664   O O      . GLN A 1 44  ? 32.593  -11.951 -76.737 1.00 66.93  ?  48  GLN A O      1 
ATOM 665   C CB     . GLN A 1 44  ? 30.550  -14.004 -76.919 1.00 63.90  ?  48  GLN A CB     1 
ATOM 666   C CG     . GLN A 1 44  ? 29.894  -15.244 -77.504 1.00 69.97  ?  48  GLN A CG     1 
ATOM 667   C CD     . GLN A 1 44  ? 28.416  -15.053 -77.775 1.00 68.70  ?  48  GLN A CD     1 
ATOM 668   O OE1    . GLN A 1 44  ? 27.700  -14.451 -76.977 1.00 54.59  ?  48  GLN A OE1    1 
ATOM 669   N NE2    . GLN A 1 44  ? 27.952  -15.566 -78.907 1.00 68.85  ?  48  GLN A NE2    1 
ATOM 670   H H      . GLN A 1 44  ? 31.265  -15.258 -74.912 1.00 72.50  ?  48  GLN A H      1 
ATOM 671   H HA     . GLN A 1 44  ? 32.505  -14.558 -77.176 1.00 73.26  ?  48  GLN A HA     1 
ATOM 672   H HB2    . GLN A 1 44  ? 30.007  -13.706 -76.172 1.00 76.68  ?  48  GLN A HB2    1 
ATOM 673   H HB3    . GLN A 1 44  ? 30.563  -13.322 -77.609 1.00 76.68  ?  48  GLN A HB3    1 
ATOM 674   H HG2    . GLN A 1 44  ? 30.327  -15.464 -78.344 1.00 83.97  ?  48  GLN A HG2    1 
ATOM 675   H HG3    . GLN A 1 44  ? 29.992  -15.979 -76.878 1.00 83.97  ?  48  GLN A HG3    1 
ATOM 676   H HE21   . GLN A 1 44  ? 28.484  -15.980 -79.441 1.00 82.61  ?  48  GLN A HE21   1 
ATOM 677   H HE22   . GLN A 1 44  ? 27.120  -15.484 -79.106 1.00 82.61  ?  48  GLN A HE22   1 
ATOM 678   N N      . GLY A 1 45  ? 33.103  -12.852 -74.738 1.00 77.42  ?  49  GLY A N      1 
ATOM 679   C CA     . GLY A 1 45  ? 33.720  -11.652 -74.218 1.00 52.22  ?  49  GLY A CA     1 
ATOM 680   C C      . GLY A 1 45  ? 32.775  -10.691 -73.532 1.00 52.21  ?  49  GLY A C      1 
ATOM 681   O O      . GLY A 1 45  ? 33.241  -9.780  -72.837 1.00 63.90  ?  49  GLY A O      1 
ATOM 682   H H      . GLY A 1 45  ? 33.101  -13.508 -74.182 1.00 92.90  ?  49  GLY A H      1 
ATOM 683   H HA2    . GLY A 1 45  ? 34.406  -11.903 -73.579 1.00 62.66  ?  49  GLY A HA2    1 
ATOM 684   H HA3    . GLY A 1 45  ? 34.150  -11.179 -74.948 1.00 62.66  ?  49  GLY A HA3    1 
ATOM 685   N N      . TYR A 1 46  ? 31.467  -10.866 -73.693 1.00 44.09  ?  50  TYR A N      1 
ATOM 686   C CA     . TYR A 1 46  ? 30.479  -9.939  -73.143 1.00 45.23  ?  50  TYR A CA     1 
ATOM 687   C C      . TYR A 1 46  ? 30.148  -10.215 -71.682 1.00 55.15  ?  50  TYR A C      1 
ATOM 688   O O      . TYR A 1 46  ? 28.986  -10.121 -71.281 1.00 62.75  ?  50  TYR A O      1 
ATOM 689   C CB     . TYR A 1 46  ? 29.218  -9.995  -74.001 1.00 46.60  ?  50  TYR A CB     1 
ATOM 690   C CG     . TYR A 1 46  ? 29.378  -9.370  -75.367 1.00 49.92  ?  50  TYR A CG     1 
ATOM 691   C CD1    . TYR A 1 46  ? 28.898  -8.094  -75.627 1.00 67.96  ?  50  TYR A CD1    1 
ATOM 692   C CD2    . TYR A 1 46  ? 30.012  -10.052 -76.394 1.00 61.48  ?  50  TYR A CD2    1 
ATOM 693   C CE1    . TYR A 1 46  ? 29.043  -7.517  -76.872 1.00 74.63  ?  50  TYR A CE1    1 
ATOM 694   C CE2    . TYR A 1 46  ? 30.162  -9.483  -77.642 1.00 73.60  ?  50  TYR A CE2    1 
ATOM 695   C CZ     . TYR A 1 46  ? 29.676  -8.215  -77.875 1.00 68.52  ?  50  TYR A CZ     1 
ATOM 696   O OH     . TYR A 1 46  ? 29.824  -7.646  -79.117 1.00 63.70  ?  50  TYR A OH     1 
ATOM 697   H H      . TYR A 1 46  ? 31.120  -11.524 -74.123 1.00 52.90  ?  50  TYR A H      1 
ATOM 698   H HA     . TYR A 1 46  ? 30.834  -9.038  -73.199 1.00 54.27  ?  50  TYR A HA     1 
ATOM 699   H HB2    . TYR A 1 46  ? 28.968  -10.924 -74.128 1.00 55.91  ?  50  TYR A HB2    1 
ATOM 700   H HB3    . TYR A 1 46  ? 28.506  -9.523  -73.541 1.00 55.91  ?  50  TYR A HB3    1 
ATOM 701   H HD1    . TYR A 1 46  ? 28.471  -7.620  -74.951 1.00 81.55  ?  50  TYR A HD1    1 
ATOM 702   H HD2    . TYR A 1 46  ? 30.341  -10.908 -76.240 1.00 73.78  ?  50  TYR A HD2    1 
ATOM 703   H HE1    . TYR A 1 46  ? 28.716  -6.661  -77.032 1.00 89.55  ?  50  TYR A HE1    1 
ATOM 704   H HE2    . TYR A 1 46  ? 30.589  -9.953  -78.322 1.00 88.32  ?  50  TYR A HE2    1 
ATOM 705   H HH     . TYR A 1 46  ? 30.224  -8.176  -79.631 1.00 76.44  ?  50  TYR A HH     1 
ATOM 706   N N      . GLU A 1 47  ? 31.146  -10.553 -70.864 1.00 56.03  ?  51  GLU A N      1 
ATOM 707   C CA     . GLU A 1 47  ? 30.887  -10.796 -69.449 1.00 54.30  ?  51  GLU A CA     1 
ATOM 708   C C      . GLU A 1 47  ? 30.226  -9.587  -68.805 1.00 59.54  ?  51  GLU A C      1 
ATOM 709   O O      . GLU A 1 47  ? 29.204  -9.711  -68.120 1.00 62.62  ?  51  GLU A O      1 
ATOM 710   C CB     . GLU A 1 47  ? 32.190  -11.141 -68.727 1.00 61.73  ?  51  GLU A CB     1 
ATOM 711   C CG     . GLU A 1 47  ? 32.018  -11.398 -67.235 1.00 62.75  ?  51  GLU A CG     1 
ATOM 712   C CD     . GLU A 1 47  ? 33.336  -11.617 -66.525 1.00 67.01  ?  51  GLU A CD     1 
ATOM 713   O OE1    . GLU A 1 47  ? 33.388  -11.417 -65.294 1.00 63.79  ?  51  GLU A OE1    1 
ATOM 714   O OE2    . GLU A 1 47  ? 34.320  -11.985 -67.197 1.00 61.55  -1 51  GLU A OE2    1 
ATOM 715   H H      . GLU A 1 47  ? 31.968  -10.647 -71.100 1.00 67.23  ?  51  GLU A H      1 
ATOM 716   H HA     . GLU A 1 47  ? 30.285  -11.552 -69.362 1.00 65.16  ?  51  GLU A HA     1 
ATOM 717   H HB2    . GLU A 1 47  ? 32.565  -11.942 -69.124 1.00 74.08  ?  51  GLU A HB2    1 
ATOM 718   H HB3    . GLU A 1 47  ? 32.809  -10.401 -68.830 1.00 74.08  ?  51  GLU A HB3    1 
ATOM 719   H HG2    . GLU A 1 47  ? 31.583  -10.632 -66.830 1.00 75.29  ?  51  GLU A HG2    1 
ATOM 720   H HG3    . GLU A 1 47  ? 31.475  -12.193 -67.112 1.00 75.29  ?  51  GLU A HG3    1 
ATOM 721   N N      . ASP A 1 48  ? 30.796  -8.401  -69.021 1.00 66.57  ?  52  ASP A N      1 
ATOM 722   C CA     . ASP A 1 48  ? 30.276  -7.199  -68.382 1.00 55.87  ?  52  ASP A CA     1 
ATOM 723   C C      . ASP A 1 48  ? 28.874  -6.862  -68.871 1.00 52.20  ?  52  ASP A C      1 
ATOM 724   O O      . ASP A 1 48  ? 28.099  -6.237  -68.140 1.00 46.32  ?  52  ASP A O      1 
ATOM 725   C CB     . ASP A 1 48  ? 31.223  -6.030  -68.635 1.00 51.51  ?  52  ASP A CB     1 
ATOM 726   C CG     . ASP A 1 48  ? 32.639  -6.325  -68.188 1.00 59.09  ?  52  ASP A CG     1 
ATOM 727   O OD1    . ASP A 1 48  ? 33.395  -6.933  -68.973 1.00 73.76  ?  52  ASP A OD1    1 
ATOM 728   O OD2    . ASP A 1 48  ? 32.996  -5.954  -67.051 1.00 69.35  -1 52  ASP A OD2    1 
ATOM 729   H H      . ASP A 1 48  ? 31.479  -8.269  -69.527 1.00 79.89  ?  52  ASP A H      1 
ATOM 730   H HA     . ASP A 1 48  ? 30.230  -7.346  -67.424 1.00 67.04  ?  52  ASP A HA     1 
ATOM 731   H HB2    . ASP A 1 48  ? 31.241  -5.836  -69.585 1.00 61.81  ?  52  ASP A HB2    1 
ATOM 732   H HB3    . ASP A 1 48  ? 30.908  -5.255  -68.143 1.00 61.81  ?  52  ASP A HB3    1 
ATOM 733   N N      . ALA A 1 49  ? 28.529  -7.263  -70.096 1.00 58.63  ?  53  ALA A N      1 
ATOM 734   C CA     . ALA A 1 49  ? 27.186  -6.999  -70.599 1.00 53.66  ?  53  ALA A CA     1 
ATOM 735   C C      . ALA A 1 49  ? 26.141  -7.757  -69.794 1.00 46.51  ?  53  ALA A C      1 
ATOM 736   O O      . ALA A 1 49  ? 25.053  -7.235  -69.530 1.00 47.57  ?  53  ALA A O      1 
ATOM 737   C CB     . ALA A 1 49  ? 27.098  -7.370  -72.077 1.00 70.51  ?  53  ALA A CB     1 
ATOM 738   H H      . ALA A 1 49  ? 29.044  -7.681  -70.643 1.00 70.36  ?  53  ALA A H      1 
ATOM 739   H HA     . ALA A 1 49  ? 26.999  -6.050  -70.517 1.00 64.39  ?  53  ALA A HA     1 
ATOM 740   H HB1    . ALA A 1 49  ? 26.199  -7.188  -72.395 1.00 84.61  ?  53  ALA A HB1    1 
ATOM 741   H HB2    . ALA A 1 49  ? 27.739  -6.840  -72.575 1.00 84.61  ?  53  ALA A HB2    1 
ATOM 742   H HB3    . ALA A 1 49  ? 27.300  -8.314  -72.178 1.00 84.61  ?  53  ALA A HB3    1 
ATOM 743   N N      . PHE A 1 50  ? 26.452  -8.991  -69.397 1.00 49.49  ?  54  PHE A N      1 
ATOM 744   C CA     . PHE A 1 50  ? 25.528  -9.758  -68.570 1.00 65.93  ?  54  PHE A CA     1 
ATOM 745   C C      . PHE A 1 50  ? 25.369  -9.116  -67.198 1.00 60.36  ?  54  PHE A C      1 
ATOM 746   O O      . PHE A 1 50  ? 24.247  -8.891  -66.730 1.00 53.12  ?  54  PHE A O      1 
ATOM 747   C CB     . PHE A 1 50  ? 26.018  -11.200 -68.439 1.00 56.75  ?  54  PHE A CB     1 
ATOM 748   C CG     . PHE A 1 50  ? 25.155  -12.056 -67.558 1.00 50.33  ?  54  PHE A CG     1 
ATOM 749   C CD1    . PHE A 1 50  ? 23.912  -12.484 -67.991 1.00 49.11  ?  54  PHE A CD1    1 
ATOM 750   C CD2    . PHE A 1 50  ? 25.589  -12.437 -66.301 1.00 50.40  ?  54  PHE A CD2    1 
ATOM 751   C CE1    . PHE A 1 50  ? 23.118  -13.270 -67.184 1.00 50.68  ?  54  PHE A CE1    1 
ATOM 752   C CE2    . PHE A 1 50  ? 24.797  -13.224 -65.491 1.00 50.48  ?  54  PHE A CE2    1 
ATOM 753   C CZ     . PHE A 1 50  ? 23.561  -13.641 -65.934 1.00 51.33  ?  54  PHE A CZ     1 
ATOM 754   H H      . PHE A 1 50  ? 27.183  -9.401  -69.591 1.00 59.39  ?  54  PHE A H      1 
ATOM 755   H HA     . PHE A 1 50  ? 24.657  -9.773  -68.997 1.00 79.11  ?  54  PHE A HA     1 
ATOM 756   H HB2    . PHE A 1 50  ? 26.036  -11.606 -69.320 1.00 68.09  ?  54  PHE A HB2    1 
ATOM 757   H HB3    . PHE A 1 50  ? 26.912  -11.194 -68.062 1.00 68.09  ?  54  PHE A HB3    1 
ATOM 758   H HD1    . PHE A 1 50  ? 23.608  -12.236 -68.834 1.00 58.93  ?  54  PHE A HD1    1 
ATOM 759   H HD2    . PHE A 1 50  ? 26.422  -12.157 -65.997 1.00 60.48  ?  54  PHE A HD2    1 
ATOM 760   H HE1    . PHE A 1 50  ? 22.284  -13.551 -67.484 1.00 60.81  ?  54  PHE A HE1    1 
ATOM 761   H HE2    . PHE A 1 50  ? 25.097  -13.473 -64.647 1.00 60.57  ?  54  PHE A HE2    1 
ATOM 762   H HZ     . PHE A 1 50  ? 23.026  -14.172 -65.389 1.00 61.60  ?  54  PHE A HZ     1 
ATOM 763   N N      . ASN A 1 51  ? 26.488  -8.810  -66.539 1.00 53.42  ?  55  ASN A N      1 
ATOM 764   C CA     . ASN A 1 51  ? 26.426  -8.193  -65.218 1.00 47.44  ?  55  ASN A CA     1 
ATOM 765   C C      . ASN A 1 51  ? 25.652  -6.883  -65.257 1.00 61.47  ?  55  ASN A C      1 
ATOM 766   O O      . ASN A 1 51  ? 24.948  -6.539  -64.301 1.00 57.00  ?  55  ASN A O      1 
ATOM 767   C CB     . ASN A 1 51  ? 27.838  -7.959  -64.688 1.00 50.24  ?  55  ASN A CB     1 
ATOM 768   C CG     . ASN A 1 51  ? 28.669  -9.221  -64.676 1.00 52.89  ?  55  ASN A CG     1 
ATOM 769   O OD1    . ASN A 1 51  ? 28.274  -10.242 -65.235 1.00 61.10  ?  55  ASN A OD1    1 
ATOM 770   N ND2    . ASN A 1 51  ? 29.832  -9.157  -64.043 1.00 56.45  ?  55  ASN A ND2    1 
ATOM 771   H H      . ASN A 1 51  ? 27.285  -8.947  -66.832 1.00 64.10  ?  55  ASN A H      1 
ATOM 772   H HA     . ASN A 1 51  ? 25.970  -8.795  -64.608 1.00 56.93  ?  55  ASN A HA     1 
ATOM 773   H HB2    . ASN A 1 51  ? 28.285  -7.311  -65.254 1.00 60.28  ?  55  ASN A HB2    1 
ATOM 774   H HB3    . ASN A 1 51  ? 27.784  -7.626  -63.779 1.00 60.28  ?  55  ASN A HB3    1 
ATOM 775   H HD21   . ASN A 1 51  ? 30.341  -9.850  -64.009 1.00 67.74  ?  55  ASN A HD21   1 
ATOM 776   H HD22   . ASN A 1 51  ? 30.078  -8.424  -63.668 1.00 67.74  ?  55  ASN A HD22   1 
ATOM 777   N N      . PHE A 1 52  ? 25.769  -6.137  -66.356 1.00 64.06  ?  56  PHE A N      1 
ATOM 778   C CA     . PHE A 1 52  ? 25.101  -4.843  -66.449 1.00 51.72  ?  56  PHE A CA     1 
ATOM 779   C C      . PHE A 1 52  ? 23.588  -5.011  -66.470 1.00 53.50  ?  56  PHE A C      1 
ATOM 780   O O      . PHE A 1 52  ? 22.880  -4.490  -65.602 1.00 53.04  ?  56  PHE A O      1 
ATOM 781   C CB     . PHE A 1 52  ? 25.580  -4.098  -67.696 1.00 62.47  ?  56  PHE A CB     1 
ATOM 782   C CG     . PHE A 1 52  ? 24.983  -2.727  -67.852 1.00 68.98  ?  56  PHE A CG     1 
ATOM 783   C CD1    . PHE A 1 52  ? 23.740  -2.560  -68.441 1.00 71.29  ?  56  PHE A CD1    1 
ATOM 784   C CD2    . PHE A 1 52  ? 25.668  -1.605  -67.419 1.00 67.44  ?  56  PHE A CD2    1 
ATOM 785   C CE1    . PHE A 1 52  ? 23.190  -1.302  -68.587 1.00 56.20  ?  56  PHE A CE1    1 
ATOM 786   C CE2    . PHE A 1 52  ? 25.122  -0.345  -67.564 1.00 77.52  ?  56  PHE A CE2    1 
ATOM 787   C CZ     . PHE A 1 52  ? 23.882  -0.194  -68.149 1.00 69.59  ?  56  PHE A CZ     1 
ATOM 788   H H      . PHE A 1 52  ? 26.224  -6.355  -67.052 1.00 76.87  ?  56  PHE A H      1 
ATOM 789   H HA     . PHE A 1 52  ? 25.333  -4.310  -65.673 1.00 62.06  ?  56  PHE A HA     1 
ATOM 790   H HB2    . PHE A 1 52  ? 26.544  -3.998  -67.649 1.00 74.96  ?  56  PHE A HB2    1 
ATOM 791   H HB3    . PHE A 1 52  ? 25.342  -4.617  -68.481 1.00 74.96  ?  56  PHE A HB3    1 
ATOM 792   H HD1    . PHE A 1 52  ? 23.268  -3.304  -68.737 1.00 85.55  ?  56  PHE A HD1    1 
ATOM 793   H HD2    . PHE A 1 52  ? 26.504  -1.702  -67.023 1.00 80.92  ?  56  PHE A HD2    1 
ATOM 794   H HE1    . PHE A 1 52  ? 22.354  -1.202  -68.982 1.00 67.44  ?  56  PHE A HE1    1 
ATOM 795   H HE2    . PHE A 1 52  ? 25.591  0.402   -67.267 1.00 93.03  ?  56  PHE A HE2    1 
ATOM 796   H HZ     . PHE A 1 52  ? 23.513  0.654   -68.247 1.00 83.51  ?  56  PHE A HZ     1 
ATOM 797   N N      . TRP A 1 53  ? 23.072  -5.741  -67.460 1.00 66.28  ?  57  TRP A N      1 
ATOM 798   C CA     . TRP A 1 53  ? 21.626  -5.875  -67.599 1.00 67.23  ?  57  TRP A CA     1 
ATOM 799   C C      . TRP A 1 53  ? 21.015  -6.495  -66.351 1.00 56.50  ?  57  TRP A C      1 
ATOM 800   O O      . TRP A 1 53  ? 20.074  -5.944  -65.769 1.00 65.02  ?  57  TRP A O      1 
ATOM 801   C CB     . TRP A 1 53  ? 21.293  -6.706  -68.836 1.00 63.33  ?  57  TRP A CB     1 
ATOM 802   C CG     . TRP A 1 53  ? 21.638  -6.021  -70.115 1.00 69.34  ?  57  TRP A CG     1 
ATOM 803   C CD1    . TRP A 1 53  ? 22.544  -6.432  -71.045 1.00 70.54  ?  57  TRP A CD1    1 
ATOM 804   C CD2    . TRP A 1 53  ? 21.088  -4.794  -70.603 1.00 68.76  ?  57  TRP A CD2    1 
ATOM 805   N NE1    . TRP A 1 53  ? 22.590  -5.539  -72.087 1.00 78.74  ?  57  TRP A NE1    1 
ATOM 806   C CE2    . TRP A 1 53  ? 21.705  -4.523  -71.839 1.00 81.02  ?  57  TRP A CE2    1 
ATOM 807   C CE3    . TRP A 1 53  ? 20.133  -3.898  -70.115 1.00 60.92  ?  57  TRP A CE3    1 
ATOM 808   C CZ2    . TRP A 1 53  ? 21.397  -3.395  -72.596 1.00 88.06  ?  57  TRP A CZ2    1 
ATOM 809   C CZ3    . TRP A 1 53  ? 19.828  -2.780  -70.866 1.00 63.45  ?  57  TRP A CZ3    1 
ATOM 810   C CH2    . TRP A 1 53  ? 20.458  -2.537  -72.093 1.00 79.23  ?  57  TRP A CH2    1 
ATOM 811   H H      . TRP A 1 53  ? 23.530  -6.161  -68.054 1.00 79.53  ?  57  TRP A H      1 
ATOM 812   H HA     . TRP A 1 53  ? 21.238  -4.994  -67.716 1.00 80.68  ?  57  TRP A HA     1 
ATOM 813   H HB2    . TRP A 1 53  ? 21.790  -7.538  -68.799 1.00 75.99  ?  57  TRP A HB2    1 
ATOM 814   H HB3    . TRP A 1 53  ? 20.340  -6.890  -68.843 1.00 75.99  ?  57  TRP A HB3    1 
ATOM 815   H HD1    . TRP A 1 53  ? 23.055  -7.207  -70.985 1.00 84.65  ?  57  TRP A HD1    1 
ATOM 816   H HE1    . TRP A 1 53  ? 23.092  -5.607  -72.782 1.00 94.48  ?  57  TRP A HE1    1 
ATOM 817   H HE3    . TRP A 1 53  ? 19.710  -4.052  -69.302 1.00 73.10  ?  57  TRP A HE3    1 
ATOM 818   H HZ2    . TRP A 1 53  ? 21.814  -3.231  -73.411 1.00 105.68 ?  57  TRP A HZ2    1 
ATOM 819   H HZ3    . TRP A 1 53  ? 19.194  -2.177  -70.552 1.00 76.14  ?  57  TRP A HZ3    1 
ATOM 820   H HH2    . TRP A 1 53  ? 20.233  -1.775  -72.577 1.00 95.08  ?  57  TRP A HH2    1 
ATOM 821   N N      . PHE A 1 54  ? 21.546  -7.643  -65.923 1.00 43.04  ?  58  PHE A N      1 
ATOM 822   C CA     . PHE A 1 54  ? 21.053  -8.318  -64.727 1.00 41.73  ?  58  PHE A CA     1 
ATOM 823   C C      . PHE A 1 54  ? 20.751  -7.324  -63.614 1.00 48.76  ?  58  PHE A C      1 
ATOM 824   O O      . PHE A 1 54  ? 19.685  -7.366  -62.994 1.00 49.77  ?  58  PHE A O      1 
ATOM 825   C CB     . PHE A 1 54  ? 22.084  -9.352  -64.264 1.00 50.76  ?  58  PHE A CB     1 
ATOM 826   C CG     . PHE A 1 54  ? 21.579  -10.281 -63.198 1.00 43.81  ?  58  PHE A CG     1 
ATOM 827   C CD1    . PHE A 1 54  ? 22.143  -10.277 -61.935 1.00 37.11  ?  58  PHE A CD1    1 
ATOM 828   C CD2    . PHE A 1 54  ? 20.543  -11.159 -63.460 1.00 58.29  ?  58  PHE A CD2    1 
ATOM 829   C CE1    . PHE A 1 54  ? 21.683  -11.131 -60.957 1.00 27.58  ?  58  PHE A CE1    1 
ATOM 830   C CE2    . PHE A 1 54  ? 20.081  -12.014 -62.483 1.00 56.16  ?  58  PHE A CE2    1 
ATOM 831   C CZ     . PHE A 1 54  ? 20.651  -11.998 -61.231 1.00 39.07  ?  58  PHE A CZ     1 
ATOM 832   H H      . PHE A 1 54  ? 22.196  -8.051  -66.311 1.00 51.65  ?  58  PHE A H      1 
ATOM 833   H HA     . PHE A 1 54  ? 20.231  -8.787  -64.943 1.00 50.08  ?  58  PHE A HA     1 
ATOM 834   H HB2    . PHE A 1 54  ? 22.348  -9.891  -65.025 1.00 60.92  ?  58  PHE A HB2    1 
ATOM 835   H HB3    . PHE A 1 54  ? 22.856  -8.884  -63.908 1.00 60.92  ?  58  PHE A HB3    1 
ATOM 836   H HD1    . PHE A 1 54  ? 22.841  -9.693  -61.744 1.00 44.53  ?  58  PHE A HD1    1 
ATOM 837   H HD2    . PHE A 1 54  ? 20.154  -11.173 -64.305 1.00 69.95  ?  58  PHE A HD2    1 
ATOM 838   H HE1    . PHE A 1 54  ? 22.068  -11.120 -60.110 1.00 33.09  ?  58  PHE A HE1    1 
ATOM 839   H HE2    . PHE A 1 54  ? 19.384  -12.600 -62.669 1.00 67.40  ?  58  PHE A HE2    1 
ATOM 840   H HZ     . PHE A 1 54  ? 20.340  -12.574 -60.570 1.00 46.88  ?  58  PHE A HZ     1 
ATOM 841   N N      . ASP A 1 55  ? 21.679  -6.398  -63.368 1.00 44.22  ?  59  ASP A N      1 
ATOM 842   C CA     . ASP A 1 55  ? 21.489  -5.422  -62.302 1.00 34.15  ?  59  ASP A CA     1 
ATOM 843   C C      . ASP A 1 55  ? 20.290  -4.524  -62.577 1.00 50.79  ?  59  ASP A C      1 
ATOM 844   O O      . ASP A 1 55  ? 19.491  -4.251  -61.674 1.00 64.33  ?  59  ASP A O      1 
ATOM 845   C CB     . ASP A 1 55  ? 22.756  -4.590  -62.141 1.00 37.05  ?  59  ASP A CB     1 
ATOM 846   C CG     . ASP A 1 55  ? 23.944  -5.423  -61.721 1.00 41.23  ?  59  ASP A CG     1 
ATOM 847   O OD1    . ASP A 1 55  ? 23.910  -6.649  -61.934 1.00 41.15  ?  59  ASP A OD1    1 
ATOM 848   O OD2    . ASP A 1 55  ? 24.916  -4.855  -61.185 1.00 45.73  -1 59  ASP A OD2    1 
ATOM 849   H H      . ASP A 1 55  ? 22.418  -6.317  -63.800 1.00 53.07  ?  59  ASP A H      1 
ATOM 850   H HA     . ASP A 1 55  ? 21.329  -5.891  -61.469 1.00 40.98  ?  59  ASP A HA     1 
ATOM 851   H HB2    . ASP A 1 55  ? 22.969  -4.168  -62.988 1.00 44.46  ?  59  ASP A HB2    1 
ATOM 852   H HB3    . ASP A 1 55  ? 22.608  -3.914  -61.461 1.00 44.46  ?  59  ASP A HB3    1 
ATOM 853   N N      . LYS A 1 56  ? 20.147  -4.054  -63.817 1.00 50.49  ?  60  LYS A N      1 
ATOM 854   C CA     . LYS A 1 56  ? 19.047  -3.153  -64.141 1.00 54.19  ?  60  LYS A CA     1 
ATOM 855   C C      . LYS A 1 56  ? 17.697  -3.785  -63.839 1.00 59.57  ?  60  LYS A C      1 
ATOM 856   O O      . LYS A 1 56  ? 16.754  -3.082  -63.461 1.00 65.95  ?  60  LYS A O      1 
ATOM 857   C CB     . LYS A 1 56  ? 19.114  -2.750  -65.612 1.00 59.25  ?  60  LYS A CB     1 
ATOM 858   C CG     . LYS A 1 56  ? 20.354  -1.950  -65.985 1.00 71.50  ?  60  LYS A CG     1 
ATOM 859   C CD     . LYS A 1 56  ? 20.096  -0.450  -65.995 1.00 72.44  ?  60  LYS A CD     1 
ATOM 860   C CE     . LYS A 1 56  ? 19.137  -0.055  -67.109 1.00 78.10  ?  60  LYS A CE     1 
ATOM 861   N NZ     . LYS A 1 56  ? 19.222  1.392   -67.440 1.00 84.21  1  60  LYS A NZ     1 
ATOM 862   H H      . LYS A 1 56  ? 20.666  -4.240  -64.478 1.00 60.59  ?  60  LYS A H      1 
ATOM 863   H HA     . LYS A 1 56  ? 19.129  -2.349  -63.605 1.00 65.02  ?  60  LYS A HA     1 
ATOM 864   H HB2    . LYS A 1 56  ? 19.107  -3.553  -66.156 1.00 71.10  ?  60  LYS A HB2    1 
ATOM 865   H HB3    . LYS A 1 56  ? 18.338  -2.206  -65.822 1.00 71.10  ?  60  LYS A HB3    1 
ATOM 866   H HG2    . LYS A 1 56  ? 21.054  -2.130  -65.338 1.00 85.81  ?  60  LYS A HG2    1 
ATOM 867   H HG3    . LYS A 1 56  ? 20.645  -2.211  -66.872 1.00 85.81  ?  60  LYS A HG3    1 
ATOM 868   H HD2    . LYS A 1 56  ? 19.702  -0.187  -65.148 1.00 86.93  ?  60  LYS A HD2    1 
ATOM 869   H HD3    . LYS A 1 56  ? 20.934  0.018   -66.135 1.00 86.93  ?  60  LYS A HD3    1 
ATOM 870   H HE2    . LYS A 1 56  ? 19.352  -0.560  -67.908 1.00 93.72  ?  60  LYS A HE2    1 
ATOM 871   H HE3    . LYS A 1 56  ? 18.228  -0.246  -66.828 1.00 93.72  ?  60  LYS A HE3    1 
ATOM 872   H HZ1    . LYS A 1 56  ? 18.650  1.589   -68.093 1.00 101.05 ?  60  LYS A HZ1    1 
ATOM 873   H HZ2    . LYS A 1 56  ? 19.022  1.881   -66.724 1.00 101.05 ?  60  LYS A HZ2    1 
ATOM 874   H HZ3    . LYS A 1 56  ? 20.046  1.595   -67.708 1.00 101.05 ?  60  LYS A HZ3    1 
ATOM 875   N N      . LEU A 1 57  ? 17.583  -5.103  -63.998 1.00 56.48  ?  61  LEU A N      1 
ATOM 876   C CA     . LEU A 1 57  ? 16.298  -5.761  -63.804 1.00 54.07  ?  61  LEU A CA     1 
ATOM 877   C C      . LEU A 1 57  ? 16.006  -6.003  -62.332 1.00 52.88  ?  61  LEU A C      1 
ATOM 878   O O      . LEU A 1 57  ? 14.839  -5.989  -61.927 1.00 63.89  ?  61  LEU A O      1 
ATOM 879   C CB     . LEU A 1 57  ? 16.267  -7.079  -64.574 1.00 54.64  ?  61  LEU A CB     1 
ATOM 880   C CG     . LEU A 1 57  ? 16.709  -6.962  -66.034 1.00 34.69  ?  61  LEU A CG     1 
ATOM 881   C CD1    . LEU A 1 57  ? 17.860  -7.895  -66.301 1.00 33.49  ?  61  LEU A CD1    1 
ATOM 882   C CD2    . LEU A 1 57  ? 15.563  -7.248  -66.968 1.00 46.74  ?  61  LEU A CD2    1 
ATOM 883   H H      . LEU A 1 57  ? 18.226  -5.630  -64.215 1.00 67.77  ?  61  LEU A H      1 
ATOM 884   H HA     . LEU A 1 57  ? 15.597  -5.192  -64.158 1.00 64.89  ?  61  LEU A HA     1 
ATOM 885   H HB2    . LEU A 1 57  ? 16.859  -7.710  -64.136 1.00 65.57  ?  61  LEU A HB2    1 
ATOM 886   H HB3    . LEU A 1 57  ? 15.360  -7.422  -64.567 1.00 65.57  ?  61  LEU A HB3    1 
ATOM 887   H HG     . LEU A 1 57  ? 17.013  -6.056  -66.200 1.00 41.63  ?  61  LEU A HG     1 
ATOM 888   H HD11   . LEU A 1 57  ? 18.127  -7.808  -67.230 1.00 40.19  ?  61  LEU A HD11   1 
ATOM 889   H HD12   . LEU A 1 57  ? 18.600  -7.658  -65.720 1.00 40.19  ?  61  LEU A HD12   1 
ATOM 890   H HD13   . LEU A 1 57  ? 17.577  -8.805  -66.122 1.00 40.19  ?  61  LEU A HD13   1 
ATOM 891   H HD21   . LEU A 1 57  ? 15.875  -7.166  -67.883 1.00 56.09  ?  61  LEU A HD21   1 
ATOM 892   H HD22   . LEU A 1 57  ? 15.242  -8.149  -66.807 1.00 56.09  ?  61  LEU A HD22   1 
ATOM 893   H HD23   . LEU A 1 57  ? 14.853  -6.608  -66.802 1.00 56.09  ?  61  LEU A HD23   1 
ATOM 894   N N      . VAL A 1 58  ? 17.042  -6.227  -61.520 1.00 47.23  ?  62  VAL A N      1 
ATOM 895   C CA     . VAL A 1 58  ? 16.842  -6.286  -60.080 1.00 50.85  ?  62  VAL A CA     1 
ATOM 896   C C      . VAL A 1 58  ? 16.524  -4.905  -59.532 1.00 58.66  ?  62  VAL A C      1 
ATOM 897   O O      . VAL A 1 58  ? 15.964  -4.786  -58.438 1.00 62.25  ?  62  VAL A O      1 
ATOM 898   C CB     . VAL A 1 58  ? 18.075  -6.867  -59.364 1.00 47.75  ?  62  VAL A CB     1 
ATOM 899   C CG1    . VAL A 1 58  ? 17.755  -7.139  -57.906 1.00 43.26  ?  62  VAL A CG1    1 
ATOM 900   C CG2    . VAL A 1 58  ? 18.542  -8.139  -60.037 1.00 46.65  ?  62  VAL A CG2    1 
ATOM 901   H H      . VAL A 1 58  ? 17.854  -6.347  -61.776 1.00 56.67  ?  62  VAL A H      1 
ATOM 902   H HA     . VAL A 1 58  ? 16.086  -6.863  -59.890 1.00 61.02  ?  62  VAL A HA     1 
ATOM 903   H HB     . VAL A 1 58  ? 18.798  -6.222  -59.400 1.00 57.31  ?  62  VAL A HB     1 
ATOM 904   H HG11   . VAL A 1 58  ? 18.543  -7.505  -57.473 1.00 51.91  ?  62  VAL A HG11   1 
ATOM 905   H HG12   . VAL A 1 58  ? 17.499  -6.307  -57.478 1.00 51.91  ?  62  VAL A HG12   1 
ATOM 906   H HG13   . VAL A 1 58  ? 17.025  -7.776  -57.856 1.00 51.91  ?  62  VAL A HG13   1 
ATOM 907   H HG21   . VAL A 1 58  ? 19.317  -8.480  -59.565 1.00 55.98  ?  62  VAL A HG21   1 
ATOM 908   H HG22   . VAL A 1 58  ? 17.825  -8.792  -60.011 1.00 55.98  ?  62  VAL A HG22   1 
ATOM 909   H HG23   . VAL A 1 58  ? 18.776  -7.941  -60.958 1.00 55.98  ?  62  VAL A HG23   1 
ATOM 910   N N      . THR A 1 59  ? 16.887  -3.851  -60.262 1.00 61.23  ?  63  THR A N      1 
ATOM 911   C CA     . THR A 1 59  ? 16.491  -2.505  -59.877 1.00 50.40  ?  63  THR A CA     1 
ATOM 912   C C      . THR A 1 59  ? 15.015  -2.248  -60.149 1.00 47.03  ?  63  THR A C      1 
ATOM 913   O O      . THR A 1 59  ? 14.427  -1.359  -59.526 1.00 39.36  ?  63  THR A O      1 
ATOM 914   C CB     . THR A 1 59  ? 17.347  -1.479  -60.621 1.00 56.53  ?  63  THR A CB     1 
ATOM 915   O OG1    . THR A 1 59  ? 18.734  -1.767  -60.405 1.00 51.42  ?  63  THR A OG1    1 
ATOM 916   C CG2    . THR A 1 59  ? 17.051  -0.073  -60.134 1.00 62.46  ?  63  THR A CG2    1 
ATOM 917   H H      . THR A 1 59  ? 17.360  -3.891  -60.979 1.00 73.47  ?  63  THR A H      1 
ATOM 918   H HA     . THR A 1 59  ? 16.644  -2.390  -58.926 1.00 60.48  ?  63  THR A HA     1 
ATOM 919   H HB     . THR A 1 59  ? 17.151  -1.523  -61.570 1.00 67.83  ?  63  THR A HB     1 
ATOM 920   H HG1    . THR A 1 59  ? 18.915  -2.536  -60.689 1.00 61.70  ?  63  THR A HG1    1 
ATOM 921   H HG21   . THR A 1 59  ? 17.601  0.566   -60.614 1.00 74.95  ?  63  THR A HG21   1 
ATOM 922   H HG22   . THR A 1 59  ? 16.117  0.140   -60.283 1.00 74.95  ?  63  THR A HG22   1 
ATOM 923   H HG23   . THR A 1 59  ? 17.243  -0.004  -59.185 1.00 74.95  ?  63  THR A HG23   1 
ATOM 924   N N      . LYS A 1 60  ? 14.405  -3.005  -61.062 1.00 55.50  ?  64  LYS A N      1 
ATOM 925   C CA     . LYS A 1 60  ? 12.990  -2.819  -61.356 1.00 60.89  ?  64  LYS A CA     1 
ATOM 926   C C      . LYS A 1 60  ? 12.106  -3.262  -60.199 1.00 54.13  ?  64  LYS A C      1 
ATOM 927   O O      . LYS A 1 60  ? 10.996  -2.745  -60.037 1.00 50.97  ?  64  LYS A O      1 
ATOM 928   C CB     . LYS A 1 60  ? 12.610  -3.595  -62.616 1.00 56.32  ?  64  LYS A CB     1 
ATOM 929   C CG     . LYS A 1 60  ? 13.252  -3.089  -63.898 1.00 53.37  ?  64  LYS A CG     1 
ATOM 930   C CD     . LYS A 1 60  ? 12.856  -1.656  -64.189 1.00 68.83  ?  64  LYS A CD     1 
ATOM 931   C CE     . LYS A 1 60  ? 12.936  -1.339  -65.672 1.00 87.71  ?  64  LYS A CE     1 
ATOM 932   N NZ     . LYS A 1 60  ? 11.916  -2.083  -66.459 1.00 83.36  1  64  LYS A NZ     1 
ATOM 933   H H      . LYS A 1 60  ? 14.786  -3.626  -61.519 1.00 66.61  ?  64  LYS A H      1 
ATOM 934   H HA     . LYS A 1 60  ? 12.821  -1.878  -61.520 1.00 73.07  ?  64  LYS A HA     1 
ATOM 935   H HB2    . LYS A 1 60  ? 12.877  -4.520  -62.501 1.00 67.58  ?  64  LYS A HB2    1 
ATOM 936   H HB3    . LYS A 1 60  ? 11.648  -3.545  -62.731 1.00 67.58  ?  64  LYS A HB3    1 
ATOM 937   H HG2    . LYS A 1 60  ? 14.217  -3.126  -63.808 1.00 64.05  ?  64  LYS A HG2    1 
ATOM 938   H HG3    . LYS A 1 60  ? 12.962  -3.642  -64.640 1.00 64.05  ?  64  LYS A HG3    1 
ATOM 939   H HD2    . LYS A 1 60  ? 11.942  -1.512  -63.898 1.00 82.59  ?  64  LYS A HD2    1 
ATOM 940   H HD3    . LYS A 1 60  ? 13.456  -1.057  -63.718 1.00 82.59  ?  64  LYS A HD3    1 
ATOM 941   H HE2    . LYS A 1 60  ? 12.785  -0.389  -65.802 1.00 105.26 ?  64  LYS A HE2    1 
ATOM 942   H HE3    . LYS A 1 60  ? 13.813  -1.587  -66.003 1.00 105.26 ?  64  LYS A HE3    1 
ATOM 943   H HZ1    . LYS A 1 60  ? 11.987  -1.876  -67.321 1.00 100.03 ?  64  LYS A HZ1    1 
ATOM 944   H HZ2    . LYS A 1 60  ? 12.035  -2.959  -66.360 1.00 100.03 ?  64  LYS A HZ2    1 
ATOM 945   H HZ3    . LYS A 1 60  ? 11.099  -1.869  -66.177 1.00 100.03 ?  64  LYS A HZ3    1 
ATOM 946   N N      . ILE A 1 61  ? 12.574  -4.216  -59.388 1.00 54.92  ?  65  ILE A N      1 
ATOM 947   C CA     . ILE A 1 61  ? 11.743  -4.801  -58.339 1.00 52.41  ?  65  ILE A CA     1 
ATOM 948   C C      . ILE A 1 61  ? 11.896  -4.107  -56.994 1.00 57.41  ?  65  ILE A C      1 
ATOM 949   O O      . ILE A 1 61  ? 11.081  -4.351  -56.091 1.00 43.33  ?  65  ILE A O      1 
ATOM 950   C CB     . ILE A 1 61  ? 12.064  -6.300  -58.165 1.00 58.34  ?  65  ILE A CB     1 
ATOM 951   C CG1    . ILE A 1 61  ? 13.477  -6.487  -57.610 1.00 46.49  ?  65  ILE A CG1    1 
ATOM 952   C CG2    . ILE A 1 61  ? 11.941  -7.026  -59.494 1.00 69.70  ?  65  ILE A CG2    1 
ATOM 953   C CD1    . ILE A 1 61  ? 13.547  -6.697  -56.112 1.00 53.01  ?  65  ILE A CD1    1 
ATOM 954   H H      . ILE A 1 61  ? 13.370  -4.540  -59.428 1.00 65.90  ?  65  ILE A H      1 
ATOM 955   H HA     . ILE A 1 61  ? 10.813  -4.727  -58.604 1.00 62.89  ?  65  ILE A HA     1 
ATOM 956   H HB     . ILE A 1 61  ? 11.429  -6.684  -57.540 1.00 70.01  ?  65  ILE A HB     1 
ATOM 957   H HG12   . ILE A 1 61  ? 13.875  -7.263  -58.034 1.00 55.79  ?  65  ILE A HG12   1 
ATOM 958   H HG13   . ILE A 1 61  ? 13.999  -5.697  -57.821 1.00 55.79  ?  65  ILE A HG13   1 
ATOM 959   H HG21   . ILE A 1 61  ? 12.147  -7.964  -59.360 1.00 83.64  ?  65  ILE A HG21   1 
ATOM 960   H HG22   . ILE A 1 61  ? 11.034  -6.929  -59.824 1.00 83.64  ?  65  ILE A HG22   1 
ATOM 961   H HG23   . ILE A 1 61  ? 12.567  -6.636  -60.125 1.00 83.64  ?  65  ILE A HG23   1 
ATOM 962   H HD11   . ILE A 1 61  ? 14.475  -6.805  -55.852 1.00 63.61  ?  65  ILE A HD11   1 
ATOM 963   H HD12   . ILE A 1 61  ? 13.166  -5.923  -55.667 1.00 63.61  ?  65  ILE A HD12   1 
ATOM 964   H HD13   . ILE A 1 61  ? 13.042  -7.492  -55.881 1.00 63.61  ?  65  ILE A HD13   1 
ATOM 965   N N      . LEU A 1 62  ? 12.904  -3.243  -56.829 1.00 67.66  ?  66  LEU A N      1 
ATOM 966   C CA     . LEU A 1 62  ? 13.173  -2.687  -55.504 1.00 44.56  ?  66  LEU A CA     1 
ATOM 967   C C      . LEU A 1 62  ? 12.037  -1.804  -55.006 1.00 45.05  ?  66  LEU A C      1 
ATOM 968   O O      . LEU A 1 62  ? 11.613  -1.969  -53.855 1.00 58.56  ?  66  LEU A O      1 
ATOM 969   C CB     . LEU A 1 62  ? 14.508  -1.938  -55.515 1.00 35.64  ?  66  LEU A CB     1 
ATOM 970   C CG     . LEU A 1 62  ? 15.768  -2.804  -55.487 1.00 38.00  ?  66  LEU A CG     1 
ATOM 971   C CD1    . LEU A 1 62  ? 17.002  -1.950  -55.698 1.00 37.76  ?  66  LEU A CD1    1 
ATOM 972   C CD2    . LEU A 1 62  ? 15.881  -3.565  -54.180 1.00 53.42  ?  66  LEU A CD2    1 
ATOM 973   H H      . LEU A 1 62  ? 13.431  -2.970  -57.451 1.00 81.19  ?  66  LEU A H      1 
ATOM 974   H HA     . LEU A 1 62  ? 13.261  -3.423  -54.878 1.00 53.47  ?  66  LEU A HA     1 
ATOM 975   H HB2    . LEU A 1 62  ? 14.548  -1.398  -56.320 1.00 42.77  ?  66  LEU A HB2    1 
ATOM 976   H HB3    . LEU A 1 62  ? 14.539  -1.359  -54.738 1.00 42.77  ?  66  LEU A HB3    1 
ATOM 977   H HG     . LEU A 1 62  ? 15.724  -3.451  -56.208 1.00 45.60  ?  66  LEU A HG     1 
ATOM 978   H HD11   . LEU A 1 62  ? 17.787  -2.519  -55.676 1.00 45.31  ?  66  LEU A HD11   1 
ATOM 979   H HD12   . LEU A 1 62  ? 16.936  -1.509  -56.559 1.00 45.31  ?  66  LEU A HD12   1 
ATOM 980   H HD13   . LEU A 1 62  ? 17.052  -1.289  -54.990 1.00 45.31  ?  66  LEU A HD13   1 
ATOM 981   H HD21   . LEU A 1 62  ? 16.688  -4.102  -54.196 1.00 64.10  ?  66  LEU A HD21   1 
ATOM 982   H HD22   . LEU A 1 62  ? 15.920  -2.930  -53.448 1.00 64.10  ?  66  LEU A HD22   1 
ATOM 983   H HD23   . LEU A 1 62  ? 15.104  -4.138  -54.081 1.00 64.10  ?  66  LEU A HD23   1 
ATOM 984   N N      . PRO A 1 63  ? 11.501  -0.867  -55.800 1.00 38.32  ?  67  PRO A N      1 
ATOM 985   C CA     . PRO A 1 63  ? 10.462  0.030   -55.262 1.00 44.67  ?  67  PRO A CA     1 
ATOM 986   C C      . PRO A 1 63  ? 9.210   -0.682  -54.779 1.00 57.41  ?  67  PRO A C      1 
ATOM 987   O O      . PRO A 1 63  ? 8.357   -0.031  -54.164 1.00 61.57  ?  67  PRO A O      1 
ATOM 988   C CB     . PRO A 1 63  ? 10.148  0.952   -56.449 1.00 68.97  ?  67  PRO A CB     1 
ATOM 989   C CG     . PRO A 1 63  ? 11.340  0.863   -57.332 1.00 70.23  ?  67  PRO A CG     1 
ATOM 990   C CD     . PRO A 1 63  ? 11.854  -0.529  -57.184 1.00 56.48  ?  67  PRO A CD     1 
ATOM 991   H HA     . PRO A 1 63  ? 10.825  0.561   -54.536 1.00 53.60  ?  67  PRO A HA     1 
ATOM 992   H HB2    . PRO A 1 63  ? 9.355   0.634   -56.909 1.00 82.77  ?  67  PRO A HB2    1 
ATOM 993   H HB3    . PRO A 1 63  ? 10.021  1.860   -56.133 1.00 82.77  ?  67  PRO A HB3    1 
ATOM 994   H HG2    . PRO A 1 63  ? 11.078  1.034   -58.250 1.00 84.27  ?  67  PRO A HG2    1 
ATOM 995   H HG3    . PRO A 1 63  ? 12.007  1.505   -57.042 1.00 84.27  ?  67  PRO A HG3    1 
ATOM 996   H HD2    . PRO A 1 63  ? 11.404  -1.124  -57.804 1.00 67.77  ?  67  PRO A HD2    1 
ATOM 997   H HD3    . PRO A 1 63  ? 12.816  -0.550  -57.304 1.00 67.77  ?  67  PRO A HD3    1 
ATOM 998   N N      . LEU A 1 64  ? 9.067   -1.979  -55.033 1.00 58.48  ?  68  LEU A N      1 
ATOM 999   C CA     . LEU A 1 64  ? 7.879   -2.696  -54.593 1.00 55.48  ?  68  LEU A CA     1 
ATOM 1000  C C      . LEU A 1 64  ? 7.822   -2.755  -53.073 1.00 58.34  ?  68  LEU A C      1 
ATOM 1001  O O      . LEU A 1 64  ? 8.844   -2.915  -52.400 1.00 44.65  ?  68  LEU A O      1 
ATOM 1002  C CB     . LEU A 1 64  ? 7.874   -4.109  -55.171 1.00 46.75  ?  68  LEU A CB     1 
ATOM 1003  C CG     . LEU A 1 64  ? 7.771   -4.218  -56.692 1.00 45.70  ?  68  LEU A CG     1 
ATOM 1004  C CD1    . LEU A 1 64  ? 7.991   -5.651  -57.126 1.00 56.67  ?  68  LEU A CD1    1 
ATOM 1005  C CD2    . LEU A 1 64  ? 6.423   -3.716  -57.178 1.00 62.93  ?  68  LEU A CD2    1 
ATOM 1006  H H      . LEU A 1 64  ? 9.639   -2.463  -55.455 1.00 70.18  ?  68  LEU A H      1 
ATOM 1007  H HA     . LEU A 1 64  ? 7.088   -2.233  -54.911 1.00 66.57  ?  68  LEU A HA     1 
ATOM 1008  H HB2    . LEU A 1 64  ? 8.697   -4.549  -54.906 1.00 56.10  ?  68  LEU A HB2    1 
ATOM 1009  H HB3    . LEU A 1 64  ? 7.118   -4.588  -54.796 1.00 56.10  ?  68  LEU A HB3    1 
ATOM 1010  H HG     . LEU A 1 64  ? 8.461   -3.670  -57.097 1.00 54.84  ?  68  LEU A HG     1 
ATOM 1011  H HD11   . LEU A 1 64  ? 7.922   -5.702  -58.092 1.00 68.00  ?  68  LEU A HD11   1 
ATOM 1012  H HD12   . LEU A 1 64  ? 8.874   -5.935  -56.841 1.00 68.00  ?  68  LEU A HD12   1 
ATOM 1013  H HD13   . LEU A 1 64  ? 7.314   -6.212  -56.716 1.00 68.00  ?  68  LEU A HD13   1 
ATOM 1014  H HD21   . LEU A 1 64  ? 6.386   -3.797  -58.144 1.00 75.52  ?  68  LEU A HD21   1 
ATOM 1015  H HD22   . LEU A 1 64  ? 5.723   -4.253  -56.773 1.00 75.52  ?  68  LEU A HD22   1 
ATOM 1016  H HD23   . LEU A 1 64  ? 6.320   -2.787  -56.919 1.00 75.52  ?  68  LEU A HD23   1 
ATOM 1017  N N      . LYS A 1 65  ? 6.612   -2.633  -52.531 1.00 72.24  ?  69  LYS A N      1 
ATOM 1018  C CA     . LYS A 1 65  ? 6.431   -2.681  -51.091 1.00 67.89  ?  69  LYS A CA     1 
ATOM 1019  C C      . LYS A 1 65  ? 6.920   -4.017  -50.536 1.00 60.37  ?  69  LYS A C      1 
ATOM 1020  O O      . LYS A 1 65  ? 7.275   -4.941  -51.270 1.00 58.39  ?  69  LYS A O      1 
ATOM 1021  C CB     . LYS A 1 65  ? 4.961   -2.495  -50.717 1.00 61.97  ?  69  LYS A CB     1 
ATOM 1022  C CG     . LYS A 1 65  ? 4.244   -1.362  -51.429 1.00 81.45  ?  69  LYS A CG     1 
ATOM 1023  C CD     . LYS A 1 65  ? 2.948   -0.987  -50.711 1.00 97.58  ?  69  LYS A CD     1 
ATOM 1024  C CE     . LYS A 1 65  ? 2.027   -2.187  -50.499 1.00 92.81  ?  69  LYS A CE     1 
ATOM 1025  N NZ     . LYS A 1 65  ? 0.808   -1.831  -49.720 1.00 70.71  1  69  LYS A NZ     1 
ATOM 1026  H H      . LYS A 1 65  ? 5.885   -2.523  -52.977 1.00 86.68  ?  69  LYS A H      1 
ATOM 1027  H HA     . LYS A 1 65  ? 6.945   -1.970  -50.677 1.00 81.47  ?  69  LYS A HA     1 
ATOM 1028  H HB2    . LYS A 1 65  ? 4.486   -3.315  -50.924 1.00 74.37  ?  69  LYS A HB2    1 
ATOM 1029  H HB3    . LYS A 1 65  ? 4.907   -2.321  -49.765 1.00 74.37  ?  69  LYS A HB3    1 
ATOM 1030  H HG2    . LYS A 1 65  ? 4.819   -0.581  -51.448 1.00 97.74  ?  69  LYS A HG2    1 
ATOM 1031  H HG3    . LYS A 1 65  ? 4.023   -1.640  -52.332 1.00 97.74  ?  69  LYS A HG3    1 
ATOM 1032  H HD2    . LYS A 1 65  ? 3.164   -0.616  -49.841 1.00 117.10 ?  69  LYS A HD2    1 
ATOM 1033  H HD3    . LYS A 1 65  ? 2.470   -0.331  -51.242 1.00 117.10 ?  69  LYS A HD3    1 
ATOM 1034  H HE2    . LYS A 1 65  ? 1.745   -2.528  -51.362 1.00 111.37 ?  69  LYS A HE2    1 
ATOM 1035  H HE3    . LYS A 1 65  ? 2.508   -2.874  -50.010 1.00 111.37 ?  69  LYS A HE3    1 
ATOM 1036  H HZ1    . LYS A 1 65  ? 0.295   -2.550  -49.615 1.00 84.85  ?  69  LYS A HZ1    1 
ATOM 1037  H HZ2    . LYS A 1 65  ? 1.040   -1.520  -48.919 1.00 84.85  ?  69  LYS A HZ2    1 
ATOM 1038  H HZ3    . LYS A 1 65  ? 0.345   -1.205  -50.151 1.00 84.85  ?  69  LYS A HZ3    1 
ATOM 1039  N N      . LYS A 1 66  ? 6.934   -4.105  -49.210 1.00 73.95  ?  70  LYS A N      1 
ATOM 1040  C CA     . LYS A 1 66  ? 7.132   -5.385  -48.551 1.00 67.04  ?  70  LYS A CA     1 
ATOM 1041  C C      . LYS A 1 66  ? 5.925   -6.281  -48.793 1.00 69.58  ?  70  LYS A C      1 
ATOM 1042  O O      . LYS A 1 66  ? 4.795   -5.811  -48.949 1.00 73.32  ?  70  LYS A O      1 
ATOM 1043  C CB     . LYS A 1 66  ? 7.345   -5.190  -47.049 1.00 61.00  ?  70  LYS A CB     1 
ATOM 1044  C CG     . LYS A 1 66  ? 7.559   -6.482  -46.268 1.00 59.47  ?  70  LYS A CG     1 
ATOM 1045  C CD     . LYS A 1 66  ? 7.657   -6.214  -44.776 1.00 80.15  ?  70  LYS A CD     1 
ATOM 1046  C CE     . LYS A 1 66  ? 8.221   -7.406  -44.014 1.00 74.47  ?  70  LYS A CE     1 
ATOM 1047  N NZ     . LYS A 1 66  ? 7.250   -8.528  -43.897 1.00 73.52  1  70  LYS A NZ     1 
ATOM 1048  H H      . LYS A 1 66  ? 6.832   -3.441  -48.674 1.00 88.73  ?  70  LYS A H      1 
ATOM 1049  H HA     . LYS A 1 66  ? 7.917   -5.820  -48.918 1.00 80.45  ?  70  LYS A HA     1 
ATOM 1050  H HB2    . LYS A 1 66  ? 8.128   -4.633  -46.917 1.00 73.19  ?  70  LYS A HB2    1 
ATOM 1051  H HB3    . LYS A 1 66  ? 6.564   -4.748  -46.680 1.00 73.19  ?  70  LYS A HB3    1 
ATOM 1052  H HG2    . LYS A 1 66  ? 6.809   -7.078  -46.422 1.00 71.37  ?  70  LYS A HG2    1 
ATOM 1053  H HG3    . LYS A 1 66  ? 8.385   -6.900  -46.558 1.00 71.37  ?  70  LYS A HG3    1 
ATOM 1054  H HD2    . LYS A 1 66  ? 8.244   -5.456  -44.627 1.00 96.18  ?  70  LYS A HD2    1 
ATOM 1055  H HD3    . LYS A 1 66  ? 6.772   -6.025  -44.427 1.00 96.18  ?  70  LYS A HD3    1 
ATOM 1056  H HE2    . LYS A 1 66  ? 9.005   -7.737  -44.480 1.00 89.37  ?  70  LYS A HE2    1 
ATOM 1057  H HE3    . LYS A 1 66  ? 8.463   -7.124  -43.118 1.00 89.37  ?  70  LYS A HE3    1 
ATOM 1058  H HZ1    . LYS A 1 66  ? 7.617   -9.202  -43.447 1.00 88.23  ?  70  LYS A HZ1    1 
ATOM 1059  H HZ2    . LYS A 1 66  ? 6.521   -8.254  -43.465 1.00 88.23  ?  70  LYS A HZ2    1 
ATOM 1060  H HZ3    . LYS A 1 66  ? 7.016   -8.813  -44.706 1.00 88.23  ?  70  LYS A HZ3    1 
ATOM 1061  N N      . ASN A 1 67  ? 6.175   -7.588  -48.835 1.00 71.67  ?  71  ASN A N      1 
ATOM 1062  C CA     . ASN A 1 67  ? 5.165   -8.615  -49.061 1.00 64.09  ?  71  ASN A CA     1 
ATOM 1063  C C      . ASN A 1 67  ? 4.561   -8.553  -50.456 1.00 63.28  ?  71  ASN A C      1 
ATOM 1064  O O      . ASN A 1 67  ? 3.669   -9.351  -50.761 1.00 71.45  ?  71  ASN A O      1 
ATOM 1065  C CB     . ASN A 1 67  ? 4.023   -8.552  -48.036 1.00 65.67  ?  71  ASN A CB     1 
ATOM 1066  C CG     . ASN A 1 67  ? 4.327   -9.331  -46.778 1.00 65.20  ?  71  ASN A CG     1 
ATOM 1067  O OD1    . ASN A 1 67  ? 5.487   -9.576  -46.450 1.00 59.41  ?  71  ASN A OD1    1 
ATOM 1068  N ND2    . ASN A 1 67  ? 3.282   -9.733  -46.065 1.00 77.39  ?  71  ASN A ND2    1 
ATOM 1069  H H      . ASN A 1 67  ? 6.962   -7.916  -48.728 1.00 86.01  ?  71  ASN A H      1 
ATOM 1070  H HA     . ASN A 1 67  ? 5.588   -9.483  -48.968 1.00 76.91  ?  71  ASN A HA     1 
ATOM 1071  H HB2    . ASN A 1 67  ? 3.872   -7.627  -47.788 1.00 78.80  ?  71  ASN A HB2    1 
ATOM 1072  H HB3    . ASN A 1 67  ? 3.220   -8.925  -48.434 1.00 78.80  ?  71  ASN A HB3    1 
ATOM 1073  H HD21   . ASN A 1 67  ? 3.402   -10.180 -45.340 1.00 92.87  ?  71  ASN A HD21   1 
ATOM 1074  H HD22   . ASN A 1 67  ? 2.485   -9.546  -46.328 1.00 92.87  ?  71  ASN A HD22   1 
ATOM 1075  N N      . GLU A 1 68  ? 5.003   -7.637  -51.312 1.00 75.22  ?  72  GLU A N      1 
ATOM 1076  C CA     . GLU A 1 68  ? 4.518   -7.621  -52.684 1.00 74.24  ?  72  GLU A CA     1 
ATOM 1077  C C      . GLU A 1 68  ? 4.928   -8.915  -53.370 1.00 76.89  ?  72  GLU A C      1 
ATOM 1078  O O      . GLU A 1 68  ? 6.119   -9.221  -53.480 1.00 68.83  ?  72  GLU A O      1 
ATOM 1079  C CB     . GLU A 1 68  ? 5.070   -6.406  -53.427 1.00 73.16  ?  72  GLU A CB     1 
ATOM 1080  C CG     . GLU A 1 68  ? 4.123   -5.816  -54.465 1.00 93.81  ?  72  GLU A CG     1 
ATOM 1081  C CD     . GLU A 1 68  ? 2.861   -5.228  -53.855 1.00 112.82 ?  72  GLU A CD     1 
ATOM 1082  O OE1    . GLU A 1 68  ? 1.999   -6.004  -53.392 1.00 113.65 ?  72  GLU A OE1    1 
ATOM 1083  O OE2    . GLU A 1 68  ? 2.733   -3.986  -53.835 1.00 105.06 -1 72  GLU A OE2    1 
ATOM 1084  H H      . GLU A 1 68  ? 5.576   -7.024  -51.126 1.00 90.26  ?  72  GLU A H      1 
ATOM 1085  H HA     . GLU A 1 68  ? 3.549   -7.566  -52.683 1.00 89.08  ?  72  GLU A HA     1 
ATOM 1086  H HB2    . GLU A 1 68  ? 5.268   -5.711  -52.780 1.00 87.79  ?  72  GLU A HB2    1 
ATOM 1087  H HB3    . GLU A 1 68  ? 5.884   -6.667  -53.886 1.00 87.79  ?  72  GLU A HB3    1 
ATOM 1088  H HG2    . GLU A 1 68  ? 4.582   -5.107  -54.943 1.00 112.57 ?  72  GLU A HG2    1 
ATOM 1089  H HG3    . GLU A 1 68  ? 3.859   -6.515  -55.084 1.00 112.57 ?  72  GLU A HG3    1 
ATOM 1090  N N      . ILE A 1 69  ? 3.932   -9.681  -53.821 1.00 81.78  ?  73  ILE A N      1 
ATOM 1091  C CA     . ILE A 1 69  ? 4.168   -11.055 -54.259 1.00 73.00  ?  73  ILE A CA     1 
ATOM 1092  C C      . ILE A 1 69  ? 5.261   -11.131 -55.313 1.00 63.76  ?  73  ILE A C      1 
ATOM 1093  O O      . ILE A 1 69  ? 6.015   -12.110 -55.366 1.00 66.37  ?  73  ILE A O      1 
ATOM 1094  C CB     . ILE A 1 69  ? 2.854   -11.681 -54.775 1.00 78.30  ?  73  ILE A CB     1 
ATOM 1095  C CG1    . ILE A 1 69  ? 3.099   -13.101 -55.290 1.00 81.77  ?  73  ILE A CG1    1 
ATOM 1096  C CG2    . ILE A 1 69  ? 2.248   -10.832 -55.883 1.00 72.36  ?  73  ILE A CG2    1 
ATOM 1097  C CD1    . ILE A 1 69  ? 3.764   -14.024 -54.288 1.00 69.81  ?  73  ILE A CD1    1 
ATOM 1098  H H      . ILE A 1 69  ? 3.112   -9.427  -53.883 1.00 98.14  ?  73  ILE A H      1 
ATOM 1099  H HA     . ILE A 1 69  ? 4.461   -11.576 -53.496 1.00 87.60  ?  73  ILE A HA     1 
ATOM 1100  H HB     . ILE A 1 69  ? 2.223   -11.724 -54.039 1.00 93.96  ?  73  ILE A HB     1 
ATOM 1101  H HG12   . ILE A 1 69  ? 2.247   -13.495 -55.533 1.00 98.12  ?  73  ILE A HG12   1 
ATOM 1102  H HG13   . ILE A 1 69  ? 3.672   -13.054 -56.072 1.00 98.12  ?  73  ILE A HG13   1 
ATOM 1103  H HG21   . ILE A 1 69  ? 1.426   -11.250 -56.186 1.00 86.83  ?  73  ILE A HG21   1 
ATOM 1104  H HG22   . ILE A 1 69  ? 2.061   -9.946  -55.536 1.00 86.83  ?  73  ILE A HG22   1 
ATOM 1105  H HG23   . ILE A 1 69  ? 2.879   -10.774 -56.617 1.00 86.83  ?  73  ILE A HG23   1 
ATOM 1106  H HD11   . ILE A 1 69  ? 3.882   -14.897 -54.693 1.00 83.77  ?  73  ILE A HD11   1 
ATOM 1107  H HD12   . ILE A 1 69  ? 4.627   -13.653 -54.042 1.00 83.77  ?  73  ILE A HD12   1 
ATOM 1108  H HD13   . ILE A 1 69  ? 3.199   -14.096 -53.503 1.00 83.77  ?  73  ILE A HD13   1 
ATOM 1109  N N      . ILE A 1 70  ? 5.369   -10.115 -56.167 1.00 58.35  ?  74  ILE A N      1 
ATOM 1110  C CA     . ILE A 1 70  ? 6.297   -10.193 -57.290 1.00 52.17  ?  74  ILE A CA     1 
ATOM 1111  C C      . ILE A 1 70  ? 7.735   -10.160 -56.792 1.00 58.36  ?  74  ILE A C      1 
ATOM 1112  O O      . ILE A 1 70  ? 8.576   -10.956 -57.223 1.00 63.17  ?  74  ILE A O      1 
ATOM 1113  C CB     . ILE A 1 70  ? 6.018   -9.062  -58.295 1.00 45.16  ?  74  ILE A CB     1 
ATOM 1114  C CG1    . ILE A 1 70  ? 4.602   -9.193  -58.861 1.00 66.84  ?  74  ILE A CG1    1 
ATOM 1115  C CG2    . ILE A 1 70  ? 7.021   -9.098  -59.435 1.00 70.06  ?  74  ILE A CG2    1 
ATOM 1116  C CD1    . ILE A 1 70  ? 3.570   -8.356  -58.144 1.00 84.24  ?  74  ILE A CD1    1 
ATOM 1117  H H      . ILE A 1 70  ? 4.923   -9.381  -56.120 1.00 70.02  ?  74  ILE A H      1 
ATOM 1118  H HA     . ILE A 1 70  ? 6.162   -11.036 -57.748 1.00 62.60  ?  74  ILE A HA     1 
ATOM 1119  H HB     . ILE A 1 70  ? 6.094   -8.210  -57.837 1.00 54.20  ?  74  ILE A HB     1 
ATOM 1120  H HG12   . ILE A 1 70  ? 4.612   -8.917  -59.791 1.00 80.20  ?  74  ILE A HG12   1 
ATOM 1121  H HG13   . ILE A 1 70  ? 4.326   -10.121 -58.797 1.00 80.20  ?  74  ILE A HG13   1 
ATOM 1122  H HG21   . ILE A 1 70  ? 6.823   -8.377  -60.052 1.00 84.08  ?  74  ILE A HG21   1 
ATOM 1123  H HG22   . ILE A 1 70  ? 7.914   -8.988  -59.073 1.00 84.08  ?  74  ILE A HG22   1 
ATOM 1124  H HG23   . ILE A 1 70  ? 6.951   -9.952  -59.890 1.00 84.08  ?  74  ILE A HG23   1 
ATOM 1125  H HD11   . ILE A 1 70  ? 2.706   -8.496  -58.562 1.00 101.09 ?  74  ILE A HD11   1 
ATOM 1126  H HD12   . ILE A 1 70  ? 3.535   -8.627  -57.214 1.00 101.09 ?  74  ILE A HD12   1 
ATOM 1127  H HD13   . ILE A 1 70  ? 3.822   -7.422  -58.209 1.00 101.09 ?  74  ILE A HD13   1 
ATOM 1128  N N      . GLY A 1 71  ? 8.038   -9.242  -55.882 1.00 63.85  ?  75  GLY A N      1 
ATOM 1129  C CA     . GLY A 1 71  ? 9.380   -9.120  -55.355 1.00 60.00  ?  75  GLY A CA     1 
ATOM 1130  C C      . GLY A 1 71  ? 9.938   -10.439 -54.867 1.00 59.74  ?  75  GLY A C      1 
ATOM 1131  O O      . GLY A 1 71  ? 10.971  -10.901 -55.360 1.00 61.62  ?  75  GLY A O      1 
ATOM 1132  H H      . GLY A 1 71  ? 7.478   -8.676  -55.555 1.00 76.62  ?  75  GLY A H      1 
ATOM 1133  H HA2    . GLY A 1 71  ? 9.968   -8.776  -56.046 1.00 72.00  ?  75  GLY A HA2    1 
ATOM 1134  H HA3    . GLY A 1 71  ? 9.380   -8.495  -54.613 1.00 72.00  ?  75  GLY A HA3    1 
ATOM 1135  N N      . ASP A 1 72  ? 9.248   -11.058 -53.906 1.00 68.89  ?  76  ASP A N      1 
ATOM 1136  C CA     . ASP A 1 72  ? 9.707   -12.314 -53.322 1.00 66.15  ?  76  ASP A CA     1 
ATOM 1137  C C      . ASP A 1 72  ? 10.216  -13.281 -54.382 1.00 60.65  ?  76  ASP A C      1 
ATOM 1138  O O      . ASP A 1 72  ? 11.318  -13.827 -54.265 1.00 63.50  ?  76  ASP A O      1 
ATOM 1139  C CB     . ASP A 1 72  ? 8.569   -12.954 -52.524 1.00 77.21  ?  76  ASP A CB     1 
ATOM 1140  C CG     . ASP A 1 72  ? 8.173   -12.136 -51.312 1.00 92.35  ?  76  ASP A CG     1 
ATOM 1141  O OD1    . ASP A 1 72  ? 8.560   -12.516 -50.188 1.00 78.98  ?  76  ASP A OD1    1 
ATOM 1142  O OD2    . ASP A 1 72  ? 7.477   -11.113 -51.483 1.00 96.83  -1 76  ASP A OD2    1 
ATOM 1143  H H      . ASP A 1 72  ? 8.509   -10.767 -53.576 1.00 82.67  ?  76  ASP A H      1 
ATOM 1144  H HA     . ASP A 1 72  ? 10.436  -12.129 -52.709 1.00 79.38  ?  76  ASP A HA     1 
ATOM 1145  H HB2    . ASP A 1 72  ? 7.790   -13.039 -53.096 1.00 92.65  ?  76  ASP A HB2    1 
ATOM 1146  H HB3    . ASP A 1 72  ? 8.852   -13.829 -52.216 1.00 92.65  ?  76  ASP A HB3    1 
ATOM 1147  N N      . ARG A 1 73  ? 9.426   -13.500 -55.434 1.00 59.66  ?  77  ARG A N      1 
ATOM 1148  C CA     . ARG A 1 73  ? 9.815   -14.460 -56.461 1.00 61.08  ?  77  ARG A CA     1 
ATOM 1149  C C      . ARG A 1 73  ? 11.157  -14.086 -57.076 1.00 61.19  ?  77  ARG A C      1 
ATOM 1150  O O      . ARG A 1 73  ? 12.043  -14.934 -57.224 1.00 58.82  ?  77  ARG A O      1 
ATOM 1151  C CB     . ARG A 1 73  ? 8.738   -14.546 -57.541 1.00 59.53  ?  77  ARG A CB     1 
ATOM 1152  C CG     . ARG A 1 73  ? 7.318   -14.707 -57.017 1.00 57.44  ?  77  ARG A CG     1 
ATOM 1153  C CD     . ARG A 1 73  ? 6.484   -15.557 -57.963 1.00 70.33  ?  77  ARG A CD     1 
ATOM 1154  N NE     . ARG A 1 73  ? 5.101   -15.099 -58.070 1.00 74.59  ?  77  ARG A NE     1 
ATOM 1155  C CZ     . ARG A 1 73  ? 4.075   -15.605 -57.392 1.00 70.46  ?  77  ARG A CZ     1 
ATOM 1156  N NH1    . ARG A 1 73  ? 4.250   -16.602 -56.535 1.00 79.05  1  77  ARG A NH1    1 
ATOM 1157  N NH2    . ARG A 1 73  ? 2.860   -15.111 -57.575 1.00 60.05  ?  77  ARG A NH2    1 
ATOM 1158  H H      . ARG A 1 73  ? 8.672   -13.110 -55.574 1.00 71.59  ?  77  ARG A H      1 
ATOM 1159  H HA     . ARG A 1 73  ? 9.905   -15.336 -56.056 1.00 73.30  ?  77  ARG A HA     1 
ATOM 1160  H HB2    . ARG A 1 73  ? 8.765   -13.734 -58.070 1.00 71.43  ?  77  ARG A HB2    1 
ATOM 1161  H HB3    . ARG A 1 73  ? 8.929   -15.310 -58.108 1.00 71.43  ?  77  ARG A HB3    1 
ATOM 1162  H HG2    . ARG A 1 73  ? 7.341   -15.145 -56.152 1.00 68.93  ?  77  ARG A HG2    1 
ATOM 1163  H HG3    . ARG A 1 73  ? 6.901   -13.834 -56.942 1.00 68.93  ?  77  ARG A HG3    1 
ATOM 1164  H HD2    . ARG A 1 73  ? 6.879   -15.524 -58.849 1.00 84.40  ?  77  ARG A HD2    1 
ATOM 1165  H HD3    . ARG A 1 73  ? 6.472   -16.471 -57.639 1.00 84.40  ?  77  ARG A HD3    1 
ATOM 1166  H HE     . ARG A 1 73  ? 4.938   -14.451 -58.612 1.00 89.51  ?  77  ARG A HE     1 
ATOM 1167  H HH11   . ARG A 1 73  ? 5.035   -16.930 -56.412 1.00 94.86  ?  77  ARG A HH11   1 
ATOM 1168  H HH12   . ARG A 1 73  ? 3.578   -16.921 -56.103 1.00 94.86  ?  77  ARG A HH12   1 
ATOM 1169  H HH21   . ARG A 1 73  ? 2.738   -14.464 -58.128 1.00 72.06  ?  77  ARG A HH21   1 
ATOM 1170  H HH22   . ARG A 1 73  ? 2.193   -15.434 -57.138 1.00 72.06  ?  77  ARG A HH22   1 
ATOM 1171  N N      . ILE A 1 74  ? 11.326  -12.815 -57.440 1.00 54.47  ?  78  ILE A N      1 
ATOM 1172  C CA     . ILE A 1 74  ? 12.581  -12.391 -58.049 1.00 44.42  ?  78  ILE A CA     1 
ATOM 1173  C C      . ILE A 1 74  ? 13.718  -12.511 -57.045 1.00 53.25  ?  78  ILE A C      1 
ATOM 1174  O O      . ILE A 1 74  ? 14.812  -12.979 -57.379 1.00 55.45  ?  78  ILE A O      1 
ATOM 1175  C CB     . ILE A 1 74  ? 12.462  -10.958 -58.594 1.00 34.40  ?  78  ILE A CB     1 
ATOM 1176  C CG1    . ILE A 1 74  ? 11.177  -10.785 -59.412 1.00 53.50  ?  78  ILE A CG1    1 
ATOM 1177  C CG2    . ILE A 1 74  ? 13.677  -10.621 -59.443 1.00 31.23  ?  78  ILE A CG2    1 
ATOM 1178  C CD1    . ILE A 1 74  ? 11.041  -11.732 -60.576 1.00 60.69  ?  78  ILE A CD1    1 
ATOM 1179  H H      . ILE A 1 74  ? 10.741  -12.191 -57.347 1.00 65.36  ?  78  ILE A H      1 
ATOM 1180  H HA     . ILE A 1 74  ? 12.780  -12.978 -58.795 1.00 53.31  ?  78  ILE A HA     1 
ATOM 1181  H HB     . ILE A 1 74  ? 12.432  -10.345 -57.843 1.00 41.28  ?  78  ILE A HB     1 
ATOM 1182  H HG12   . ILE A 1 74  ? 10.416  -10.927 -58.828 1.00 64.20  ?  78  ILE A HG12   1 
ATOM 1183  H HG13   . ILE A 1 74  ? 11.154  -9.882  -59.765 1.00 64.20  ?  78  ILE A HG13   1 
ATOM 1184  H HG21   . ILE A 1 74  ? 13.586  -9.715  -59.778 1.00 37.47  ?  78  ILE A HG21   1 
ATOM 1185  H HG22   . ILE A 1 74  ? 14.474  -10.692 -58.894 1.00 37.47  ?  78  ILE A HG22   1 
ATOM 1186  H HG23   . ILE A 1 74  ? 13.727  -11.245 -60.183 1.00 37.47  ?  78  ILE A HG23   1 
ATOM 1187  H HD11   . ILE A 1 74  ? 10.205  -11.552 -61.033 1.00 72.83  ?  78  ILE A HD11   1 
ATOM 1188  H HD12   . ILE A 1 74  ? 11.786  -11.596 -61.182 1.00 72.83  ?  78  ILE A HD12   1 
ATOM 1189  H HD13   . ILE A 1 74  ? 11.047  -12.643 -60.243 1.00 72.83  ?  78  ILE A HD13   1 
ATOM 1190  N N      . VAL A 1 75  ? 13.478  -12.101 -55.800 1.00 61.45  ?  79  VAL A N      1 
ATOM 1191  C CA     . VAL A 1 75  ? 14.515  -12.185 -54.776 1.00 60.54  ?  79  VAL A CA     1 
ATOM 1192  C C      . VAL A 1 75  ? 14.969  -13.629 -54.607 1.00 68.38  ?  79  VAL A C      1 
ATOM 1193  O O      . VAL A 1 75  ? 16.168  -13.930 -54.625 1.00 61.04  ?  79  VAL A O      1 
ATOM 1194  C CB     . VAL A 1 75  ? 14.009  -11.593 -53.449 1.00 49.53  ?  79  VAL A CB     1 
ATOM 1195  C CG1    . VAL A 1 75  ? 15.093  -11.659 -52.385 1.00 59.75  ?  79  VAL A CG1    1 
ATOM 1196  C CG2    . VAL A 1 75  ? 13.552  -10.156 -53.645 1.00 40.99  ?  79  VAL A CG2    1 
ATOM 1197  H H      . VAL A 1 75  ? 12.731  -11.774 -55.525 1.00 73.73  ?  79  VAL A H      1 
ATOM 1198  H HA     . VAL A 1 75  ? 15.282  -11.663 -55.062 1.00 72.65  ?  79  VAL A HA     1 
ATOM 1199  H HB     . VAL A 1 75  ? 13.249  -12.111 -53.139 1.00 59.44  ?  79  VAL A HB     1 
ATOM 1200  H HG11   . VAL A 1 75  ? 14.749  -11.280 -51.560 1.00 71.70  ?  79  VAL A HG11   1 
ATOM 1201  H HG12   . VAL A 1 75  ? 15.342  -12.586 -52.245 1.00 71.70  ?  79  VAL A HG12   1 
ATOM 1202  H HG13   . VAL A 1 75  ? 15.862  -11.151 -52.686 1.00 71.70  ?  79  VAL A HG13   1 
ATOM 1203  H HG21   . VAL A 1 75  ? 13.238  -9.806  -52.797 1.00 49.19  ?  79  VAL A HG21   1 
ATOM 1204  H HG22   . VAL A 1 75  ? 14.301  -9.628  -53.964 1.00 49.19  ?  79  VAL A HG22   1 
ATOM 1205  H HG23   . VAL A 1 75  ? 12.834  -10.139 -54.297 1.00 49.19  ?  79  VAL A HG23   1 
ATOM 1206  N N      . LYS A 1 76  ? 14.012  -14.545 -54.444 1.00 75.32  ?  80  LYS A N      1 
ATOM 1207  C CA     . LYS A 1 76  ? 14.356  -15.957 -54.314 1.00 65.05  ?  80  LYS A CA     1 
ATOM 1208  C C      . LYS A 1 76  ? 15.189  -16.426 -55.498 1.00 62.78  ?  80  LYS A C      1 
ATOM 1209  O O      . LYS A 1 76  ? 16.179  -17.146 -55.325 1.00 56.33  ?  80  LYS A O      1 
ATOM 1210  C CB     . LYS A 1 76  ? 13.083  -16.793 -54.190 1.00 59.36  ?  80  LYS A CB     1 
ATOM 1211  C CG     . LYS A 1 76  ? 12.163  -16.358 -53.058 1.00 59.17  ?  80  LYS A CG     1 
ATOM 1212  C CD     . LYS A 1 76  ? 12.043  -17.427 -51.987 1.00 58.88  ?  80  LYS A CD     1 
ATOM 1213  C CE     . LYS A 1 76  ? 11.363  -16.892 -50.738 1.00 70.50  ?  80  LYS A CE     1 
ATOM 1214  N NZ     . LYS A 1 76  ? 12.297  -16.097 -49.895 1.00 82.72  1  80  LYS A NZ     1 
ATOM 1215  H H      . LYS A 1 76  ? 13.170  -14.376 -54.406 1.00 90.39  ?  80  LYS A H      1 
ATOM 1216  H HA     . LYS A 1 76  ? 14.880  -16.083 -53.507 1.00 78.06  ?  80  LYS A HA     1 
ATOM 1217  H HB2    . LYS A 1 76  ? 12.584  -16.726 -55.019 1.00 71.23  ?  80  LYS A HB2    1 
ATOM 1218  H HB3    . LYS A 1 76  ? 13.332  -17.717 -54.030 1.00 71.23  ?  80  LYS A HB3    1 
ATOM 1219  H HG2    . LYS A 1 76  ? 12.520  -15.556 -52.646 1.00 71.01  ?  80  LYS A HG2    1 
ATOM 1220  H HG3    . LYS A 1 76  ? 11.278  -16.186 -53.415 1.00 71.01  ?  80  LYS A HG3    1 
ATOM 1221  H HD2    . LYS A 1 76  ? 11.513  -18.164 -52.329 1.00 70.65  ?  80  LYS A HD2    1 
ATOM 1222  H HD3    . LYS A 1 76  ? 12.929  -17.736 -51.743 1.00 70.65  ?  80  LYS A HD3    1 
ATOM 1223  H HE2    . LYS A 1 76  ? 10.626  -16.318 -50.997 1.00 84.60  ?  80  LYS A HE2    1 
ATOM 1224  H HE3    . LYS A 1 76  ? 11.037  -17.637 -50.209 1.00 84.60  ?  80  LYS A HE3    1 
ATOM 1225  H HZ1    . LYS A 1 76  ? 11.873  -15.797 -49.172 1.00 99.26  ?  80  LYS A HZ1    1 
ATOM 1226  H HZ2    . LYS A 1 76  ? 12.982  -16.605 -49.639 1.00 99.26  ?  80  LYS A HZ2    1 
ATOM 1227  H HZ3    . LYS A 1 76  ? 12.607  -15.403 -50.357 1.00 99.26  ?  80  LYS A HZ3    1 
ATOM 1228  N N      . LEU A 1 77  ? 14.808  -16.020 -56.710 1.00 68.26  ?  81  LEU A N      1 
ATOM 1229  C CA     . LEU A 1 77  ? 15.561  -16.407 -57.898 1.00 56.84  ?  81  LEU A CA     1 
ATOM 1230  C C      . LEU A 1 77  ? 16.989  -15.880 -57.835 1.00 55.99  ?  81  LEU A C      1 
ATOM 1231  O O      . LEU A 1 77  ? 17.949  -16.639 -58.009 1.00 56.49  ?  81  LEU A O      1 
ATOM 1232  C CB     . LEU A 1 77  ? 14.840  -15.900 -59.148 1.00 52.04  ?  81  LEU A CB     1 
ATOM 1233  C CG     . LEU A 1 77  ? 15.622  -15.782 -60.458 1.00 48.72  ?  81  LEU A CG     1 
ATOM 1234  C CD1    . LEU A 1 77  ? 16.366  -17.055 -60.800 1.00 48.34  ?  81  LEU A CD1    1 
ATOM 1235  C CD2    . LEU A 1 77  ? 14.667  -15.419 -61.584 1.00 54.79  ?  81  LEU A CD2    1 
ATOM 1236  H H      . LEU A 1 77  ? 14.123  -15.524 -56.868 1.00 81.91  ?  81  LEU A H      1 
ATOM 1237  H HA     . LEU A 1 77  ? 15.600  -17.375 -57.946 1.00 68.21  ?  81  LEU A HA     1 
ATOM 1238  H HB2    . LEU A 1 77  ? 14.095  -16.497 -59.321 1.00 62.44  ?  81  LEU A HB2    1 
ATOM 1239  H HB3    . LEU A 1 77  ? 14.493  -15.016 -58.949 1.00 62.44  ?  81  LEU A HB3    1 
ATOM 1240  H HG     . LEU A 1 77  ? 16.272  -15.067 -60.374 1.00 58.46  ?  81  LEU A HG     1 
ATOM 1241  H HD11   . LEU A 1 77  ? 16.843  -16.927 -61.635 1.00 58.01  ?  81  LEU A HD11   1 
ATOM 1242  H HD12   . LEU A 1 77  ? 16.994  -17.254 -60.088 1.00 58.01  ?  81  LEU A HD12   1 
ATOM 1243  H HD13   . LEU A 1 77  ? 15.728  -17.779 -60.891 1.00 58.01  ?  81  LEU A HD13   1 
ATOM 1244  H HD21   . LEU A 1 77  ? 15.169  -15.346 -62.411 1.00 65.74  ?  81  LEU A HD21   1 
ATOM 1245  H HD22   . LEU A 1 77  ? 13.996  -16.114 -61.665 1.00 65.74  ?  81  LEU A HD22   1 
ATOM 1246  H HD23   . LEU A 1 77  ? 14.243  -14.571 -61.378 1.00 65.74  ?  81  LEU A HD23   1 
ATOM 1247  N N      . VAL A 1 78  ? 17.150  -14.581 -57.580 1.00 60.22  ?  82  VAL A N      1 
ATOM 1248  C CA     . VAL A 1 78  ? 18.492  -14.008 -57.513 1.00 56.72  ?  82  VAL A CA     1 
ATOM 1249  C C      . VAL A 1 78  ? 19.315  -14.725 -56.455 1.00 57.87  ?  82  VAL A C      1 
ATOM 1250  O O      . VAL A 1 78  ? 20.493  -15.036 -56.668 1.00 58.86  ?  82  VAL A O      1 
ATOM 1251  C CB     . VAL A 1 78  ? 18.419  -12.493 -57.245 1.00 46.47  ?  82  VAL A CB     1 
ATOM 1252  C CG1    . VAL A 1 78  ? 19.818  -11.897 -57.149 1.00 59.38  ?  82  VAL A CG1    1 
ATOM 1253  C CG2    . VAL A 1 78  ? 17.636  -11.796 -58.344 1.00 47.85  ?  82  VAL A CG2    1 
ATOM 1254  H H      . VAL A 1 78  ? 16.512  -14.020 -57.445 1.00 72.27  ?  82  VAL A H      1 
ATOM 1255  H HA     . VAL A 1 78  ? 18.930  -14.137 -58.368 1.00 68.06  ?  82  VAL A HA     1 
ATOM 1256  H HB     . VAL A 1 78  ? 17.964  -12.338 -56.403 1.00 55.77  ?  82  VAL A HB     1 
ATOM 1257  H HG11   . VAL A 1 78  ? 19.744  -10.944 -56.980 1.00 71.26  ?  82  VAL A HG11   1 
ATOM 1258  H HG12   . VAL A 1 78  ? 20.294  -12.326 -56.421 1.00 71.26  ?  82  VAL A HG12   1 
ATOM 1259  H HG13   . VAL A 1 78  ? 20.284  -12.050 -57.985 1.00 71.26  ?  82  VAL A HG13   1 
ATOM 1260  H HG21   . VAL A 1 78  ? 17.603  -10.845 -58.155 1.00 57.42  ?  82  VAL A HG21   1 
ATOM 1261  H HG22   . VAL A 1 78  ? 18.079  -11.950 -59.193 1.00 57.42  ?  82  VAL A HG22   1 
ATOM 1262  H HG23   . VAL A 1 78  ? 16.737  -12.160 -58.370 1.00 57.42  ?  82  VAL A HG23   1 
ATOM 1263  N N      . ALA A 1 79  ? 18.710  -15.009 -55.302 1.00 61.46  ?  83  ALA A N      1 
ATOM 1264  C CA     . ALA A 1 79  ? 19.423  -15.734 -54.258 1.00 67.68  ?  83  ALA A CA     1 
ATOM 1265  C C      . ALA A 1 79  ? 19.824  -17.121 -54.742 1.00 71.33  ?  83  ALA A C      1 
ATOM 1266  O O      . ALA A 1 79  ? 20.978  -17.538 -54.587 1.00 71.12  ?  83  ALA A O      1 
ATOM 1267  C CB     . ALA A 1 79  ? 18.557  -15.828 -53.003 1.00 66.00  ?  83  ALA A CB     1 
ATOM 1268  H H      . ALA A 1 79  ? 17.901  -14.796 -55.103 1.00 73.75  ?  83  ALA A H      1 
ATOM 1269  H HA     . ALA A 1 79  ? 20.232  -15.249 -54.031 1.00 81.21  ?  83  ALA A HA     1 
ATOM 1270  H HB1    . ALA A 1 79  ? 19.045  -16.313 -52.319 1.00 79.20  ?  83  ALA A HB1    1 
ATOM 1271  H HB2    . ALA A 1 79  ? 18.354  -14.932 -52.693 1.00 79.20  ?  83  ALA A HB2    1 
ATOM 1272  H HB3    . ALA A 1 79  ? 17.737  -16.298 -53.221 1.00 79.20  ?  83  ALA A HB3    1 
ATOM 1273  N N      . ALA A 1 80  ? 18.881  -17.850 -55.340 1.00 70.01  ?  84  ALA A N      1 
ATOM 1274  C CA     . ALA A 1 80  ? 19.187  -19.185 -55.838 1.00 70.54  ?  84  ALA A CA     1 
ATOM 1275  C C      . ALA A 1 80  ? 20.260  -19.148 -56.918 1.00 60.27  ?  84  ALA A C      1 
ATOM 1276  O O      . ALA A 1 80  ? 21.073  -20.073 -57.016 1.00 61.83  ?  84  ALA A O      1 
ATOM 1277  C CB     . ALA A 1 80  ? 17.917  -19.846 -56.370 1.00 77.17  ?  84  ALA A CB     1 
ATOM 1278  H H      . ALA A 1 80  ? 18.068  -17.598 -55.467 1.00 84.01  ?  84  ALA A H      1 
ATOM 1279  H HA     . ALA A 1 80  ? 19.521  -19.726 -55.105 1.00 84.64  ?  84  ALA A HA     1 
ATOM 1280  H HB1    . ALA A 1 80  ? 18.136  -20.732 -56.698 1.00 92.61  ?  84  ALA A HB1    1 
ATOM 1281  H HB2    . ALA A 1 80  ? 17.270  -19.910 -55.651 1.00 92.61  ?  84  ALA A HB2    1 
ATOM 1282  H HB3    . ALA A 1 80  ? 17.559  -19.306 -57.092 1.00 92.61  ?  84  ALA A HB3    1 
ATOM 1283  N N      . PHE A 1 81  ? 20.282  -18.091 -57.731 1.00 54.81  ?  85  PHE A N      1 
ATOM 1284  C CA     . PHE A 1 81  ? 21.312  -17.965 -58.757 1.00 46.54  ?  85  PHE A CA     1 
ATOM 1285  C C      . PHE A 1 81  ? 22.691  -17.832 -58.127 1.00 51.00  ?  85  PHE A C      1 
ATOM 1286  O O      . PHE A 1 81  ? 23.626  -18.552 -58.494 1.00 54.69  ?  85  PHE A O      1 
ATOM 1287  C CB     . PHE A 1 81  ? 21.005  -16.766 -59.651 1.00 42.62  ?  85  PHE A CB     1 
ATOM 1288  C CG     . PHE A 1 81  ? 21.920  -16.638 -60.834 1.00 43.47  ?  85  PHE A CG     1 
ATOM 1289  C CD1    . PHE A 1 81  ? 22.657  -15.485 -61.036 1.00 50.28  ?  85  PHE A CD1    1 
ATOM 1290  C CD2    . PHE A 1 81  ? 22.042  -17.670 -61.744 1.00 44.77  ?  85  PHE A CD2    1 
ATOM 1291  C CE1    . PHE A 1 81  ? 23.494  -15.364 -62.126 1.00 31.90  ?  85  PHE A CE1    1 
ATOM 1292  C CE2    . PHE A 1 81  ? 22.880  -17.554 -62.832 1.00 53.06  ?  85  PHE A CE2    1 
ATOM 1293  C CZ     . PHE A 1 81  ? 23.606  -16.400 -63.023 1.00 47.17  ?  85  PHE A CZ     1 
ATOM 1294  H H      . PHE A 1 81  ? 19.718  -17.442 -57.710 1.00 65.78  ?  85  PHE A H      1 
ATOM 1295  H HA     . PHE A 1 81  ? 21.309  -18.763 -59.309 1.00 55.85  ?  85  PHE A HA     1 
ATOM 1296  H HB2    . PHE A 1 81  ? 20.099  -16.850 -59.986 1.00 51.15  ?  85  PHE A HB2    1 
ATOM 1297  H HB3    . PHE A 1 81  ? 21.087  -15.955 -59.125 1.00 51.15  ?  85  PHE A HB3    1 
ATOM 1298  H HD1    . PHE A 1 81  ? 22.584  -14.781 -60.433 1.00 60.34  ?  85  PHE A HD1    1 
ATOM 1299  H HD2    . PHE A 1 81  ? 21.553  -18.452 -61.621 1.00 53.73  ?  85  PHE A HD2    1 
ATOM 1300  H HE1    . PHE A 1 81  ? 23.985  -14.584 -62.251 1.00 38.29  ?  85  PHE A HE1    1 
ATOM 1301  H HE2    . PHE A 1 81  ? 22.954  -18.255 -63.439 1.00 63.68  ?  85  PHE A HE2    1 
ATOM 1302  H HZ     . PHE A 1 81  ? 24.172  -16.322 -63.757 1.00 56.60  ?  85  PHE A HZ     1 
ATOM 1303  N N      . ILE A 1 82  ? 22.837  -16.913 -57.171 1.00 56.56  ?  86  ILE A N      1 
ATOM 1304  C CA     . ILE A 1 82  ? 24.116  -16.752 -56.486 1.00 57.21  ?  86  ILE A CA     1 
ATOM 1305  C C      . ILE A 1 82  ? 24.516  -18.059 -55.819 1.00 55.21  ?  86  ILE A C      1 
ATOM 1306  O O      . ILE A 1 82  ? 25.649  -18.533 -55.962 1.00 60.94  ?  86  ILE A O      1 
ATOM 1307  C CB     . ILE A 1 82  ? 24.042  -15.608 -55.458 1.00 62.33  ?  86  ILE A CB     1 
ATOM 1308  C CG1    . ILE A 1 82  ? 23.574  -14.300 -56.108 1.00 46.62  ?  86  ILE A CG1    1 
ATOM 1309  C CG2    . ILE A 1 82  ? 25.398  -15.417 -54.783 1.00 64.52  ?  86  ILE A CG2    1 
ATOM 1310  C CD1    . ILE A 1 82  ? 24.585  -13.645 -57.018 1.00 59.93  ?  86  ILE A CD1    1 
ATOM 1311  H H      . ILE A 1 82  ? 22.218  -16.378 -56.904 1.00 67.87  ?  86  ILE A H      1 
ATOM 1312  H HA     . ILE A 1 82  ? 24.798  -16.526 -57.138 1.00 68.65  ?  86  ILE A HA     1 
ATOM 1313  H HB     . ILE A 1 82  ? 23.397  -15.854 -54.777 1.00 74.79  ?  86  ILE A HB     1 
ATOM 1314  H HG12   . ILE A 1 82  ? 22.781  -14.484 -56.635 1.00 55.95  ?  86  ILE A HG12   1 
ATOM 1315  H HG13   . ILE A 1 82  ? 23.359  -13.666 -55.406 1.00 55.95  ?  86  ILE A HG13   1 
ATOM 1316  H HG21   . ILE A 1 82  ? 25.331  -14.693 -54.140 1.00 77.42  ?  86  ILE A HG21   1 
ATOM 1317  H HG22   . ILE A 1 82  ? 25.644  -16.239 -54.331 1.00 77.42  ?  86  ILE A HG22   1 
ATOM 1318  H HG23   . ILE A 1 82  ? 26.059  -15.200 -55.459 1.00 77.42  ?  86  ILE A HG23   1 
ATOM 1319  H HD11   . ILE A 1 82  ? 24.203  -12.831 -57.380 1.00 71.92  ?  86  ILE A HD11   1 
ATOM 1320  H HD12   . ILE A 1 82  ? 25.382  -13.438 -56.505 1.00 71.92  ?  86  ILE A HD12   1 
ATOM 1321  H HD13   . ILE A 1 82  ? 24.804  -14.257 -57.738 1.00 71.92  ?  86  ILE A HD13   1 
ATOM 1322  N N      . ALA A 1 83  ? 23.585  -18.663 -55.079 1.00 53.78  ?  87  ALA A N      1 
ATOM 1323  C CA     . ALA A 1 83  ? 23.894  -19.885 -54.347 1.00 62.00  ?  87  ALA A CA     1 
ATOM 1324  C C      . ALA A 1 83  ? 24.331  -20.992 -55.296 1.00 55.92  ?  87  ALA A C      1 
ATOM 1325  O O      . ALA A 1 83  ? 25.359  -21.644 -55.078 1.00 47.20  ?  87  ALA A O      1 
ATOM 1326  C CB     . ALA A 1 83  ? 22.678  -20.322 -53.531 1.00 68.97  ?  87  ALA A CB     1 
ATOM 1327  H H      . ALA A 1 83  ? 22.776  -18.386 -54.986 1.00 64.53  ?  87  ALA A H      1 
ATOM 1328  H HA     . ALA A 1 83  ? 24.623  -19.711 -53.732 1.00 74.40  ?  87  ALA A HA     1 
ATOM 1329  H HB1    . ALA A 1 83  ? 22.897  -21.136 -53.050 1.00 82.77  ?  87  ALA A HB1    1 
ATOM 1330  H HB2    . ALA A 1 83  ? 22.449  -19.618 -52.905 1.00 82.77  ?  87  ALA A HB2    1 
ATOM 1331  H HB3    . ALA A 1 83  ? 21.935  -20.484 -54.134 1.00 82.77  ?  87  ALA A HB3    1 
ATOM 1332  N N      . SER A 1 84  ? 23.562  -21.216 -56.362 1.00 41.94  ?  88  SER A N      1 
ATOM 1333  C CA     . SER A 1 84  ? 23.916  -22.256 -57.319 1.00 49.03  ?  88  SER A CA     1 
ATOM 1334  C C      . SER A 1 84  ? 25.318  -22.039 -57.872 1.00 46.88  ?  88  SER A C      1 
ATOM 1335  O O      . SER A 1 84  ? 26.079  -22.996 -58.048 1.00 60.68  ?  88  SER A O      1 
ATOM 1336  C CB     . SER A 1 84  ? 22.891  -22.294 -58.450 1.00 61.44  ?  88  SER A CB     1 
ATOM 1337  O OG     . SER A 1 84  ? 23.285  -23.205 -59.460 1.00 69.07  ?  88  SER A OG     1 
ATOM 1338  H H      . SER A 1 84  ? 22.842  -20.785 -56.550 1.00 50.33  ?  88  SER A H      1 
ATOM 1339  H HA     . SER A 1 84  ? 23.901  -23.116 -56.871 1.00 58.84  ?  88  SER A HA     1 
ATOM 1340  H HB2    . SER A 1 84  ? 22.035  -22.573 -58.090 1.00 73.73  ?  88  SER A HB2    1 
ATOM 1341  H HB3    . SER A 1 84  ? 22.815  -21.408 -58.837 1.00 73.73  ?  88  SER A HB3    1 
ATOM 1342  H HG     . SER A 1 84  ? 23.355  -23.978 -59.138 1.00 82.89  ?  88  SER A HG     1 
ATOM 1343  N N      . LEU A 1 85  ? 25.680  -20.786 -58.146 1.00 51.82  ?  89  LEU A N      1 
ATOM 1344  C CA     . LEU A 1 85  ? 27.021  -20.497 -58.641 1.00 54.60  ?  89  LEU A CA     1 
ATOM 1345  C C      . LEU A 1 85  ? 28.070  -20.812 -57.584 1.00 52.88  ?  89  LEU A C      1 
ATOM 1346  O O      . LEU A 1 85  ? 29.103  -21.422 -57.881 1.00 52.20  ?  89  LEU A O      1 
ATOM 1347  C CB     . LEU A 1 85  ? 27.115  -19.034 -59.069 1.00 53.17  ?  89  LEU A CB     1 
ATOM 1348  C CG     . LEU A 1 85  ? 26.265  -18.648 -60.275 1.00 41.33  ?  89  LEU A CG     1 
ATOM 1349  C CD1    . LEU A 1 85  ? 25.804  -17.219 -60.139 1.00 54.93  ?  89  LEU A CD1    1 
ATOM 1350  C CD2    . LEU A 1 85  ? 27.058  -18.828 -61.554 1.00 49.43  ?  89  LEU A CD2    1 
ATOM 1351  H H      . LEU A 1 85  ? 25.175  -20.096 -58.055 1.00 62.18  ?  89  LEU A H      1 
ATOM 1352  H HA     . LEU A 1 85  ? 27.199  -21.050 -59.418 1.00 65.52  ?  89  LEU A HA     1 
ATOM 1353  H HB2    . LEU A 1 85  ? 26.834  -18.479 -58.325 1.00 63.80  ?  89  LEU A HB2    1 
ATOM 1354  H HB3    . LEU A 1 85  ? 28.039  -18.838 -59.289 1.00 63.80  ?  89  LEU A HB3    1 
ATOM 1355  H HG     . LEU A 1 85  ? 25.483  -19.220 -60.316 1.00 49.59  ?  89  LEU A HG     1 
ATOM 1356  H HD11   . LEU A 1 85  ? 25.265  -16.986 -60.912 1.00 65.91  ?  89  LEU A HD11   1 
ATOM 1357  H HD12   . LEU A 1 85  ? 25.276  -17.134 -59.330 1.00 65.91  ?  89  LEU A HD12   1 
ATOM 1358  H HD13   . LEU A 1 85  ? 26.580  -16.640 -60.091 1.00 65.91  ?  89  LEU A HD13   1 
ATOM 1359  H HD21   . LEU A 1 85  ? 26.501  -18.578 -62.308 1.00 59.31  ?  89  LEU A HD21   1 
ATOM 1360  H HD22   . LEU A 1 85  ? 27.844  -18.261 -61.520 1.00 59.31  ?  89  LEU A HD22   1 
ATOM 1361  H HD23   . LEU A 1 85  ? 27.323  -19.758 -61.633 1.00 59.31  ?  89  LEU A HD23   1 
ATOM 1362  N N      . GLU A 1 86  ? 27.826  -20.390 -56.344 1.00 54.38  ?  90  GLU A N      1 
ATOM 1363  C CA     . GLU A 1 86  ? 28.735  -20.729 -55.255 1.00 58.07  ?  90  GLU A CA     1 
ATOM 1364  C C      . GLU A 1 86  ? 28.897  -22.236 -55.142 1.00 80.05  ?  90  GLU A C      1 
ATOM 1365  O O      . GLU A 1 86  ? 30.019  -22.747 -55.043 1.00 88.64  ?  90  GLU A O      1 
ATOM 1366  C CB     . GLU A 1 86  ? 28.211  -20.137 -53.945 1.00 68.58  ?  90  GLU A CB     1 
ATOM 1367  C CG     . GLU A 1 86  ? 29.074  -20.416 -52.725 1.00 87.67  ?  90  GLU A CG     1 
ATOM 1368  C CD     . GLU A 1 86  ? 30.418  -19.722 -52.788 1.00 83.84  ?  90  GLU A CD     1 
ATOM 1369  O OE1    . GLU A 1 86  ? 30.653  -18.966 -53.752 1.00 84.63  ?  90  GLU A OE1    1 
ATOM 1370  O OE2    . GLU A 1 86  ? 31.241  -19.931 -51.872 1.00 63.38  -1 90  GLU A OE2    1 
ATOM 1371  H H      . GLU A 1 86  ? 27.149  -19.914 -56.110 1.00 65.25  ?  90  GLU A H      1 
ATOM 1372  H HA     . GLU A 1 86  ? 29.606  -20.343 -55.435 1.00 69.68  ?  90  GLU A HA     1 
ATOM 1373  H HB2    . GLU A 1 86  ? 28.148  -19.174 -54.045 1.00 82.29  ?  90  GLU A HB2    1 
ATOM 1374  H HB3    . GLU A 1 86  ? 27.330  -20.505 -53.771 1.00 82.29  ?  90  GLU A HB3    1 
ATOM 1375  H HG2    . GLU A 1 86  ? 28.612  -20.103 -51.932 1.00 105.20 ?  90  GLU A HG2    1 
ATOM 1376  H HG3    . GLU A 1 86  ? 29.233  -21.371 -52.662 1.00 105.20 ?  90  GLU A HG3    1 
ATOM 1377  N N      . ARG A 1 87  ? 27.784  -22.970 -55.180 1.00 85.37  ?  91  ARG A N      1 
ATOM 1378  C CA     . ARG A 1 87  ? 27.831  -24.418 -55.014 1.00 78.55  ?  91  ARG A CA     1 
ATOM 1379  C C      . ARG A 1 87  ? 28.734  -25.064 -56.058 1.00 71.76  ?  91  ARG A C      1 
ATOM 1380  O O      . ARG A 1 87  ? 29.620  -25.856 -55.720 1.00 78.37  ?  91  ARG A O      1 
ATOM 1381  C CB     . ARG A 1 87  ? 26.417  -24.991 -55.086 1.00 76.98  ?  91  ARG A CB     1 
ATOM 1382  C CG     . ARG A 1 87  ? 25.915  -25.587 -53.782 1.00 79.81  ?  91  ARG A CG     1 
ATOM 1383  C CD     . ARG A 1 87  ? 26.116  -27.087 -53.731 1.00 83.21  ?  91  ARG A CD     1 
ATOM 1384  N NE     . ARG A 1 87  ? 24.973  -27.741 -53.106 1.00 90.00  ?  91  ARG A NE     1 
ATOM 1385  C CZ     . ARG A 1 87  ? 25.026  -28.519 -52.030 1.00 87.32  ?  91  ARG A CZ     1 
ATOM 1386  N NH1    . ARG A 1 87  ? 26.178  -28.789 -51.428 1.00 93.87  1  91  ARG A NH1    1 
ATOM 1387  N NH2    . ARG A 1 87  ? 23.906  -29.043 -51.565 1.00 95.85  ?  91  ARG A NH2    1 
ATOM 1388  H H      . ARG A 1 87  ? 26.994  -22.653 -55.301 1.00 102.45 ?  91  ARG A H      1 
ATOM 1389  H HA     . ARG A 1 87  ? 28.193  -24.623 -54.138 1.00 94.26  ?  91  ARG A HA     1 
ATOM 1390  H HB2    . ARG A 1 87  ? 25.807  -24.281 -55.340 1.00 92.37  ?  91  ARG A HB2    1 
ATOM 1391  H HB3    . ARG A 1 87  ? 26.400  -25.692 -55.756 1.00 92.37  ?  91  ARG A HB3    1 
ATOM 1392  H HG2    . ARG A 1 87  ? 26.402  -25.191 -53.042 1.00 95.78  ?  91  ARG A HG2    1 
ATOM 1393  H HG3    . ARG A 1 87  ? 24.966  -25.405 -53.693 1.00 95.78  ?  91  ARG A HG3    1 
ATOM 1394  H HD2    . ARG A 1 87  ? 26.210  -27.430 -54.633 1.00 99.86  ?  91  ARG A HD2    1 
ATOM 1395  H HD3    . ARG A 1 87  ? 26.908  -27.289 -53.209 1.00 99.86  ?  91  ARG A HD3    1 
ATOM 1396  H HE     . ARG A 1 87  ? 24.201  -27.613 -53.463 1.00 108.00 ?  91  ARG A HE     1 
ATOM 1397  H HH11   . ARG A 1 87  ? 26.910  -28.450 -51.726 1.00 112.65 ?  91  ARG A HH11   1 
ATOM 1398  H HH12   . ARG A 1 87  ? 26.192  -29.298 -50.734 1.00 112.65 ?  91  ARG A HH12   1 
ATOM 1399  H HH21   . ARG A 1 87  ? 23.158  -28.874 -51.954 1.00 115.01 ?  91  ARG A HH21   1 
ATOM 1400  H HH22   . ARG A 1 87  ? 23.925  -29.553 -50.873 1.00 115.01 ?  91  ARG A HH22   1 
ATOM 1401  N N      . GLU A 1 88  ? 28.517  -24.743 -57.336 1.00 73.07  ?  92  GLU A N      1 
ATOM 1402  C CA     . GLU A 1 88  ? 29.434  -25.206 -58.372 1.00 79.98  ?  92  GLU A CA     1 
ATOM 1403  C C      . GLU A 1 88  ? 30.883  -24.983 -57.964 1.00 77.02  ?  92  GLU A C      1 
ATOM 1404  O O      . GLU A 1 88  ? 31.760  -25.793 -58.284 1.00 77.35  ?  92  GLU A O      1 
ATOM 1405  C CB     . GLU A 1 88  ? 29.151  -24.484 -59.688 1.00 84.58  ?  92  GLU A CB     1 
ATOM 1406  C CG     . GLU A 1 88  ? 27.918  -24.960 -60.426 1.00 83.01  ?  92  GLU A CG     1 
ATOM 1407  C CD     . GLU A 1 88  ? 27.664  -24.148 -61.677 1.00 85.86  ?  92  GLU A CD     1 
ATOM 1408  O OE1    . GLU A 1 88  ? 26.556  -24.248 -62.240 1.00 98.89  ?  92  GLU A OE1    1 
ATOM 1409  O OE2    . GLU A 1 88  ? 28.577  -23.403 -62.093 1.00 65.64  -1 92  GLU A OE2    1 
ATOM 1410  H H      . GLU A 1 88  ? 27.859  -24.268 -57.622 1.00 87.68  ?  92  GLU A H      1 
ATOM 1411  H HA     . GLU A 1 88  ? 29.302  -26.156 -58.513 1.00 95.97  ?  92  GLU A HA     1 
ATOM 1412  H HB2    . GLU A 1 88  ? 29.034  -23.539 -59.502 1.00 101.49 ?  92  GLU A HB2    1 
ATOM 1413  H HB3    . GLU A 1 88  ? 29.911  -24.607 -60.277 1.00 101.49 ?  92  GLU A HB3    1 
ATOM 1414  H HG2    . GLU A 1 88  ? 28.040  -25.886 -60.686 1.00 99.61  ?  92  GLU A HG2    1 
ATOM 1415  H HG3    . GLU A 1 88  ? 27.145  -24.873 -59.846 1.00 99.61  ?  92  GLU A HG3    1 
ATOM 1416  N N      . LEU A 1 89  ? 31.149  -23.896 -57.240 1.00 83.27  ?  93  LEU A N      1 
ATOM 1417  C CA     . LEU A 1 89  ? 32.520  -23.504 -56.953 1.00 85.89  ?  93  LEU A CA     1 
ATOM 1418  C C      . LEU A 1 89  ? 33.087  -24.212 -55.730 1.00 85.29  ?  93  LEU A C      1 
ATOM 1419  O O      . LEU A 1 89  ? 34.309  -24.361 -55.625 1.00 84.74  ?  93  LEU A O      1 
ATOM 1420  C CB     . LEU A 1 89  ? 32.582  -21.988 -56.767 1.00 71.15  ?  93  LEU A CB     1 
ATOM 1421  C CG     . LEU A 1 89  ? 33.942  -21.357 -56.486 1.00 82.70  ?  93  LEU A CG     1 
ATOM 1422  C CD1    . LEU A 1 89  ? 34.964  -21.765 -57.532 1.00 89.66  ?  93  LEU A CD1    1 
ATOM 1423  C CD2    . LEU A 1 89  ? 33.795  -19.847 -56.438 1.00 97.56  ?  93  LEU A CD2    1 
ATOM 1424  H H      . LEU A 1 89  ? 30.553  -23.374 -56.906 1.00 99.92  ?  93  LEU A H      1 
ATOM 1425  H HA     . LEU A 1 89  ? 33.077  -23.733 -57.713 1.00 103.07 ?  93  LEU A HA     1 
ATOM 1426  H HB2    . LEU A 1 89  ? 32.241  -21.575 -57.575 1.00 85.38  ?  93  LEU A HB2    1 
ATOM 1427  H HB3    . LEU A 1 89  ? 32.004  -21.755 -56.024 1.00 85.38  ?  93  LEU A HB3    1 
ATOM 1428  H HG     . LEU A 1 89  ? 34.259  -21.658 -55.620 1.00 99.24  ?  93  LEU A HG     1 
ATOM 1429  H HD11   . LEU A 1 89  ? 35.814  -21.347 -57.322 1.00 107.59 ?  93  LEU A HD11   1 
ATOM 1430  H HD12   . LEU A 1 89  ? 35.059  -22.730 -57.521 1.00 107.59 ?  93  LEU A HD12   1 
ATOM 1431  H HD13   . LEU A 1 89  ? 34.657  -21.472 -58.404 1.00 107.59 ?  93  LEU A HD13   1 
ATOM 1432  H HD21   . LEU A 1 89  ? 34.663  -19.451 -56.259 1.00 117.07 ?  93  LEU A HD21   1 
ATOM 1433  H HD22   . LEU A 1 89  ? 33.459  -19.535 -57.292 1.00 117.07 ?  93  LEU A HD22   1 
ATOM 1434  H HD23   . LEU A 1 89  ? 33.173  -19.613 -55.732 1.00 117.07 ?  93  LEU A HD23   1 
ATOM 1435  N N      . ILE A 1 90  ? 32.237  -24.658 -54.806 1.00 94.59  ?  94  ILE A N      1 
ATOM 1436  C CA     . ILE A 1 90  ? 32.732  -25.322 -53.603 1.00 89.81  ?  94  ILE A CA     1 
ATOM 1437  C C      . ILE A 1 90  ? 33.139  -26.757 -53.911 1.00 89.41  ?  94  ILE A C      1 
ATOM 1438  O O      . ILE A 1 90  ? 34.295  -27.149 -53.709 1.00 82.26  ?  94  ILE A O      1 
ATOM 1439  C CB     . ILE A 1 90  ? 31.682  -25.277 -52.477 1.00 86.92  ?  94  ILE A CB     1 
ATOM 1440  C CG1    . ILE A 1 90  ? 31.172  -23.853 -52.247 1.00 76.98  ?  94  ILE A CG1    1 
ATOM 1441  C CG2    . ILE A 1 90  ? 32.292  -25.807 -51.185 1.00 79.73  ?  94  ILE A CG2    1 
ATOM 1442  C CD1    . ILE A 1 90  ? 29.997  -23.773 -51.288 1.00 75.12  ?  94  ILE A CD1    1 
ATOM 1443  H H      . ILE A 1 90  ? 31.380  -24.590 -54.851 1.00 113.50 ?  94  ILE A H      1 
ATOM 1444  H HA     . ILE A 1 90  ? 33.520  -24.852 -53.290 1.00 107.77 ?  94  ILE A HA     1 
ATOM 1445  H HB     . ILE A 1 90  ? 30.933  -25.842 -52.724 1.00 104.31 ?  94  ILE A HB     1 
ATOM 1446  H HG12   . ILE A 1 90  ? 31.893  -23.318 -51.879 1.00 92.38  ?  94  ILE A HG12   1 
ATOM 1447  H HG13   . ILE A 1 90  ? 30.888  -23.481 -53.097 1.00 92.38  ?  94  ILE A HG13   1 
ATOM 1448  H HG21   . ILE A 1 90  ? 31.623  -25.774 -50.483 1.00 95.68  ?  94  ILE A HG21   1 
ATOM 1449  H HG22   . ILE A 1 90  ? 32.581  -26.722 -51.325 1.00 95.68  ?  94  ILE A HG22   1 
ATOM 1450  H HG23   . ILE A 1 90  ? 33.051  -25.252 -50.945 1.00 95.68  ?  94  ILE A HG23   1 
ATOM 1451  H HD11   . ILE A 1 90  ? 29.730  -22.846 -51.192 1.00 90.14  ?  94  ILE A HD11   1 
ATOM 1452  H HD12   . ILE A 1 90  ? 29.262  -24.294 -51.646 1.00 90.14  ?  94  ILE A HD12   1 
ATOM 1453  H HD13   . ILE A 1 90  ? 30.268  -24.131 -50.428 1.00 90.14  ?  94  ILE A HD13   1 
ATOM 1454  N N      . LEU A 1 91  ? 32.195  -27.565 -54.406 1.00 80.33  ?  95  LEU A N      1 
ATOM 1455  C CA     . LEU A 1 91  ? 32.470  -28.986 -54.586 1.00 76.44  ?  95  LEU A CA     1 
ATOM 1456  C C      . LEU A 1 91  ? 33.707  -29.209 -55.443 1.00 82.14  ?  95  LEU A C      1 
ATOM 1457  O O      . LEU A 1 91  ? 34.412  -30.208 -55.266 1.00 108.60 ?  95  LEU A O      1 
ATOM 1458  C CB     . LEU A 1 91  ? 31.253  -29.696 -55.189 1.00 80.33  ?  95  LEU A CB     1 
ATOM 1459  C CG     . LEU A 1 91  ? 30.739  -29.341 -56.587 1.00 84.85  ?  95  LEU A CG     1 
ATOM 1460  C CD1    . LEU A 1 91  ? 31.526  -30.040 -57.690 1.00 95.19  ?  95  LEU A CD1    1 
ATOM 1461  C CD2    . LEU A 1 91  ? 29.268  -29.717 -56.685 1.00 82.95  ?  95  LEU A CD2    1 
ATOM 1462  H H      . LEU A 1 91  ? 31.405  -27.317 -54.640 1.00 96.40  ?  95  LEU A H      1 
ATOM 1463  H HA     . LEU A 1 91  ? 32.640  -29.382 -53.717 1.00 91.73  ?  95  LEU A HA     1 
ATOM 1464  H HB2    . LEU A 1 91  ? 31.455  -30.644 -55.208 1.00 96.39  ?  95  LEU A HB2    1 
ATOM 1465  H HB3    . LEU A 1 91  ? 30.509  -29.552 -54.583 1.00 96.39  ?  95  LEU A HB3    1 
ATOM 1466  H HG     . LEU A 1 91  ? 30.815  -28.383 -56.721 1.00 101.82 ?  95  LEU A HG     1 
ATOM 1467  H HD11   . LEU A 1 91  ? 31.160  -29.781 -58.550 1.00 114.22 ?  95  LEU A HD11   1 
ATOM 1468  H HD12   . LEU A 1 91  ? 32.456  -29.772 -57.631 1.00 114.22 ?  95  LEU A HD12   1 
ATOM 1469  H HD13   . LEU A 1 91  ? 31.449  -30.999 -57.573 1.00 114.22 ?  95  LEU A HD13   1 
ATOM 1470  H HD21   . LEU A 1 91  ? 28.944  -29.492 -57.571 1.00 99.54  ?  95  LEU A HD21   1 
ATOM 1471  H HD22   . LEU A 1 91  ? 29.176  -30.670 -56.530 1.00 99.54  ?  95  LEU A HD22   1 
ATOM 1472  H HD23   . LEU A 1 91  ? 28.771  -29.223 -56.014 1.00 99.54  ?  95  LEU A HD23   1 
ATOM 1473  N N      . ALA A 1 92  ? 33.992  -28.293 -56.369 1.00 82.99  ?  96  ALA A N      1 
ATOM 1474  C CA     . ALA A 1 92  ? 35.265  -28.336 -57.076 1.00 94.16  ?  96  ALA A CA     1 
ATOM 1475  C C      . ALA A 1 92  ? 36.420  -28.221 -56.092 1.00 93.08  ?  96  ALA A C      1 
ATOM 1476  O O      . ALA A 1 92  ? 37.252  -29.127 -55.975 1.00 100.50 ?  96  ALA A O      1 
ATOM 1477  C CB     . ALA A 1 92  ? 35.325  -27.215 -58.115 1.00 102.30 ?  96  ALA A CB     1 
ATOM 1478  H H      . ALA A 1 92  ? 33.473  -27.648 -56.601 1.00 99.59  ?  96  ALA A H      1 
ATOM 1479  H HA     . ALA A 1 92  ? 35.344  -29.184 -57.540 1.00 112.99 ?  96  ALA A HA     1 
ATOM 1480  H HB1    . ALA A 1 92  ? 36.177  -27.258 -58.576 1.00 122.76 ?  96  ALA A HB1    1 
ATOM 1481  H HB2    . ALA A 1 92  ? 34.600  -27.333 -58.748 1.00 122.76 ?  96  ALA A HB2    1 
ATOM 1482  H HB3    . ALA A 1 92  ? 35.235  -26.361 -57.663 1.00 122.76 ?  96  ALA A HB3    1 
ATOM 1483  N N      . LYS A 1 93  ? 36.466  -27.114 -55.349 1.00 95.24  ?  97  LYS A N      1 
ATOM 1484  C CA     . LYS A 1 93  ? 37.551  -26.886 -54.404 1.00 98.57  ?  97  LYS A CA     1 
ATOM 1485  C C      . LYS A 1 93  ? 37.711  -28.028 -53.412 1.00 96.51  ?  97  LYS A C      1 
ATOM 1486  O O      . LYS A 1 93  ? 38.801  -28.201 -52.855 1.00 93.24  ?  97  LYS A O      1 
ATOM 1487  C CB     . LYS A 1 93  ? 37.316  -25.573 -53.654 1.00 100.98 ?  97  LYS A CB     1 
ATOM 1488  C CG     . LYS A 1 93  ? 37.457  -24.336 -54.528 1.00 106.00 ?  97  LYS A CG     1 
ATOM 1489  C CD     . LYS A 1 93  ? 37.320  -23.050 -53.725 1.00 109.74 ?  97  LYS A CD     1 
ATOM 1490  C CE     . LYS A 1 93  ? 35.877  -22.781 -53.332 1.00 99.02  ?  97  LYS A CE     1 
ATOM 1491  N NZ     . LYS A 1 93  ? 35.717  -21.459 -52.665 1.00 76.99  1  97  LYS A NZ     1 
ATOM 1492  H H      . LYS A 1 93  ? 35.881  -26.484 -55.375 1.00 114.29 ?  97  LYS A H      1 
ATOM 1493  H HA     . LYS A 1 93  ? 38.382  -26.802 -54.897 1.00 118.29 ?  97  LYS A HA     1 
ATOM 1494  H HB2    . LYS A 1 93  ? 36.417  -25.578 -53.289 1.00 121.18 ?  97  LYS A HB2    1 
ATOM 1495  H HB3    . LYS A 1 93  ? 37.963  -25.504 -52.935 1.00 121.18 ?  97  LYS A HB3    1 
ATOM 1496  H HG2    . LYS A 1 93  ? 38.333  -24.340 -54.946 1.00 127.20 ?  97  LYS A HG2    1 
ATOM 1497  H HG3    . LYS A 1 93  ? 36.764  -24.344 -55.206 1.00 127.20 ?  97  LYS A HG3    1 
ATOM 1498  H HD2    . LYS A 1 93  ? 37.846  -23.123 -52.913 1.00 131.69 ?  97  LYS A HD2    1 
ATOM 1499  H HD3    . LYS A 1 93  ? 37.632  -22.304 -54.260 1.00 131.69 ?  97  LYS A HD3    1 
ATOM 1500  H HE2    . LYS A 1 93  ? 35.324  -22.786 -54.129 1.00 118.82 ?  97  LYS A HE2    1 
ATOM 1501  H HE3    . LYS A 1 93  ? 35.581  -23.469 -52.715 1.00 118.82 ?  97  LYS A HE3    1 
ATOM 1502  H HZ1    . LYS A 1 93  ? 34.864  -21.330 -52.447 1.00 92.38  ?  97  LYS A HZ1    1 
ATOM 1503  H HZ2    . LYS A 1 93  ? 36.212  -21.430 -51.926 1.00 92.38  ?  97  LYS A HZ2    1 
ATOM 1504  H HZ3    . LYS A 1 93  ? 35.977  -20.808 -53.213 1.00 92.38  ?  97  LYS A HZ3    1 
ATOM 1505  N N      . LYS A 1 94  ? 36.659  -28.816 -53.175 1.00 99.93  ?  98  LYS A N      1 
ATOM 1506  C CA     . LYS A 1 94  ? 36.782  -29.933 -52.244 1.00 107.51 ?  98  LYS A CA     1 
ATOM 1507  C C      . LYS A 1 94  ? 37.844  -30.922 -52.707 1.00 99.30  ?  98  LYS A C      1 
ATOM 1508  O O      . LYS A 1 94  ? 38.554  -31.511 -51.882 1.00 95.00  ?  98  LYS A O      1 
ATOM 1509  C CB     . LYS A 1 94  ? 35.434  -30.635 -52.066 1.00 88.99  ?  98  LYS A CB     1 
ATOM 1510  C CG     . LYS A 1 94  ? 34.545  -30.014 -50.995 1.00 86.89  ?  98  LYS A CG     1 
ATOM 1511  C CD     . LYS A 1 94  ? 33.760  -31.066 -50.218 1.00 68.01  ?  98  LYS A CD     1 
ATOM 1512  C CE     . LYS A 1 94  ? 32.701  -31.739 -51.075 1.00 75.29  ?  98  LYS A CE     1 
ATOM 1513  N NZ     . LYS A 1 94  ? 31.822  -32.631 -50.266 1.00 79.62  1  98  LYS A NZ     1 
ATOM 1514  H H      . LYS A 1 94  ? 35.882  -28.726 -53.533 1.00 119.91 ?  98  LYS A H      1 
ATOM 1515  H HA     . LYS A 1 94  ? 37.053  -29.590 -51.378 1.00 129.01 ?  98  LYS A HA     1 
ATOM 1516  H HB2    . LYS A 1 94  ? 34.951  -30.601 -52.907 1.00 106.79 ?  98  LYS A HB2    1 
ATOM 1517  H HB3    . LYS A 1 94  ? 35.594  -31.559 -51.818 1.00 106.79 ?  98  LYS A HB3    1 
ATOM 1518  H HG2    . LYS A 1 94  ? 35.099  -29.525 -50.367 1.00 104.27 ?  98  LYS A HG2    1 
ATOM 1519  H HG3    . LYS A 1 94  ? 33.910  -29.414 -51.417 1.00 104.27 ?  98  LYS A HG3    1 
ATOM 1520  H HD2    . LYS A 1 94  ? 34.372  -31.749 -49.902 1.00 81.61  ?  98  LYS A HD2    1 
ATOM 1521  H HD3    . LYS A 1 94  ? 33.317  -30.641 -49.467 1.00 81.61  ?  98  LYS A HD3    1 
ATOM 1522  H HE2    . LYS A 1 94  ? 32.145  -31.060 -51.488 1.00 90.35  ?  98  LYS A HE2    1 
ATOM 1523  H HE3    . LYS A 1 94  ? 33.135  -32.277 -51.755 1.00 90.35  ?  98  LYS A HE3    1 
ATOM 1524  H HZ1    . LYS A 1 94  ? 31.211  -33.012 -50.790 1.00 95.54  ?  98  LYS A HZ1    1 
ATOM 1525  H HZ2    . LYS A 1 94  ? 32.308  -33.267 -49.878 1.00 95.54  ?  98  LYS A HZ2    1 
ATOM 1526  H HZ3    . LYS A 1 94  ? 31.407  -32.159 -49.635 1.00 95.54  ?  98  LYS A HZ3    1 
ATOM 1527  N N      . GLN A 1 95  ? 37.975  -31.121 -54.019 1.00 105.03 ?  99  GLN A N      1 
ATOM 1528  C CA     . GLN A 1 95  ? 39.009  -32.011 -54.533 1.00 91.88  ?  99  GLN A CA     1 
ATOM 1529  C C      . GLN A 1 95  ? 39.439  -31.626 -55.945 1.00 93.61  ?  99  GLN A C      1 
ATOM 1530  O O      . GLN A 1 95  ? 40.637  -31.541 -56.232 1.00 85.35  ?  99  GLN A O      1 
ATOM 1531  C CB     . GLN A 1 95  ? 38.530  -33.469 -54.498 1.00 97.80  ?  99  GLN A CB     1 
ATOM 1532  C CG     . GLN A 1 95  ? 37.442  -33.848 -55.503 1.00 110.12 ?  99  GLN A CG     1 
ATOM 1533  C CD     . GLN A 1 95  ? 36.143  -33.103 -55.285 1.00 88.90  ?  99  GLN A CD     1 
ATOM 1534  O OE1    . GLN A 1 95  ? 35.991  -32.370 -54.311 1.00 91.38  ?  99  GLN A OE1    1 
ATOM 1535  N NE2    . GLN A 1 95  ? 35.191  -33.297 -56.191 1.00 66.68  ?  99  GLN A NE2    1 
ATOM 1536  H H      . GLN A 1 95  ? 37.483  -30.756 -54.624 1.00 126.04 ?  99  GLN A H      1 
ATOM 1537  H HA     . GLN A 1 95  ? 39.789  -31.944 -53.960 1.00 110.26 ?  99  GLN A HA     1 
ATOM 1538  H HB2    . GLN A 1 95  ? 39.292  -34.044 -54.668 1.00 117.36 ?  99  GLN A HB2    1 
ATOM 1539  H HB3    . GLN A 1 95  ? 38.180  -33.653 -53.612 1.00 117.36 ?  99  GLN A HB3    1 
ATOM 1540  H HG2    . GLN A 1 95  ? 37.757  -33.644 -56.398 1.00 132.14 ?  99  GLN A HG2    1 
ATOM 1541  H HG3    . GLN A 1 95  ? 37.259  -34.797 -55.425 1.00 132.14 ?  99  GLN A HG3    1 
ATOM 1542  H HE21   . GLN A 1 95  ? 35.332  -33.823 -56.856 1.00 80.02  ?  99  GLN A HE21   1 
ATOM 1543  H HE22   . GLN A 1 95  ? 34.434  -32.897 -56.112 1.00 80.02  ?  99  GLN A HE22   1 
ATOM 1544  N N      . ASN A 1 96  ? 38.474  -31.383 -56.828 1.00 99.80  ?  100 ASN A N      1 
ATOM 1545  C CA     . ASN A 1 96  ? 38.764  -31.152 -58.237 1.00 100.95 ?  100 ASN A CA     1 
ATOM 1546  C C      . ASN A 1 96  ? 39.233  -29.719 -58.460 1.00 101.12 ?  100 ASN A C      1 
ATOM 1547  O O      . ASN A 1 96  ? 38.629  -28.770 -57.954 1.00 109.32 ?  100 ASN A O      1 
ATOM 1548  C CB     . ASN A 1 96  ? 37.522  -31.451 -59.081 1.00 97.09  ?  100 ASN A CB     1 
ATOM 1549  C CG     . ASN A 1 96  ? 37.496  -30.686 -60.393 1.00 96.49  ?  100 ASN A CG     1 
ATOM 1550  O OD1    . ASN A 1 96  ? 38.533  -30.445 -61.013 1.00 103.53 ?  100 ASN A OD1    1 
ATOM 1551  N ND2    . ASN A 1 96  ? 36.298  -30.303 -60.825 1.00 88.82  ?  100 ASN A ND2    1 
ATOM 1552  H H      . ASN A 1 96  ? 37.637  -31.347 -56.633 1.00 119.77 ?  100 ASN A H      1 
ATOM 1553  H HA     . ASN A 1 96  ? 39.473  -31.750 -58.519 1.00 121.14 ?  100 ASN A HA     1 
ATOM 1554  H HB2    . ASN A 1 96  ? 37.503  -32.399 -59.287 1.00 116.51 ?  100 ASN A HB2    1 
ATOM 1555  H HB3    . ASN A 1 96  ? 36.732  -31.206 -58.576 1.00 116.51 ?  100 ASN A HB3    1 
ATOM 1556  H HD21   . ASN A 1 96  ? 36.226  -29.866 -61.562 1.00 106.58 ?  100 ASN A HD21   1 
ATOM 1557  H HD22   . ASN A 1 96  ? 35.596  -30.492 -60.367 1.00 106.58 ?  100 ASN A HD22   1 
ATOM 1558  N N      . TYR A 1 97  ? 40.312  -29.566 -59.220 1.00 104.94 ?  101 TYR A N      1 
ATOM 1559  C CA     . TYR A 1 97  ? 40.839  -28.244 -59.532 1.00 100.37 ?  101 TYR A CA     1 
ATOM 1560  C C      . TYR A 1 97  ? 41.733  -28.316 -60.767 1.00 100.04 ?  101 TYR A C      1 
ATOM 1561  O O      . TYR A 1 97  ? 42.167  -29.405 -61.131 1.00 121.99 ?  101 TYR A O      1 
ATOM 1562  C CB     . TYR A 1 97  ? 41.624  -27.686 -58.338 1.00 109.84 ?  101 TYR A CB     1 
ATOM 1563  C CG     . TYR A 1 97  ? 43.065  -28.161 -58.238 1.00 112.15 ?  101 TYR A CG     1 
ATOM 1564  C CD1    . TYR A 1 97  ? 44.057  -27.313 -57.765 1.00 107.87 ?  101 TYR A CD1    1 
ATOM 1565  C CD2    . TYR A 1 97  ? 43.430  -29.456 -58.595 1.00 109.28 ?  101 TYR A CD2    1 
ATOM 1566  C CE1    . TYR A 1 97  ? 45.369  -27.729 -57.670 1.00 98.03  ?  101 TYR A CE1    1 
ATOM 1567  C CE2    . TYR A 1 97  ? 44.742  -29.879 -58.507 1.00 102.69 ?  101 TYR A CE2    1 
ATOM 1568  C CZ     . TYR A 1 97  ? 45.706  -29.012 -58.039 1.00 99.59  ?  101 TYR A CZ     1 
ATOM 1569  O OH     . TYR A 1 97  ? 47.014  -29.427 -57.941 1.00 98.07  ?  101 TYR A OH     1 
ATOM 1570  H H      . TYR A 1 97  ? 40.758  -30.214 -59.568 1.00 125.93 ?  101 TYR A H      1 
ATOM 1571  H HA     . TYR A 1 97  ? 40.103  -27.641 -59.722 1.00 120.45 ?  101 TYR A HA     1 
ATOM 1572  H HB2    . TYR A 1 97  ? 41.639  -26.718 -58.404 1.00 131.80 ?  101 TYR A HB2    1 
ATOM 1573  H HB3    . TYR A 1 97  ? 41.172  -27.949 -57.521 1.00 131.80 ?  101 TYR A HB3    1 
ATOM 1574  H HD1    . TYR A 1 97  ? 43.836  -26.444 -57.518 1.00 129.44 ?  101 TYR A HD1    1 
ATOM 1575  H HD2    . TYR A 1 97  ? 42.782  -30.041 -58.915 1.00 131.14 ?  101 TYR A HD2    1 
ATOM 1576  H HE1    . TYR A 1 97  ? 46.022  -27.147 -57.355 1.00 117.64 ?  101 TYR A HE1    1 
ATOM 1577  H HE2    . TYR A 1 97  ? 44.973  -30.745 -58.753 1.00 123.23 ?  101 TYR A HE2    1 
ATOM 1578  H HH     . TYR A 1 97  ? 47.082  -30.225 -58.196 1.00 117.69 ?  101 TYR A HH     1 
ATOM 1579  N N      . LYS A 1 98  ? 42.014  -27.197 -61.434 1.00 94.10  ?  102 LYS A N      1 
ATOM 1580  C CA     . LYS A 1 98  ? 41.357  -25.909 -61.240 1.00 113.28 ?  102 LYS A CA     1 
ATOM 1581  C C      . LYS A 1 98  ? 40.540  -25.640 -62.489 1.00 111.89 ?  102 LYS A C      1 
ATOM 1582  O O      . LYS A 1 98  ? 41.100  -25.555 -63.583 1.00 117.24 ?  102 LYS A O      1 
ATOM 1583  C CB     . LYS A 1 98  ? 42.374  -24.788 -61.022 1.00 110.50 ?  102 LYS A CB     1 
ATOM 1584  C CG     . LYS A 1 98  ? 43.375  -25.051 -59.910 1.00 106.75 ?  102 LYS A CG     1 
ATOM 1585  C CD     . LYS A 1 98  ? 44.493  -24.018 -59.898 1.00 94.87  ?  102 LYS A CD     1 
ATOM 1586  C CE     . LYS A 1 98  ? 45.442  -24.193 -61.076 1.00 92.18  ?  102 LYS A CE     1 
ATOM 1587  N NZ     . LYS A 1 98  ? 46.061  -25.547 -61.107 1.00 83.76  1  102 LYS A NZ     1 
ATOM 1588  H H      . LYS A 1 98  ? 42.621  -27.162 -62.042 1.00 112.92 ?  102 LYS A H      1 
ATOM 1589  H HA     . LYS A 1 98  ? 40.763  -25.951 -60.475 1.00 135.94 ?  102 LYS A HA     1 
ATOM 1590  H HB2    . LYS A 1 98  ? 42.874  -24.660 -61.843 1.00 132.60 ?  102 LYS A HB2    1 
ATOM 1591  H HB3    . LYS A 1 98  ? 41.895  -23.974 -60.801 1.00 132.60 ?  102 LYS A HB3    1 
ATOM 1592  H HG2    . LYS A 1 98  ? 42.919  -25.013 -59.055 1.00 128.10 ?  102 LYS A HG2    1 
ATOM 1593  H HG3    . LYS A 1 98  ? 43.773  -25.926 -60.038 1.00 128.10 ?  102 LYS A HG3    1 
ATOM 1594  H HD2    . LYS A 1 98  ? 44.107  -23.130 -59.949 1.00 113.84 ?  102 LYS A HD2    1 
ATOM 1595  H HD3    . LYS A 1 98  ? 45.006  -24.113 -59.080 1.00 113.84 ?  102 LYS A HD3    1 
ATOM 1596  H HE2    . LYS A 1 98  ? 44.949  -24.068 -61.902 1.00 110.62 ?  102 LYS A HE2    1 
ATOM 1597  H HE3    . LYS A 1 98  ? 46.154  -23.537 -61.011 1.00 110.62 ?  102 LYS A HE3    1 
ATOM 1598  H HZ1    . LYS A 1 98  ? 46.608  -25.615 -61.806 1.00 100.51 ?  102 LYS A HZ1    1 
ATOM 1599  H HZ2    . LYS A 1 98  ? 46.527  -25.686 -60.362 1.00 100.51 ?  102 LYS A HZ2    1 
ATOM 1600  H HZ3    . LYS A 1 98  ? 45.429  -26.170 -61.173 1.00 100.51 ?  102 LYS A HZ3    1 
ATOM 1601  N N      . LEU A 1 99  ? 39.222  -25.521 -62.337 1.00 99.99  ?  103 LEU A N      1 
ATOM 1602  C CA     . LEU A 1 99  ? 38.352  -25.337 -63.491 1.00 92.44  ?  103 LEU A CA     1 
ATOM 1603  C C      . LEU A 1 99  ? 38.918  -24.233 -64.373 1.00 81.04  ?  103 LEU A C      1 
ATOM 1604  O O      . LEU A 1 99  ? 38.889  -23.055 -64.007 1.00 92.21  ?  103 LEU A O      1 
ATOM 1605  C CB     . LEU A 1 99  ? 36.923  -25.013 -63.058 1.00 88.96  ?  103 LEU A CB     1 
ATOM 1606  C CG     . LEU A 1 99  ? 36.064  -26.161 -62.519 1.00 107.82 ?  103 LEU A CG     1 
ATOM 1607  C CD1    . LEU A 1 99  ? 36.643  -26.772 -61.252 1.00 110.50 ?  103 LEU A CD1    1 
ATOM 1608  C CD2    . LEU A 1 99  ? 34.648  -25.672 -62.267 1.00 87.85  ?  103 LEU A CD2    1 
ATOM 1609  H H      . LEU A 1 99  ? 38.812  -25.542 -61.582 1.00 119.99 ?  103 LEU A H      1 
ATOM 1610  H HA     . LEU A 1 99  ? 38.331  -26.158 -64.009 1.00 110.92 ?  103 LEU A HA     1 
ATOM 1611  H HB2    . LEU A 1 99  ? 36.968  -24.341 -62.360 1.00 106.75 ?  103 LEU A HB2    1 
ATOM 1612  H HB3    . LEU A 1 99  ? 36.455  -24.644 -63.823 1.00 106.75 ?  103 LEU A HB3    1 
ATOM 1613  H HG     . LEU A 1 99  ? 36.021  -26.860 -63.191 1.00 129.38 ?  103 LEU A HG     1 
ATOM 1614  H HD11   . LEU A 1 99  ? 36.063  -27.490 -60.955 1.00 132.60 ?  103 LEU A HD11   1 
ATOM 1615  H HD12   . LEU A 1 99  ? 37.528  -27.118 -61.445 1.00 132.60 ?  103 LEU A HD12   1 
ATOM 1616  H HD13   . LEU A 1 99  ? 36.697  -26.086 -60.568 1.00 132.60 ?  103 LEU A HD13   1 
ATOM 1617  H HD21   . LEU A 1 99  ? 34.116  -26.408 -61.926 1.00 105.42 ?  103 LEU A HD21   1 
ATOM 1618  H HD22   . LEU A 1 99  ? 34.675  -24.953 -61.616 1.00 105.42 ?  103 LEU A HD22   1 
ATOM 1619  H HD23   . LEU A 1 99  ? 34.273  -25.349 -63.101 1.00 105.42 ?  103 LEU A HD23   1 
ATOM 1620  N N      . THR A 1 100 ? 39.438  -24.614 -65.539 1.00 85.76  ?  104 THR A N      1 
ATOM 1621  C CA     . THR A 1 100 ? 40.299  -23.749 -66.336 1.00 94.69  ?  104 THR A CA     1 
ATOM 1622  C C      . THR A 1 100 ? 39.572  -22.576 -66.976 1.00 105.38 ?  104 THR A C      1 
ATOM 1623  O O      . THR A 1 100 ? 40.199  -21.850 -67.755 1.00 107.05 ?  104 THR A O      1 
ATOM 1624  C CB     . THR A 1 100 ? 40.974  -24.568 -67.435 1.00 94.72  ?  104 THR A CB     1 
ATOM 1625  O OG1    . THR A 1 100 ? 39.977  -25.062 -68.338 1.00 103.57 ?  104 THR A OG1    1 
ATOM 1626  C CG2    . THR A 1 100 ? 41.738  -25.736 -66.839 1.00 83.22  ?  104 THR A CG2    1 
ATOM 1627  H H      . THR A 1 100 ? 39.302  -25.385 -65.894 1.00 102.92 ?  104 THR A H      1 
ATOM 1628  H HA     . THR A 1 100 ? 40.995  -23.390 -65.764 1.00 113.63 ?  104 THR A HA     1 
ATOM 1629  H HB     . THR A 1 100 ? 41.599  -24.006 -67.919 1.00 113.67 ?  104 THR A HB     1 
ATOM 1630  H HG1    . THR A 1 100 ? 40.339  -25.514 -68.946 1.00 124.28 ?  104 THR A HG1    1 
ATOM 1631  H HG21   . THR A 1 100 ? 42.162  -26.249 -67.544 1.00 99.86  ?  104 THR A HG21   1 
ATOM 1632  H HG22   . THR A 1 100 ? 42.420  -25.410 -66.231 1.00 99.86  ?  104 THR A HG22   1 
ATOM 1633  H HG23   . THR A 1 100 ? 41.131  -26.314 -66.350 1.00 99.86  ?  104 THR A HG23   1 
ATOM 1634  N N      . ASN A 1 101 ? 38.288  -22.364 -66.687 1.00 107.00 ?  105 ASN A N      1 
ATOM 1635  C CA     . ASN A 1 101 ? 37.529  -21.283 -67.302 1.00 105.91 ?  105 ASN A CA     1 
ATOM 1636  C C      . ASN A 1 101 ? 37.327  -20.096 -66.365 1.00 93.32  ?  105 ASN A C      1 
ATOM 1637  O O      . ASN A 1 101 ? 36.393  -19.311 -66.561 1.00 93.70  ?  105 ASN A O      1 
ATOM 1638  C CB     . ASN A 1 101 ? 36.179  -21.803 -67.797 1.00 99.29  ?  105 ASN A CB     1 
ATOM 1639  C CG     . ASN A 1 101 ? 36.319  -22.790 -68.938 1.00 111.07 ?  105 ASN A CG     1 
ATOM 1640  O OD1    . ASN A 1 101 ? 36.462  -22.399 -70.097 1.00 115.13 ?  105 ASN A OD1    1 
ATOM 1641  N ND2    . ASN A 1 101 ? 36.278  -24.077 -68.617 1.00 95.97  ?  105 ASN A ND2    1 
ATOM 1642  H H      . ASN A 1 101 ? 37.832  -22.838 -66.133 1.00 128.40 ?  105 ASN A H      1 
ATOM 1643  H HA     . ASN A 1 101 ? 38.020  -20.964 -68.075 1.00 127.10 ?  105 ASN A HA     1 
ATOM 1644  H HB2    . ASN A 1 101 ? 35.725  -22.251 -67.066 1.00 119.15 ?  105 ASN A HB2    1 
ATOM 1645  H HB3    . ASN A 1 101 ? 35.647  -21.055 -68.110 1.00 119.15 ?  105 ASN A HB3    1 
ATOM 1646  H HD21   . ASN A 1 101 ? 36.353  -24.676 -69.229 1.00 115.17 ?  105 ASN A HD21   1 
ATOM 1647  H HD22   . ASN A 1 101 ? 36.176  -24.312 -67.796 1.00 115.17 ?  105 ASN A HD22   1 
ATOM 1648  N N      . ASP A 1 102 ? 38.176  -19.951 -65.348 1.00 77.91  ?  106 ASP A N      1 
ATOM 1649  C CA     . ASP A 1 102 ? 38.227  -18.733 -64.539 1.00 74.75  ?  106 ASP A CA     1 
ATOM 1650  C C      . ASP A 1 102 ? 36.895  -18.441 -63.850 1.00 69.28  ?  106 ASP A C      1 
ATOM 1651  O O      . ASP A 1 102 ? 36.559  -17.283 -63.596 1.00 76.30  ?  106 ASP A O      1 
ATOM 1652  C CB     . ASP A 1 102 ? 38.653  -17.538 -65.400 1.00 79.73  ?  106 ASP A CB     1 
ATOM 1653  C CG     . ASP A 1 102 ? 38.896  -16.283 -64.586 1.00 88.32  ?  106 ASP A CG     1 
ATOM 1654  O OD1    . ASP A 1 102 ? 39.206  -16.406 -63.383 1.00 93.39  ?  106 ASP A OD1    1 
ATOM 1655  O OD2    . ASP A 1 102 ? 38.774  -15.175 -65.149 1.00 86.17  -1 106 ASP A OD2    1 
ATOM 1656  H H      . ASP A 1 102 ? 38.741  -20.551 -65.104 1.00 93.49  ?  106 ASP A H      1 
ATOM 1657  H HA     . ASP A 1 102 ? 38.896  -18.850 -63.847 1.00 89.70  ?  106 ASP A HA     1 
ATOM 1658  H HB2    . ASP A 1 102 ? 39.477  -17.760 -65.862 1.00 95.67  ?  106 ASP A HB2    1 
ATOM 1659  H HB3    . ASP A 1 102 ? 37.953  -17.347 -66.044 1.00 95.67  ?  106 ASP A HB3    1 
ATOM 1660  N N      . GLU A 1 103 ? 36.122  -19.479 -63.520 1.00 67.85  ?  107 GLU A N      1 
ATOM 1661  C CA     . GLU A 1 103 ? 34.796  -19.242 -62.956 1.00 62.14  ?  107 GLU A CA     1 
ATOM 1662  C C      . GLU A 1 103 ? 34.855  -18.751 -61.517 1.00 59.62  ?  107 GLU A C      1 
ATOM 1663  O O      . GLU A 1 103 ? 33.894  -18.129 -61.051 1.00 71.62  ?  107 GLU A O      1 
ATOM 1664  C CB     . GLU A 1 103 ? 33.939  -20.504 -63.026 1.00 67.13  ?  107 GLU A CB     1 
ATOM 1665  C CG     . GLU A 1 103 ? 34.016  -21.246 -64.355 1.00 101.04 ?  107 GLU A CG     1 
ATOM 1666  C CD     . GLU A 1 103 ? 34.876  -22.487 -64.276 1.00 111.46 ?  107 GLU A CD     1 
ATOM 1667  O OE1    . GLU A 1 103 ? 35.548  -22.669 -63.243 1.00 111.68 ?  107 GLU A OE1    1 
ATOM 1668  O OE2    . GLU A 1 103 ? 34.879  -23.280 -65.242 1.00 105.30 -1 107 GLU A OE2    1 
ATOM 1669  H H      . GLU A 1 103 ? 36.336  -20.307 -63.610 1.00 81.43  ?  107 GLU A H      1 
ATOM 1670  H HA     . GLU A 1 103 ? 34.354  -18.557 -63.482 1.00 74.57  ?  107 GLU A HA     1 
ATOM 1671  H HB2    . GLU A 1 103 ? 34.229  -21.115 -62.330 1.00 80.56  ?  107 GLU A HB2    1 
ATOM 1672  H HB3    . GLU A 1 103 ? 33.012  -20.258 -62.879 1.00 80.56  ?  107 GLU A HB3    1 
ATOM 1673  H HG2    . GLU A 1 103 ? 33.122  -21.516 -64.619 1.00 121.25 ?  107 GLU A HG2    1 
ATOM 1674  H HG3    . GLU A 1 103 ? 34.397  -20.657 -65.024 1.00 121.25 ?  107 GLU A HG3    1 
ATOM 1675  N N      . GLU A 1 104 ? 35.945  -19.018 -60.796 1.00 63.78  ?  108 GLU A N      1 
ATOM 1676  C CA     . GLU A 1 104 ? 36.093  -18.430 -59.469 1.00 76.59  ?  108 GLU A CA     1 
ATOM 1677  C C      . GLU A 1 104 ? 36.239  -16.918 -59.564 1.00 85.72  ?  108 GLU A C      1 
ATOM 1678  O O      . GLU A 1 104 ? 35.674  -16.181 -58.748 1.00 77.89  ?  108 GLU A O      1 
ATOM 1679  C CB     . GLU A 1 104 ? 37.295  -19.040 -58.748 1.00 82.51  ?  108 GLU A CB     1 
ATOM 1680  C CG     . GLU A 1 104 ? 37.453  -18.561 -57.309 1.00 98.51  ?  108 GLU A CG     1 
ATOM 1681  C CD     . GLU A 1 104 ? 38.705  -19.096 -56.644 1.00 111.00 ?  108 GLU A CD     1 
ATOM 1682  O OE1    . GLU A 1 104 ? 38.937  -18.766 -55.461 1.00 105.26 ?  108 GLU A OE1    1 
ATOM 1683  O OE2    . GLU A 1 104 ? 39.458  -19.843 -57.303 1.00 110.27 -1 108 GLU A OE2    1 
ATOM 1684  H H      . GLU A 1 104 ? 36.595  -19.522 -61.045 1.00 76.54  ?  108 GLU A H      1 
ATOM 1685  H HA     . GLU A 1 104 ? 35.299  -18.624 -58.947 1.00 91.90  ?  108 GLU A HA     1 
ATOM 1686  H HB2    . GLU A 1 104 ? 37.193  -20.004 -58.730 1.00 99.01  ?  108 GLU A HB2    1 
ATOM 1687  H HB3    . GLU A 1 104 ? 38.103  -18.803 -59.230 1.00 99.01  ?  108 GLU A HB3    1 
ATOM 1688  H HG2    . GLU A 1 104 ? 37.500  -17.593 -57.302 1.00 118.21 ?  108 GLU A HG2    1 
ATOM 1689  H HG3    . GLU A 1 104 ? 36.689  -18.860 -56.792 1.00 118.21 ?  108 GLU A HG3    1 
ATOM 1690  N N      . GLY A 1 105 ? 36.991  -16.439 -60.556 1.00 86.16  ?  109 GLY A N      1 
ATOM 1691  C CA     . GLY A 1 105 ? 37.106  -15.005 -60.756 1.00 63.96  ?  109 GLY A CA     1 
ATOM 1692  C C      . GLY A 1 105 ? 35.829  -14.393 -61.295 1.00 57.63  ?  109 GLY A C      1 
ATOM 1693  O O      . GLY A 1 105 ? 35.453  -13.282 -60.911 1.00 75.24  ?  109 GLY A O      1 
ATOM 1694  H H      . GLY A 1 105 ? 37.435  -16.918 -61.115 1.00 103.39 ?  109 GLY A H      1 
ATOM 1695  H HA2    . GLY A 1 105 ? 37.320  -14.577 -59.913 1.00 76.76  ?  109 GLY A HA2    1 
ATOM 1696  H HA3    . GLY A 1 105 ? 37.823  -14.824 -61.384 1.00 76.76  ?  109 GLY A HA3    1 
ATOM 1697  N N      . ILE A 1 106 ? 35.142  -15.105 -62.191 1.00 52.28  ?  110 ILE A N      1 
ATOM 1698  C CA     . ILE A 1 106 ? 33.889  -14.597 -62.739 1.00 53.89  ?  110 ILE A CA     1 
ATOM 1699  C C      . ILE A 1 106 ? 32.875  -14.385 -61.624 1.00 52.32  ?  110 ILE A C      1 
ATOM 1700  O O      . ILE A 1 106 ? 32.127  -13.401 -61.623 1.00 62.03  ?  110 ILE A O      1 
ATOM 1701  C CB     . ILE A 1 106 ? 33.351  -15.553 -63.820 1.00 60.98  ?  110 ILE A CB     1 
ATOM 1702  C CG1    . ILE A 1 106 ? 34.320  -15.613 -65.003 1.00 62.12  ?  110 ILE A CG1    1 
ATOM 1703  C CG2    . ILE A 1 106 ? 31.977  -15.102 -64.302 1.00 60.34  ?  110 ILE A CG2    1 
ATOM 1704  C CD1    . ILE A 1 106 ? 34.062  -16.763 -65.948 1.00 54.90  ?  110 ILE A CD1    1 
ATOM 1705  H H      . ILE A 1 106 ? 35.379  -15.874 -62.493 1.00 62.74  ?  110 ILE A H      1 
ATOM 1706  H HA     . ILE A 1 106 ? 34.054  -13.738 -63.157 1.00 64.67  ?  110 ILE A HA     1 
ATOM 1707  H HB     . ILE A 1 106 ? 33.271  -16.441 -63.438 1.00 73.17  ?  110 ILE A HB     1 
ATOM 1708  H HG12   . ILE A 1 106 ? 34.243  -14.790 -65.511 1.00 74.54  ?  110 ILE A HG12   1 
ATOM 1709  H HG13   . ILE A 1 106 ? 35.223  -15.706 -64.663 1.00 74.54  ?  110 ILE A HG13   1 
ATOM 1710  H HG21   . ILE A 1 106 ? 31.662  -15.720 -64.981 1.00 72.41  ?  110 ILE A HG21   1 
ATOM 1711  H HG22   . ILE A 1 106 ? 31.365  -15.097 -63.549 1.00 72.41  ?  110 ILE A HG22   1 
ATOM 1712  H HG23   . ILE A 1 106 ? 32.050  -14.210 -64.675 1.00 72.41  ?  110 ILE A HG23   1 
ATOM 1713  H HD11   . ILE A 1 106 ? 34.713  -16.733 -66.667 1.00 65.88  ?  110 ILE A HD11   1 
ATOM 1714  H HD12   . ILE A 1 106 ? 34.146  -17.597 -65.460 1.00 65.88  ?  110 ILE A HD12   1 
ATOM 1715  H HD13   . ILE A 1 106 ? 33.165  -16.680 -66.309 1.00 65.88  ?  110 ILE A HD13   1 
ATOM 1716  N N      . PHE A 1 107 ? 32.831  -15.304 -60.660 1.00 49.67  ?  111 PHE A N      1 
ATOM 1717  C CA     . PHE A 1 107 ? 31.915  -15.146 -59.537 1.00 56.68  ?  111 PHE A CA     1 
ATOM 1718  C C      . PHE A 1 107 ? 32.347  -13.988 -58.648 1.00 59.07  ?  111 PHE A C      1 
ATOM 1719  O O      . PHE A 1 107 ? 31.550  -13.093 -58.344 1.00 60.02  ?  111 PHE A O      1 
ATOM 1720  C CB     . PHE A 1 107 ? 31.837  -16.445 -58.736 1.00 50.71  ?  111 PHE A CB     1 
ATOM 1721  C CG     . PHE A 1 107 ? 30.892  -16.382 -57.572 1.00 47.60  ?  111 PHE A CG     1 
ATOM 1722  C CD1    . PHE A 1 107 ? 29.527  -16.286 -57.778 1.00 43.91  ?  111 PHE A CD1    1 
ATOM 1723  C CD2    . PHE A 1 107 ? 31.366  -16.427 -56.273 1.00 48.58  ?  111 PHE A CD2    1 
ATOM 1724  C CE1    . PHE A 1 107 ? 28.655  -16.229 -56.711 1.00 40.64  ?  111 PHE A CE1    1 
ATOM 1725  C CE2    . PHE A 1 107 ? 30.497  -16.371 -55.203 1.00 45.51  ?  111 PHE A CE2    1 
ATOM 1726  C CZ     . PHE A 1 107 ? 29.140  -16.273 -55.424 1.00 41.75  ?  111 PHE A CZ     1 
ATOM 1727  H H      . PHE A 1 107 ? 33.313  -16.016 -60.634 1.00 59.61  ?  111 PHE A H      1 
ATOM 1728  H HA     . PHE A 1 107 ? 31.028  -14.949 -59.877 1.00 68.02  ?  111 PHE A HA     1 
ATOM 1729  H HB2    . PHE A 1 107 ? 31.537  -17.157 -59.323 1.00 60.86  ?  111 PHE A HB2    1 
ATOM 1730  H HB3    . PHE A 1 107 ? 32.719  -16.653 -58.391 1.00 60.86  ?  111 PHE A HB3    1 
ATOM 1731  H HD1    . PHE A 1 107 ? 29.194  -16.256 -58.646 1.00 52.69  ?  111 PHE A HD1    1 
ATOM 1732  H HD2    . PHE A 1 107 ? 32.281  -16.493 -56.119 1.00 58.30  ?  111 PHE A HD2    1 
ATOM 1733  H HE1    . PHE A 1 107 ? 27.739  -16.163 -56.862 1.00 48.77  ?  111 PHE A HE1    1 
ATOM 1734  H HE2    . PHE A 1 107 ? 30.826  -16.400 -54.334 1.00 54.61  ?  111 PHE A HE2    1 
ATOM 1735  H HZ     . PHE A 1 107 ? 28.552  -16.235 -54.704 1.00 50.10  ?  111 PHE A HZ     1 
ATOM 1736  N N      . SER A 1 108 ? 33.612  -13.985 -58.224 1.00 71.73  ?  112 SER A N      1 
ATOM 1737  C CA     . SER A 1 108 ? 34.115  -12.882 -57.415 1.00 67.52  ?  112 SER A CA     1 
ATOM 1738  C C      . SER A 1 108 ? 33.922  -11.551 -58.128 1.00 56.35  ?  112 SER A C      1 
ATOM 1739  O O      . SER A 1 108 ? 33.592  -10.541 -57.496 1.00 59.85  ?  112 SER A O      1 
ATOM 1740  C CB     . SER A 1 108 ? 35.590  -13.105 -57.085 1.00 71.36  ?  112 SER A CB     1 
ATOM 1741  O OG     . SER A 1 108 ? 36.067  -12.100 -56.210 1.00 61.85  ?  112 SER A OG     1 
ATOM 1742  H H      . SER A 1 108 ? 34.189  -14.602 -58.389 1.00 86.08  ?  112 SER A H      1 
ATOM 1743  H HA     . SER A 1 108 ? 33.622  -12.850 -56.580 1.00 81.02  ?  112 SER A HA     1 
ATOM 1744  H HB2    . SER A 1 108 ? 35.690  -13.970 -56.658 1.00 85.63  ?  112 SER A HB2    1 
ATOM 1745  H HB3    . SER A 1 108 ? 36.104  -13.078 -57.907 1.00 85.63  ?  112 SER A HB3    1 
ATOM 1746  H HG     . SER A 1 108 ? 36.878  -12.232 -56.035 1.00 74.22  ?  112 SER A HG     1 
ATOM 1747  N N      . ARG A 1 109 ? 34.119  -11.530 -59.448 1.00 54.93  ?  113 ARG A N      1 
ATOM 1748  C CA     . ARG A 1 109 ? 33.888  -10.308 -60.208 1.00 42.94  ?  113 ARG A CA     1 
ATOM 1749  C C      . ARG A 1 109 ? 32.406  -9.987  -60.325 1.00 35.67  ?  113 ARG A C      1 
ATOM 1750  O O      . ARG A 1 109 ? 32.037  -8.814  -60.428 1.00 40.59  ?  113 ARG A O      1 
ATOM 1751  C CB     . ARG A 1 109 ? 34.505  -10.423 -61.601 1.00 47.78  ?  113 ARG A CB     1 
ATOM 1752  C CG     . ARG A 1 109 ? 35.982  -10.082 -61.650 1.00 50.62  ?  113 ARG A CG     1 
ATOM 1753  C CD     . ARG A 1 109 ? 36.495  -9.981  -63.073 1.00 47.25  ?  113 ARG A CD     1 
ATOM 1754  N NE     . ARG A 1 109 ? 37.163  -11.201 -63.510 1.00 58.45  ?  113 ARG A NE     1 
ATOM 1755  C CZ     . ARG A 1 109 ? 36.564  -12.207 -64.139 1.00 62.45  ?  113 ARG A CZ     1 
ATOM 1756  N NH1    . ARG A 1 109 ? 35.268  -12.156 -64.415 1.00 61.07  1  113 ARG A NH1    1 
ATOM 1757  N NH2    . ARG A 1 109 ? 37.268  -13.271 -64.494 1.00 68.52  ?  113 ARG A NH2    1 
ATOM 1758  H H      . ARG A 1 109 ? 34.383  -12.200 -59.917 1.00 65.91  ?  113 ARG A H      1 
ATOM 1759  H HA     . ARG A 1 109 ? 34.318  -9.568  -59.751 1.00 51.53  ?  113 ARG A HA     1 
ATOM 1760  H HB2    . ARG A 1 109 ? 34.401  -11.335 -61.914 1.00 57.34  ?  113 ARG A HB2    1 
ATOM 1761  H HB3    . ARG A 1 109 ? 34.041  -9.816  -62.199 1.00 57.34  ?  113 ARG A HB3    1 
ATOM 1762  H HG2    . ARG A 1 109 ? 36.126  -9.226  -61.215 1.00 60.74  ?  113 ARG A HG2    1 
ATOM 1763  H HG3    . ARG A 1 109 ? 36.485  -10.776 -61.196 1.00 60.74  ?  113 ARG A HG3    1 
ATOM 1764  H HD2    . ARG A 1 109 ? 35.748  -9.816  -63.668 1.00 56.70  ?  113 ARG A HD2    1 
ATOM 1765  H HD3    . ARG A 1 109 ? 37.133  -9.252  -63.129 1.00 56.70  ?  113 ARG A HD3    1 
ATOM 1766  H HE     . ARG A 1 109 ? 38.005  -11.275 -63.350 1.00 70.14  ?  113 ARG A HE     1 
ATOM 1767  H HH11   . ARG A 1 109 ? 34.807  -11.467 -64.186 1.00 73.28  ?  113 ARG A HH11   1 
ATOM 1768  H HH12   . ARG A 1 109 ? 34.889  -12.812 -64.822 1.00 73.28  ?  113 ARG A HH12   1 
ATOM 1769  H HH21   . ARG A 1 109 ? 38.108  -13.309 -64.318 1.00 82.22  ?  113 ARG A HH21   1 
ATOM 1770  H HH22   . ARG A 1 109 ? 36.883  -13.925 -64.901 1.00 82.22  ?  113 ARG A HH22   1 
ATOM 1771  N N      . PHE A 1 110 ? 31.544  -11.003 -60.316 1.00 52.22  ?  114 PHE A N      1 
ATOM 1772  C CA     . PHE A 1 110 ? 30.116  -10.753 -60.468 1.00 46.87  ?  114 PHE A CA     1 
ATOM 1773  C C      . PHE A 1 110 ? 29.476  -10.348 -59.147 1.00 47.27  ?  114 PHE A C      1 
ATOM 1774  O O      . PHE A 1 110 ? 28.719  -9.374  -59.091 1.00 56.15  ?  114 PHE A O      1 
ATOM 1775  C CB     . PHE A 1 110 ? 29.419  -11.989 -61.034 1.00 36.49  ?  114 PHE A CB     1 
ATOM 1776  C CG     . PHE A 1 110 ? 27.924  -11.897 -61.010 1.00 39.07  ?  114 PHE A CG     1 
ATOM 1777  C CD1    . PHE A 1 110 ? 27.202  -12.474 -59.983 1.00 39.50  ?  114 PHE A CD1    1 
ATOM 1778  C CD2    . PHE A 1 110 ? 27.240  -11.229 -62.009 1.00 50.72  ?  114 PHE A CD2    1 
ATOM 1779  C CE1    . PHE A 1 110 ? 25.828  -12.390 -59.956 1.00 28.57  ?  114 PHE A CE1    1 
ATOM 1780  C CE2    . PHE A 1 110 ? 25.864  -11.144 -61.983 1.00 40.97  ?  114 PHE A CE2    1 
ATOM 1781  C CZ     . PHE A 1 110 ? 25.160  -11.725 -60.955 1.00 25.26  ?  114 PHE A CZ     1 
ATOM 1782  H H      . PHE A 1 110 ? 31.757  -11.831 -60.225 1.00 62.66  ?  114 PHE A H      1 
ATOM 1783  H HA     . PHE A 1 110 ? 29.989  -10.025 -61.097 1.00 56.25  ?  114 PHE A HA     1 
ATOM 1784  H HB2    . PHE A 1 110 ? 29.695  -12.109 -61.956 1.00 43.79  ?  114 PHE A HB2    1 
ATOM 1785  H HB3    . PHE A 1 110 ? 29.678  -12.762 -60.509 1.00 43.79  ?  114 PHE A HB3    1 
ATOM 1786  H HD1    . PHE A 1 110 ? 27.648  -12.926 -59.304 1.00 47.40  ?  114 PHE A HD1    1 
ATOM 1787  H HD2    . PHE A 1 110 ? 27.713  -10.834 -62.706 1.00 60.87  ?  114 PHE A HD2    1 
ATOM 1788  H HE1    . PHE A 1 110 ? 25.352  -12.784 -59.260 1.00 34.29  ?  114 PHE A HE1    1 
ATOM 1789  H HE2    . PHE A 1 110 ? 25.412  -10.694 -62.660 1.00 49.17  ?  114 PHE A HE2    1 
ATOM 1790  H HZ     . PHE A 1 110 ? 24.232  -11.669 -60.936 1.00 30.32  ?  114 PHE A HZ     1 
ATOM 1791  N N      . VAL A 1 111 ? 29.760  -11.085 -58.073 1.00 55.23  ?  115 VAL A N      1 
ATOM 1792  C CA     . VAL A 1 111 ? 29.110  -10.798 -56.800 1.00 45.05  ?  115 VAL A CA     1 
ATOM 1793  C C      . VAL A 1 111 ? 29.557  -9.443  -56.270 1.00 48.75  ?  115 VAL A C      1 
ATOM 1794  O O      . VAL A 1 111 ? 28.746  -8.662  -55.760 1.00 56.08  ?  115 VAL A O      1 
ATOM 1795  C CB     . VAL A 1 111 ? 29.384  -11.929 -55.791 1.00 52.18  ?  115 VAL A CB     1 
ATOM 1796  C CG1    . VAL A 1 111 ? 30.841  -11.934 -55.346 1.00 46.31  ?  115 VAL A CG1    1 
ATOM 1797  C CG2    . VAL A 1 111 ? 28.449  -11.812 -54.603 1.00 59.56  ?  115 VAL A CG2    1 
ATOM 1798  H H      . VAL A 1 111 ? 30.314  -11.743 -58.057 1.00 66.27  ?  115 VAL A H      1 
ATOM 1799  H HA     . VAL A 1 111 ? 28.151  -10.757 -56.943 1.00 54.06  ?  115 VAL A HA     1 
ATOM 1800  H HB     . VAL A 1 111 ? 29.206  -12.779 -56.223 1.00 62.62  ?  115 VAL A HB     1 
ATOM 1801  H HG11   . VAL A 1 111 ? 30.974  -12.657 -54.713 1.00 55.57  ?  115 VAL A HG11   1 
ATOM 1802  H HG12   . VAL A 1 111 ? 31.408  -12.064 -56.122 1.00 55.57  ?  115 VAL A HG12   1 
ATOM 1803  H HG13   . VAL A 1 111 ? 31.045  -11.084 -54.925 1.00 55.57  ?  115 VAL A HG13   1 
ATOM 1804  H HG21   . VAL A 1 111 ? 28.638  -12.532 -53.981 1.00 71.47  ?  115 VAL A HG21   1 
ATOM 1805  H HG22   . VAL A 1 111 ? 28.593  -10.956 -54.171 1.00 71.47  ?  115 VAL A HG22   1 
ATOM 1806  H HG23   . VAL A 1 111 ? 27.533  -11.876 -54.915 1.00 71.47  ?  115 VAL A HG23   1 
ATOM 1807  N N      . ASP A 1 112 ? 30.850  -9.138  -56.388 1.00 57.23  ?  116 ASP A N      1 
ATOM 1808  C CA     . ASP A 1 112 ? 31.343  -7.833  -55.964 1.00 50.55  ?  116 ASP A CA     1 
ATOM 1809  C C      . ASP A 1 112 ? 30.655  -6.715  -56.734 1.00 31.31  ?  116 ASP A C      1 
ATOM 1810  O O      . ASP A 1 112 ? 30.245  -5.707  -56.149 1.00 21.83  ?  116 ASP A O      1 
ATOM 1811  C CB     . ASP A 1 112 ? 32.858  -7.770  -56.156 1.00 59.20  ?  116 ASP A CB     1 
ATOM 1812  C CG     . ASP A 1 112 ? 33.463  -6.484  -55.632 1.00 65.38  ?  116 ASP A CG     1 
ATOM 1813  O OD1    . ASP A 1 112 ? 32.916  -5.400  -55.918 1.00 58.13  ?  116 ASP A OD1    1 
ATOM 1814  O OD2    . ASP A 1 112 ? 34.492  -6.559  -54.932 1.00 76.98  -1 116 ASP A OD2    1 
ATOM 1815  H H      . ASP A 1 112 ? 31.452  -9.663  -56.705 1.00 68.67  ?  116 ASP A H      1 
ATOM 1816  H HA     . ASP A 1 112 ? 31.153  -7.712  -55.020 1.00 60.67  ?  116 ASP A HA     1 
ATOM 1817  H HB2    . ASP A 1 112 ? 33.268  -8.509  -55.681 1.00 71.04  ?  116 ASP A HB2    1 
ATOM 1818  H HB3    . ASP A 1 112 ? 33.059  -7.832  -57.103 1.00 71.04  ?  116 ASP A HB3    1 
ATOM 1819  N N      . GLN A 1 113 ? 30.517  -6.878  -58.049 1.00 40.77  ?  117 GLN A N      1 
ATOM 1820  C CA     . GLN A 1 113 ? 29.879  -5.852  -58.864 1.00 37.19  ?  117 GLN A CA     1 
ATOM 1821  C C      . GLN A 1 113 ? 28.389  -5.742  -58.571 1.00 37.39  ?  117 GLN A C      1 
ATOM 1822  O O      . GLN A 1 113 ? 27.828  -4.645  -58.640 1.00 43.43  ?  117 GLN A O      1 
ATOM 1823  C CB     . GLN A 1 113 ? 30.117  -6.153  -60.344 1.00 35.96  ?  117 GLN A CB     1 
ATOM 1824  C CG     . GLN A 1 113 ? 29.307  -5.300  -61.304 1.00 50.42  ?  117 GLN A CG     1 
ATOM 1825  C CD     . GLN A 1 113 ? 27.925  -5.862  -61.572 1.00 44.62  ?  117 GLN A CD     1 
ATOM 1826  O OE1    . GLN A 1 113 ? 27.620  -6.993  -61.201 1.00 39.19  ?  117 GLN A OE1    1 
ATOM 1827  N NE2    . GLN A 1 113 ? 27.079  -5.069  -62.215 1.00 52.64  ?  117 GLN A NE2    1 
ATOM 1828  H H      . GLN A 1 113 ? 30.784  -7.567  -58.489 1.00 48.92  ?  117 GLN A H      1 
ATOM 1829  H HA     . GLN A 1 113 ? 30.286  -4.995  -58.665 1.00 44.63  ?  117 GLN A HA     1 
ATOM 1830  H HB2    . GLN A 1 113 ? 31.055  -6.008  -60.543 1.00 43.15  ?  117 GLN A HB2    1 
ATOM 1831  H HB3    . GLN A 1 113 ? 29.888  -7.081  -60.512 1.00 43.15  ?  117 GLN A HB3    1 
ATOM 1832  H HG2    . GLN A 1 113 ? 29.202  -4.413  -60.926 1.00 60.50  ?  117 GLN A HG2    1 
ATOM 1833  H HG3    . GLN A 1 113 ? 29.778  -5.245  -62.151 1.00 60.50  ?  117 GLN A HG3    1 
ATOM 1834  H HE21   . GLN A 1 113 ? 27.327  -4.281  -62.457 1.00 63.17  ?  117 GLN A HE21   1 
ATOM 1835  H HE22   . GLN A 1 113 ? 26.283  -5.342  -62.391 1.00 63.17  ?  117 GLN A HE22   1 
ATOM 1836  N N      . PHE A 1 114 ? 27.729  -6.855  -58.249 1.00 44.13  ?  118 PHE A N      1 
ATOM 1837  C CA     . PHE A 1 114 ? 26.295  -6.807  -57.989 1.00 40.12  ?  118 PHE A CA     1 
ATOM 1838  C C      . PHE A 1 114 ? 25.997  -6.050  -56.702 1.00 45.90  ?  118 PHE A C      1 
ATOM 1839  O O      . PHE A 1 114 ? 25.135  -5.164  -56.676 1.00 59.22  ?  118 PHE A O      1 
ATOM 1840  C CB     . PHE A 1 114 ? 25.722  -8.221  -57.920 1.00 29.81  ?  118 PHE A CB     1 
ATOM 1841  C CG     . PHE A 1 114 ? 24.278  -8.264  -57.516 1.00 30.81  ?  118 PHE A CG     1 
ATOM 1842  C CD1    . PHE A 1 114 ? 23.301  -7.744  -58.344 1.00 31.89  ?  118 PHE A CD1    1 
ATOM 1843  C CD2    . PHE A 1 114 ? 23.898  -8.825  -56.312 1.00 32.81  ?  118 PHE A CD2    1 
ATOM 1844  C CE1    . PHE A 1 114 ? 21.973  -7.781  -57.977 1.00 15.35  ?  118 PHE A CE1    1 
ATOM 1845  C CE2    . PHE A 1 114 ? 22.569  -8.864  -55.944 1.00 35.38  ?  118 PHE A CE2    1 
ATOM 1846  C CZ     . PHE A 1 114 ? 21.608  -8.341  -56.779 1.00 16.76  ?  118 PHE A CZ     1 
ATOM 1847  H H      . PHE A 1 114 ? 28.083  -7.636  -58.176 1.00 52.95  ?  118 PHE A H      1 
ATOM 1848  H HA     . PHE A 1 114 ? 25.857  -6.341  -58.719 1.00 48.15  ?  118 PHE A HA     1 
ATOM 1849  H HB2    . PHE A 1 114 ? 25.799  -8.633  -58.794 1.00 35.77  ?  118 PHE A HB2    1 
ATOM 1850  H HB3    . PHE A 1 114 ? 26.228  -8.732  -57.269 1.00 35.77  ?  118 PHE A HB3    1 
ATOM 1851  H HD1    . PHE A 1 114 ? 23.542  -7.363  -59.158 1.00 38.27  ?  118 PHE A HD1    1 
ATOM 1852  H HD2    . PHE A 1 114 ? 24.544  -9.179  -55.744 1.00 39.37  ?  118 PHE A HD2    1 
ATOM 1853  H HE1    . PHE A 1 114 ? 21.324  -7.428  -58.542 1.00 18.42  ?  118 PHE A HE1    1 
ATOM 1854  H HE2    . PHE A 1 114 ? 22.323  -9.243  -55.131 1.00 42.45  ?  118 PHE A HE2    1 
ATOM 1855  H HZ     . PHE A 1 114 ? 20.712  -8.367  -56.531 1.00 20.11  ?  118 PHE A HZ     1 
ATOM 1856  N N      . ILE A 1 115 ? 26.701  -6.387  -55.622 1.00 51.14  ?  119 ILE A N      1 
ATOM 1857  C CA     . ILE A 1 115 ? 26.437  -5.756  -54.332 1.00 55.93  ?  119 ILE A CA     1 
ATOM 1858  C C      . ILE A 1 115 ? 26.574  -4.243  -54.446 1.00 50.78  ?  119 ILE A C      1 
ATOM 1859  O O      . ILE A 1 115 ? 25.706  -3.486  -53.995 1.00 43.31  ?  119 ILE A O      1 
ATOM 1860  C CB     . ILE A 1 115 ? 27.375  -6.330  -53.254 1.00 39.13  ?  119 ILE A CB     1 
ATOM 1861  C CG1    . ILE A 1 115 ? 27.110  -7.827  -53.074 1.00 41.57  ?  119 ILE A CG1    1 
ATOM 1862  C CG2    . ILE A 1 115 ? 27.175  -5.605  -51.929 1.00 50.90  ?  119 ILE A CG2    1 
ATOM 1863  C CD1    . ILE A 1 115 ? 28.120  -8.534  -52.206 1.00 34.97  ?  119 ILE A CD1    1 
ATOM 1864  H H      . ILE A 1 115 ? 27.331  -6.973  -55.610 1.00 61.37  ?  119 ILE A H      1 
ATOM 1865  H HA     . ILE A 1 115 ? 25.525  -5.953  -54.067 1.00 67.12  ?  119 ILE A HA     1 
ATOM 1866  H HB     . ILE A 1 115 ? 28.293  -6.208  -53.541 1.00 46.96  ?  119 ILE A HB     1 
ATOM 1867  H HG12   . ILE A 1 115 ? 26.238  -7.942  -52.666 1.00 49.88  ?  119 ILE A HG12   1 
ATOM 1868  H HG13   . ILE A 1 115 ? 27.122  -8.251  -53.946 1.00 49.88  ?  119 ILE A HG13   1 
ATOM 1869  H HG21   . ILE A 1 115 ? 27.776  -5.985  -51.268 1.00 61.08  ?  119 ILE A HG21   1 
ATOM 1870  H HG22   . ILE A 1 115 ? 27.371  -4.663  -52.052 1.00 61.08  ?  119 ILE A HG22   1 
ATOM 1871  H HG23   . ILE A 1 115 ? 26.255  -5.717  -51.643 1.00 61.08  ?  119 ILE A HG23   1 
ATOM 1872  H HD11   . ILE A 1 115 ? 27.880  -9.472  -52.145 1.00 41.97  ?  119 ILE A HD11   1 
ATOM 1873  H HD12   . ILE A 1 115 ? 28.999  -8.442  -52.606 1.00 41.97  ?  119 ILE A HD12   1 
ATOM 1874  H HD13   . ILE A 1 115 ? 28.113  -8.132  -51.324 1.00 41.97  ?  119 ILE A HD13   1 
ATOM 1875  N N      . ARG A 1 116 ? 27.665  -3.779  -55.055 1.00 52.93  ?  120 ARG A N      1 
ATOM 1876  C CA     . ARG A 1 116 ? 27.874  -2.344  -55.197 1.00 35.27  ?  120 ARG A CA     1 
ATOM 1877  C C      . ARG A 1 116 ? 26.751  -1.669  -55.969 1.00 36.04  ?  120 ARG A C      1 
ATOM 1878  O O      . ARG A 1 116 ? 26.574  -0.454  -55.841 1.00 43.07  ?  120 ARG A O      1 
ATOM 1879  C CB     . ARG A 1 116 ? 29.210  -2.074  -55.885 1.00 36.25  ?  120 ARG A CB     1 
ATOM 1880  C CG     . ARG A 1 116 ? 30.416  -2.403  -55.028 1.00 27.21  ?  120 ARG A CG     1 
ATOM 1881  C CD     . ARG A 1 116 ? 31.710  -2.155  -55.777 1.00 50.28  ?  120 ARG A CD     1 
ATOM 1882  N NE     . ARG A 1 116 ? 32.882  -2.489  -54.974 1.00 56.97  ?  120 ARG A NE     1 
ATOM 1883  C CZ     . ARG A 1 116 ? 33.501  -1.643  -54.155 1.00 61.06  ?  120 ARG A CZ     1 
ATOM 1884  N NH1    . ARG A 1 116 ? 33.067  -0.398  -54.018 1.00 54.44  1  120 ARG A NH1    1 
ATOM 1885  N NH2    . ARG A 1 116 ? 34.561  -2.045  -53.468 1.00 79.79  ?  120 ARG A NH2    1 
ATOM 1886  H H      . ARG A 1 116 ? 28.289  -4.267  -55.389 1.00 63.51  ?  120 ARG A H      1 
ATOM 1887  H HA     . ARG A 1 116 ? 27.909  -1.945  -54.314 1.00 42.33  ?  120 ARG A HA     1 
ATOM 1888  H HB2    . ARG A 1 116 ? 29.262  -2.613  -56.690 1.00 43.50  ?  120 ARG A HB2    1 
ATOM 1889  H HB3    . ARG A 1 116 ? 29.258  -1.133  -56.116 1.00 43.50  ?  120 ARG A HB3    1 
ATOM 1890  H HG2    . ARG A 1 116 ? 30.410  -1.841  -54.237 1.00 32.65  ?  120 ARG A HG2    1 
ATOM 1891  H HG3    . ARG A 1 116 ? 30.384  -3.339  -54.776 1.00 32.65  ?  120 ARG A HG3    1 
ATOM 1892  H HD2    . ARG A 1 116 ? 31.725  -2.705  -56.576 1.00 60.34  ?  120 ARG A HD2    1 
ATOM 1893  H HD3    . ARG A 1 116 ? 31.764  -1.217  -56.016 1.00 60.34  ?  120 ARG A HD3    1 
ATOM 1894  H HE     . ARG A 1 116 ? 33.194  -3.288  -55.034 1.00 68.36  ?  120 ARG A HE     1 
ATOM 1895  H HH11   . ARG A 1 116 ? 32.380  -0.131  -54.461 1.00 65.32  ?  120 ARG A HH11   1 
ATOM 1896  H HH12   . ARG A 1 116 ? 33.473  0.143   -53.487 1.00 65.32  ?  120 ARG A HH12   1 
ATOM 1897  H HH21   . ARG A 1 116 ? 34.847  -2.851  -53.552 1.00 95.75  ?  120 ARG A HH21   1 
ATOM 1898  H HH22   . ARG A 1 116 ? 34.962  -1.499  -52.938 1.00 95.75  ?  120 ARG A HH22   1 
ATOM 1899  N N      . HIS A 1 117 ? 25.989  -2.418  -56.766 1.00 38.66  ?  121 HIS A N      1 
ATOM 1900  C CA     . HIS A 1 117 ? 24.867  -1.822  -57.481 1.00 46.49  ?  121 HIS A CA     1 
ATOM 1901  C C      . HIS A 1 117 ? 23.674  -1.617  -56.558 1.00 46.17  ?  121 HIS A C      1 
ATOM 1902  O O      . HIS A 1 117 ? 23.063  -0.544  -56.551 1.00 59.17  ?  121 HIS A O      1 
ATOM 1903  C CB     . HIS A 1 117 ? 24.468  -2.696  -58.668 1.00 43.46  ?  121 HIS A CB     1 
ATOM 1904  C CG     . HIS A 1 117 ? 23.364  -2.116  -59.495 1.00 38.07  ?  121 HIS A CG     1 
ATOM 1905  N ND1    . HIS A 1 117 ? 23.596  -1.268  -60.556 1.00 48.98  ?  121 HIS A ND1    1 
ATOM 1906  C CD2    . HIS A 1 117 ? 22.020  -2.257  -59.413 1.00 35.85  ?  121 HIS A CD2    1 
ATOM 1907  C CE1    . HIS A 1 117 ? 22.443  -0.915  -61.096 1.00 52.92  ?  121 HIS A CE1    1 
ATOM 1908  N NE2    . HIS A 1 117 ? 21.471  -1.502  -60.421 1.00 54.01  ?  121 HIS A NE2    1 
ATOM 1909  H H      . HIS A 1 117 ? 26.100  -3.259  -56.907 1.00 46.39  ?  121 HIS A H      1 
ATOM 1910  H HA     . HIS A 1 117 ? 25.135  -0.955  -57.823 1.00 55.79  ?  121 HIS A HA     1 
ATOM 1911  H HB2    . HIS A 1 117 ? 25.240  -2.814  -59.244 1.00 52.15  ?  121 HIS A HB2    1 
ATOM 1912  H HB3    . HIS A 1 117 ? 24.170  -3.557  -58.337 1.00 52.15  ?  121 HIS A HB3    1 
ATOM 1913  H HD2    . HIS A 1 117 ? 21.555  -2.772  -58.794 1.00 43.02  ?  121 HIS A HD2    1 
ATOM 1914  H HE1    . HIS A 1 117 ? 22.334  -0.349  -61.825 1.00 63.50  ?  121 HIS A HE1    1 
ATOM 1915  H HE2    . HIS A 1 117 ? 20.630  -1.423  -60.585 1.00 64.81  ?  121 HIS A HE2    1 
ATOM 1916  N N      . VAL A 1 118 ? 23.324  -2.638  -55.774 1.00 47.36  ?  122 VAL A N      1 
ATOM 1917  C CA     . VAL A 1 118 ? 22.190  -2.515  -54.871 1.00 44.19  ?  122 VAL A CA     1 
ATOM 1918  C C      . VAL A 1 118 ? 22.505  -1.601  -53.697 1.00 43.84  ?  122 VAL A C      1 
ATOM 1919  O O      . VAL A 1 118 ? 21.584  -1.161  -53.001 1.00 46.98  ?  122 VAL A O      1 
ATOM 1920  C CB     . VAL A 1 118 ? 21.742  -3.899  -54.369 1.00 49.41  ?  122 VAL A CB     1 
ATOM 1921  C CG1    . VAL A 1 118 ? 21.281  -4.754  -55.532 1.00 50.85  ?  122 VAL A CG1    1 
ATOM 1922  C CG2    . VAL A 1 118 ? 22.863  -4.589  -53.606 1.00 48.31  ?  122 VAL A CG2    1 
ATOM 1923  H H      . VAL A 1 118 ? 23.723  -3.400  -55.749 1.00 56.83  ?  122 VAL A H      1 
ATOM 1924  H HA     . VAL A 1 118 ? 21.447  -2.123  -55.357 1.00 53.03  ?  122 VAL A HA     1 
ATOM 1925  H HB     . VAL A 1 118 ? 20.992  -3.788  -53.763 1.00 59.30  ?  122 VAL A HB     1 
ATOM 1926  H HG11   . VAL A 1 118 ? 21.003  -5.620  -55.196 1.00 61.02  ?  122 VAL A HG11   1 
ATOM 1927  H HG12   . VAL A 1 118 ? 20.536  -4.314  -55.970 1.00 61.02  ?  122 VAL A HG12   1 
ATOM 1928  H HG13   . VAL A 1 118 ? 22.016  -4.861  -56.155 1.00 61.02  ?  122 VAL A HG13   1 
ATOM 1929  H HG21   . VAL A 1 118 ? 22.552  -5.456  -53.304 1.00 57.97  ?  122 VAL A HG21   1 
ATOM 1930  H HG22   . VAL A 1 118 ? 23.625  -4.698  -54.197 1.00 57.97  ?  122 VAL A HG22   1 
ATOM 1931  H HG23   . VAL A 1 118 ? 23.110  -4.041  -52.845 1.00 57.97  ?  122 VAL A HG23   1 
ATOM 1932  N N      . LEU A 1 119 ? 23.780  -1.305  -53.451 1.00 59.82  ?  123 LEU A N      1 
ATOM 1933  C CA     . LEU A 1 119 ? 24.150  -0.372  -52.394 1.00 61.82  ?  123 LEU A CA     1 
ATOM 1934  C C      . LEU A 1 119 ? 23.958  1.085   -52.797 1.00 47.67  ?  123 LEU A C      1 
ATOM 1935  O O      . LEU A 1 119 ? 24.249  1.976   -51.993 1.00 47.37  ?  123 LEU A O      1 
ATOM 1936  C CB     . LEU A 1 119 ? 25.604  -0.596  -51.968 1.00 55.51  ?  123 LEU A CB     1 
ATOM 1937  C CG     . LEU A 1 119 ? 25.900  -1.808  -51.081 1.00 49.22  ?  123 LEU A CG     1 
ATOM 1938  C CD1    . LEU A 1 119 ? 27.383  -1.858  -50.757 1.00 58.30  ?  123 LEU A CD1    1 
ATOM 1939  C CD2    . LEU A 1 119 ? 25.085  -1.781  -49.796 1.00 44.52  ?  123 LEU A CD2    1 
ATOM 1940  H H      . LEU A 1 119 ? 24.449  -1.631  -53.883 1.00 71.78  ?  123 LEU A H      1 
ATOM 1941  H HA     . LEU A 1 119 ? 23.587  -0.539  -51.622 1.00 74.19  ?  123 LEU A HA     1 
ATOM 1942  H HB2    . LEU A 1 119 ? 26.139  -0.695  -52.771 1.00 66.61  ?  123 LEU A HB2    1 
ATOM 1943  H HB3    . LEU A 1 119 ? 25.899  0.190   -51.483 1.00 66.61  ?  123 LEU A HB3    1 
ATOM 1944  H HG     . LEU A 1 119 ? 25.671  -2.617  -51.564 1.00 59.07  ?  123 LEU A HG     1 
ATOM 1945  H HD11   . LEU A 1 119 ? 27.557  -2.629  -50.194 1.00 69.96  ?  123 LEU A HD11   1 
ATOM 1946  H HD12   . LEU A 1 119 ? 27.884  -1.932  -51.584 1.00 69.96  ?  123 LEU A HD12   1 
ATOM 1947  H HD13   . LEU A 1 119 ? 27.631  -1.045  -50.290 1.00 69.96  ?  123 LEU A HD13   1 
ATOM 1948  H HD21   . LEU A 1 119 ? 25.304  -2.564  -49.267 1.00 53.43  ?  123 LEU A HD21   1 
ATOM 1949  H HD22   . LEU A 1 119 ? 25.303  -0.975  -49.301 1.00 53.43  ?  123 LEU A HD22   1 
ATOM 1950  H HD23   . LEU A 1 119 ? 24.141  -1.786  -50.020 1.00 53.43  ?  123 LEU A HD23   1 
ATOM 1951  N N      . ARG A 1 120 ? 23.488  1.350   -54.014 1.00 45.84  ?  124 ARG A N      1 
ATOM 1952  C CA     . ARG A 1 120 ? 23.139  2.705   -54.409 1.00 46.57  ?  124 ARG A CA     1 
ATOM 1953  C C      . ARG A 1 120 ? 21.744  3.104   -53.950 1.00 47.91  ?  124 ARG A C      1 
ATOM 1954  O O      . ARG A 1 120 ? 21.353  4.259   -54.145 1.00 82.90  ?  124 ARG A O      1 
ATOM 1955  C CB     . ARG A 1 120 ? 23.243  2.848   -55.928 1.00 50.11  ?  124 ARG A CB     1 
ATOM 1956  C CG     . ARG A 1 120 ? 24.667  2.784   -56.448 1.00 56.50  ?  124 ARG A CG     1 
ATOM 1957  C CD     . ARG A 1 120 ? 24.703  2.510   -57.938 1.00 57.65  ?  124 ARG A CD     1 
ATOM 1958  N NE     . ARG A 1 120 ? 23.944  3.494   -58.701 1.00 49.08  ?  124 ARG A NE     1 
ATOM 1959  C CZ     . ARG A 1 120 ? 23.713  3.411   -60.007 1.00 63.83  ?  124 ARG A CZ     1 
ATOM 1960  N NH1    . ARG A 1 120 ? 24.178  2.383   -60.705 1.00 73.16  1  124 ARG A NH1    1 
ATOM 1961  N NH2    . ARG A 1 120 ? 23.013  4.355   -60.619 1.00 87.87  ?  124 ARG A NH2    1 
ATOM 1962  H H      . ARG A 1 120 ? 23.363  0.760   -54.627 1.00 55.01  ?  124 ARG A H      1 
ATOM 1963  H HA     . ARG A 1 120 ? 23.771  3.322   -54.008 1.00 55.88  ?  124 ARG A HA     1 
ATOM 1964  H HB2    . ARG A 1 120 ? 22.742  2.129   -56.345 1.00 60.13  ?  124 ARG A HB2    1 
ATOM 1965  H HB3    . ARG A 1 120 ? 22.870  3.704   -56.189 1.00 60.13  ?  124 ARG A HB3    1 
ATOM 1966  H HG2    . ARG A 1 120 ? 25.106  3.633   -56.285 1.00 67.80  ?  124 ARG A HG2    1 
ATOM 1967  H HG3    . ARG A 1 120 ? 25.141  2.068   -55.996 1.00 67.80  ?  124 ARG A HG3    1 
ATOM 1968  H HD2    . ARG A 1 120 ? 25.623  2.536   -58.244 1.00 69.18  ?  124 ARG A HD2    1 
ATOM 1969  H HD3    . ARG A 1 120 ? 24.320  1.635   -58.110 1.00 69.18  ?  124 ARG A HD3    1 
ATOM 1970  H HE     . ARG A 1 120 ? 23.626  4.172   -58.279 1.00 58.90  ?  124 ARG A HE     1 
ATOM 1971  H HH11   . ARG A 1 120 ? 24.633  1.767   -60.313 1.00 87.79  ?  124 ARG A HH11   1 
ATOM 1972  H HH12   . ARG A 1 120 ? 24.025  2.333   -61.550 1.00 87.79  ?  124 ARG A HH12   1 
ATOM 1973  H HH21   . ARG A 1 120 ? 22.709  5.023   -60.170 1.00 105.44 ?  124 ARG A HH21   1 
ATOM 1974  H HH22   . ARG A 1 120 ? 22.862  4.300   -61.463 1.00 105.44 ?  124 ARG A HH22   1 
ATOM 1975  N N      . GLY A 1 121 ? 20.993  2.181   -53.355 1.00 36.66  ?  125 GLY A N      1 
ATOM 1976  C CA     . GLY A 1 121 ? 19.681  2.480   -52.820 1.00 57.64  ?  125 GLY A CA     1 
ATOM 1977  C C      . GLY A 1 121 ? 19.585  2.129   -51.351 1.00 51.81  ?  125 GLY A C      1 
ATOM 1978  O O      . GLY A 1 121 ? 18.501  1.837   -50.839 1.00 46.95  ?  125 GLY A O      1 
ATOM 1979  H H      . GLY A 1 121 ? 21.231  1.362   -53.250 1.00 43.99  ?  125 GLY A H      1 
ATOM 1980  H HA2    . GLY A 1 121 ? 19.494  3.426   -52.926 1.00 69.17  ?  125 GLY A HA2    1 
ATOM 1981  H HA3    . GLY A 1 121 ? 19.009  1.976   -53.304 1.00 69.17  ?  125 GLY A HA3    1 
ATOM 1982  N N      . VAL A 1 122 ? 20.727  2.152   -50.664 1.00 45.16  ?  126 VAL A N      1 
ATOM 1983  C CA     . VAL A 1 122 ? 20.753  1.811   -49.246 1.00 45.64  ?  126 VAL A CA     1 
ATOM 1984  C C      . VAL A 1 122 ? 20.214  2.954   -48.399 1.00 53.93  ?  126 VAL A C      1 
ATOM 1985  O O      . VAL A 1 122 ? 19.655  2.718   -47.322 1.00 55.61  ?  126 VAL A O      1 
ATOM 1986  C CB     . VAL A 1 122 ? 22.180  1.423   -48.817 1.00 43.83  ?  126 VAL A CB     1 
ATOM 1987  C CG1    . VAL A 1 122 ? 23.159  2.555   -49.088 1.00 58.17  ?  126 VAL A CG1    1 
ATOM 1988  C CG2    . VAL A 1 122 ? 22.215  1.036   -47.346 1.00 52.22  ?  126 VAL A CG2    1 
ATOM 1989  H H      . VAL A 1 122 ? 21.493  2.361   -50.994 1.00 54.20  ?  126 VAL A H      1 
ATOM 1990  H HA     . VAL A 1 122 ? 20.181  1.041   -49.101 1.00 54.77  ?  126 VAL A HA     1 
ATOM 1991  H HB     . VAL A 1 122 ? 22.464  0.653   -49.334 1.00 52.60  ?  126 VAL A HB     1 
ATOM 1992  H HG11   . VAL A 1 122 ? 24.046  2.280   -48.808 1.00 69.80  ?  126 VAL A HG11   1 
ATOM 1993  H HG12   . VAL A 1 122 ? 23.159  2.752   -50.038 1.00 69.80  ?  126 VAL A HG12   1 
ATOM 1994  H HG13   . VAL A 1 122 ? 22.882  3.338   -48.587 1.00 69.80  ?  126 VAL A HG13   1 
ATOM 1995  H HG21   . VAL A 1 122 ? 23.123  0.797   -47.105 1.00 62.67  ?  126 VAL A HG21   1 
ATOM 1996  H HG22   . VAL A 1 122 ? 21.919  1.792   -46.815 1.00 62.67  ?  126 VAL A HG22   1 
ATOM 1997  H HG23   . VAL A 1 122 ? 21.624  0.280   -47.204 1.00 62.67  ?  126 VAL A HG23   1 
ATOM 1998  N N      . GLU A 1 123 ? 20.373  4.199   -48.852 1.00 76.73  ?  127 GLU A N      1 
ATOM 1999  C CA     . GLU A 1 123 ? 19.894  5.367   -48.122 1.00 67.21  ?  127 GLU A CA     1 
ATOM 2000  C C      . GLU A 1 123 ? 18.876  6.155   -48.939 1.00 51.61  ?  127 GLU A C      1 
ATOM 2001  O O      . GLU A 1 123 ? 18.764  7.372   -48.797 1.00 46.84  ?  127 GLU A O      1 
ATOM 2002  C CB     . GLU A 1 123 ? 21.060  6.266   -47.713 1.00 53.64  ?  127 GLU A CB     1 
ATOM 2003  C CG     . GLU A 1 123 ? 22.053  5.599   -46.775 1.00 78.81  ?  127 GLU A CG     1 
ATOM 2004  C CD     . GLU A 1 123 ? 22.877  6.596   -45.988 1.00 76.88  ?  127 GLU A CD     1 
ATOM 2005  O OE1    . GLU A 1 123 ? 23.039  7.738   -46.463 1.00 89.06  ?  127 GLU A OE1    1 
ATOM 2006  O OE2    . GLU A 1 123 ? 23.357  6.239   -44.892 1.00 79.06  -1 127 GLU A OE2    1 
ATOM 2007  H H      . GLU A 1 123 ? 20.764  4.393   -49.593 1.00 92.08  ?  127 GLU A H      1 
ATOM 2008  H HA     . GLU A 1 123 ? 19.454  5.068   -47.311 1.00 80.65  ?  127 GLU A HA     1 
ATOM 2009  H HB2    . GLU A 1 123 ? 21.542  6.535   -48.511 1.00 64.37  ?  127 GLU A HB2    1 
ATOM 2010  H HB3    . GLU A 1 123 ? 20.707  7.049   -47.263 1.00 64.37  ?  127 GLU A HB3    1 
ATOM 2011  H HG2    . GLU A 1 123 ? 21.567  5.046   -46.142 1.00 94.57  ?  127 GLU A HG2    1 
ATOM 2012  H HG3    . GLU A 1 123 ? 22.661  5.051   -47.295 1.00 94.57  ?  127 GLU A HG3    1 
ATOM 2013  N N      . SER A 1 124 ? 18.125  5.472   -49.795 1.00 45.71  ?  128 SER A N      1 
ATOM 2014  C CA     . SER A 1 124 ? 17.105  6.142   -50.578 1.00 40.05  ?  128 SER A CA     1 
ATOM 2015  C C      . SER A 1 124 ? 15.994  6.661   -49.667 1.00 40.07  ?  128 SER A C      1 
ATOM 2016  O O      . SER A 1 124 ? 15.761  6.113   -48.588 1.00 47.19  ?  128 SER A O      1 
ATOM 2017  C CB     . SER A 1 124 ? 16.516  5.189   -51.611 1.00 43.94  ?  128 SER A CB     1 
ATOM 2018  O OG     . SER A 1 124 ? 15.343  5.730   -52.190 1.00 55.09  ?  128 SER A OG     1 
ATOM 2019  H H      . SER A 1 124 ? 18.188  4.626   -49.939 1.00 54.85  ?  128 SER A H      1 
ATOM 2020  H HA     . SER A 1 124 ? 17.498  6.896   -51.044 1.00 48.06  ?  128 SER A HA     1 
ATOM 2021  H HB2    . SER A 1 124 ? 17.172  5.038   -52.310 1.00 52.72  ?  128 SER A HB2    1 
ATOM 2022  H HB3    . SER A 1 124 ? 16.296  4.350   -51.177 1.00 52.72  ?  128 SER A HB3    1 
ATOM 2023  H HG     . SER A 1 124 ? 15.030  5.195   -52.757 1.00 66.11  ?  128 SER A HG     1 
ATOM 2024  N N      . PRO A 1 125 ? 15.292  7.722   -50.076 1.00 48.89  ?  129 PRO A N      1 
ATOM 2025  C CA     . PRO A 1 125 ? 14.165  8.190   -49.254 1.00 48.34  ?  129 PRO A CA     1 
ATOM 2026  C C      . PRO A 1 125 ? 13.052  7.167   -49.151 1.00 58.26  ?  129 PRO A C      1 
ATOM 2027  O O      . PRO A 1 125 ? 12.430  7.029   -48.091 1.00 57.73  ?  129 PRO A O      1 
ATOM 2028  C CB     . PRO A 1 125 ? 13.694  9.460   -49.979 1.00 57.31  ?  129 PRO A CB     1 
ATOM 2029  C CG     . PRO A 1 125 ? 14.764  9.808   -50.945 1.00 61.81  ?  129 PRO A CG     1 
ATOM 2030  C CD     . PRO A 1 125 ? 15.475  8.544   -51.283 1.00 79.93  ?  129 PRO A CD     1 
ATOM 2031  H HA     . PRO A 1 125 ? 14.471  8.423   -48.363 1.00 58.01  ?  129 PRO A HA     1 
ATOM 2032  H HB2    . PRO A 1 125 ? 12.862  9.277   -50.444 1.00 68.77  ?  129 PRO A HB2    1 
ATOM 2033  H HB3    . PRO A 1 125 ? 13.573  10.174  -49.334 1.00 68.77  ?  129 PRO A HB3    1 
ATOM 2034  H HG2    . PRO A 1 125 ? 14.365  10.193  -51.741 1.00 74.18  ?  129 PRO A HG2    1 
ATOM 2035  H HG3    . PRO A 1 125 ? 15.375  10.439  -50.534 1.00 74.18  ?  129 PRO A HG3    1 
ATOM 2036  H HD2    . PRO A 1 125 ? 15.061  8.117   -52.049 1.00 95.91  ?  129 PRO A HD2    1 
ATOM 2037  H HD3    . PRO A 1 125 ? 16.417  8.716   -51.436 1.00 95.91  ?  129 PRO A HD3    1 
ATOM 2038  N N      . ASP A 1 126 ? 12.783  6.446   -50.234 1.00 65.24  ?  130 ASP A N      1 
ATOM 2039  C CA     . ASP A 1 126 ? 11.681  5.497   -50.252 1.00 58.26  ?  130 ASP A CA     1 
ATOM 2040  C C      . ASP A 1 126 ? 11.954  4.361   -49.275 1.00 55.35  ?  130 ASP A C      1 
ATOM 2041  O O      . ASP A 1 126 ? 13.044  3.781   -49.269 1.00 61.39  ?  130 ASP A O      1 
ATOM 2042  C CB     . ASP A 1 126 ? 11.482  4.954   -51.664 1.00 56.22  ?  130 ASP A CB     1 
ATOM 2043  C CG     . ASP A 1 126 ? 10.190  4.184   -51.813 1.00 60.19  ?  130 ASP A CG     1 
ATOM 2044  O OD1    . ASP A 1 126 ? 10.028  3.487   -52.835 1.00 62.67  ?  130 ASP A OD1    1 
ATOM 2045  O OD2    . ASP A 1 126 ? 9.338   4.276   -50.907 1.00 57.80  -1 130 ASP A OD2    1 
ATOM 2046  H H      . ASP A 1 126 ? 13.224  6.489   -50.971 1.00 78.29  ?  130 ASP A H      1 
ATOM 2047  H HA     . ASP A 1 126 ? 10.866  5.946   -49.978 1.00 69.91  ?  130 ASP A HA     1 
ATOM 2048  H HB2    . ASP A 1 126 ? 11.463  5.696   -52.289 1.00 67.47  ?  130 ASP A HB2    1 
ATOM 2049  H HB3    . ASP A 1 126 ? 12.215  4.356   -51.880 1.00 67.47  ?  130 ASP A HB3    1 
ATOM 2050  N N      . LYS A 1 127 ? 10.961  4.051   -48.440 1.00 71.41  ?  131 LYS A N      1 
ATOM 2051  C CA     . LYS A 1 127 ? 11.128  2.985   -47.458 1.00 69.30  ?  131 LYS A CA     1 
ATOM 2052  C C      . LYS A 1 127 ? 11.190  1.618   -48.126 1.00 58.73  ?  131 LYS A C      1 
ATOM 2053  O O      . LYS A 1 127 ? 11.888  0.721   -47.640 1.00 45.86  ?  131 LYS A O      1 
ATOM 2054  C CB     . LYS A 1 127 ? 9.985   3.032   -46.441 1.00 71.68  ?  131 LYS A CB     1 
ATOM 2055  C CG     . LYS A 1 127 ? 8.779   2.174   -46.805 1.00 75.35  ?  131 LYS A CG     1 
ATOM 2056  C CD     . LYS A 1 127 ? 7.513   2.628   -46.092 1.00 83.52  ?  131 LYS A CD     1 
ATOM 2057  C CE     . LYS A 1 127 ? 7.732   2.837   -44.604 1.00 87.09  ?  131 LYS A CE     1 
ATOM 2058  N NZ     . LYS A 1 127 ? 6.454   3.107   -43.890 1.00 90.06  1  131 LYS A NZ     1 
ATOM 2059  H H      . LYS A 1 127 ? 10.193  4.437   -48.422 1.00 85.69  ?  131 LYS A H      1 
ATOM 2060  H HA     . LYS A 1 127 ? 11.961  3.123   -46.980 1.00 83.16  ?  131 LYS A HA     1 
ATOM 2061  H HB2    . LYS A 1 127 ? 10.319  2.722   -45.585 1.00 86.01  ?  131 LYS A HB2    1 
ATOM 2062  H HB3    . LYS A 1 127 ? 9.680   3.950   -46.360 1.00 86.01  ?  131 LYS A HB3    1 
ATOM 2063  H HG2    . LYS A 1 127 ? 8.624   2.233   -47.761 1.00 90.42  ?  131 LYS A HG2    1 
ATOM 2064  H HG3    . LYS A 1 127 ? 8.955   1.255   -46.551 1.00 90.42  ?  131 LYS A HG3    1 
ATOM 2065  H HD2    . LYS A 1 127 ? 7.218   3.470   -46.474 1.00 100.23 ?  131 LYS A HD2    1 
ATOM 2066  H HD3    . LYS A 1 127 ? 6.826   1.953   -46.203 1.00 100.23 ?  131 LYS A HD3    1 
ATOM 2067  H HE2    . LYS A 1 127 ? 8.129   2.038   -44.224 1.00 104.51 ?  131 LYS A HE2    1 
ATOM 2068  H HE3    . LYS A 1 127 ? 8.319   3.598   -44.472 1.00 104.51 ?  131 LYS A HE3    1 
ATOM 2069  H HZ1    . LYS A 1 127 ? 6.610   3.225   -43.021 1.00 108.07 ?  131 LYS A HZ1    1 
ATOM 2070  H HZ2    . LYS A 1 127 ? 6.071   3.840   -44.217 1.00 108.07 ?  131 LYS A HZ2    1 
ATOM 2071  H HZ3    . LYS A 1 127 ? 5.897   2.420   -43.992 1.00 108.07 ?  131 LYS A HZ3    1 
ATOM 2072  N N      . ASN A 1 128 ? 10.478  1.442   -49.239 1.00 50.15  ?  132 ASN A N      1 
ATOM 2073  C CA     . ASN A 1 128 ? 10.462  0.150   -49.911 1.00 31.74  ?  132 ASN A CA     1 
ATOM 2074  C C      . ASN A 1 128 ? 11.800  -0.143  -50.573 1.00 35.25  ?  132 ASN A C      1 
ATOM 2075  O O      . ASN A 1 128 ? 12.288  -1.277  -50.520 1.00 47.20  ?  132 ASN A O      1 
ATOM 2076  C CB     . ASN A 1 128 ? 9.331   0.116   -50.935 1.00 51.37  ?  132 ASN A CB     1 
ATOM 2077  C CG     . ASN A 1 128 ? 7.986   0.433   -50.318 1.00 55.37  ?  132 ASN A CG     1 
ATOM 2078  O OD1    . ASN A 1 128 ? 7.791   0.265   -49.116 1.00 35.78  ?  132 ASN A OD1    1 
ATOM 2079  N ND2    . ASN A 1 128 ? 7.049   0.892   -51.137 1.00 76.67  ?  132 ASN A ND2    1 
ATOM 2080  H H      . ASN A 1 128 ? 10.002  2.049   -49.620 1.00 60.17  ?  132 ASN A H      1 
ATOM 2081  H HA     . ASN A 1 128 ? 10.293  -0.545  -49.256 1.00 38.09  ?  132 ASN A HA     1 
ATOM 2082  H HB2    . ASN A 1 128 ? 9.508   0.775   -51.625 1.00 61.64  ?  132 ASN A HB2    1 
ATOM 2083  H HB3    . ASN A 1 128 ? 9.282   -0.770  -51.325 1.00 61.64  ?  132 ASN A HB3    1 
ATOM 2084  H HD21   . ASN A 1 128 ? 6.268   1.086   -50.832 1.00 92.01  ?  132 ASN A HD21   1 
ATOM 2085  H HD22   . ASN A 1 128 ? 7.222   0.996   -51.973 1.00 92.01  ?  132 ASN A HD22   1 
ATOM 2086  N N      . VAL A 1 129 ? 12.410  0.862   -51.199 1.00 47.99  ?  133 VAL A N      1 
ATOM 2087  C CA     . VAL A 1 129 ? 13.730  0.672   -51.792 1.00 47.83  ?  133 VAL A CA     1 
ATOM 2088  C C      . VAL A 1 129 ? 14.725  0.241   -50.724 1.00 41.33  ?  133 VAL A C      1 
ATOM 2089  O O      . VAL A 1 129 ? 15.484  -0.717  -50.907 1.00 49.39  ?  133 VAL A O      1 
ATOM 2090  C CB     . VAL A 1 129 ? 14.189  1.957   -52.505 1.00 48.73  ?  133 VAL A CB     1 
ATOM 2091  C CG1    . VAL A 1 129 ? 15.631  1.828   -52.983 1.00 48.38  ?  133 VAL A CG1    1 
ATOM 2092  C CG2    . VAL A 1 129 ? 13.272  2.261   -53.677 1.00 61.97  ?  133 VAL A CG2    1 
ATOM 2093  H H      . VAL A 1 129 ? 12.085  1.653   -51.294 1.00 57.59  ?  133 VAL A H      1 
ATOM 2094  H HA     . VAL A 1 129 ? 13.679  -0.034  -52.455 1.00 57.39  ?  133 VAL A HA     1 
ATOM 2095  H HB     . VAL A 1 129 ? 14.142  2.700   -51.884 1.00 58.47  ?  133 VAL A HB     1 
ATOM 2096  H HG11   . VAL A 1 129 ? 15.891  2.651   -53.427 1.00 58.05  ?  133 VAL A HG11   1 
ATOM 2097  H HG12   . VAL A 1 129 ? 16.204  1.671   -52.216 1.00 58.05  ?  133 VAL A HG12   1 
ATOM 2098  H HG13   . VAL A 1 129 ? 15.693  1.084   -53.601 1.00 58.05  ?  133 VAL A HG13   1 
ATOM 2099  H HG21   . VAL A 1 129 ? 13.577  3.072   -54.113 1.00 74.37  ?  133 VAL A HG21   1 
ATOM 2100  H HG22   . VAL A 1 129 ? 13.301  1.519   -54.300 1.00 74.37  ?  133 VAL A HG22   1 
ATOM 2101  H HG23   . VAL A 1 129 ? 12.368  2.382   -53.346 1.00 74.37  ?  133 VAL A HG23   1 
ATOM 2102  N N      . ARG A 1 130 ? 14.734  0.940   -49.590 1.00 35.51  ?  134 ARG A N      1 
ATOM 2103  C CA     . ARG A 1 130 ? 15.663  0.590   -48.523 1.00 39.68  ?  134 ARG A CA     1 
ATOM 2104  C C      . ARG A 1 130 ? 15.412  -0.823  -48.016 1.00 54.03  ?  134 ARG A C      1 
ATOM 2105  O O      . ARG A 1 130 ? 16.358  -1.559  -47.715 1.00 61.76  ?  134 ARG A O      1 
ATOM 2106  C CB     . ARG A 1 130 ? 15.553  1.596   -47.379 1.00 57.20  ?  134 ARG A CB     1 
ATOM 2107  C CG     . ARG A 1 130 ? 16.385  2.846   -47.591 1.00 65.89  ?  134 ARG A CG     1 
ATOM 2108  C CD     . ARG A 1 130 ? 16.267  3.822   -46.433 1.00 45.62  ?  134 ARG A CD     1 
ATOM 2109  N NE     . ARG A 1 130 ? 14.930  4.403   -46.343 1.00 49.12  ?  134 ARG A NE     1 
ATOM 2110  C CZ     . ARG A 1 130 ? 14.070  4.213   -45.345 1.00 45.31  ?  134 ARG A CZ     1 
ATOM 2111  N NH1    . ARG A 1 130 ? 12.882  4.799   -45.386 1.00 65.69  1  134 ARG A NH1    1 
ATOM 2112  N NH2    . ARG A 1 130 ? 14.385  3.459   -44.302 1.00 35.26  ?  134 ARG A NH2    1 
ATOM 2113  H H      . ARG A 1 130 ? 14.222  1.609   -49.417 1.00 42.61  ?  134 ARG A H      1 
ATOM 2114  H HA     . ARG A 1 130 ? 16.568  0.627   -48.868 1.00 47.62  ?  134 ARG A HA     1 
ATOM 2115  H HB2    . ARG A 1 130 ? 14.626  1.868   -47.288 1.00 68.63  ?  134 ARG A HB2    1 
ATOM 2116  H HB3    . ARG A 1 130 ? 15.855  1.174   -46.560 1.00 68.63  ?  134 ARG A HB3    1 
ATOM 2117  H HG2    . ARG A 1 130 ? 17.317  2.596   -47.681 1.00 79.07  ?  134 ARG A HG2    1 
ATOM 2118  H HG3    . ARG A 1 130 ? 16.082  3.296   -48.396 1.00 79.07  ?  134 ARG A HG3    1 
ATOM 2119  H HD2    . ARG A 1 130 ? 16.451  3.355   -45.603 1.00 54.74  ?  134 ARG A HD2    1 
ATOM 2120  H HD3    . ARG A 1 130 ? 16.903  4.543   -46.558 1.00 54.74  ?  134 ARG A HD3    1 
ATOM 2121  H HE     . ARG A 1 130 ? 14.677  4.910   -46.990 1.00 58.94  ?  134 ARG A HE     1 
ATOM 2122  H HH11   . ARG A 1 130 ? 12.669  5.293   -46.057 1.00 78.83  ?  134 ARG A HH11   1 
ATOM 2123  H HH12   . ARG A 1 130 ? 12.323  4.684   -44.743 1.00 78.83  ?  134 ARG A HH12   1 
ATOM 2124  H HH21   . ARG A 1 130 ? 15.153  3.074   -44.265 1.00 42.32  ?  134 ARG A HH21   1 
ATOM 2125  H HH22   . ARG A 1 130 ? 13.818  3.348   -43.664 1.00 42.32  ?  134 ARG A HH22   1 
ATOM 2126  N N      . PHE A 1 131 ? 14.146  -1.227  -47.925 1.00 64.57  ?  135 PHE A N      1 
ATOM 2127  C CA     . PHE A 1 131 ? 13.832  -2.558  -47.418 1.00 53.89  ?  135 PHE A CA     1 
ATOM 2128  C C      . PHE A 1 131 ? 14.400  -3.639  -48.326 1.00 42.97  ?  135 PHE A C      1 
ATOM 2129  O O      . PHE A 1 131 ? 15.182  -4.491  -47.890 1.00 37.07  ?  135 PHE A O      1 
ATOM 2130  C CB     . PHE A 1 131 ? 12.320  -2.723  -47.274 1.00 60.07  ?  135 PHE A CB     1 
ATOM 2131  C CG     . PHE A 1 131 ? 11.885  -4.150  -47.151 1.00 38.95  ?  135 PHE A CG     1 
ATOM 2132  C CD1    . PHE A 1 131 ? 12.248  -4.904  -46.051 1.00 46.08  ?  135 PHE A CD1    1 
ATOM 2133  C CD2    . PHE A 1 131 ? 11.115  -4.740  -48.137 1.00 48.66  ?  135 PHE A CD2    1 
ATOM 2134  C CE1    . PHE A 1 131 ? 11.852  -6.217  -45.934 1.00 50.81  ?  135 PHE A CE1    1 
ATOM 2135  C CE2    . PHE A 1 131 ? 10.715  -6.055  -48.024 1.00 64.60  ?  135 PHE A CE2    1 
ATOM 2136  C CZ     . PHE A 1 131 ? 11.085  -6.794  -46.922 1.00 53.52  ?  135 PHE A CZ     1 
ATOM 2137  H H      . PHE A 1 131 ? 13.461  -0.757  -48.147 1.00 77.48  ?  135 PHE A H      1 
ATOM 2138  H HA     . PHE A 1 131 ? 14.231  -2.664  -46.540 1.00 64.67  ?  135 PHE A HA     1 
ATOM 2139  H HB2    . PHE A 1 131 ? 12.028  -2.254  -46.477 1.00 72.09  ?  135 PHE A HB2    1 
ATOM 2140  H HB3    . PHE A 1 131 ? 11.888  -2.346  -48.056 1.00 72.09  ?  135 PHE A HB3    1 
ATOM 2141  H HD1    . PHE A 1 131 ? 12.767  -4.519  -45.382 1.00 55.29  ?  135 PHE A HD1    1 
ATOM 2142  H HD2    . PHE A 1 131 ? 10.863  -4.245  -48.882 1.00 58.39  ?  135 PHE A HD2    1 
ATOM 2143  H HE1    . PHE A 1 131 ? 12.102  -6.714  -45.189 1.00 60.98  ?  135 PHE A HE1    1 
ATOM 2144  H HE2    . PHE A 1 131 ? 10.197  -6.443  -48.692 1.00 77.52  ?  135 PHE A HE2    1 
ATOM 2145  H HZ     . PHE A 1 131 ? 10.816  -7.680  -46.844 1.00 64.23  ?  135 PHE A HZ     1 
ATOM 2146  N N      . ARG A 1 132 ? 14.021  -3.616  -49.603 1.00 47.72  ?  136 ARG A N      1 
ATOM 2147  C CA     . ARG A 1 132 ? 14.379  -4.710  -50.492 1.00 42.57  ?  136 ARG A CA     1 
ATOM 2148  C C      . ARG A 1 132 ? 15.862  -4.724  -50.833 1.00 37.50  ?  136 ARG A C      1 
ATOM 2149  O O      . ARG A 1 132 ? 16.388  -5.783  -51.181 1.00 52.47  ?  136 ARG A O      1 
ATOM 2150  C CB     . ARG A 1 132 ? 13.530  -4.645  -51.759 1.00 40.04  ?  136 ARG A CB     1 
ATOM 2151  C CG     . ARG A 1 132 ? 12.052  -4.846  -51.470 1.00 47.71  ?  136 ARG A CG     1 
ATOM 2152  C CD     . ARG A 1 132 ? 11.268  -5.249  -52.699 1.00 59.94  ?  136 ARG A CD     1 
ATOM 2153  N NE     . ARG A 1 132 ? 9.928   -5.711  -52.348 1.00 58.82  ?  136 ARG A NE     1 
ATOM 2154  C CZ     . ARG A 1 132 ? 9.638   -6.947  -51.950 1.00 51.18  ?  136 ARG A CZ     1 
ATOM 2155  N NH1    . ARG A 1 132 ? 8.388   -7.270  -51.652 1.00 64.14  1  136 ARG A NH1    1 
ATOM 2156  N NH2    . ARG A 1 132 ? 10.592  -7.861  -51.845 1.00 56.25  ?  136 ARG A NH2    1 
ATOM 2157  H H      . ARG A 1 132 ? 13.562  -2.988  -49.971 1.00 57.27  ?  136 ARG A H      1 
ATOM 2158  H HA     . ARG A 1 132 ? 14.175  -5.547  -50.047 1.00 51.08  ?  136 ARG A HA     1 
ATOM 2159  H HB2    . ARG A 1 132 ? 13.641  -3.774  -52.172 1.00 48.05  ?  136 ARG A HB2    1 
ATOM 2160  H HB3    . ARG A 1 132 ? 13.816  -5.343  -52.370 1.00 48.05  ?  136 ARG A HB3    1 
ATOM 2161  H HG2    . ARG A 1 132 ? 11.951  -5.547  -50.807 1.00 57.26  ?  136 ARG A HG2    1 
ATOM 2162  H HG3    . ARG A 1 132 ? 11.679  -4.016  -51.135 1.00 57.26  ?  136 ARG A HG3    1 
ATOM 2163  H HD2    . ARG A 1 132 ? 11.182  -4.484  -53.289 1.00 71.93  ?  136 ARG A HD2    1 
ATOM 2164  H HD3    . ARG A 1 132 ? 11.731  -5.972  -53.151 1.00 71.93  ?  136 ARG A HD3    1 
ATOM 2165  H HE     . ARG A 1 132 ? 9.282   -5.146  -52.403 1.00 70.58  ?  136 ARG A HE     1 
ATOM 2166  H HH11   . ARG A 1 132 ? 7.765   -6.681  -51.717 1.00 76.97  ?  136 ARG A HH11   1 
ATOM 2167  H HH12   . ARG A 1 132 ? 8.201   -8.068  -51.394 1.00 76.97  ?  136 ARG A HH12   1 
ATOM 2168  H HH21   . ARG A 1 132 ? 11.405  -7.658  -52.036 1.00 67.49  ?  136 ARG A HH21   1 
ATOM 2169  H HH22   . ARG A 1 132 ? 10.397  -8.658  -51.586 1.00 67.49  ?  136 ARG A HH22   1 
ATOM 2170  N N      . VAL A 1 133 ? 16.554  -3.588  -50.733 1.00 38.28  ?  137 VAL A N      1 
ATOM 2171  C CA     . VAL A 1 133 ? 18.009  -3.606  -50.865 1.00 32.41  ?  137 VAL A CA     1 
ATOM 2172  C C      . VAL A 1 133 ? 18.620  -4.436  -49.746 1.00 36.90  ?  137 VAL A C      1 
ATOM 2173  O O      . VAL A 1 133 ? 19.445  -5.324  -49.985 1.00 48.88  ?  137 VAL A O      1 
ATOM 2174  C CB     . VAL A 1 133 ? 18.571  -2.173  -50.876 1.00 42.07  ?  137 VAL A CB     1 
ATOM 2175  C CG1    . VAL A 1 133 ? 20.087  -2.179  -50.691 1.00 33.90  ?  137 VAL A CG1    1 
ATOM 2176  C CG2    . VAL A 1 133 ? 18.217  -1.480  -52.179 1.00 71.20  ?  137 VAL A CG2    1 
ATOM 2177  H H      . VAL A 1 133 ? 16.213  -2.811  -50.593 1.00 45.93  ?  137 VAL A H      1 
ATOM 2178  H HA     . VAL A 1 133 ? 18.243  -4.024  -51.708 1.00 38.89  ?  137 VAL A HA     1 
ATOM 2179  H HB     . VAL A 1 133 ? 18.177  -1.669  -50.147 1.00 50.48  ?  137 VAL A HB     1 
ATOM 2180  H HG11   . VAL A 1 133 ? 20.410  -1.265  -50.702 1.00 40.68  ?  137 VAL A HG11   1 
ATOM 2181  H HG12   . VAL A 1 133 ? 20.299  -2.595  -49.841 1.00 40.68  ?  137 VAL A HG12   1 
ATOM 2182  H HG13   . VAL A 1 133 ? 20.490  -2.682  -51.415 1.00 40.68  ?  137 VAL A HG13   1 
ATOM 2183  H HG21   . VAL A 1 133 ? 18.579  -0.580  -52.166 1.00 85.44  ?  137 VAL A HG21   1 
ATOM 2184  H HG22   . VAL A 1 133 ? 18.600  -1.981  -52.916 1.00 85.44  ?  137 VAL A HG22   1 
ATOM 2185  H HG23   . VAL A 1 133 ? 17.251  -1.447  -52.266 1.00 85.44  ?  137 VAL A HG23   1 
ATOM 2186  N N      . LEU A 1 134 ? 18.228  -4.152  -48.502 1.00 48.56  ?  138 LEU A N      1 
ATOM 2187  C CA     . LEU A 1 134 ? 18.683  -4.971  -47.385 1.00 41.85  ?  138 LEU A CA     1 
ATOM 2188  C C      . LEU A 1 134 ? 18.191  -6.405  -47.516 1.00 50.55  ?  138 LEU A C      1 
ATOM 2189  O O      . LEU A 1 134 ? 18.862  -7.336  -47.058 1.00 55.51  ?  138 LEU A O      1 
ATOM 2190  C CB     . LEU A 1 134 ? 18.209  -4.370  -46.061 1.00 41.60  ?  138 LEU A CB     1 
ATOM 2191  C CG     . LEU A 1 134 ? 19.044  -3.257  -45.417 1.00 37.61  ?  138 LEU A CG     1 
ATOM 2192  C CD1    . LEU A 1 134 ? 20.425  -3.759  -45.026 1.00 48.78  ?  138 LEU A CD1    1 
ATOM 2193  C CD2    . LEU A 1 134 ? 19.160  -2.045  -46.316 1.00 60.00  ?  138 LEU A CD2    1 
ATOM 2194  H H      . LEU A 1 134 ? 17.708  -3.503  -48.284 1.00 58.27  ?  138 LEU A H      1 
ATOM 2195  H HA     . LEU A 1 134 ? 19.653  -4.985  -47.378 1.00 50.22  ?  138 LEU A HA     1 
ATOM 2196  H HB2    . LEU A 1 134 ? 17.321  -4.006  -46.203 1.00 49.92  ?  138 LEU A HB2    1 
ATOM 2197  H HB3    . LEU A 1 134 ? 18.154  -5.090  -45.413 1.00 49.92  ?  138 LEU A HB3    1 
ATOM 2198  H HG     . LEU A 1 134 ? 18.598  -2.973  -44.603 1.00 45.13  ?  138 LEU A HG     1 
ATOM 2199  H HD11   . LEU A 1 134 ? 20.923  -3.031  -44.623 1.00 58.53  ?  138 LEU A HD11   1 
ATOM 2200  H HD12   . LEU A 1 134 ? 20.328  -4.486  -44.391 1.00 58.53  ?  138 LEU A HD12   1 
ATOM 2201  H HD13   . LEU A 1 134 ? 20.883  -4.073  -45.821 1.00 58.53  ?  138 LEU A HD13   1 
ATOM 2202  H HD21   . LEU A 1 134 ? 19.694  -1.371  -45.869 1.00 72.00  ?  138 LEU A HD21   1 
ATOM 2203  H HD22   . LEU A 1 134 ? 19.586  -2.309  -47.147 1.00 72.00  ?  138 LEU A HD22   1 
ATOM 2204  H HD23   . LEU A 1 134 ? 18.272  -1.699  -46.495 1.00 72.00  ?  138 LEU A HD23   1 
ATOM 2205  N N      . GLN A 1 135 ? 17.027  -6.604  -48.137 1.00 57.13  ?  139 GLN A N      1 
ATOM 2206  C CA     . GLN A 1 135 ? 16.491  -7.952  -48.290 1.00 49.24  ?  139 GLN A CA     1 
ATOM 2207  C C      . GLN A 1 135 ? 17.353  -8.785  -49.230 1.00 39.68  ?  139 GLN A C      1 
ATOM 2208  O O      . GLN A 1 135 ? 17.632  -9.955  -48.948 1.00 48.19  ?  139 GLN A O      1 
ATOM 2209  C CB     . GLN A 1 135 ? 15.050  -7.883  -48.795 1.00 53.57  ?  139 GLN A CB     1 
ATOM 2210  C CG     . GLN A 1 135 ? 14.313  -9.210  -48.777 1.00 39.51  ?  139 GLN A CG     1 
ATOM 2211  C CD     . GLN A 1 135 ? 12.879  -9.084  -49.253 1.00 43.03  ?  139 GLN A CD     1 
ATOM 2212  O OE1    . GLN A 1 135 ? 12.503  -8.090  -49.872 1.00 60.61  ?  139 GLN A OE1    1 
ATOM 2213  N NE2    . GLN A 1 135 ? 12.069  -10.094 -48.964 1.00 59.71  ?  139 GLN A NE2    1 
ATOM 2214  H H      . GLN A 1 135 ? 16.536  -5.983  -48.473 1.00 68.55  ?  139 GLN A H      1 
ATOM 2215  H HA     . GLN A 1 135 ? 16.484  -8.389  -47.424 1.00 59.08  ?  139 GLN A HA     1 
ATOM 2216  H HB2    . GLN A 1 135 ? 14.555  -7.264  -48.237 1.00 64.28  ?  139 GLN A HB2    1 
ATOM 2217  H HB3    . GLN A 1 135 ? 15.057  -7.563  -49.711 1.00 64.28  ?  139 GLN A HB3    1 
ATOM 2218  H HG2    . GLN A 1 135 ? 14.770  -9.834  -49.362 1.00 47.41  ?  139 GLN A HG2    1 
ATOM 2219  H HG3    . GLN A 1 135 ? 14.299  -9.552  -47.870 1.00 47.41  ?  139 GLN A HG3    1 
ATOM 2220  H HE21   . GLN A 1 135 ? 12.367  -10.773 -48.528 1.00 71.65  ?  139 GLN A HE21   1 
ATOM 2221  H HE22   . GLN A 1 135 ? 11.246  -10.070 -49.212 1.00 71.65  ?  139 GLN A HE22   1 
ATOM 2222  N N      . LEU A 1 136 ? 17.788  -8.203  -50.350 1.00 48.12  ?  140 LEU A N      1 
ATOM 2223  C CA     . LEU A 1 136 ? 18.642  -8.940  -51.276 1.00 44.01  ?  140 LEU A CA     1 
ATOM 2224  C C      . LEU A 1 136 ? 19.938  -9.365  -50.606 1.00 39.99  ?  140 LEU A C      1 
ATOM 2225  O O      . LEU A 1 136 ? 20.446  -10.463 -50.858 1.00 59.26  ?  140 LEU A O      1 
ATOM 2226  C CB     . LEU A 1 136 ? 18.956  -8.092  -52.508 1.00 53.71  ?  140 LEU A CB     1 
ATOM 2227  C CG     . LEU A 1 136 ? 17.806  -7.614  -53.393 1.00 62.90  ?  140 LEU A CG     1 
ATOM 2228  C CD1    . LEU A 1 136 ? 18.360  -7.008  -54.665 1.00 62.74  ?  140 LEU A CD1    1 
ATOM 2229  C CD2    . LEU A 1 136 ? 16.841  -8.730  -53.715 1.00 61.07  ?  140 LEU A CD2    1 
ATOM 2230  H H      . LEU A 1 136 ? 17.606  -7.397  -50.591 1.00 57.74  ?  140 LEU A H      1 
ATOM 2231  H HA     . LEU A 1 136 ? 18.177  -9.739  -51.569 1.00 52.82  ?  140 LEU A HA     1 
ATOM 2232  H HB2    . LEU A 1 136 ? 19.425  -7.298  -52.207 1.00 64.45  ?  140 LEU A HB2    1 
ATOM 2233  H HB3    . LEU A 1 136 ? 19.548  -8.609  -53.077 1.00 64.45  ?  140 LEU A HB3    1 
ATOM 2234  H HG     . LEU A 1 136 ? 17.315  -6.922  -52.923 1.00 75.48  ?  140 LEU A HG     1 
ATOM 2235  H HD11   . LEU A 1 136 ? 17.623  -6.707  -55.219 1.00 75.29  ?  140 LEU A HD11   1 
ATOM 2236  H HD12   . LEU A 1 136 ? 18.929  -6.256  -54.435 1.00 75.29  ?  140 LEU A HD12   1 
ATOM 2237  H HD13   . LEU A 1 136 ? 18.876  -7.681  -55.137 1.00 75.29  ?  140 LEU A HD13   1 
ATOM 2238  H HD21   . LEU A 1 136 ? 16.131  -8.381  -54.276 1.00 73.29  ?  140 LEU A HD21   1 
ATOM 2239  H HD22   . LEU A 1 136 ? 17.317  -9.434  -54.182 1.00 73.29  ?  140 LEU A HD22   1 
ATOM 2240  H HD23   . LEU A 1 136 ? 16.470  -9.075  -52.887 1.00 73.29  ?  140 LEU A HD23   1 
ATOM 2241  N N      . LEU A 1 137 ? 20.494  -8.507  -49.754 1.00 29.40  ?  141 LEU A N      1 
ATOM 2242  C CA     . LEU A 1 137 ? 21.796  -8.794  -49.165 1.00 36.84  ?  141 LEU A CA     1 
ATOM 2243  C C      . LEU A 1 137 ? 21.713  -9.948  -48.175 1.00 40.68  ?  141 LEU A C      1 
ATOM 2244  O O      . LEU A 1 137 ? 22.567  -10.841 -48.183 1.00 55.48  ?  141 LEU A O      1 
ATOM 2245  C CB     . LEU A 1 137 ? 22.344  -7.540  -48.489 1.00 52.63  ?  141 LEU A CB     1 
ATOM 2246  C CG     . LEU A 1 137 ? 22.617  -6.382  -49.450 1.00 46.00  ?  141 LEU A CG     1 
ATOM 2247  C CD1    . LEU A 1 137 ? 22.494  -5.051  -48.739 1.00 49.27  ?  141 LEU A CD1    1 
ATOM 2248  C CD2    . LEU A 1 137 ? 23.992  -6.525  -50.069 1.00 43.47  ?  141 LEU A CD2    1 
ATOM 2249  H H      . LEU A 1 137 ? 20.144  -7.762  -49.504 1.00 35.29  ?  141 LEU A H      1 
ATOM 2250  H HA     . LEU A 1 137 ? 22.412  -9.048  -49.870 1.00 44.20  ?  141 LEU A HA     1 
ATOM 2251  H HB2    . LEU A 1 137 ? 21.700  -7.233  -47.832 1.00 63.16  ?  141 LEU A HB2    1 
ATOM 2252  H HB3    . LEU A 1 137 ? 23.179  -7.763  -48.050 1.00 63.16  ?  141 LEU A HB3    1 
ATOM 2253  H HG     . LEU A 1 137 ? 21.962  -6.402  -50.164 1.00 55.20  ?  141 LEU A HG     1 
ATOM 2254  H HD11   . LEU A 1 137 ? 22.673  -4.338  -49.372 1.00 59.13  ?  141 LEU A HD11   1 
ATOM 2255  H HD12   . LEU A 1 137 ? 21.595  -4.963  -48.387 1.00 59.13  ?  141 LEU A HD12   1 
ATOM 2256  H HD13   . LEU A 1 137 ? 23.139  -5.019  -48.015 1.00 59.13  ?  141 LEU A HD13   1 
ATOM 2257  H HD21   . LEU A 1 137 ? 24.144  -5.782  -50.674 1.00 52.17  ?  141 LEU A HD21   1 
ATOM 2258  H HD22   . LEU A 1 137 ? 24.658  -6.521  -49.364 1.00 52.17  ?  141 LEU A HD22   1 
ATOM 2259  H HD23   . LEU A 1 137 ? 24.032  -7.363  -50.557 1.00 52.17  ?  141 LEU A HD23   1 
ATOM 2260  N N      . ALA A 1 138 ? 20.686  -9.957  -47.325 1.00 43.41  ?  142 ALA A N      1 
ATOM 2261  C CA     . ALA A 1 138 ? 20.577  -11.001 -46.311 1.00 48.77  ?  142 ALA A CA     1 
ATOM 2262  C C      . ALA A 1 138 ? 20.571  -12.390 -46.937 1.00 45.86  ?  142 ALA A C      1 
ATOM 2263  O O      . ALA A 1 138 ? 21.241  -13.304 -46.444 1.00 45.28  ?  142 ALA A O      1 
ATOM 2264  C CB     . ALA A 1 138 ? 19.315  -10.788 -45.477 1.00 62.27  ?  142 ALA A CB     1 
ATOM 2265  H H      . ALA A 1 138 ? 20.049  -9.379  -47.315 1.00 52.09  ?  142 ALA A H      1 
ATOM 2266  H HA     . ALA A 1 138 ? 21.341  -10.944 -45.717 1.00 58.53  ?  142 ALA A HA     1 
ATOM 2267  H HB1    . ALA A 1 138 ? 19.257  -11.488 -44.808 1.00 74.72  ?  142 ALA A HB1    1 
ATOM 2268  H HB2    . ALA A 1 138 ? 19.365  -9.921  -45.045 1.00 74.72  ?  142 ALA A HB2    1 
ATOM 2269  H HB3    . ALA A 1 138 ? 18.541  -10.822 -46.061 1.00 74.72  ?  142 ALA A HB3    1 
ATOM 2270  N N      . VAL A 1 139 ? 19.827  -12.569 -48.030 1.00 45.27  ?  143 VAL A N      1 
ATOM 2271  C CA     . VAL A 1 139 ? 19.653  -13.901 -48.598 1.00 38.42  ?  143 VAL A CA     1 
ATOM 2272  C C      . VAL A 1 139 ? 20.906  -14.347 -49.340 1.00 34.67  ?  143 VAL A C      1 
ATOM 2273  O O      . VAL A 1 139 ? 21.264  -15.528 -49.317 1.00 49.98  ?  143 VAL A O      1 
ATOM 2274  C CB     . VAL A 1 139 ? 18.410  -13.932 -49.506 1.00 36.06  ?  143 VAL A CB     1 
ATOM 2275  C CG1    . VAL A 1 139 ? 17.181  -13.470 -48.735 1.00 42.16  ?  143 VAL A CG1    1 
ATOM 2276  C CG2    . VAL A 1 139 ? 18.613  -13.078 -50.747 1.00 49.36  ?  143 VAL A CG2    1 
ATOM 2277  H H      . VAL A 1 139 ? 19.418  -11.942 -48.454 1.00 54.32  ?  143 VAL A H      1 
ATOM 2278  H HA     . VAL A 1 139 ? 19.503  -14.528 -47.874 1.00 46.11  ?  143 VAL A HA     1 
ATOM 2279  H HB     . VAL A 1 139 ? 18.255  -14.845 -49.794 1.00 43.27  ?  143 VAL A HB     1 
ATOM 2280  H HG11   . VAL A 1 139 ? 16.411  -13.498 -49.324 1.00 50.59  ?  143 VAL A HG11   1 
ATOM 2281  H HG12   . VAL A 1 139 ? 17.042  -14.062 -47.980 1.00 50.59  ?  143 VAL A HG12   1 
ATOM 2282  H HG13   . VAL A 1 139 ? 17.327  -12.563 -48.423 1.00 50.59  ?  143 VAL A HG13   1 
ATOM 2283  H HG21   . VAL A 1 139 ? 17.813  -13.121 -51.294 1.00 59.23  ?  143 VAL A HG21   1 
ATOM 2284  H HG22   . VAL A 1 139 ? 18.780  -12.162 -50.476 1.00 59.23  ?  143 VAL A HG22   1 
ATOM 2285  H HG23   . VAL A 1 139 ? 19.373  -13.420 -51.244 1.00 59.23  ?  143 VAL A HG23   1 
ATOM 2286  N N      . ILE A 1 140 ? 21.599  -13.417 -50.008 1.00 28.83  ?  144 ILE A N      1 
ATOM 2287  C CA     . ILE A 1 140 ? 22.815  -13.760 -50.735 1.00 35.89  ?  144 ILE A CA     1 
ATOM 2288  C C      . ILE A 1 140 ? 24.048  -13.723 -49.848 1.00 44.05  ?  144 ILE A C      1 
ATOM 2289  O O      . ILE A 1 140 ? 25.139  -14.085 -50.305 1.00 48.03  ?  144 ILE A O      1 
ATOM 2290  C CB     . ILE A 1 140 ? 23.036  -12.818 -51.939 1.00 31.53  ?  144 ILE A CB     1 
ATOM 2291  C CG1    . ILE A 1 140 ? 23.452  -11.421 -51.476 1.00 34.23  ?  144 ILE A CG1    1 
ATOM 2292  C CG2    . ILE A 1 140 ? 21.781  -12.725 -52.788 1.00 54.71  ?  144 ILE A CG2    1 
ATOM 2293  C CD1    . ILE A 1 140 ? 24.936  -11.159 -51.589 1.00 43.38  ?  144 ILE A CD1    1 
ATOM 2294  H H      . ILE A 1 140 ? 21.383  -12.586 -50.053 1.00 34.60  ?  144 ILE A H      1 
ATOM 2295  H HA     . ILE A 1 140 ? 22.727  -14.663 -51.079 1.00 43.07  ?  144 ILE A HA     1 
ATOM 2296  H HB     . ILE A 1 140 ? 23.749  -13.183 -52.486 1.00 37.84  ?  144 ILE A HB     1 
ATOM 2297  H HG12   . ILE A 1 140 ? 22.992  -10.762 -52.019 1.00 41.07  ?  144 ILE A HG12   1 
ATOM 2298  H HG13   . ILE A 1 140 ? 23.202  -11.313 -50.545 1.00 41.07  ?  144 ILE A HG13   1 
ATOM 2299  H HG21   . ILE A 1 140 ? 21.949  -12.129 -53.535 1.00 65.66  ?  144 ILE A HG21   1 
ATOM 2300  H HG22   . ILE A 1 140 ? 21.556  -13.610 -53.116 1.00 65.66  ?  144 ILE A HG22   1 
ATOM 2301  H HG23   . ILE A 1 140 ? 21.057  -12.379 -52.244 1.00 65.66  ?  144 ILE A HG23   1 
ATOM 2302  H HD11   . ILE A 1 140 ? 25.122  -10.259 -51.279 1.00 52.06  ?  144 ILE A HD11   1 
ATOM 2303  H HD12   . ILE A 1 140 ? 25.413  -11.803 -51.043 1.00 52.06  ?  144 ILE A HD12   1 
ATOM 2304  H HD13   . ILE A 1 140 ? 25.202  -11.252 -52.518 1.00 52.06  ?  144 ILE A HD13   1 
ATOM 2305  N N      . MET A 1 141 ? 23.907  -13.310 -48.589 1.00 41.70  ?  145 MET A N      1 
ATOM 2306  C CA     . MET A 1 141 ? 25.076  -13.059 -47.753 1.00 46.91  ?  145 MET A CA     1 
ATOM 2307  C C      . MET A 1 141 ? 25.880  -14.333 -47.532 1.00 58.30  ?  145 MET A C      1 
ATOM 2308  O O      . MET A 1 141 ? 27.113  -14.328 -47.627 1.00 66.15  ?  145 MET A O      1 
ATOM 2309  C CB     . MET A 1 141 ? 24.636  -12.461 -46.417 1.00 62.28  ?  145 MET A CB     1 
ATOM 2310  C CG     . MET A 1 141 ? 25.745  -11.776 -45.629 1.00 75.23  ?  145 MET A CG     1 
ATOM 2311  S SD     . MET A 1 141 ? 26.594  -10.455 -46.520 1.00 80.98  ?  145 MET A SD     1 
ATOM 2312  C CE     . MET A 1 141 ? 25.222  -9.487  -47.140 1.00 53.02  ?  145 MET A CE     1 
ATOM 2313  H H      . MET A 1 141 ? 23.153  -13.170 -48.199 1.00 50.04  ?  145 MET A H      1 
ATOM 2314  H HA     . MET A 1 141 ? 25.642  -12.407 -48.197 1.00 56.29  ?  145 MET A HA     1 
ATOM 2315  H HB2    . MET A 1 141 ? 23.946  -11.800 -46.586 1.00 74.73  ?  145 MET A HB2    1 
ATOM 2316  H HB3    . MET A 1 141 ? 24.278  -13.172 -45.863 1.00 74.73  ?  145 MET A HB3    1 
ATOM 2317  H HG2    . MET A 1 141 ? 25.361  -11.389 -44.826 1.00 90.28  ?  145 MET A HG2    1 
ATOM 2318  H HG3    . MET A 1 141 ? 26.408  -12.441 -45.386 1.00 90.28  ?  145 MET A HG3    1 
ATOM 2319  H HE1    . MET A 1 141 ? 25.570  -8.735  -47.646 1.00 63.62  ?  145 MET A HE1    1 
ATOM 2320  H HE2    . MET A 1 141 ? 24.675  -10.046 -47.713 1.00 63.62  ?  145 MET A HE2    1 
ATOM 2321  H HE3    . MET A 1 141 ? 24.697  -9.167  -46.390 1.00 63.62  ?  145 MET A HE3    1 
ATOM 2322  N N      . ASP A 1 142 ? 25.198  -15.440 -47.234 1.00 56.68  ?  146 ASP A N      1 
ATOM 2323  C CA     . ASP A 1 142 ? 25.902  -16.681 -46.935 1.00 65.47  ?  146 ASP A CA     1 
ATOM 2324  C C      . ASP A 1 142 ? 26.716  -17.171 -48.125 1.00 69.53  ?  146 ASP A C      1 
ATOM 2325  O O      . ASP A 1 142 ? 27.758  -17.809 -47.941 1.00 65.36  ?  146 ASP A O      1 
ATOM 2326  C CB     . ASP A 1 142 ? 24.906  -17.757 -46.507 1.00 75.54  ?  146 ASP A CB     1 
ATOM 2327  C CG     . ASP A 1 142 ? 24.076  -17.340 -45.314 1.00 76.67  ?  146 ASP A CG     1 
ATOM 2328  O OD1    . ASP A 1 142 ? 24.585  -17.423 -44.178 1.00 74.28  ?  146 ASP A OD1    1 
ATOM 2329  O OD2    . ASP A 1 142 ? 22.912  -16.933 -45.511 1.00 68.50  -1 146 ASP A OD2    1 
ATOM 2330  H H      . ASP A 1 142 ? 24.340  -15.496 -47.200 1.00 68.01  ?  146 ASP A H      1 
ATOM 2331  H HA     . ASP A 1 142 ? 26.513  -16.527 -46.197 1.00 78.57  ?  146 ASP A HA     1 
ATOM 2332  H HB2    . ASP A 1 142 ? 24.302  -17.941 -47.244 1.00 90.64  ?  146 ASP A HB2    1 
ATOM 2333  H HB3    . ASP A 1 142 ? 25.392  -18.562 -46.268 1.00 90.64  ?  146 ASP A HB3    1 
ATOM 2334  N N      . ASN A 1 143 ? 26.266  -16.880 -49.345 1.00 71.75  ?  147 ASN A N      1 
ATOM 2335  C CA     . ASN A 1 143 ? 26.848  -17.454 -50.550 1.00 57.82  ?  147 ASN A CA     1 
ATOM 2336  C C      . ASN A 1 143 ? 27.761  -16.482 -51.286 1.00 55.63  ?  147 ASN A C      1 
ATOM 2337  O O      . ASN A 1 143 ? 27.992  -16.653 -52.487 1.00 65.85  ?  147 ASN A O      1 
ATOM 2338  C CB     . ASN A 1 143 ? 25.737  -17.936 -51.481 1.00 53.89  ?  147 ASN A CB     1 
ATOM 2339  C CG     . ASN A 1 143 ? 24.639  -18.664 -50.741 1.00 45.19  ?  147 ASN A CG     1 
ATOM 2340  O OD1    . ASN A 1 143 ? 23.455  -18.424 -50.969 1.00 53.07  ?  147 ASN A OD1    1 
ATOM 2341  N ND2    . ASN A 1 143 ? 25.028  -19.552 -49.837 1.00 38.45  ?  147 ASN A ND2    1 
ATOM 2342  H H      . ASN A 1 143 ? 25.614  -16.342 -49.501 1.00 86.10  ?  147 ASN A H      1 
ATOM 2343  H HA     . ASN A 1 143 ? 27.380  -18.226 -50.300 1.00 69.39  ?  147 ASN A HA     1 
ATOM 2344  H HB2    . ASN A 1 143 ? 25.343  -17.171 -51.928 1.00 64.67  ?  147 ASN A HB2    1 
ATOM 2345  H HB3    . ASN A 1 143 ? 26.114  -18.545 -52.136 1.00 64.67  ?  147 ASN A HB3    1 
ATOM 2346  H HD21   . ASN A 1 143 ? 24.441  -19.993 -49.388 1.00 46.13  ?  147 ASN A HD21   1 
ATOM 2347  H HD22   . ASN A 1 143 ? 25.866  -19.687 -49.699 1.00 46.13  ?  147 ASN A HD22   1 
ATOM 2348  N N      . ILE A 1 144 ? 28.286  -15.469 -50.598 1.00 62.95  ?  148 ILE A N      1 
ATOM 2349  C CA     . ILE A 1 144 ? 29.197  -14.541 -51.259 1.00 58.79  ?  148 ILE A CA     1 
ATOM 2350  C C      . ILE A 1 144 ? 30.579  -15.157 -51.417 1.00 42.84  ?  148 ILE A C      1 
ATOM 2351  O O      . ILE A 1 144 ? 31.302  -14.829 -52.363 1.00 28.56  ?  148 ILE A O      1 
ATOM 2352  C CB     . ILE A 1 144 ? 29.285  -13.214 -50.490 1.00 63.26  ?  148 ILE A CB     1 
ATOM 2353  C CG1    . ILE A 1 144 ? 27.897  -12.615 -50.281 1.00 56.75  ?  148 ILE A CG1    1 
ATOM 2354  C CG2    . ILE A 1 144 ? 30.147  -12.231 -51.258 1.00 64.68  ?  148 ILE A CG2    1 
ATOM 2355  C CD1    . ILE A 1 144 ? 27.890  -11.425 -49.351 1.00 68.12  ?  148 ILE A CD1    1 
ATOM 2356  H H      . ILE A 1 144 ? 28.135  -15.301 -49.768 1.00 75.54  ?  148 ILE A H      1 
ATOM 2357  H HA     . ILE A 1 144 ? 28.856  -14.348 -52.146 1.00 70.54  ?  148 ILE A HA     1 
ATOM 2358  H HB     . ILE A 1 144 ? 29.690  -13.378 -49.625 1.00 75.91  ?  148 ILE A HB     1 
ATOM 2359  H HG12   . ILE A 1 144 ? 27.547  -12.325 -51.138 1.00 68.10  ?  148 ILE A HG12   1 
ATOM 2360  H HG13   . ILE A 1 144 ? 27.317  -13.293 -49.901 1.00 68.10  ?  148 ILE A HG13   1 
ATOM 2361  H HG21   . ILE A 1 144 ? 30.194  -11.398 -50.763 1.00 77.62  ?  148 ILE A HG21   1 
ATOM 2362  H HG22   . ILE A 1 144 ? 31.036  -12.605 -51.362 1.00 77.62  ?  148 ILE A HG22   1 
ATOM 2363  H HG23   . ILE A 1 144 ? 29.749  -12.076 -52.129 1.00 77.62  ?  148 ILE A HG23   1 
ATOM 2364  H HD11   . ILE A 1 144 ? 26.981  -11.098 -49.265 1.00 81.75  ?  148 ILE A HD11   1 
ATOM 2365  H HD12   . ILE A 1 144 ? 28.227  -11.701 -48.484 1.00 81.75  ?  148 ILE A HD12   1 
ATOM 2366  H HD13   . ILE A 1 144 ? 28.458  -10.732 -49.722 1.00 81.75  ?  148 ILE A HD13   1 
ATOM 2367  N N      . GLY A 1 145 ? 30.975  -16.037 -50.508 1.00 56.36  ?  149 GLY A N      1 
ATOM 2368  C CA     . GLY A 1 145 ? 32.317  -16.589 -50.574 1.00 74.54  ?  149 GLY A CA     1 
ATOM 2369  C C      . GLY A 1 145 ? 33.331  -15.555 -50.127 1.00 53.72  ?  149 GLY A C      1 
ATOM 2370  O O      . GLY A 1 145 ? 33.194  -14.938 -49.065 1.00 50.20  ?  149 GLY A O      1 
ATOM 2371  H H      . GLY A 1 145 ? 30.496  -16.327 -49.855 1.00 67.63  ?  149 GLY A H      1 
ATOM 2372  H HA2    . GLY A 1 145 ? 32.384  -17.365 -49.996 1.00 89.45  ?  149 GLY A HA2    1 
ATOM 2373  H HA3    . GLY A 1 145 ? 32.521  -16.856 -51.484 1.00 89.45  ?  149 GLY A HA3    1 
ATOM 2374  N N      . GLU A 1 146 ? 34.361  -15.357 -50.942 1.00 43.43  ?  150 GLU A N      1 
ATOM 2375  C CA     . GLU A 1 146 ? 35.394  -14.377 -50.651 1.00 51.61  ?  150 GLU A CA     1 
ATOM 2376  C C      . GLU A 1 146 ? 35.081  -13.055 -51.336 1.00 69.86  ?  150 GLU A C      1 
ATOM 2377  O O      . GLU A 1 146 ? 34.452  -13.014 -52.397 1.00 72.74  ?  150 GLU A O      1 
ATOM 2378  C CB     . GLU A 1 146 ? 36.764  -14.879 -51.105 1.00 62.30  ?  150 GLU A CB     1 
ATOM 2379  C CG     . GLU A 1 146 ? 37.446  -15.796 -50.109 1.00 58.16  ?  150 GLU A CG     1 
ATOM 2380  C CD     . GLU A 1 146 ? 38.828  -16.219 -50.563 1.00 77.94  ?  150 GLU A CD     1 
ATOM 2381  O OE1    . GLU A 1 146 ? 39.419  -15.514 -51.407 1.00 71.07  ?  150 GLU A OE1    1 
ATOM 2382  O OE2    . GLU A 1 146 ? 39.321  -17.259 -50.080 1.00 103.16 -1 150 GLU A OE2    1 
ATOM 2383  H H      . GLU A 1 146 ? 34.483  -15.784 -51.678 1.00 52.12  ?  150 GLU A H      1 
ATOM 2384  H HA     . GLU A 1 146 ? 35.429  -14.223 -49.694 1.00 61.93  ?  150 GLU A HA     1 
ATOM 2385  H HB2    . GLU A 1 146 ? 36.657  -15.371 -51.934 1.00 74.76  ?  150 GLU A HB2    1 
ATOM 2386  H HB3    . GLU A 1 146 ? 37.344  -14.115 -51.249 1.00 74.76  ?  150 GLU A HB3    1 
ATOM 2387  H HG2    . GLU A 1 146 ? 37.537  -15.333 -49.262 1.00 69.79  ?  150 GLU A HG2    1 
ATOM 2388  H HG3    . GLU A 1 146 ? 36.909  -16.596 -49.995 1.00 69.79  ?  150 GLU A HG3    1 
ATOM 2389  N N      . ILE A 1 147 ? 35.531  -11.969 -50.713 1.00 78.64  ?  151 ILE A N      1 
ATOM 2390  C CA     . ILE A 1 147 ? 35.322  -10.624 -51.228 1.00 68.25  ?  151 ILE A CA     1 
ATOM 2391  C C      . ILE A 1 147 ? 36.572  -9.801  -50.961 1.00 65.70  ?  151 ILE A C      1 
ATOM 2392  O O      . ILE A 1 147 ? 37.347  -10.092 -50.045 1.00 68.30  ?  151 ILE A O      1 
ATOM 2393  C CB     . ILE A 1 147 ? 34.090  -9.946  -50.591 1.00 53.71  ?  151 ILE A CB     1 
ATOM 2394  C CG1    . ILE A 1 147 ? 34.197  -9.985  -49.063 1.00 44.24  ?  151 ILE A CG1    1 
ATOM 2395  C CG2    . ILE A 1 147 ? 32.826  -10.624 -51.067 1.00 62.29  ?  151 ILE A CG2    1 
ATOM 2396  C CD1    . ILE A 1 147 ? 33.073  -9.273  -48.337 1.00 42.60  ?  151 ILE A CD1    1 
ATOM 2397  H H      . ILE A 1 147 ? 35.969  -11.989 -49.973 1.00 94.37  ?  151 ILE A H      1 
ATOM 2398  H HA     . ILE A 1 147 ? 35.184  -10.666 -52.187 1.00 81.90  ?  151 ILE A HA     1 
ATOM 2399  H HB     . ILE A 1 147 ? 34.067  -9.019  -50.874 1.00 64.45  ?  151 ILE A HB     1 
ATOM 2400  H HG12   . ILE A 1 147 ? 34.192  -10.911 -48.775 1.00 53.09  ?  151 ILE A HG12   1 
ATOM 2401  H HG13   . ILE A 1 147 ? 35.030  -9.565  -48.799 1.00 53.09  ?  151 ILE A HG13   1 
ATOM 2402  H HG21   . ILE A 1 147 ? 32.061  -10.188 -50.659 1.00 74.75  ?  151 ILE A HG21   1 
ATOM 2403  H HG22   . ILE A 1 147 ? 32.772  -10.550 -52.033 1.00 74.75  ?  151 ILE A HG22   1 
ATOM 2404  H HG23   . ILE A 1 147 ? 32.852  -11.558 -50.807 1.00 74.75  ?  151 ILE A HG23   1 
ATOM 2405  H HD11   . ILE A 1 147 ? 33.218  -9.346  -47.381 1.00 51.12  ?  151 ILE A HD11   1 
ATOM 2406  H HD12   . ILE A 1 147 ? 33.069  -8.339  -48.601 1.00 51.12  ?  151 ILE A HD12   1 
ATOM 2407  H HD13   . ILE A 1 147 ? 32.229  -9.688  -48.577 1.00 51.12  ?  151 ILE A HD13   1 
ATOM 2408  N N      . ASP A 1 148 ? 36.769  -8.771  -51.776 1.00 76.44  ?  152 ASP A N      1 
ATOM 2409  C CA     . ASP A 1 148 ? 37.833  -7.819  -51.515 1.00 78.95  ?  152 ASP A CA     1 
ATOM 2410  C C      . ASP A 1 148 ? 37.623  -7.165  -50.153 1.00 64.66  ?  152 ASP A C      1 
ATOM 2411  O O      . ASP A 1 148 ? 36.510  -7.107  -49.625 1.00 65.37  ?  152 ASP A O      1 
ATOM 2412  C CB     . ASP A 1 148 ? 37.877  -6.753  -52.608 1.00 94.75  ?  152 ASP A CB     1 
ATOM 2413  C CG     . ASP A 1 148 ? 39.116  -5.886  -52.526 1.00 80.91  ?  152 ASP A CG     1 
ATOM 2414  O OD1    . ASP A 1 148 ? 39.801  -5.918  -51.481 1.00 80.82  ?  152 ASP A OD1    1 
ATOM 2415  O OD2    . ASP A 1 148 ? 39.406  -5.169  -53.506 1.00 78.57  -1 152 ASP A OD2    1 
ATOM 2416  H H      . ASP A 1 148 ? 36.304  -8.605  -52.480 1.00 91.73  ?  152 ASP A H      1 
ATOM 2417  H HA     . ASP A 1 148 ? 38.685  -8.282  -51.505 1.00 94.75  ?  152 ASP A HA     1 
ATOM 2418  H HB2    . ASP A 1 148 ? 37.871  -7.188  -53.475 1.00 113.70 ?  152 ASP A HB2    1 
ATOM 2419  H HB3    . ASP A 1 148 ? 37.101  -6.177  -52.519 1.00 113.70 ?  152 ASP A HB3    1 
ATOM 2420  N N      . GLU A 1 149 ? 38.717  -6.663  -49.583 1.00 76.12  ?  153 GLU A N      1 
ATOM 2421  C CA     . GLU A 1 149 ? 38.639  -6.055  -48.261 1.00 75.60  ?  153 GLU A CA     1 
ATOM 2422  C C      . GLU A 1 149 ? 37.797  -4.787  -48.287 1.00 62.94  ?  153 GLU A C      1 
ATOM 2423  O O      . GLU A 1 149 ? 36.991  -4.552  -47.380 1.00 64.93  ?  153 GLU A O      1 
ATOM 2424  C CB     . GLU A 1 149 ? 40.043  -5.753  -47.742 1.00 76.89  ?  153 GLU A CB     1 
ATOM 2425  C CG     . GLU A 1 149 ? 40.070  -5.133  -46.356 1.00 82.10  ?  153 GLU A CG     1 
ATOM 2426  C CD     . GLU A 1 149 ? 41.472  -4.790  -45.904 1.00 102.59 ?  153 GLU A CD     1 
ATOM 2427  O OE1    . GLU A 1 149 ? 41.612  -4.065  -44.896 1.00 110.77 ?  153 GLU A OE1    1 
ATOM 2428  O OE2    . GLU A 1 149 ? 42.435  -5.241  -46.558 1.00 103.89 -1 153 GLU A OE2    1 
ATOM 2429  H H      . GLU A 1 149 ? 39.502  -6.663  -49.935 1.00 91.34  ?  153 GLU A H      1 
ATOM 2430  H HA     . GLU A 1 149 ? 38.221  -6.681  -47.649 1.00 90.72  ?  153 GLU A HA     1 
ATOM 2431  H HB2    . GLU A 1 149 ? 40.546  -6.581  -47.705 1.00 92.27  ?  153 GLU A HB2    1 
ATOM 2432  H HB3    . GLU A 1 149 ? 40.474  -5.134  -48.351 1.00 92.27  ?  153 GLU A HB3    1 
ATOM 2433  H HG2    . GLU A 1 149 ? 39.547  -4.316  -46.364 1.00 98.52  ?  153 GLU A HG2    1 
ATOM 2434  H HG3    . GLU A 1 149 ? 39.694  -5.762  -45.720 1.00 98.52  ?  153 GLU A HG3    1 
ATOM 2435  N N      . SER A 1 150 ? 37.967  -3.959  -49.319 1.00 58.79  ?  154 SER A N      1 
ATOM 2436  C CA     . SER A 1 150 ? 37.256  -2.686  -49.371 1.00 47.43  ?  154 SER A CA     1 
ATOM 2437  C C      . SER A 1 150 ? 35.749  -2.899  -49.310 1.00 52.24  ?  154 SER A C      1 
ATOM 2438  O O      . SER A 1 150 ? 35.050  -2.250  -48.524 1.00 73.04  ?  154 SER A O      1 
ATOM 2439  C CB     . SER A 1 150 ? 37.646  -1.923  -50.636 1.00 52.98  ?  154 SER A CB     1 
ATOM 2440  O OG     . SER A 1 150 ? 37.251  -2.623  -51.802 1.00 75.75  ?  154 SER A OG     1 
ATOM 2441  H H      . SER A 1 150 ? 38.481  -4.110  -49.991 1.00 70.55  ?  154 SER A H      1 
ATOM 2442  H HA     . SER A 1 150 ? 37.514  -2.149  -48.606 1.00 56.92  ?  154 SER A HA     1 
ATOM 2443  H HB2    . SER A 1 150 ? 37.210  -1.056  -50.628 1.00 63.58  ?  154 SER A HB2    1 
ATOM 2444  H HB3    . SER A 1 150 ? 38.609  -1.808  -50.650 1.00 63.58  ?  154 SER A HB3    1 
ATOM 2445  H HG     . SER A 1 150 ? 37.473  -2.190  -52.486 1.00 90.89  ?  154 SER A HG     1 
ATOM 2446  N N      . LEU A 1 151 ? 35.228  -3.814  -50.130 1.00 54.16  ?  155 LEU A N      1 
ATOM 2447  C CA     . LEU A 1 151 ? 33.793  -4.071  -50.119 1.00 54.90  ?  155 LEU A CA     1 
ATOM 2448  C C      . LEU A 1 151 ? 33.329  -4.561  -48.756 1.00 51.32  ?  155 LEU A C      1 
ATOM 2449  O O      . LEU A 1 151 ? 32.195  -4.286  -48.350 1.00 51.18  ?  155 LEU A O      1 
ATOM 2450  C CB     . LEU A 1 151 ? 33.430  -5.090  -51.199 1.00 64.13  ?  155 LEU A CB     1 
ATOM 2451  C CG     . LEU A 1 151 ? 31.951  -5.476  -51.289 1.00 51.10  ?  155 LEU A CG     1 
ATOM 2452  C CD1    . LEU A 1 151 ? 31.065  -4.254  -51.460 1.00 55.35  ?  155 LEU A CD1    1 
ATOM 2453  C CD2    . LEU A 1 151 ? 31.727  -6.453  -52.430 1.00 62.90  ?  155 LEU A CD2    1 
ATOM 2454  H H      . LEU A 1 151 ? 35.676  -4.289  -50.691 1.00 64.99  ?  155 LEU A H      1 
ATOM 2455  H HA     . LEU A 1 151 ? 33.323  -3.246  -50.316 1.00 65.88  ?  155 LEU A HA     1 
ATOM 2456  H HB2    . LEU A 1 151 ? 33.686  -4.725  -52.060 1.00 76.95  ?  155 LEU A HB2    1 
ATOM 2457  H HB3    . LEU A 1 151 ? 33.931  -5.903  -51.031 1.00 76.95  ?  155 LEU A HB3    1 
ATOM 2458  H HG     . LEU A 1 151 ? 31.691  -5.917  -50.465 1.00 61.32  ?  155 LEU A HG     1 
ATOM 2459  H HD11   . LEU A 1 151 ? 30.140  -4.540  -51.513 1.00 66.42  ?  155 LEU A HD11   1 
ATOM 2460  H HD12   . LEU A 1 151 ? 31.187  -3.667  -50.698 1.00 66.42  ?  155 LEU A HD12   1 
ATOM 2461  H HD13   . LEU A 1 151 ? 31.317  -3.795  -52.277 1.00 66.42  ?  155 LEU A HD13   1 
ATOM 2462  H HD21   . LEU A 1 151 ? 30.785  -6.683  -52.468 1.00 75.48  ?  155 LEU A HD21   1 
ATOM 2463  H HD22   . LEU A 1 151 ? 31.999  -6.033  -53.262 1.00 75.48  ?  155 LEU A HD22   1 
ATOM 2464  H HD23   . LEU A 1 151 ? 32.256  -7.250  -52.272 1.00 75.48  ?  155 LEU A HD23   1 
ATOM 2465  N N      . PHE A 1 152 ? 34.184  -5.289  -48.037 1.00 53.12  ?  156 PHE A N      1 
ATOM 2466  C CA     . PHE A 1 152 ? 33.829  -5.718  -46.691 1.00 62.67  ?  156 PHE A CA     1 
ATOM 2467  C C      . PHE A 1 152 ? 33.626  -4.518  -45.777 1.00 59.08  ?  156 PHE A C      1 
ATOM 2468  O O      . PHE A 1 152 ? 32.674  -4.481  -44.989 1.00 58.45  ?  156 PHE A O      1 
ATOM 2469  C CB     . PHE A 1 152 ? 34.911  -6.645  -46.135 1.00 53.25  ?  156 PHE A CB     1 
ATOM 2470  C CG     . PHE A 1 152 ? 34.636  -7.131  -44.743 1.00 42.04  ?  156 PHE A CG     1 
ATOM 2471  C CD1    . PHE A 1 152 ? 35.340  -6.623  -43.666 1.00 48.32  ?  156 PHE A CD1    1 
ATOM 2472  C CD2    . PHE A 1 152 ? 33.669  -8.093  -44.510 1.00 50.43  ?  156 PHE A CD2    1 
ATOM 2473  C CE1    . PHE A 1 152 ? 35.088  -7.067  -42.384 1.00 51.14  ?  156 PHE A CE1    1 
ATOM 2474  C CE2    . PHE A 1 152 ? 33.412  -8.540  -43.231 1.00 68.27  ?  156 PHE A CE2    1 
ATOM 2475  C CZ     . PHE A 1 152 ? 34.122  -8.027  -42.167 1.00 74.89  ?  156 PHE A CZ     1 
ATOM 2476  H H      . PHE A 1 152 ? 34.962  -5.542  -48.303 1.00 63.74  ?  156 PHE A H      1 
ATOM 2477  H HA     . PHE A 1 152 ? 32.997  -6.215  -46.725 1.00 75.20  ?  156 PHE A HA     1 
ATOM 2478  H HB2    . PHE A 1 152 ? 34.983  -7.422  -46.711 1.00 63.90  ?  156 PHE A HB2    1 
ATOM 2479  H HB3    . PHE A 1 152 ? 35.755  -6.167  -46.121 1.00 63.90  ?  156 PHE A HB3    1 
ATOM 2480  H HD1    . PHE A 1 152 ? 35.993  -5.975  -43.807 1.00 57.98  ?  156 PHE A HD1    1 
ATOM 2481  H HD2    . PHE A 1 152 ? 33.187  -8.442  -45.225 1.00 60.52  ?  156 PHE A HD2    1 
ATOM 2482  H HE1    . PHE A 1 152 ? 35.568  -6.719  -41.667 1.00 61.37  ?  156 PHE A HE1    1 
ATOM 2483  H HE2    . PHE A 1 152 ? 32.760  -9.188  -43.086 1.00 81.93  ?  156 PHE A HE2    1 
ATOM 2484  H HZ     . PHE A 1 152 ? 33.950  -8.327  -41.304 1.00 89.87  ?  156 PHE A HZ     1 
ATOM 2485  N N      . ASN A 1 153 ? 34.504  -3.520  -45.878 1.00 61.32  ?  157 ASN A N      1 
ATOM 2486  C CA     . ASN A 1 153 ? 34.355  -2.319  -45.065 1.00 61.84  ?  157 ASN A CA     1 
ATOM 2487  C C      . ASN A 1 153 ? 33.128  -1.516  -45.474 1.00 54.54  ?  157 ASN A C      1 
ATOM 2488  O O      . ASN A 1 153 ? 32.486  -0.893  -44.621 1.00 55.04  ?  157 ASN A O      1 
ATOM 2489  C CB     . ASN A 1 153 ? 35.611  -1.458  -45.175 1.00 58.02  ?  157 ASN A CB     1 
ATOM 2490  C CG     . ASN A 1 153 ? 36.862  -2.200  -44.758 1.00 43.18  ?  157 ASN A CG     1 
ATOM 2491  O OD1    . ASN A 1 153 ? 36.829  -3.033  -43.855 1.00 44.59  ?  157 ASN A OD1    1 
ATOM 2492  N ND2    . ASN A 1 153 ? 37.973  -1.905  -45.419 1.00 53.15  ?  157 ASN A ND2    1 
ATOM 2493  H H      . ASN A 1 153 ? 35.186  -3.515  -46.402 1.00 73.58  ?  157 ASN A H      1 
ATOM 2494  H HA     . ASN A 1 153 ? 34.249  -2.578  -44.136 1.00 74.20  ?  157 ASN A HA     1 
ATOM 2495  H HB2    . ASN A 1 153 ? 35.722  -1.175  -46.096 1.00 69.62  ?  157 ASN A HB2    1 
ATOM 2496  H HB3    . ASN A 1 153 ? 35.515  -0.683  -44.599 1.00 69.62  ?  157 ASN A HB3    1 
ATOM 2497  H HD21   . ASN A 1 153 ? 38.710  -2.300  -45.219 1.00 63.78  ?  157 ASN A HD21   1 
ATOM 2498  H HD22   . ASN A 1 153 ? 37.956  -1.318  -46.047 1.00 63.78  ?  157 ASN A HD22   1 
ATOM 2499  N N      . LEU A 1 154 ? 32.789  -1.515  -46.763 1.00 51.91  ?  158 LEU A N      1 
ATOM 2500  C CA     . LEU A 1 154 ? 31.629  -0.768  -47.230 1.00 48.27  ?  158 LEU A CA     1 
ATOM 2501  C C      . LEU A 1 154 ? 30.314  -1.406  -46.801 1.00 58.94  ?  158 LEU A C      1 
ATOM 2502  O O      . LEU A 1 154 ? 29.302  -0.703  -46.716 1.00 57.71  ?  158 LEU A O      1 
ATOM 2503  C CB     . LEU A 1 154 ? 31.671  -0.643  -48.753 1.00 54.44  ?  158 LEU A CB     1 
ATOM 2504  C CG     . LEU A 1 154 ? 30.522  0.116   -49.420 1.00 72.23  ?  158 LEU A CG     1 
ATOM 2505  C CD1    . LEU A 1 154 ? 30.393  1.516   -48.848 1.00 88.84  ?  158 LEU A CD1    1 
ATOM 2506  C CD2    . LEU A 1 154 ? 30.728  0.174   -50.925 1.00 77.32  ?  158 LEU A CD2    1 
ATOM 2507  H H      . LEU A 1 154 ? 33.214  -1.936  -47.382 1.00 62.29  ?  158 LEU A H      1 
ATOM 2508  H HA     . LEU A 1 154 ? 31.661  0.126   -46.857 1.00 57.92  ?  158 LEU A HA     1 
ATOM 2509  H HB2    . LEU A 1 154 ? 32.492  -0.187  -48.996 1.00 65.32  ?  158 LEU A HB2    1 
ATOM 2510  H HB3    . LEU A 1 154 ? 31.679  -1.537  -49.130 1.00 65.32  ?  158 LEU A HB3    1 
ATOM 2511  H HG     . LEU A 1 154 ? 29.691  -0.355  -49.249 1.00 86.67  ?  158 LEU A HG     1 
ATOM 2512  H HD11   . LEU A 1 154 ? 29.658  1.970   -49.290 1.00 106.61 ?  158 LEU A HD11   1 
ATOM 2513  H HD12   . LEU A 1 154 ? 30.219  1.453   -47.896 1.00 106.61 ?  158 LEU A HD12   1 
ATOM 2514  H HD13   . LEU A 1 154 ? 31.220  1.997   -49.003 1.00 106.61 ?  158 LEU A HD13   1 
ATOM 2515  H HD21   . LEU A 1 154 ? 29.990  0.659   -51.326 1.00 92.78  ?  158 LEU A HD21   1 
ATOM 2516  H HD22   . LEU A 1 154 ? 31.564  0.631   -51.111 1.00 92.78  ?  158 LEU A HD22   1 
ATOM 2517  H HD23   . LEU A 1 154 ? 30.760  -0.730  -51.274 1.00 92.78  ?  158 LEU A HD23   1 
ATOM 2518  N N      . LEU A 1 155 ? 30.305  -2.711  -46.529 1.00 57.62  ?  159 LEU A N      1 
ATOM 2519  C CA     . LEU A 1 155 ? 29.084  -3.373  -46.081 1.00 45.15  ?  159 LEU A CA     1 
ATOM 2520  C C      . LEU A 1 155 ? 28.838  -3.124  -44.601 1.00 49.90  ?  159 LEU A C      1 
ATOM 2521  O O      . LEU A 1 155 ? 27.725  -2.766  -44.201 1.00 64.31  ?  159 LEU A O      1 
ATOM 2522  C CB     . LEU A 1 155 ? 29.167  -4.873  -46.364 1.00 43.81  ?  159 LEU A CB     1 
ATOM 2523  C CG     . LEU A 1 155 ? 28.918  -5.312  -47.806 1.00 54.27  ?  159 LEU A CG     1 
ATOM 2524  C CD1    . LEU A 1 155 ? 29.299  -6.768  -47.981 1.00 71.73  ?  159 LEU A CD1    1 
ATOM 2525  C CD2    . LEU A 1 155 ? 27.466  -5.100  -48.183 1.00 40.18  ?  159 LEU A CD2    1 
ATOM 2526  H H      . LEU A 1 155 ? 30.987  -3.231  -46.595 1.00 69.15  ?  159 LEU A H      1 
ATOM 2527  H HA     . LEU A 1 155 ? 28.331  -3.015  -46.576 1.00 54.18  ?  159 LEU A HA     1 
ATOM 2528  H HB2    . LEU A 1 155 ? 30.054  -5.179  -46.119 1.00 52.57  ?  159 LEU A HB2    1 
ATOM 2529  H HB3    . LEU A 1 155 ? 28.509  -5.322  -45.810 1.00 52.57  ?  159 LEU A HB3    1 
ATOM 2530  H HG     . LEU A 1 155 ? 29.468  -4.780  -48.402 1.00 65.12  ?  159 LEU A HG     1 
ATOM 2531  H HD11   . LEU A 1 155 ? 29.135  -7.028  -48.901 1.00 86.08  ?  159 LEU A HD11   1 
ATOM 2532  H HD12   . LEU A 1 155 ? 30.240  -6.875  -47.769 1.00 86.08  ?  159 LEU A HD12   1 
ATOM 2533  H HD13   . LEU A 1 155 ? 28.761  -7.309  -47.383 1.00 86.08  ?  159 LEU A HD13   1 
ATOM 2534  H HD21   . LEU A 1 155 ? 27.333  -5.385  -49.101 1.00 48.22  ?  159 LEU A HD21   1 
ATOM 2535  H HD22   . LEU A 1 155 ? 26.906  -5.624  -47.590 1.00 48.22  ?  159 LEU A HD22   1 
ATOM 2536  H HD23   . LEU A 1 155 ? 27.251  -4.158  -48.095 1.00 48.22  ?  159 LEU A HD23   1 
ATOM 2537  N N      . ILE A 1 156 ? 29.863  -3.314  -43.770 1.00 52.95  ?  160 ILE A N      1 
ATOM 2538  C CA     . ILE A 1 156 ? 29.701  -3.052  -42.346 1.00 51.42  ?  160 ILE A CA     1 
ATOM 2539  C C      . ILE A 1 156 ? 29.446  -1.572  -42.104 1.00 62.39  ?  160 ILE A C      1 
ATOM 2540  O O      . ILE A 1 156 ? 28.707  -1.203  -41.183 1.00 62.19  ?  160 ILE A O      1 
ATOM 2541  C CB     . ILE A 1 156 ? 30.931  -3.552  -41.567 1.00 60.06  ?  160 ILE A CB     1 
ATOM 2542  C CG1    . ILE A 1 156 ? 32.198  -2.836  -42.045 1.00 67.78  ?  160 ILE A CG1    1 
ATOM 2543  C CG2    . ILE A 1 156 ? 31.068  -5.056  -41.734 1.00 76.80  ?  160 ILE A CG2    1 
ATOM 2544  C CD1    . ILE A 1 156 ? 33.427  -3.144  -41.219 1.00 72.05  ?  160 ILE A CD1    1 
ATOM 2545  H H      . ILE A 1 156 ? 30.645  -3.587  -44.002 1.00 63.54  ?  160 ILE A H      1 
ATOM 2546  H HA     . ILE A 1 156 ? 28.928  -3.542  -42.024 1.00 61.71  ?  160 ILE A HA     1 
ATOM 2547  H HB     . ILE A 1 156 ? 30.801  -3.355  -40.626 1.00 72.08  ?  160 ILE A HB     1 
ATOM 2548  H HG12   . ILE A 1 156 ? 32.381  -3.104  -42.959 1.00 81.34  ?  160 ILE A HG12   1 
ATOM 2549  H HG13   . ILE A 1 156 ? 32.048  -1.879  -42.007 1.00 81.34  ?  160 ILE A HG13   1 
ATOM 2550  H HG21   . ILE A 1 156 ? 31.846  -5.358  -41.239 1.00 92.16  ?  160 ILE A HG21   1 
ATOM 2551  H HG22   . ILE A 1 156 ? 30.270  -5.486  -41.390 1.00 92.16  ?  160 ILE A HG22   1 
ATOM 2552  H HG23   . ILE A 1 156 ? 31.175  -5.261  -42.676 1.00 92.16  ?  160 ILE A HG23   1 
ATOM 2553  H HD11   . ILE A 1 156 ? 34.182  -2.656  -41.583 1.00 86.46  ?  160 ILE A HD11   1 
ATOM 2554  H HD12   . ILE A 1 156 ? 33.267  -2.871  -40.302 1.00 86.46  ?  160 ILE A HD12   1 
ATOM 2555  H HD13   . ILE A 1 156 ? 33.601  -4.098  -41.255 1.00 86.46  ?  160 ILE A HD13   1 
ATOM 2556  N N      . LEU A 1 157 ? 30.042  -0.702  -42.919 1.00 53.90  ?  161 LEU A N      1 
ATOM 2557  C CA     . LEU A 1 157 ? 29.803  0.729   -42.777 1.00 36.86  ?  161 LEU A CA     1 
ATOM 2558  C C      . LEU A 1 157 ? 28.338  1.058   -43.027 1.00 40.68  ?  161 LEU A C      1 
ATOM 2559  O O      . LEU A 1 157 ? 27.699  1.750   -42.228 1.00 52.71  ?  161 LEU A O      1 
ATOM 2560  C CB     . LEU A 1 157 ? 30.702  1.501   -43.740 1.00 50.37  ?  161 LEU A CB     1 
ATOM 2561  C CG     . LEU A 1 157 ? 30.699  3.022   -43.594 1.00 54.85  ?  161 LEU A CG     1 
ATOM 2562  C CD1    . LEU A 1 157 ? 31.547  3.442   -42.406 1.00 69.14  ?  161 LEU A CD1    1 
ATOM 2563  C CD2    . LEU A 1 157 ? 31.190  3.683   -44.870 1.00 52.06  ?  161 LEU A CD2    1 
ATOM 2564  H H      . LEU A 1 157 ? 30.582  -0.913  -43.555 1.00 64.69  ?  161 LEU A H      1 
ATOM 2565  H HA     . LEU A 1 157 ? 30.024  1.000   -41.873 1.00 44.23  ?  161 LEU A HA     1 
ATOM 2566  H HB2    . LEU A 1 157 ? 31.616  1.201   -43.610 1.00 60.45  ?  161 LEU A HB2    1 
ATOM 2567  H HB3    . LEU A 1 157 ? 30.423  1.298   -44.647 1.00 60.45  ?  161 LEU A HB3    1 
ATOM 2568  H HG     . LEU A 1 157 ? 29.790  3.321   -43.433 1.00 65.82  ?  161 LEU A HG     1 
ATOM 2569  H HD11   . LEU A 1 157 ? 31.530  4.410   -42.333 1.00 82.96  ?  161 LEU A HD11   1 
ATOM 2570  H HD12   . LEU A 1 157 ? 31.181  3.043   -41.601 1.00 82.96  ?  161 LEU A HD12   1 
ATOM 2571  H HD13   . LEU A 1 157 ? 32.457  3.136   -42.543 1.00 82.96  ?  161 LEU A HD13   1 
ATOM 2572  H HD21   . LEU A 1 157 ? 31.178  4.646   -44.751 1.00 62.47  ?  161 LEU A HD21   1 
ATOM 2573  H HD22   . LEU A 1 157 ? 32.094  3.383   -45.053 1.00 62.47  ?  161 LEU A HD22   1 
ATOM 2574  H HD23   . LEU A 1 157 ? 30.603  3.433   -45.601 1.00 62.47  ?  161 LEU A HD23   1 
ATOM 2575  N N      . SER A 1 158 ? 27.786  0.562   -44.134 1.00 46.83  ?  162 SER A N      1 
ATOM 2576  C CA     . SER A 1 158 ? 26.393  0.842   -44.454 1.00 50.53  ?  162 SER A CA     1 
ATOM 2577  C C      . SER A 1 158 ? 25.449  0.204   -43.446 1.00 46.14  ?  162 SER A C      1 
ATOM 2578  O O      . SER A 1 158 ? 24.397  0.772   -43.135 1.00 50.37  ?  162 SER A O      1 
ATOM 2579  C CB     . SER A 1 158 ? 26.074  0.343   -45.860 1.00 39.76  ?  162 SER A CB     1 
ATOM 2580  O OG     . SER A 1 158 ? 27.046  0.794   -46.785 1.00 49.12  ?  162 SER A OG     1 
ATOM 2581  H H      . SER A 1 158 ? 28.193  0.067   -44.708 1.00 56.20  ?  162 SER A H      1 
ATOM 2582  H HA     . SER A 1 158 ? 26.250  1.801   -44.435 1.00 60.64  ?  162 SER A HA     1 
ATOM 2583  H HB2    . SER A 1 158 ? 26.066  -0.627  -45.857 1.00 47.71  ?  162 SER A HB2    1 
ATOM 2584  H HB3    . SER A 1 158 ? 25.204  0.681   -46.126 1.00 47.71  ?  162 SER A HB3    1 
ATOM 2585  H HG     . SER A 1 158 ? 27.805  0.508   -46.566 1.00 58.94  ?  162 SER A HG     1 
ATOM 2586  N N      . LEU A 1 159 ? 25.809  -0.965  -42.921 1.00 50.44  ?  163 LEU A N      1 
ATOM 2587  C CA     . LEU A 1 159 ? 24.910  -1.690  -42.033 1.00 56.74  ?  163 LEU A CA     1 
ATOM 2588  C C      . LEU A 1 159 ? 24.878  -1.065  -40.644 1.00 52.70  ?  163 LEU A C      1 
ATOM 2589  O O      . LEU A 1 159 ? 23.802  -0.870  -40.068 1.00 50.68  ?  163 LEU A O      1 
ATOM 2590  C CB     . LEU A 1 159 ? 25.333  -3.156  -41.960 1.00 56.47  ?  163 LEU A CB     1 
ATOM 2591  C CG     . LEU A 1 159 ? 25.035  -3.960  -43.227 1.00 42.71  ?  163 LEU A CG     1 
ATOM 2592  C CD1    . LEU A 1 159 ? 25.930  -5.181  -43.316 1.00 47.68  ?  163 LEU A CD1    1 
ATOM 2593  C CD2    . LEU A 1 159 ? 23.574  -4.368  -43.255 1.00 41.43  ?  163 LEU A CD2    1 
ATOM 2594  H H      . LEU A 1 159 ? 26.562  -1.355  -43.062 1.00 60.53  ?  163 LEU A H      1 
ATOM 2595  H HA     . LEU A 1 159 ? 24.012  -1.655  -42.397 1.00 68.09  ?  163 LEU A HA     1 
ATOM 2596  H HB2    . LEU A 1 159 ? 26.290  -3.197  -41.804 1.00 67.77  ?  163 LEU A HB2    1 
ATOM 2597  H HB3    . LEU A 1 159 ? 24.863  -3.580  -41.225 1.00 67.77  ?  163 LEU A HB3    1 
ATOM 2598  H HG     . LEU A 1 159 ? 25.207  -3.404  -44.003 1.00 51.26  ?  163 LEU A HG     1 
ATOM 2599  H HD11   . LEU A 1 159 ? 25.717  -5.668  -44.128 1.00 57.22  ?  163 LEU A HD11   1 
ATOM 2600  H HD12   . LEU A 1 159 ? 26.856  -4.892  -43.336 1.00 57.22  ?  163 LEU A HD12   1 
ATOM 2601  H HD13   . LEU A 1 159 ? 25.774  -5.743  -42.542 1.00 57.22  ?  163 LEU A HD13   1 
ATOM 2602  H HD21   . LEU A 1 159 ? 23.404  -4.876  -44.064 1.00 49.72  ?  163 LEU A HD21   1 
ATOM 2603  H HD22   . LEU A 1 159 ? 23.384  -4.913  -42.476 1.00 49.72  ?  163 LEU A HD22   1 
ATOM 2604  H HD23   . LEU A 1 159 ? 23.023  -3.570  -43.243 1.00 49.72  ?  163 LEU A HD23   1 
ATOM 2605  N N      . ASN A 1 160 ? 26.049  -0.736  -40.092 1.00 54.88  ?  164 ASN A N      1 
ATOM 2606  C CA     . ASN A 1 160 ? 26.093  -0.125  -38.769 1.00 59.30  ?  164 ASN A CA     1 
ATOM 2607  C C      . ASN A 1 160 ? 25.323  1.186   -38.717 1.00 64.73  ?  164 ASN A C      1 
ATOM 2608  O O      . ASN A 1 160 ? 25.004  1.662   -37.622 1.00 63.62  ?  164 ASN A O      1 
ATOM 2609  C CB     . ASN A 1 160 ? 27.542  0.102   -38.341 1.00 60.06  ?  164 ASN A CB     1 
ATOM 2610  C CG     . ASN A 1 160 ? 28.208  -1.167  -37.853 1.00 57.47  ?  164 ASN A CG     1 
ATOM 2611  O OD1    . ASN A 1 160 ? 27.692  -2.265  -38.049 1.00 54.77  ?  164 ASN A OD1    1 
ATOM 2612  N ND2    . ASN A 1 160 ? 29.360  -1.022  -37.212 1.00 58.95  ?  164 ASN A ND2    1 
ATOM 2613  H H      . ASN A 1 160 ? 26.817  -0.855  -40.459 1.00 65.86  ?  164 ASN A H      1 
ATOM 2614  H HA     . ASN A 1 160 ? 25.687  -0.733  -38.131 1.00 71.16  ?  164 ASN A HA     1 
ATOM 2615  H HB2    . ASN A 1 160 ? 28.048  0.435   -39.099 1.00 72.07  ?  164 ASN A HB2    1 
ATOM 2616  H HB3    . ASN A 1 160 ? 27.561  0.749   -37.619 1.00 72.07  ?  164 ASN A HB3    1 
ATOM 2617  H HD21   . ASN A 1 160 ? 29.777  -1.713  -36.916 1.00 70.74  ?  164 ASN A HD21   1 
ATOM 2618  H HD22   . ASN A 1 160 ? 29.690  -0.236  -37.093 1.00 70.74  ?  164 ASN A HD22   1 
ATOM 2619  N N      . LYS A 1 161 ? 25.025  1.785   -39.870 1.00 57.79  ?  165 LYS A N      1 
ATOM 2620  C CA     . LYS A 1 161 ? 24.139  2.939   -39.917 1.00 56.43  ?  165 LYS A CA     1 
ATOM 2621  C C      . LYS A 1 161 ? 22.681  2.524   -40.071 1.00 48.16  ?  165 LYS A C      1 
ATOM 2622  O O      . LYS A 1 161 ? 21.801  3.105   -39.429 1.00 53.93  ?  165 LYS A O      1 
ATOM 2623  C CB     . LYS A 1 161 ? 24.533  3.869   -41.067 1.00 64.00  ?  165 LYS A CB     1 
ATOM 2624  C CG     . LYS A 1 161 ? 25.955  4.402   -40.987 1.00 59.02  ?  165 LYS A CG     1 
ATOM 2625  C CD     . LYS A 1 161 ? 26.116  5.694   -41.779 1.00 63.53  ?  165 LYS A CD     1 
ATOM 2626  C CE     . LYS A 1 161 ? 25.928  5.493   -43.278 1.00 72.03  ?  165 LYS A CE     1 
ATOM 2627  N NZ     . LYS A 1 161 ? 27.147  4.951   -43.935 1.00 66.26  1  165 LYS A NZ     1 
ATOM 2628  H H      . LYS A 1 161 ? 25.326  1.540   -40.638 1.00 69.35  ?  165 LYS A H      1 
ATOM 2629  H HA     . LYS A 1 161 ? 24.223  3.435   -39.088 1.00 67.71  ?  165 LYS A HA     1 
ATOM 2630  H HB2    . LYS A 1 161 ? 24.448  3.383   -41.903 1.00 76.80  ?  165 LYS A HB2    1 
ATOM 2631  H HB3    . LYS A 1 161 ? 23.933  4.631   -41.070 1.00 76.80  ?  165 LYS A HB3    1 
ATOM 2632  H HG2    . LYS A 1 161 ? 26.176  4.585   -40.060 1.00 70.83  ?  165 LYS A HG2    1 
ATOM 2633  H HG3    . LYS A 1 161 ? 26.565  3.743   -41.354 1.00 70.83  ?  165 LYS A HG3    1 
ATOM 2634  H HD2    . LYS A 1 161 ? 25.453  6.335   -41.477 1.00 76.24  ?  165 LYS A HD2    1 
ATOM 2635  H HD3    . LYS A 1 161 ? 27.008  6.045   -41.633 1.00 76.24  ?  165 LYS A HD3    1 
ATOM 2636  H HE2    . LYS A 1 161 ? 25.203  4.866   -43.425 1.00 86.44  ?  165 LYS A HE2    1 
ATOM 2637  H HE3    . LYS A 1 161 ? 25.719  6.346   -43.689 1.00 86.44  ?  165 LYS A HE3    1 
ATOM 2638  H HZ1    . LYS A 1 161 ? 27.002  4.847   -44.807 1.00 79.51  ?  165 LYS A HZ1    1 
ATOM 2639  H HZ2    . LYS A 1 161 ? 27.829  5.512   -43.820 1.00 79.51  ?  165 LYS A HZ2    1 
ATOM 2640  H HZ3    . LYS A 1 161 ? 27.359  4.163   -43.580 1.00 79.51  ?  165 LYS A HZ3    1 
ATOM 2641  N N      . ARG A 1 162 ? 22.409  1.528   -40.914 1.00 49.45  ?  166 ARG A N      1 
ATOM 2642  C CA     . ARG A 1 162 ? 21.041  1.077   -41.133 1.00 51.15  ?  166 ARG A CA     1 
ATOM 2643  C C      . ARG A 1 162 ? 20.442  0.383   -39.920 1.00 46.69  ?  166 ARG A C      1 
ATOM 2644  O O      . ARG A 1 162 ? 19.223  0.188   -39.884 1.00 50.75  ?  166 ARG A O      1 
ATOM 2645  C CB     . ARG A 1 162 ? 20.991  0.135   -42.336 1.00 57.92  ?  166 ARG A CB     1 
ATOM 2646  C CG     . ARG A 1 162 ? 21.404  0.778   -43.649 1.00 65.25  ?  166 ARG A CG     1 
ATOM 2647  C CD     . ARG A 1 162 ? 20.232  1.451   -44.347 1.00 59.91  ?  166 ARG A CD     1 
ATOM 2648  N NE     . ARG A 1 162 ? 19.572  2.455   -43.519 1.00 40.33  ?  166 ARG A NE     1 
ATOM 2649  C CZ     . ARG A 1 162 ? 20.106  3.628   -43.199 1.00 50.10  ?  166 ARG A CZ     1 
ATOM 2650  N NH1    . ARG A 1 162 ? 21.323  3.946   -43.620 1.00 58.23  1  166 ARG A NH1    1 
ATOM 2651  N NH2    . ARG A 1 162 ? 19.430  4.479   -42.444 1.00 66.35  ?  166 ARG A NH2    1 
ATOM 2652  H H      . ARG A 1 162 ? 22.999  1.099   -41.370 1.00 59.34  ?  166 ARG A H      1 
ATOM 2653  H HA     . ARG A 1 162 ? 20.488  1.847   -41.336 1.00 61.38  ?  166 ARG A HA     1 
ATOM 2654  H HB2    . ARG A 1 162 ? 21.588  -0.611  -42.172 1.00 69.51  ?  166 ARG A HB2    1 
ATOM 2655  H HB3    . ARG A 1 162 ? 20.082  -0.189  -42.440 1.00 69.51  ?  166 ARG A HB3    1 
ATOM 2656  H HG2    . ARG A 1 162 ? 22.080  1.452   -43.474 1.00 78.30  ?  166 ARG A HG2    1 
ATOM 2657  H HG3    . ARG A 1 162 ? 21.758  0.096   -44.240 1.00 78.30  ?  166 ARG A HG3    1 
ATOM 2658  H HD2    . ARG A 1 162 ? 20.553  1.890   -45.150 1.00 71.89  ?  166 ARG A HD2    1 
ATOM 2659  H HD3    . ARG A 1 162 ? 19.574  0.776   -44.579 1.00 71.89  ?  166 ARG A HD3    1 
ATOM 2660  H HE     . ARG A 1 162 ? 18.786  2.276   -43.220 1.00 48.40  ?  166 ARG A HE     1 
ATOM 2661  H HH11   . ARG A 1 162 ? 21.766  3.396   -44.110 1.00 69.88  ?  166 ARG A HH11   1 
ATOM 2662  H HH12   . ARG A 1 162 ? 21.667  4.706   -43.408 1.00 69.88  ?  166 ARG A HH12   1 
ATOM 2663  H HH21   . ARG A 1 162 ? 18.642  4.276   -42.166 1.00 79.62  ?  166 ARG A HH21   1 
ATOM 2664  H HH22   . ARG A 1 162 ? 19.778  5.237   -42.232 1.00 79.62  ?  166 ARG A HH22   1 
ATOM 2665  N N      . ILE A 1 163 ? 21.253  0.005   -38.933 1.00 41.68  ?  167 ILE A N      1 
ATOM 2666  C CA     . ILE A 1 163 ? 20.696  -0.628  -37.745 1.00 39.44  ?  167 ILE A CA     1 
ATOM 2667  C C      . ILE A 1 163 ? 19.824  0.355   -36.982 1.00 56.42  ?  167 ILE A C      1 
ATOM 2668  O O      . ILE A 1 163 ? 18.855  -0.045  -36.327 1.00 54.40  ?  167 ILE A O      1 
ATOM 2669  C CB     . ILE A 1 163 ? 21.828  -1.190  -36.866 1.00 43.98  ?  167 ILE A CB     1 
ATOM 2670  C CG1    . ILE A 1 163 ? 21.263  -2.087  -35.765 1.00 62.30  ?  167 ILE A CG1    1 
ATOM 2671  C CG2    . ILE A 1 163 ? 22.650  -0.065  -36.256 1.00 60.10  ?  167 ILE A CG2    1 
ATOM 2672  C CD1    . ILE A 1 163 ? 20.693  -3.388  -36.278 1.00 58.23  ?  167 ILE A CD1    1 
ATOM 2673  H H      . ILE A 1 163 ? 22.107  0.101   -38.927 1.00 50.02  ?  167 ILE A H      1 
ATOM 2674  H HA     . ILE A 1 163 ? 20.137  -1.371  -38.019 1.00 47.33  ?  167 ILE A HA     1 
ATOM 2675  H HB     . ILE A 1 163 ? 22.412  -1.725  -37.426 1.00 52.78  ?  167 ILE A HB     1 
ATOM 2676  H HG12   . ILE A 1 163 ? 21.973  -2.300  -35.139 1.00 74.76  ?  167 ILE A HG12   1 
ATOM 2677  H HG13   . ILE A 1 163 ? 20.553  -1.611  -35.307 1.00 74.76  ?  167 ILE A HG13   1 
ATOM 2678  H HG21   . ILE A 1 163 ? 23.353  -0.450  -35.709 1.00 72.12  ?  167 ILE A HG21   1 
ATOM 2679  H HG22   . ILE A 1 163 ? 23.038  0.465   -36.970 1.00 72.12  ?  167 ILE A HG22   1 
ATOM 2680  H HG23   . ILE A 1 163 ? 22.071  0.488   -35.710 1.00 72.12  ?  167 ILE A HG23   1 
ATOM 2681  H HD11   . ILE A 1 163 ? 20.355  -3.902  -35.527 1.00 69.88  ?  167 ILE A HD11   1 
ATOM 2682  H HD12   . ILE A 1 163 ? 19.972  -3.194  -36.897 1.00 69.88  ?  167 ILE A HD12   1 
ATOM 2683  H HD13   . ILE A 1 163 ? 21.394  -3.884  -36.730 1.00 69.88  ?  167 ILE A HD13   1 
ATOM 2684  N N      . TYR A 1 164 ? 20.143  1.648   -37.053 1.00 63.67  ?  168 TYR A N      1 
ATOM 2685  C CA     . TYR A 1 164 ? 19.372  2.692   -36.392 1.00 39.34  ?  168 TYR A CA     1 
ATOM 2686  C C      . TYR A 1 164 ? 18.405  3.384   -37.344 1.00 29.96  ?  168 TYR A C      1 
ATOM 2687  O O      . TYR A 1 164 ? 18.075  4.556   -37.148 1.00 51.74  ?  168 TYR A O      1 
ATOM 2688  C CB     . TYR A 1 164 ? 20.307  3.726   -35.767 1.00 45.54  ?  168 TYR A CB     1 
ATOM 2689  C CG     . TYR A 1 164 ? 21.251  3.177   -34.725 1.00 44.80  ?  168 TYR A CG     1 
ATOM 2690  C CD1    . TYR A 1 164 ? 22.601  3.013   -35.003 1.00 40.48  ?  168 TYR A CD1    1 
ATOM 2691  C CD2    . TYR A 1 164 ? 20.796  2.837   -33.460 1.00 54.81  ?  168 TYR A CD2    1 
ATOM 2692  C CE1    . TYR A 1 164 ? 23.469  2.518   -34.053 1.00 49.26  ?  168 TYR A CE1    1 
ATOM 2693  C CE2    . TYR A 1 164 ? 21.658  2.342   -32.502 1.00 67.81  ?  168 TYR A CE2    1 
ATOM 2694  C CZ     . TYR A 1 164 ? 22.993  2.185   -32.805 1.00 65.51  ?  168 TYR A CZ     1 
ATOM 2695  O OH     . TYR A 1 164 ? 23.856  1.691   -31.855 1.00 79.74  ?  168 TYR A OH     1 
ATOM 2696  H H      . TYR A 1 164 ? 20.820  1.949   -37.490 1.00 76.41  ?  168 TYR A H      1 
ATOM 2697  H HA     . TYR A 1 164 ? 18.852  2.292   -35.678 1.00 47.20  ?  168 TYR A HA     1 
ATOM 2698  H HB2    . TYR A 1 164 ? 20.845  4.122   -36.471 1.00 54.64  ?  168 TYR A HB2    1 
ATOM 2699  H HB3    . TYR A 1 164 ? 19.770  4.413   -35.343 1.00 54.64  ?  168 TYR A HB3    1 
ATOM 2700  H HD1    . TYR A 1 164 ? 22.925  3.238   -35.846 1.00 48.57  ?  168 TYR A HD1    1 
ATOM 2701  H HD2    . TYR A 1 164 ? 19.896  2.943   -33.254 1.00 65.77  ?  168 TYR A HD2    1 
ATOM 2702  H HE1    . TYR A 1 164 ? 24.371  2.411   -34.254 1.00 59.12  ?  168 TYR A HE1    1 
ATOM 2703  H HE2    . TYR A 1 164 ? 21.339  2.115   -31.658 1.00 81.38  ?  168 TYR A HE2    1 
ATOM 2704  H HH     . TYR A 1 164 ? 23.438  1.530   -31.144 1.00 95.68  ?  168 TYR A HH     1 
ATOM 2705  N N      . ASP A 1 165 ? 17.944  2.685   -38.374 1.00 23.69  ?  169 ASP A N      1 
ATOM 2706  C CA     . ASP A 1 165 ? 17.087  3.310   -39.365 1.00 32.15  ?  169 ASP A CA     1 
ATOM 2707  C C      . ASP A 1 165 ? 15.704  3.590   -38.783 1.00 36.11  ?  169 ASP A C      1 
ATOM 2708  O O      . ASP A 1 165 ? 15.283  2.997   -37.788 1.00 34.29  ?  169 ASP A O      1 
ATOM 2709  C CB     . ASP A 1 165 ? 16.965  2.422   -40.598 1.00 37.87  ?  169 ASP A CB     1 
ATOM 2710  C CG     . ASP A 1 165 ? 16.288  3.124   -41.752 1.00 45.91  ?  169 ASP A CG     1 
ATOM 2711  O OD1    . ASP A 1 165 ? 15.051  3.278   -41.706 1.00 41.08  ?  169 ASP A OD1    1 
ATOM 2712  O OD2    . ASP A 1 165 ? 16.991  3.514   -42.707 1.00 44.93  -1 169 ASP A OD2    1 
ATOM 2713  H H      . ASP A 1 165 ? 18.112  1.854   -38.519 1.00 28.43  ?  169 ASP A H      1 
ATOM 2714  H HA     . ASP A 1 165 ? 17.478  4.155   -39.637 1.00 38.58  ?  169 ASP A HA     1 
ATOM 2715  H HB2    . ASP A 1 165 ? 17.852  2.156   -40.887 1.00 45.44  ?  169 ASP A HB2    1 
ATOM 2716  H HB3    . ASP A 1 165 ? 16.439  1.638   -40.374 1.00 45.44  ?  169 ASP A HB3    1 
ATOM 2717  N N      . ARG A 1 166 ? 14.992  4.512   -39.433 1.00 50.24  ?  170 ARG A N      1 
ATOM 2718  C CA     . ARG A 1 166 ? 13.679  4.923   -38.947 1.00 54.07  ?  170 ARG A CA     1 
ATOM 2719  C C      . ARG A 1 166 ? 12.708  3.752   -38.940 1.00 42.83  ?  170 ARG A C      1 
ATOM 2720  O O      . ARG A 1 166 ? 12.031  3.496   -37.939 1.00 38.22  ?  170 ARG A O      1 
ATOM 2721  C CB     . ARG A 1 166 ? 13.132  6.057   -39.814 1.00 63.47  ?  170 ARG A CB     1 
ATOM 2722  C CG     . ARG A 1 166 ? 12.143  6.971   -39.111 1.00 65.35  ?  170 ARG A CG     1 
ATOM 2723  C CD     . ARG A 1 166 ? 11.477  7.921   -40.093 1.00 61.46  ?  170 ARG A CD     1 
ATOM 2724  N NE     . ARG A 1 166 ? 10.729  8.977   -39.416 1.00 84.79  ?  170 ARG A NE     1 
ATOM 2725  C CZ     . ARG A 1 166 ? 9.917   9.834   -40.028 1.00 93.90  ?  170 ARG A CZ     1 
ATOM 2726  N NH1    . ARG A 1 166 ? 9.731   9.765   -41.340 1.00 96.11  1  170 ARG A NH1    1 
ATOM 2727  N NH2    . ARG A 1 166 ? 9.284   10.763  -39.325 1.00 100.22 ?  170 ARG A NH2    1 
ATOM 2728  H H      . ARG A 1 166 ? 15.246  4.910   -40.152 1.00 60.28  ?  170 ARG A H      1 
ATOM 2729  H HA     . ARG A 1 166 ? 13.764  5.251   -38.038 1.00 64.88  ?  170 ARG A HA     1 
ATOM 2730  H HB2    . ARG A 1 166 ? 13.875  6.604   -40.114 1.00 76.16  ?  170 ARG A HB2    1 
ATOM 2731  H HB3    . ARG A 1 166 ? 12.681  5.671   -40.581 1.00 76.16  ?  170 ARG A HB3    1 
ATOM 2732  H HG2    . ARG A 1 166 ? 11.453  6.434   -38.690 1.00 78.42  ?  170 ARG A HG2    1 
ATOM 2733  H HG3    . ARG A 1 166 ? 12.611  7.499   -38.446 1.00 78.42  ?  170 ARG A HG3    1 
ATOM 2734  H HD2    . ARG A 1 166 ? 12.158  8.339   -40.644 1.00 73.75  ?  170 ARG A HD2    1 
ATOM 2735  H HD3    . ARG A 1 166 ? 10.858  7.422   -40.649 1.00 73.75  ?  170 ARG A HD3    1 
ATOM 2736  H HE     . ARG A 1 166 ? 10.820  9.050   -38.564 1.00 101.75 ?  170 ARG A HE     1 
ATOM 2737  H HH11   . ARG A 1 166 ? 10.140  9.165   -41.801 1.00 115.33 ?  170 ARG A HH11   1 
ATOM 2738  H HH12   . ARG A 1 166 ? 9.204   10.321  -41.730 1.00 115.33 ?  170 ARG A HH12   1 
ATOM 2739  H HH21   . ARG A 1 166 ? 9.400   10.811  -38.474 1.00 120.27 ?  170 ARG A HH21   1 
ATOM 2740  H HH22   . ARG A 1 166 ? 8.757   11.316  -39.719 1.00 120.27 ?  170 ARG A HH22   1 
ATOM 2741  N N      . GLU A 1 167 ? 12.623  3.036   -40.048 1.00 38.79  ?  171 GLU A N      1 
ATOM 2742  C CA     . GLU A 1 167 ? 11.648  1.962   -40.151 1.00 67.59  ?  171 GLU A CA     1 
ATOM 2743  C C      . GLU A 1 167 ? 12.125  0.738   -39.371 1.00 70.55  ?  171 GLU A C      1 
ATOM 2744  O O      . GLU A 1 167 ? 13.305  0.388   -39.429 1.00 72.34  ?  171 GLU A O      1 
ATOM 2745  C CB     . GLU A 1 167 ? 11.418  1.582   -41.612 1.00 71.51  ?  171 GLU A CB     1 
ATOM 2746  C CG     . GLU A 1 167 ? 10.705  2.641   -42.433 1.00 72.48  ?  171 GLU A CG     1 
ATOM 2747  C CD     . GLU A 1 167 ? 9.439   3.140   -41.765 1.00 86.62  ?  171 GLU A CD     1 
ATOM 2748  O OE1    . GLU A 1 167 ? 9.518   4.129   -41.007 1.00 74.71  ?  171 GLU A OE1    1 
ATOM 2749  O OE2    . GLU A 1 167 ? 8.371   2.533   -41.979 1.00 92.47  -1 171 GLU A OE2    1 
ATOM 2750  H H      . GLU A 1 167 ? 13.111  3.147   -40.747 1.00 46.55  ?  171 GLU A H      1 
ATOM 2751  H HA     . GLU A 1 167 ? 10.804  2.256   -39.774 1.00 81.11  ?  171 GLU A HA     1 
ATOM 2752  H HB2    . GLU A 1 167 ? 12.279  1.417   -42.029 1.00 85.81  ?  171 GLU A HB2    1 
ATOM 2753  H HB3    . GLU A 1 167 ? 10.881  0.775   -41.642 1.00 85.81  ?  171 GLU A HB3    1 
ATOM 2754  H HG2    . GLU A 1 167 ? 11.298  3.399   -42.556 1.00 86.98  ?  171 GLU A HG2    1 
ATOM 2755  H HG3    . GLU A 1 167 ? 10.462  2.265   -43.293 1.00 86.98  ?  171 GLU A HG3    1 
ATOM 2756  N N      . PRO A 1 168 ? 11.235  0.072   -38.628 1.00 62.43  ?  172 PRO A N      1 
ATOM 2757  C CA     . PRO A 1 168 ? 11.651  -1.186  -37.991 1.00 55.51  ?  172 PRO A CA     1 
ATOM 2758  C C      . PRO A 1 168 ? 11.968  -2.269  -39.000 1.00 53.96  ?  172 PRO A C      1 
ATOM 2759  O O      . PRO A 1 168 ? 12.941  -3.011  -38.823 1.00 51.08  ?  172 PRO A O      1 
ATOM 2760  C CB     . PRO A 1 168 ? 10.444  -1.558  -37.116 1.00 63.70  ?  172 PRO A CB     1 
ATOM 2761  C CG     . PRO A 1 168 ? 9.628   -0.315  -37.009 1.00 68.08  ?  172 PRO A CG     1 
ATOM 2762  C CD     . PRO A 1 168 ? 9.852   0.430   -38.277 1.00 72.02  ?  172 PRO A CD     1 
ATOM 2763  H HA     . PRO A 1 168 ? 12.424  -1.037  -37.425 1.00 66.62  ?  172 PRO A HA     1 
ATOM 2764  H HB2    . PRO A 1 168 ? 9.936   -2.264  -37.545 1.00 76.44  ?  172 PRO A HB2    1 
ATOM 2765  H HB3    . PRO A 1 168 ? 10.751  -1.842  -36.241 1.00 76.44  ?  172 PRO A HB3    1 
ATOM 2766  H HG2    . PRO A 1 168 ? 8.692   -0.549  -36.912 1.00 81.70  ?  172 PRO A HG2    1 
ATOM 2767  H HG3    . PRO A 1 168 ? 9.930   0.207   -36.250 1.00 81.70  ?  172 PRO A HG3    1 
ATOM 2768  H HD2    . PRO A 1 168 ? 9.237   0.124   -38.963 1.00 86.42  ?  172 PRO A HD2    1 
ATOM 2769  H HD3    . PRO A 1 168 ? 9.775   1.385   -38.128 1.00 86.42  ?  172 PRO A HD3    1 
ATOM 2770  N N      . THR A 1 169 ? 11.176  -2.370  -40.068 1.00 56.12  ?  173 THR A N      1 
ATOM 2771  C CA     . THR A 1 169 ? 11.370  -3.431  -41.047 1.00 51.54  ?  173 THR A CA     1 
ATOM 2772  C C      . THR A 1 169 ? 12.808  -3.464  -41.543 1.00 45.60  ?  173 THR A C      1 
ATOM 2773  O O      . THR A 1 169 ? 13.474  -4.504  -41.493 1.00 64.07  ?  173 THR A O      1 
ATOM 2774  C CB     . THR A 1 169 ? 10.407  -3.238  -42.217 1.00 43.70  ?  173 THR A CB     1 
ATOM 2775  O OG1    . THR A 1 169 ? 9.073   -3.082  -41.717 1.00 50.20  ?  173 THR A OG1    1 
ATOM 2776  C CG2    . THR A 1 169 ? 10.458  -4.434  -43.145 1.00 80.57  ?  173 THR A CG2    1 
ATOM 2777  H H      . THR A 1 169 ? 10.523  -1.838  -40.246 1.00 67.34  ?  173 THR A H      1 
ATOM 2778  H HA     . THR A 1 169 ? 11.174  -4.286  -40.633 1.00 61.84  ?  173 THR A HA     1 
ATOM 2779  H HB     . THR A 1 169 ? 10.660  -2.448  -42.718 1.00 52.44  ?  173 THR A HB     1 
ATOM 2780  H HG1    . THR A 1 169 ? 8.538   -2.975  -42.356 1.00 60.24  ?  173 THR A HG1    1 
ATOM 2781  H HG21   . THR A 1 169 ? 9.844   -4.305  -43.885 1.00 96.68  ?  173 THR A HG21   1 
ATOM 2782  H HG22   . THR A 1 169 ? 11.356  -4.544  -43.495 1.00 96.68  ?  173 THR A HG22   1 
ATOM 2783  H HG23   . THR A 1 169 ? 10.207  -5.238  -42.664 1.00 96.68  ?  173 THR A HG23   1 
ATOM 2784  N N      . VAL A 1 170 ? 13.310  -2.324  -42.019 1.00 39.09  ?  174 VAL A N      1 
ATOM 2785  C CA     . VAL A 1 170 ? 14.666  -2.283  -42.550 1.00 43.92  ?  174 VAL A CA     1 
ATOM 2786  C C      . VAL A 1 170 ? 15.677  -2.585  -41.456 1.00 49.87  ?  174 VAL A C      1 
ATOM 2787  O O      . VAL A 1 170 ? 16.767  -3.098  -41.731 1.00 55.59  ?  174 VAL A O      1 
ATOM 2788  C CB     . VAL A 1 170 ? 14.940  -0.919  -43.208 1.00 47.39  ?  174 VAL A CB     1 
ATOM 2789  C CG1    . VAL A 1 170 ? 13.888  -0.613  -44.257 1.00 45.14  ?  174 VAL A CG1    1 
ATOM 2790  C CG2    . VAL A 1 170 ? 14.967  0.174   -42.172 1.00 62.77  ?  174 VAL A CG2    1 
ATOM 2791  H H      . VAL A 1 170 ? 12.891  -1.574  -42.044 1.00 46.91  ?  174 VAL A H      1 
ATOM 2792  H HA     . VAL A 1 170 ? 14.756  -2.966  -43.233 1.00 52.71  ?  174 VAL A HA     1 
ATOM 2793  H HB     . VAL A 1 170 ? 15.805  -0.943  -43.645 1.00 56.87  ?  174 VAL A HB     1 
ATOM 2794  H HG11   . VAL A 1 170 ? 14.083  0.250   -44.656 1.00 54.17  ?  174 VAL A HG11   1 
ATOM 2795  H HG12   . VAL A 1 170 ? 13.910  -1.304  -44.937 1.00 54.17  ?  174 VAL A HG12   1 
ATOM 2796  H HG13   . VAL A 1 170 ? 13.016  -0.592  -43.833 1.00 54.17  ?  174 VAL A HG13   1 
ATOM 2797  H HG21   . VAL A 1 170 ? 15.141  1.021   -42.612 1.00 75.32  ?  174 VAL A HG21   1 
ATOM 2798  H HG22   . VAL A 1 170 ? 14.108  0.204   -41.722 1.00 75.32  ?  174 VAL A HG22   1 
ATOM 2799  H HG23   . VAL A 1 170 ? 15.670  -0.016  -41.531 1.00 75.32  ?  174 VAL A HG23   1 
ATOM 2800  N N      . ARG A 1 171 ? 15.342  -2.270  -40.203 1.00 44.92  ?  175 ARG A N      1 
ATOM 2801  C CA     . ARG A 1 171 ? 16.241  -2.598  -39.104 1.00 45.94  ?  175 ARG A CA     1 
ATOM 2802  C C      . ARG A 1 171 ? 16.308  -4.101  -38.875 1.00 53.71  ?  175 ARG A C      1 
ATOM 2803  O O      . ARG A 1 171 ? 17.354  -4.616  -38.463 1.00 60.34  ?  175 ARG A O      1 
ATOM 2804  C CB     . ARG A 1 171 ? 15.804  -1.878  -37.827 1.00 43.53  ?  175 ARG A CB     1 
ATOM 2805  C CG     . ARG A 1 171 ? 16.118  -0.392  -37.829 1.00 42.05  ?  175 ARG A CG     1 
ATOM 2806  C CD     . ARG A 1 171 ? 16.003  0.237   -36.450 1.00 49.51  ?  175 ARG A CD     1 
ATOM 2807  N NE     . ARG A 1 171 ? 14.668  0.762   -36.176 1.00 54.77  ?  175 ARG A NE     1 
ATOM 2808  C CZ     . ARG A 1 171 ? 13.779  0.205   -35.358 1.00 44.08  ?  175 ARG A CZ     1 
ATOM 2809  N NH1    . ARG A 1 171 ? 14.059  -0.913  -34.705 1.00 49.86  1  175 ARG A NH1    1 
ATOM 2810  N NH2    . ARG A 1 171 ? 12.597  0.778   -35.187 1.00 42.17  ?  175 ARG A NH2    1 
ATOM 2811  H H      . ARG A 1 171 ? 14.615  -1.874  -39.970 1.00 53.90  ?  175 ARG A H      1 
ATOM 2812  H HA     . ARG A 1 171 ? 17.133  -2.291  -39.327 1.00 55.12  ?  175 ARG A HA     1 
ATOM 2813  H HB2    . ARG A 1 171 ? 14.844  -1.979  -37.723 1.00 52.24  ?  175 ARG A HB2    1 
ATOM 2814  H HB3    . ARG A 1 171 ? 16.261  -2.278  -37.070 1.00 52.24  ?  175 ARG A HB3    1 
ATOM 2815  H HG2    . ARG A 1 171 ? 17.026  -0.261  -38.144 1.00 50.46  ?  175 ARG A HG2    1 
ATOM 2816  H HG3    . ARG A 1 171 ? 15.495  0.062   -38.418 1.00 50.46  ?  175 ARG A HG3    1 
ATOM 2817  H HD2    . ARG A 1 171 ? 16.204  -0.435  -35.779 1.00 59.41  ?  175 ARG A HD2    1 
ATOM 2818  H HD3    . ARG A 1 171 ? 16.633  0.971   -36.383 1.00 59.41  ?  175 ARG A HD3    1 
ATOM 2819  H HE     . ARG A 1 171 ? 14.438  1.487   -36.576 1.00 65.73  ?  175 ARG A HE     1 
ATOM 2820  H HH11   . ARG A 1 171 ? 14.825  -1.291  -34.809 1.00 59.83  ?  175 ARG A HH11   1 
ATOM 2821  H HH12   . ARG A 1 171 ? 13.475  -1.262  -34.179 1.00 59.83  ?  175 ARG A HH12   1 
ATOM 2822  H HH21   . ARG A 1 171 ? 12.406  1.504   -35.607 1.00 50.61  ?  175 ARG A HH21   1 
ATOM 2823  H HH22   . ARG A 1 171 ? 12.019  0.422   -34.660 1.00 50.61  ?  175 ARG A HH22   1 
ATOM 2824  N N      . ILE A 1 172 ? 15.217  -4.822  -39.138 1.00 61.95  ?  176 ILE A N      1 
ATOM 2825  C CA     . ILE A 1 172 ? 15.251  -6.278  -39.038 1.00 39.48  ?  176 ILE A CA     1 
ATOM 2826  C C      . ILE A 1 172 ? 16.182  -6.851  -40.096 1.00 43.70  ?  176 ILE A C      1 
ATOM 2827  O O      . ILE A 1 172 ? 17.062  -7.665  -39.801 1.00 48.71  ?  176 ILE A O      1 
ATOM 2828  C CB     . ILE A 1 172 ? 13.835  -6.867  -39.165 1.00 35.69  ?  176 ILE A CB     1 
ATOM 2829  C CG1    . ILE A 1 172 ? 12.891  -6.248  -38.133 1.00 40.56  ?  176 ILE A CG1    1 
ATOM 2830  C CG2    . ILE A 1 172 ? 13.881  -8.372  -38.971 1.00 48.01  ?  176 ILE A CG2    1 
ATOM 2831  C CD1    . ILE A 1 172 ? 11.436  -6.610  -38.338 1.00 37.94  ?  176 ILE A CD1    1 
ATOM 2832  H H      . ILE A 1 172 ? 14.456  -4.496  -39.374 1.00 74.33  ?  176 ILE A H      1 
ATOM 2833  H HA     . ILE A 1 172 ? 15.600  -6.525  -38.167 1.00 47.38  ?  176 ILE A HA     1 
ATOM 2834  H HB     . ILE A 1 172 ? 13.495  -6.676  -40.054 1.00 42.83  ?  176 ILE A HB     1 
ATOM 2835  H HG12   . ILE A 1 172 ? 13.151  -6.554  -37.250 1.00 48.67  ?  176 ILE A HG12   1 
ATOM 2836  H HG13   . ILE A 1 172 ? 12.966  -5.282  -38.182 1.00 48.67  ?  176 ILE A HG13   1 
ATOM 2837  H HG21   . ILE A 1 172 ? 12.982  -8.728  -39.054 1.00 57.62  ?  176 ILE A HG21   1 
ATOM 2838  H HG22   . ILE A 1 172 ? 14.455  -8.760  -39.650 1.00 57.62  ?  176 ILE A HG22   1 
ATOM 2839  H HG23   . ILE A 1 172 ? 14.233  -8.565  -38.088 1.00 57.62  ?  176 ILE A HG23   1 
ATOM 2840  H HD11   . ILE A 1 172 ? 10.905  -6.182  -37.648 1.00 45.53  ?  176 ILE A HD11   1 
ATOM 2841  H HD12   . ILE A 1 172 ? 11.154  -6.301  -39.213 1.00 45.53  ?  176 ILE A HD12   1 
ATOM 2842  H HD13   . ILE A 1 172 ? 11.340  -7.574  -38.280 1.00 45.53  ?  176 ILE A HD13   1 
ATOM 2843  N N      . GLN A 1 173 ? 15.999  -6.435  -41.349 1.00 47.14  ?  177 GLN A N      1 
ATOM 2844  C CA     . GLN A 1 173 ? 16.876  -6.906  -42.411 1.00 39.72  ?  177 GLN A CA     1 
ATOM 2845  C C      . GLN A 1 173 ? 18.325  -6.542  -42.134 1.00 44.44  ?  177 GLN A C      1 
ATOM 2846  O O      . GLN A 1 173 ? 19.239  -7.211  -42.626 1.00 48.83  ?  177 GLN A O      1 
ATOM 2847  C CB     . GLN A 1 173 ? 16.435  -6.324  -43.750 1.00 38.17  ?  177 GLN A CB     1 
ATOM 2848  C CG     . GLN A 1 173 ? 14.974  -6.560  -44.071 1.00 42.10  ?  177 GLN A CG     1 
ATOM 2849  C CD     . GLN A 1 173 ? 14.615  -8.025  -44.062 1.00 39.92  ?  177 GLN A CD     1 
ATOM 2850  O OE1    . GLN A 1 173 ? 15.466  -8.883  -44.284 1.00 42.35  ?  177 GLN A OE1    1 
ATOM 2851  N NE2    . GLN A 1 173 ? 13.350  -8.322  -43.796 1.00 43.17  ?  177 GLN A NE2    1 
ATOM 2852  H H      . GLN A 1 173 ? 15.385  -5.889  -41.604 1.00 56.56  ?  177 GLN A H      1 
ATOM 2853  H HA     . GLN A 1 173 ? 16.814  -7.873  -42.468 1.00 47.67  ?  177 GLN A HA     1 
ATOM 2854  H HB2    . GLN A 1 173 ? 16.584  -5.366  -43.738 1.00 45.80  ?  177 GLN A HB2    1 
ATOM 2855  H HB3    . GLN A 1 173 ? 16.962  -6.729  -44.456 1.00 45.80  ?  177 GLN A HB3    1 
ATOM 2856  H HG2    . GLN A 1 173 ? 14.427  -6.111  -43.408 1.00 50.52  ?  177 GLN A HG2    1 
ATOM 2857  H HG3    . GLN A 1 173 ? 14.782  -6.208  -44.955 1.00 50.52  ?  177 GLN A HG3    1 
ATOM 2858  H HE21   . GLN A 1 173 ? 12.784  -7.694  -43.641 1.00 51.80  ?  177 GLN A HE21   1 
ATOM 2859  H HE22   . GLN A 1 173 ? 13.096  -9.144  -43.779 1.00 51.80  ?  177 GLN A HE22   1 
ATOM 2860  N N      . ALA A 1 174 ? 18.556  -5.492  -41.346 1.00 39.74  ?  178 ALA A N      1 
ATOM 2861  C CA     . ALA A 1 174 ? 19.922  -5.083  -41.043 1.00 40.50  ?  178 ALA A CA     1 
ATOM 2862  C C      . ALA A 1 174 ? 20.635  -6.135  -40.203 1.00 52.76  ?  178 ALA A C      1 
ATOM 2863  O O      . ALA A 1 174 ? 21.765  -6.528  -40.514 1.00 55.76  ?  178 ALA A O      1 
ATOM 2864  C CB     . ALA A 1 174 ? 19.917  -3.734  -40.329 1.00 44.23  ?  178 ALA A CB     1 
ATOM 2865  H H      . ALA A 1 174 ? 17.948  -5.007  -40.980 1.00 47.69  ?  178 ALA A H      1 
ATOM 2866  H HA     . ALA A 1 174 ? 20.412  -4.981  -41.874 1.00 48.60  ?  178 ALA A HA     1 
ATOM 2867  H HB1    . ALA A 1 174 ? 20.831  -3.476  -40.135 1.00 53.08  ?  178 ALA A HB1    1 
ATOM 2868  H HB2    . ALA A 1 174 ? 19.502  -3.073  -40.907 1.00 53.08  ?  178 ALA A HB2    1 
ATOM 2869  H HB3    . ALA A 1 174 ? 19.413  -3.815  -39.504 1.00 53.08  ?  178 ALA A HB3    1 
ATOM 2870  N N      . VAL A 1 175 ? 19.993  -6.608  -39.133 1.00 54.80  ?  179 VAL A N      1 
ATOM 2871  C CA     . VAL A 1 175 ? 20.638  -7.604  -38.284 1.00 53.63  ?  179 VAL A CA     1 
ATOM 2872  C C      . VAL A 1 175 ? 20.837  -8.904  -39.051 1.00 54.49  ?  179 VAL A C      1 
ATOM 2873  O O      . VAL A 1 175 ? 21.905  -9.523  -38.976 1.00 57.41  ?  179 VAL A O      1 
ATOM 2874  C CB     . VAL A 1 175 ? 19.841  -7.821  -36.983 1.00 51.14  ?  179 VAL A CB     1 
ATOM 2875  C CG1    . VAL A 1 175 ? 19.820  -6.548  -36.162 1.00 65.40  ?  179 VAL A CG1    1 
ATOM 2876  C CG2    . VAL A 1 175 ? 18.424  -8.281  -37.264 1.00 51.02  ?  179 VAL A CG2    1 
ATOM 2877  H H      . VAL A 1 175 ? 19.204  -6.374  -38.883 1.00 65.76  ?  179 VAL A H      1 
ATOM 2878  H HA     . VAL A 1 175 ? 21.516  -7.275  -38.036 1.00 64.35  ?  179 VAL A HA     1 
ATOM 2879  H HB     . VAL A 1 175 ? 20.279  -8.509  -36.456 1.00 61.36  ?  179 VAL A HB     1 
ATOM 2880  H HG11   . VAL A 1 175 ? 19.315  -6.705  -35.349 1.00 78.47  ?  179 VAL A HG11   1 
ATOM 2881  H HG12   . VAL A 1 175 ? 20.732  -6.300  -35.943 1.00 78.47  ?  179 VAL A HG12   1 
ATOM 2882  H HG13   . VAL A 1 175 ? 19.401  -5.845  -36.682 1.00 78.47  ?  179 VAL A HG13   1 
ATOM 2883  H HG21   . VAL A 1 175 ? 17.960  -8.405  -36.421 1.00 61.22  ?  179 VAL A HG21   1 
ATOM 2884  H HG22   . VAL A 1 175 ? 17.973  -7.606  -37.794 1.00 61.22  ?  179 VAL A HG22   1 
ATOM 2885  H HG23   . VAL A 1 175 ? 18.455  -9.119  -37.751 1.00 61.22  ?  179 VAL A HG23   1 
ATOM 2886  N N      . PHE A 1 176 ? 19.828  -9.330  -39.816 1.00 60.81  ?  180 PHE A N      1 
ATOM 2887  C CA     . PHE A 1 176 ? 19.988  -10.515 -40.654 1.00 49.58  ?  180 PHE A CA     1 
ATOM 2888  C C      . PHE A 1 176 ? 21.276  -10.440 -41.460 1.00 45.06  ?  180 PHE A C      1 
ATOM 2889  O O      . PHE A 1 176 ? 21.978  -11.444 -41.623 1.00 60.11  ?  180 PHE A O      1 
ATOM 2890  C CB     . PHE A 1 176 ? 18.792  -10.672 -41.597 1.00 51.79  ?  180 PHE A CB     1 
ATOM 2891  C CG     . PHE A 1 176 ? 17.503  -11.046 -40.912 1.00 36.63  ?  180 PHE A CG     1 
ATOM 2892  C CD1    . PHE A 1 176 ? 17.470  -11.383 -39.570 1.00 40.27  ?  180 PHE A CD1    1 
ATOM 2893  C CD2    . PHE A 1 176 ? 16.317  -11.070 -41.628 1.00 46.41  ?  180 PHE A CD2    1 
ATOM 2894  C CE1    . PHE A 1 176 ? 16.281  -11.727 -38.960 1.00 53.07  ?  180 PHE A CE1    1 
ATOM 2895  C CE2    . PHE A 1 176 ? 15.128  -11.414 -41.020 1.00 45.04  ?  180 PHE A CE2    1 
ATOM 2896  C CZ     . PHE A 1 176 ? 15.111  -11.742 -39.687 1.00 36.42  ?  180 PHE A CZ     1 
ATOM 2897  H H      . PHE A 1 176 ? 19.055  -8.956  -39.866 1.00 72.97  ?  180 PHE A H      1 
ATOM 2898  H HA     . PHE A 1 176 ? 20.031  -11.301 -40.087 1.00 59.49  ?  180 PHE A HA     1 
ATOM 2899  H HB2    . PHE A 1 176 ? 18.647  -9.830  -42.057 1.00 62.14  ?  180 PHE A HB2    1 
ATOM 2900  H HB3    . PHE A 1 176 ? 18.995  -11.367 -42.242 1.00 62.14  ?  180 PHE A HB3    1 
ATOM 2901  H HD1    . PHE A 1 176 ? 18.257  -11.374 -39.074 1.00 48.33  ?  180 PHE A HD1    1 
ATOM 2902  H HD2    . PHE A 1 176 ? 16.323  -10.848 -42.531 1.00 55.69  ?  180 PHE A HD2    1 
ATOM 2903  H HE1    . PHE A 1 176 ? 16.270  -11.950 -38.057 1.00 63.68  ?  180 PHE A HE1    1 
ATOM 2904  H HE2    . PHE A 1 176 ? 14.339  -11.423 -41.512 1.00 54.05  ?  180 PHE A HE2    1 
ATOM 2905  H HZ     . PHE A 1 176 ? 14.310  -11.974 -39.275 1.00 43.71  ?  180 PHE A HZ     1 
ATOM 2906  N N      . CYS A 1 177 ? 21.606  -9.255  -41.971 1.00 44.96  ?  181 CYS A N      1 
ATOM 2907  C CA     . CYS A 1 177 ? 22.853  -9.082  -42.703 1.00 45.08  ?  181 CYS A CA     1 
ATOM 2908  C C      . CYS A 1 177 ? 24.059  -9.032  -41.777 1.00 47.08  ?  181 CYS A C      1 
ATOM 2909  O O      . CYS A 1 177 ? 25.175  -9.343  -42.206 1.00 53.97  ?  181 CYS A O      1 
ATOM 2910  C CB     . CYS A 1 177 ? 22.792  -7.810  -43.545 1.00 38.94  ?  181 CYS A CB     1 
ATOM 2911  S SG     . CYS A 1 177 ? 21.588  -7.872  -44.889 1.00 65.19  ?  181 CYS A SG     1 
ATOM 2912  H H      . CYS A 1 177 ? 21.128  -8.542  -41.907 1.00 53.95  ?  181 CYS A H      1 
ATOM 2913  H HA     . CYS A 1 177 ? 22.970  -9.834  -43.305 1.00 54.09  ?  181 CYS A HA     1 
ATOM 2914  H HB2    . CYS A 1 177 ? 22.555  -7.067  -42.970 1.00 46.73  ?  181 CYS A HB2    1 
ATOM 2915  H HB3    . CYS A 1 177 ? 23.665  -7.655  -43.938 1.00 46.73  ?  181 CYS A HB3    1 
ATOM 2916  H HG     . CYS A 1 177 ? 20.495  -8.048  -44.426 1.00 78.23  ?  181 CYS A HG     1 
ATOM 2917  N N      . LEU A 1 178 ? 23.863  -8.646  -40.515 1.00 42.25  ?  182 LEU A N      1 
ATOM 2918  C CA     . LEU A 1 178 ? 24.974  -8.585  -39.574 1.00 43.43  ?  182 LEU A CA     1 
ATOM 2919  C C      . LEU A 1 178 ? 25.244  -9.930  -38.917 1.00 54.52  ?  182 LEU A C      1 
ATOM 2920  O O      . LEU A 1 178 ? 26.387  -10.209 -38.537 1.00 62.69  ?  182 LEU A O      1 
ATOM 2921  C CB     . LEU A 1 178 ? 24.698  -7.534  -38.499 1.00 43.57  ?  182 LEU A CB     1 
ATOM 2922  C CG     . LEU A 1 178 ? 24.914  -6.075  -38.900 1.00 42.36  ?  182 LEU A CG     1 
ATOM 2923  C CD1    . LEU A 1 178 ? 24.398  -5.153  -37.816 1.00 48.07  ?  182 LEU A CD1    1 
ATOM 2924  C CD2    . LEU A 1 178 ? 26.385  -5.801  -39.168 1.00 43.38  ?  182 LEU A CD2    1 
ATOM 2925  H H      . LEU A 1 178 ? 23.102  -8.417  -40.185 1.00 50.70  ?  182 LEU A H      1 
ATOM 2926  H HA     . LEU A 1 178 ? 25.776  -8.320  -40.052 1.00 52.11  ?  182 LEU A HA     1 
ATOM 2927  H HB2    . LEU A 1 178 ? 23.773  -7.621  -38.221 1.00 52.28  ?  182 LEU A HB2    1 
ATOM 2928  H HB3    . LEU A 1 178 ? 25.278  -7.713  -37.743 1.00 52.28  ?  182 LEU A HB3    1 
ATOM 2929  H HG     . LEU A 1 178 ? 24.419  -5.892  -39.714 1.00 50.83  ?  182 LEU A HG     1 
ATOM 2930  H HD11   . LEU A 1 178 ? 24.544  -4.233  -38.088 1.00 57.69  ?  182 LEU A HD11   1 
ATOM 2931  H HD12   . LEU A 1 178 ? 23.450  -5.314  -37.689 1.00 57.69  ?  182 LEU A HD12   1 
ATOM 2932  H HD13   . LEU A 1 178 ? 24.878  -5.335  -36.993 1.00 57.69  ?  182 LEU A HD13   1 
ATOM 2933  H HD21   . LEU A 1 178 ? 26.491  -4.870  -39.420 1.00 52.05  ?  182 LEU A HD21   1 
ATOM 2934  H HD22   . LEU A 1 178 ? 26.892  -5.986  -38.363 1.00 52.05  ?  182 LEU A HD22   1 
ATOM 2935  H HD23   . LEU A 1 178 ? 26.686  -6.376  -39.889 1.00 52.05  ?  182 LEU A HD23   1 
ATOM 2936  N N      . THR A 1 179 ? 24.219  -10.770 -38.771 1.00 54.15  ?  183 THR A N      1 
ATOM 2937  C CA     . THR A 1 179 ? 24.413  -12.060 -38.122 1.00 44.80  ?  183 THR A CA     1 
ATOM 2938  C C      . THR A 1 179 ? 25.448  -12.902 -38.852 1.00 46.63  ?  183 THR A C      1 
ATOM 2939  O O      . THR A 1 179 ? 26.131  -13.721 -38.229 1.00 57.05  ?  183 THR A O      1 
ATOM 2940  C CB     . THR A 1 179 ? 23.086  -12.809 -38.040 1.00 44.78  ?  183 THR A CB     1 
ATOM 2941  O OG1    . THR A 1 179 ? 22.518  -12.927 -39.350 1.00 58.93  ?  183 THR A OG1    1 
ATOM 2942  C CG2    . THR A 1 179 ? 22.122  -12.073 -37.134 1.00 58.20  ?  183 THR A CG2    1 
ATOM 2943  H H      . THR A 1 179 ? 23.415  -10.617 -39.035 1.00 64.98  ?  183 THR A H      1 
ATOM 2944  H HA     . THR A 1 179 ? 24.731  -11.913 -37.218 1.00 53.76  ?  183 THR A HA     1 
ATOM 2945  H HB     . THR A 1 179 ? 23.238  -13.694 -37.673 1.00 53.74  ?  183 THR A HB     1 
ATOM 2946  H HG1    . THR A 1 179 ? 22.383  -12.164 -39.674 1.00 70.71  ?  183 THR A HG1    1 
ATOM 2947  H HG21   . THR A 1 179 ? 21.281  -12.553 -37.085 1.00 69.83  ?  183 THR A HG21   1 
ATOM 2948  H HG22   . THR A 1 179 ? 22.496  -12.000 -36.242 1.00 69.83  ?  183 THR A HG22   1 
ATOM 2949  H HG23   . THR A 1 179 ? 21.957  -11.182 -37.480 1.00 69.83  ?  183 THR A HG23   1 
ATOM 2950  N N      . LYS A 1 180 ? 25.588  -12.711 -40.161 1.00 47.87  ?  184 LYS A N      1 
ATOM 2951  C CA     . LYS A 1 180 ? 26.547  -13.474 -40.947 1.00 56.37  ?  184 LYS A CA     1 
ATOM 2952  C C      . LYS A 1 180 ? 27.980  -12.994 -40.749 1.00 52.04  ?  184 LYS A C      1 
ATOM 2953  O O      . LYS A 1 180 ? 28.891  -13.546 -41.376 1.00 59.24  ?  184 LYS A O      1 
ATOM 2954  C CB     . LYS A 1 180 ? 26.189  -13.406 -42.435 1.00 68.89  ?  184 LYS A CB     1 
ATOM 2955  C CG     . LYS A 1 180 ? 24.693  -13.392 -42.753 1.00 58.68  ?  184 LYS A CG     1 
ATOM 2956  C CD     . LYS A 1 180 ? 23.969  -14.641 -42.276 1.00 60.28  ?  184 LYS A CD     1 
ATOM 2957  C CE     . LYS A 1 180 ? 22.488  -14.564 -42.621 1.00 63.68  ?  184 LYS A CE     1 
ATOM 2958  N NZ     . LYS A 1 180 ? 21.715  -15.746 -42.160 1.00 63.16  1  184 LYS A NZ     1 
ATOM 2959  H H      . LYS A 1 180 ? 25.135  -12.142 -40.619 1.00 57.45  ?  184 LYS A H      1 
ATOM 2960  H HA     . LYS A 1 180 ? 26.506  -14.404 -40.673 1.00 67.64  ?  184 LYS A HA     1 
ATOM 2961  H HB2    . LYS A 1 180 ? 26.572  -12.595 -42.806 1.00 82.66  ?  184 LYS A HB2    1 
ATOM 2962  H HB3    . LYS A 1 180 ? 26.573  -14.178 -42.879 1.00 82.66  ?  184 LYS A HB3    1 
ATOM 2963  H HG2    . LYS A 1 180 ? 24.286  -12.627 -42.318 1.00 70.41  ?  184 LYS A HG2    1 
ATOM 2964  H HG3    . LYS A 1 180 ? 24.576  -13.328 -43.714 1.00 70.41  ?  184 LYS A HG3    1 
ATOM 2965  H HD2    . LYS A 1 180 ? 24.346  -15.421 -42.713 1.00 72.33  ?  184 LYS A HD2    1 
ATOM 2966  H HD3    . LYS A 1 180 ? 24.056  -14.718 -41.313 1.00 72.33  ?  184 LYS A HD3    1 
ATOM 2967  H HE2    . LYS A 1 180 ? 22.107  -13.777 -42.200 1.00 76.41  ?  184 LYS A HE2    1 
ATOM 2968  H HE3    . LYS A 1 180 ? 22.392  -14.502 -43.584 1.00 76.41  ?  184 LYS A HE3    1 
ATOM 2969  H HZ1    . LYS A 1 180 ? 20.859  -15.656 -42.384 1.00 75.79  ?  184 LYS A HZ1    1 
ATOM 2970  H HZ2    . LYS A 1 180 ? 22.037  -16.485 -42.538 1.00 75.79  ?  184 LYS A HZ2    1 
ATOM 2971  H HZ3    . LYS A 1 180 ? 21.777  -15.824 -41.276 1.00 75.79  ?  184 LYS A HZ3    1 
ATOM 2972  N N      . PHE A 1 181 ? 28.200  -11.987 -39.903 1.00 51.45  ?  185 PHE A N      1 
ATOM 2973  C CA     . PHE A 1 181 ? 29.526  -11.442 -39.643 1.00 61.94  ?  185 PHE A CA     1 
ATOM 2974  C C      . PHE A 1 181 ? 29.991  -11.689 -38.214 1.00 64.11  ?  185 PHE A C      1 
ATOM 2975  O O      . PHE A 1 181 ? 31.017  -11.136 -37.804 1.00 76.46  ?  185 PHE A O      1 
ATOM 2976  C CB     . PHE A 1 181 ? 29.546  -9.935  -39.917 1.00 64.57  ?  185 PHE A CB     1 
ATOM 2977  C CG     . PHE A 1 181 ? 29.330  -9.567  -41.356 1.00 65.23  ?  185 PHE A CG     1 
ATOM 2978  C CD1    . PHE A 1 181 ? 30.336  -9.745  -42.289 1.00 72.02  ?  185 PHE A CD1    1 
ATOM 2979  C CD2    . PHE A 1 181 ? 28.131  -9.015  -41.770 1.00 56.15  ?  185 PHE A CD2    1 
ATOM 2980  C CE1    . PHE A 1 181 ? 30.142  -9.397  -43.609 1.00 69.15  ?  185 PHE A CE1    1 
ATOM 2981  C CE2    . PHE A 1 181 ? 27.933  -8.666  -43.089 1.00 46.48  ?  185 PHE A CE2    1 
ATOM 2982  C CZ     . PHE A 1 181 ? 28.940  -8.856  -44.009 1.00 62.60  ?  185 PHE A CZ     1 
ATOM 2983  H H      . PHE A 1 181 ? 27.577  -11.595 -39.458 1.00 61.74  ?  185 PHE A H      1 
ATOM 2984  H HA     . PHE A 1 181 ? 30.163  -11.863 -40.241 1.00 74.33  ?  185 PHE A HA     1 
ATOM 2985  H HB2    . PHE A 1 181 ? 28.843  -9.515  -39.397 1.00 77.48  ?  185 PHE A HB2    1 
ATOM 2986  H HB3    . PHE A 1 181 ? 30.408  -9.581  -39.648 1.00 77.48  ?  185 PHE A HB3    1 
ATOM 2987  H HD1    . PHE A 1 181 ? 31.149  -10.111 -42.024 1.00 86.42  ?  185 PHE A HD1    1 
ATOM 2988  H HD2    . PHE A 1 181 ? 27.447  -8.885  -41.153 1.00 67.38  ?  185 PHE A HD2    1 
ATOM 2989  H HE1    . PHE A 1 181 ? 30.823  -9.527  -44.229 1.00 82.98  ?  185 PHE A HE1    1 
ATOM 2990  H HE2    . PHE A 1 181 ? 27.120  -8.301  -43.357 1.00 55.77  ?  185 PHE A HE2    1 
ATOM 2991  H HZ     . PHE A 1 181 ? 28.808  -8.621  -44.899 1.00 75.12  ?  185 PHE A HZ     1 
ATOM 2992  N N      . GLN A 1 182 ? 29.269  -12.505 -37.446 1.00 65.80  ?  186 GLN A N      1 
ATOM 2993  C CA     . GLN A 1 182 ? 29.492  -12.549 -36.005 1.00 69.78  ?  186 GLN A CA     1 
ATOM 2994  C C      . GLN A 1 182 ? 30.846  -13.154 -35.657 1.00 86.73  ?  186 GLN A C      1 
ATOM 2995  O O      . GLN A 1 182 ? 31.557  -12.630 -34.790 1.00 86.87  ?  186 GLN A O      1 
ATOM 2996  C CB     . GLN A 1 182 ? 28.360  -13.320 -35.330 1.00 67.89  ?  186 GLN A CB     1 
ATOM 2997  C CG     . GLN A 1 182 ? 27.130  -12.467 -35.073 1.00 55.66  ?  186 GLN A CG     1 
ATOM 2998  C CD     . GLN A 1 182 ? 25.972  -13.256 -34.507 1.00 52.78  ?  186 GLN A CD     1 
ATOM 2999  O OE1    . GLN A 1 182 ? 25.823  -13.372 -33.293 1.00 66.15  ?  186 GLN A OE1    1 
ATOM 3000  N NE2    . GLN A 1 182 ? 25.140  -13.800 -35.385 1.00 63.96  ?  186 GLN A NE2    1 
ATOM 3001  H H      . GLN A 1 182 ? 28.654  -13.035 -37.731 1.00 78.97  ?  186 GLN A H      1 
ATOM 3002  H HA     . GLN A 1 182 ? 29.477  -11.643 -35.660 1.00 83.74  ?  186 GLN A HA     1 
ATOM 3003  H HB2    . GLN A 1 182 ? 28.098  -14.059 -35.901 1.00 81.47  ?  186 GLN A HB2    1 
ATOM 3004  H HB3    . GLN A 1 182 ? 28.674  -13.657 -34.476 1.00 81.47  ?  186 GLN A HB3    1 
ATOM 3005  H HG2    . GLN A 1 182 ? 27.357  -11.770 -34.438 1.00 66.80  ?  186 GLN A HG2    1 
ATOM 3006  H HG3    . GLN A 1 182 ? 26.841  -12.070 -35.910 1.00 66.80  ?  186 GLN A HG3    1 
ATOM 3007  H HE21   . GLN A 1 182 ? 25.274  -13.693 -36.228 1.00 76.75  ?  186 GLN A HE21   1 
ATOM 3008  H HE22   . GLN A 1 182 ? 24.466  -14.258 -35.112 1.00 76.75  ?  186 GLN A HE22   1 
ATOM 3009  N N      . ASP A 1 183 ? 31.224  -14.249 -36.306 1.00 95.28  ?  187 ASP A N      1 
ATOM 3010  C CA     . ASP A 1 183 ? 32.518  -14.865 -36.029 1.00 94.17  ?  187 ASP A CA     1 
ATOM 3011  C C      . ASP A 1 183 ? 33.650  -13.968 -36.516 1.00 88.54  ?  187 ASP A C      1 
ATOM 3012  O O      . ASP A 1 183 ? 33.955  -12.950 -35.896 1.00 80.79  ?  187 ASP A O      1 
ATOM 3013  C CB     . ASP A 1 183 ? 32.620  -16.245 -36.681 1.00 94.37  ?  187 ASP A CB     1 
ATOM 3014  C CG     . ASP A 1 183 ? 32.174  -17.360 -35.757 1.00 104.45 ?  187 ASP A CG     1 
ATOM 3015  O OD1    . ASP A 1 183 ? 32.976  -17.769 -34.891 1.00 100.03 ?  187 ASP A OD1    1 
ATOM 3016  O OD2    . ASP A 1 183 ? 31.025  -17.829 -35.895 1.00 106.21 -1 187 ASP A OD2    1 
ATOM 3017  H H      . ASP A 1 183 ? 30.757  -14.652 -36.905 1.00 114.34 ?  187 ASP A H      1 
ATOM 3018  H HA     . ASP A 1 183 ? 32.615  -14.979 -35.071 1.00 113.00 ?  187 ASP A HA     1 
ATOM 3019  H HB2    . ASP A 1 183 ? 32.056  -16.265 -37.470 1.00 113.24 ?  187 ASP A HB2    1 
ATOM 3020  H HB3    . ASP A 1 183 ? 33.543  -16.411 -36.929 1.00 113.24 ?  187 ASP A HB3    1 
ATOM 3021  N N      . GLU A 1 201 ? 32.786  -7.394  -34.185 1.00 75.93  ?  205 GLU A N      1 
ATOM 3022  C CA     . GLU A 1 201 ? 32.103  -6.130  -33.945 1.00 70.08  ?  205 GLU A CA     1 
ATOM 3023  C C      . GLU A 1 201 ? 30.602  -6.284  -34.139 1.00 61.48  ?  205 GLU A C      1 
ATOM 3024  O O      . GLU A 1 201 ? 29.811  -5.618  -33.473 1.00 66.69  ?  205 GLU A O      1 
ATOM 3025  C CB     . GLU A 1 201 ? 32.643  -5.042  -34.875 1.00 69.17  ?  205 GLU A CB     1 
ATOM 3026  C CG     . GLU A 1 201 ? 32.065  -3.658  -34.619 1.00 81.70  ?  205 GLU A CG     1 
ATOM 3027  C CD     . GLU A 1 201 ? 32.530  -2.636  -35.639 1.00 88.23  ?  205 GLU A CD     1 
ATOM 3028  O OE1    . GLU A 1 201 ? 31.767  -2.347  -36.584 1.00 54.89  ?  205 GLU A OE1    1 
ATOM 3029  O OE2    . GLU A 1 201 ? 33.663  -2.129  -35.500 1.00 96.69  -1 205 GLU A OE2    1 
ATOM 3030  H HA     . GLU A 1 201 ? 32.263  -5.851  -33.030 1.00 84.09  ?  205 GLU A HA     1 
ATOM 3031  H HB2    . GLU A 1 201 ? 33.605  -4.986  -34.762 1.00 83.01  ?  205 GLU A HB2    1 
ATOM 3032  H HB3    . GLU A 1 201 ? 32.435  -5.285  -35.791 1.00 83.01  ?  205 GLU A HB3    1 
ATOM 3033  H HG2    . GLU A 1 201 ? 31.097  -3.706  -34.662 1.00 98.04  ?  205 GLU A HG2    1 
ATOM 3034  H HG3    . GLU A 1 201 ? 32.344  -3.355  -33.741 1.00 98.04  ?  205 GLU A HG3    1 
ATOM 3035  N N      . ALA A 1 202 ? 30.212  -7.166  -35.060 1.00 54.93  ?  206 ALA A N      1 
ATOM 3036  C CA     . ALA A 1 202 ? 28.792  -7.370  -35.327 1.00 55.73  ?  206 ALA A CA     1 
ATOM 3037  C C      . ALA A 1 202 ? 28.058  -7.812  -34.070 1.00 58.10  ?  206 ALA A C      1 
ATOM 3038  O O      . ALA A 1 202 ? 26.934  -7.369  -33.810 1.00 64.39  ?  206 ALA A O      1 
ATOM 3039  C CB     . ALA A 1 202 ? 28.611  -8.395  -36.443 1.00 64.06  ?  206 ALA A CB     1 
ATOM 3040  H H      . ALA A 1 202 ? 30.740  -7.650  -35.535 1.00 65.92  ?  206 ALA A H      1 
ATOM 3041  H HA     . ALA A 1 202 ? 28.403  -6.532  -35.622 1.00 66.87  ?  206 ALA A HA     1 
ATOM 3042  H HB1    . ALA A 1 202 ? 27.663  -8.519  -36.607 1.00 76.87  ?  206 ALA A HB1    1 
ATOM 3043  H HB2    . ALA A 1 202 ? 29.046  -8.068  -37.246 1.00 76.87  ?  206 ALA A HB2    1 
ATOM 3044  H HB3    . ALA A 1 202 ? 29.011  -9.235  -36.169 1.00 76.87  ?  206 ALA A HB3    1 
ATOM 3045  N N      . THR A 1 203 ? 28.681  -8.680  -33.272 1.00 65.53  ?  207 THR A N      1 
ATOM 3046  C CA     . THR A 1 203 ? 28.058  -9.119  -32.029 1.00 68.95  ?  207 THR A CA     1 
ATOM 3047  C C      . THR A 1 203 ? 27.707  -7.928  -31.147 1.00 66.25  ?  207 THR A C      1 
ATOM 3048  O O      . THR A 1 203 ? 26.585  -7.824  -30.640 1.00 63.28  ?  207 THR A O      1 
ATOM 3049  C CB     . THR A 1 203 ? 28.989  -10.081 -31.291 1.00 73.51  ?  207 THR A CB     1 
ATOM 3050  O OG1    . THR A 1 203 ? 30.272  -9.467  -31.114 1.00 76.57  ?  207 THR A OG1    1 
ATOM 3051  C CG2    . THR A 1 203 ? 29.153  -11.371 -32.077 1.00 71.85  ?  207 THR A CG2    1 
ATOM 3052  H H      . THR A 1 203 ? 29.455  -9.023  -33.426 1.00 78.63  ?  207 THR A H      1 
ATOM 3053  H HA     . THR A 1 203 ? 27.237  -9.594  -32.236 1.00 82.74  ?  207 THR A HA     1 
ATOM 3054  H HB     . THR A 1 203 ? 28.611  -10.295 -30.424 1.00 88.21  ?  207 THR A HB     1 
ATOM 3055  H HG1    . THR A 1 203 ? 30.788  -9.991  -30.709 1.00 91.88  ?  207 THR A HG1    1 
ATOM 3056  H HG21   . THR A 1 203 ? 29.745  -11.975 -31.602 1.00 86.22  ?  207 THR A HG21   1 
ATOM 3057  H HG22   . THR A 1 203 ? 28.291  -11.801 -32.192 1.00 86.22  ?  207 THR A HG22   1 
ATOM 3058  H HG23   . THR A 1 203 ? 29.531  -11.182 -32.950 1.00 86.22  ?  207 THR A HG23   1 
ATOM 3059  N N      . ARG A 1 204 ? 28.657  -7.008  -30.967 1.00 64.86  ?  208 ARG A N      1 
ATOM 3060  C CA     . ARG A 1 204 ? 28.416  -5.830  -30.139 1.00 62.44  ?  208 ARG A CA     1 
ATOM 3061  C C      . ARG A 1 204 ? 27.137  -5.114  -30.554 1.00 55.40  ?  208 ARG A C      1 
ATOM 3062  O O      . ARG A 1 204 ? 26.287  -4.796  -29.715 1.00 46.87  ?  208 ARG A O      1 
ATOM 3063  C CB     . ARG A 1 204 ? 29.613  -4.882  -30.230 1.00 72.53  ?  208 ARG A CB     1 
ATOM 3064  C CG     . ARG A 1 204 ? 30.812  -5.318  -29.408 1.00 82.59  ?  208 ARG A CG     1 
ATOM 3065  C CD     . ARG A 1 204 ? 30.736  -4.791  -27.984 1.00 104.69 ?  208 ARG A CD     1 
ATOM 3066  N NE     . ARG A 1 204 ? 31.596  -3.627  -27.785 1.00 100.28 ?  208 ARG A NE     1 
ATOM 3067  C CZ     . ARG A 1 204 ? 31.663  -2.925  -26.657 1.00 93.98  ?  208 ARG A CZ     1 
ATOM 3068  N NH1    . ARG A 1 204 ? 30.914  -3.258  -25.615 1.00 99.75  1  208 ARG A NH1    1 
ATOM 3069  N NH2    . ARG A 1 204 ? 32.479  -1.885  -26.573 1.00 84.77  ?  208 ARG A NH2    1 
ATOM 3070  H H      . ARG A 1 204 ? 29.444  -7.044  -31.311 1.00 77.84  ?  208 ARG A H      1 
ATOM 3071  H HA     . ARG A 1 204 ? 28.320  -6.107  -29.214 1.00 74.92  ?  208 ARG A HA     1 
ATOM 3072  H HB2    . ARG A 1 204 ? 29.895  -4.824  -31.156 1.00 87.04  ?  208 ARG A HB2    1 
ATOM 3073  H HB3    . ARG A 1 204 ? 29.341  -4.006  -29.914 1.00 87.04  ?  208 ARG A HB3    1 
ATOM 3074  H HG2    . ARG A 1 204 ? 30.840  -6.287  -29.372 1.00 99.11  ?  208 ARG A HG2    1 
ATOM 3075  H HG3    . ARG A 1 204 ? 31.622  -4.974  -29.816 1.00 99.11  ?  208 ARG A HG3    1 
ATOM 3076  H HD2    . ARG A 1 204 ? 29.823  -4.528  -27.789 1.00 125.62 ?  208 ARG A HD2    1 
ATOM 3077  H HD3    . ARG A 1 204 ? 31.022  -5.486  -27.371 1.00 125.62 ?  208 ARG A HD3    1 
ATOM 3078  H HE     . ARG A 1 204 ? 32.093  -3.379  -28.442 1.00 120.33 ?  208 ARG A HE     1 
ATOM 3079  H HH11   . ARG A 1 204 ? 30.384  -3.932  -25.664 1.00 119.70 ?  208 ARG A HH11   1 
ATOM 3080  H HH12   . ARG A 1 204 ? 30.961  -2.799  -24.888 1.00 119.70 ?  208 ARG A HH12   1 
ATOM 3081  H HH21   . ARG A 1 204 ? 32.966  -1.664  -27.247 1.00 101.73 ?  208 ARG A HH21   1 
ATOM 3082  H HH22   . ARG A 1 204 ? 32.521  -1.429  -25.845 1.00 101.73 ?  208 ARG A HH22   1 
ATOM 3083  N N      . THR A 1 205 ? 26.983  -4.855  -31.853 1.00 47.47  ?  209 THR A N      1 
ATOM 3084  C CA     . THR A 1 205 ? 25.820  -4.110  -32.322 1.00 55.70  ?  209 THR A CA     1 
ATOM 3085  C C      . THR A 1 205 ? 24.527  -4.859  -32.025 1.00 62.52  ?  209 THR A C      1 
ATOM 3086  O O      . THR A 1 205 ? 23.526  -4.250  -31.630 1.00 55.84  ?  209 THR A O      1 
ATOM 3087  C CB     . THR A 1 205 ? 25.945  -3.832  -33.820 1.00 54.63  ?  209 THR A CB     1 
ATOM 3088  O OG1    . THR A 1 205 ? 27.169  -3.134  -34.074 1.00 56.17  ?  209 THR A OG1    1 
ATOM 3089  C CG2    . THR A 1 205 ? 24.779  -2.988  -34.314 1.00 62.52  ?  209 THR A CG2    1 
ATOM 3090  H H      . THR A 1 205 ? 27.529  -5.095  -32.472 1.00 56.97  ?  209 THR A H      1 
ATOM 3091  H HA     . THR A 1 205 ? 25.784  -3.257  -31.861 1.00 66.84  ?  209 THR A HA     1 
ATOM 3092  H HB     . THR A 1 205 ? 25.945  -4.672  -34.306 1.00 65.56  ?  209 THR A HB     1 
ATOM 3093  H HG1    . THR A 1 205 ? 27.245  -2.977  -34.896 1.00 67.41  ?  209 THR A HG1    1 
ATOM 3094  H HG21   . THR A 1 205 ? 24.871  -2.820  -35.264 1.00 75.03  ?  209 THR A HG21   1 
ATOM 3095  H HG22   . THR A 1 205 ? 23.943  -3.454  -34.156 1.00 75.03  ?  209 THR A HG22   1 
ATOM 3096  H HG23   . THR A 1 205 ? 24.761  -2.140  -33.843 1.00 75.03  ?  209 THR A HG23   1 
ATOM 3097  N N      . LEU A 1 206 ? 24.526  -6.182  -32.205 1.00 66.67  ?  210 LEU A N      1 
ATOM 3098  C CA     . LEU A 1 206 ? 23.308  -6.948  -31.971 1.00 50.93  ?  210 LEU A CA     1 
ATOM 3099  C C      . LEU A 1 206 ? 22.955  -6.985  -30.491 1.00 54.00  ?  210 LEU A C      1 
ATOM 3100  O O      . LEU A 1 206 ? 21.774  -6.945  -30.128 1.00 54.29  ?  210 LEU A O      1 
ATOM 3101  C CB     . LEU A 1 206 ? 23.458  -8.363  -32.526 1.00 49.17  ?  210 LEU A CB     1 
ATOM 3102  C CG     . LEU A 1 206 ? 23.145  -8.511  -34.015 1.00 44.78  ?  210 LEU A CG     1 
ATOM 3103  C CD1    . LEU A 1 206 ? 24.296  -8.013  -34.864 1.00 43.78  ?  210 LEU A CD1    1 
ATOM 3104  C CD2    . LEU A 1 206 ? 22.840  -9.953  -34.352 1.00 65.21  ?  210 LEU A CD2    1 
ATOM 3105  H H      . LEU A 1 206 ? 25.204  -6.648  -32.457 1.00 80.01  ?  210 LEU A H      1 
ATOM 3106  H HA     . LEU A 1 206 ? 22.574  -6.522  -32.441 1.00 61.11  ?  210 LEU A HA     1 
ATOM 3107  H HB2    . LEU A 1 206 ? 24.374  -8.652  -32.389 1.00 59.00  ?  210 LEU A HB2    1 
ATOM 3108  H HB3    . LEU A 1 206 ? 22.857  -8.950  -32.041 1.00 59.00  ?  210 LEU A HB3    1 
ATOM 3109  H HG     . LEU A 1 206 ? 22.362  -7.980  -34.229 1.00 53.73  ?  210 LEU A HG     1 
ATOM 3110  H HD11   . LEU A 1 206 ? 24.066  -8.120  -35.800 1.00 52.54  ?  210 LEU A HD11   1 
ATOM 3111  H HD12   . LEU A 1 206 ? 24.451  -7.076  -34.666 1.00 52.54  ?  210 LEU A HD12   1 
ATOM 3112  H HD13   . LEU A 1 206 ? 25.088  -8.532  -34.656 1.00 52.54  ?  210 LEU A HD13   1 
ATOM 3113  H HD21   . LEU A 1 206 ? 22.646  -10.021 -35.300 1.00 78.25  ?  210 LEU A HD21   1 
ATOM 3114  H HD22   . LEU A 1 206 ? 23.612  -10.498 -34.133 1.00 78.25  ?  210 LEU A HD22   1 
ATOM 3115  H HD23   . LEU A 1 206 ? 22.073  -10.242 -33.834 1.00 78.25  ?  210 LEU A HD23   1 
ATOM 3116  N N      . VAL A 1 207 ? 23.962  -7.061  -29.619 1.00 51.67  ?  211 VAL A N      1 
ATOM 3117  C CA     . VAL A 1 207 ? 23.696  -6.982  -28.188 1.00 41.77  ?  211 VAL A CA     1 
ATOM 3118  C C      . VAL A 1 207 ? 23.085  -5.635  -27.840 1.00 51.87  ?  211 VAL A C      1 
ATOM 3119  O O      . VAL A 1 207 ? 22.280  -5.529  -26.908 1.00 60.22  ?  211 VAL A O      1 
ATOM 3120  C CB     . VAL A 1 207 ? 24.986  -7.239  -27.386 1.00 51.30  ?  211 VAL A CB     1 
ATOM 3121  C CG1    . VAL A 1 207 ? 24.725  -7.100  -25.895 1.00 46.48  ?  211 VAL A CG1    1 
ATOM 3122  C CG2    . VAL A 1 207 ? 25.531  -8.620  -27.691 1.00 55.94  ?  211 VAL A CG2    1 
ATOM 3123  H H      . VAL A 1 207 ? 24.791  -7.156  -29.827 1.00 62.00  ?  211 VAL A H      1 
ATOM 3124  H HA     . VAL A 1 207 ? 23.055  -7.670  -27.949 1.00 50.12  ?  211 VAL A HA     1 
ATOM 3125  H HB     . VAL A 1 207 ? 25.655  -6.584  -27.639 1.00 61.56  ?  211 VAL A HB     1 
ATOM 3126  H HG11   . VAL A 1 207 ? 25.550  -7.265  -25.414 1.00 55.77  ?  211 VAL A HG11   1 
ATOM 3127  H HG12   . VAL A 1 207 ? 24.410  -6.201  -25.713 1.00 55.77  ?  211 VAL A HG12   1 
ATOM 3128  H HG13   . VAL A 1 207 ? 24.052  -7.746  -25.631 1.00 55.77  ?  211 VAL A HG13   1 
ATOM 3129  H HG21   . VAL A 1 207 ? 26.342  -8.759  -27.177 1.00 67.12  ?  211 VAL A HG21   1 
ATOM 3130  H HG22   . VAL A 1 207 ? 24.866  -9.282  -27.448 1.00 67.12  ?  211 VAL A HG22   1 
ATOM 3131  H HG23   . VAL A 1 207 ? 25.727  -8.679  -28.640 1.00 67.12  ?  211 VAL A HG23   1 
ATOM 3132  N N      . ALA A 1 208 ? 23.457  -4.586  -28.573 1.00 59.33  ?  212 ALA A N      1 
ATOM 3133  C CA     . ALA A 1 208 ? 22.884  -3.270  -28.320 1.00 55.46  ?  212 ALA A CA     1 
ATOM 3134  C C      . ALA A 1 208 ? 21.458  -3.169  -28.842 1.00 55.80  ?  212 ALA A C      1 
ATOM 3135  O O      . ALA A 1 208 ? 20.633  -2.463  -28.252 1.00 61.84  ?  212 ALA A O      1 
ATOM 3136  C CB     . ALA A 1 208 ? 23.756  -2.190  -28.955 1.00 57.49  ?  212 ALA A CB     1 
ATOM 3137  H H      . ALA A 1 208 ? 24.030  -4.610  -29.214 1.00 71.20  ?  212 ALA A H      1 
ATOM 3138  H HA     . ALA A 1 208 ? 22.864  -3.114  -27.362 1.00 66.55  ?  212 ALA A HA     1 
ATOM 3139  H HB1    . ALA A 1 208 ? 23.362  -1.322  -28.778 1.00 68.99  ?  212 ALA A HB1    1 
ATOM 3140  H HB2    . ALA A 1 208 ? 24.645  -2.235  -28.570 1.00 68.99  ?  212 ALA A HB2    1 
ATOM 3141  H HB3    . ALA A 1 208 ? 23.801  -2.344  -29.912 1.00 68.99  ?  212 ALA A HB3    1 
ATOM 3142  N N      . SER A 1 209 ? 21.148  -3.865  -29.937 1.00 48.66  ?  213 SER A N      1 
ATOM 3143  C CA     . SER A 1 209 ? 19.817  -3.777  -30.524 1.00 53.64  ?  213 SER A CA     1 
ATOM 3144  C C      . SER A 1 209 ? 18.802  -4.636  -29.785 1.00 52.62  ?  213 SER A C      1 
ATOM 3145  O O      . SER A 1 209 ? 17.617  -4.287  -29.743 1.00 48.30  ?  213 SER A O      1 
ATOM 3146  C CB     . SER A 1 209 ? 19.868  -4.183  -31.995 1.00 55.10  ?  213 SER A CB     1 
ATOM 3147  O OG     . SER A 1 209 ? 20.455  -3.162  -32.781 1.00 60.92  ?  213 SER A OG     1 
ATOM 3148  H H      . SER A 1 209 ? 21.687  -4.389  -30.354 1.00 58.40  ?  213 SER A H      1 
ATOM 3149  H HA     . SER A 1 209 ? 19.515  -2.856  -30.479 1.00 64.37  ?  213 SER A HA     1 
ATOM 3150  H HB2    . SER A 1 209 ? 20.397  -4.991  -32.081 1.00 66.13  ?  213 SER A HB2    1 
ATOM 3151  H HB3    . SER A 1 209 ? 18.965  -4.343  -32.310 1.00 66.13  ?  213 SER A HB3    1 
ATOM 3152  H HG     . SER A 1 209 ? 20.477  -3.397  -33.587 1.00 73.11  ?  213 SER A HG     1 
ATOM 3153  N N      . ILE A 1 210 ? 19.234  -5.758  -29.205 1.00 50.80  ?  214 ILE A N      1 
ATOM 3154  C CA     . ILE A 1 210 ? 18.312  -6.604  -28.460 1.00 48.23  ?  214 ILE A CA     1 
ATOM 3155  C C      . ILE A 1 210 ? 17.833  -5.923  -27.189 1.00 54.98  ?  214 ILE A C      1 
ATOM 3156  O O      . ILE A 1 210 ? 16.838  -6.353  -26.597 1.00 54.91  ?  214 ILE A O      1 
ATOM 3157  C CB     . ILE A 1 210 ? 18.969  -7.957  -28.128 1.00 59.19  ?  214 ILE A CB     1 
ATOM 3158  C CG1    . ILE A 1 210 ? 17.953  -8.894  -27.468 1.00 58.98  ?  214 ILE A CG1    1 
ATOM 3159  C CG2    . ILE A 1 210 ? 20.179  -7.754  -27.229 1.00 53.18  ?  214 ILE A CG2    1 
ATOM 3160  C CD1    . ILE A 1 210 ? 18.465  -10.297 -27.235 1.00 61.14  ?  214 ILE A CD1    1 
ATOM 3161  H H      . ILE A 1 210 ? 20.045  -6.044  -29.230 1.00 60.96  ?  214 ILE A H      1 
ATOM 3162  H HA     . ILE A 1 210 ? 17.535  -6.780  -29.013 1.00 57.87  ?  214 ILE A HA     1 
ATOM 3163  H HB     . ILE A 1 210 ? 19.268  -8.364  -28.956 1.00 71.03  ?  214 ILE A HB     1 
ATOM 3164  H HG12   . ILE A 1 210 ? 17.702  -8.525  -26.607 1.00 70.78  ?  214 ILE A HG12   1 
ATOM 3165  H HG13   . ILE A 1 210 ? 17.171  -8.956  -28.038 1.00 70.78  ?  214 ILE A HG13   1 
ATOM 3166  H HG21   . ILE A 1 210 ? 20.575  -8.617  -27.033 1.00 63.81  ?  214 ILE A HG21   1 
ATOM 3167  H HG22   . ILE A 1 210 ? 20.822  -7.191  -27.688 1.00 63.81  ?  214 ILE A HG22   1 
ATOM 3168  H HG23   . ILE A 1 210 ? 19.893  -7.327  -26.407 1.00 63.81  ?  214 ILE A HG23   1 
ATOM 3169  H HD11   . ILE A 1 210 ? 17.765  -10.823 -26.817 1.00 73.37  ?  214 ILE A HD11   1 
ATOM 3170  H HD12   . ILE A 1 210 ? 18.709  -10.689 -28.088 1.00 73.37  ?  214 ILE A HD12   1 
ATOM 3171  H HD13   . ILE A 1 210 ? 19.241  -10.257 -26.655 1.00 73.37  ?  214 ILE A HD13   1 
ATOM 3172  N N      . GLN A 1 211 ? 18.517  -4.871  -26.749 1.00 68.14  ?  215 GLN A N      1 
ATOM 3173  C CA     . GLN A 1 211 ? 18.180  -4.174  -25.513 1.00 62.78  ?  215 GLN A CA     1 
ATOM 3174  C C      . GLN A 1 211 ? 17.569  -2.801  -25.735 1.00 56.72  ?  215 GLN A C      1 
ATOM 3175  O O      . GLN A 1 211 ? 16.647  -2.419  -25.013 1.00 42.13  ?  215 GLN A O      1 
ATOM 3176  C CB     . GLN A 1 211 ? 19.431  -4.022  -24.642 1.00 56.10  ?  215 GLN A CB     1 
ATOM 3177  C CG     . GLN A 1 211 ? 19.815  -5.271  -23.878 1.00 49.52  ?  215 GLN A CG     1 
ATOM 3178  C CD     . GLN A 1 211 ? 20.857  -4.999  -22.818 1.00 46.88  ?  215 GLN A CD     1 
ATOM 3179  O OE1    . GLN A 1 211 ? 21.610  -4.031  -22.906 1.00 48.02  ?  215 GLN A OE1    1 
ATOM 3180  N NE2    . GLN A 1 211 ? 20.900  -5.847  -21.801 1.00 51.10  ?  215 GLN A NE2    1 
ATOM 3181  H H      . GLN A 1 211 ? 19.194  -4.535  -27.158 1.00 81.76  ?  215 GLN A H      1 
ATOM 3182  H HA     . GLN A 1 211 ? 17.538  -4.708  -25.020 1.00 75.33  ?  215 GLN A HA     1 
ATOM 3183  H HB2    . GLN A 1 211 ? 20.179  -3.783  -25.211 1.00 67.32  ?  215 GLN A HB2    1 
ATOM 3184  H HB3    . GLN A 1 211 ? 19.275  -3.317  -23.994 1.00 67.32  ?  215 GLN A HB3    1 
ATOM 3185  H HG2    . GLN A 1 211 ? 19.027  -5.631  -23.441 1.00 59.42  ?  215 GLN A HG2    1 
ATOM 3186  H HG3    . GLN A 1 211 ? 20.178  -5.923  -24.498 1.00 59.42  ?  215 GLN A HG3    1 
ATOM 3187  H HE21   . GLN A 1 211 ? 20.352  -6.510  -21.770 1.00 61.31  ?  215 GLN A HE21   1 
ATOM 3188  H HE22   . GLN A 1 211 ? 21.475  -5.736  -21.171 1.00 61.31  ?  215 GLN A HE22   1 
ATOM 3189  N N      . ASN A 1 212 ? 18.055  -2.052  -26.722 1.00 48.63  ?  216 ASN A N      1 
ATOM 3190  C CA     . ASN A 1 212 ? 17.688  -0.655  -26.888 1.00 41.11  ?  216 ASN A CA     1 
ATOM 3191  C C      . ASN A 1 212 ? 16.773  -0.399  -28.076 1.00 40.77  ?  216 ASN A C      1 
ATOM 3192  O O      . ASN A 1 212 ? 16.480  0.764   -28.367 1.00 56.22  ?  216 ASN A O      1 
ATOM 3193  C CB     . ASN A 1 212 ? 18.952  0.196   -27.036 1.00 62.57  ?  216 ASN A CB     1 
ATOM 3194  C CG     . ASN A 1 212 ? 19.816  0.176   -25.792 1.00 54.17  ?  216 ASN A CG     1 
ATOM 3195  O OD1    . ASN A 1 212 ? 19.561  0.902   -24.832 1.00 50.33  ?  216 ASN A OD1    1 
ATOM 3196  N ND2    . ASN A 1 212 ? 20.848  -0.657  -25.805 1.00 45.10  ?  216 ASN A ND2    1 
ATOM 3197  H H      . ASN A 1 212 ? 18.607  -2.337  -27.316 1.00 58.36  ?  216 ASN A H      1 
ATOM 3198  H HA     . ASN A 1 212 ? 17.224  -0.359  -26.090 1.00 49.33  ?  216 ASN A HA     1 
ATOM 3199  H HB2    . ASN A 1 212 ? 19.480  -0.147  -27.774 1.00 75.09  ?  216 ASN A HB2    1 
ATOM 3200  H HB3    . ASN A 1 212 ? 18.697  1.115   -27.209 1.00 75.09  ?  216 ASN A HB3    1 
ATOM 3201  H HD21   . ASN A 1 212 ? 21.370  -0.706  -25.123 1.00 54.12  ?  216 ASN A HD21   1 
ATOM 3202  H HD22   . ASN A 1 212 ? 20.996  -1.147  -26.495 1.00 54.12  ?  216 ASN A HD22   1 
ATOM 3203  N N      . ASP A 1 213 ? 16.317  -1.426  -28.758 1.00 32.34  ?  217 ASP A N      1 
ATOM 3204  C CA     . ASP A 1 213 ? 15.485  -1.199  -29.934 1.00 38.88  ?  217 ASP A CA     1 
ATOM 3205  C C      . ASP A 1 213 ? 14.017  -1.157  -29.529 1.00 34.63  ?  217 ASP A C      1 
ATOM 3206  O O      . ASP A 1 213 ? 13.565  -2.034  -28.788 1.00 31.33  ?  217 ASP A O      1 
ATOM 3207  C CB     . ASP A 1 213 ? 15.697  -2.291  -30.967 1.00 36.07  ?  217 ASP A CB     1 
ATOM 3208  C CG     . ASP A 1 213 ? 14.992  -1.998  -32.272 1.00 50.74  ?  217 ASP A CG     1 
ATOM 3209  O OD1    . ASP A 1 213 ? 15.686  -1.729  -33.274 1.00 48.24  ?  217 ASP A OD1    1 
ATOM 3210  O OD2    . ASP A 1 213 ? 13.745  -2.025  -32.294 1.00 47.29  -1 217 ASP A OD2    1 
ATOM 3211  H H      . ASP A 1 213 ? 16.466  -2.252  -28.572 1.00 38.81  ?  217 ASP A H      1 
ATOM 3212  H HA     . ASP A 1 213 ? 15.717  -0.347  -30.335 1.00 46.65  ?  217 ASP A HA     1 
ATOM 3213  H HB2    . ASP A 1 213 ? 16.646  -2.373  -31.149 1.00 43.29  ?  217 ASP A HB2    1 
ATOM 3214  H HB3    . ASP A 1 213 ? 15.351  -3.128  -30.619 1.00 43.29  ?  217 ASP A HB3    1 
ATOM 3215  N N      . PRO A 1 214 ? 13.243  -0.168  -29.983 1.00 46.23  ?  218 PRO A N      1 
ATOM 3216  C CA     . PRO A 1 214 ? 11.833  -0.116  -29.566 1.00 43.90  ?  218 PRO A CA     1 
ATOM 3217  C C      . PRO A 1 214 ? 10.980  -1.201  -30.194 1.00 43.60  ?  218 PRO A C      1 
ATOM 3218  O O      . PRO A 1 214 ? 10.055  -1.705  -29.546 1.00 48.52  ?  218 PRO A O      1 
ATOM 3219  C CB     . PRO A 1 214 ? 11.393  1.284   -30.009 1.00 43.29  ?  218 PRO A CB     1 
ATOM 3220  C CG     . PRO A 1 214 ? 12.282  1.606   -31.153 1.00 56.39  ?  218 PRO A CG     1 
ATOM 3221  C CD     . PRO A 1 214 ? 13.606  0.974   -30.840 1.00 54.09  ?  218 PRO A CD     1 
ATOM 3222  H HA     . PRO A 1 214 ? 11.768  -0.179  -28.600 1.00 52.68  ?  218 PRO A HA     1 
ATOM 3223  H HB2    . PRO A 1 214 ? 10.465  1.264   -30.289 1.00 51.95  ?  218 PRO A HB2    1 
ATOM 3224  H HB3    . PRO A 1 214 ? 11.522  1.915   -29.284 1.00 51.95  ?  218 PRO A HB3    1 
ATOM 3225  H HG2    . PRO A 1 214 ? 11.911  1.232   -31.967 1.00 67.67  ?  218 PRO A HG2    1 
ATOM 3226  H HG3    . PRO A 1 214 ? 12.375  2.568   -31.232 1.00 67.67  ?  218 PRO A HG3    1 
ATOM 3227  H HD2    . PRO A 1 214 ? 14.034  0.664   -31.653 1.00 64.91  ?  218 PRO A HD2    1 
ATOM 3228  H HD3    . PRO A 1 214 ? 14.171  1.595   -30.354 1.00 64.91  ?  218 PRO A HD3    1 
ATOM 3229  N N      . SER A 1 215 ? 11.255  -1.572  -31.440 1.00 44.62  ?  219 SER A N      1 
ATOM 3230  C CA     . SER A 1 215 ? 10.461  -2.592  -32.110 1.00 39.53  ?  219 SER A CA     1 
ATOM 3231  C C      . SER A 1 215 ? 10.806  -3.963  -31.548 1.00 47.83  ?  219 SER A C      1 
ATOM 3232  O O      . SER A 1 215 ? 11.963  -4.392  -31.604 1.00 64.72  ?  219 SER A O      1 
ATOM 3233  C CB     . SER A 1 215 ? 10.709  -2.555  -33.614 1.00 46.17  ?  219 SER A CB     1 
ATOM 3234  O OG     . SER A 1 215 ? 9.930   -3.536  -34.277 1.00 39.07  ?  219 SER A OG     1 
ATOM 3235  H H      . SER A 1 215 ? 11.893  -1.249  -31.917 1.00 53.54  ?  219 SER A H      1 
ATOM 3236  H HA     . SER A 1 215 ? 9.519   -2.424  -31.951 1.00 47.43  ?  219 SER A HA     1 
ATOM 3237  H HB2    . SER A 1 215 ? 10.469  -1.678  -33.953 1.00 55.40  ?  219 SER A HB2    1 
ATOM 3238  H HB3    . SER A 1 215 ? 11.648  -2.730  -33.784 1.00 55.40  ?  219 SER A HB3    1 
ATOM 3239  H HG     . SER A 1 215 ? 10.074  -3.507  -35.104 1.00 46.88  ?  219 SER A HG     1 
ATOM 3240  N N      . ALA A 1 216 ? 9.802   -4.653  -31.005 1.00 55.09  ?  220 ALA A N      1 
ATOM 3241  C CA     . ALA A 1 216 ? 10.039  -5.975  -30.439 1.00 34.29  ?  220 ALA A CA     1 
ATOM 3242  C C      . ALA A 1 216 ? 10.543  -6.950  -31.492 1.00 35.34  ?  220 ALA A C      1 
ATOM 3243  O O      . ALA A 1 216 ? 11.336  -7.845  -31.181 1.00 34.90  ?  220 ALA A O      1 
ATOM 3244  C CB     . ALA A 1 216 ? 8.760   -6.505  -29.794 1.00 40.96  ?  220 ALA A CB     1 
ATOM 3245  H H      . ALA A 1 216 ? 8.988   -4.381  -30.953 1.00 66.11  ?  220 ALA A H      1 
ATOM 3246  H HA     . ALA A 1 216 ? 10.716  -5.906  -29.748 1.00 41.15  ?  220 ALA A HA     1 
ATOM 3247  H HB1    . ALA A 1 216 ? 8.934   -7.384  -29.423 1.00 49.16  ?  220 ALA A HB1    1 
ATOM 3248  H HB2    . ALA A 1 216 ? 8.486   -5.896  -29.090 1.00 49.16  ?  220 ALA A HB2    1 
ATOM 3249  H HB3    . ALA A 1 216 ? 8.066   -6.562  -30.470 1.00 49.16  ?  220 ALA A HB3    1 
ATOM 3250  N N      . GLU A 1 217 ? 10.101  -6.794  -32.740 1.00 38.51  ?  221 GLU A N      1 
ATOM 3251  C CA     . GLU A 1 217 ? 10.503  -7.718  -33.792 1.00 31.90  ?  221 GLU A CA     1 
ATOM 3252  C C      . GLU A 1 217 ? 11.971  -7.575  -34.171 1.00 31.22  ?  221 GLU A C      1 
ATOM 3253  O O      . GLU A 1 217 ? 12.543  -8.513  -34.733 1.00 43.66  ?  221 GLU A O      1 
ATOM 3254  C CB     . GLU A 1 217 ? 9.623   -7.518  -35.023 1.00 26.42  ?  221 GLU A CB     1 
ATOM 3255  C CG     . GLU A 1 217 ? 8.133   -7.578  -34.718 1.00 32.97  ?  221 GLU A CG     1 
ATOM 3256  C CD     . GLU A 1 217 ? 7.283   -7.716  -35.963 1.00 63.76  ?  221 GLU A CD     1 
ATOM 3257  O OE1    . GLU A 1 217 ? 7.831   -7.592  -37.077 1.00 52.77  ?  221 GLU A OE1    1 
ATOM 3258  O OE2    . GLU A 1 217 ? 6.066   -7.952  -35.825 1.00 69.79  -1 221 GLU A OE2    1 
ATOM 3259  H H      . GLU A 1 217 ? 9.574   -6.167  -33.000 1.00 46.21  ?  221 GLU A H      1 
ATOM 3260  H HA     . GLU A 1 217 ? 10.368  -8.626  -33.477 1.00 38.28  ?  221 GLU A HA     1 
ATOM 3261  H HB2    . GLU A 1 217 ? 9.813   -6.648  -35.406 1.00 31.71  ?  221 GLU A HB2    1 
ATOM 3262  H HB3    . GLU A 1 217 ? 9.823   -8.214  -35.668 1.00 31.71  ?  221 GLU A HB3    1 
ATOM 3263  H HG2    . GLU A 1 217 ? 7.958   -8.344  -34.149 1.00 39.57  ?  221 GLU A HG2    1 
ATOM 3264  H HG3    . GLU A 1 217 ? 7.870   -6.762  -34.264 1.00 39.57  ?  221 GLU A HG3    1 
ATOM 3265  N N      . VAL A 1 218 ? 12.592  -6.431  -33.888 1.00 29.42  ?  222 VAL A N      1 
ATOM 3266  C CA     . VAL A 1 218 ? 14.034  -6.312  -34.072 1.00 31.72  ?  222 VAL A CA     1 
ATOM 3267  C C      . VAL A 1 218 ? 14.767  -6.963  -32.912 1.00 26.94  ?  222 VAL A C      1 
ATOM 3268  O O      . VAL A 1 218 ? 15.789  -7.628  -33.104 1.00 35.20  ?  222 VAL A O      1 
ATOM 3269  C CB     . VAL A 1 218 ? 14.438  -4.836  -34.227 1.00 40.36  ?  222 VAL A CB     1 
ATOM 3270  C CG1    . VAL A 1 218 ? 15.927  -4.727  -34.517 1.00 44.41  ?  222 VAL A CG1    1 
ATOM 3271  C CG2    . VAL A 1 218 ? 13.630  -4.167  -35.325 1.00 48.01  ?  222 VAL A CG2    1 
ATOM 3272  H H      . VAL A 1 218 ? 12.207  -5.720  -33.594 1.00 35.30  ?  222 VAL A H      1 
ATOM 3273  H HA     . VAL A 1 218 ? 14.287  -6.778  -34.884 1.00 38.07  ?  222 VAL A HA     1 
ATOM 3274  H HB     . VAL A 1 218 ? 14.258  -4.370  -33.396 1.00 48.43  ?  222 VAL A HB     1 
ATOM 3275  H HG11   . VAL A 1 218 ? 16.161  -3.790  -34.611 1.00 53.29  ?  222 VAL A HG11   1 
ATOM 3276  H HG12   . VAL A 1 218 ? 16.421  -5.119  -33.780 1.00 53.29  ?  222 VAL A HG12   1 
ATOM 3277  H HG13   . VAL A 1 218 ? 16.124  -5.202  -35.339 1.00 53.29  ?  222 VAL A HG13   1 
ATOM 3278  H HG21   . VAL A 1 218 ? 13.906  -3.240  -35.400 1.00 57.61  ?  222 VAL A HG21   1 
ATOM 3279  H HG22   . VAL A 1 218 ? 13.792  -4.629  -36.163 1.00 57.61  ?  222 VAL A HG22   1 
ATOM 3280  H HG23   . VAL A 1 218 ? 12.688  -4.215  -35.098 1.00 57.61  ?  222 VAL A HG23   1 
ATOM 3281  N N      . ARG A 1 219 ? 14.268  -6.769  -31.692 1.00 26.73  ?  223 ARG A N      1 
ATOM 3282  C CA     . ARG A 1 219 ? 14.831  -7.462  -30.540 1.00 43.02  ?  223 ARG A CA     1 
ATOM 3283  C C      . ARG A 1 219 ? 14.785  -8.969  -30.747 1.00 47.83  ?  223 ARG A C      1 
ATOM 3284  O O      . ARG A 1 219 ? 15.773  -9.675  -30.516 1.00 49.05  ?  223 ARG A O      1 
ATOM 3285  C CB     . ARG A 1 219 ? 14.067  -7.068  -29.278 1.00 45.22  ?  223 ARG A CB     1 
ATOM 3286  C CG     . ARG A 1 219 ? 14.451  -5.713  -28.722 1.00 26.49  ?  223 ARG A CG     1 
ATOM 3287  C CD     . ARG A 1 219 ? 13.240  -4.929  -28.262 1.00 24.05  ?  223 ARG A CD     1 
ATOM 3288  N NE     . ARG A 1 219 ? 12.308  -5.741  -27.490 1.00 24.07  ?  223 ARG A NE     1 
ATOM 3289  C CZ     . ARG A 1 219 ? 11.069  -5.367  -27.186 1.00 27.22  ?  223 ARG A CZ     1 
ATOM 3290  N NH1    . ARG A 1 219 ? 10.604  -4.196  -27.595 1.00 31.58  1  223 ARG A NH1    1 
ATOM 3291  N NH2    . ARG A 1 219 ? 10.288  -6.169  -26.482 1.00 46.23  ?  223 ARG A NH2    1 
ATOM 3292  H H      . ARG A 1 219 ? 13.611  -6.246  -31.507 1.00 32.07  ?  223 ARG A H      1 
ATOM 3293  H HA     . ARG A 1 219 ? 15.758  -7.199  -30.430 1.00 51.63  ?  223 ARG A HA     1 
ATOM 3294  H HB2    . ARG A 1 219 ? 13.119  -7.046  -29.481 1.00 54.26  ?  223 ARG A HB2    1 
ATOM 3295  H HB3    . ARG A 1 219 ? 14.240  -7.729  -28.590 1.00 54.26  ?  223 ARG A HB3    1 
ATOM 3296  H HG2    . ARG A 1 219 ? 15.040  -5.835  -27.961 1.00 31.79  ?  223 ARG A HG2    1 
ATOM 3297  H HG3    . ARG A 1 219 ? 14.899  -5.200  -29.413 1.00 31.79  ?  223 ARG A HG3    1 
ATOM 3298  H HD2    . ARG A 1 219 ? 13.533  -4.194  -27.701 1.00 28.86  ?  223 ARG A HD2    1 
ATOM 3299  H HD3    . ARG A 1 219 ? 12.769  -4.589  -29.039 1.00 28.86  ?  223 ARG A HD3    1 
ATOM 3300  H HE     . ARG A 1 219 ? 12.593  -6.487  -27.171 1.00 28.88  ?  223 ARG A HE     1 
ATOM 3301  H HH11   . ARG A 1 219 ? 11.106  -3.670  -28.054 1.00 37.90  ?  223 ARG A HH11   1 
ATOM 3302  H HH12   . ARG A 1 219 ? 9.801   -3.960  -27.397 1.00 37.90  ?  223 ARG A HH12   1 
ATOM 3303  N N      . ARG A 1 220 ? 13.636  -9.476  -31.190 1.00 51.33  ?  224 ARG A N      1 
ATOM 3304  C CA     . ARG A 1 220 ? 13.504  -10.898 -31.478 1.00 34.19  ?  224 ARG A CA     1 
ATOM 3305  C C      . ARG A 1 220 ? 14.539  -11.344 -32.502 1.00 31.12  ?  224 ARG A C      1 
ATOM 3306  O O      . ARG A 1 220 ? 15.312  -12.276 -32.256 1.00 44.07  ?  224 ARG A O      1 
ATOM 3307  C CB     . ARG A 1 220 ? 12.085  -11.178 -31.968 1.00 27.73  ?  224 ARG A CB     1 
ATOM 3308  C CG     . ARG A 1 220 ? 11.828  -12.578 -32.470 1.00 16.82  ?  224 ARG A CG     1 
ATOM 3309  C CD     . ARG A 1 220 ? 10.428  -12.665 -33.029 1.00 22.72  ?  224 ARG A CD     1 
ATOM 3310  N NE     . ARG A 1 220 ? 9.460   -12.066 -32.120 1.00 18.64  ?  224 ARG A NE     1 
ATOM 3311  C CZ     . ARG A 1 220 ? 8.282   -11.581 -32.489 1.00 30.38  ?  224 ARG A CZ     1 
ATOM 3312  N NH1    . ARG A 1 220 ? 7.906   -11.609 -33.759 1.00 44.51  1  224 ARG A NH1    1 
ATOM 3313  N NH2    . ARG A 1 220 ? 7.478   -11.055 -31.580 1.00 33.87  ?  224 ARG A NH2    1 
ATOM 3314  H H      . ARG A 1 220 ? 12.921  -9.019  -31.330 1.00 61.60  ?  224 ARG A H      1 
ATOM 3315  H HA     . ARG A 1 220 ? 13.648  -11.404 -30.663 1.00 41.03  ?  224 ARG A HA     1 
ATOM 3316  H HB2    . ARG A 1 220 ? 11.471  -11.016 -31.235 1.00 33.27  ?  224 ARG A HB2    1 
ATOM 3317  H HB3    . ARG A 1 220 ? 11.887  -10.568 -32.696 1.00 33.27  ?  224 ARG A HB3    1 
ATOM 3318  H HG2    . ARG A 1 220 ? 12.458  -12.792 -33.177 1.00 20.18  ?  224 ARG A HG2    1 
ATOM 3319  H HG3    . ARG A 1 220 ? 11.909  -13.208 -31.737 1.00 20.18  ?  224 ARG A HG3    1 
ATOM 3320  H HD2    . ARG A 1 220 ? 10.389  -12.189 -33.873 1.00 27.26  ?  224 ARG A HD2    1 
ATOM 3321  H HD3    . ARG A 1 220 ? 10.190  -13.597 -33.157 1.00 27.26  ?  224 ARG A HD3    1 
ATOM 3322  H HE     . ARG A 1 220 ? 9.667   -12.023 -31.286 1.00 22.37  ?  224 ARG A HE     1 
ATOM 3323  H HH11   . ARG A 1 220 ? 8.427   -11.949 -34.354 1.00 53.41  ?  224 ARG A HH11   1 
ATOM 3324  H HH12   . ARG A 1 220 ? 7.141   -11.291 -33.989 1.00 53.41  ?  224 ARG A HH12   1 
ATOM 3325  H HH21   . ARG A 1 220 ? 7.718   -11.033 -30.755 1.00 40.65  ?  224 ARG A HH21   1 
ATOM 3326  H HH22   . ARG A 1 220 ? 6.713   -10.738 -31.814 1.00 40.65  ?  224 ARG A HH22   1 
ATOM 3327  N N      . ALA A 1 221 ? 14.580  -10.677 -33.655 1.00 28.52  ?  225 ALA A N      1 
ATOM 3328  C CA     . ALA A 1 221 ? 15.540  -11.037 -34.692 1.00 24.95  ?  225 ALA A CA     1 
ATOM 3329  C C      . ALA A 1 221 ? 16.960  -11.052 -34.146 1.00 28.59  ?  225 ALA A C      1 
ATOM 3330  O O      . ALA A 1 221 ? 17.744  -11.960 -34.441 1.00 39.33  ?  225 ALA A O      1 
ATOM 3331  C CB     . ALA A 1 221 ? 15.430  -10.064 -35.863 1.00 38.47  ?  225 ALA A CB     1 
ATOM 3332  H H      . ALA A 1 221 ? 14.066  -10.019 -33.859 1.00 34.22  ?  225 ALA A H      1 
ATOM 3333  H HA     . ALA A 1 221 ? 15.334  -11.927 -35.020 1.00 29.94  ?  225 ALA A HA     1 
ATOM 3334  H HB1    . ALA A 1 221 ? 16.073  -10.315 -36.544 1.00 46.16  ?  225 ALA A HB1    1 
ATOM 3335  H HB2    . ALA A 1 221 ? 14.531  -10.106 -36.225 1.00 46.16  ?  225 ALA A HB2    1 
ATOM 3336  H HB3    . ALA A 1 221 ? 15.617  -9.166  -35.546 1.00 46.16  ?  225 ALA A HB3    1 
ATOM 3337  N N      . ALA A 1 222 ? 17.316  -10.044 -33.352 1.00 33.37  ?  226 ALA A N      1 
ATOM 3338  C CA     . ALA A 1 222 ? 18.640  -10.027 -32.744 1.00 40.71  ?  226 ALA A CA     1 
ATOM 3339  C C      . ALA A 1 222 ? 18.783  -11.118 -31.694 1.00 48.38  ?  226 ALA A C      1 
ATOM 3340  O O      . ALA A 1 222 ? 19.901  -11.551 -31.403 1.00 41.57  ?  226 ALA A O      1 
ATOM 3341  C CB     . ALA A 1 222 ? 18.918  -8.661  -32.122 1.00 47.50  ?  226 ALA A CB     1 
ATOM 3342  H H      . ALA A 1 222 ? 16.818  -9.371  -33.153 1.00 40.05  ?  226 ALA A H      1 
ATOM 3343  H HA     . ALA A 1 222 ? 19.305  -10.185 -33.432 1.00 48.85  ?  226 ALA A HA     1 
ATOM 3344  H HB1    . ALA A 1 222 ? 19.802  -8.670  -31.723 1.00 57.00  ?  226 ALA A HB1    1 
ATOM 3345  H HB2    . ALA A 1 222 ? 18.874  -7.984  -32.815 1.00 57.00  ?  226 ALA A HB2    1 
ATOM 3346  H HB3    . ALA A 1 222 ? 18.250  -8.482  -31.442 1.00 57.00  ?  226 ALA A HB3    1 
ATOM 3347  N N      . MET A 1 223 ? 17.669  -11.570 -31.118 1.00 48.62  ?  227 MET A N      1 
ATOM 3348  C CA     . MET A 1 223 ? 17.727  -12.608 -30.095 1.00 50.21  ?  227 MET A CA     1 
ATOM 3349  C C      . MET A 1 223 ? 17.971  -13.977 -30.717 1.00 53.29  ?  227 MET A C      1 
ATOM 3350  O O      . MET A 1 223 ? 18.915  -14.683 -30.343 1.00 42.79  ?  227 MET A O      1 
ATOM 3351  C CB     . MET A 1 223 ? 16.428  -12.608 -29.288 1.00 47.37  ?  227 MET A CB     1 
ATOM 3352  C CG     . MET A 1 223 ? 16.413  -13.562 -28.106 1.00 44.30  ?  227 MET A CG     1 
ATOM 3353  S SD     . MET A 1 223 ? 14.799  -14.318 -27.828 1.00 34.13  ?  227 MET A SD     1 
ATOM 3354  C CE     . MET A 1 223 ? 13.707  -12.904 -27.808 1.00 47.07  ?  227 MET A CE     1 
ATOM 3355  H H      . MET A 1 223 ? 16.875  -11.295 -31.302 1.00 58.34  ?  227 MET A H      1 
ATOM 3356  H HA     . MET A 1 223 ? 18.455  -12.406 -29.486 1.00 60.26  ?  227 MET A HA     1 
ATOM 3357  H HB2    . MET A 1 223 ? 16.276  -11.714 -28.945 1.00 56.85  ?  227 MET A HB2    1 
ATOM 3358  H HB3    . MET A 1 223 ? 15.699  -12.859 -29.877 1.00 56.85  ?  227 MET A HB3    1 
ATOM 3359  H HG2    . MET A 1 223 ? 17.052  -14.273 -28.267 1.00 53.16  ?  227 MET A HG2    1 
ATOM 3360  H HG3    . MET A 1 223 ? 16.656  -13.073 -27.304 1.00 53.16  ?  227 MET A HG3    1 
ATOM 3361  H HE1    . MET A 1 223 ? 12.798  -13.209 -27.662 1.00 56.48  ?  227 MET A HE1    1 
ATOM 3362  H HE2    . MET A 1 223 ? 13.976  -12.308 -27.092 1.00 56.48  ?  227 MET A HE2    1 
ATOM 3363  H HE3    . MET A 1 223 ? 13.769  -12.446 -28.661 1.00 56.48  ?  227 MET A HE3    1 
ATOM 3364  N N      . LEU A 1 224 ? 17.131  -14.366 -31.678 1.00 47.91  ?  228 LEU A N      1 
ATOM 3365  C CA     . LEU A 1 224 ? 17.195  -15.718 -32.218 1.00 29.75  ?  228 LEU A CA     1 
ATOM 3366  C C      . LEU A 1 224 ? 18.488  -15.956 -32.986 1.00 34.62  ?  228 LEU A C      1 
ATOM 3367  O O      . LEU A 1 224 ? 19.132  -16.996 -32.816 1.00 57.98  ?  228 LEU A O      1 
ATOM 3368  C CB     . LEU A 1 224 ? 15.986  -15.976 -33.115 1.00 23.43  ?  228 LEU A CB     1 
ATOM 3369  C CG     . LEU A 1 224 ? 14.610  -15.853 -32.456 1.00 23.32  ?  228 LEU A CG     1 
ATOM 3370  C CD1    . LEU A 1 224 ? 13.520  -16.224 -33.443 1.00 41.65  ?  228 LEU A CD1    1 
ATOM 3371  C CD2    . LEU A 1 224 ? 14.509  -16.719 -31.216 1.00 35.89  ?  228 LEU A CD2    1 
ATOM 3372  H H      . LEU A 1 224 ? 16.522  -13.870 -32.028 1.00 57.50  ?  228 LEU A H      1 
ATOM 3373  H HA     . LEU A 1 224 ? 17.163  -16.352 -31.484 1.00 35.71  ?  228 LEU A HA     1 
ATOM 3374  H HB2    . LEU A 1 224 ? 16.011  -15.341 -33.848 1.00 28.12  ?  228 LEU A HB2    1 
ATOM 3375  H HB3    . LEU A 1 224 ? 16.056  -16.877 -33.468 1.00 28.12  ?  228 LEU A HB3    1 
ATOM 3376  H HG     . LEU A 1 224 ? 14.470  -14.931 -32.189 1.00 27.99  ?  228 LEU A HG     1 
ATOM 3377  H HD11   . LEU A 1 224 ? 12.658  -16.140 -33.007 1.00 49.98  ?  228 LEU A HD11   1 
ATOM 3378  H HD12   . LEU A 1 224 ? 13.566  -15.624 -34.204 1.00 49.98  ?  228 LEU A HD12   1 
ATOM 3379  H HD13   . LEU A 1 224 ? 13.656  -17.139 -33.734 1.00 49.98  ?  228 LEU A HD13   1 
ATOM 3380  H HD21   . LEU A 1 224 ? 13.626  -16.614 -30.829 1.00 43.06  ?  228 LEU A HD21   1 
ATOM 3381  H HD22   . LEU A 1 224 ? 14.654  -17.646 -31.465 1.00 43.06  ?  228 LEU A HD22   1 
ATOM 3382  H HD23   . LEU A 1 224 ? 15.185  -16.439 -30.580 1.00 43.06  ?  228 LEU A HD23   1 
ATOM 3383  N N      . ASN A 1 225 ? 18.886  -15.011 -33.831 1.00 42.23  ?  229 ASN A N      1 
ATOM 3384  C CA     . ASN A 1 225 ? 20.043  -15.192 -34.696 1.00 56.04  ?  229 ASN A CA     1 
ATOM 3385  C C      . ASN A 1 225 ? 21.354  -14.776 -34.042 1.00 51.00  ?  229 ASN A C      1 
ATOM 3386  O O      . ASN A 1 225 ? 22.362  -14.646 -34.742 1.00 50.69  ?  229 ASN A O      1 
ATOM 3387  C CB     . ASN A 1 225 ? 19.852  -14.411 -35.997 1.00 39.63  ?  229 ASN A CB     1 
ATOM 3388  C CG     . ASN A 1 225 ? 18.718  -14.950 -36.840 1.00 51.18  ?  229 ASN A CG     1 
ATOM 3389  O OD1    . ASN A 1 225 ? 18.943  -15.686 -37.799 1.00 79.62  ?  229 ASN A OD1    1 
ATOM 3390  N ND2    . ASN A 1 225 ? 17.489  -14.594 -36.483 1.00 39.78  ?  229 ASN A ND2    1 
ATOM 3391  H H      . ASN A 1 225 ? 18.499  -14.248 -33.922 1.00 50.67  ?  229 ASN A H      1 
ATOM 3392  H HA     . ASN A 1 225 ? 20.114  -16.132 -34.925 1.00 67.24  ?  229 ASN A HA     1 
ATOM 3393  H HB2    . ASN A 1 225 ? 19.655  -13.485 -35.784 1.00 47.55  ?  229 ASN A HB2    1 
ATOM 3394  H HB3    . ASN A 1 225 ? 20.667  -14.464 -36.521 1.00 47.55  ?  229 ASN A HB3    1 
ATOM 3395  H HD21   . ASN A 1 225 ? 16.812  -14.876 -36.932 1.00 47.73  ?  229 ASN A HD21   1 
ATOM 3396  H HD22   . ASN A 1 225 ? 17.370  -14.081 -35.803 1.00 47.73  ?  229 ASN A HD22   1 
ATOM 3397  N N      . LEU A 1 226 ? 21.372  -14.567 -32.729 1.00 43.23  ?  230 LEU A N      1 
ATOM 3398  C CA     . LEU A 1 226 ? 22.607  -14.178 -32.066 1.00 53.44  ?  230 LEU A CA     1 
ATOM 3399  C C      . LEU A 1 226 ? 23.537  -15.387 -31.942 1.00 54.76  ?  230 LEU A C      1 
ATOM 3400  O O      . LEU A 1 226 ? 23.146  -16.534 -32.169 1.00 71.88  ?  230 LEU A O      1 
ATOM 3401  C CB     . LEU A 1 226 ? 22.305  -13.568 -30.696 1.00 72.09  ?  230 LEU A CB     1 
ATOM 3402  C CG     . LEU A 1 226 ? 23.315  -12.618 -30.037 1.00 51.62  ?  230 LEU A CG     1 
ATOM 3403  C CD1    . LEU A 1 226 ? 24.043  -11.728 -31.027 1.00 49.48  ?  230 LEU A CD1    1 
ATOM 3404  C CD2    . LEU A 1 226 ? 22.599  -11.746 -29.027 1.00 39.97  ?  230 LEU A CD2    1 
ATOM 3405  H H      . LEU A 1 226 ? 20.693  -14.642 -32.207 1.00 51.88  ?  230 LEU A H      1 
ATOM 3406  H HA     . LEU A 1 226 ? 23.057  -13.506 -32.602 1.00 64.13  ?  230 LEU A HA     1 
ATOM 3407  H HB2    . LEU A 1 226 ? 21.474  -13.074 -30.775 1.00 86.51  ?  230 LEU A HB2    1 
ATOM 3408  H HB3    . LEU A 1 226 ? 22.172  -14.301 -30.075 1.00 86.51  ?  230 LEU A HB3    1 
ATOM 3409  H HG     . LEU A 1 226 ? 23.978  -13.143 -29.562 1.00 61.94  ?  230 LEU A HG     1 
ATOM 3410  H HD11   . LEU A 1 226 ? 24.661  -11.158 -30.543 1.00 59.37  ?  230 LEU A HD11   1 
ATOM 3411  H HD12   . LEU A 1 226 ? 24.529  -12.286 -31.654 1.00 59.37  ?  230 LEU A HD12   1 
ATOM 3412  H HD13   . LEU A 1 226 ? 23.394  -11.185 -31.500 1.00 59.37  ?  230 LEU A HD13   1 
ATOM 3413  H HD21   . LEU A 1 226 ? 23.241  -11.148 -28.615 1.00 47.96  ?  230 LEU A HD21   1 
ATOM 3414  H HD22   . LEU A 1 226 ? 21.914  -11.232 -29.483 1.00 47.96  ?  230 LEU A HD22   1 
ATOM 3415  H HD23   . LEU A 1 226 ? 22.193  -12.312 -28.353 1.00 47.96  ?  230 LEU A HD23   1 
ATOM 3416  N N      . ILE A 1 227 ? 24.791  -15.115 -31.573 1.00 56.89  ?  231 ILE A N      1 
ATOM 3417  C CA     . ILE A 1 227 ? 25.817  -16.154 -31.614 1.00 56.38  ?  231 ILE A CA     1 
ATOM 3418  C C      . ILE A 1 227 ? 25.586  -17.191 -30.520 1.00 65.43  ?  231 ILE A C      1 
ATOM 3419  O O      . ILE A 1 227 ? 25.741  -18.396 -30.748 1.00 75.03  ?  231 ILE A O      1 
ATOM 3420  C CB     . ILE A 1 227 ? 27.218  -15.521 -31.513 1.00 58.14  ?  231 ILE A CB     1 
ATOM 3421  C CG1    . ILE A 1 227 ? 28.296  -16.567 -31.802 1.00 58.53  ?  231 ILE A CG1    1 
ATOM 3422  C CG2    . ILE A 1 227 ? 27.434  -14.887 -30.143 1.00 71.85  ?  231 ILE A CG2    1 
ATOM 3423  C CD1    . ILE A 1 227 ? 29.687  -15.985 -31.951 1.00 64.59  ?  231 ILE A CD1    1 
ATOM 3424  H H      . ILE A 1 227 ? 25.068  -14.349 -31.300 1.00 68.27  ?  231 ILE A H      1 
ATOM 3425  H HA     . ILE A 1 227 ? 25.762  -16.611 -32.468 1.00 67.66  ?  231 ILE A HA     1 
ATOM 3426  H HB     . ILE A 1 227 ? 27.285  -14.824 -32.184 1.00 69.77  ?  231 ILE A HB     1 
ATOM 3427  H HG12   . ILE A 1 227 ? 28.318  -17.204 -31.070 1.00 70.23  ?  231 ILE A HG12   1 
ATOM 3428  H HG13   . ILE A 1 227 ? 28.075  -17.023 -32.629 1.00 70.23  ?  231 ILE A HG13   1 
ATOM 3429  H HG21   . ILE A 1 227 ? 28.322  -14.499 -30.111 1.00 86.22  ?  231 ILE A HG21   1 
ATOM 3430  H HG22   . ILE A 1 227 ? 26.766  -14.197 -30.006 1.00 86.22  ?  231 ILE A HG22   1 
ATOM 3431  H HG23   . ILE A 1 227 ? 27.347  -15.572 -29.461 1.00 86.22  ?  231 ILE A HG23   1 
ATOM 3432  H HD11   . ILE A 1 227 ? 30.312  -16.705 -32.131 1.00 77.51  ?  231 ILE A HD11   1 
ATOM 3433  H HD12   . ILE A 1 227 ? 29.687  -15.354 -32.687 1.00 77.51  ?  231 ILE A HD12   1 
ATOM 3434  H HD13   . ILE A 1 227 ? 29.930  -15.534 -31.127 1.00 77.51  ?  231 ILE A HD13   1 
ATOM 3435  N N      . ASN A 1 228 ? 25.215  -16.746 -29.321 1.00 74.63  ?  232 ASN A N      1 
ATOM 3436  C CA     . ASN A 1 228 ? 24.986  -17.637 -28.184 1.00 78.97  ?  232 ASN A CA     1 
ATOM 3437  C C      . ASN A 1 228 ? 26.258  -18.397 -27.808 1.00 67.69  ?  232 ASN A C      1 
ATOM 3438  O O      . ASN A 1 228 ? 26.279  -19.628 -27.739 1.00 63.74  ?  232 ASN A O      1 
ATOM 3439  C CB     . ASN A 1 228 ? 23.838  -18.609 -28.467 1.00 69.99  ?  232 ASN A CB     1 
ATOM 3440  C CG     . ASN A 1 228 ? 23.512  -19.484 -27.273 1.00 67.98  ?  232 ASN A CG     1 
ATOM 3441  O OD1    . ASN A 1 228 ? 23.859  -19.157 -26.140 1.00 46.38  ?  232 ASN A OD1    1 
ATOM 3442  N ND2    . ASN A 1 228 ? 22.852  -20.608 -27.524 1.00 90.51  ?  232 ASN A ND2    1 
ATOM 3443  H H      . ASN A 1 228 ? 25.087  -15.915 -29.137 1.00 89.56  ?  232 ASN A H      1 
ATOM 3444  H HA     . ASN A 1 228 ? 24.731  -17.099 -27.418 1.00 94.76  ?  232 ASN A HA     1 
ATOM 3445  H HB2    . ASN A 1 228 ? 23.043  -18.102 -28.694 1.00 83.99  ?  232 ASN A HB2    1 
ATOM 3446  H HB3    . ASN A 1 228 ? 24.087  -19.187 -29.205 1.00 83.99  ?  232 ASN A HB3    1 
ATOM 3447  H HD21   . ASN A 1 228 ? 22.644  -21.138 -26.879 1.00 108.61 ?  232 ASN A HD21   1 
ATOM 3448  H HD22   . ASN A 1 228 ? 22.632  -20.807 -28.331 1.00 108.61 ?  232 ASN A HD22   1 
ATOM 3449  N N      . ASP A 1 229 ? 27.329  -17.653 -27.563 1.00 70.38  ?  233 ASP A N      1 
ATOM 3450  C CA     . ASP A 1 229 ? 28.522  -18.212 -26.955 1.00 64.33  ?  233 ASP A CA     1 
ATOM 3451  C C      . ASP A 1 229 ? 28.458  -17.948 -25.449 1.00 69.62  ?  233 ASP A C      1 
ATOM 3452  O O      . ASP A 1 229 ? 27.381  -17.697 -24.898 1.00 70.40  ?  233 ASP A O      1 
ATOM 3453  C CB     . ASP A 1 229 ? 29.771  -17.623 -27.620 1.00 78.79  ?  233 ASP A CB     1 
ATOM 3454  C CG     . ASP A 1 229 ? 30.073  -16.214 -27.156 1.00 84.43  ?  233 ASP A CG     1 
ATOM 3455  O OD1    . ASP A 1 229 ? 30.680  -16.061 -26.076 1.00 85.57  ?  233 ASP A OD1    1 
ATOM 3456  O OD2    . ASP A 1 229 ? 29.715  -15.259 -27.877 1.00 93.87  -1 233 ASP A OD2    1 
ATOM 3457  H H      . ASP A 1 229 ? 27.388  -16.814 -27.743 1.00 84.45  ?  233 ASP A H      1 
ATOM 3458  H HA     . ASP A 1 229 ? 28.530  -19.172 -27.093 1.00 77.19  ?  233 ASP A HA     1 
ATOM 3459  H HB2    . ASP A 1 229 ? 30.536  -18.180 -27.405 1.00 94.55  ?  233 ASP A HB2    1 
ATOM 3460  H HB3    . ASP A 1 229 ? 29.637  -17.600 -28.581 1.00 94.55  ?  233 ASP A HB3    1 
ATOM 3461  N N      . ASN A 1 230 ? 29.604  -18.002 -24.771 1.00 79.70  ?  234 ASN A N      1 
ATOM 3462  C CA     . ASN A 1 230 ? 29.598  -17.796 -23.327 1.00 68.49  ?  234 ASN A CA     1 
ATOM 3463  C C      . ASN A 1 230 ? 29.350  -16.335 -22.974 1.00 77.31  ?  234 ASN A C      1 
ATOM 3464  O O      . ASN A 1 230 ? 28.686  -16.038 -21.974 1.00 92.98  ?  234 ASN A O      1 
ATOM 3465  C CB     . ASN A 1 230 ? 30.914  -18.273 -22.717 1.00 73.51  ?  234 ASN A CB     1 
ATOM 3466  C CG     . ASN A 1 230 ? 30.972  -19.777 -22.567 1.00 92.63  ?  234 ASN A CG     1 
ATOM 3467  O OD1    . ASN A 1 230 ? 30.661  -20.519 -23.498 1.00 93.13  ?  234 ASN A OD1    1 
ATOM 3468  N ND2    . ASN A 1 230 ? 31.350  -20.236 -21.381 1.00 80.68  ?  234 ASN A ND2    1 
ATOM 3469  H H      . ASN A 1 230 ? 30.378  -18.153 -25.114 1.00 95.64  ?  234 ASN A H      1 
ATOM 3470  H HA     . ASN A 1 230 ? 28.882  -18.322 -22.939 1.00 82.19  ?  234 ASN A HA     1 
ATOM 3471  H HB2    . ASN A 1 230 ? 31.647  -18.000 -23.291 1.00 88.22  ?  234 ASN A HB2    1 
ATOM 3472  H HB3    . ASN A 1 230 ? 31.016  -17.879 -21.837 1.00 88.22  ?  234 ASN A HB3    1 
ATOM 3473  H HD21   . ASN A 1 230 ? 31.399  -21.084 -21.243 1.00 96.82  ?  234 ASN A HD21   1 
ATOM 3474  H HD22   . ASN A 1 230 ? 31.546  -19.686 -20.749 1.00 96.82  ?  234 ASN A HD22   1 
ATOM 3475  N N      . ASN A 1 231 ? 29.865  -15.410 -23.782 1.00 80.33  ?  235 ASN A N      1 
ATOM 3476  C CA     . ASN A 1 231 ? 29.793  -13.997 -23.426 1.00 79.56  ?  235 ASN A CA     1 
ATOM 3477  C C      . ASN A 1 231 ? 28.431  -13.396 -23.752 1.00 60.52  ?  235 ASN A C      1 
ATOM 3478  O O      . ASN A 1 231 ? 27.932  -12.549 -23.003 1.00 51.85  ?  235 ASN A O      1 
ATOM 3479  C CB     . ASN A 1 231 ? 30.904  -13.228 -24.139 1.00 83.04  ?  235 ASN A CB     1 
ATOM 3480  C CG     . ASN A 1 231 ? 32.282  -13.579 -23.611 1.00 71.19  ?  235 ASN A CG     1 
ATOM 3481  O OD1    . ASN A 1 231 ? 32.485  -13.685 -22.402 1.00 44.58  ?  235 ASN A OD1    1 
ATOM 3482  N ND2    . ASN A 1 231 ? 33.233  -13.772 -24.516 1.00 80.47  ?  235 ASN A ND2    1 
ATOM 3483  H H      . ASN A 1 231 ? 30.256  -15.571 -24.530 1.00 96.40  ?  235 ASN A H      1 
ATOM 3484  H HA     . ASN A 1 231 ? 29.935  -13.908 -22.471 1.00 95.48  ?  235 ASN A HA     1 
ATOM 3485  H HB2    . ASN A 1 231 ? 30.881  -13.442 -25.085 1.00 99.65  ?  235 ASN A HB2    1 
ATOM 3486  H HB3    . ASN A 1 231 ? 30.766  -12.277 -24.009 1.00 99.65  ?  235 ASN A HB3    1 
ATOM 3487  H HD21   . ASN A 1 231 ? 34.031  -13.973 -24.265 1.00 96.56  ?  235 ASN A HD21   1 
ATOM 3488  H HD22   . ASN A 1 231 ? 33.052  -13.695 -25.353 1.00 96.56  ?  235 ASN A HD22   1 
ATOM 3489  N N      . THR A 1 232 ? 27.812  -13.818 -24.853 1.00 64.95  ?  236 THR A N      1 
ATOM 3490  C CA     . THR A 1 232 ? 26.542  -13.244 -25.274 1.00 55.82  ?  236 THR A CA     1 
ATOM 3491  C C      . THR A 1 232 ? 25.335  -13.930 -24.652 1.00 57.63  ?  236 THR A C      1 
ATOM 3492  O O      . THR A 1 232 ? 24.232  -13.376 -24.709 1.00 63.71  ?  236 THR A O      1 
ATOM 3493  C CB     . THR A 1 232 ? 26.407  -13.310 -26.797 1.00 51.40  ?  236 THR A CB     1 
ATOM 3494  O OG1    . THR A 1 232 ? 26.368  -14.679 -27.217 1.00 62.31  ?  236 THR A OG1    1 
ATOM 3495  C CG2    . THR A 1 232 ? 27.576  -12.611 -27.470 1.00 58.18  ?  236 THR A CG2    1 
ATOM 3496  H H      . THR A 1 232 ? 28.109  -14.436 -25.372 1.00 77.93  ?  236 THR A H      1 
ATOM 3497  H HA     . THR A 1 232 ? 26.519  -12.310 -25.013 1.00 66.98  ?  236 THR A HA     1 
ATOM 3498  H HB     . THR A 1 232 ? 25.588  -12.867 -27.068 1.00 61.68  ?  236 THR A HB     1 
ATOM 3499  H HG1    . THR A 1 232 ? 25.712  -15.069 -26.866 1.00 74.78  ?  236 THR A HG1    1 
ATOM 3500  H HG21   . THR A 1 232 ? 27.480  -12.659 -28.434 1.00 69.81  ?  236 THR A HG21   1 
ATOM 3501  H HG22   . THR A 1 232 ? 27.603  -11.679 -27.202 1.00 69.81  ?  236 THR A HG22   1 
ATOM 3502  H HG23   . THR A 1 232 ? 28.409  -13.037 -27.214 1.00 69.81  ?  236 THR A HG23   1 
ATOM 3503  N N      . ARG A 1 233 ? 25.511  -15.109 -24.062 1.00 63.22  ?  237 ARG A N      1 
ATOM 3504  C CA     . ARG A 1 233 ? 24.363  -15.860 -23.565 1.00 61.12  ?  237 ARG A CA     1 
ATOM 3505  C C      . ARG A 1 233 ? 23.516  -15.074 -22.572 1.00 50.35  ?  237 ARG A C      1 
ATOM 3506  O O      . ARG A 1 233 ? 22.280  -15.187 -22.636 1.00 47.44  ?  237 ARG A O      1 
ATOM 3507  C CB     . ARG A 1 233 ? 24.840  -17.177 -22.940 1.00 69.06  ?  237 ARG A CB     1 
ATOM 3508  C CG     . ARG A 1 233 ? 23.720  -18.164 -22.680 1.00 71.46  ?  237 ARG A CG     1 
ATOM 3509  C CD     . ARG A 1 233 ? 24.232  -19.486 -22.133 1.00 81.51  ?  237 ARG A CD     1 
ATOM 3510  N NE     . ARG A 1 233 ? 25.108  -20.184 -23.072 1.00 76.02  ?  237 ARG A NE     1 
ATOM 3511  C CZ     . ARG A 1 233 ? 26.434  -20.254 -22.973 1.00 76.25  ?  237 ARG A CZ     1 
ATOM 3512  N NH1    . ARG A 1 233 ? 27.074  -19.672 -21.968 1.00 78.87  1  237 ARG A NH1    1 
ATOM 3513  N NH2    . ARG A 1 233 ? 27.127  -20.919 -23.885 1.00 78.51  ?  237 ARG A NH2    1 
ATOM 3514  H H      . ARG A 1 233 ? 26.272  -15.491 -23.939 1.00 75.87  ?  237 ARG A H      1 
ATOM 3515  H HA     . ARG A 1 233 ? 23.794  -16.084 -24.318 1.00 73.34  ?  237 ARG A HA     1 
ATOM 3516  H HB2    . ARG A 1 233 ? 25.473  -17.598 -23.543 1.00 82.87  ?  237 ARG A HB2    1 
ATOM 3517  H HB3    . ARG A 1 233 ? 25.270  -16.984 -22.093 1.00 82.87  ?  237 ARG A HB3    1 
ATOM 3518  H HG2    . ARG A 1 233 ? 23.108  -17.786 -22.029 1.00 85.76  ?  237 ARG A HG2    1 
ATOM 3519  H HG3    . ARG A 1 233 ? 23.254  -18.343 -23.511 1.00 85.76  ?  237 ARG A HG3    1 
ATOM 3520  H HD2    . ARG A 1 233 ? 24.736  -19.318 -21.321 1.00 97.81  ?  237 ARG A HD2    1 
ATOM 3521  H HD3    . ARG A 1 233 ? 23.477  -20.063 -21.942 1.00 97.81  ?  237 ARG A HD3    1 
ATOM 3522  H HE     . ARG A 1 233 ? 24.739  -20.579 -23.741 1.00 91.23  ?  237 ARG A HE     1 
ATOM 3523  H HH11   . ARG A 1 233 ? 26.633  -19.238 -21.370 1.00 94.64  ?  237 ARG A HH11   1 
ATOM 3524  H HH12   . ARG A 1 233 ? 27.931  -19.725 -21.915 1.00 94.64  ?  237 ARG A HH12   1 
ATOM 3525  H HH21   . ARG A 1 233 ? 26.721  -21.301 -24.540 1.00 94.21  ?  237 ARG A HH21   1 
ATOM 3526  H HH22   . ARG A 1 233 ? 27.984  -20.967 -23.824 1.00 94.21  ?  237 ARG A HH22   1 
ATOM 3527  N N      . PRO A 1 234 ? 24.081  -14.284 -21.652 1.00 51.47  ?  238 PRO A N      1 
ATOM 3528  C CA     . PRO A 1 234 ? 23.221  -13.589 -20.678 1.00 63.58  ?  238 PRO A CA     1 
ATOM 3529  C C      . PRO A 1 234 ? 22.228  -12.637 -21.318 1.00 59.11  ?  238 PRO A C      1 
ATOM 3530  O O      . PRO A 1 234 ? 21.062  -12.596 -20.907 1.00 58.49  ?  238 PRO A O      1 
ATOM 3531  C CB     . PRO A 1 234 ? 24.229  -12.848 -19.787 1.00 53.98  ?  238 PRO A CB     1 
ATOM 3532  C CG     . PRO A 1 234 ? 25.517  -13.568 -19.975 1.00 58.58  ?  238 PRO A CG     1 
ATOM 3533  C CD     . PRO A 1 234 ? 25.510  -14.052 -21.387 1.00 54.40  ?  238 PRO A CD     1 
ATOM 3534  H HA     . PRO A 1 234 ? 22.738  -14.236 -20.139 1.00 76.30  ?  238 PRO A HA     1 
ATOM 3535  H HB2    . PRO A 1 234 ? 24.306  -11.926 -20.079 1.00 64.78  ?  238 PRO A HB2    1 
ATOM 3536  H HB3    . PRO A 1 234 ? 23.943  -12.893 -18.862 1.00 64.78  ?  238 PRO A HB3    1 
ATOM 3537  H HG2    . PRO A 1 234 ? 26.255  -12.956 -19.828 1.00 70.30  ?  238 PRO A HG2    1 
ATOM 3538  H HG3    . PRO A 1 234 ? 25.565  -14.315 -19.358 1.00 70.30  ?  238 PRO A HG3    1 
ATOM 3539  H HD2    . PRO A 1 234 ? 25.859  -13.370 -21.981 1.00 65.28  ?  238 PRO A HD2    1 
ATOM 3540  H HD3    . PRO A 1 234 ? 26.008  -14.881 -21.463 1.00 65.28  ?  238 PRO A HD3    1 
ATOM 3541  N N      . TYR A 1 235 ? 22.658  -11.859 -22.313 1.00 56.20  ?  239 TYR A N      1 
ATOM 3542  C CA     . TYR A 1 235 ? 21.739  -10.939 -22.971 1.00 51.89  ?  239 TYR A CA     1 
ATOM 3543  C C      . TYR A 1 235 ? 20.609  -11.685 -23.663 1.00 54.80  ?  239 TYR A C      1 
ATOM 3544  O O      . TYR A 1 235 ? 19.485  -11.178 -23.738 1.00 62.67  ?  239 TYR A O      1 
ATOM 3545  C CB     . TYR A 1 235 ? 22.493  -10.071 -23.978 1.00 60.10  ?  239 TYR A CB     1 
ATOM 3546  C CG     . TYR A 1 235 ? 23.583  -9.228  -23.358 1.00 55.77  ?  239 TYR A CG     1 
ATOM 3547  C CD1    . TYR A 1 235 ? 24.920  -9.571  -23.502 1.00 46.36  ?  239 TYR A CD1    1 
ATOM 3548  C CD2    . TYR A 1 235 ? 23.275  -8.092  -22.625 1.00 51.68  ?  239 TYR A CD2    1 
ATOM 3549  C CE1    . TYR A 1 235 ? 25.918  -8.805  -22.937 1.00 43.82  ?  239 TYR A CE1    1 
ATOM 3550  C CE2    . TYR A 1 235 ? 24.267  -7.320  -22.055 1.00 53.35  ?  239 TYR A CE2    1 
ATOM 3551  C CZ     . TYR A 1 235 ? 25.586  -7.681  -22.214 1.00 52.13  ?  239 TYR A CZ     1 
ATOM 3552  O OH     . TYR A 1 235 ? 26.578  -6.916  -21.649 1.00 58.21  ?  239 TYR A OH     1 
ATOM 3553  H H      . TYR A 1 235 ? 23.461  -11.846 -22.619 1.00 67.44  ?  239 TYR A H      1 
ATOM 3554  H HA     . TYR A 1 235 ? 21.347  -10.353 -22.305 1.00 62.27  ?  239 TYR A HA     1 
ATOM 3555  H HB2    . TYR A 1 235 ? 22.904  -10.647 -24.641 1.00 72.11  ?  239 TYR A HB2    1 
ATOM 3556  H HB3    . TYR A 1 235 ? 21.863  -9.472  -24.408 1.00 72.11  ?  239 TYR A HB3    1 
ATOM 3557  H HD1    . TYR A 1 235 ? 25.147  -10.330 -23.990 1.00 55.63  ?  239 TYR A HD1    1 
ATOM 3558  H HD2    . TYR A 1 235 ? 22.385  -7.845  -22.516 1.00 62.02  ?  239 TYR A HD2    1 
ATOM 3559  H HE1    . TYR A 1 235 ? 26.810  -9.047  -23.042 1.00 52.58  ?  239 TYR A HE1    1 
ATOM 3560  H HE2    . TYR A 1 235 ? 24.046  -6.560  -21.567 1.00 64.02  ?  239 TYR A HE2    1 
ATOM 3561  H HH     . TYR A 1 235 ? 26.240  -6.265  -21.239 1.00 69.85  ?  239 TYR A HH     1 
ATOM 3562  N N      . ILE A 1 236 ? 20.884  -12.888 -24.167 1.00 59.94  ?  240 ILE A N      1 
ATOM 3563  C CA     . ILE A 1 236 ? 19.846  -13.665 -24.835 1.00 44.04  ?  240 ILE A CA     1 
ATOM 3564  C C      . ILE A 1 236 ? 18.812  -14.136 -23.823 1.00 37.75  ?  240 ILE A C      1 
ATOM 3565  O O      . ILE A 1 236 ? 17.606  -13.928 -23.997 1.00 33.46  ?  240 ILE A O      1 
ATOM 3566  C CB     . ILE A 1 236 ? 20.465  -14.850 -25.597 1.00 33.22  ?  240 ILE A CB     1 
ATOM 3567  C CG1    . ILE A 1 236 ? 21.623  -14.374 -26.476 1.00 39.40  ?  240 ILE A CG1    1 
ATOM 3568  C CG2    . ILE A 1 236 ? 19.406  -15.511 -26.448 1.00 42.46  ?  240 ILE A CG2    1 
ATOM 3569  C CD1    . ILE A 1 236 ? 22.293  -15.462 -27.295 1.00 49.39  ?  240 ILE A CD1    1 
ATOM 3570  H H      . ILE A 1 236 ? 21.653  -13.271 -24.136 1.00 71.92  ?  240 ILE A H      1 
ATOM 3571  H HA     . ILE A 1 236 ? 19.395  -13.099 -25.481 1.00 52.84  ?  240 ILE A HA     1 
ATOM 3572  H HB     . ILE A 1 236 ? 20.801  -15.495 -24.955 1.00 39.87  ?  240 ILE A HB     1 
ATOM 3573  H HG12   . ILE A 1 236 ? 21.287  -13.707 -27.095 1.00 47.28  ?  240 ILE A HG12   1 
ATOM 3574  H HG13   . ILE A 1 236 ? 22.300  -13.978 -25.906 1.00 47.28  ?  240 ILE A HG13   1 
ATOM 3575  H HG21   . ILE A 1 236 ? 19.804  -16.257 -26.924 1.00 50.95  ?  240 ILE A HG21   1 
ATOM 3576  H HG22   . ILE A 1 236 ? 18.692  -15.829 -25.872 1.00 50.95  ?  240 ILE A HG22   1 
ATOM 3577  H HG23   . ILE A 1 236 ? 19.058  -14.862 -27.079 1.00 50.95  ?  240 ILE A HG23   1 
ATOM 3578  H HD11   . ILE A 1 236 ? 23.009  -15.067 -27.816 1.00 59.27  ?  240 ILE A HD11   1 
ATOM 3579  H HD12   . ILE A 1 236 ? 22.651  -16.133 -26.694 1.00 59.27  ?  240 ILE A HD12   1 
ATOM 3580  H HD13   . ILE A 1 236 ? 21.635  -15.862 -27.885 1.00 59.27  ?  240 ILE A HD13   1 
ATOM 3581  N N      . LEU A 1 237 ? 19.271  -14.775 -22.748 1.00 41.29  ?  241 LEU A N      1 
ATOM 3582  C CA     . LEU A 1 237 ? 18.372  -15.214 -21.691 1.00 45.37  ?  241 LEU A CA     1 
ATOM 3583  C C      . LEU A 1 237 ? 17.687  -14.050 -20.994 1.00 43.82  ?  241 LEU A C      1 
ATOM 3584  O O      . LEU A 1 237 ? 16.712  -14.273 -20.268 1.00 40.96  ?  241 LEU A O      1 
ATOM 3585  C CB     . LEU A 1 237 ? 19.148  -16.045 -20.671 1.00 48.88  ?  241 LEU A CB     1 
ATOM 3586  C CG     . LEU A 1 237 ? 19.837  -17.284 -21.244 1.00 44.33  ?  241 LEU A CG     1 
ATOM 3587  C CD1    . LEU A 1 237 ? 20.841  -17.842 -20.255 1.00 63.35  ?  241 LEU A CD1    1 
ATOM 3588  C CD2    . LEU A 1 237 ? 18.808  -18.336 -21.614 1.00 34.65  ?  241 LEU A CD2    1 
ATOM 3589  H H      . LEU A 1 237 ? 20.098  -14.964 -22.609 1.00 49.55  ?  241 LEU A H      1 
ATOM 3590  H HA     . LEU A 1 237 ? 17.685  -15.779 -22.077 1.00 54.44  ?  241 LEU A HA     1 
ATOM 3591  H HB2    . LEU A 1 237 ? 19.834  -15.486 -20.274 1.00 58.66  ?  241 LEU A HB2    1 
ATOM 3592  H HB3    . LEU A 1 237 ? 18.533  -16.343 -19.983 1.00 58.66  ?  241 LEU A HB3    1 
ATOM 3593  H HG     . LEU A 1 237 ? 20.316  -17.036 -22.050 1.00 53.19  ?  241 LEU A HG     1 
ATOM 3594  H HD11   . LEU A 1 237 ? 21.262  -18.626 -20.642 1.00 76.02  ?  241 LEU A HD11   1 
ATOM 3595  H HD12   . LEU A 1 237 ? 21.509  -17.165 -20.068 1.00 76.02  ?  241 LEU A HD12   1 
ATOM 3596  H HD13   . LEU A 1 237 ? 20.377  -18.085 -19.438 1.00 76.02  ?  241 LEU A HD13   1 
ATOM 3597  H HD21   . LEU A 1 237 ? 19.265  -19.111 -21.974 1.00 41.58  ?  241 LEU A HD21   1 
ATOM 3598  H HD22   . LEU A 1 237 ? 18.311  -18.584 -20.819 1.00 41.58  ?  241 LEU A HD22   1 
ATOM 3599  H HD23   . LEU A 1 237 ? 18.206  -17.967 -22.279 1.00 41.58  ?  241 LEU A HD23   1 
ATOM 3600  N N      . GLU A 1 238 ? 18.168  -12.822 -21.195 1.00 47.80  ?  242 GLU A N      1 
ATOM 3601  C CA     . GLU A 1 238 ? 17.528  -11.665 -20.582 1.00 42.59  ?  242 GLU A CA     1 
ATOM 3602  C C      . GLU A 1 238 ? 16.098  -11.506 -21.078 1.00 35.74  ?  242 GLU A C      1 
ATOM 3603  O O      . GLU A 1 238 ? 15.207  -11.114 -20.318 1.00 20.77  ?  242 GLU A O      1 
ATOM 3604  C CB     . GLU A 1 238 ? 18.335  -10.403 -20.881 1.00 52.80  ?  242 GLU A CB     1 
ATOM 3605  C CG     . GLU A 1 238 ? 18.091  -9.263  -19.901 1.00 63.90  ?  242 GLU A CG     1 
ATOM 3606  C CD     . GLU A 1 238 ? 18.514  -7.910  -20.444 1.00 65.80  ?  242 GLU A CD     1 
ATOM 3607  O OE1    . GLU A 1 238 ? 18.614  -7.759  -21.680 1.00 48.08  ?  242 GLU A OE1    1 
ATOM 3608  O OE2    . GLU A 1 238 ? 18.745  -6.994  -19.630 1.00 71.30  -1 242 GLU A OE2    1 
ATOM 3609  H H      . GLU A 1 238 ? 18.856  -12.637 -21.677 1.00 57.36  ?  242 GLU A H      1 
ATOM 3610  H HA     . GLU A 1 238 ? 17.502  -11.788 -19.620 1.00 51.11  ?  242 GLU A HA     1 
ATOM 3611  H HB2    . GLU A 1 238 ? 19.279  -10.622 -20.851 1.00 63.36  ?  242 GLU A HB2    1 
ATOM 3612  H HB3    . GLU A 1 238 ? 18.100  -10.086 -21.768 1.00 63.36  ?  242 GLU A HB3    1 
ATOM 3613  H HG2    . GLU A 1 238 ? 17.143  -9.220  -19.698 1.00 76.69  ?  242 GLU A HG2    1 
ATOM 3614  H HG3    . GLU A 1 238 ? 18.596  -9.431  -19.091 1.00 76.69  ?  242 GLU A HG3    1 
ATOM 3615  N N      . ARG A 1 239 ? 15.860  -11.807 -22.353 1.00 38.25  ?  243 ARG A N      1 
ATOM 3616  C CA     . ARG A 1 239 ? 14.545  -11.613 -22.949 1.00 34.33  ?  243 ARG A CA     1 
ATOM 3617  C C      . ARG A 1 239 ? 13.458  -12.463 -22.306 1.00 31.30  ?  243 ARG A C      1 
ATOM 3618  O O      . ARG A 1 239 ? 12.289  -12.319 -22.677 1.00 31.61  ?  243 ARG A O      1 
ATOM 3619  C CB     . ARG A 1 239 ? 14.616  -11.910 -24.445 1.00 52.21  ?  243 ARG A CB     1 
ATOM 3620  C CG     . ARG A 1 239 ? 15.517  -10.957 -25.214 1.00 50.40  ?  243 ARG A CG     1 
ATOM 3621  C CD     . ARG A 1 239 ? 14.938  -9.556  -25.251 1.00 51.40  ?  243 ARG A CD     1 
ATOM 3622  N NE     . ARG A 1 239 ? 15.694  -8.624  -24.424 1.00 46.39  ?  243 ARG A NE     1 
ATOM 3623  C CZ     . ARG A 1 239 ? 15.289  -7.395  -24.124 1.00 44.28  ?  243 ARG A CZ     1 
ATOM 3624  N NH1    . ARG A 1 239 ? 16.046  -6.615  -23.367 1.00 51.20  1  243 ARG A NH1    1 
ATOM 3625  N NH2    . ARG A 1 239 ? 14.126  -6.947  -24.574 1.00 38.84  ?  243 ARG A NH2    1 
ATOM 3626  H H      . ARG A 1 239 ? 16.447  -12.127 -22.894 1.00 45.90  ?  243 ARG A H      1 
ATOM 3627  H HA     . ARG A 1 239 ? 14.291  -10.683 -22.845 1.00 41.20  ?  243 ARG A HA     1 
ATOM 3628  H HB2    . ARG A 1 239 ? 14.958  -12.809 -24.570 1.00 62.66  ?  243 ARG A HB2    1 
ATOM 3629  H HB3    . ARG A 1 239 ? 13.724  -11.842 -24.819 1.00 62.66  ?  243 ARG A HB3    1 
ATOM 3630  H HG2    . ARG A 1 239 ? 16.384  -10.917 -24.781 1.00 60.48  ?  243 ARG A HG2    1 
ATOM 3631  H HG3    . ARG A 1 239 ? 15.611  -11.272 -26.126 1.00 60.48  ?  243 ARG A HG3    1 
ATOM 3632  H HD2    . ARG A 1 239 ? 14.954  -9.229  -26.165 1.00 61.68  ?  243 ARG A HD2    1 
ATOM 3633  H HD3    . ARG A 1 239 ? 14.026  -9.580  -24.922 1.00 61.68  ?  243 ARG A HD3    1 
ATOM 3634  H HE     . ARG A 1 239 ? 16.468  -8.873  -24.141 1.00 55.67  ?  243 ARG A HE     1 
ATOM 3635  H HH11   . ARG A 1 239 ? 16.800  -6.903  -23.071 1.00 61.44  ?  243 ARG A HH11   1 
ATOM 3636  H HH12   . ARG A 1 239 ? 15.782  -5.820  -23.170 1.00 61.44  ?  243 ARG A HH12   1 
ATOM 3637  H HH21   . ARG A 1 239 ? 13.632  -7.451  -25.067 1.00 46.61  ?  243 ARG A HH21   1 
ATOM 3638  H HH22   . ARG A 1 239 ? 13.866  -6.152  -24.377 1.00 46.61  ?  243 ARG A HH22   1 
ATOM 3639  N N      . ALA A 1 240 ? 13.797  -13.340 -21.363 1.00 25.05  ?  244 ALA A N      1 
ATOM 3640  C CA     . ALA A 1 240 ? 12.775  -14.100 -20.657 1.00 29.49  ?  244 ALA A CA     1 
ATOM 3641  C C      . ALA A 1 240 ? 11.776  -13.197 -19.954 1.00 36.95  ?  244 ALA A C      1 
ATOM 3642  O O      . ALA A 1 240 ? 10.689  -13.660 -19.591 1.00 35.43  ?  244 ALA A O      1 
ATOM 3643  C CB     . ALA A 1 240 ? 13.432  -15.041 -19.651 1.00 37.02  ?  244 ALA A CB     1 
ATOM 3644  H H      . ALA A 1 240 ? 14.604  -13.510 -21.117 1.00 30.06  ?  244 ALA A H      1 
ATOM 3645  H HA     . ALA A 1 240 ? 12.288  -14.641 -21.298 1.00 35.38  ?  244 ALA A HA     1 
ATOM 3646  H HB1    . ALA A 1 240 ? 12.741  -15.541 -19.188 1.00 44.42  ?  244 ALA A HB1    1 
ATOM 3647  H HB2    . ALA A 1 240 ? 14.020  -15.650 -20.126 1.00 44.42  ?  244 ALA A HB2    1 
ATOM 3648  H HB3    . ALA A 1 240 ? 13.944  -14.516 -19.015 1.00 44.42  ?  244 ALA A HB3    1 
ATOM 3649  N N      . ARG A 1 241 ? 12.110  -11.925 -19.762 1.00 43.86  ?  245 ARG A N      1 
ATOM 3650  C CA     . ARG A 1 241 ? 11.201  -10.943 -19.190 1.00 34.18  ?  245 ARG A CA     1 
ATOM 3651  C C      . ARG A 1 241 ? 11.012  -9.776  -20.146 1.00 36.99  ?  245 ARG A C      1 
ATOM 3652  O O      . ARG A 1 241 ? 10.876  -8.623  -19.736 1.00 45.18  ?  245 ARG A O      1 
ATOM 3653  C CB     . ARG A 1 241 ? 11.704  -10.461 -17.831 1.00 23.32  ?  245 ARG A CB     1 
ATOM 3654  C CG     . ARG A 1 241 ? 11.705  -11.526 -16.762 1.00 31.54  ?  245 ARG A CG     1 
ATOM 3655  C CD     . ARG A 1 241 ? 10.300  -11.956 -16.389 1.00 47.89  ?  245 ARG A CD     1 
ATOM 3656  N NE     . ARG A 1 241 ? 9.643   -11.002 -15.508 1.00 28.90  ?  245 ARG A NE     1 
ATOM 3657  C CZ     . ARG A 1 241 ? 8.349   -11.030 -15.215 1.00 37.84  ?  245 ARG A CZ     1 
ATOM 3658  N NH1    . ARG A 1 241 ? 7.835   -10.126 -14.397 1.00 60.58  1  245 ARG A NH1    1 
ATOM 3659  N NH2    . ARG A 1 241 ? 7.563   -11.956 -15.746 1.00 56.36  ?  245 ARG A NH2    1 
ATOM 3660  H H      . ARG A 1 241 ? 12.881  -11.600 -19.963 1.00 52.63  ?  245 ARG A H      1 
ATOM 3661  H HA     . ARG A 1 241 ? 10.336  -11.360 -19.055 1.00 41.02  ?  245 ARG A HA     1 
ATOM 3662  H HB2    . ARG A 1 241 ? 12.614  -10.141 -17.931 1.00 27.98  ?  245 ARG A HB2    1 
ATOM 3663  H HB3    . ARG A 1 241 ? 11.134  -9.737  -17.527 1.00 27.98  ?  245 ARG A HB3    1 
ATOM 3664  H HG2    . ARG A 1 241 ? 12.183  -12.305 -17.088 1.00 37.85  ?  245 ARG A HG2    1 
ATOM 3665  H HG3    . ARG A 1 241 ? 12.136  -11.178 -15.965 1.00 37.85  ?  245 ARG A HG3    1 
ATOM 3666  H HD2    . ARG A 1 241 ? 9.768   -12.036 -17.197 1.00 57.47  ?  245 ARG A HD2    1 
ATOM 3667  H HD3    . ARG A 1 241 ? 10.341  -12.810 -15.932 1.00 57.47  ?  245 ARG A HD3    1 
ATOM 3668  H HE     . ARG A 1 241 ? 10.135  -10.422 -15.105 1.00 34.68  ?  245 ARG A HE     1 
ATOM 3669  H HH11   . ARG A 1 241 ? 8.340   -9.522  -14.053 1.00 72.70  ?  245 ARG A HH11   1 
ATOM 3670  H HH12   . ARG A 1 241 ? 6.995   -10.142 -14.212 1.00 72.70  ?  245 ARG A HH12   1 
ATOM 3671  H HH21   . ARG A 1 241 ? 7.893   -12.546 -16.277 1.00 67.63  ?  245 ARG A HH21   1 
ATOM 3672  H HH22   . ARG A 1 241 ? 6.725   -11.969 -15.556 1.00 67.63  ?  245 ARG A HH22   1 
ATOM 3673  N N      . ASP A 1 242 ? 10.997  -10.069 -21.442 1.00 36.27  ?  246 ASP A N      1 
ATOM 3674  C CA     . ASP A 1 242 ? 10.747  -9.043  -22.440 1.00 33.10  ?  246 ASP A CA     1 
ATOM 3675  C C      . ASP A 1 242 ? 9.270   -8.672  -22.446 1.00 35.97  ?  246 ASP A C      1 
ATOM 3676  O O      . ASP A 1 242 ? 8.396   -9.540  -22.389 1.00 48.24  ?  246 ASP A O      1 
ATOM 3677  C CB     . ASP A 1 242 ? 11.173  -9.539  -23.818 1.00 37.98  ?  246 ASP A CB     1 
ATOM 3678  C CG     . ASP A 1 242 ? 11.042  -8.480  -24.877 1.00 21.58  ?  246 ASP A CG     1 
ATOM 3679  O OD1    . ASP A 1 242 ? 12.079  -7.933  -25.299 1.00 20.30  ?  246 ASP A OD1    1 
ATOM 3680  O OD2    . ASP A 1 242 ? 9.900   -8.191  -25.280 1.00 30.60  -1 246 ASP A OD2    1 
ATOM 3681  H H      . ASP A 1 242 ? 11.129  -10.855 -21.766 1.00 43.52  ?  246 ASP A H      1 
ATOM 3682  H HA     . ASP A 1 242 ? 11.263  -8.250  -22.225 1.00 39.72  ?  246 ASP A HA     1 
ATOM 3683  H HB2    . ASP A 1 242 ? 12.103  -9.815  -23.782 1.00 45.58  ?  246 ASP A HB2    1 
ATOM 3684  H HB3    . ASP A 1 242 ? 10.613  -10.289 -24.072 1.00 45.58  ?  246 ASP A HB3    1 
ATOM 3685  N N      . VAL A 1 243 ? 8.989   -7.369  -22.514 1.00 36.83  ?  247 VAL A N      1 
ATOM 3686  C CA     . VAL A 1 243 ? 7.610   -6.901  -22.426 1.00 33.16  ?  247 VAL A CA     1 
ATOM 3687  C C      . VAL A 1 243 ? 6.744   -7.490  -23.526 1.00 32.48  ?  247 VAL A C      1 
ATOM 3688  O O      . VAL A 1 243 ? 5.514   -7.453  -23.429 1.00 35.02  ?  247 VAL A O      1 
ATOM 3689  C CB     . VAL A 1 243 ? 7.549   -5.359  -22.457 1.00 33.89  ?  247 VAL A CB     1 
ATOM 3690  C CG1    . VAL A 1 243 ? 8.282   -4.773  -21.263 1.00 40.44  ?  247 VAL A CG1    1 
ATOM 3691  C CG2    . VAL A 1 243 ? 8.113   -4.813  -23.758 1.00 41.54  ?  247 VAL A CG2    1 
ATOM 3692  H H      . VAL A 1 243 ? 9.573   -6.744  -22.609 1.00 44.20  ?  247 VAL A H      1 
ATOM 3693  H HA     . VAL A 1 243 ? 7.241   -7.191  -21.577 1.00 39.80  ?  247 VAL A HA     1 
ATOM 3694  H HB     . VAL A 1 243 ? 6.621   -5.083  -22.398 1.00 40.67  ?  247 VAL A HB     1 
ATOM 3695  H HG11   . VAL A 1 243 ? 8.230   -3.806  -21.304 1.00 48.53  ?  247 VAL A HG11   1 
ATOM 3696  H HG12   . VAL A 1 243 ? 7.864   -5.093  -20.448 1.00 48.53  ?  247 VAL A HG12   1 
ATOM 3697  H HG13   . VAL A 1 243 ? 9.209   -5.056  -21.293 1.00 48.53  ?  247 VAL A HG13   1 
ATOM 3698  H HG21   . VAL A 1 243 ? 8.059   -3.845  -23.744 1.00 49.84  ?  247 VAL A HG21   1 
ATOM 3699  H HG22   . VAL A 1 243 ? 9.038   -5.092  -23.842 1.00 49.84  ?  247 VAL A HG22   1 
ATOM 3700  H HG23   . VAL A 1 243 ? 7.593   -5.163  -24.498 1.00 49.84  ?  247 VAL A HG23   1 
ATOM 3701  N N      . ASN A 1 244 ? 7.350   -8.029  -24.578 1.00 29.09  ?  248 ASN A N      1 
ATOM 3702  C CA     . ASN A 1 244 ? 6.598   -8.671  -25.644 1.00 42.89  ?  248 ASN A CA     1 
ATOM 3703  C C      . ASN A 1 244 ? 6.355   -10.127 -25.276 1.00 53.98  ?  248 ASN A C      1 
ATOM 3704  O O      . ASN A 1 244 ? 7.278   -10.830 -24.853 1.00 64.14  ?  248 ASN A O      1 
ATOM 3705  C CB     . ASN A 1 244 ? 7.345   -8.578  -26.973 1.00 45.41  ?  248 ASN A CB     1 
ATOM 3706  C CG     . ASN A 1 244 ? 6.434   -8.784  -28.163 1.00 55.83  ?  248 ASN A CG     1 
ATOM 3707  O OD1    . ASN A 1 244 ? 5.287   -8.340  -28.164 1.00 60.58  ?  248 ASN A OD1    1 
ATOM 3708  N ND2    . ASN A 1 244 ? 6.938   -9.467  -29.181 1.00 53.78  ?  248 ASN A ND2    1 
ATOM 3709  H H      . ASN A 1 244 ? 8.202   -8.036  -24.696 1.00 34.90  ?  248 ASN A H      1 
ATOM 3710  H HA     . ASN A 1 244 ? 5.739   -8.231  -25.743 1.00 51.47  ?  248 ASN A HA     1 
ATOM 3711  H HB2    . ASN A 1 244 ? 7.747   -7.698  -27.050 1.00 54.50  ?  248 ASN A HB2    1 
ATOM 3712  H HB3    . ASN A 1 244 ? 8.033   -9.262  -26.999 1.00 54.50  ?  248 ASN A HB3    1 
ATOM 3713  H HD21   . ASN A 1 244 ? 6.459   -9.610  -29.881 1.00 64.53  ?  248 ASN A HD21   1 
ATOM 3714  H HD22   . ASN A 1 244 ? 7.743   -9.767  -29.142 1.00 64.53  ?  248 ASN A HD22   1 
ATOM 3715  N N      . ILE A 1 245 ? 5.110   -10.573 -25.436 1.00 61.77  ?  249 ILE A N      1 
ATOM 3716  C CA     . ILE A 1 245 ? 4.755   -11.937 -25.059 1.00 46.38  ?  249 ILE A CA     1 
ATOM 3717  C C      . ILE A 1 245 ? 5.494   -12.937 -25.934 1.00 31.02  ?  249 ILE A C      1 
ATOM 3718  O O      . ILE A 1 245 ? 6.042   -13.931 -25.444 1.00 32.72  ?  249 ILE A O      1 
ATOM 3719  C CB     . ILE A 1 245 ? 3.230   -12.130 -25.145 1.00 39.29  ?  249 ILE A CB     1 
ATOM 3720  C CG1    . ILE A 1 245 ? 2.514   -11.094 -24.278 1.00 64.09  ?  249 ILE A CG1    1 
ATOM 3721  C CG2    . ILE A 1 245 ? 2.846   -13.525 -24.699 1.00 27.30  ?  249 ILE A CG2    1 
ATOM 3722  C CD1    . ILE A 1 245 ? 1.967   -9.912  -25.043 1.00 72.96  ?  249 ILE A CD1    1 
ATOM 3723  H H      . ILE A 1 245 ? 4.460   -10.111 -25.757 1.00 74.12  ?  249 ILE A H      1 
ATOM 3724  H HA     . ILE A 1 245 ? 5.023   -12.090 -24.139 1.00 55.66  ?  249 ILE A HA     1 
ATOM 3725  H HB     . ILE A 1 245 ? 2.953   -12.011 -26.067 1.00 47.15  ?  249 ILE A HB     1 
ATOM 3726  H HG12   . ILE A 1 245 ? 1.770   -11.525 -23.830 1.00 76.91  ?  249 ILE A HG12   1 
ATOM 3727  H HG13   . ILE A 1 245 ? 3.140   -10.754 -23.620 1.00 76.91  ?  249 ILE A HG13   1 
ATOM 3728  H HG21   . ILE A 1 245 ? 1.883   -13.623 -24.763 1.00 32.77  ?  249 ILE A HG21   1 
ATOM 3729  H HG22   . ILE A 1 245 ? 3.283   -14.172 -25.276 1.00 32.77  ?  249 ILE A HG22   1 
ATOM 3730  H HG23   . ILE A 1 245 ? 3.133   -13.653 -23.782 1.00 32.77  ?  249 ILE A HG23   1 
ATOM 3731  H HD11   . ILE A 1 245 ? 1.532   -9.308  -24.421 1.00 87.55  ?  249 ILE A HD11   1 
ATOM 3732  H HD12   . ILE A 1 245 ? 2.699   -9.458  -25.488 1.00 87.55  ?  249 ILE A HD12   1 
ATOM 3733  H HD13   . ILE A 1 245 ? 1.327   -10.230 -25.699 1.00 87.55  ?  249 ILE A HD13   1 
ATOM 3734  N N      . VAL A 1 246 ? 5.529   -12.687 -27.241 1.00 32.63  ?  250 VAL A N      1 
ATOM 3735  C CA     . VAL A 1 246 ? 6.161   -13.624 -28.162 1.00 32.14  ?  250 VAL A CA     1 
ATOM 3736  C C      . VAL A 1 246 ? 7.641   -13.772 -27.839 1.00 35.97  ?  250 VAL A C      1 
ATOM 3737  O O      . VAL A 1 246 ? 8.182   -14.883 -27.835 1.00 50.11  ?  250 VAL A O      1 
ATOM 3738  C CB     . VAL A 1 246 ? 5.940   -13.167 -29.614 1.00 32.99  ?  250 VAL A CB     1 
ATOM 3739  C CG1    . VAL A 1 246 ? 6.544   -14.160 -30.585 1.00 36.88  ?  250 VAL A CG1    1 
ATOM 3740  C CG2    . VAL A 1 246 ? 4.457   -12.982 -29.896 1.00 39.25  ?  250 VAL A CG2    1 
ATOM 3741  H H      . VAL A 1 246 ? 5.196   -11.989 -27.616 1.00 39.16  ?  250 VAL A H      1 
ATOM 3742  H HA     . VAL A 1 246 ? 5.745   -14.495 -28.058 1.00 38.57  ?  250 VAL A HA     1 
ATOM 3743  H HB     . VAL A 1 246 ? 6.380   -12.312 -29.747 1.00 39.59  ?  250 VAL A HB     1 
ATOM 3744  H HG11   . VAL A 1 246 ? 6.391   -13.849 -31.490 1.00 44.26  ?  250 VAL A HG11   1 
ATOM 3745  H HG12   . VAL A 1 246 ? 7.496   -14.229 -30.414 1.00 44.26  ?  250 VAL A HG12   1 
ATOM 3746  H HG13   . VAL A 1 246 ? 6.121   -15.024 -30.456 1.00 44.26  ?  250 VAL A HG13   1 
ATOM 3747  H HG21   . VAL A 1 246 ? 4.344   -12.694 -30.815 1.00 47.11  ?  250 VAL A HG21   1 
ATOM 3748  H HG22   . VAL A 1 246 ? 4.002   -13.827 -29.756 1.00 47.11  ?  250 VAL A HG22   1 
ATOM 3749  H HG23   . VAL A 1 246 ? 4.102   -12.311 -29.293 1.00 47.11  ?  250 VAL A HG23   1 
ATOM 3750  N N      . ASN A 1 247 ? 8.321   -12.659 -27.560 1.00 45.37  ?  251 ASN A N      1 
ATOM 3751  C CA     . ASN A 1 247 ? 9.749   -12.723 -27.277 1.00 34.82  ?  251 ASN A CA     1 
ATOM 3752  C C      . ASN A 1 247 ? 10.048  -13.475 -25.988 1.00 39.53  ?  251 ASN A C      1 
ATOM 3753  O O      . ASN A 1 247 ? 11.163  -13.980 -25.828 1.00 47.14  ?  251 ASN A O      1 
ATOM 3754  C CB     . ASN A 1 247 ? 10.335  -11.313 -27.204 1.00 52.54  ?  251 ASN A CB     1 
ATOM 3755  C CG     . ASN A 1 247 ? 10.189  -10.555 -28.507 1.00 49.31  ?  251 ASN A CG     1 
ATOM 3756  O OD1    . ASN A 1 247 ? 9.250   -10.781 -29.269 1.00 45.61  ?  251 ASN A OD1    1 
ATOM 3757  N ND2    . ASN A 1 247 ? 11.123  -9.651  -28.771 1.00 44.08  ?  251 ASN A ND2    1 
ATOM 3758  H H      . ASN A 1 247 ? 7.983   -11.869 -27.530 1.00 54.44  ?  251 ASN A H      1 
ATOM 3759  H HA     . ASN A 1 247 ? 10.190  -13.191 -28.002 1.00 41.78  ?  251 ASN A HA     1 
ATOM 3760  H HB2    . ASN A 1 247 ? 9.874   -10.814 -26.512 1.00 63.05  ?  251 ASN A HB2    1 
ATOM 3761  H HB3    . ASN A 1 247 ? 11.281  -11.374 -26.997 1.00 63.05  ?  251 ASN A HB3    1 
ATOM 3762  H HD21   . ASN A 1 247 ? 11.085  -9.194  -29.499 1.00 52.89  ?  251 ASN A HD21   1 
ATOM 3763  H HD22   . ASN A 1 247 ? 11.767  -9.523  -28.216 1.00 52.89  ?  251 ASN A HD22   1 
ATOM 3764  N N      . ARG A 1 248 ? 9.087   -13.556 -25.069 1.00 38.60  ?  252 ARG A N      1 
ATOM 3765  C CA     . ARG A 1 248 ? 9.253   -14.335 -23.849 1.00 44.27  ?  252 ARG A CA     1 
ATOM 3766  C C      . ARG A 1 248 ? 8.907   -15.804 -24.034 1.00 44.39  ?  252 ARG A C      1 
ATOM 3767  O O      . ARG A 1 248 ? 9.338   -16.636 -23.227 1.00 58.67  ?  252 ARG A O      1 
ATOM 3768  C CB     . ARG A 1 248 ? 8.383   -13.757 -22.729 1.00 48.21  ?  252 ARG A CB     1 
ATOM 3769  C CG     . ARG A 1 248 ? 8.968   -12.526 -22.081 1.00 33.45  ?  252 ARG A CG     1 
ATOM 3770  C CD     . ARG A 1 248 ? 8.114   -12.021 -20.938 1.00 40.55  ?  252 ARG A CD     1 
ATOM 3771  N NE     . ARG A 1 248 ? 6.892   -11.369 -21.401 1.00 44.62  ?  252 ARG A NE     1 
ATOM 3772  C CZ     . ARG A 1 248 ? 5.656   -11.796 -21.157 1.00 36.46  ?  252 ARG A CZ     1 
ATOM 3773  N NH1    . ARG A 1 248 ? 5.437   -12.889 -20.440 1.00 37.53  1  252 ARG A NH1    1 
ATOM 3774  N NH2    . ARG A 1 248 ? 4.624   -11.115 -21.628 1.00 33.97  ?  252 ARG A NH2    1 
ATOM 3775  H H      . ARG A 1 248 ? 8.324   -13.164 -25.131 1.00 46.32  ?  252 ARG A H      1 
ATOM 3776  H HA     . ARG A 1 248 ? 10.179  -14.280 -23.567 1.00 53.12  ?  252 ARG A HA     1 
ATOM 3777  H HB2    . ARG A 1 248 ? 7.518   -13.517 -23.096 1.00 57.85  ?  252 ARG A HB2    1 
ATOM 3778  H HB3    . ARG A 1 248 ? 8.273   -14.431 -22.040 1.00 57.85  ?  252 ARG A HB3    1 
ATOM 3779  H HG2    . ARG A 1 248 ? 9.847   -12.738 -21.730 1.00 40.14  ?  252 ARG A HG2    1 
ATOM 3780  H HG3    . ARG A 1 248 ? 9.035   -11.820 -22.743 1.00 40.14  ?  252 ARG A HG3    1 
ATOM 3781  H HD2    . ARG A 1 248 ? 7.861   -12.770 -20.376 1.00 48.66  ?  252 ARG A HD2    1 
ATOM 3782  H HD3    . ARG A 1 248 ? 8.622   -11.375 -20.423 1.00 48.66  ?  252 ARG A HD3    1 
ATOM 3783  H HE     . ARG A 1 248 ? 6.978   -10.653 -21.868 1.00 53.54  ?  252 ARG A HE     1 
ATOM 3784  H HH11   . ARG A 1 248 ? 6.101   -13.338 -20.127 1.00 45.04  ?  252 ARG A HH11   1 
ATOM 3785  H HH12   . ARG A 1 248 ? 4.632   -13.151 -20.291 1.00 45.04  ?  252 ARG A HH12   1 
ATOM 3786  H HH21   . ARG A 1 248 ? 4.755   -10.404 -22.094 1.00 40.77  ?  252 ARG A HH21   1 
ATOM 3787  H HH22   . ARG A 1 248 ? 3.823   -11.387 -21.473 1.00 40.77  ?  252 ARG A HH22   1 
ATOM 3788  N N      . ARG A 1 249 ? 8.138   -16.137 -25.067 1.00 45.72  ?  253 ARG A N      1 
ATOM 3789  C CA     . ARG A 1 249 ? 7.779   -17.524 -25.329 1.00 41.95  ?  253 ARG A CA     1 
ATOM 3790  C C      . ARG A 1 249 ? 8.870   -18.249 -26.106 1.00 34.15  ?  253 ARG A C      1 
ATOM 3791  O O      . ARG A 1 249 ? 9.169   -19.413 -25.820 1.00 53.54  ?  253 ARG A O      1 
ATOM 3792  C CB     . ARG A 1 249 ? 6.458   -17.571 -26.093 1.00 38.26  ?  253 ARG A CB     1 
ATOM 3793  C CG     . ARG A 1 249 ? 6.102   -18.922 -26.673 1.00 32.52  ?  253 ARG A CG     1 
ATOM 3794  C CD     . ARG A 1 249 ? 4.734   -18.873 -27.310 1.00 57.17  ?  253 ARG A CD     1 
ATOM 3795  N NE     . ARG A 1 249 ? 4.656   -17.832 -28.329 1.00 36.04  ?  253 ARG A NE     1 
ATOM 3796  C CZ     . ARG A 1 249 ? 3.522   -17.313 -28.787 1.00 52.86  ?  253 ARG A CZ     1 
ATOM 3797  N NH1    . ARG A 1 249 ? 2.354   -17.727 -28.315 1.00 63.48  1  253 ARG A NH1    1 
ATOM 3798  N NH2    . ARG A 1 249 ? 3.555   -16.371 -29.716 1.00 58.49  ?  253 ARG A NH2    1 
ATOM 3799  H H      . ARG A 1 249 ? 7.810   -15.576 -25.630 1.00 54.86  ?  253 ARG A H      1 
ATOM 3800  H HA     . ARG A 1 249 ? 7.655   -17.985 -24.484 1.00 50.34  ?  253 ARG A HA     1 
ATOM 3801  H HB2    . ARG A 1 249 ? 5.743   -17.314 -25.490 1.00 45.91  ?  253 ARG A HB2    1 
ATOM 3802  H HB3    . ARG A 1 249 ? 6.504   -16.940 -26.829 1.00 45.91  ?  253 ARG A HB3    1 
ATOM 3803  H HG2    . ARG A 1 249 ? 6.750   -19.163 -27.353 1.00 39.03  ?  253 ARG A HG2    1 
ATOM 3804  H HG3    . ARG A 1 249 ? 6.089   -19.585 -25.966 1.00 39.03  ?  253 ARG A HG3    1 
ATOM 3805  H HD2    . ARG A 1 249 ? 4.547   -19.726 -27.732 1.00 68.61  ?  253 ARG A HD2    1 
ATOM 3806  H HD3    . ARG A 1 249 ? 4.071   -18.682 -26.629 1.00 68.61  ?  253 ARG A HD3    1 
ATOM 3807  H HE     . ARG A 1 249 ? 5.393   -17.534 -28.655 1.00 43.24  ?  253 ARG A HE     1 
ATOM 3808  H HH11   . ARG A 1 249 ? 2.327   -18.339 -27.711 1.00 76.18  ?  253 ARG A HH11   1 
ATOM 3809  H HH12   . ARG A 1 249 ? 1.624   -17.386 -28.614 1.00 76.18  ?  253 ARG A HH12   1 
ATOM 3810  H HH21   . ARG A 1 249 ? 4.310   -16.098 -30.025 1.00 70.18  ?  253 ARG A HH21   1 
ATOM 3811  H HH22   . ARG A 1 249 ? 2.822   -16.033 -30.012 1.00 70.18  ?  253 ARG A HH22   1 
ATOM 3812  N N      . LEU A 1 250 ? 9.478   -17.579 -27.085 1.00 37.76  ?  254 LEU A N      1 
ATOM 3813  C CA     . LEU A 1 250 ? 10.438  -18.249 -27.953 1.00 44.60  ?  254 LEU A CA     1 
ATOM 3814  C C      . LEU A 1 250 ? 11.758  -18.518 -27.246 1.00 50.47  ?  254 LEU A C      1 
ATOM 3815  O O      . LEU A 1 250 ? 12.485  -19.440 -27.630 1.00 66.69  ?  254 LEU A O      1 
ATOM 3816  C CB     . LEU A 1 250 ? 10.675  -17.421 -29.213 1.00 42.32  ?  254 LEU A CB     1 
ATOM 3817  C CG     . LEU A 1 250 ? 9.688   -17.696 -30.348 1.00 58.14  ?  254 LEU A CG     1 
ATOM 3818  C CD1    . LEU A 1 250 ? 8.291   -17.226 -29.987 1.00 53.24  ?  254 LEU A CD1    1 
ATOM 3819  C CD2    . LEU A 1 250 ? 10.159  -17.046 -31.634 1.00 53.82  ?  254 LEU A CD2    1 
ATOM 3820  H H      . LEU A 1 250 ? 9.353   -16.747 -27.264 1.00 45.31  ?  254 LEU A H      1 
ATOM 3821  H HA     . LEU A 1 250 ? 10.068  -19.104 -28.225 1.00 53.51  ?  254 LEU A HA     1 
ATOM 3822  H HB2    . LEU A 1 250 ? 10.605  -16.481 -28.984 1.00 50.79  ?  254 LEU A HB2    1 
ATOM 3823  H HB3    . LEU A 1 250 ? 11.566  -17.611 -29.546 1.00 50.79  ?  254 LEU A HB3    1 
ATOM 3824  H HG     . LEU A 1 250 ? 9.647   -18.653 -30.499 1.00 69.77  ?  254 LEU A HG     1 
ATOM 3825  H HD11   . LEU A 1 250 ? 7.693   -17.415 -30.727 1.00 63.88  ?  254 LEU A HD11   1 
ATOM 3826  H HD12   . LEU A 1 250 ? 7.995   -17.698 -29.193 1.00 63.88  ?  254 LEU A HD12   1 
ATOM 3827  H HD13   . LEU A 1 250 ? 8.314   -16.271 -29.816 1.00 63.88  ?  254 LEU A HD13   1 
ATOM 3828  H HD21   . LEU A 1 250 ? 9.517   -17.235 -32.337 1.00 64.58  ?  254 LEU A HD21   1 
ATOM 3829  H HD22   . LEU A 1 250 ? 10.227  -16.088 -31.497 1.00 64.58  ?  254 LEU A HD22   1 
ATOM 3830  H HD23   . LEU A 1 250 ? 11.027  -17.409 -31.872 1.00 64.58  ?  254 LEU A HD23   1 
ATOM 3831  N N      . VAL A 1 251 ? 12.094  -17.731 -26.224 1.00 41.33  ?  255 VAL A N      1 
ATOM 3832  C CA     . VAL A 1 251 ? 13.311  -18.003 -25.465 1.00 40.84  ?  255 VAL A CA     1 
ATOM 3833  C C      . VAL A 1 251 ? 13.235  -19.385 -24.836 1.00 54.62  ?  255 VAL A C      1 
ATOM 3834  O O      . VAL A 1 251 ? 14.217  -20.136 -24.828 1.00 68.67  ?  255 VAL A O      1 
ATOM 3835  C CB     . VAL A 1 251 ? 13.549  -16.909 -24.407 1.00 64.48  ?  255 VAL A CB     1 
ATOM 3836  C CG1    . VAL A 1 251 ? 12.346  -16.762 -23.492 1.00 53.58  ?  255 VAL A CG1    1 
ATOM 3837  C CG2    . VAL A 1 251 ? 14.807  -17.205 -23.593 1.00 43.60  ?  255 VAL A CG2    1 
ATOM 3838  H H      . VAL A 1 251 ? 11.645  -17.049 -25.955 1.00 49.59  ?  255 VAL A H      1 
ATOM 3839  H HA     . VAL A 1 251 ? 14.067  -17.996 -26.073 1.00 49.01  ?  255 VAL A HA     1 
ATOM 3840  H HB     . VAL A 1 251 ? 13.681  -16.061 -24.859 1.00 77.37  ?  255 VAL A HB     1 
ATOM 3841  H HG11   . VAL A 1 251 ? 12.528  -16.067 -22.840 1.00 64.30  ?  255 VAL A HG11   1 
ATOM 3842  H HG12   . VAL A 1 251 ? 11.572  -16.521 -24.025 1.00 64.30  ?  255 VAL A HG12   1 
ATOM 3843  H HG13   . VAL A 1 251 ? 12.187  -17.606 -23.041 1.00 64.30  ?  255 VAL A HG13   1 
ATOM 3844  H HG21   . VAL A 1 251 ? 14.931  -16.502 -22.936 1.00 52.32  ?  255 VAL A HG21   1 
ATOM 3845  H HG22   . VAL A 1 251 ? 14.700  -18.060 -23.146 1.00 52.32  ?  255 VAL A HG22   1 
ATOM 3846  H HG23   . VAL A 1 251 ? 15.569  -17.237 -24.192 1.00 52.32  ?  255 VAL A HG23   1 
ATOM 3847  N N      . TYR A 1 252 ? 12.068  -19.746 -24.303 1.00 57.60  ?  256 TYR A N      1 
ATOM 3848  C CA     . TYR A 1 252 ? 11.892  -21.087 -23.762 1.00 41.87  ?  256 TYR A CA     1 
ATOM 3849  C C      . TYR A 1 252 ? 11.780  -22.112 -24.883 1.00 50.97  ?  256 TYR A C      1 
ATOM 3850  O O      . TYR A 1 252 ? 12.509  -23.110 -24.903 1.00 60.79  ?  256 TYR A O      1 
ATOM 3851  C CB     . TYR A 1 252 ? 10.657  -21.136 -22.864 1.00 41.39  ?  256 TYR A CB     1 
ATOM 3852  C CG     . TYR A 1 252 ? 10.774  -20.328 -21.593 1.00 54.87  ?  256 TYR A CG     1 
ATOM 3853  C CD1    . TYR A 1 252 ? 11.741  -20.628 -20.644 1.00 59.64  ?  256 TYR A CD1    1 
ATOM 3854  C CD2    . TYR A 1 252 ? 9.905   -19.277 -21.331 1.00 47.95  ?  256 TYR A CD2    1 
ATOM 3855  C CE1    . TYR A 1 252 ? 11.849  -19.897 -19.479 1.00 56.00  ?  256 TYR A CE1    1 
ATOM 3856  C CE2    . TYR A 1 252 ? 10.005  -18.541 -20.167 1.00 43.34  ?  256 TYR A CE2    1 
ATOM 3857  C CZ     . TYR A 1 252 ? 10.978  -18.857 -19.245 1.00 42.23  ?  256 TYR A CZ     1 
ATOM 3858  O OH     . TYR A 1 252 ? 11.086  -18.131 -18.083 1.00 43.24  ?  256 TYR A OH     1 
ATOM 3859  H H      . TYR A 1 252 ? 11.375  -19.240 -24.244 1.00 69.11  ?  256 TYR A H      1 
ATOM 3860  H HA     . TYR A 1 252 ? 12.665  -21.315 -23.223 1.00 50.24  ?  256 TYR A HA     1 
ATOM 3861  H HB2    . TYR A 1 252 ? 9.898   -20.793 -23.361 1.00 49.66  ?  256 TYR A HB2    1 
ATOM 3862  H HB3    . TYR A 1 252 ? 10.492  -22.058 -22.612 1.00 49.66  ?  256 TYR A HB3    1 
ATOM 3863  H HD1    . TYR A 1 252 ? 12.331  -21.330 -20.799 1.00 71.57  ?  256 TYR A HD1    1 
ATOM 3864  H HD2    . TYR A 1 252 ? 9.248   -19.062 -21.953 1.00 57.54  ?  256 TYR A HD2    1 
ATOM 3865  H HE1    . TYR A 1 252 ? 12.504  -20.108 -18.853 1.00 67.20  ?  256 TYR A HE1    1 
ATOM 3866  H HE2    . TYR A 1 252 ? 9.419   -17.838 -20.007 1.00 52.00  ?  256 TYR A HE2    1 
ATOM 3867  H HH     . TYR A 1 252 ? 11.717  -18.429 -17.616 1.00 51.88  ?  256 TYR A HH     1 
ATOM 3868  N N      . SER A 1 253 ? 10.876  -21.877 -25.832 1.00 52.12  ?  257 SER A N      1 
ATOM 3869  C CA     . SER A 1 253 ? 10.670  -22.802 -26.938 1.00 49.44  ?  257 SER A CA     1 
ATOM 3870  C C      . SER A 1 253 ? 11.921  -22.942 -27.796 1.00 42.07  ?  257 SER A C      1 
ATOM 3871  O O      . SER A 1 253 ? 12.554  -23.999 -27.808 1.00 65.21  ?  257 SER A O      1 
ATOM 3872  C CB     . SER A 1 253 ? 9.497   -22.342 -27.804 1.00 34.01  ?  257 SER A CB     1 
ATOM 3873  O OG     . SER A 1 253 ? 8.291   -22.338 -27.064 1.00 47.30  ?  257 SER A OG     1 
ATOM 3874  H H      . SER A 1 253 ? 10.367  -21.184 -25.856 1.00 62.55  ?  257 SER A H      1 
ATOM 3875  H HA     . SER A 1 253 ? 10.453  -23.678 -26.581 1.00 59.33  ?  257 SER A HA     1 
ATOM 3876  H HB2    . SER A 1 253 ? 9.675   -21.443 -28.123 1.00 40.81  ?  257 SER A HB2    1 
ATOM 3877  H HB3    . SER A 1 253 ? 9.404   -22.947 -28.556 1.00 40.81  ?  257 SER A HB3    1 
ATOM 3878  H HG     . SER A 1 253 ? 7.656   -22.083 -27.551 1.00 56.77  ?  257 SER A HG     1 
ATOM 3879  N N      . ARG A 1 254 ? 12.288  -21.880 -28.511 1.00 43.25  ?  258 ARG A N      1 
ATOM 3880  C CA     . ARG A 1 254 ? 13.329  -21.993 -29.527 1.00 48.59  ?  258 ARG A CA     1 
ATOM 3881  C C      . ARG A 1 254 ? 14.711  -22.135 -28.903 1.00 54.20  ?  258 ARG A C      1 
ATOM 3882  O O      . ARG A 1 254 ? 15.460  -23.060 -29.235 1.00 67.98  ?  258 ARG A O      1 
ATOM 3883  C CB     . ARG A 1 254 ? 13.290  -20.777 -30.449 1.00 49.19  ?  258 ARG A CB     1 
ATOM 3884  C CG     . ARG A 1 254 ? 12.004  -20.638 -31.238 1.00 59.61  ?  258 ARG A CG     1 
ATOM 3885  C CD     . ARG A 1 254 ? 11.858  -21.742 -32.263 1.00 69.84  ?  258 ARG A CD     1 
ATOM 3886  N NE     . ARG A 1 254 ? 10.626  -21.607 -33.034 1.00 81.22  ?  258 ARG A NE     1 
ATOM 3887  C CZ     . ARG A 1 254 ? 10.486  -20.823 -34.099 1.00 89.60  ?  258 ARG A CZ     1 
ATOM 3888  N NH1    . ARG A 1 254 ? 9.323   -20.771 -34.731 1.00 89.97  1  258 ARG A NH1    1 
ATOM 3889  N NH2    . ARG A 1 254 ? 11.502  -20.089 -34.533 1.00 89.90  ?  258 ARG A NH2    1 
ATOM 3890  H H      . ARG A 1 254 ? 11.953  -21.092 -28.429 1.00 51.90  ?  258 ARG A H      1 
ATOM 3891  H HA     . ARG A 1 254 ? 13.161  -22.782 -30.064 1.00 58.31  ?  258 ARG A HA     1 
ATOM 3892  H HB2    . ARG A 1 254 ? 13.395  -19.975 -29.913 1.00 59.03  ?  258 ARG A HB2    1 
ATOM 3893  H HB3    . ARG A 1 254 ? 14.020  -20.844 -31.084 1.00 59.03  ?  258 ARG A HB3    1 
ATOM 3894  H HG2    . ARG A 1 254 ? 11.250  -20.685 -30.631 1.00 71.53  ?  258 ARG A HG2    1 
ATOM 3895  H HG3    . ARG A 1 254 ? 12.006  -19.788 -31.706 1.00 71.53  ?  258 ARG A HG3    1 
ATOM 3896  H HD2    . ARG A 1 254 ? 12.607  -21.707 -32.879 1.00 83.81  ?  258 ARG A HD2    1 
ATOM 3897  H HD3    . ARG A 1 254 ? 11.839  -22.599 -31.809 1.00 83.81  ?  258 ARG A HD3    1 
ATOM 3898  H HE     . ARG A 1 254 ? 9.944   -22.066 -32.782 1.00 97.47  ?  258 ARG A HE     1 
ATOM 3899  H HH11   . ARG A 1 254 ? 8.661   -21.244 -34.453 1.00 107.96 ?  258 ARG A HH11   1 
ATOM 3900  H HH12   . ARG A 1 254 ? 9.230   -20.264 -35.419 1.00 107.96 ?  258 ARG A HH12   1 
ATOM 3901  H HH21   . ARG A 1 254 ? 12.259  -20.120 -34.126 1.00 107.88 ?  258 ARG A HH21   1 
ATOM 3902  H HH22   . ARG A 1 254 ? 11.404  -19.584 -35.222 1.00 107.88 ?  258 ARG A HH22   1 
ATOM 3903  N N      . ILE A 1 255 ? 15.072  -21.225 -27.999 1.00 46.28  ?  259 ILE A N      1 
ATOM 3904  C CA     . ILE A 1 255 ? 16.463  -21.134 -27.571 1.00 50.57  ?  259 ILE A CA     1 
ATOM 3905  C C      . ILE A 1 255 ? 16.814  -22.275 -26.629 1.00 58.40  ?  259 ILE A C      1 
ATOM 3906  O O      . ILE A 1 255 ? 17.860  -22.917 -26.780 1.00 76.60  ?  259 ILE A O      1 
ATOM 3907  C CB     . ILE A 1 255 ? 16.732  -19.757 -26.939 1.00 52.60  ?  259 ILE A CB     1 
ATOM 3908  C CG1    . ILE A 1 255 ? 16.489  -18.676 -27.995 1.00 30.66  ?  259 ILE A CG1    1 
ATOM 3909  C CG2    . ILE A 1 255 ? 18.152  -19.690 -26.377 1.00 60.37  ?  259 ILE A CG2    1 
ATOM 3910  C CD1    . ILE A 1 255 ? 16.927  -17.296 -27.612 1.00 39.65  ?  259 ILE A CD1    1 
ATOM 3911  H H      . ILE A 1 255 ? 14.541  -20.660 -27.626 1.00 55.54  ?  259 ILE A H      1 
ATOM 3912  H HA     . ILE A 1 255 ? 17.032  -21.213 -28.352 1.00 60.68  ?  259 ILE A HA     1 
ATOM 3913  H HB     . ILE A 1 255 ? 16.105  -19.623 -26.211 1.00 63.12  ?  259 ILE A HB     1 
ATOM 3914  H HG12   . ILE A 1 255 ? 16.969  -18.921 -28.802 1.00 36.79  ?  259 ILE A HG12   1 
ATOM 3915  H HG13   . ILE A 1 255 ? 15.538  -18.638 -28.184 1.00 36.79  ?  259 ILE A HG13   1 
ATOM 3916  H HG21   . ILE A 1 255 ? 18.296  -18.814 -25.986 1.00 72.44  ?  259 ILE A HG21   1 
ATOM 3917  H HG22   . ILE A 1 255 ? 18.256  -20.377 -25.700 1.00 72.44  ?  259 ILE A HG22   1 
ATOM 3918  H HG23   . ILE A 1 255 ? 18.783  -19.838 -27.099 1.00 72.44  ?  259 ILE A HG23   1 
ATOM 3919  H HD11   . ILE A 1 255 ? 16.731  -16.689 -28.343 1.00 47.58  ?  259 ILE A HD11   1 
ATOM 3920  H HD12   . ILE A 1 255 ? 16.445  -17.022 -26.816 1.00 47.58  ?  259 ILE A HD12   1 
ATOM 3921  H HD13   . ILE A 1 255 ? 17.881  -17.306 -27.435 1.00 47.58  ?  259 ILE A HD13   1 
ATOM 3922  N N      . LEU A 1 256 ? 15.958  -22.557 -25.649 1.00 53.32  ?  260 LEU A N      1 
ATOM 3923  C CA     . LEU A 1 256 ? 16.280  -23.604 -24.690 1.00 58.53  ?  260 LEU A CA     1 
ATOM 3924  C C      . LEU A 1 256 ? 16.075  -25.002 -25.259 1.00 53.23  ?  260 LEU A C      1 
ATOM 3925  O O      . LEU A 1 256 ? 16.606  -25.966 -24.697 1.00 66.40  ?  260 LEU A O      1 
ATOM 3926  C CB     . LEU A 1 256 ? 15.458  -23.425 -23.412 1.00 71.25  ?  260 LEU A CB     1 
ATOM 3927  C CG     . LEU A 1 256 ? 15.736  -22.131 -22.638 1.00 56.92  ?  260 LEU A CG     1 
ATOM 3928  C CD1    . LEU A 1 256 ? 14.874  -22.062 -21.397 1.00 41.35  ?  260 LEU A CD1    1 
ATOM 3929  C CD2    . LEU A 1 256 ? 17.203  -22.000 -22.254 1.00 41.10  ?  260 LEU A CD2    1 
ATOM 3930  H H      . LEU A 1 256 ? 15.203  -22.166 -25.521 1.00 63.99  ?  260 LEU A H      1 
ATOM 3931  H HA     . LEU A 1 256 ? 17.216  -23.523 -24.449 1.00 70.23  ?  260 LEU A HA     1 
ATOM 3932  H HB2    . LEU A 1 256 ? 14.517  -23.429 -23.648 1.00 85.50  ?  260 LEU A HB2    1 
ATOM 3933  H HB3    . LEU A 1 256 ? 15.647  -24.168 -22.818 1.00 85.50  ?  260 LEU A HB3    1 
ATOM 3934  H HG     . LEU A 1 256 ? 15.508  -21.375 -23.201 1.00 68.30  ?  260 LEU A HG     1 
ATOM 3935  H HD11   . LEU A 1 256 ? 15.067  -21.237 -20.925 1.00 49.62  ?  260 LEU A HD11   1 
ATOM 3936  H HD12   . LEU A 1 256 ? 13.941  -22.082 -21.660 1.00 49.62  ?  260 LEU A HD12   1 
ATOM 3937  H HD13   . LEU A 1 256 ? 15.076  -22.823 -20.830 1.00 49.62  ?  260 LEU A HD13   1 
ATOM 3938  H HD21   . LEU A 1 256 ? 17.329  -21.170 -21.769 1.00 49.32  ?  260 LEU A HD21   1 
ATOM 3939  H HD22   . LEU A 1 256 ? 17.451  -22.752 -21.694 1.00 49.32  ?  260 LEU A HD22   1 
ATOM 3940  H HD23   . LEU A 1 256 ? 17.741  -21.996 -23.061 1.00 49.32  ?  260 LEU A HD23   1 
ATOM 3941  N N      . LYS A 1 257 ? 15.328  -25.141 -26.356 1.00 52.50  ?  261 LYS A N      1 
ATOM 3942  C CA     . LYS A 1 257 ? 15.338  -26.404 -27.085 1.00 58.26  ?  261 LYS A CA     1 
ATOM 3943  C C      . LYS A 1 257 ? 16.596  -26.546 -27.928 1.00 60.07  ?  261 LYS A C      1 
ATOM 3944  O O      . LYS A 1 257 ? 17.101  -27.660 -28.098 1.00 70.85  ?  261 LYS A O      1 
ATOM 3945  C CB     . LYS A 1 257 ? 14.106  -26.528 -27.983 1.00 60.87  ?  261 LYS A CB     1 
ATOM 3946  C CG     . LYS A 1 257 ? 12.824  -26.895 -27.242 1.00 60.42  ?  261 LYS A CG     1 
ATOM 3947  C CD     . LYS A 1 257 ? 11.671  -27.215 -28.194 1.00 68.82  ?  261 LYS A CD     1 
ATOM 3948  C CE     . LYS A 1 257 ? 11.997  -28.388 -29.112 1.00 91.28  ?  261 LYS A CE     1 
ATOM 3949  N NZ     . LYS A 1 257 ? 10.784  -28.965 -29.758 1.00 92.61  1  261 LYS A NZ     1 
ATOM 3950  H H      . LYS A 1 257 ? 14.820  -24.533 -26.690 1.00 63.00  ?  261 LYS A H      1 
ATOM 3951  H HA     . LYS A 1 257 ? 15.320  -27.135 -26.449 1.00 69.91  ?  261 LYS A HA     1 
ATOM 3952  H HB2    . LYS A 1 257 ? 13.957  -25.679 -28.426 1.00 73.05  ?  261 LYS A HB2    1 
ATOM 3953  H HB3    . LYS A 1 257 ? 14.272  -27.218 -28.644 1.00 73.05  ?  261 LYS A HB3    1 
ATOM 3954  H HG2    . LYS A 1 257 ? 12.987  -27.678 -26.693 1.00 72.50  ?  261 LYS A HG2    1 
ATOM 3955  H HG3    . LYS A 1 257 ? 12.555  -26.148 -26.685 1.00 72.50  ?  261 LYS A HG3    1 
ATOM 3956  H HD2    . LYS A 1 257 ? 10.885  -27.447 -27.676 1.00 82.58  ?  261 LYS A HD2    1 
ATOM 3957  H HD3    . LYS A 1 257 ? 11.491  -26.440 -28.747 1.00 82.58  ?  261 LYS A HD3    1 
ATOM 3958  H HE2    . LYS A 1 257 ? 12.595  -28.085 -29.814 1.00 109.53 ?  261 LYS A HE2    1 
ATOM 3959  H HE3    . LYS A 1 257 ? 12.423  -29.088 -28.593 1.00 109.53 ?  261 LYS A HE3    1 
ATOM 3960  H HZ1    . LYS A 1 257 ? 11.014  -29.645 -30.284 1.00 111.13 ?  261 LYS A HZ1    1 
ATOM 3961  H HZ2    . LYS A 1 257 ? 10.220  -29.259 -29.136 1.00 111.13 ?  261 LYS A HZ2    1 
ATOM 3962  H HZ3    . LYS A 1 257 ? 10.377  -28.344 -30.248 1.00 111.13 ?  261 LYS A HZ3    1 
ATOM 3963  N N      . SER A 1 258 ? 17.113  -25.436 -28.460 1.00 62.87  ?  262 SER A N      1 
ATOM 3964  C CA     . SER A 1 258 ? 18.344  -25.496 -29.237 1.00 65.20  ?  262 SER A CA     1 
ATOM 3965  C C      . SER A 1 258 ? 19.532  -25.873 -28.364 1.00 65.62  ?  262 SER A C      1 
ATOM 3966  O O      . SER A 1 258 ? 20.488  -26.487 -28.850 1.00 78.16  ?  262 SER A O      1 
ATOM 3967  C CB     . SER A 1 258 ? 18.598  -24.153 -29.923 1.00 67.33  ?  262 SER A CB     1 
ATOM 3968  O OG     . SER A 1 258 ? 18.979  -23.165 -28.983 1.00 70.22  ?  262 SER A OG     1 
ATOM 3969  H H      . SER A 1 258 ? 16.773  -24.650 -28.385 1.00 75.45  ?  262 SER A H      1 
ATOM 3970  H HA     . SER A 1 258 ? 18.251  -26.172 -29.926 1.00 78.23  ?  262 SER A HA     1 
ATOM 3971  H HB2    . SER A 1 258 ? 19.309  -24.261 -30.573 1.00 80.80  ?  262 SER A HB2    1 
ATOM 3972  H HB3    . SER A 1 258 ? 17.784  -23.868 -30.367 1.00 80.80  ?  262 SER A HB3    1 
ATOM 3973  H HG     . SER A 1 258 ? 18.371  -23.061 -28.413 1.00 84.26  ?  262 SER A HG     1 
ATOM 3974  N N      . MET A 1 259 ? 19.490  -25.520 -27.079 1.00 63.09  ?  263 MET A N      1 
ATOM 3975  C CA     . MET A 1 259 ? 20.594  -25.834 -26.181 1.00 62.94  ?  263 MET A CA     1 
ATOM 3976  C C      . MET A 1 259 ? 20.507  -27.256 -25.644 1.00 72.46  ?  263 MET A C      1 
ATOM 3977  O O      . MET A 1 259 ? 21.540  -27.862 -25.339 1.00 75.71  ?  263 MET A O      1 
ATOM 3978  C CB     . MET A 1 259 ? 20.621  -24.837 -25.022 1.00 70.10  ?  263 MET A CB     1 
ATOM 3979  C CG     . MET A 1 259 ? 20.837  -23.399 -25.454 1.00 82.36  ?  263 MET A CG     1 
ATOM 3980  S SD     . MET A 1 259 ? 21.136  -22.285 -24.070 1.00 81.64  ?  263 MET A SD     1 
ATOM 3981  C CE     . MET A 1 259 ? 22.846  -22.659 -23.698 1.00 75.64  ?  263 MET A CE     1 
ATOM 3982  H H      . MET A 1 259 ? 18.837  -25.102 -26.706 1.00 75.71  ?  263 MET A H      1 
ATOM 3983  H HA     . MET A 1 259 ? 21.426  -25.739 -26.670 1.00 75.53  ?  263 MET A HA     1 
ATOM 3984  H HB2    . MET A 1 259 ? 19.774  -24.882 -24.552 1.00 84.12  ?  263 MET A HB2    1 
ATOM 3985  H HB3    . MET A 1 259 ? 21.343  -25.078 -24.420 1.00 84.12  ?  263 MET A HB3    1 
ATOM 3986  H HG2    . MET A 1 259 ? 21.607  -23.358 -26.042 1.00 98.83  ?  263 MET A HG2    1 
ATOM 3987  H HG3    . MET A 1 259 ? 20.046  -23.088 -25.922 1.00 98.83  ?  263 MET A HG3    1 
ATOM 3988  H HE1    . MET A 1 259 ? 23.134  -22.110 -22.952 1.00 90.77  ?  263 MET A HE1    1 
ATOM 3989  H HE2    . MET A 1 259 ? 22.921  -23.598 -23.467 1.00 90.77  ?  263 MET A HE2    1 
ATOM 3990  H HE3    . MET A 1 259 ? 23.388  -22.466 -24.479 1.00 90.77  ?  263 MET A HE3    1 
ATOM 3991  N N      . GLY A 1 260 ? 19.299  -27.802 -25.522 1.00 73.11  ?  264 GLY A N      1 
ATOM 3992  C CA     . GLY A 1 260 ? 19.127  -29.155 -25.033 1.00 67.36  ?  264 GLY A CA     1 
ATOM 3993  C C      . GLY A 1 260 ? 19.603  -29.326 -23.607 1.00 60.47  ?  264 GLY A C      1 
ATOM 3994  O O      . GLY A 1 260 ? 18.998  -28.788 -22.676 1.00 59.72  ?  264 GLY A O      1 
ATOM 3995  H H      . GLY A 1 260 ? 18.563  -27.402 -25.718 1.00 87.73  ?  264 GLY A H      1 
ATOM 3996  H HA2    . GLY A 1 260 ? 18.188  -29.395 -25.073 1.00 80.83  ?  264 GLY A HA2    1 
ATOM 3997  H HA3    . GLY A 1 260 ? 19.624  -29.768 -25.598 1.00 80.83  ?  264 GLY A HA3    1 
ATOM 3998  N N      . ARG A 1 261 ? 20.683  -30.082 -23.422 1.00 79.30  ?  265 ARG A N      1 
ATOM 3999  C CA     . ARG A 1 261 ? 21.283  -30.250 -22.106 1.00 91.94  ?  265 ARG A CA     1 
ATOM 4000  C C      . ARG A 1 261 ? 22.362  -29.217 -21.820 1.00 90.24  ?  265 ARG A C      1 
ATOM 4001  O O      . ARG A 1 261 ? 22.857  -29.156 -20.690 1.00 95.87  ?  265 ARG A O      1 
ATOM 4002  C CB     . ARG A 1 261 ? 21.882  -31.652 -21.967 1.00 104.84 ?  265 ARG A CB     1 
ATOM 4003  C CG     . ARG A 1 261 ? 21.011  -32.764 -22.525 1.00 107.67 ?  265 ARG A CG     1 
ATOM 4004  C CD     . ARG A 1 261 ? 21.578  -34.135 -22.190 1.00 103.28 ?  265 ARG A CD     1 
ATOM 4005  N NE     . ARG A 1 261 ? 23.010  -34.225 -22.469 1.00 100.94 ?  265 ARG A NE     1 
ATOM 4006  C CZ     . ARG A 1 261 ? 23.972  -34.015 -21.573 1.00 99.20  ?  265 ARG A CZ     1 
ATOM 4007  N NH1    . ARG A 1 261 ? 23.672  -33.700 -20.319 1.00 88.35  1  265 ARG A NH1    1 
ATOM 4008  N NH2    . ARG A 1 261 ? 25.243  -34.120 -21.932 1.00 106.91 ?  265 ARG A NH2    1 
ATOM 4009  H H      . ARG A 1 261 ? 21.088  -30.511 -24.048 1.00 95.16  ?  265 ARG A H      1 
ATOM 4010  H HA     . ARG A 1 261 ? 20.592  -30.152 -21.432 1.00 110.32 ?  265 ARG A HA     1 
ATOM 4011  H HB2    . ARG A 1 261 ? 22.729  -31.677 -22.439 1.00 125.81 ?  265 ARG A HB2    1 
ATOM 4012  H HB3    . ARG A 1 261 ? 22.027  -31.836 -21.026 1.00 125.81 ?  265 ARG A HB3    1 
ATOM 4013  H HG2    . ARG A 1 261 ? 20.123  -32.700 -22.139 1.00 129.20 ?  265 ARG A HG2    1 
ATOM 4014  H HG3    . ARG A 1 261 ? 20.964  -32.681 -23.490 1.00 129.20 ?  265 ARG A HG3    1 
ATOM 4015  H HD2    . ARG A 1 261 ? 21.443  -34.313 -21.246 1.00 123.94 ?  265 ARG A HD2    1 
ATOM 4016  H HD3    . ARG A 1 261 ? 21.124  -34.806 -22.724 1.00 123.94 ?  265 ARG A HD3    1 
ATOM 4017  H HE     . ARG A 1 261 ? 23.248  -34.428 -23.270 1.00 121.12 ?  265 ARG A HE     1 
ATOM 4018  H HH11   . ARG A 1 261 ? 22.850  -33.629 -20.078 1.00 106.03 ?  265 ARG A HH11   1 
ATOM 4019  H HH12   . ARG A 1 261 ? 24.301  -33.567 -19.747 1.00 106.03 ?  265 ARG A HH12   1 
ATOM 4020  H HH21   . ARG A 1 261 ? 25.446  -34.324 -22.742 1.00 128.29 ?  265 ARG A HH21   1 
ATOM 4021  H HH22   . ARG A 1 261 ? 25.866  -33.986 -21.354 1.00 128.29 ?  265 ARG A HH22   1 
ATOM 4022  N N      . LYS A 1 262 ? 22.736  -28.409 -22.813 1.00 75.59  ?  266 LYS A N      1 
ATOM 4023  C CA     . LYS A 1 262 ? 23.733  -27.366 -22.615 1.00 80.02  ?  266 LYS A CA     1 
ATOM 4024  C C      . LYS A 1 262 ? 23.318  -26.366 -21.545 1.00 77.24  ?  266 LYS A C      1 
ATOM 4025  O O      . LYS A 1 262 ? 24.163  -25.591 -21.084 1.00 76.67  ?  266 LYS A O      1 
ATOM 4026  C CB     . LYS A 1 262 ? 23.983  -26.656 -23.947 1.00 91.37  ?  266 LYS A CB     1 
ATOM 4027  C CG     . LYS A 1 262 ? 25.230  -25.791 -24.003 1.00 97.99  ?  266 LYS A CG     1 
ATOM 4028  C CD     . LYS A 1 262 ? 25.558  -25.433 -25.450 1.00 96.83  ?  266 LYS A CD     1 
ATOM 4029  C CE     . LYS A 1 262 ? 25.947  -23.974 -25.607 1.00 98.96  ?  266 LYS A CE     1 
ATOM 4030  N NZ     . LYS A 1 262 ? 26.109  -23.596 -27.039 1.00 78.21  1  266 LYS A NZ     1 
ATOM 4031  H H      . LYS A 1 262 ? 22.423  -28.447 -23.614 1.00 90.70  ?  266 LYS A H      1 
ATOM 4032  H HA     . LYS A 1 262 ? 24.565  -27.777 -22.333 1.00 96.03  ?  266 LYS A HA     1 
ATOM 4033  H HB2    . LYS A 1 262 ? 24.063  -27.328 -24.642 1.00 109.64 ?  266 LYS A HB2    1 
ATOM 4034  H HB3    . LYS A 1 262 ? 23.223  -26.084 -24.136 1.00 109.64 ?  266 LYS A HB3    1 
ATOM 4035  H HG2    . LYS A 1 262 ? 25.077  -24.970 -23.510 1.00 117.59 ?  266 LYS A HG2    1 
ATOM 4036  H HG3    . LYS A 1 262 ? 25.980  -26.278 -23.629 1.00 117.59 ?  266 LYS A HG3    1 
ATOM 4037  H HD2    . LYS A 1 262 ? 26.303  -25.977 -25.750 1.00 116.19 ?  266 LYS A HD2    1 
ATOM 4038  H HD3    . LYS A 1 262 ? 24.779  -25.599 -26.003 1.00 116.19 ?  266 LYS A HD3    1 
ATOM 4039  H HE2    . LYS A 1 262 ? 25.253  -23.416 -25.222 1.00 118.75 ?  266 LYS A HE2    1 
ATOM 4040  H HE3    . LYS A 1 262 ? 26.791  -23.818 -25.155 1.00 118.75 ?  266 LYS A HE3    1 
ATOM 4041  H HZ1    . LYS A 1 262 ? 26.336  -22.738 -27.103 1.00 93.85  ?  266 LYS A HZ1    1 
ATOM 4042  H HZ2    . LYS A 1 262 ? 26.745  -24.093 -27.414 1.00 93.85  ?  266 LYS A HZ2    1 
ATOM 4043  H HZ3    . LYS A 1 262 ? 25.344  -23.727 -27.476 1.00 93.85  ?  266 LYS A HZ3    1 
ATOM 4044  N N      . CYS A 1 263 ? 22.047  -26.368 -21.137 1.00 71.93  ?  267 CYS A N      1 
ATOM 4045  C CA     . CYS A 1 263 ? 21.605  -25.481 -20.068 1.00 72.24  ?  267 CYS A CA     1 
ATOM 4046  C C      . CYS A 1 263 ? 22.229  -25.883 -18.739 1.00 80.29  ?  267 CYS A C      1 
ATOM 4047  O O      . CYS A 1 263 ? 22.774  -25.043 -18.015 1.00 92.47  ?  267 CYS A O      1 
ATOM 4048  C CB     . CYS A 1 263 ? 20.080  -25.504 -19.968 1.00 63.18  ?  267 CYS A CB     1 
ATOM 4049  S SG     . CYS A 1 263 ? 19.232  -25.535 -21.557 1.00 56.90  ?  267 CYS A SG     1 
ATOM 4050  H H      . CYS A 1 263 ? 21.429  -26.870 -21.462 1.00 86.31  ?  267 CYS A H      1 
ATOM 4051  H HA     . CYS A 1 263 ? 21.882  -24.574 -20.271 1.00 86.68  ?  267 CYS A HA     1 
ATOM 4052  H HB2    . CYS A 1 263 ? 19.813  -26.297 -19.476 1.00 75.82  ?  267 CYS A HB2    1 
ATOM 4053  H HB3    . CYS A 1 263 ? 19.788  -24.711 -19.493 1.00 75.82  ?  267 CYS A HB3    1 
ATOM 4054  H HG     . CYS A 1 263 ? 19.564  -26.519 -22.159 1.00 68.27  ?  267 CYS A HG     1 
ATOM 4055  N N      . PHE A 1 264 ? 22.166  -27.172 -18.406 1.00 88.71  ?  268 PHE A N      1 
ATOM 4056  C CA     . PHE A 1 264 ? 22.673  -27.631 -17.120 1.00 83.54  ?  268 PHE A CA     1 
ATOM 4057  C C      . PHE A 1 264 ? 24.188  -27.536 -17.039 1.00 81.53  ?  268 PHE A C      1 
ATOM 4058  O O      . PHE A 1 264 ? 24.738  -27.523 -15.933 1.00 76.95  ?  268 PHE A O      1 
ATOM 4059  C CB     . PHE A 1 264 ? 22.236  -29.073 -16.864 1.00 81.78  ?  268 PHE A CB     1 
ATOM 4060  C CG     . PHE A 1 264 ? 20.869  -29.397 -17.394 1.00 68.52  ?  268 PHE A CG     1 
ATOM 4061  C CD1    . PHE A 1 264 ? 19.737  -28.862 -16.808 1.00 69.47  ?  268 PHE A CD1    1 
ATOM 4062  C CD2    . PHE A 1 264 ? 20.718  -30.237 -18.483 1.00 77.51  ?  268 PHE A CD2    1 
ATOM 4063  C CE1    . PHE A 1 264 ? 18.481  -29.161 -17.296 1.00 64.55  ?  268 PHE A CE1    1 
ATOM 4064  C CE2    . PHE A 1 264 ? 19.465  -30.538 -18.974 1.00 77.91  ?  268 PHE A CE2    1 
ATOM 4065  C CZ     . PHE A 1 264 ? 18.346  -29.998 -18.380 1.00 65.70  ?  268 PHE A CZ     1 
ATOM 4066  H H      . PHE A 1 264 ? 21.838  -27.793 -18.903 1.00 106.45 ?  268 PHE A H      1 
ATOM 4067  H HA     . PHE A 1 264 ? 22.300  -27.076 -16.418 1.00 100.25 ?  268 PHE A HA     1 
ATOM 4068  H HB2    . PHE A 1 264 ? 22.869  -29.672 -17.291 1.00 98.13  ?  268 PHE A HB2    1 
ATOM 4069  H HB3    . PHE A 1 264 ? 22.229  -29.232 -15.907 1.00 98.13  ?  268 PHE A HB3    1 
ATOM 4070  H HD1    . PHE A 1 264 ? 19.823  -28.296 -16.075 1.00 83.36  ?  268 PHE A HD1    1 
ATOM 4071  H HD2    . PHE A 1 264 ? 21.471  -30.604 -18.888 1.00 93.01  ?  268 PHE A HD2    1 
ATOM 4072  H HE1    . PHE A 1 264 ? 17.726  -28.795 -16.893 1.00 77.46  ?  268 PHE A HE1    1 
ATOM 4073  H HE2    . PHE A 1 264 ? 19.376  -31.104 -19.706 1.00 93.50  ?  268 PHE A HE2    1 
ATOM 4074  H HZ     . PHE A 1 264 ? 17.500  -30.200 -18.710 1.00 78.84  ?  268 PHE A HZ     1 
ATOM 4075  N N      . ASP A 1 265 ? 24.869  -27.463 -18.180 1.00 94.04  ?  269 ASP A N      1 
ATOM 4076  C CA     . ASP A 1 265 ? 26.325  -27.451 -18.227 1.00 97.74  ?  269 ASP A CA     1 
ATOM 4077  C C      . ASP A 1 265 ? 26.907  -26.053 -18.368 1.00 95.13  ?  269 ASP A C      1 
ATOM 4078  O O      . ASP A 1 265 ? 27.892  -25.730 -17.698 1.00 102.62 ?  269 ASP A O      1 
ATOM 4079  C CB     . ASP A 1 265 ? 26.813  -28.315 -19.393 1.00 107.78 ?  269 ASP A CB     1 
ATOM 4080  C CG     . ASP A 1 265 ? 26.174  -29.686 -19.408 1.00 97.10  ?  269 ASP A CG     1 
ATOM 4081  O OD1    . ASP A 1 265 ? 25.938  -30.243 -18.316 1.00 103.56 ?  269 ASP A OD1    1 
ATOM 4082  O OD2    . ASP A 1 265 ? 25.902  -30.204 -20.511 1.00 76.96  -1 269 ASP A OD2    1 
ATOM 4083  H H      . ASP A 1 265 ? 24.500  -27.417 -18.955 1.00 112.85 ?  269 ASP A H      1 
ATOM 4084  H HA     . ASP A 1 265 ? 26.669  -27.836 -17.406 1.00 117.29 ?  269 ASP A HA     1 
ATOM 4085  H HB2    . ASP A 1 265 ? 26.595  -27.872 -20.228 1.00 129.34 ?  269 ASP A HB2    1 
ATOM 4086  H HB3    . ASP A 1 265 ? 27.774  -28.431 -19.320 1.00 129.34 ?  269 ASP A HB3    1 
ATOM 4087  N N      . ASP A 1 266 ? 26.323  -25.216 -19.224 1.00 95.34  ?  270 ASP A N      1 
ATOM 4088  C CA     . ASP A 1 266 ? 26.887  -23.906 -19.525 1.00 92.67  ?  270 ASP A CA     1 
ATOM 4089  C C      . ASP A 1 266 ? 26.192  -22.762 -18.802 1.00 88.24  ?  270 ASP A C      1 
ATOM 4090  O O      . ASP A 1 266 ? 26.819  -21.724 -18.570 1.00 89.26  ?  270 ASP A O      1 
ATOM 4091  C CB     . ASP A 1 266 ? 26.835  -23.650 -21.034 1.00 98.18  ?  270 ASP A CB     1 
ATOM 4092  C CG     . ASP A 1 266 ? 27.656  -24.653 -21.819 1.00 98.55  ?  270 ASP A CG     1 
ATOM 4093  O OD1    . ASP A 1 266 ? 27.777  -25.807 -21.360 1.00 87.41  ?  270 ASP A OD1    1 
ATOM 4094  O OD2    . ASP A 1 266 ? 28.183  -24.288 -22.890 1.00 98.59  -1 270 ASP A OD2    1 
ATOM 4095  H H      . ASP A 1 266 ? 25.594  -25.386 -19.646 1.00 114.41 ?  270 ASP A H      1 
ATOM 4096  H HA     . ASP A 1 266 ? 27.819  -23.901 -19.256 1.00 111.20 ?  270 ASP A HA     1 
ATOM 4097  H HB2    . ASP A 1 266 ? 25.915  -23.713 -21.335 1.00 117.81 ?  270 ASP A HB2    1 
ATOM 4098  H HB3    . ASP A 1 266 ? 27.186  -22.765 -21.218 1.00 117.81 ?  270 ASP A HB3    1 
ATOM 4099  N N      . ILE A 1 267 ? 24.923  -22.916 -18.439 1.00 89.16  ?  271 ILE A N      1 
ATOM 4100  C CA     . ILE A 1 267 ? 24.185  -21.863 -17.750 1.00 76.97  ?  271 ILE A CA     1 
ATOM 4101  C C      . ILE A 1 267 ? 24.369  -22.034 -16.251 1.00 83.09  ?  271 ILE A C      1 
ATOM 4102  O O      . ILE A 1 267 ? 24.326  -23.152 -15.725 1.00 96.82  ?  271 ILE A O      1 
ATOM 4103  C CB     . ILE A 1 267 ? 22.694  -21.888 -18.138 1.00 68.65  ?  271 ILE A CB     1 
ATOM 4104  C CG1    . ILE A 1 267 ? 22.545  -21.715 -19.652 1.00 74.79  ?  271 ILE A CG1    1 
ATOM 4105  C CG2    . ILE A 1 267 ? 21.934  -20.792 -17.397 1.00 59.04  ?  271 ILE A CG2    1 
ATOM 4106  C CD1    . ILE A 1 267 ? 21.118  -21.797 -20.161 1.00 67.88  ?  271 ILE A CD1    1 
ATOM 4107  H H      . ILE A 1 267 ? 24.462  -23.628 -18.582 1.00 106.99 ?  271 ILE A H      1 
ATOM 4108  H HA     . ILE A 1 267 ? 24.549  -21.001 -18.003 1.00 92.37  ?  271 ILE A HA     1 
ATOM 4109  H HB     . ILE A 1 267 ? 22.322  -22.747 -17.886 1.00 82.38  ?  271 ILE A HB     1 
ATOM 4110  H HG12   . ILE A 1 267 ? 22.896  -20.845 -19.901 1.00 89.75  ?  271 ILE A HG12   1 
ATOM 4111  H HG13   . ILE A 1 267 ? 23.055  -22.411 -20.095 1.00 89.75  ?  271 ILE A HG13   1 
ATOM 4112  H HG21   . ILE A 1 267 ? 21.000  -20.825 -17.656 1.00 70.85  ?  271 ILE A HG21   1 
ATOM 4113  H HG22   . ILE A 1 267 ? 22.019  -20.940 -16.442 1.00 70.85  ?  271 ILE A HG22   1 
ATOM 4114  H HG23   . ILE A 1 267 ? 22.313  -19.931 -17.633 1.00 70.85  ?  271 ILE A HG23   1 
ATOM 4115  H HD11   . ILE A 1 267 ? 21.119  -21.677 -21.124 1.00 81.45  ?  271 ILE A HD11   1 
ATOM 4116  H HD12   . ILE A 1 267 ? 20.752  -22.666 -19.936 1.00 81.45  ?  271 ILE A HD12   1 
ATOM 4117  H HD13   . ILE A 1 267 ? 20.593  -21.098 -19.741 1.00 81.45  ?  271 ILE A HD13   1 
ATOM 4118  N N      . GLU A 1 268 ? 24.576  -20.919 -15.557 1.00 89.18  ?  272 GLU A N      1 
ATOM 4119  C CA     . GLU A 1 268 ? 24.787  -20.968 -14.122 1.00 87.65  ?  272 GLU A CA     1 
ATOM 4120  C C      . GLU A 1 268 ? 23.469  -21.266 -13.407 1.00 80.46  ?  272 GLU A C      1 
ATOM 4121  O O      . GLU A 1 268 ? 22.399  -20.862 -13.869 1.00 77.95  ?  272 GLU A O      1 
ATOM 4122  C CB     . GLU A 1 268 ? 25.362  -19.648 -13.622 1.00 98.70  ?  272 GLU A CB     1 
ATOM 4123  C CG     . GLU A 1 268 ? 26.621  -19.208 -14.350 1.00 109.80 ?  272 GLU A CG     1 
ATOM 4124  C CD     . GLU A 1 268 ? 27.768  -20.183 -14.169 1.00 117.68 ?  272 GLU A CD     1 
ATOM 4125  O OE1    . GLU A 1 268 ? 28.459  -20.103 -13.132 1.00 115.48 ?  272 GLU A OE1    1 
ATOM 4126  O OE2    . GLU A 1 268 ? 27.973  -21.036 -15.058 1.00 110.97 -1 272 GLU A OE2    1 
ATOM 4127  H H      . GLU A 1 268 ? 24.598  -20.129 -15.895 1.00 107.02 ?  272 GLU A H      1 
ATOM 4128  H HA     . GLU A 1 268 ? 25.416  -21.676 -13.913 1.00 105.18 ?  272 GLU A HA     1 
ATOM 4129  H HB2    . GLU A 1 268 ? 24.695  -18.953 -13.738 1.00 118.44 ?  272 GLU A HB2    1 
ATOM 4130  H HB3    . GLU A 1 268 ? 25.580  -19.739 -12.681 1.00 118.44 ?  272 GLU A HB3    1 
ATOM 4131  H HG2    . GLU A 1 268 ? 26.431  -19.141 -15.299 1.00 131.76 ?  272 GLU A HG2    1 
ATOM 4132  H HG3    . GLU A 1 268 ? 26.902  -18.346 -14.005 1.00 131.76 ?  272 GLU A HG3    1 
ATOM 4133  N N      . PRO A 1 269 ? 23.517  -21.974 -12.275 1.00 91.60  ?  273 PRO A N      1 
ATOM 4134  C CA     . PRO A 1 269 ? 22.258  -22.320 -11.593 1.00 92.34  ?  273 PRO A CA     1 
ATOM 4135  C C      . PRO A 1 269 ? 21.453  -21.111 -11.149 1.00 76.18  ?  273 PRO A C      1 
ATOM 4136  O O      . PRO A 1 269 ? 20.229  -21.094 -11.330 1.00 64.20  ?  273 PRO A O      1 
ATOM 4137  C CB     . PRO A 1 269 ? 22.729  -23.159 -10.396 1.00 78.14  ?  273 PRO A CB     1 
ATOM 4138  C CG     . PRO A 1 269 ? 24.066  -23.670 -10.789 1.00 92.69  ?  273 PRO A CG     1 
ATOM 4139  C CD     . PRO A 1 269 ? 24.682  -22.595 -11.621 1.00 90.73  ?  273 PRO A CD     1 
ATOM 4140  H HA     . PRO A 1 269 ? 21.708  -22.872 -12.170 1.00 110.80 ?  273 PRO A HA     1 
ATOM 4141  H HB2    . PRO A 1 269 ? 22.794  -22.597 -9.607  1.00 93.77  ?  273 PRO A HB2    1 
ATOM 4142  H HB3    . PRO A 1 269 ? 22.111  -23.891 -10.246 1.00 93.77  ?  273 PRO A HB3    1 
ATOM 4143  H HG2    . PRO A 1 269 ? 24.598  -23.835 -9.995  1.00 111.22 ?  273 PRO A HG2    1 
ATOM 4144  H HG3    . PRO A 1 269 ? 23.963  -24.484 -11.306 1.00 111.22 ?  273 PRO A HG3    1 
ATOM 4145  H HD2    . PRO A 1 269 ? 25.138  -21.950 -11.058 1.00 108.87 ?  273 PRO A HD2    1 
ATOM 4146  H HD3    . PRO A 1 269 ? 25.279  -22.977 -12.283 1.00 108.87 ?  273 PRO A HD3    1 
ATOM 4147  N N      . HIS A 1 270 ? 22.100  -20.098 -10.569 1.00 74.28  ?  274 HIS A N      1 
ATOM 4148  C CA     . HIS A 1 270 ? 21.357  -18.960 -10.036 1.00 77.53  ?  274 HIS A CA     1 
ATOM 4149  C C      . HIS A 1 270 ? 20.572  -18.253 -11.133 1.00 78.19  ?  274 HIS A C      1 
ATOM 4150  O O      . HIS A 1 270 ? 19.452  -17.784 -10.901 1.00 76.38  ?  274 HIS A O      1 
ATOM 4151  C CB     . HIS A 1 270 ? 22.306  -17.989 -9.334  1.00 81.88  ?  274 HIS A CB     1 
ATOM 4152  C CG     . HIS A 1 270 ? 23.318  -17.363 -10.243 1.00 96.79  ?  274 HIS A CG     1 
ATOM 4153  N ND1    . HIS A 1 270 ? 24.426  -18.040 -10.702 1.00 94.61  ?  274 HIS A ND1    1 
ATOM 4154  C CD2    . HIS A 1 270 ? 23.395  -16.116 -10.764 1.00 106.26 ?  274 HIS A CD2    1 
ATOM 4155  C CE1    . HIS A 1 270 ? 25.140  -17.240 -11.475 1.00 92.36  ?  274 HIS A CE1    1 
ATOM 4156  N NE2    . HIS A 1 270 ? 24.535  -16.067 -11.529 1.00 98.64  ?  274 HIS A NE2    1 
ATOM 4157  H H      . HIS A 1 270 ? 22.954  -20.047 -10.474 1.00 89.13  ?  274 HIS A H      1 
ATOM 4158  H HA     . HIS A 1 270 ? 20.721  -19.282 -9.378  1.00 93.04  ?  274 HIS A HA     1 
ATOM 4159  H HB2    . HIS A 1 270 ? 21.784  -17.275 -8.936  1.00 98.25  ?  274 HIS A HB2    1 
ATOM 4160  H HB3    . HIS A 1 270 ? 22.787  -18.469 -8.642  1.00 98.25  ?  274 HIS A HB3    1 
ATOM 4161  H HD2    . HIS A 1 270 ? 22.788  -15.424 -10.633 1.00 127.51 ?  274 HIS A HD2    1 
ATOM 4162  H HE1    . HIS A 1 270 ? 25.932  -17.465 -11.907 1.00 110.83 ?  274 HIS A HE1    1 
ATOM 4163  H HE2    . HIS A 1 270 ? 24.811  -15.383 -11.971 1.00 118.37 ?  274 HIS A HE2    1 
ATOM 4164  N N      . ILE A 1 271 ? 21.142  -18.165 -12.336 1.00 82.78  ?  275 ILE A N      1 
ATOM 4165  C CA     . ILE A 1 271 ? 20.378  -17.672 -13.476 1.00 72.68  ?  275 ILE A CA     1 
ATOM 4166  C C      . ILE A 1 271 ? 19.388  -18.731 -13.935 1.00 75.12  ?  275 ILE A C      1 
ATOM 4167  O O      . ILE A 1 271 ? 18.262  -18.419 -14.341 1.00 67.07  ?  275 ILE A O      1 
ATOM 4168  C CB     . ILE A 1 271 ? 21.321  -17.254 -14.618 1.00 72.42  ?  275 ILE A CB     1 
ATOM 4169  C CG1    . ILE A 1 271 ? 22.305  -16.188 -14.132 1.00 97.07  ?  275 ILE A CG1    1 
ATOM 4170  C CG2    . ILE A 1 271 ? 20.515  -16.739 -15.805 1.00 75.19  ?  275 ILE A CG2    1 
ATOM 4171  C CD1    . ILE A 1 271 ? 23.346  -15.784 -15.158 1.00 105.97 ?  275 ILE A CD1    1 
ATOM 4172  H H      . ILE A 1 271 ? 21.955  -18.381 -12.514 1.00 99.33  ?  275 ILE A H      1 
ATOM 4173  H HA     . ILE A 1 271 ? 19.874  -16.889 -13.203 1.00 87.22  ?  275 ILE A HA     1 
ATOM 4174  H HB     . ILE A 1 271 ? 21.825  -18.032 -14.902 1.00 86.90  ?  275 ILE A HB     1 
ATOM 4175  H HG12   . ILE A 1 271 ? 21.807  -15.392 -13.889 1.00 116.48 ?  275 ILE A HG12   1 
ATOM 4176  H HG13   . ILE A 1 271 ? 22.775  -16.530 -13.355 1.00 116.48 ?  275 ILE A HG13   1 
ATOM 4177  H HG21   . ILE A 1 271 ? 21.125  -16.481 -16.513 1.00 90.22  ?  275 ILE A HG21   1 
ATOM 4178  H HG22   . ILE A 1 271 ? 19.926  -17.445 -16.116 1.00 90.22  ?  275 ILE A HG22   1 
ATOM 4179  H HG23   . ILE A 1 271 ? 19.992  -15.973 -15.523 1.00 90.22  ?  275 ILE A HG23   1 
ATOM 4180  H HD11   . ILE A 1 271 ? 23.926  -15.109 -14.770 1.00 127.17 ?  275 ILE A HD11   1 
ATOM 4181  H HD12   . ILE A 1 271 ? 23.866  -16.565 -15.404 1.00 127.17 ?  275 ILE A HD12   1 
ATOM 4182  H HD13   . ILE A 1 271 ? 22.897  -15.425 -15.939 1.00 127.17 ?  275 ILE A HD13   1 
ATOM 4183  N N      . PHE A 1 272 ? 19.790  -20.001 -13.876 1.00 77.88  ?  276 PHE A N      1 
ATOM 4184  C CA     . PHE A 1 272 ? 18.918  -21.081 -14.318 1.00 75.38  ?  276 PHE A CA     1 
ATOM 4185  C C      . PHE A 1 272 ? 17.666  -21.156 -13.454 1.00 75.55  ?  276 PHE A C      1 
ATOM 4186  O O      . PHE A 1 272 ? 16.543  -21.209 -13.969 1.00 66.73  ?  276 PHE A O      1 
ATOM 4187  C CB     . PHE A 1 272 ? 19.683  -22.403 -14.284 1.00 72.65  ?  276 PHE A CB     1 
ATOM 4188  C CG     . PHE A 1 272 ? 18.936  -23.550 -14.890 1.00 59.46  ?  276 PHE A CG     1 
ATOM 4189  C CD1    . PHE A 1 272 ? 19.147  -23.912 -16.209 1.00 60.24  ?  276 PHE A CD1    1 
ATOM 4190  C CD2    . PHE A 1 272 ? 18.024  -24.268 -14.141 1.00 49.50  ?  276 PHE A CD2    1 
ATOM 4191  C CE1    . PHE A 1 272 ? 18.460  -24.968 -16.766 1.00 55.28  ?  276 PHE A CE1    1 
ATOM 4192  C CE2    . PHE A 1 272 ? 17.335  -25.322 -14.694 1.00 62.29  ?  276 PHE A CE2    1 
ATOM 4193  C CZ     . PHE A 1 272 ? 17.553  -25.673 -16.007 1.00 61.85  ?  276 PHE A CZ     1 
ATOM 4194  H H      . PHE A 1 272 ? 20.557  -20.259 -13.585 1.00 93.46  ?  276 PHE A H      1 
ATOM 4195  H HA     . PHE A 1 272 ? 18.643  -20.914 -15.233 1.00 90.45  ?  276 PHE A HA     1 
ATOM 4196  H HB2    . PHE A 1 272 ? 20.512  -22.297 -14.776 1.00 87.18  ?  276 PHE A HB2    1 
ATOM 4197  H HB3    . PHE A 1 272 ? 19.875  -22.630 -13.361 1.00 87.18  ?  276 PHE A HB3    1 
ATOM 4198  H HD1    . PHE A 1 272 ? 19.759  -23.438 -16.724 1.00 72.29  ?  276 PHE A HD1    1 
ATOM 4199  H HD2    . PHE A 1 272 ? 17.872  -24.035 -13.253 1.00 59.40  ?  276 PHE A HD2    1 
ATOM 4200  H HE1    . PHE A 1 272 ? 18.609  -25.204 -17.653 1.00 66.34  ?  276 PHE A HE1    1 
ATOM 4201  H HE2    . PHE A 1 272 ? 16.723  -25.798 -14.180 1.00 74.75  ?  276 PHE A HE2    1 
ATOM 4202  H HZ     . PHE A 1 272 ? 17.089  -26.386 -16.382 1.00 74.22  ?  276 PHE A HZ     1 
ATOM 4203  N N      . ASP A 1 273 ? 17.840  -21.159 -12.131 1.00 74.23  ?  277 ASP A N      1 
ATOM 4204  C CA     . ASP A 1 273 ? 16.691  -21.234 -11.236 1.00 74.83  ?  277 ASP A CA     1 
ATOM 4205  C C      . ASP A 1 273 ? 15.748  -20.058 -11.438 1.00 67.20  ?  277 ASP A C      1 
ATOM 4206  O O      . ASP A 1 273 ? 14.547  -20.173 -11.172 1.00 71.25  ?  277 ASP A O      1 
ATOM 4207  C CB     . ASP A 1 273 ? 17.163  -21.286 -9.784  1.00 88.34  ?  277 ASP A CB     1 
ATOM 4208  C CG     . ASP A 1 273 ? 17.969  -22.529 -9.482  1.00 84.89  ?  277 ASP A CG     1 
ATOM 4209  O OD1    . ASP A 1 273 ? 18.472  -23.155 -10.436 1.00 76.47  ?  277 ASP A OD1    1 
ATOM 4210  O OD2    . ASP A 1 273 ? 18.105  -22.876 -8.291  1.00 81.51  -1 277 ASP A OD2    1 
ATOM 4211  H H      . ASP A 1 273 ? 18.602  -21.118 -11.734 1.00 89.08  ?  277 ASP A H      1 
ATOM 4212  H HA     . ASP A 1 273 ? 16.199  -22.049 -11.422 1.00 89.79  ?  277 ASP A HA     1 
ATOM 4213  H HB2    . ASP A 1 273 ? 17.721  -20.514 -9.604  1.00 106.01 ?  277 ASP A HB2    1 
ATOM 4214  H HB3    . ASP A 1 273 ? 16.389  -21.281 -9.200  1.00 106.01 ?  277 ASP A HB3    1 
ATOM 4215  N N      . GLN A 1 274 ? 16.269  -18.924 -11.905 1.00 72.50  ?  278 GLN A N      1 
ATOM 4216  C CA     . GLN A 1 274 ? 15.427  -17.756 -12.128 1.00 69.97  ?  278 GLN A CA     1 
ATOM 4217  C C      . GLN A 1 274 ? 14.589  -17.911 -13.391 1.00 56.88  ?  278 GLN A C      1 
ATOM 4218  O O      . GLN A 1 274 ? 13.396  -17.590 -13.391 1.00 56.47  ?  278 GLN A O      1 
ATOM 4219  C CB     . GLN A 1 274 ? 16.296  -16.500 -12.209 1.00 72.79  ?  278 GLN A CB     1 
ATOM 4220  C CG     . GLN A 1 274 ? 15.524  -15.190 -12.277 1.00 60.53  ?  278 GLN A CG     1 
ATOM 4221  C CD     . GLN A 1 274 ? 14.861  -14.829 -10.963 1.00 64.75  ?  278 GLN A CD     1 
ATOM 4222  O OE1    . GLN A 1 274 ? 14.124  -15.626 -10.385 1.00 69.54  ?  278 GLN A OE1    1 
ATOM 4223  N NE2    . GLN A 1 274 ? 15.126  -13.621 -10.482 1.00 71.63  ?  278 GLN A NE2    1 
ATOM 4224  H H      . GLN A 1 274 ? 17.099  -18.807 -12.098 1.00 87.00  ?  278 GLN A H      1 
ATOM 4225  H HA     . GLN A 1 274 ? 14.821  -17.654 -11.377 1.00 83.96  ?  278 GLN A HA     1 
ATOM 4226  H HB2    . GLN A 1 274 ? 16.863  -16.466 -11.422 1.00 87.35  ?  278 GLN A HB2    1 
ATOM 4227  H HB3    . GLN A 1 274 ? 16.847  -16.557 -13.005 1.00 87.35  ?  278 GLN A HB3    1 
ATOM 4228  H HG2    . GLN A 1 274 ? 16.136  -14.475 -12.510 1.00 72.64  ?  278 GLN A HG2    1 
ATOM 4229  H HG3    . GLN A 1 274 ? 14.831  -15.267 -12.951 1.00 72.64  ?  278 GLN A HG3    1 
ATOM 4230  H HE21   . GLN A 1 274 ? 15.650  -13.092 -10.912 1.00 85.95  ?  278 GLN A HE21   1 
ATOM 4231  H HE22   . GLN A 1 274 ? 14.775  -13.367 -9.739  1.00 85.95  ?  278 GLN A HE22   1 
ATOM 4232  N N      . LEU A 1 275 ? 15.194  -18.406 -14.471 1.00 58.21  ?  279 LEU A N      1 
ATOM 4233  C CA     . LEU A 1 275 ? 14.469  -18.593 -15.722 1.00 54.84  ?  279 LEU A CA     1 
ATOM 4234  C C      . LEU A 1 275 ? 13.213  -19.426 -15.506 1.00 61.33  ?  279 LEU A C      1 
ATOM 4235  O O      . LEU A 1 275 ? 12.093  -18.967 -15.753 1.00 44.38  ?  279 LEU A O      1 
ATOM 4236  C CB     . LEU A 1 275 ? 15.384  -19.255 -16.751 1.00 43.92  ?  279 LEU A CB     1 
ATOM 4237  C CG     . LEU A 1 275 ? 16.339  -18.307 -17.471 1.00 49.02  ?  279 LEU A CG     1 
ATOM 4238  C CD1    . LEU A 1 275 ? 17.539  -19.056 -18.012 1.00 66.12  ?  279 LEU A CD1    1 
ATOM 4239  C CD2    . LEU A 1 275 ? 15.608  -17.595 -18.591 1.00 56.25  ?  279 LEU A CD2    1 
ATOM 4240  H H      . LEU A 1 275 ? 16.021  -18.640 -14.503 1.00 69.85  ?  279 LEU A H      1 
ATOM 4241  H HA     . LEU A 1 275 ? 14.201  -17.727 -16.067 1.00 65.81  ?  279 LEU A HA     1 
ATOM 4242  H HB2    . LEU A 1 275 ? 15.921  -19.925 -16.301 1.00 52.70  ?  279 LEU A HB2    1 
ATOM 4243  H HB3    . LEU A 1 275 ? 14.832  -19.680 -17.426 1.00 52.70  ?  279 LEU A HB3    1 
ATOM 4244  H HG     . LEU A 1 275 ? 16.657  -17.638 -16.844 1.00 58.83  ?  279 LEU A HG     1 
ATOM 4245  H HD11   . LEU A 1 275 ? 18.125  -18.428 -18.463 1.00 79.35  ?  279 LEU A HD11   1 
ATOM 4246  H HD12   . LEU A 1 275 ? 18.007  -19.477 -17.275 1.00 79.35  ?  279 LEU A HD12   1 
ATOM 4247  H HD13   . LEU A 1 275 ? 17.233  -19.731 -18.638 1.00 79.35  ?  279 LEU A HD13   1 
ATOM 4248  H HD21   . LEU A 1 275 ? 16.226  -16.997 -19.040 1.00 67.50  ?  279 LEU A HD21   1 
ATOM 4249  H HD22   . LEU A 1 275 ? 15.272  -18.255 -19.218 1.00 67.50  ?  279 LEU A HD22   1 
ATOM 4250  H HD23   . LEU A 1 275 ? 14.871  -17.090 -18.215 1.00 67.50  ?  279 LEU A HD23   1 
ATOM 4251  N N      . ILE A 1 276 ? 13.389  -20.665 -15.042 1.00 75.49  ?  280 ILE A N      1 
ATOM 4252  C CA     . ILE A 1 276 ? 12.249  -21.546 -14.802 1.00 59.08  ?  280 ILE A CA     1 
ATOM 4253  C C      . ILE A 1 276 ? 11.232  -20.880 -13.891 1.00 63.27  ?  280 ILE A C      1 
ATOM 4254  O O      . ILE A 1 276 ? 10.022  -21.084 -14.044 1.00 61.76  ?  280 ILE A O      1 
ATOM 4255  C CB     . ILE A 1 276 ? 12.731  -22.892 -14.223 1.00 56.34  ?  280 ILE A CB     1 
ATOM 4256  C CG1    . ILE A 1 276 ? 13.634  -22.660 -13.006 1.00 76.07  ?  280 ILE A CG1    1 
ATOM 4257  C CG2    . ILE A 1 276 ? 13.447  -23.690 -15.301 1.00 48.21  ?  280 ILE A CG2    1 
ATOM 4258  C CD1    . ILE A 1 276 ? 14.080  -23.925 -12.313 1.00 83.97  ?  280 ILE A CD1    1 
ATOM 4259  H H      . ILE A 1 276 ? 14.153  -21.016 -14.860 1.00 90.59  ?  280 ILE A H      1 
ATOM 4260  H HA     . ILE A 1 276 ? 11.813  -21.728 -15.649 1.00 70.90  ?  280 ILE A HA     1 
ATOM 4261  H HB     . ILE A 1 276 ? 11.954  -23.397 -13.935 1.00 67.60  ?  280 ILE A HB     1 
ATOM 4262  H HG12   . ILE A 1 276 ? 14.430  -22.186 -13.295 1.00 91.28  ?  280 ILE A HG12   1 
ATOM 4263  H HG13   . ILE A 1 276 ? 13.151  -22.123 -12.358 1.00 91.28  ?  280 ILE A HG13   1 
ATOM 4264  H HG21   . ILE A 1 276 ? 13.745  -24.533 -14.924 1.00 57.85  ?  280 ILE A HG21   1 
ATOM 4265  H HG22   . ILE A 1 276 ? 12.833  -23.853 -16.033 1.00 57.85  ?  280 ILE A HG22   1 
ATOM 4266  H HG23   . ILE A 1 276 ? 14.210  -23.181 -15.616 1.00 57.85  ?  280 ILE A HG23   1 
ATOM 4267  H HD11   . ILE A 1 276 ? 14.643  -23.690 -11.560 1.00 100.77 ?  280 ILE A HD11   1 
ATOM 4268  H HD12   . ILE A 1 276 ? 13.297  -24.407 -12.004 1.00 100.77 ?  280 ILE A HD12   1 
ATOM 4269  H HD13   . ILE A 1 276 ? 14.578  -24.470 -12.942 1.00 100.77 ?  280 ILE A HD13   1 
ATOM 4270  N N      . GLU A 1 277 ? 11.695  -20.070 -12.939 1.00 60.83  ?  281 GLU A N      1 
ATOM 4271  C CA     . GLU A 1 277 ? 10.770  -19.393 -12.036 1.00 52.74  ?  281 GLU A CA     1 
ATOM 4272  C C      . GLU A 1 277 ? 9.861   -18.443 -12.804 1.00 56.75  ?  281 GLU A C      1 
ATOM 4273  O O      . GLU A 1 277 ? 8.641   -18.440 -12.612 1.00 43.91  ?  281 GLU A O      1 
ATOM 4274  C CB     . GLU A 1 277 ? 11.551  -18.641 -10.959 1.00 59.10  ?  281 GLU A CB     1 
ATOM 4275  C CG     . GLU A 1 277 ? 10.678  -17.957 -9.921  1.00 72.10  ?  281 GLU A CG     1 
ATOM 4276  C CD     . GLU A 1 277 ? 11.428  -17.666 -8.638  1.00 82.22  ?  281 GLU A CD     1 
ATOM 4277  O OE1    . GLU A 1 277 ? 11.053  -16.706 -7.933  1.00 73.76  ?  281 GLU A OE1    1 
ATOM 4278  O OE2    . GLU A 1 277 ? 12.395  -18.394 -8.336  1.00 83.21  -1 281 GLU A OE2    1 
ATOM 4279  H H      . GLU A 1 277 ? 12.525  -19.898 -12.797 1.00 72.99  ?  281 GLU A H      1 
ATOM 4280  H HA     . GLU A 1 277 ? 10.213  -20.055 -11.598 1.00 63.28  ?  281 GLU A HA     1 
ATOM 4281  H HB2    . GLU A 1 277 ? 12.124  -19.270 -10.494 1.00 70.92  ?  281 GLU A HB2    1 
ATOM 4282  H HB3    . GLU A 1 277 ? 12.092  -17.959 -11.386 1.00 70.92  ?  281 GLU A HB3    1 
ATOM 4283  H HG2    . GLU A 1 277 ? 10.358  -17.115 -10.281 1.00 86.51  ?  281 GLU A HG2    1 
ATOM 4284  H HG3    . GLU A 1 277 ? 9.929   -18.534 -9.707  1.00 86.51  ?  281 GLU A HG3    1 
ATOM 4285  N N      . TRP A 1 278 ? 10.443  -17.633 -13.688 1.00 64.00  ?  282 TRP A N      1 
ATOM 4286  C CA     . TRP A 1 278 ? 9.650   -16.676 -14.450 1.00 51.92  ?  282 TRP A CA     1 
ATOM 4287  C C      . TRP A 1 278 ? 8.655   -17.383 -15.360 1.00 46.98  ?  282 TRP A C      1 
ATOM 4288  O O      . TRP A 1 278 ? 7.510   -16.939 -15.505 1.00 52.33  ?  282 TRP A O      1 
ATOM 4289  C CB     . TRP A 1 278 ? 10.573  -15.778 -15.270 1.00 43.42  ?  282 TRP A CB     1 
ATOM 4290  C CG     . TRP A 1 278 ? 11.334  -14.780 -14.458 1.00 34.16  ?  282 TRP A CG     1 
ATOM 4291  C CD1    . TRP A 1 278 ? 10.949  -14.215 -13.279 1.00 45.56  ?  282 TRP A CD1    1 
ATOM 4292  C CD2    . TRP A 1 278 ? 12.614  -14.222 -14.771 1.00 37.50  ?  282 TRP A CD2    1 
ATOM 4293  N NE1    . TRP A 1 278 ? 11.911  -13.340 -12.838 1.00 46.08  ?  282 TRP A NE1    1 
ATOM 4294  C CE2    . TRP A 1 278 ? 12.944  -13.327 -13.737 1.00 38.79  ?  282 TRP A CE2    1 
ATOM 4295  C CE3    . TRP A 1 278 ? 13.515  -14.394 -15.826 1.00 47.22  ?  282 TRP A CE3    1 
ATOM 4296  C CZ2    . TRP A 1 278 ? 14.133  -12.606 -13.726 1.00 53.15  ?  282 TRP A CZ2    1 
ATOM 4297  C CZ3    . TRP A 1 278 ? 14.695  -13.678 -15.814 1.00 41.69  ?  282 TRP A CZ3    1 
ATOM 4298  C CH2    . TRP A 1 278 ? 14.994  -12.796 -14.771 1.00 47.51  ?  282 TRP A CH2    1 
ATOM 4299  H H      . TRP A 1 278 ? 11.285  -17.618 -13.861 1.00 76.80  ?  282 TRP A H      1 
ATOM 4300  H HA     . TRP A 1 278 ? 9.151   -16.116 -13.836 1.00 62.30  ?  282 TRP A HA     1 
ATOM 4301  H HB2    . TRP A 1 278 ? 11.218  -16.335 -15.734 1.00 52.10  ?  282 TRP A HB2    1 
ATOM 4302  H HB3    . TRP A 1 278 ? 10.039  -15.289 -15.916 1.00 52.10  ?  282 TRP A HB3    1 
ATOM 4303  H HD1    . TRP A 1 278 ? 10.150  -14.395 -12.838 1.00 54.67  ?  282 TRP A HD1    1 
ATOM 4304  H HE1    . TRP A 1 278 ? 11.871  -12.876 -12.115 1.00 55.29  ?  282 TRP A HE1    1 
ATOM 4305  H HE3    . TRP A 1 278 ? 13.322  -14.979 -16.523 1.00 56.66  ?  282 TRP A HE3    1 
ATOM 4306  H HZ2    . TRP A 1 278 ? 14.336  -12.019 -13.034 1.00 63.78  ?  282 TRP A HZ2    1 
ATOM 4307  H HZ3    . TRP A 1 278 ? 15.301  -13.784 -16.511 1.00 50.03  ?  282 TRP A HZ3    1 
ATOM 4308  H HH2    . TRP A 1 278 ? 15.797  -12.327 -14.789 1.00 57.01  ?  282 TRP A HH2    1 
ATOM 4309  N N      . GLY A 1 279 ? 9.072   -18.486 -15.981 1.00 53.72  ?  283 GLY A N      1 
ATOM 4310  C CA     . GLY A 1 279 ? 8.224   -19.129 -16.969 1.00 49.16  ?  283 GLY A CA     1 
ATOM 4311  C C      . GLY A 1 279 ? 7.009   -19.805 -16.364 1.00 50.44  ?  283 GLY A C      1 
ATOM 4312  O O      . GLY A 1 279 ? 5.924   -19.787 -16.951 1.00 36.25  ?  283 GLY A O      1 
ATOM 4313  H H      . GLY A 1 279 ? 9.828   -18.873 -15.847 1.00 64.46  ?  283 GLY A H      1 
ATOM 4314  H HA2    . GLY A 1 279 ? 7.918   -18.467 -17.609 1.00 58.99  ?  283 GLY A HA2    1 
ATOM 4315  H HA3    . GLY A 1 279 ? 8.739   -19.799 -17.446 1.00 58.99  ?  283 GLY A HA3    1 
ATOM 4316  N N      . LEU A 1 280 ? 7.170   -20.411 -15.186 1.00 66.12  ?  284 LEU A N      1 
ATOM 4317  C CA     . LEU A 1 280 ? 6.078   -21.181 -14.602 1.00 57.57  ?  284 LEU A CA     1 
ATOM 4318  C C      . LEU A 1 280 ? 4.961   -20.304 -14.057 1.00 55.03  ?  284 LEU A C      1 
ATOM 4319  O O      . LEU A 1 280 ? 3.832   -20.786 -13.915 1.00 57.28  ?  284 LEU A O      1 
ATOM 4320  C CB     . LEU A 1 280 ? 6.600   -22.083 -13.480 1.00 56.89  ?  284 LEU A CB     1 
ATOM 4321  C CG     . LEU A 1 280 ? 6.974   -23.528 -13.821 1.00 47.14  ?  284 LEU A CG     1 
ATOM 4322  C CD1    . LEU A 1 280 ? 5.811   -24.279 -14.461 1.00 58.51  ?  284 LEU A CD1    1 
ATOM 4323  C CD2    . LEU A 1 280 ? 8.191   -23.576 -14.714 1.00 51.23  ?  284 LEU A CD2    1 
ATOM 4324  H H      . LEU A 1 280 ? 7.888   -20.390 -14.714 1.00 79.35  ?  284 LEU A H      1 
ATOM 4325  H HA     . LEU A 1 280 ? 5.698   -21.752 -15.288 1.00 69.08  ?  284 LEU A HA     1 
ATOM 4326  H HB2    . LEU A 1 280 ? 7.395   -21.667 -13.112 1.00 68.27  ?  284 LEU A HB2    1 
ATOM 4327  H HB3    . LEU A 1 280 ? 5.918   -22.124 -12.792 1.00 68.27  ?  284 LEU A HB3    1 
ATOM 4328  H HG     . LEU A 1 280 ? 7.199   -23.989 -12.998 1.00 56.57  ?  284 LEU A HG     1 
ATOM 4329  H HD11   . LEU A 1 280 ? 6.092   -25.186 -14.659 1.00 70.21  ?  284 LEU A HD11   1 
ATOM 4330  H HD12   . LEU A 1 280 ? 5.064   -24.292 -13.843 1.00 70.21  ?  284 LEU A HD12   1 
ATOM 4331  H HD13   . LEU A 1 280 ? 5.556   -23.826 -15.280 1.00 70.21  ?  284 LEU A HD13   1 
ATOM 4332  H HD21   . LEU A 1 280 ? 8.402   -24.502 -14.911 1.00 61.48  ?  284 LEU A HD21   1 
ATOM 4333  H HD22   . LEU A 1 280 ? 7.998   -23.098 -15.536 1.00 61.48  ?  284 LEU A HD22   1 
ATOM 4334  H HD23   . LEU A 1 280 ? 8.936   -23.158 -14.255 1.00 61.48  ?  284 LEU A HD23   1 
ATOM 4335  N N      . GLU A 1 281 ? 5.239   -19.038 -13.749 1.00 56.39  ?  285 GLU A N      1 
ATOM 4336  C CA     . GLU A 1 281 ? 4.247   -18.164 -13.135 1.00 52.03  ?  285 GLU A CA     1 
ATOM 4337  C C      . GLU A 1 281 ? 4.116   -16.854 -13.900 1.00 40.34  ?  285 GLU A C      1 
ATOM 4338  O O      . GLU A 1 281 ? 3.760   -15.824 -13.325 1.00 43.55  ?  285 GLU A O      1 
ATOM 4339  C CB     . GLU A 1 281 ? 4.590   -17.903 -11.669 1.00 57.08  ?  285 GLU A CB     1 
ATOM 4340  C CG     . GLU A 1 281 ? 5.949   -17.270 -11.446 1.00 69.66  ?  285 GLU A CG     1 
ATOM 4341  C CD     . GLU A 1 281 ? 6.632   -17.795 -10.200 1.00 72.60  ?  285 GLU A CD     1 
ATOM 4342  O OE1    . GLU A 1 281 ? 7.279   -18.860 -10.280 1.00 68.12  ?  285 GLU A OE1    1 
ATOM 4343  O OE2    . GLU A 1 281 ? 6.512   -17.151 -9.137  1.00 79.13  -1 285 GLU A OE2    1 
ATOM 4344  H H      . GLU A 1 281 ? 6.000   -18.661 -13.887 1.00 67.67  ?  285 GLU A H      1 
ATOM 4345  H HA     . GLU A 1 281 ? 3.385   -18.607 -13.161 1.00 62.43  ?  285 GLU A HA     1 
ATOM 4346  H HB2    . GLU A 1 281 ? 3.923   -17.306 -11.296 1.00 68.49  ?  285 GLU A HB2    1 
ATOM 4347  H HB3    . GLU A 1 281 ? 4.577   -18.748 -11.192 1.00 68.49  ?  285 GLU A HB3    1 
ATOM 4348  H HG2    . GLU A 1 281 ? 6.519   -17.466 -12.207 1.00 83.59  ?  285 GLU A HG2    1 
ATOM 4349  H HG3    . GLU A 1 281 ? 5.841   -16.311 -11.349 1.00 83.59  ?  285 GLU A HG3    1 
ATOM 4350  N N      . ASP A 1 282 ? 4.395   -16.880 -15.198 1.00 42.43  ?  286 ASP A N      1 
ATOM 4351  C CA     . ASP A 1 282 ? 4.165   -15.714 -16.033 1.00 44.65  ?  286 ASP A CA     1 
ATOM 4352  C C      . ASP A 1 282 ? 2.669   -15.467 -16.184 1.00 44.16  ?  286 ASP A C      1 
ATOM 4353  O O      . ASP A 1 282 ? 1.856   -16.393 -16.151 1.00 46.28  ?  286 ASP A O      1 
ATOM 4354  C CB     . ASP A 1 282 ? 4.815   -15.908 -17.402 1.00 39.58  ?  286 ASP A CB     1 
ATOM 4355  C CG     . ASP A 1 282 ? 4.522   -14.770 -18.351 1.00 46.33  ?  286 ASP A CG     1 
ATOM 4356  O OD1    . ASP A 1 282 ? 5.483   -14.118 -18.806 1.00 55.28  ?  286 ASP A OD1    1 
ATOM 4357  O OD2    . ASP A 1 282 ? 3.334   -14.533 -18.648 1.00 46.85  -1 286 ASP A OD2    1 
ATOM 4358  H H      . ASP A 1 282 ? 4.718   -17.559 -15.616 1.00 50.91  ?  286 ASP A H      1 
ATOM 4359  H HA     . ASP A 1 282 ? 4.563   -14.935 -15.614 1.00 53.58  ?  286 ASP A HA     1 
ATOM 4360  H HB2    . ASP A 1 282 ? 5.777   -15.966 -17.290 1.00 47.49  ?  286 ASP A HB2    1 
ATOM 4361  H HB3    . ASP A 1 282 ? 4.477   -16.725 -17.799 1.00 47.49  ?  286 ASP A HB3    1 
ATOM 4362  N N      . ARG A 1 283 ? 2.306   -14.194 -16.351 1.00 44.12  ?  287 ARG A N      1 
ATOM 4363  C CA     . ARG A 1 283 ? 0.897   -13.822 -16.376 1.00 39.94  ?  287 ARG A CA     1 
ATOM 4364  C C      . ARG A 1 283 ? 0.177   -14.344 -17.611 1.00 48.50  ?  287 ARG A C      1 
ATOM 4365  O O      . ARG A 1 283 ? -1.053  -14.452 -17.593 1.00 47.53  ?  287 ARG A O      1 
ATOM 4366  C CB     . ARG A 1 283 ? 0.750   -12.300 -16.304 1.00 53.45  ?  287 ARG A CB     1 
ATOM 4367  C CG     . ARG A 1 283 ? 1.513   -11.637 -15.161 1.00 48.20  ?  287 ARG A CG     1 
ATOM 4368  C CD     . ARG A 1 283 ? 1.004   -12.077 -13.795 1.00 57.20  ?  287 ARG A CD     1 
ATOM 4369  N NE     . ARG A 1 283 ? -0.199  -11.360 -13.379 1.00 50.20  ?  287 ARG A NE     1 
ATOM 4370  C CZ     . ARG A 1 283 ? -0.224  -10.376 -12.483 1.00 36.62  ?  287 ARG A CZ     1 
ATOM 4371  N NH1    . ARG A 1 283 ? 0.889   -9.969  -11.887 1.00 31.22  1  287 ARG A NH1    1 
ATOM 4372  N NH2    . ARG A 1 283 ? -1.373  -9.796  -12.175 1.00 37.61  ?  287 ARG A NH2    1 
ATOM 4373  H H      . ARG A 1 283 ? 2.852   -13.536 -16.450 1.00 52.94  ?  287 ARG A H      1 
ATOM 4374  H HA     . ARG A 1 283 ? 0.461   -14.199 -15.597 1.00 47.92  ?  287 ARG A HA     1 
ATOM 4375  H HB2    . ARG A 1 283 ? 1.077   -11.918 -17.134 1.00 64.14  ?  287 ARG A HB2    1 
ATOM 4376  H HB3    . ARG A 1 283 ? -0.189  -12.084 -16.194 1.00 64.14  ?  287 ARG A HB3    1 
ATOM 4377  H HG2    . ARG A 1 283 ? 2.451   -11.875 -15.225 1.00 57.84  ?  287 ARG A HG2    1 
ATOM 4378  H HG3    . ARG A 1 283 ? 1.408   -10.675 -15.226 1.00 57.84  ?  287 ARG A HG3    1 
ATOM 4379  H HD2    . ARG A 1 283 ? 0.793   -13.023 -13.827 1.00 68.64  ?  287 ARG A HD2    1 
ATOM 4380  H HD3    . ARG A 1 283 ? 1.695   -11.914 -13.134 1.00 68.64  ?  287 ARG A HD3    1 
ATOM 4381  H HE     . ARG A 1 283 ? -0.945  -11.590 -13.739 1.00 60.24  ?  287 ARG A HE     1 
ATOM 4382  H HH11   . ARG A 1 283 ? 1.640   -10.341 -12.079 1.00 37.46  ?  287 ARG A HH11   1 
ATOM 4383  H HH12   . ARG A 1 283 ? 0.859   -9.332  -11.310 1.00 37.46  ?  287 ARG A HH12   1 
ATOM 4384  H HH21   . ARG A 1 283 ? -2.100  -10.053 -12.556 1.00 45.14  ?  287 ARG A HH21   1 
ATOM 4385  H HH22   . ARG A 1 283 ? -1.393  -9.160  -11.597 1.00 45.14  ?  287 ARG A HH22   1 
ATOM 4386  N N      . GLU A 1 284 ? 0.904   -14.670 -18.675 1.00 42.91  ?  288 GLU A N      1 
ATOM 4387  C CA     . GLU A 1 284 ? 0.287   -15.117 -19.915 1.00 49.08  ?  288 GLU A CA     1 
ATOM 4388  C C      . GLU A 1 284 ? 0.224   -16.636 -19.972 1.00 57.41  ?  288 GLU A C      1 
ATOM 4389  O O      . GLU A 1 284 ? 1.178   -17.325 -19.601 1.00 65.48  ?  288 GLU A O      1 
ATOM 4390  C CB     . GLU A 1 284 ? 1.060   -14.586 -21.121 1.00 48.78  ?  288 GLU A CB     1 
ATOM 4391  C CG     . GLU A 1 284 ? 0.722   -13.156 -21.490 1.00 78.84  ?  288 GLU A CG     1 
ATOM 4392  C CD     . GLU A 1 284 ? -0.712  -12.997 -21.957 1.00 95.69  ?  288 GLU A CD     1 
ATOM 4393  O OE1    . GLU A 1 284 ? -1.360  -14.024 -22.251 1.00 69.18  ?  288 GLU A OE1    1 
ATOM 4394  O OE2    . GLU A 1 284 ? -1.193  -11.847 -22.028 1.00 102.56 -1 288 GLU A OE2    1 
ATOM 4395  H H      . GLU A 1 284 ? 1.763   -14.640 -18.703 1.00 51.49  ?  288 GLU A H      1 
ATOM 4396  H HA     . GLU A 1 284 ? -0.620  -14.774 -19.962 1.00 58.90  ?  288 GLU A HA     1 
ATOM 4397  H HB2    . GLU A 1 284 ? 2.009   -14.625 -20.924 1.00 58.54  ?  288 GLU A HB2    1 
ATOM 4398  H HB3    . GLU A 1 284 ? 0.861   -15.145 -21.889 1.00 58.54  ?  288 GLU A HB3    1 
ATOM 4399  H HG2    . GLU A 1 284 ? 0.849   -12.590 -20.712 1.00 94.61  ?  288 GLU A HG2    1 
ATOM 4400  H HG3    . GLU A 1 284 ? 1.306   -12.868 -22.209 1.00 94.61  ?  288 GLU A HG3    1 
ATOM 4401  N N      . LEU A 1 285 ? -0.910  -17.152 -20.451 1.00 67.42  ?  289 LEU A N      1 
ATOM 4402  C CA     . LEU A 1 285 ? -1.065  -18.595 -20.583 1.00 70.97  ?  289 LEU A CA     1 
ATOM 4403  C C      . LEU A 1 285 ? -0.071  -19.165 -21.582 1.00 50.15  ?  289 LEU A C      1 
ATOM 4404  O O      . LEU A 1 285 ? 0.389   -20.300 -21.425 1.00 30.60  ?  289 LEU A O      1 
ATOM 4405  C CB     . LEU A 1 285 ? -2.492  -18.942 -21.019 1.00 71.28  ?  289 LEU A CB     1 
ATOM 4406  C CG     . LEU A 1 285 ? -3.683  -18.517 -20.149 1.00 90.14  ?  289 LEU A CG     1 
ATOM 4407  C CD1    . LEU A 1 285 ? -3.387  -18.703 -18.673 1.00 90.06  ?  289 LEU A CD1    1 
ATOM 4408  C CD2    . LEU A 1 285 ? -4.132  -17.088 -20.434 1.00 69.96  ?  289 LEU A CD2    1 
ATOM 4409  H H      . LEU A 1 285 ? -1.592  -16.693 -20.702 1.00 80.90  ?  289 LEU A H      1 
ATOM 4410  H HA     . LEU A 1 285 ? -0.902  -19.013 -19.723 1.00 85.16  ?  289 LEU A HA     1 
ATOM 4411  H HB2    . LEU A 1 285 ? -2.634  -18.546 -21.893 1.00 85.54  ?  289 LEU A HB2    1 
ATOM 4412  H HB3    . LEU A 1 285 ? -2.543  -19.907 -21.104 1.00 85.54  ?  289 LEU A HB3    1 
ATOM 4413  H HG     . LEU A 1 285 ? -4.431  -19.097 -20.363 1.00 108.16 ?  289 LEU A HG     1 
ATOM 4414  H HD11   . LEU A 1 285 ? -4.161  -18.425 -18.159 1.00 108.07 ?  289 LEU A HD11   1 
ATOM 4415  H HD12   . LEU A 1 285 ? -3.197  -19.639 -18.505 1.00 108.07 ?  289 LEU A HD12   1 
ATOM 4416  H HD13   . LEU A 1 285 ? -2.618  -18.161 -18.435 1.00 108.07 ?  289 LEU A HD13   1 
ATOM 4417  H HD21   . LEU A 1 285 ? -4.884  -16.873 -19.859 1.00 83.95  ?  289 LEU A HD21   1 
ATOM 4418  H HD22   . LEU A 1 285 ? -3.395  -16.484 -20.254 1.00 83.95  ?  289 LEU A HD22   1 
ATOM 4419  H HD23   . LEU A 1 285 ? -4.397  -17.019 -21.364 1.00 83.95  ?  289 LEU A HD23   1 
ATOM 4420  N N      . SER A 1 286 ? 0.279   -18.389 -22.607 1.00 50.24  ?  290 SER A N      1 
ATOM 4421  C CA     . SER A 1 286 ? 1.126   -18.903 -23.675 1.00 50.47  ?  290 SER A CA     1 
ATOM 4422  C C      . SER A 1 286 ? 2.547   -19.154 -23.189 1.00 49.62  ?  290 SER A C      1 
ATOM 4423  O O      . SER A 1 286 ? 3.156   -20.169 -23.541 1.00 57.66  ?  290 SER A O      1 
ATOM 4424  C CB     . SER A 1 286 ? 1.130   -17.925 -24.847 1.00 60.69  ?  290 SER A CB     1 
ATOM 4425  O OG     . SER A 1 286 ? 1.861   -18.446 -25.940 1.00 70.40  ?  290 SER A OG     1 
ATOM 4426  H H      . SER A 1 286 ? 0.040   -17.569 -22.705 1.00 60.29  ?  290 SER A H      1 
ATOM 4427  H HA     . SER A 1 286 ? 0.763   -19.746 -23.988 1.00 60.57  ?  290 SER A HA     1 
ATOM 4428  H HB2    . SER A 1 286 ? 0.215   -17.766 -25.127 1.00 72.83  ?  290 SER A HB2    1 
ATOM 4429  H HB3    . SER A 1 286 ? 1.538   -17.093 -24.562 1.00 72.83  ?  290 SER A HB3    1 
ATOM 4430  H HG     . SER A 1 286 ? 1.518   -19.168 -26.198 1.00 84.48  ?  290 SER A HG     1 
ATOM 4431  N N      . VAL A 1 287 ? 3.094   -18.244 -22.383 1.00 44.14  ?  291 VAL A N      1 
ATOM 4432  C CA     . VAL A 1 287 ? 4.482   -18.385 -21.957 1.00 42.82  ?  291 VAL A CA     1 
ATOM 4433  C C      . VAL A 1 287 ? 4.634   -19.574 -21.020 1.00 51.17  ?  291 VAL A C      1 
ATOM 4434  O O      . VAL A 1 287 ? 5.645   -20.284 -21.058 1.00 64.53  ?  291 VAL A O      1 
ATOM 4435  C CB     . VAL A 1 287 ? 4.974   -17.085 -21.299 1.00 41.42  ?  291 VAL A CB     1 
ATOM 4436  C CG1    . VAL A 1 287 ? 6.433   -17.217 -20.882 1.00 42.67  ?  291 VAL A CG1    1 
ATOM 4437  C CG2    . VAL A 1 287 ? 4.798   -15.912 -22.248 1.00 66.38  ?  291 VAL A CG2    1 
ATOM 4438  H H      . VAL A 1 287 ? 2.691   -17.550 -22.076 1.00 52.96  ?  291 VAL A H      1 
ATOM 4439  H HA     . VAL A 1 287 ? 5.034   -18.550 -22.737 1.00 51.39  ?  291 VAL A HA     1 
ATOM 4440  H HB     . VAL A 1 287 ? 4.447   -16.911 -20.503 1.00 49.70  ?  291 VAL A HB     1 
ATOM 4441  H HG11   . VAL A 1 287 ? 6.720   -16.386 -20.471 1.00 51.21  ?  291 VAL A HG11   1 
ATOM 4442  H HG12   . VAL A 1 287 ? 6.515   -17.946 -20.248 1.00 51.21  ?  291 VAL A HG12   1 
ATOM 4443  H HG13   . VAL A 1 287 ? 6.970   -17.400 -21.669 1.00 51.21  ?  291 VAL A HG13   1 
ATOM 4444  H HG21   . VAL A 1 287 ? 5.114   -15.105 -21.813 1.00 79.65  ?  291 VAL A HG21   1 
ATOM 4445  H HG22   . VAL A 1 287 ? 5.312   -16.078 -23.053 1.00 79.65  ?  291 VAL A HG22   1 
ATOM 4446  H HG23   . VAL A 1 287 ? 3.857   -15.823 -22.468 1.00 79.65  ?  291 VAL A HG23   1 
ATOM 4447  N N      . ARG A 1 288 ? 3.641   -19.811 -20.163 1.00 47.42  ?  292 ARG A N      1 
ATOM 4448  C CA     . ARG A 1 288 ? 3.733   -20.924 -19.225 1.00 44.42  ?  292 ARG A CA     1 
ATOM 4449  C C      . ARG A 1 288 ? 3.814   -22.253 -19.966 1.00 49.37  ?  292 ARG A C      1 
ATOM 4450  O O      . ARG A 1 288 ? 4.690   -23.079 -19.689 1.00 42.46  ?  292 ARG A O      1 
ATOM 4451  C CB     . ARG A 1 288 ? 2.541   -20.905 -18.269 1.00 45.75  ?  292 ARG A CB     1 
ATOM 4452  C CG     . ARG A 1 288 ? 2.603   -19.790 -17.242 1.00 32.79  ?  292 ARG A CG     1 
ATOM 4453  C CD     . ARG A 1 288 ? 1.804   -20.125 -15.997 1.00 44.56  ?  292 ARG A CD     1 
ATOM 4454  N NE     . ARG A 1 288 ? 0.365   -20.026 -16.214 1.00 50.75  ?  292 ARG A NE     1 
ATOM 4455  C CZ     . ARG A 1 288 ? -0.356  -18.930 -15.998 1.00 64.14  ?  292 ARG A CZ     1 
ATOM 4456  N NH1    . ARG A 1 288 ? 0.218   -17.818 -15.559 1.00 76.31  1  292 ARG A NH1    1 
ATOM 4457  N NH2    . ARG A 1 288 ? -1.661  -18.946 -16.223 1.00 57.59  ?  292 ARG A NH2    1 
ATOM 4458  H H      . ARG A 1 288 ? 2.916   -19.351 -20.106 1.00 56.91  ?  292 ARG A H      1 
ATOM 4459  H HA     . ARG A 1 288 ? 4.541   -20.826 -18.698 1.00 53.30  ?  292 ARG A HA     1 
ATOM 4460  H HB2    . ARG A 1 288 ? 1.728   -20.789 -18.785 1.00 54.90  ?  292 ARG A HB2    1 
ATOM 4461  H HB3    . ARG A 1 288 ? 2.510   -21.748 -17.791 1.00 54.90  ?  292 ARG A HB3    1 
ATOM 4462  H HG2    . ARG A 1 288 ? 3.526   -19.649 -16.980 1.00 39.35  ?  292 ARG A HG2    1 
ATOM 4463  H HG3    . ARG A 1 288 ? 2.237   -18.979 -17.628 1.00 39.35  ?  292 ARG A HG3    1 
ATOM 4464  H HD2    . ARG A 1 288 ? 2.005   -21.034 -15.726 1.00 53.47  ?  292 ARG A HD2    1 
ATOM 4465  H HD3    . ARG A 1 288 ? 2.044   -19.506 -15.290 1.00 53.47  ?  292 ARG A HD3    1 
ATOM 4466  H HE     . ARG A 1 288 ? -0.046  -20.725 -16.501 1.00 60.90  ?  292 ARG A HE     1 
ATOM 4467  H HH11   . ARG A 1 288 ? 1.065   -17.801 -15.410 1.00 91.57  ?  292 ARG A HH11   1 
ATOM 4468  H HH12   . ARG A 1 288 ? -0.256  -17.113 -15.423 1.00 91.57  ?  292 ARG A HH12   1 
ATOM 4469  H HH21   . ARG A 1 288 ? -2.039  -19.663 -16.509 1.00 69.11  ?  292 ARG A HH21   1 
ATOM 4470  H HH22   . ARG A 1 288 ? -2.129  -18.238 -16.086 1.00 69.11  ?  292 ARG A HH22   1 
ATOM 4471  N N      . ASN A 1 289 ? 2.908   -22.473 -20.921 1.00 53.18  ?  293 ASN A N      1 
ATOM 4472  C CA     . ASN A 1 289 ? 2.929   -23.717 -21.682 1.00 37.98  ?  293 ASN A CA     1 
ATOM 4473  C C      . ASN A 1 289 ? 4.270   -23.918 -22.374 1.00 36.49  ?  293 ASN A C      1 
ATOM 4474  O O      . ASN A 1 289 ? 4.753   -25.049 -22.492 1.00 59.39  ?  293 ASN A O      1 
ATOM 4475  C CB     . ASN A 1 289 ? 1.795   -23.722 -22.704 1.00 47.54  ?  293 ASN A CB     1 
ATOM 4476  C CG     . ASN A 1 289 ? 0.431   -23.762 -22.054 1.00 43.79  ?  293 ASN A CG     1 
ATOM 4477  O OD1    . ASN A 1 289 ? 0.314   -23.777 -20.831 1.00 33.70  ?  293 ASN A OD1    1 
ATOM 4478  N ND2    . ASN A 1 289 ? -0.613  -23.773 -22.873 1.00 34.82  ?  293 ASN A ND2    1 
ATOM 4479  H H      . ASN A 1 289 ? 2.283   -21.926 -21.143 1.00 63.82  ?  293 ASN A H      1 
ATOM 4480  H HA     . ASN A 1 289 ? 2.790   -24.461 -21.076 1.00 45.57  ?  293 ASN A HA     1 
ATOM 4481  H HB2    . ASN A 1 289 ? 1.849   -22.916 -23.241 1.00 57.05  ?  293 ASN A HB2    1 
ATOM 4482  H HB3    . ASN A 1 289 ? 1.882   -24.505 -23.270 1.00 57.05  ?  293 ASN A HB3    1 
ATOM 4483  H HD21   . ASN A 1 289 ? -1.411  -23.796 -22.552 1.00 41.79  ?  293 ASN A HD21   1 
ATOM 4484  H HD22   . ASN A 1 289 ? -0.492  -23.758 -23.724 1.00 41.79  ?  293 ASN A HD22   1 
ATOM 4485  N N      . ALA A 1 290 ? 4.889   -22.833 -22.839 1.00 49.41  ?  294 ALA A N      1 
ATOM 4486  C CA     . ALA A 1 290 ? 6.196   -22.949 -23.473 1.00 55.43  ?  294 ALA A CA     1 
ATOM 4487  C C      . ALA A 1 290 ? 7.245   -23.446 -22.493 1.00 47.49  ?  294 ALA A C      1 
ATOM 4488  O O      . ALA A 1 290 ? 8.173   -24.160 -22.887 1.00 49.00  ?  294 ALA A O      1 
ATOM 4489  C CB     . ALA A 1 290 ? 6.615   -21.604 -24.058 1.00 74.02  ?  294 ALA A CB     1 
ATOM 4490  H H      . ALA A 1 290 ? 4.577   -22.032 -22.801 1.00 59.29  ?  294 ALA A H      1 
ATOM 4491  H HA     . ALA A 1 290 ? 6.138   -23.588 -24.201 1.00 66.52  ?  294 ALA A HA     1 
ATOM 4492  H HB1    . ALA A 1 290 ? 7.486   -21.699 -24.475 1.00 88.83  ?  294 ALA A HB1    1 
ATOM 4493  H HB2    . ALA A 1 290 ? 5.960   -21.328 -24.718 1.00 88.83  ?  294 ALA A HB2    1 
ATOM 4494  H HB3    . ALA A 1 290 ? 6.660   -20.950 -23.343 1.00 88.83  ?  294 ALA A HB3    1 
ATOM 4495  N N      . CYS A 1 291 ? 7.121   -23.078 -21.220 1.00 49.24  ?  295 CYS A N      1 
ATOM 4496  C CA     . CYS A 1 291 ? 8.069   -23.528 -20.211 1.00 51.07  ?  295 CYS A CA     1 
ATOM 4497  C C      . CYS A 1 291 ? 7.691   -24.886 -19.637 1.00 49.20  ?  295 CYS A C      1 
ATOM 4498  O O      . CYS A 1 291 ? 8.560   -25.746 -19.466 1.00 61.74  ?  295 CYS A O      1 
ATOM 4499  C CB     . CYS A 1 291 ? 8.170   -22.498 -19.085 1.00 59.92  ?  295 CYS A CB     1 
ATOM 4500  S SG     . CYS A 1 291 ? 9.454   -22.877 -17.875 1.00 60.03  ?  295 CYS A SG     1 
ATOM 4501  H H      . CYS A 1 291 ? 6.497   -22.570 -20.917 1.00 59.09  ?  295 CYS A H      1 
ATOM 4502  H HA     . CYS A 1 291 ? 8.946   -23.610 -20.618 1.00 61.28  ?  295 CYS A HA     1 
ATOM 4503  H HB2    . CYS A 1 291 ? 8.371   -21.631 -19.470 1.00 71.90  ?  295 CYS A HB2    1 
ATOM 4504  H HB3    . CYS A 1 291 ? 7.321   -22.462 -18.617 1.00 71.90  ?  295 CYS A HB3    1 
ATOM 4505  H HG     . CYS A 1 291 ? 9.461   -22.022 -17.033 1.00 72.04  ?  295 CYS A HG     1 
ATOM 4506  N N      . LYS A 1 292 ? 6.409   -25.101 -19.338 1.00 54.47  ?  296 LYS A N      1 
ATOM 4507  C CA     . LYS A 1 292 ? 5.969   -26.406 -18.858 1.00 48.66  ?  296 LYS A CA     1 
ATOM 4508  C C      . LYS A 1 292 ? 6.352   -27.502 -19.845 1.00 47.81  ?  296 LYS A C      1 
ATOM 4509  O O      . LYS A 1 292 ? 7.043   -28.464 -19.492 1.00 58.01  ?  296 LYS A O      1 
ATOM 4510  C CB     . LYS A 1 292 ? 4.458   -26.398 -18.623 1.00 50.90  ?  296 LYS A CB     1 
ATOM 4511  C CG     . LYS A 1 292 ? 4.003   -25.520 -17.469 1.00 44.98  ?  296 LYS A CG     1 
ATOM 4512  C CD     . LYS A 1 292 ? 2.504   -25.651 -17.248 1.00 47.22  ?  296 LYS A CD     1 
ATOM 4513  C CE     . LYS A 1 292 ? 2.010   -24.748 -16.131 1.00 64.08  ?  296 LYS A CE     1 
ATOM 4514  N NZ     . LYS A 1 292 ? 0.547   -24.902 -15.909 1.00 53.40  1  296 LYS A NZ     1 
ATOM 4515  H H      . LYS A 1 292 ? 5.783   -24.514 -19.403 1.00 65.37  ?  296 LYS A H      1 
ATOM 4516  H HA     . LYS A 1 292 ? 6.405   -26.597 -18.012 1.00 58.39  ?  296 LYS A HA     1 
ATOM 4517  H HB2    . LYS A 1 292 ? 4.021   -26.077 -19.427 1.00 61.08  ?  296 LYS A HB2    1 
ATOM 4518  H HB3    . LYS A 1 292 ? 4.169   -27.304 -18.434 1.00 61.08  ?  296 LYS A HB3    1 
ATOM 4519  H HG2    . LYS A 1 292 ? 4.457   -25.794 -16.657 1.00 53.97  ?  296 LYS A HG2    1 
ATOM 4520  H HG3    . LYS A 1 292 ? 4.203   -24.592 -17.672 1.00 53.97  ?  296 LYS A HG3    1 
ATOM 4521  H HD2    . LYS A 1 292 ? 2.039   -25.404 -18.063 1.00 56.66  ?  296 LYS A HD2    1 
ATOM 4522  H HD3    . LYS A 1 292 ? 2.296   -26.568 -17.010 1.00 56.66  ?  296 LYS A HD3    1 
ATOM 4523  H HE2    . LYS A 1 292 ? 2.469   -24.978 -15.308 1.00 76.90  ?  296 LYS A HE2    1 
ATOM 4524  H HE3    . LYS A 1 292 ? 2.186   -23.823 -16.366 1.00 76.90  ?  296 LYS A HE3    1 
ATOM 4525  H HZ1    . LYS A 1 292 ? 0.281   -24.365 -15.251 1.00 64.08  ?  296 LYS A HZ1    1 
ATOM 4526  H HZ2    . LYS A 1 292 ? 0.103   -24.693 -16.651 1.00 64.08  ?  296 LYS A HZ2    1 
ATOM 4527  H HZ3    . LYS A 1 292 ? 0.360   -25.744 -15.688 1.00 64.08  ?  296 LYS A HZ3    1 
ATOM 4528  N N      . ARG A 1 293 ? 5.911   -27.368 -21.098 1.00 45.54  ?  297 ARG A N      1 
ATOM 4529  C CA     . ARG A 1 293 ? 6.231   -28.372 -22.107 1.00 39.63  ?  297 ARG A CA     1 
ATOM 4530  C C      . ARG A 1 293 ? 7.736   -28.563 -22.236 1.00 39.05  ?  297 ARG A C      1 
ATOM 4531  O O      . ARG A 1 293 ? 8.214   -29.692 -22.384 1.00 62.19  ?  297 ARG A O      1 
ATOM 4532  C CB     . ARG A 1 293 ? 5.624   -27.970 -23.450 1.00 37.00  ?  297 ARG A CB     1 
ATOM 4533  C CG     . ARG A 1 293 ? 5.923   -28.939 -24.585 1.00 60.23  ?  297 ARG A CG     1 
ATOM 4534  C CD     . ARG A 1 293 ? 5.607   -28.335 -25.941 1.00 73.29  ?  297 ARG A CD     1 
ATOM 4535  N NE     . ARG A 1 293 ? 6.572   -28.760 -26.950 1.00 76.61  ?  297 ARG A NE     1 
ATOM 4536  C CZ     . ARG A 1 293 ? 6.485   -29.887 -27.649 1.00 86.54  ?  297 ARG A CZ     1 
ATOM 4537  N NH1    . ARG A 1 293 ? 5.471   -30.721 -27.460 1.00 91.76  1  297 ARG A NH1    1 
ATOM 4538  N NH2    . ARG A 1 293 ? 7.419   -30.183 -28.541 1.00 85.10  ?  297 ARG A NH2    1 
ATOM 4539  H H      . ARG A 1 293 ? 5.432   -26.714 -21.383 1.00 54.65  ?  297 ARG A H      1 
ATOM 4540  H HA     . ARG A 1 293 ? 5.842   -29.220 -21.843 1.00 47.56  ?  297 ARG A HA     1 
ATOM 4541  H HB2    . ARG A 1 293 ? 4.661   -27.917 -23.353 1.00 44.39  ?  297 ARG A HB2    1 
ATOM 4542  H HB3    . ARG A 1 293 ? 5.976   -27.102 -23.703 1.00 44.39  ?  297 ARG A HB3    1 
ATOM 4543  H HG2    . ARG A 1 293 ? 6.865   -29.170 -24.569 1.00 72.28  ?  297 ARG A HG2    1 
ATOM 4544  H HG3    . ARG A 1 293 ? 5.381   -29.736 -24.475 1.00 72.28  ?  297 ARG A HG3    1 
ATOM 4545  H HD2    . ARG A 1 293 ? 4.724   -28.624 -26.223 1.00 87.95  ?  297 ARG A HD2    1 
ATOM 4546  H HD3    . ARG A 1 293 ? 5.639   -27.368 -25.876 1.00 87.95  ?  297 ARG A HD3    1 
ATOM 4547  H HE     . ARG A 1 293 ? 7.243   -28.245 -27.104 1.00 91.93  ?  297 ARG A HE     1 
ATOM 4548  H HH11   . ARG A 1 293 ? 4.863   -30.534 -26.882 1.00 110.11 ?  297 ARG A HH11   1 
ATOM 4549  H HH12   . ARG A 1 293 ? 5.421   -31.448 -27.917 1.00 110.11 ?  297 ARG A HH12   1 
ATOM 4550  H HH21   . ARG A 1 293 ? 8.078   -29.645 -28.668 1.00 102.11 ?  297 ARG A HH21   1 
ATOM 4551  H HH22   . ARG A 1 293 ? 7.365   -30.911 -28.996 1.00 102.11 ?  297 ARG A HH22   1 
ATOM 4552  N N      . LEU A 1 294 ? 8.498   -27.471 -22.193 1.00 36.44  ?  298 LEU A N      1 
ATOM 4553  C CA     . LEU A 1 294 ? 9.950   -27.576 -22.288 1.00 33.42  ?  298 LEU A CA     1 
ATOM 4554  C C      . LEU A 1 294 ? 10.497  -28.512 -21.220 1.00 46.21  ?  298 LEU A C      1 
ATOM 4555  O O      . LEU A 1 294 ? 11.299  -29.406 -21.511 1.00 64.20  ?  298 LEU A O      1 
ATOM 4556  C CB     . LEU A 1 294 ? 10.581  -26.190 -22.161 1.00 56.90  ?  298 LEU A CB     1 
ATOM 4557  C CG     . LEU A 1 294 ? 12.107  -26.124 -22.040 1.00 53.31  ?  298 LEU A CG     1 
ATOM 4558  C CD1    . LEU A 1 294 ? 12.776  -26.471 -23.356 1.00 60.93  ?  298 LEU A CD1    1 
ATOM 4559  C CD2    . LEU A 1 294 ? 12.539  -24.751 -21.561 1.00 65.04  ?  298 LEU A CD2    1 
ATOM 4560  H H      . LEU A 1 294 ? 8.203   -26.667 -22.110 1.00 43.73  ?  298 LEU A H      1 
ATOM 4561  H HA     . LEU A 1 294 ? 10.186  -27.938 -23.156 1.00 40.10  ?  298 LEU A HA     1 
ATOM 4562  H HB2    . LEU A 1 294 ? 10.335  -25.675 -22.946 1.00 68.28  ?  298 LEU A HB2    1 
ATOM 4563  H HB3    . LEU A 1 294 ? 10.213  -25.763 -21.372 1.00 68.28  ?  298 LEU A HB3    1 
ATOM 4564  H HG     . LEU A 1 294 ? 12.396  -26.773 -21.379 1.00 63.97  ?  298 LEU A HG     1 
ATOM 4565  H HD11   . LEU A 1 294 ? 13.738  -26.420 -23.244 1.00 73.11  ?  298 LEU A HD11   1 
ATOM 4566  H HD12   . LEU A 1 294 ? 12.520  -27.371 -23.613 1.00 73.11  ?  298 LEU A HD12   1 
ATOM 4567  H HD13   . LEU A 1 294 ? 12.488  -25.839 -24.033 1.00 73.11  ?  298 LEU A HD13   1 
ATOM 4568  H HD21   . LEU A 1 294 ? 13.506  -24.731 -21.491 1.00 78.05  ?  298 LEU A HD21   1 
ATOM 4569  H HD22   . LEU A 1 294 ? 12.239  -24.086 -22.201 1.00 78.05  ?  298 LEU A HD22   1 
ATOM 4570  H HD23   . LEU A 1 294 ? 12.140  -24.579 -20.694 1.00 78.05  ?  298 LEU A HD23   1 
ATOM 4571  N N      . ILE A 1 295 ? 10.073  -28.319 -19.972 1.00 50.63  ?  299 ILE A N      1 
ATOM 4572  C CA     . ILE A 1 295 ? 10.593  -29.127 -18.873 1.00 53.79  ?  299 ILE A CA     1 
ATOM 4573  C C      . ILE A 1 295 ? 10.118  -30.567 -19.012 1.00 49.51  ?  299 ILE A C      1 
ATOM 4574  O O      . ILE A 1 295 ? 10.921  -31.506 -19.059 1.00 54.16  ?  299 ILE A O      1 
ATOM 4575  C CB     . ILE A 1 295 ? 10.173  -28.529 -17.519 1.00 55.27  ?  299 ILE A CB     1 
ATOM 4576  C CG1    . ILE A 1 295 ? 10.581  -27.057 -17.420 1.00 65.64  ?  299 ILE A CG1    1 
ATOM 4577  C CG2    . ILE A 1 295 ? 10.816  -29.300 -16.377 1.00 40.38  ?  299 ILE A CG2    1 
ATOM 4578  C CD1    . ILE A 1 295 ? 9.839   -26.298 -16.348 1.00 64.45  ?  299 ILE A CD1    1 
ATOM 4579  H H      . ILE A 1 295 ? 9.490   -27.732 -19.738 1.00 60.76  ?  299 ILE A H      1 
ATOM 4580  H HA     . ILE A 1 295 ? 11.562  -29.127 -18.913 1.00 64.55  ?  299 ILE A HA     1 
ATOM 4581  H HB     . ILE A 1 295 ? 9.209   -28.593 -17.434 1.00 66.32  ?  299 ILE A HB     1 
ATOM 4582  H HG12   . ILE A 1 295 ? 11.528  -27.007 -17.218 1.00 78.77  ?  299 ILE A HG12   1 
ATOM 4583  H HG13   . ILE A 1 295 ? 10.401  -26.625 -18.269 1.00 78.77  ?  299 ILE A HG13   1 
ATOM 4584  H HG21   . ILE A 1 295 ? 10.538  -28.907 -15.535 1.00 48.45  ?  299 ILE A HG21   1 
ATOM 4585  H HG22   . ILE A 1 295 ? 10.529  -30.226 -16.421 1.00 48.45  ?  299 ILE A HG22   1 
ATOM 4586  H HG23   . ILE A 1 295 ? 11.780  -29.248 -16.465 1.00 48.45  ?  299 ILE A HG23   1 
ATOM 4587  H HD11   . ILE A 1 295 ? 10.146  -25.378 -16.343 1.00 77.34  ?  299 ILE A HD11   1 
ATOM 4588  H HD12   . ILE A 1 295 ? 8.888   -26.329 -16.541 1.00 77.34  ?  299 ILE A HD12   1 
ATOM 4589  H HD13   . ILE A 1 295 ? 10.016  -26.711 -15.489 1.00 77.34  ?  299 ILE A HD13   1 
ATOM 4590  N N      . ALA A 1 296 ? 8.803   -30.759 -19.088 1.00 60.08  ?  300 ALA A N      1 
ATOM 4591  C CA     . ALA A 1 296 ? 8.227   -32.096 -19.129 1.00 48.49  ?  300 ALA A CA     1 
ATOM 4592  C C      . ALA A 1 296 ? 8.649   -32.847 -20.384 1.00 58.06  ?  300 ALA A C      1 
ATOM 4593  O O      . ALA A 1 296 ? 9.359   -33.852 -20.301 1.00 77.02  ?  300 ALA A O      1 
ATOM 4594  C CB     . ALA A 1 296 ? 6.702   -32.016 -19.053 1.00 47.07  ?  300 ALA A CB     1 
ATOM 4595  H H      . ALA A 1 296 ? 8.222   -30.126 -19.118 1.00 72.10  ?  300 ALA A H      1 
ATOM 4596  H HA     . ALA A 1 296 ? 8.539   -32.598 -18.360 1.00 58.19  ?  300 ALA A HA     1 
ATOM 4597  H HB1    . ALA A 1 296 ? 6.337   -32.915 -19.081 1.00 56.49  ?  300 ALA A HB1    1 
ATOM 4598  H HB2    . ALA A 1 296 ? 6.450   -31.583 -18.222 1.00 56.49  ?  300 ALA A HB2    1 
ATOM 4599  H HB3    . ALA A 1 296 ? 6.374   -31.502 -19.807 1.00 56.49  ?  300 ALA A HB3    1 
ATOM 4600  N N      . HIS A 1 297 ? 8.224   -32.370 -21.552 1.00 56.99  ?  301 HIS A N      1 
ATOM 4601  C CA     . HIS A 1 297 ? 8.464   -33.112 -22.785 1.00 57.43  ?  301 HIS A CA     1 
ATOM 4602  C C      . HIS A 1 297 ? 9.948   -33.154 -23.130 1.00 57.95  ?  301 HIS A C      1 
ATOM 4603  O O      . HIS A 1 297 ? 10.560  -34.227 -23.171 1.00 86.40  ?  301 HIS A O      1 
ATOM 4604  C CB     . HIS A 1 297 ? 7.665   -32.488 -23.930 1.00 64.33  ?  301 HIS A CB     1 
ATOM 4605  C CG     . HIS A 1 297 ? 7.888   -33.152 -25.252 1.00 71.99  ?  301 HIS A CG     1 
ATOM 4606  N ND1    . HIS A 1 297 ? 9.080   -33.062 -25.939 1.00 85.83  ?  301 HIS A ND1    1 
ATOM 4607  C CD2    . HIS A 1 297 ? 7.070   -33.910 -26.019 1.00 65.58  ?  301 HIS A CD2    1 
ATOM 4608  C CE1    . HIS A 1 297 ? 8.988   -33.741 -27.068 1.00 83.34  ?  301 HIS A CE1    1 
ATOM 4609  N NE2    . HIS A 1 297 ? 7.777   -34.265 -27.141 1.00 77.56  ?  301 HIS A NE2    1 
ATOM 4610  H H      . HIS A 1 297 ? 7.799   -31.630 -21.656 1.00 68.38  ?  301 HIS A H      1 
ATOM 4611  H HA     . HIS A 1 297 ? 8.158   -34.025 -22.669 1.00 68.91  ?  301 HIS A HA     1 
ATOM 4612  H HB2    . HIS A 1 297 ? 6.720   -32.552 -23.722 1.00 77.19  ?  301 HIS A HB2    1 
ATOM 4613  H HB3    . HIS A 1 297 ? 7.921   -31.557 -24.019 1.00 77.19  ?  301 HIS A HB3    1 
ATOM 4614  H HD1    . HIS A 1 297 ? 9.777   -32.634 -25.672 1.00 102.99 ?  301 HIS A HD1    1 
ATOM 4615  H HD2    . HIS A 1 297 ? 6.193   -34.149 -25.821 1.00 78.70  ?  301 HIS A HD2    1 
ATOM 4616  H HE1    . HIS A 1 297 ? 9.660   -33.833 -27.704 1.00 100.00 ?  301 HIS A HE1    1 
ATOM 4617  N N      . ASP A 1 298 ? 10.548  -31.991 -23.382 1.00 59.19  ?  302 ASP A N      1 
ATOM 4618  C CA     . ASP A 1 298 ? 11.870  -31.958 -23.998 1.00 60.48  ?  302 ASP A CA     1 
ATOM 4619  C C      . ASP A 1 298 ? 12.955  -32.408 -23.028 1.00 56.98  ?  302 ASP A C      1 
ATOM 4620  O O      . ASP A 1 298 ? 13.735  -33.316 -23.335 1.00 69.05  ?  302 ASP A O      1 
ATOM 4621  C CB     . ASP A 1 298 ? 12.162  -30.554 -24.523 1.00 73.78  ?  302 ASP A CB     1 
ATOM 4622  C CG     . ASP A 1 298 ? 11.289  -30.186 -25.704 1.00 87.26  ?  302 ASP A CG     1 
ATOM 4623  O OD1    . ASP A 1 298 ? 10.969  -31.087 -26.507 1.00 87.37  ?  302 ASP A OD1    1 
ATOM 4624  O OD2    . ASP A 1 298 ? 10.918  -29.001 -25.828 1.00 82.10  -1 302 ASP A OD2    1 
ATOM 4625  H H      . ASP A 1 298 ? 10.215  -31.217 -23.208 1.00 71.03  ?  302 ASP A H      1 
ATOM 4626  H HA     . ASP A 1 298 ? 11.878  -32.566 -24.754 1.00 72.57  ?  302 ASP A HA     1 
ATOM 4627  H HB2    . ASP A 1 298 ? 11.998  -29.910 -23.816 1.00 88.54  ?  302 ASP A HB2    1 
ATOM 4628  H HB3    . ASP A 1 298 ? 13.088  -30.508 -24.808 1.00 88.54  ?  302 ASP A HB3    1 
ATOM 4629  N N      . TRP A 1 299 ? 13.030  -31.781 -21.854 1.00 58.84  ?  303 TRP A N      1 
ATOM 4630  C CA     . TRP A 1 299 ? 14.125  -32.081 -20.937 1.00 66.18  ?  303 TRP A CA     1 
ATOM 4631  C C      . TRP A 1 299 ? 14.047  -33.515 -20.429 1.00 76.34  ?  303 TRP A C      1 
ATOM 4632  O O      . TRP A 1 299 ? 15.075  -34.193 -20.313 1.00 86.30  ?  303 TRP A O      1 
ATOM 4633  C CB     . TRP A 1 299 ? 14.120  -31.092 -19.773 1.00 64.76  ?  303 TRP A CB     1 
ATOM 4634  C CG     . TRP A 1 299 ? 14.693  -29.748 -20.116 1.00 69.28  ?  303 TRP A CG     1 
ATOM 4635  C CD1    . TRP A 1 299 ? 15.360  -29.405 -21.258 1.00 84.92  ?  303 TRP A CD1    1 
ATOM 4636  C CD2    . TRP A 1 299 ? 14.650  -28.568 -19.308 1.00 75.52  ?  303 TRP A CD2    1 
ATOM 4637  N NE1    . TRP A 1 299 ? 15.735  -28.085 -21.208 1.00 85.73  ?  303 TRP A NE1    1 
ATOM 4638  C CE2    . TRP A 1 299 ? 15.311  -27.548 -20.022 1.00 79.97  ?  303 TRP A CE2    1 
ATOM 4639  C CE3    . TRP A 1 299 ? 14.118  -28.274 -18.050 1.00 76.09  ?  303 TRP A CE3    1 
ATOM 4640  C CZ2    . TRP A 1 299 ? 15.452  -26.258 -19.520 1.00 69.11  ?  303 TRP A CZ2    1 
ATOM 4641  C CZ3    . TRP A 1 299 ? 14.259  -26.992 -17.553 1.00 79.07  ?  303 TRP A CZ3    1 
ATOM 4642  C CH2    . TRP A 1 299 ? 14.920  -26.000 -18.286 1.00 77.58  ?  303 TRP A CH2    1 
ATOM 4643  H H      . TRP A 1 299 ? 12.473  -31.190 -21.571 1.00 70.61  ?  303 TRP A H      1 
ATOM 4644  H HA     . TRP A 1 299 ? 14.966  -31.980 -21.410 1.00 79.41  ?  303 TRP A HA     1 
ATOM 4645  H HB2    . TRP A 1 299 ? 13.205  -30.958 -19.480 1.00 77.71  ?  303 TRP A HB2    1 
ATOM 4646  H HB3    . TRP A 1 299 ? 14.647  -31.462 -19.047 1.00 77.71  ?  303 TRP A HB3    1 
ATOM 4647  H HD1    . TRP A 1 299 ? 15.536  -29.982 -21.965 1.00 101.90 ?  303 TRP A HD1    1 
ATOM 4648  H HE1    . TRP A 1 299 ? 16.165  -27.664 -21.822 1.00 102.88 ?  303 TRP A HE1    1 
ATOM 4649  H HE3    . TRP A 1 299 ? 13.677  -28.928 -17.557 1.00 91.31  ?  303 TRP A HE3    1 
ATOM 4650  H HZ2    . TRP A 1 299 ? 15.890  -25.597 -20.004 1.00 82.93  ?  303 TRP A HZ2    1 
ATOM 4651  H HZ3    . TRP A 1 299 ? 13.909  -26.785 -16.717 1.00 94.88  ?  303 TRP A HZ3    1 
ATOM 4652  H HH2    . TRP A 1 299 ? 15.000  -25.146 -17.927 1.00 93.09  ?  303 TRP A HH2    1 
ATOM 4653  N N      . LEU A 1 300 ? 12.843  -33.999 -20.121 1.00 66.78  ?  304 LEU A N      1 
ATOM 4654  C CA     . LEU A 1 300 ? 12.702  -35.381 -19.678 1.00 58.91  ?  304 LEU A CA     1 
ATOM 4655  C C      . LEU A 1 300 ? 13.190  -36.342 -20.756 1.00 64.53  ?  304 LEU A C      1 
ATOM 4656  O O      . LEU A 1 300 ? 14.014  -37.224 -20.493 1.00 80.73  ?  304 LEU A O      1 
ATOM 4657  C CB     . LEU A 1 300 ? 11.246  -35.667 -19.316 1.00 56.69  ?  304 LEU A CB     1 
ATOM 4658  C CG     . LEU A 1 300 ? 11.004  -36.858 -18.392 1.00 67.67  ?  304 LEU A CG     1 
ATOM 4659  C CD1    . LEU A 1 300 ? 11.215  -36.456 -16.944 1.00 71.12  ?  304 LEU A CD1    1 
ATOM 4660  C CD2    . LEU A 1 300 ? 9.610   -37.421 -18.597 1.00 70.99  ?  304 LEU A CD2    1 
ATOM 4661  H H      . LEU A 1 300 ? 12.107  -33.555 -20.159 1.00 80.14  ?  304 LEU A H      1 
ATOM 4662  H HA     . LEU A 1 300 ? 13.243  -35.518 -18.885 1.00 70.69  ?  304 LEU A HA     1 
ATOM 4663  H HB2    . LEU A 1 300 ? 10.882  -34.882 -18.877 1.00 68.02  ?  304 LEU A HB2    1 
ATOM 4664  H HB3    . LEU A 1 300 ? 10.755  -35.833 -20.136 1.00 68.02  ?  304 LEU A HB3    1 
ATOM 4665  H HG     . LEU A 1 300 ? 11.642  -37.556 -18.604 1.00 81.20  ?  304 LEU A HG     1 
ATOM 4666  H HD11   . LEU A 1 300 ? 11.056  -37.226 -16.376 1.00 85.34  ?  304 LEU A HD11   1 
ATOM 4667  H HD12   . LEU A 1 300 ? 12.127  -36.145 -16.833 1.00 85.34  ?  304 LEU A HD12   1 
ATOM 4668  H HD13   . LEU A 1 300 ? 10.594  -35.745 -16.720 1.00 85.34  ?  304 LEU A HD13   1 
ATOM 4669  H HD21   . LEU A 1 300 ? 9.483   -38.174 -18.000 1.00 85.19  ?  304 LEU A HD21   1 
ATOM 4670  H HD22   . LEU A 1 300 ? 8.959   -36.729 -18.402 1.00 85.19  ?  304 LEU A HD22   1 
ATOM 4671  H HD23   . LEU A 1 300 ? 9.520   -37.710 -19.519 1.00 85.19  ?  304 LEU A HD23   1 
ATOM 4672  N N      . ASN A 1 301 ? 12.693  -36.179 -21.984 1.00 62.16  ?  305 ASN A N      1 
ATOM 4673  C CA     . ASN A 1 301 ? 13.183  -36.990 -23.093 1.00 63.31  ?  305 ASN A CA     1 
ATOM 4674  C C      . ASN A 1 301 ? 14.678  -36.789 -23.297 1.00 64.76  ?  305 ASN A C      1 
ATOM 4675  O O      . ASN A 1 301 ? 15.402  -37.736 -23.623 1.00 84.65  ?  305 ASN A O      1 
ATOM 4676  C CB     . ASN A 1 301 ? 12.419  -36.643 -24.370 1.00 66.96  ?  305 ASN A CB     1 
ATOM 4677  C CG     . ASN A 1 301 ? 10.935  -36.912 -24.251 1.00 61.51  ?  305 ASN A CG     1 
ATOM 4678  O OD1    . ASN A 1 301 ? 10.436  -37.229 -23.173 1.00 44.29  ?  305 ASN A OD1    1 
ATOM 4679  N ND2    . ASN A 1 301 ? 10.218  -36.777 -25.359 1.00 72.21  ?  305 ASN A ND2    1 
ATOM 4680  H H      . ASN A 1 301 ? 12.081  -35.613 -22.197 1.00 74.59  ?  305 ASN A H      1 
ATOM 4681  H HA     . ASN A 1 301 ? 13.029  -37.926 -22.894 1.00 75.97  ?  305 ASN A HA     1 
ATOM 4682  H HB2    . ASN A 1 301 ? 12.540  -35.701 -24.566 1.00 80.36  ?  305 ASN A HB2    1 
ATOM 4683  H HB3    . ASN A 1 301 ? 12.764  -37.181 -25.101 1.00 80.36  ?  305 ASN A HB3    1 
ATOM 4684  H HD21   . ASN A 1 301 ? 9.370   -36.918 -25.343 1.00 86.65  ?  305 ASN A HD21   1 
ATOM 4685  H HD22   . ASN A 1 301 ? 10.602  -36.548 -26.094 1.00 86.65  ?  305 ASN A HD22   1 
ATOM 4686  N N      . ALA A 1 302 ? 15.159  -35.559 -23.111 1.00 63.62  ?  306 ALA A N      1 
ATOM 4687  C CA     . ALA A 1 302 ? 16.589  -35.301 -23.225 1.00 70.17  ?  306 ALA A CA     1 
ATOM 4688  C C      . ALA A 1 302 ? 17.370  -35.983 -22.110 1.00 75.96  ?  306 ALA A C      1 
ATOM 4689  O O      . ALA A 1 302 ? 18.537  -36.340 -22.304 1.00 79.72  ?  306 ALA A O      1 
ATOM 4690  C CB     . ALA A 1 302 ? 16.855  -33.796 -23.210 1.00 82.32  ?  306 ALA A CB     1 
ATOM 4691  H H      . ALA A 1 302 ? 14.684  -34.868 -22.920 1.00 76.34  ?  306 ALA A H      1 
ATOM 4692  H HA     . ALA A 1 302 ? 16.907  -35.653 -24.071 1.00 84.20  ?  306 ALA A HA     1 
ATOM 4693  H HB1    . ALA A 1 302 ? 17.810  -33.643 -23.287 1.00 98.79  ?  306 ALA A HB1    1 
ATOM 4694  H HB2    . ALA A 1 302 ? 16.393  -33.387 -23.959 1.00 98.79  ?  306 ALA A HB2    1 
ATOM 4695  H HB3    . ALA A 1 302 ? 16.526  -33.425 -22.376 1.00 98.79  ?  306 ALA A HB3    1 
ATOM 4696  N N      . LEU A 1 303 ? 16.752  -36.169 -20.945 1.00 76.49  ?  307 LEU A N      1 
ATOM 4697  C CA     . LEU A 1 303 ? 17.392  -36.827 -19.816 1.00 90.96  ?  307 LEU A CA     1 
ATOM 4698  C C      . LEU A 1 303 ? 17.000  -38.294 -19.691 1.00 93.24  ?  307 LEU A C      1 
ATOM 4699  O O      . LEU A 1 303 ? 17.232  -38.900 -18.640 1.00 88.35  ?  307 LEU A O      1 
ATOM 4700  C CB     . LEU A 1 303 ? 17.061  -36.087 -18.518 1.00 93.81  ?  307 LEU A CB     1 
ATOM 4701  C CG     . LEU A 1 303 ? 17.691  -34.705 -18.334 1.00 95.40  ?  307 LEU A CG     1 
ATOM 4702  C CD1    . LEU A 1 303 ? 17.234  -34.105 -17.018 1.00 90.15  ?  307 LEU A CD1    1 
ATOM 4703  C CD2    . LEU A 1 303 ? 19.211  -34.766 -18.385 1.00 93.23  ?  307 LEU A CD2    1 
ATOM 4704  H H      . LEU A 1 303 ? 15.945  -35.917 -20.785 1.00 91.79  ?  307 LEU A H      1 
ATOM 4705  H HA     . LEU A 1 303 ? 18.354  -36.790 -19.939 1.00 109.15 ?  307 LEU A HA     1 
ATOM 4706  H HB2    . LEU A 1 303 ? 16.099  -35.973 -18.472 1.00 112.57 ?  307 LEU A HB2    1 
ATOM 4707  H HB3    . LEU A 1 303 ? 17.354  -36.636 -17.774 1.00 112.57 ?  307 LEU A HB3    1 
ATOM 4708  H HG     . LEU A 1 303 ? 17.390  -34.123 -19.050 1.00 114.48 ?  307 LEU A HG     1 
ATOM 4709  H HD11   . LEU A 1 303 ? 17.638  -33.230 -16.913 1.00 108.18 ?  307 LEU A HD11   1 
ATOM 4710  H HD12   . LEU A 1 303 ? 16.267  -34.024 -17.027 1.00 108.18 ?  307 LEU A HD12   1 
ATOM 4711  H HD13   . LEU A 1 303 ? 17.510  -34.687 -16.293 1.00 108.18 ?  307 LEU A HD13   1 
ATOM 4712  H HD21   . LEU A 1 303 ? 19.567  -33.872 -18.264 1.00 111.87 ?  307 LEU A HD21   1 
ATOM 4713  H HD22   . LEU A 1 303 ? 19.526  -35.347 -17.675 1.00 111.87 ?  307 LEU A HD22   1 
ATOM 4714  H HD23   . LEU A 1 303 ? 19.483  -35.118 -19.246 1.00 111.87 ?  307 LEU A HD23   1 
ATOM 4715  N N      . ASP A 1 304 ? 16.406  -38.874 -20.731 1.00 90.81  ?  308 ASP A N      1 
ATOM 4716  C CA     . ASP A 1 304 ? 16.131  -40.305 -20.800 1.00 85.51  ?  308 ASP A CA     1 
ATOM 4717  C C      . ASP A 1 304 ? 15.062  -40.753 -19.812 1.00 77.61  ?  308 ASP A C      1 
ATOM 4718  O O      . ASP A 1 304 ? 15.023  -41.927 -19.433 1.00 94.97  ?  308 ASP A O      1 
ATOM 4719  C CB     . ASP A 1 304 ? 17.413  -41.114 -20.574 1.00 105.23 ?  308 ASP A CB     1 
ATOM 4720  C CG     . ASP A 1 304 ? 18.574  -40.611 -21.410 1.00 107.91 ?  308 ASP A CG     1 
ATOM 4721  O OD1    . ASP A 1 304 ? 18.340  -40.191 -22.562 1.00 104.72 ?  308 ASP A OD1    1 
ATOM 4722  O OD2    . ASP A 1 304 ? 19.719  -40.630 -20.913 1.00 105.14 -1 308 ASP A OD2    1 
ATOM 4723  H H      . ASP A 1 304 ? 16.145  -38.445 -21.429 1.00 108.97 ?  308 ASP A H      1 
ATOM 4724  H HA     . ASP A 1 304 ? 15.809  -40.512 -21.692 1.00 102.62 ?  308 ASP A HA     1 
ATOM 4725  H HB2    . ASP A 1 304 ? 17.666  -41.052 -19.640 1.00 126.28 ?  308 ASP A HB2    1 
ATOM 4726  H HB3    . ASP A 1 304 ? 17.249  -42.040 -20.814 1.00 126.28 ?  308 ASP A HB3    1 
ATOM 4727  N N      . GLY A 1 305 ? 14.188  -39.848 -19.380 1.00 80.75  ?  309 GLY A N      1 
ATOM 4728  C CA     . GLY A 1 305 ? 13.120  -40.213 -18.473 1.00 72.90  ?  309 GLY A CA     1 
ATOM 4729  C C      . GLY A 1 305 ? 13.509  -40.286 -17.015 1.00 75.18  ?  309 GLY A C      1 
ATOM 4730  O O      . GLY A 1 305 ? 12.680  -40.684 -16.190 1.00 72.70  ?  309 GLY A O      1 
ATOM 4731  H H      . GLY A 1 305 ? 14.196  -39.017 -19.601 1.00 96.90  ?  309 GLY A H      1 
ATOM 4732  H HA2    . GLY A 1 305 ? 12.402  -39.565 -18.557 1.00 87.47  ?  309 GLY A HA2    1 
ATOM 4733  H HA3    . GLY A 1 305 ? 12.771  -41.080 -18.731 1.00 87.47  ?  309 GLY A HA3    1 
ATOM 4734  N N      . ASP A 1 306 ? 14.738  -39.914 -16.667 1.00 80.79  ?  310 ASP A N      1 
ATOM 4735  C CA     . ASP A 1 306 ? 15.204  -39.983 -15.285 1.00 81.46  ?  310 ASP A CA     1 
ATOM 4736  C C      . ASP A 1 306 ? 14.580  -38.833 -14.510 1.00 80.85  ?  310 ASP A C      1 
ATOM 4737  O O      . ASP A 1 306 ? 15.043  -37.693 -14.583 1.00 83.04  ?  310 ASP A O      1 
ATOM 4738  C CB     . ASP A 1 306 ? 16.726  -39.930 -15.231 1.00 85.03  ?  310 ASP A CB     1 
ATOM 4739  C CG     . ASP A 1 306 ? 17.269  -40.093 -13.823 1.00 95.38  ?  310 ASP A CG     1 
ATOM 4740  O OD1    . ASP A 1 306 ? 16.703  -39.496 -12.883 1.00 90.73  ?  310 ASP A OD1    1 
ATOM 4741  O OD2    . ASP A 1 306 ? 18.270  -40.821 -13.657 1.00 88.53  -1 310 ASP A OD2    1 
ATOM 4742  H H      . ASP A 1 306 ? 15.326  -39.614 -17.218 1.00 96.95  ?  310 ASP A H      1 
ATOM 4743  H HA     . ASP A 1 306 ? 14.911  -40.818 -14.886 1.00 97.75  ?  310 ASP A HA     1 
ATOM 4744  H HB2    . ASP A 1 306 ? 17.087  -40.646 -15.777 1.00 102.04 ?  310 ASP A HB2    1 
ATOM 4745  H HB3    . ASP A 1 306 ? 17.024  -39.071 -15.570 1.00 102.04 ?  310 ASP A HB3    1 
ATOM 4746  N N      . LEU A 1 307 ? 13.523  -39.130 -13.753 1.00 79.53  ?  311 LEU A N      1 
ATOM 4747  C CA     . LEU A 1 307 ? 12.886  -38.094 -12.951 1.00 68.29  ?  311 LEU A CA     1 
ATOM 4748  C C      . LEU A 1 307 ? 13.789  -37.638 -11.814 1.00 65.70  ?  311 LEU A C      1 
ATOM 4749  O O      . LEU A 1 307 ? 13.713  -36.480 -11.393 1.00 81.35  ?  311 LEU A O      1 
ATOM 4750  C CB     . LEU A 1 307 ? 11.552  -38.602 -12.403 1.00 72.63  ?  311 LEU A CB     1 
ATOM 4751  C CG     . LEU A 1 307 ? 10.641  -37.578 -11.719 1.00 81.28  ?  311 LEU A CG     1 
ATOM 4752  C CD1    . LEU A 1 307 ? 10.299  -36.426 -12.650 1.00 91.55  ?  311 LEU A CD1    1 
ATOM 4753  C CD2    . LEU A 1 307 ? 9.369   -38.252 -11.233 1.00 77.88  ?  311 LEU A CD2    1 
ATOM 4754  H H      . LEU A 1 307 ? 13.163  -39.909 -13.689 1.00 95.44  ?  311 LEU A H      1 
ATOM 4755  H HA     . LEU A 1 307 ? 12.705  -37.326 -13.515 1.00 81.95  ?  311 LEU A HA     1 
ATOM 4756  H HB2    . LEU A 1 307 ? 11.049  -38.982 -13.140 1.00 87.16  ?  311 LEU A HB2    1 
ATOM 4757  H HB3    . LEU A 1 307 ? 11.738  -39.296 -11.752 1.00 87.16  ?  311 LEU A HB3    1 
ATOM 4758  H HG     . LEU A 1 307 ? 11.101  -37.213 -10.947 1.00 97.53  ?  311 LEU A HG     1 
ATOM 4759  H HD11   . LEU A 1 307 ? 9.723   -35.802 -12.181 1.00 109.86 ?  311 LEU A HD11   1 
ATOM 4760  H HD12   . LEU A 1 307 ? 11.119  -35.982 -12.918 1.00 109.86 ?  311 LEU A HD12   1 
ATOM 4761  H HD13   . LEU A 1 307 ? 9.841   -36.776 -13.431 1.00 109.86 ?  311 LEU A HD13   1 
ATOM 4762  H HD21   . LEU A 1 307 ? 8.806   -37.589 -10.803 1.00 93.45  ?  311 LEU A HD21   1 
ATOM 4763  H HD22   . LEU A 1 307 ? 8.906   -38.638 -11.992 1.00 93.45  ?  311 LEU A HD22   1 
ATOM 4764  H HD23   . LEU A 1 307 ? 9.604   -38.948 -10.599 1.00 93.45  ?  311 LEU A HD23   1 
ATOM 4765  N N      . ILE A 1 308 ? 14.653  -38.522 -11.311 1.00 67.16  ?  312 ILE A N      1 
ATOM 4766  C CA     . ILE A 1 308 ? 15.551  -38.147 -10.223 1.00 70.84  ?  312 ILE A CA     1 
ATOM 4767  C C      . ILE A 1 308 ? 16.646  -37.223 -10.736 1.00 79.10  ?  312 ILE A C      1 
ATOM 4768  O O      . ILE A 1 308 ? 16.948  -36.191 -10.125 1.00 93.94  ?  312 ILE A O      1 
ATOM 4769  C CB     . ILE A 1 308 ? 16.139  -39.404 -9.556  1.00 68.15  ?  312 ILE A CB     1 
ATOM 4770  C CG1    . ILE A 1 308 ? 15.021  -40.283 -8.983  1.00 67.93  ?  312 ILE A CG1    1 
ATOM 4771  C CG2    . ILE A 1 308 ? 17.133  -39.026 -8.461  1.00 71.10  ?  312 ILE A CG2    1 
ATOM 4772  C CD1    . ILE A 1 308 ? 14.179  -39.618 -7.909  1.00 71.37  ?  312 ILE A CD1    1 
ATOM 4773  H H      . ILE A 1 308 ? 14.736  -39.335 -11.579 1.00 80.59  ?  312 ILE A H      1 
ATOM 4774  H HA     . ILE A 1 308 ? 15.044  -37.664 -9.551  1.00 85.01  ?  312 ILE A HA     1 
ATOM 4775  H HB     . ILE A 1 308 ? 16.611  -39.915 -10.232 1.00 81.78  ?  312 ILE A HB     1 
ATOM 4776  H HG12   . ILE A 1 308 ? 14.427  -40.538 -9.706  1.00 81.52  ?  312 ILE A HG12   1 
ATOM 4777  H HG13   . ILE A 1 308 ? 15.421  -41.077 -8.594  1.00 81.52  ?  312 ILE A HG13   1 
ATOM 4778  H HG21   . ILE A 1 308 ? 17.485  -39.836 -8.061  1.00 85.32  ?  312 ILE A HG21   1 
ATOM 4779  H HG22   . ILE A 1 308 ? 17.854  -38.511 -8.854  1.00 85.32  ?  312 ILE A HG22   1 
ATOM 4780  H HG23   . ILE A 1 308 ? 16.676  -38.496 -7.789  1.00 85.32  ?  312 ILE A HG23   1 
ATOM 4781  H HD11   . ILE A 1 308 ? 13.502  -40.243 -7.607  1.00 85.64  ?  312 ILE A HD11   1 
ATOM 4782  H HD12   . ILE A 1 308 ? 14.752  -39.367 -7.168  1.00 85.64  ?  312 ILE A HD12   1 
ATOM 4783  H HD13   . ILE A 1 308 ? 13.757  -38.828 -8.283  1.00 85.64  ?  312 ILE A HD13   1 
ATOM 4784  N N      . GLU A 1 309 ? 17.264  -37.577 -11.864 1.00 76.17  ?  313 GLU A N      1 
ATOM 4785  C CA     . GLU A 1 309 ? 18.314  -36.726 -12.411 1.00 83.66  ?  313 GLU A CA     1 
ATOM 4786  C C      . GLU A 1 309 ? 17.770  -35.364 -12.813 1.00 80.45  ?  313 GLU A C      1 
ATOM 4787  O O      . GLU A 1 309 ? 18.479  -34.357 -12.704 1.00 80.26  ?  313 GLU A O      1 
ATOM 4788  C CB     . GLU A 1 309 ? 18.977  -37.408 -13.605 1.00 96.24  ?  313 GLU A CB     1 
ATOM 4789  C CG     . GLU A 1 309 ? 20.150  -36.634 -14.176 1.00 89.67  ?  313 GLU A CG     1 
ATOM 4790  C CD     . GLU A 1 309 ? 20.920  -37.427 -15.211 1.00 108.12 ?  313 GLU A CD     1 
ATOM 4791  O OE1    . GLU A 1 309 ? 20.388  -38.448 -15.695 1.00 108.29 ?  313 GLU A OE1    1 
ATOM 4792  O OE2    . GLU A 1 309 ? 22.059  -37.032 -15.536 1.00 106.13 -1 313 GLU A OE2    1 
ATOM 4793  H HA     . GLU A 1 309 ? 18.992  -36.588 -11.731 1.00 100.39 ?  313 GLU A HA     1 
ATOM 4794  H HB2    . GLU A 1 309 ? 19.302  -38.279 -13.327 1.00 115.49 ?  313 GLU A HB2    1 
ATOM 4795  H HB3    . GLU A 1 309 ? 18.319  -37.513 -14.310 1.00 115.49 ?  313 GLU A HB3    1 
ATOM 4796  H HG2    . GLU A 1 309 ? 19.820  -35.827 -14.600 1.00 107.60 ?  313 GLU A HG2    1 
ATOM 4797  H HG3    . GLU A 1 309 ? 20.759  -36.407 -13.457 1.00 107.60 ?  313 GLU A HG3    1 
ATOM 4798  N N      . LEU A 1 310 ? 16.520  -35.308 -13.277 1.00 76.58  ?  314 LEU A N      1 
ATOM 4799  C CA     . LEU A 1 310 ? 15.916  -34.022 -13.602 1.00 71.81  ?  314 LEU A CA     1 
ATOM 4800  C C      . LEU A 1 310 ? 15.807  -33.136 -12.369 1.00 68.98  ?  314 LEU A C      1 
ATOM 4801  O O      . LEU A 1 310 ? 15.939  -31.912 -12.472 1.00 76.65  ?  314 LEU A O      1 
ATOM 4802  C CB     . LEU A 1 310 ? 14.540  -34.233 -14.234 1.00 75.42  ?  314 LEU A CB     1 
ATOM 4803  C CG     . LEU A 1 310 ? 13.751  -32.977 -14.612 1.00 51.72  ?  314 LEU A CG     1 
ATOM 4804  C CD1    . LEU A 1 310 ? 14.481  -32.167 -15.668 1.00 72.11  ?  314 LEU A CD1    1 
ATOM 4805  C CD2    . LEU A 1 310 ? 12.365  -33.351 -15.101 1.00 34.60  ?  314 LEU A CD2    1 
ATOM 4806  H H      . LEU A 1 310 ? 16.012  -35.989 -13.410 1.00 91.90  ?  314 LEU A H      1 
ATOM 4807  H HA     . LEU A 1 310 ? 16.476  -33.565 -14.249 1.00 86.17  ?  314 LEU A HA     1 
ATOM 4808  H HB2    . LEU A 1 310 ? 14.656  -34.753 -15.045 1.00 90.51  ?  314 LEU A HB2    1 
ATOM 4809  H HB3    . LEU A 1 310 ? 13.994  -34.736 -13.609 1.00 90.51  ?  314 LEU A HB3    1 
ATOM 4810  H HG     . LEU A 1 310 ? 13.650  -32.419 -13.825 1.00 62.07  ?  314 LEU A HG     1 
ATOM 4811  H HD11   . LEU A 1 310 ? 13.955  -31.381 -15.883 1.00 86.53  ?  314 LEU A HD11   1 
ATOM 4812  H HD12   . LEU A 1 310 ? 15.346  -31.901 -15.319 1.00 86.53  ?  314 LEU A HD12   1 
ATOM 4813  H HD13   . LEU A 1 310 ? 14.598  -32.714 -16.460 1.00 86.53  ?  314 LEU A HD13   1 
ATOM 4814  H HD21   . LEU A 1 310 ? 11.883  -32.542 -15.334 1.00 41.52  ?  314 LEU A HD21   1 
ATOM 4815  H HD22   . LEU A 1 310 ? 12.449  -33.924 -15.879 1.00 41.52  ?  314 LEU A HD22   1 
ATOM 4816  H HD23   . LEU A 1 310 ? 11.898  -33.822 -14.393 1.00 41.52  ?  314 LEU A HD23   1 
ATOM 4817  N N      . LEU A 1 311 ? 15.572  -33.729 -11.197 1.00 58.01  ?  315 LEU A N      1 
ATOM 4818  C CA     . LEU A 1 311 ? 15.498  -32.949 -9.969  1.00 52.99  ?  315 LEU A CA     1 
ATOM 4819  C C      . LEU A 1 311 ? 16.867  -32.507 -9.475  1.00 54.27  ?  315 LEU A C      1 
ATOM 4820  O O      . LEU A 1 311 ? 16.947  -31.575 -8.669  1.00 66.52  ?  315 LEU A O      1 
ATOM 4821  C CB     . LEU A 1 311 ? 14.795  -33.747 -8.871  1.00 56.06  ?  315 LEU A CB     1 
ATOM 4822  C CG     . LEU A 1 311 ? 13.346  -34.174 -9.120  1.00 48.67  ?  315 LEU A CG     1 
ATOM 4823  C CD1    . LEU A 1 311 ? 12.736  -34.688 -7.828  1.00 76.51  ?  315 LEU A CD1    1 
ATOM 4824  C CD2    . LEU A 1 311 ? 12.502  -33.050 -9.694  1.00 36.10  ?  315 LEU A CD2    1 
ATOM 4825  H H      . LEU A 1 311 ? 15.454  -34.574 -11.089 1.00 69.61  ?  315 LEU A H      1 
ATOM 4826  H HA     . LEU A 1 311 ? 14.972  -32.151 -10.138 1.00 63.59  ?  315 LEU A HA     1 
ATOM 4827  H HB2    . LEU A 1 311 ? 15.307  -34.557 -8.716  1.00 67.27  ?  315 LEU A HB2    1 
ATOM 4828  H HB3    . LEU A 1 311 ? 14.798  -33.211 -8.062  1.00 67.27  ?  315 LEU A HB3    1 
ATOM 4829  H HG     . LEU A 1 311 ? 13.342  -34.903 -9.760  1.00 58.41  ?  315 LEU A HG     1 
ATOM 4830  H HD11   . LEU A 1 311 ? 11.819  -34.955 -7.997  1.00 91.81  ?  315 LEU A HD11   1 
ATOM 4831  H HD12   . LEU A 1 311 ? 13.251  -35.449 -7.518  1.00 91.81  ?  315 LEU A HD12   1 
ATOM 4832  H HD13   . LEU A 1 311 ? 12.759  -33.980 -7.166  1.00 91.81  ?  315 LEU A HD13   1 
ATOM 4833  H HD21   . LEU A 1 311 ? 11.598  -33.373 -9.832  1.00 43.32  ?  315 LEU A HD21   1 
ATOM 4834  H HD22   . LEU A 1 311 ? 12.496  -32.308 -9.069  1.00 43.32  ?  315 LEU A HD22   1 
ATOM 4835  H HD23   . LEU A 1 311 ? 12.885  -32.767 -10.540 1.00 43.32  ?  315 LEU A HD23   1 
ATOM 4836  N N      . GLU A 1 312 ? 17.941  -33.154 -9.927  1.00 62.70  ?  316 GLU A N      1 
ATOM 4837  C CA     . GLU A 1 312 ? 19.276  -32.667 -9.603  1.00 65.80  ?  316 GLU A CA     1 
ATOM 4838  C C      . GLU A 1 312 ? 19.631  -31.440 -10.429 1.00 78.15  ?  316 GLU A C      1 
ATOM 4839  O O      . GLU A 1 312 ? 20.410  -30.595 -9.976  1.00 86.94  ?  316 GLU A O      1 
ATOM 4840  C CB     . GLU A 1 312 ? 20.313  -33.766 -9.825  1.00 74.04  ?  316 GLU A CB     1 
ATOM 4841  C CG     . GLU A 1 312 ? 19.977  -35.080 -9.142  1.00 92.37  ?  316 GLU A CG     1 
ATOM 4842  C CD     . GLU A 1 312 ? 21.181  -35.991 -9.004  1.00 102.52 ?  316 GLU A CD     1 
ATOM 4843  O OE1    . GLU A 1 312 ? 22.299  -35.476 -8.792  1.00 110.38 ?  316 GLU A OE1    1 
ATOM 4844  O OE2    . GLU A 1 312 ? 21.010  -37.224 -9.110  1.00 79.50  -1 316 GLU A OE2    1 
ATOM 4845  H H      . GLU A 1 312 ? 17.924  -33.864 -10.412 1.00 75.24  ?  316 GLU A H      1 
ATOM 4846  H HA     . GLU A 1 312 ? 19.301  -32.415 -8.667  1.00 78.96  ?  316 GLU A HA     1 
ATOM 4847  H HB2    . GLU A 1 312 ? 20.387  -33.938 -10.777 1.00 88.85  ?  316 GLU A HB2    1 
ATOM 4848  H HB3    . GLU A 1 312 ? 21.167  -33.463 -9.479  1.00 88.85  ?  316 GLU A HB3    1 
ATOM 4849  H HG2    . GLU A 1 312 ? 19.636  -34.897 -8.253  1.00 110.84 ?  316 GLU A HG2    1 
ATOM 4850  H HG3    . GLU A 1 312 ? 19.307  -35.546 -9.666  1.00 110.84 ?  316 GLU A HG3    1 
ATOM 4851  N N      . LYS A 1 313 ? 19.075  -31.330 -11.635 1.00 77.82  ?  317 LYS A N      1 
ATOM 4852  C CA     . LYS A 1 313 ? 19.228  -30.127 -12.440 1.00 69.76  ?  317 LYS A CA     1 
ATOM 4853  C C      . LYS A 1 313 ? 18.496  -28.976 -11.764 1.00 59.06  ?  317 LYS A C      1 
ATOM 4854  O O      . LYS A 1 313 ? 19.124  -28.034 -11.271 1.00 63.40  ?  317 LYS A O      1 
ATOM 4855  C CB     . LYS A 1 313 ? 18.690  -30.354 -13.855 1.00 72.46  ?  317 LYS A CB     1 
ATOM 4856  C CG     . LYS A 1 313 ? 19.240  -31.595 -14.548 1.00 79.17  ?  317 LYS A CG     1 
ATOM 4857  C CD     . LYS A 1 313 ? 20.757  -31.620 -14.548 1.00 69.16  ?  317 LYS A CD     1 
ATOM 4858  C CE     . LYS A 1 313 ? 21.293  -32.744 -15.417 1.00 77.42  ?  317 LYS A CE     1 
ATOM 4859  N NZ     . LYS A 1 313 ? 22.781  -32.769 -15.442 1.00 53.39  1  317 LYS A NZ     1 
ATOM 4860  H H      . LYS A 1 313 ? 18.602  -31.943 -12.008 1.00 93.39  ?  317 LYS A H      1 
ATOM 4861  H HA     . LYS A 1 313 ? 20.168  -29.898 -12.503 1.00 83.71  ?  317 LYS A HA     1 
ATOM 4862  H HB2    . LYS A 1 313 ? 17.726  -30.446 -13.809 1.00 86.96  ?  317 LYS A HB2    1 
ATOM 4863  H HB3    . LYS A 1 313 ? 18.920  -29.586 -14.401 1.00 86.96  ?  317 LYS A HB3    1 
ATOM 4864  H HG2    . LYS A 1 313 ? 18.925  -32.386 -14.082 1.00 95.01  ?  317 LYS A HG2    1 
ATOM 4865  H HG3    . LYS A 1 313 ? 18.937  -31.606 -15.469 1.00 95.01  ?  317 LYS A HG3    1 
ATOM 4866  H HD2    . LYS A 1 313 ? 21.091  -30.779 -14.898 1.00 82.99  ?  317 LYS A HD2    1 
ATOM 4867  H HD3    . LYS A 1 313 ? 21.076  -31.757 -13.642 1.00 82.99  ?  317 LYS A HD3    1 
ATOM 4868  H HE2    . LYS A 1 313 ? 20.983  -33.593 -15.066 1.00 92.90  ?  317 LYS A HE2    1 
ATOM 4869  H HE3    . LYS A 1 313 ? 20.978  -32.622 -16.326 1.00 92.90  ?  317 LYS A HE3    1 
ATOM 4870  H HZ1    . LYS A 1 313 ? 23.065  -33.436 -15.958 1.00 64.06  ?  317 LYS A HZ1    1 
ATOM 4871  H HZ2    . LYS A 1 313 ? 23.092  -32.001 -15.766 1.00 64.06  ?  317 LYS A HZ2    1 
ATOM 4872  H HZ3    . LYS A 1 313 ? 23.097  -32.885 -14.618 1.00 64.06  ?  317 LYS A HZ3    1 
ATOM 4873  N N      . LEU A 1 314 ? 17.166  -29.049 -11.733 1.00 55.71  ?  318 LEU A N      1 
ATOM 4874  C CA     . LEU A 1 314 ? 16.368  -28.095 -10.977 1.00 57.09  ?  318 LEU A CA     1 
ATOM 4875  C C      . LEU A 1 314 ? 16.681  -28.236 -9.493  1.00 66.13  ?  318 LEU A C      1 
ATOM 4876  O O      . LEU A 1 314 ? 15.972  -28.948 -8.776  1.00 80.14  ?  318 LEU A O      1 
ATOM 4877  C CB     . LEU A 1 314 ? 14.872  -28.317 -11.218 1.00 47.18  ?  318 LEU A CB     1 
ATOM 4878  C CG     . LEU A 1 314 ? 14.392  -28.627 -12.637 1.00 54.58  ?  318 LEU A CG     1 
ATOM 4879  C CD1    . LEU A 1 314 ? 12.897  -28.890 -12.625 1.00 48.65  ?  318 LEU A CD1    1 
ATOM 4880  C CD2    . LEU A 1 314 ? 14.727  -27.502 -13.590 1.00 78.53  ?  318 LEU A CD2    1 
ATOM 4881  H H      . LEU A 1 314 ? 16.703  -29.646 -12.144 1.00 66.86  ?  318 LEU A H      1 
ATOM 4882  H HA     . LEU A 1 314 ? 16.594  -27.193 -11.254 1.00 68.51  ?  318 LEU A HA     1 
ATOM 4883  H HB2    . LEU A 1 314 ? 14.590  -29.058 -10.660 1.00 56.61  ?  318 LEU A HB2    1 
ATOM 4884  H HB3    . LEU A 1 314 ? 14.405  -27.515 -10.935 1.00 56.61  ?  318 LEU A HB3    1 
ATOM 4885  H HG     . LEU A 1 314 ? 14.836  -29.429 -12.952 1.00 65.49  ?  318 LEU A HG     1 
ATOM 4886  H HD11   . LEU A 1 314 ? 12.604  -29.085 -13.529 1.00 58.38  ?  318 LEU A HD11   1 
ATOM 4887  H HD12   . LEU A 1 314 ? 12.715  -29.648 -12.047 1.00 58.38  ?  318 LEU A HD12   1 
ATOM 4888  H HD13   . LEU A 1 314 ? 12.440  -28.102 -12.292 1.00 58.38  ?  318 LEU A HD13   1 
ATOM 4889  H HD21   . LEU A 1 314 ? 14.408  -27.734 -14.476 1.00 94.24  ?  318 LEU A HD21   1 
ATOM 4890  H HD22   . LEU A 1 314 ? 14.293  -26.690 -13.284 1.00 94.24  ?  318 LEU A HD22   1 
ATOM 4891  H HD23   . LEU A 1 314 ? 15.689  -27.378 -13.606 1.00 94.24  ?  318 LEU A HD23   1 
ATOM 4892  N N      . ASP A 1 315 ? 17.741  -27.575 -9.028  1.00 80.08  ?  319 ASP A N      1 
ATOM 4893  C CA     . ASP A 1 315 ? 18.138  -27.656 -7.629  1.00 81.71  ?  319 ASP A CA     1 
ATOM 4894  C C      . ASP A 1 315 ? 16.921  -27.518 -6.726  1.00 74.11  ?  319 ASP A C      1 
ATOM 4895  O O      . ASP A 1 315 ? 16.109  -26.609 -6.900  1.00 77.57  ?  319 ASP A O      1 
ATOM 4896  C CB     . ASP A 1 315 ? 19.156  -26.560 -7.312  1.00 89.47  ?  319 ASP A CB     1 
ATOM 4897  C CG     . ASP A 1 315 ? 19.579  -26.564 -5.862  1.00 89.98  ?  319 ASP A CG     1 
ATOM 4898  O OD1    . ASP A 1 315 ? 20.152  -25.555 -5.408  1.00 87.26  ?  319 ASP A OD1    1 
ATOM 4899  O OD2    . ASP A 1 315 ? 19.334  -27.577 -5.175  1.00 96.95  -1 319 ASP A OD2    1 
ATOM 4900  H H      . ASP A 1 315 ? 18.247  -27.072 -9.507  1.00 96.09  ?  319 ASP A H      1 
ATOM 4901  H HA     . ASP A 1 315 ? 18.551  -28.517 -7.459  1.00 98.05  ?  319 ASP A HA     1 
ATOM 4902  H HB2    . ASP A 1 315 ? 19.947  -26.695 -7.857  1.00 107.36 ?  319 ASP A HB2    1 
ATOM 4903  H HB3    . ASP A 1 315 ? 18.761  -25.695 -7.508  1.00 107.36 ?  319 ASP A HB3    1 
ATOM 4904  N N      . VAL A 1 316 ? 16.798  -28.424 -5.759  1.00 77.57  ?  320 VAL A N      1 
ATOM 4905  C CA     . VAL A 1 316 ? 15.584  -28.499 -4.957  1.00 69.46  ?  320 VAL A CA     1 
ATOM 4906  C C      . VAL A 1 316 ? 15.868  -27.951 -3.570  1.00 65.69  ?  320 VAL A C      1 
ATOM 4907  O O      . VAL A 1 316 ? 14.962  -27.464 -2.885  1.00 58.55  ?  320 VAL A O      1 
ATOM 4908  C CB     . VAL A 1 316 ? 15.050  -29.939 -4.876  1.00 59.24  ?  320 VAL A CB     1 
ATOM 4909  C CG1    . VAL A 1 316 ? 13.666  -29.947 -4.266  1.00 60.39  ?  320 VAL A CG1    1 
ATOM 4910  C CG2    . VAL A 1 316 ? 15.020  -30.573 -6.252  1.00 51.49  ?  320 VAL A CG2    1 
ATOM 4911  H H      . VAL A 1 316 ? 17.400  -29.002 -5.550  1.00 93.09  ?  320 VAL A H      1 
ATOM 4912  H HA     . VAL A 1 316 ? 14.899  -27.947 -5.365  1.00 83.35  ?  320 VAL A HA     1 
ATOM 4913  H HB     . VAL A 1 316 ? 15.636  -30.467 -4.310  1.00 71.09  ?  320 VAL A HB     1 
ATOM 4914  H HG11   . VAL A 1 316 ? 13.346  -30.862 -4.223  1.00 72.46  ?  320 VAL A HG11   1 
ATOM 4915  H HG12   . VAL A 1 316 ? 13.712  -29.570 -3.373  1.00 72.46  ?  320 VAL A HG12   1 
ATOM 4916  H HG13   . VAL A 1 316 ? 13.074  -29.415 -4.820  1.00 72.46  ?  320 VAL A HG13   1 
ATOM 4917  H HG21   . VAL A 1 316 ? 14.680  -31.478 -6.174  1.00 61.79  ?  320 VAL A HG21   1 
ATOM 4918  H HG22   . VAL A 1 316 ? 14.440  -30.050 -6.827  1.00 61.79  ?  320 VAL A HG22   1 
ATOM 4919  H HG23   . VAL A 1 316 ? 15.920  -30.586 -6.613  1.00 61.79  ?  320 VAL A HG23   1 
ATOM 4920  N N      . SER A 1 317 ? 17.130  -28.022 -3.143  1.00 63.27  ?  321 SER A N      1 
ATOM 4921  C CA     . SER A 1 317 ? 17.469  -27.532 -1.814  1.00 70.86  ?  321 SER A CA     1 
ATOM 4922  C C      . SER A 1 317 ? 17.432  -26.010 -1.749  1.00 81.28  ?  321 SER A C      1 
ATOM 4923  O O      . SER A 1 317 ? 17.176  -25.443 -0.680  1.00 65.37  ?  321 SER A O      1 
ATOM 4924  C CB     . SER A 1 317 ? 18.848  -28.038 -1.390  1.00 49.60  ?  321 SER A CB     1 
ATOM 4925  O OG     . SER A 1 317 ? 19.147  -27.596 -0.077  1.00 60.85  ?  321 SER A OG     1 
ATOM 4926  H H      . SER A 1 317 ? 17.790  -28.342 -3.592  1.00 75.92  ?  321 SER A H      1 
ATOM 4927  H HA     . SER A 1 317 ? 16.819  -27.872 -1.179  1.00 85.03  ?  321 SER A HA     1 
ATOM 4928  H HB2    . SER A 1 317 ? 18.850  -29.008 -1.408  1.00 59.52  ?  321 SER A HB2    1 
ATOM 4929  H HB3    . SER A 1 317 ? 19.516  -27.692 -2.003  1.00 59.52  ?  321 SER A HB3    1 
ATOM 4930  H HG     . SER A 1 317 ? 19.905  -27.875 0.154   1.00 73.02  ?  321 SER A HG     1 
ATOM 4931  N N      . ARG A 1 318 ? 17.675  -25.332 -2.873  1.00 83.86  ?  322 ARG A N      1 
ATOM 4932  C CA     . ARG A 1 318 ? 17.777  -23.878 -2.897  1.00 74.16  ?  322 ARG A CA     1 
ATOM 4933  C C      . ARG A 1 318 ? 16.768  -23.226 -3.833  1.00 74.00  ?  322 ARG A C      1 
ATOM 4934  O O      . ARG A 1 318 ? 16.900  -22.032 -4.130  1.00 84.35  ?  322 ARG A O      1 
ATOM 4935  C CB     . ARG A 1 318 ? 19.193  -23.455 -3.299  1.00 81.89  ?  322 ARG A CB     1 
ATOM 4936  C CG     . ARG A 1 318 ? 20.296  -24.042 -2.432  1.00 73.96  ?  322 ARG A CG     1 
ATOM 4937  C CD     . ARG A 1 318 ? 21.661  -23.826 -3.062  1.00 79.91  ?  322 ARG A CD     1 
ATOM 4938  N NE     . ARG A 1 318 ? 22.102  -24.990 -3.825  1.00 93.89  ?  322 ARG A NE     1 
ATOM 4939  C CZ     . ARG A 1 318 ? 22.816  -25.994 -3.323  1.00 95.79  ?  322 ARG A CZ     1 
ATOM 4940  N NH1    . ARG A 1 318 ? 23.181  -25.991 -2.048  1.00 109.98 1  322 ARG A NH1    1 
ATOM 4941  N NH2    . ARG A 1 318 ? 23.168  -27.008 -4.099  1.00 78.60  ?  322 ARG A NH2    1 
ATOM 4942  H H      . ARG A 1 318 ? 17.784  -25.700 -3.642  1.00 100.64 ?  322 ARG A H      1 
ATOM 4943  H HA     . ARG A 1 318 ? 17.611  -23.540 -2.003  1.00 89.00  ?  322 ARG A HA     1 
ATOM 4944  H HB2    . ARG A 1 318 ? 19.354  -23.739 -4.213  1.00 98.27  ?  322 ARG A HB2    1 
ATOM 4945  H HB3    . ARG A 1 318 ? 19.256  -22.488 -3.242  1.00 98.27  ?  322 ARG A HB3    1 
ATOM 4946  H HG2    . ARG A 1 318 ? 20.288  -23.608 -1.564  1.00 88.75  ?  322 ARG A HG2    1 
ATOM 4947  H HG3    . ARG A 1 318 ? 20.153  -24.997 -2.333  1.00 88.75  ?  322 ARG A HG3    1 
ATOM 4948  H HD2    . ARG A 1 318 ? 21.617  -23.068 -3.665  1.00 95.90  ?  322 ARG A HD2    1 
ATOM 4949  H HD3    . ARG A 1 318 ? 22.312  -23.659 -2.362  1.00 95.90  ?  322 ARG A HD3    1 
ATOM 4950  H HE     . ARG A 1 318 ? 21.886  -25.029 -4.657  1.00 112.67 ?  322 ARG A HE     1 
ATOM 4951  H HH11   . ARG A 1 318 ? 22.956  -25.336 -1.538  1.00 131.97 ?  322 ARG A HH11   1 
ATOM 4952  H HH12   . ARG A 1 318 ? 23.643  -26.643 -1.731  1.00 131.97 ?  322 ARG A HH12   1 
ATOM 4953  H HH21   . ARG A 1 318 ? 22.935  -27.017 -4.927  1.00 94.32  ?  322 ARG A HH21   1 
ATOM 4954  H HH22   . ARG A 1 318 ? 23.630  -27.657 -3.776  1.00 94.32  ?  322 ARG A HH22   1 
ATOM 4955  N N      . SER A 1 319 ? 15.770  -23.962 -4.304  1.00 66.24  ?  323 SER A N      1 
ATOM 4956  C CA     . SER A 1 319 ? 14.761  -23.418 -5.199  1.00 69.03  ?  323 SER A CA     1 
ATOM 4957  C C      . SER A 1 319 ? 13.413  -23.359 -4.495  1.00 73.64  ?  323 SER A C      1 
ATOM 4958  O O      . SER A 1 319 ? 13.229  -23.893 -3.398  1.00 79.10  ?  323 SER A O      1 
ATOM 4959  C CB     . SER A 1 319 ? 14.653  -24.254 -6.477  1.00 80.22  ?  323 SER A CB     1 
ATOM 4960  O OG     . SER A 1 319 ? 13.702  -23.699 -7.367  1.00 75.34  ?  323 SER A OG     1 
ATOM 4961  H H      . SER A 1 319 ? 15.654  -24.793 -4.116  1.00 79.49  ?  323 SER A H      1 
ATOM 4962  H HA     . SER A 1 319 ? 15.011  -22.515 -5.449  1.00 82.84  ?  323 SER A HA     1 
ATOM 4963  H HB2    . SER A 1 319 ? 15.519  -24.276 -6.913  1.00 96.27  ?  323 SER A HB2    1 
ATOM 4964  H HB3    . SER A 1 319 ? 14.378  -25.155 -6.242  1.00 96.27  ?  323 SER A HB3    1 
ATOM 4965  H HG     . SER A 1 319 ? 13.653  -24.167 -8.063  1.00 90.41  ?  323 SER A HG     1 
ATOM 4966  N N      . SER A 1 320 ? 12.461  -22.703 -5.156  1.00 70.48  ?  324 SER A N      1 
ATOM 4967  C CA     . SER A 1 320 ? 11.149  -22.462 -4.578  1.00 82.48  ?  324 SER A CA     1 
ATOM 4968  C C      . SER A 1 320 ? 9.992   -22.819 -5.498  1.00 81.37  ?  324 SER A C      1 
ATOM 4969  O O      . SER A 1 320 ? 8.847   -22.830 -5.033  1.00 88.83  ?  324 SER A O      1 
ATOM 4970  C CB     . SER A 1 320 ? 11.011  -20.987 -4.169  1.00 93.05  ?  324 SER A CB     1 
ATOM 4971  O OG     . SER A 1 320 ? 12.116  -20.568 -3.388  1.00 91.65  ?  324 SER A OG     1 
ATOM 4972  H H      . SER A 1 320 ? 12.555  -22.385 -5.949  1.00 84.58  ?  324 SER A H      1 
ATOM 4973  H HA     . SER A 1 320 ? 11.062  -23.000 -3.775  1.00 98.98  ?  324 SER A HA     1 
ATOM 4974  H HB2    . SER A 1 320 ? 10.967  -20.442 -4.970  1.00 111.66 ?  324 SER A HB2    1 
ATOM 4975  H HB3    . SER A 1 320 ? 10.199  -20.879 -3.650  1.00 111.66 ?  324 SER A HB3    1 
ATOM 4976  H HG     . SER A 1 320 ? 12.027  -19.761 -3.172  1.00 109.98 ?  324 SER A HG     1 
ATOM 4977  N N      . VAL A 1 321 ? 10.243  -23.110 -6.774  1.00 84.05  ?  325 VAL A N      1 
ATOM 4978  C CA     . VAL A 1 321 ? 9.181   -23.406 -7.728  1.00 89.44  ?  325 VAL A CA     1 
ATOM 4979  C C      . VAL A 1 321 ? 9.160   -24.862 -8.145  1.00 90.50  ?  325 VAL A C      1 
ATOM 4980  O O      . VAL A 1 321 ? 8.357   -25.232 -9.015  1.00 80.18  ?  325 VAL A O      1 
ATOM 4981  C CB     . VAL A 1 321 ? 9.279   -22.505 -8.972  1.00 88.97  ?  325 VAL A CB     1 
ATOM 4982  C CG1    . VAL A 1 321 ? 9.159   -21.049 -8.577  1.00 95.69  ?  325 VAL A CG1    1 
ATOM 4983  C CG2    . VAL A 1 321 ? 10.582  -22.755 -9.720  1.00 78.95  ?  325 VAL A CG2    1 
ATOM 4984  H H      . VAL A 1 321 ? 11.032  -23.142 -7.114  1.00 100.86 ?  325 VAL A H      1 
ATOM 4985  H HA     . VAL A 1 321 ? 8.330   -23.216 -7.302  1.00 107.33 ?  325 VAL A HA     1 
ATOM 4986  H HB     . VAL A 1 321 ? 8.546   -22.714 -9.571  1.00 106.76 ?  325 VAL A HB     1 
ATOM 4987  H HG11   . VAL A 1 321 ? 9.224   -20.500 -9.374  1.00 114.82 ?  325 VAL A HG11   1 
ATOM 4988  H HG12   . VAL A 1 321 ? 8.302   -20.909 -8.147  1.00 114.82 ?  325 VAL A HG12   1 
ATOM 4989  H HG13   . VAL A 1 321 ? 9.878   -20.829 -7.964  1.00 114.82 ?  325 VAL A HG13   1 
ATOM 4990  H HG21   . VAL A 1 321 ? 10.616  -22.175 -10.497 1.00 94.74  ?  325 VAL A HG21   1 
ATOM 4991  H HG22   . VAL A 1 321 ? 11.327  -22.561 -9.129  1.00 94.74  ?  325 VAL A HG22   1 
ATOM 4992  H HG23   . VAL A 1 321 ? 10.613  -23.683 -9.998  1.00 94.74  ?  325 VAL A HG23   1 
ATOM 4993  N N      . CYS A 1 322 ? 10.015  -25.706 -7.565  1.00 89.81  ?  326 CYS A N      1 
ATOM 4994  C CA     . CYS A 1 322 ? 9.964   -27.126 -7.889  1.00 64.79  ?  326 CYS A CA     1 
ATOM 4995  C C      . CYS A 1 322 ? 8.569   -27.686 -7.670  1.00 63.44  ?  326 CYS A C      1 
ATOM 4996  O O      . CYS A 1 322 ? 8.150   -28.606 -8.380  1.00 78.85  ?  326 CYS A O      1 
ATOM 4997  C CB     . CYS A 1 322 ? 10.983  -27.891 -7.053  1.00 60.43  ?  326 CYS A CB     1 
ATOM 4998  S SG     . CYS A 1 322 ? 12.636  -27.201 -7.176  1.00 73.91  ?  326 CYS A SG     1 
ATOM 4999  H H      . CYS A 1 322 ? 10.619  -25.486 -6.994  1.00 107.78 ?  326 CYS A H      1 
ATOM 5000  H HA     . CYS A 1 322 ? 10.192  -27.245 -8.825  1.00 77.74  ?  326 CYS A HA     1 
ATOM 5001  H HB2    . CYS A 1 322 ? 10.714  -27.862 -6.122  1.00 72.51  ?  326 CYS A HB2    1 
ATOM 5002  H HB3    . CYS A 1 322 ? 11.018  -28.810 -7.360  1.00 72.51  ?  326 CYS A HB3    1 
ATOM 5003  H HG     . CYS A 1 322 ? 13.381  -27.850 -6.496  1.00 88.69  ?  326 CYS A HG     1 
ATOM 5004  N N      . VAL A 1 323 ? 7.830   -27.133 -6.708  1.00 57.80  ?  327 VAL A N      1 
ATOM 5005  C CA     . VAL A 1 323 ? 6.454   -27.566 -6.498  1.00 62.99  ?  327 VAL A CA     1 
ATOM 5006  C C      . VAL A 1 323 ? 5.627   -27.282 -7.740  1.00 70.44  ?  327 VAL A C      1 
ATOM 5007  O O      . VAL A 1 323 ? 4.765   -28.078 -8.128  1.00 57.95  ?  327 VAL A O      1 
ATOM 5008  C CB     . VAL A 1 323 ? 5.852   -26.879 -5.259  1.00 65.79  ?  327 VAL A CB     1 
ATOM 5009  C CG1    . VAL A 1 323 ? 4.553   -27.560 -4.868  1.00 65.80  ?  327 VAL A CG1    1 
ATOM 5010  C CG2    . VAL A 1 323 ? 6.828   -26.892 -4.089  1.00 75.57  ?  327 VAL A CG2    1 
ATOM 5011  H H      . VAL A 1 323 ? 8.098   -26.516 -6.173  1.00 69.36  ?  327 VAL A H      1 
ATOM 5012  H HA     . VAL A 1 323 ? 6.444   -28.524 -6.343  1.00 75.58  ?  327 VAL A HA     1 
ATOM 5013  H HB     . VAL A 1 323 ? 5.654   -25.954 -5.474  1.00 78.95  ?  327 VAL A HB     1 
ATOM 5014  H HG11   . VAL A 1 323 ? 4.187   -27.116 -4.088  1.00 78.96  ?  327 VAL A HG11   1 
ATOM 5015  H HG12   . VAL A 1 323 ? 3.929   -27.497 -5.609  1.00 78.96  ?  327 VAL A HG12   1 
ATOM 5016  H HG13   . VAL A 1 323 ? 4.734   -28.491 -4.666  1.00 78.96  ?  327 VAL A HG13   1 
ATOM 5017  H HG21   . VAL A 1 323 ? 6.415   -26.452 -3.330  1.00 90.69  ?  327 VAL A HG21   1 
ATOM 5018  H HG22   . VAL A 1 323 ? 7.038   -27.811 -3.865  1.00 90.69  ?  327 VAL A HG22   1 
ATOM 5019  H HG23   . VAL A 1 323 ? 7.635   -26.420 -4.347  1.00 90.69  ?  327 VAL A HG23   1 
ATOM 5020  N N      . LYS A 1 324 ? 5.880   -26.146 -8.387  1.00 84.06  ?  328 LYS A N      1 
ATOM 5021  C CA     . LYS A 1 324 ? 5.122   -25.788 -9.578  1.00 75.08  ?  328 LYS A CA     1 
ATOM 5022  C C      . LYS A 1 324 ? 5.523   -26.651 -10.766 1.00 73.19  ?  328 LYS A C      1 
ATOM 5023  O O      . LYS A 1 324 ? 4.675   -27.025 -11.584 1.00 69.64  ?  328 LYS A O      1 
ATOM 5024  C CB     . LYS A 1 324 ? 5.329   -24.310 -9.899  1.00 73.74  ?  328 LYS A CB     1 
ATOM 5025  C CG     . LYS A 1 324 ? 4.900   -23.374 -8.784  1.00 85.67  ?  328 LYS A CG     1 
ATOM 5026  C CD     . LYS A 1 324 ? 5.429   -21.971 -9.013  1.00 81.41  ?  328 LYS A CD     1 
ATOM 5027  C CE     . LYS A 1 324 ? 4.717   -20.954 -8.140  1.00 97.39  ?  328 LYS A CE     1 
ATOM 5028  N NZ     . LYS A 1 324 ? 3.290   -20.791 -8.531  1.00 87.84  1  328 LYS A NZ     1 
ATOM 5029  H H      . LYS A 1 324 ? 6.479   -25.573 -8.159  1.00 100.87 ?  328 LYS A H      1 
ATOM 5030  H HA     . LYS A 1 324 ? 4.177   -25.930 -9.408  1.00 90.09  ?  328 LYS A HA     1 
ATOM 5031  H HB2    . LYS A 1 324 ? 6.272   -24.156 -10.068 1.00 88.49  ?  328 LYS A HB2    1 
ATOM 5032  H HB3    . LYS A 1 324 ? 4.812   -24.086 -10.688 1.00 88.49  ?  328 LYS A HB3    1 
ATOM 5033  H HG2    . LYS A 1 324 ? 3.931   -23.334 -8.753  1.00 102.80 ?  328 LYS A HG2    1 
ATOM 5034  H HG3    . LYS A 1 324 ? 5.251   -23.698 -7.940  1.00 102.80 ?  328 LYS A HG3    1 
ATOM 5035  H HD2    . LYS A 1 324 ? 6.374   -21.946 -8.799  1.00 97.69  ?  328 LYS A HD2    1 
ATOM 5036  H HD3    . LYS A 1 324 ? 5.289   -21.725 -9.941  1.00 97.69  ?  328 LYS A HD3    1 
ATOM 5037  H HE2    . LYS A 1 324 ? 4.745   -21.251 -7.216  1.00 116.87 ?  328 LYS A HE2    1 
ATOM 5038  H HE3    . LYS A 1 324 ? 5.156   -20.094 -8.229  1.00 116.87 ?  328 LYS A HE3    1 
ATOM 5039  H HZ1    . LYS A 1 324 ? 2.897   -20.191 -8.005  1.00 105.41 ?  328 LYS A HZ1    1 
ATOM 5040  H HZ2    . LYS A 1 324 ? 3.236   -20.515 -9.376  1.00 105.41 ?  328 LYS A HZ2    1 
ATOM 5041  H HZ3    . LYS A 1 324 ? 2.863   -21.568 -8.454  1.00 105.41 ?  328 LYS A HZ3    1 
ATOM 5042  N N      . ALA A 1 325 ? 6.811   -26.982 -10.874 1.00 74.35  ?  329 ALA A N      1 
ATOM 5043  C CA     . ALA A 1 325 ? 7.280   -27.756 -12.018 1.00 69.39  ?  329 ALA A CA     1 
ATOM 5044  C C      . ALA A 1 325 ? 6.814   -29.204 -11.937 1.00 70.52  ?  329 ALA A C      1 
ATOM 5045  O O      . ALA A 1 325 ? 6.437   -29.797 -12.953 1.00 65.35  ?  329 ALA A O      1 
ATOM 5046  C CB     . ALA A 1 325 ? 8.803   -27.692 -12.103 1.00 55.08  ?  329 ALA A CB     1 
ATOM 5047  H H      . ALA A 1 325 ? 7.423   -26.773 -10.308 1.00 89.21  ?  329 ALA A H      1 
ATOM 5048  H HA     . ALA A 1 325 ? 6.917   -27.370 -12.830 1.00 83.27  ?  329 ALA A HA     1 
ATOM 5049  H HB1    . ALA A 1 325 ? 9.099   -28.211 -12.867 1.00 66.09  ?  329 ALA A HB1    1 
ATOM 5050  H HB2    . ALA A 1 325 ? 9.074   -26.766 -12.207 1.00 66.09  ?  329 ALA A HB2    1 
ATOM 5051  H HB3    . ALA A 1 325 ? 9.181   -28.058 -11.288 1.00 66.09  ?  329 ALA A HB3    1 
ATOM 5052  N N      . ILE A 1 326 ? 6.830   -29.789 -10.738 1.00 73.20  ?  330 ILE A N      1 
ATOM 5053  C CA     . ILE A 1 326 ? 6.478   -31.198 -10.610 1.00 60.83  ?  330 ILE A CA     1 
ATOM 5054  C C      . ILE A 1 326 ? 4.997   -31.410 -10.887 1.00 60.90  ?  330 ILE A C      1 
ATOM 5055  O O      . ILE A 1 326 ? 4.606   -32.445 -11.438 1.00 75.84  ?  330 ILE A O      1 
ATOM 5056  C CB     . ILE A 1 326 ? 6.879   -31.723 -9.219  1.00 67.31  ?  330 ILE A CB     1 
ATOM 5057  C CG1    . ILE A 1 326 ? 6.781   -33.250 -9.173  1.00 69.22  ?  330 ILE A CG1    1 
ATOM 5058  C CG2    . ILE A 1 326 ? 6.020   -31.097 -8.130  1.00 80.89  ?  330 ILE A CG2    1 
ATOM 5059  C CD1    . ILE A 1 326 ? 7.887   -33.956 -9.930  1.00 70.07  ?  330 ILE A CD1    1 
ATOM 5060  H H      . ILE A 1 326 ? 7.037   -29.400 -10.000 1.00 87.84  ?  330 ILE A H      1 
ATOM 5061  H HA     . ILE A 1 326 ? 6.977   -31.704 -11.271 1.00 73.00  ?  330 ILE A HA     1 
ATOM 5062  H HB     . ILE A 1 326 ? 7.803   -31.474 -9.057  1.00 80.77  ?  330 ILE A HB     1 
ATOM 5063  H HG12   . ILE A 1 326 ? 6.825   -33.538 -8.248  1.00 83.07  ?  330 ILE A HG12   1 
ATOM 5064  H HG13   . ILE A 1 326 ? 5.935   -33.520 -9.562  1.00 83.07  ?  330 ILE A HG13   1 
ATOM 5065  H HG21   . ILE A 1 326 ? 6.297   -31.447 -7.269  1.00 97.06  ?  330 ILE A HG21   1 
ATOM 5066  H HG22   . ILE A 1 326 ? 6.138   -30.134 -8.149  1.00 97.06  ?  330 ILE A HG22   1 
ATOM 5067  H HG23   . ILE A 1 326 ? 5.090   -31.320 -8.295  1.00 97.06  ?  330 ILE A HG23   1 
ATOM 5068  H HD11   . ILE A 1 326 ? 7.758   -34.914 -9.856  1.00 84.09  ?  330 ILE A HD11   1 
ATOM 5069  H HD12   . ILE A 1 326 ? 7.851   -33.688 -10.862 1.00 84.09  ?  330 ILE A HD12   1 
ATOM 5070  H HD13   . ILE A 1 326 ? 8.742   -33.705 -9.546  1.00 84.09  ?  330 ILE A HD13   1 
ATOM 5071  N N      . GLU A 1 327 ? 4.149   -30.451 -10.514 1.00 65.23  ?  331 GLU A N      1 
ATOM 5072  C CA     . GLU A 1 327 ? 2.735   -30.551 -10.853 1.00 57.07  ?  331 GLU A CA     1 
ATOM 5073  C C      . GLU A 1 327 ? 2.556   -30.644 -12.361 1.00 64.26  ?  331 GLU A C      1 
ATOM 5074  O O      . GLU A 1 327 ? 2.030   -31.635 -12.880 1.00 78.87  ?  331 GLU A O      1 
ATOM 5075  C CB     . GLU A 1 327 ? 1.971   -29.351 -10.290 1.00 66.13  ?  331 GLU A CB     1 
ATOM 5076  C CG     . GLU A 1 327 ? 1.968   -29.272 -8.774  1.00 75.52  ?  331 GLU A CG     1 
ATOM 5077  C CD     . GLU A 1 327 ? 1.241   -30.431 -8.130  1.00 89.76  ?  331 GLU A CD     1 
ATOM 5078  O OE1    . GLU A 1 327 ? 0.177   -30.830 -8.647  1.00 92.23  ?  331 GLU A OE1    1 
ATOM 5079  O OE2    . GLU A 1 327 ? 1.738   -30.947 -7.107  1.00 82.91  -1 331 GLU A OE2    1 
ATOM 5080  H H      . GLU A 1 327 ? 4.365   -29.746 -10.072 1.00 78.27  ?  331 GLU A H      1 
ATOM 5081  H HA     . GLU A 1 327 ? 2.368   -31.356 -10.454 1.00 68.49  ?  331 GLU A HA     1 
ATOM 5082  H HB2    . GLU A 1 327 ? 2.377   -28.537 -10.627 1.00 79.36  ?  331 GLU A HB2    1 
ATOM 5083  H HB3    . GLU A 1 327 ? 1.048   -29.403 -10.585 1.00 79.36  ?  331 GLU A HB3    1 
ATOM 5084  H HG2    . GLU A 1 327 ? 2.884   -29.278 -8.455  1.00 90.62  ?  331 GLU A HG2    1 
ATOM 5085  H HG3    . GLU A 1 327 ? 1.527   -28.452 -8.501  1.00 90.62  ?  331 GLU A HG3    1 
ATOM 5086  N N      . ALA A 1 328 ? 3.019   -29.623 -13.086 1.00 63.66  ?  332 ALA A N      1 
ATOM 5087  C CA     . ALA A 1 328 ? 2.879   -29.607 -14.538 1.00 66.45  ?  332 ALA A CA     1 
ATOM 5088  C C      . ALA A 1 328 ? 3.384   -30.901 -15.160 1.00 65.24  ?  332 ALA A C      1 
ATOM 5089  O O      . ALA A 1 328 ? 2.820   -31.386 -16.147 1.00 73.31  ?  332 ALA A O      1 
ATOM 5090  C CB     . ALA A 1 328 ? 3.629   -28.409 -15.119 1.00 81.11  ?  332 ALA A CB     1 
ATOM 5091  H H      . ALA A 1 328 ? 3.415   -28.932 -12.760 1.00 76.39  ?  332 ALA A H      1 
ATOM 5092  H HA     . ALA A 1 328 ? 1.940   -29.512 -14.764 1.00 79.74  ?  332 ALA A HA     1 
ATOM 5093  H HB1    . ALA A 1 328 ? 3.528   -28.411 -16.083 1.00 97.33  ?  332 ALA A HB1    1 
ATOM 5094  H HB2    . ALA A 1 328 ? 3.256   -27.593 -14.748 1.00 97.33  ?  332 ALA A HB2    1 
ATOM 5095  H HB3    . ALA A 1 328 ? 4.568   -28.480 -14.884 1.00 97.33  ?  332 ALA A HB3    1 
ATOM 5096  N N      . LEU A 1 329 ? 4.445   -31.477 -14.595 1.00 69.76  ?  333 LEU A N      1 
ATOM 5097  C CA     . LEU A 1 329 ? 4.965   -32.735 -15.120 1.00 59.57  ?  333 LEU A CA     1 
ATOM 5098  C C      . LEU A 1 329 ? 3.937   -33.848 -14.966 1.00 48.69  ?  333 LEU A C      1 
ATOM 5099  O O      . LEU A 1 329 ? 3.617   -34.552 -15.930 1.00 66.58  ?  333 LEU A O      1 
ATOM 5100  C CB     . LEU A 1 329 ? 6.269   -33.099 -14.411 1.00 51.63  ?  333 LEU A CB     1 
ATOM 5101  C CG     . LEU A 1 329 ? 7.308   -33.828 -15.264 1.00 50.77  ?  333 LEU A CG     1 
ATOM 5102  C CD1    . LEU A 1 329 ? 8.572   -34.070 -14.462 1.00 36.13  ?  333 LEU A CD1    1 
ATOM 5103  C CD2    . LEU A 1 329 ? 6.761   -35.137 -15.803 1.00 76.83  ?  333 LEU A CD2    1 
ATOM 5104  H H      . LEU A 1 329 ? 4.875   -31.165 -13.918 1.00 83.71  ?  333 LEU A H      1 
ATOM 5105  H HA     . LEU A 1 329 ? 5.155   -32.630 -16.065 1.00 71.49  ?  333 LEU A HA     1 
ATOM 5106  H HB2    . LEU A 1 329 ? 6.680   -32.282 -14.088 1.00 61.95  ?  333 LEU A HB2    1 
ATOM 5107  H HB3    . LEU A 1 329 ? 6.058   -33.673 -13.658 1.00 61.95  ?  333 LEU A HB3    1 
ATOM 5108  H HG     . LEU A 1 329 ? 7.540   -33.268 -16.022 1.00 60.93  ?  333 LEU A HG     1 
ATOM 5109  H HD11   . LEU A 1 329 ? 9.216   -34.532 -15.021 1.00 43.36  ?  333 LEU A HD11   1 
ATOM 5110  H HD12   . LEU A 1 329 ? 8.932   -33.216 -14.177 1.00 43.36  ?  333 LEU A HD12   1 
ATOM 5111  H HD13   . LEU A 1 329 ? 8.354   -34.613 -13.688 1.00 43.36  ?  333 LEU A HD13   1 
ATOM 5112  H HD21   . LEU A 1 329 ? 7.446   -35.568 -16.337 1.00 92.20  ?  333 LEU A HD21   1 
ATOM 5113  H HD22   . LEU A 1 329 ? 6.515   -35.706 -15.057 1.00 92.20  ?  333 LEU A HD22   1 
ATOM 5114  H HD23   . LEU A 1 329 ? 5.982   -34.952 -16.350 1.00 92.20  ?  333 LEU A HD23   1 
ATOM 5115  N N      . PHE A 1 330 ? 3.405   -34.021 -13.754 1.00 44.08  ?  334 PHE A N      1 
ATOM 5116  C CA     . PHE A 1 330 ? 2.368   -35.023 -13.541 1.00 51.38  ?  334 PHE A CA     1 
ATOM 5117  C C      . PHE A 1 330 ? 1.173   -34.797 -14.455 1.00 68.83  ?  334 PHE A C      1 
ATOM 5118  O O      . PHE A 1 330 ? 0.536   -35.763 -14.889 1.00 80.04  ?  334 PHE A O      1 
ATOM 5119  C CB     . PHE A 1 330 ? 1.917   -35.014 -12.080 1.00 61.28  ?  334 PHE A CB     1 
ATOM 5120  C CG     . PHE A 1 330 ? 2.985   -35.433 -11.103 1.00 64.81  ?  334 PHE A CG     1 
ATOM 5121  C CD1    . PHE A 1 330 ? 3.995   -36.303 -11.477 1.00 73.22  ?  334 PHE A CD1    1 
ATOM 5122  C CD2    . PHE A 1 330 ? 2.970   -34.957 -9.803  1.00 54.85  ?  334 PHE A CD2    1 
ATOM 5123  C CE1    . PHE A 1 330 ? 4.968   -36.685 -10.576 1.00 60.32  ?  334 PHE A CE1    1 
ATOM 5124  C CE2    . PHE A 1 330 ? 3.940   -35.336 -8.899  1.00 63.31  ?  334 PHE A CE2    1 
ATOM 5125  C CZ     . PHE A 1 330 ? 4.940   -36.200 -9.287  1.00 59.96  ?  334 PHE A CZ     1 
ATOM 5126  H H      . PHE A 1 330 ? 3.625   -33.576 -13.052 1.00 52.90  ?  334 PHE A H      1 
ATOM 5127  H HA     . PHE A 1 330 ? 2.733   -35.900 -13.736 1.00 61.65  ?  334 PHE A HA     1 
ATOM 5128  H HB2    . PHE A 1 330 ? 1.638   -34.115 -11.845 1.00 73.53  ?  334 PHE A HB2    1 
ATOM 5129  H HB3    . PHE A 1 330 ? 1.170   -35.625 -11.981 1.00 73.53  ?  334 PHE A HB3    1 
ATOM 5130  H HD1    . PHE A 1 330 ? 4.019   -36.633 -12.347 1.00 87.86  ?  334 PHE A HD1    1 
ATOM 5131  H HD2    . PHE A 1 330 ? 2.298   -34.373 -9.536  1.00 65.82  ?  334 PHE A HD2    1 
ATOM 5132  H HE1    . PHE A 1 330 ? 5.643   -37.268 -10.839 1.00 72.38  ?  334 PHE A HE1    1 
ATOM 5133  H HE2    . PHE A 1 330 ? 3.920   -35.008 -8.030  1.00 75.97  ?  334 PHE A HE2    1 
ATOM 5134  H HZ     . PHE A 1 330 ? 5.596   -36.457 -8.678  1.00 71.96  ?  334 PHE A HZ     1 
ATOM 5135  N N      . GLN A 1 331 ? 0.847   -33.539 -14.758 1.00 52.29  ?  335 GLN A N      1 
ATOM 5136  C CA     . GLN A 1 331 ? -0.256  -33.275 -15.674 1.00 53.61  ?  335 GLN A CA     1 
ATOM 5137  C C      . GLN A 1 331 ? 0.107   -33.681 -17.095 1.00 59.74  ?  335 GLN A C      1 
ATOM 5138  O O      . GLN A 1 331 ? -0.746  -34.169 -17.846 1.00 62.74  ?  335 GLN A O      1 
ATOM 5139  C CB     . GLN A 1 331 ? -0.642  -31.797 -15.632 1.00 62.65  ?  335 GLN A CB     1 
ATOM 5140  C CG     . GLN A 1 331 ? -0.735  -31.205 -14.236 1.00 71.95  ?  335 GLN A CG     1 
ATOM 5141  C CD     . GLN A 1 331 ? -1.563  -29.935 -14.191 1.00 90.57  ?  335 GLN A CD     1 
ATOM 5142  O OE1    . GLN A 1 331 ? -2.508  -29.765 -14.961 1.00 98.97  ?  335 GLN A OE1    1 
ATOM 5143  N NE2    . GLN A 1 331 ? -1.204  -29.031 -13.290 1.00 71.91  ?  335 GLN A NE2    1 
ATOM 5144  H H      . GLN A 1 331 ? 1.241   -32.838 -14.454 1.00 62.75  ?  335 GLN A H      1 
ATOM 5145  H HA     . GLN A 1 331 ? -1.027  -33.795 -15.400 1.00 64.33  ?  335 GLN A HA     1 
ATOM 5146  H HB2    . GLN A 1 331 ? 0.024   -31.289 -16.122 1.00 75.18  ?  335 GLN A HB2    1 
ATOM 5147  H HB3    . GLN A 1 331 ? -1.509  -31.691 -16.055 1.00 75.18  ?  335 GLN A HB3    1 
ATOM 5148  H HG2    . GLN A 1 331 ? -1.149  -31.854 -13.645 1.00 86.33  ?  335 GLN A HG2    1 
ATOM 5149  H HG3    . GLN A 1 331 ? 0.158   -30.993 -13.923 1.00 86.33  ?  335 GLN A HG3    1 
ATOM 5150  H HE21   . GLN A 1 331 ? -0.534  -29.183 -12.772 1.00 86.30  ?  335 GLN A HE21   1 
ATOM 5151  H HE22   . GLN A 1 331 ? -1.641  -28.293 -13.223 1.00 86.30  ?  335 GLN A HE22   1 
ATOM 5152  N N      . SER A 1 332 ? 1.369   -33.489 -17.482 1.00 57.09  ?  336 SER A N      1 
ATOM 5153  C CA     . SER A 1 332 ? 1.790   -33.810 -18.840 1.00 53.94  ?  336 SER A CA     1 
ATOM 5154  C C      . SER A 1 332 ? 1.964   -35.310 -19.035 1.00 63.81  ?  336 SER A C      1 
ATOM 5155  O O      . SER A 1 332 ? 1.678   -35.833 -20.118 1.00 80.13  ?  336 SER A O      1 
ATOM 5156  C CB     . SER A 1 332 ? 3.094   -33.083 -19.168 1.00 75.02  ?  336 SER A CB     1 
ATOM 5157  O OG     . SER A 1 332 ? 3.500   -33.343 -20.500 1.00 67.95  ?  336 SER A OG     1 
ATOM 5158  H H      . SER A 1 332 ? 1.993   -33.177 -16.980 1.00 68.50  ?  336 SER A H      1 
ATOM 5159  H HA     . SER A 1 332 ? 1.111   -33.504 -19.462 1.00 64.73  ?  336 SER A HA     1 
ATOM 5160  H HB2    . SER A 1 332 ? 2.958   -32.129 -19.060 1.00 90.03  ?  336 SER A HB2    1 
ATOM 5161  H HB3    . SER A 1 332 ? 3.787   -33.390 -18.562 1.00 90.03  ?  336 SER A HB3    1 
ATOM 5162  H HG     . SER A 1 332 ? 4.217   -32.938 -20.666 1.00 81.54  ?  336 SER A HG     1 
ATOM 5163  N N      . ARG A 1 333 ? 2.423   -36.017 -18.003 1.00 79.20  ?  337 ARG A N      1 
ATOM 5164  C CA     . ARG A 1 333 ? 2.714   -37.448 -18.086 1.00 71.69  ?  337 ARG A CA     1 
ATOM 5165  C C      . ARG A 1 333 ? 2.028   -38.170 -16.935 1.00 67.12  ?  337 ARG A C      1 
ATOM 5166  O O      . ARG A 1 333 ? 2.668   -38.515 -15.933 1.00 59.18  ?  337 ARG A O      1 
ATOM 5167  C CB     . ARG A 1 333 ? 4.222   -37.702 -18.062 1.00 65.05  ?  337 ARG A CB     1 
ATOM 5168  C CG     . ARG A 1 333 ? 4.970   -37.119 -19.247 1.00 75.21  ?  337 ARG A CG     1 
ATOM 5169  C CD     . ARG A 1 333 ? 4.791   -37.975 -20.489 1.00 76.06  ?  337 ARG A CD     1 
ATOM 5170  N NE     . ARG A 1 333 ? 5.424   -39.283 -20.342 1.00 93.62  ?  337 ARG A NE     1 
ATOM 5171  C CZ     . ARG A 1 333 ? 6.718   -39.518 -20.539 1.00 92.95  ?  337 ARG A CZ     1 
ATOM 5172  N NH1    . ARG A 1 333 ? 7.201   -40.742 -20.380 1.00 80.63  1  337 ARG A NH1    1 
ATOM 5173  N NH2    . ARG A 1 333 ? 7.533   -38.533 -20.893 1.00 71.07  ?  337 ARG A NH2    1 
ATOM 5174  H H      . ARG A 1 333 ? 2.577   -35.682 -17.226 1.00 95.04  ?  337 ARG A H      1 
ATOM 5175  H HA     . ARG A 1 333 ? 2.361   -37.799 -18.918 1.00 86.03  ?  337 ARG A HA     1 
ATOM 5176  H HB2    . ARG A 1 333 ? 4.591   -37.308 -17.256 1.00 78.06  ?  337 ARG A HB2    1 
ATOM 5177  H HB3    . ARG A 1 333 ? 4.376   -38.660 -18.058 1.00 78.06  ?  337 ARG A HB3    1 
ATOM 5178  H HG2    . ARG A 1 333 ? 4.628   -36.231 -19.437 1.00 90.25  ?  337 ARG A HG2    1 
ATOM 5179  H HG3    . ARG A 1 333 ? 5.917   -37.077 -19.040 1.00 90.25  ?  337 ARG A HG3    1 
ATOM 5180  H HD2    . ARG A 1 333 ? 3.844   -38.112 -20.648 1.00 91.27  ?  337 ARG A HD2    1 
ATOM 5181  H HD3    . ARG A 1 333 ? 5.196   -37.526 -21.247 1.00 91.27  ?  337 ARG A HD3    1 
ATOM 5182  H HE     . ARG A 1 333 ? 4.926   -39.945 -20.112 1.00 112.34 ?  337 ARG A HE     1 
ATOM 5183  H HH11   . ARG A 1 333 ? 6.678   -41.385 -20.150 1.00 96.75  ?  337 ARG A HH11   1 
ATOM 5184  H HH12   . ARG A 1 333 ? 8.038   -40.894 -20.507 1.00 96.75  ?  337 ARG A HH12   1 
ATOM 5185  H HH21   . ARG A 1 333 ? 7.226   -37.737 -20.997 1.00 85.29  ?  337 ARG A HH21   1 
ATOM 5186  H HH22   . ARG A 1 333 ? 8.369   -38.692 -21.019 1.00 85.29  ?  337 ARG A HH22   1 
ATOM 5187  N N      . PRO A 1 334 ? 0.719   -38.418 -17.043 1.00 73.16  ?  338 PRO A N      1 
ATOM 5188  C CA     . PRO A 1 334 ? 0.044   -39.235 -16.023 1.00 78.66  ?  338 PRO A CA     1 
ATOM 5189  C C      . PRO A 1 334 ? 0.367   -40.714 -16.124 1.00 86.16  ?  338 PRO A C      1 
ATOM 5190  O O      . PRO A 1 334 ? 0.003   -41.470 -15.215 1.00 82.87  ?  338 PRO A O      1 
ATOM 5191  C CB     . PRO A 1 334 ? -1.448  -38.979 -16.290 1.00 78.95  ?  338 PRO A CB     1 
ATOM 5192  C CG     . PRO A 1 334 ? -1.504  -37.844 -17.275 1.00 74.16  ?  338 PRO A CG     1 
ATOM 5193  C CD     . PRO A 1 334 ? -0.228  -37.898 -18.038 1.00 76.80  ?  338 PRO A CD     1 
ATOM 5194  H HA     . PRO A 1 334 ? 0.269   -38.917 -15.135 1.00 94.39  ?  338 PRO A HA     1 
ATOM 5195  H HB2    . PRO A 1 334 ? -1.852  -39.776 -16.666 1.00 94.73  ?  338 PRO A HB2    1 
ATOM 5196  H HB3    . PRO A 1 334 ? -1.888  -38.732 -15.462 1.00 94.73  ?  338 PRO A HB3    1 
ATOM 5197  H HG2    . PRO A 1 334 ? -2.261  -37.967 -17.869 1.00 88.99  ?  338 PRO A HG2    1 
ATOM 5198  H HG3    . PRO A 1 334 ? -1.579  -37.004 -16.797 1.00 88.99  ?  338 PRO A HG3    1 
ATOM 5199  H HD2    . PRO A 1 334 ? -0.305  -38.510 -18.787 1.00 92.16  ?  338 PRO A HD2    1 
ATOM 5200  H HD3    . PRO A 1 334 ? 0.034   -37.010 -18.326 1.00 92.16  ?  338 PRO A HD3    1 
ATOM 5201  N N      . ASP A 1 335 ? 1.031   -41.150 -17.196 1.00 93.90  ?  339 ASP A N      1 
ATOM 5202  C CA     . ASP A 1 335 ? 1.358   -42.563 -17.356 1.00 95.72  ?  339 ASP A CA     1 
ATOM 5203  C C      . ASP A 1 335 ? 2.529   -42.966 -16.468 1.00 88.75  ?  339 ASP A C      1 
ATOM 5204  O O      . ASP A 1 335 ? 2.446   -43.953 -15.730 1.00 83.19  ?  339 ASP A O      1 
ATOM 5205  C CB     . ASP A 1 335 ? 1.663   -42.867 -18.824 1.00 108.70 ?  339 ASP A CB     1 
ATOM 5206  C CG     . ASP A 1 335 ? 2.697   -41.927 -19.413 1.00 97.59  ?  339 ASP A CG     1 
ATOM 5207  O OD1    . ASP A 1 335 ? 2.588   -41.600 -20.614 1.00 83.83  ?  339 ASP A OD1    1 
ATOM 5208  O OD2    . ASP A 1 335 ? 3.618   -41.515 -18.677 1.00 99.02  -1 339 ASP A OD2    1 
ATOM 5209  H H      . ASP A 1 335 ? 1.302   -40.649 -17.840 1.00 112.67 ?  339 ASP A H      1 
ATOM 5210  H HA     . ASP A 1 335 ? 0.589   -43.095 -17.094 1.00 114.86 ?  339 ASP A HA     1 
ATOM 5211  H HB2    . ASP A 1 335 ? 2.005   -43.772 -18.895 1.00 130.44 ?  339 ASP A HB2    1 
ATOM 5212  H HB3    . ASP A 1 335 ? 0.848   -42.779 -19.341 1.00 130.44 ?  339 ASP A HB3    1 
ATOM 5213  N N      . ILE A 1 336 ? 3.631   -42.212 -16.523 1.00 92.65  ?  340 ILE A N      1 
ATOM 5214  C CA     . ILE A 1 336 ? 4.753   -42.473 -15.631 1.00 84.29  ?  340 ILE A CA     1 
ATOM 5215  C C      . ILE A 1 336 ? 4.331   -42.335 -14.180 1.00 83.60  ?  340 ILE A C      1 
ATOM 5216  O O      . ILE A 1 336 ? 5.000   -42.861 -13.285 1.00 81.05  ?  340 ILE A O      1 
ATOM 5217  C CB     . ILE A 1 336 ? 5.925   -41.521 -15.950 1.00 68.98  ?  340 ILE A CB     1 
ATOM 5218  C CG1    . ILE A 1 336 ? 7.148   -41.836 -15.085 1.00 68.99  ?  340 ILE A CG1    1 
ATOM 5219  C CG2    . ILE A 1 336 ? 5.508   -40.076 -15.729 1.00 64.27  ?  340 ILE A CG2    1 
ATOM 5220  C CD1    . ILE A 1 336 ? 7.697   -43.232 -15.261 1.00 72.53  ?  340 ILE A CD1    1 
ATOM 5221  H H      . ILE A 1 336 ? 3.749   -41.553 -17.063 1.00 111.18 ?  340 ILE A H      1 
ATOM 5222  H HA     . ILE A 1 336 ? 5.061   -43.383 -15.769 1.00 101.15 ?  340 ILE A HA     1 
ATOM 5223  H HB     . ILE A 1 336 ? 6.168   -41.633 -16.882 1.00 82.78  ?  340 ILE A HB     1 
ATOM 5224  H HG12   . ILE A 1 336 ? 7.856   -41.211 -15.309 1.00 82.79  ?  340 ILE A HG12   1 
ATOM 5225  H HG13   . ILE A 1 336 ? 6.904   -41.731 -14.152 1.00 82.79  ?  340 ILE A HG13   1 
ATOM 5226  H HG21   . ILE A 1 336 ? 6.258   -39.497 -15.935 1.00 77.13  ?  340 ILE A HG21   1 
ATOM 5227  H HG22   . ILE A 1 336 ? 4.761   -39.870 -16.312 1.00 77.13  ?  340 ILE A HG22   1 
ATOM 5228  H HG23   . ILE A 1 336 ? 5.246   -39.962 -14.802 1.00 77.13  ?  340 ILE A HG23   1 
ATOM 5229  H HD11   . ILE A 1 336 ? 8.465   -43.344 -14.680 1.00 87.04  ?  340 ILE A HD11   1 
ATOM 5230  H HD12   . ILE A 1 336 ? 7.008   -43.873 -15.028 1.00 87.04  ?  340 ILE A HD12   1 
ATOM 5231  H HD13   . ILE A 1 336 ? 7.962   -43.352 -16.187 1.00 87.04  ?  340 ILE A HD13   1 
ATOM 5232  N N      . LEU A 1 337 ? 3.228   -41.631 -13.927 1.00 91.10  ?  341 LEU A N      1 
ATOM 5233  C CA     . LEU A 1 337 ? 2.771   -41.408 -12.561 1.00 81.67  ?  341 LEU A CA     1 
ATOM 5234  C C      . LEU A 1 337 ? 2.628   -42.724 -11.808 1.00 87.91  ?  341 LEU A C      1 
ATOM 5235  O O      . LEU A 1 337 ? 3.109   -42.862 -10.678 1.00 78.76  ?  341 LEU A O      1 
ATOM 5236  C CB     . LEU A 1 337 ? 1.444   -40.645 -12.593 1.00 79.11  ?  341 LEU A CB     1 
ATOM 5237  C CG     . LEU A 1 337 ? 0.839   -40.106 -11.296 1.00 68.22  ?  341 LEU A CG     1 
ATOM 5238  C CD1    . LEU A 1 337 ? 1.893   -39.747 -10.263 1.00 72.90  ?  341 LEU A CD1    1 
ATOM 5239  C CD2    . LEU A 1 337 ? -0.030  -38.896 -11.615 1.00 72.60  ?  341 LEU A CD2    1 
ATOM 5240  H H      . LEU A 1 337 ? 2.728   -41.273 -14.529 1.00 109.32 ?  341 LEU A H      1 
ATOM 5241  H HA     . LEU A 1 337 ? 3.422   -40.862 -12.093 1.00 98.00  ?  341 LEU A HA     1 
ATOM 5242  H HB2    . LEU A 1 337 ? 1.562   -39.881 -13.179 1.00 94.93  ?  341 LEU A HB2    1 
ATOM 5243  H HB3    . LEU A 1 337 ? 0.780   -41.235 -12.982 1.00 94.93  ?  341 LEU A HB3    1 
ATOM 5244  H HG     . LEU A 1 337 ? 0.267   -40.788 -10.910 1.00 81.87  ?  341 LEU A HG     1 
ATOM 5245  H HD11   . LEU A 1 337 ? 1.453   -39.413 -9.466  1.00 87.48  ?  341 LEU A HD11   1 
ATOM 5246  H HD12   . LEU A 1 337 ? 2.407   -40.541 -10.049 1.00 87.48  ?  341 LEU A HD12   1 
ATOM 5247  H HD13   . LEU A 1 337 ? 2.475   -39.064 -10.632 1.00 87.48  ?  341 LEU A HD13   1 
ATOM 5248  H HD21   . LEU A 1 337 ? -0.412  -38.556 -10.791 1.00 87.12  ?  341 LEU A HD21   1 
ATOM 5249  H HD22   . LEU A 1 337 ? 0.520   -38.214 -12.031 1.00 87.12  ?  341 LEU A HD22   1 
ATOM 5250  H HD23   . LEU A 1 337 ? -0.737  -39.167 -12.222 1.00 87.12  ?  341 LEU A HD23   1 
ATOM 5251  N N      . SER A 1 338 ? 1.988   -43.715 -12.432 1.00 101.72 ?  342 SER A N      1 
ATOM 5252  C CA     . SER A 1 338 ? 1.718   -44.973 -11.747 1.00 95.23  ?  342 SER A CA     1 
ATOM 5253  C C      . SER A 1 338 ? 2.971   -45.810 -11.534 1.00 82.51  ?  342 SER A C      1 
ATOM 5254  O O      . SER A 1 338 ? 3.003   -46.623 -10.604 1.00 67.35  ?  342 SER A O      1 
ATOM 5255  C CB     . SER A 1 338 ? 0.685   -45.784 -12.529 1.00 84.66  ?  342 SER A CB     1 
ATOM 5256  O OG     . SER A 1 338 ? -0.599  -45.194 -12.428 1.00 88.20  ?  342 SER A OG     1 
ATOM 5257  H H      . SER A 1 338 ? 1.704   -43.682 -13.243 1.00 122.07 ?  342 SER A H      1 
ATOM 5258  H HA     . SER A 1 338 ? 1.341   -44.778 -10.875 1.00 114.28 ?  342 SER A HA     1 
ATOM 5259  H HB2    . SER A 1 338 ? 0.947   -45.813 -13.462 1.00 101.59 ?  342 SER A HB2    1 
ATOM 5260  H HB3    . SER A 1 338 ? 0.649   -46.683 -12.166 1.00 101.59 ?  342 SER A HB3    1 
ATOM 5261  H HG     . SER A 1 338 ? -1.158  -45.647 -12.861 1.00 105.84 ?  342 SER A HG     1 
ATOM 5262  N N      . LYS A 1 339 ? 4.002   -45.633 -12.360 1.00 90.32  ?  343 LYS A N      1 
ATOM 5263  C CA     . LYS A 1 339 ? 5.188   -46.473 -12.255 1.00 71.94  ?  343 LYS A CA     1 
ATOM 5264  C C      . LYS A 1 339 ? 6.168   -46.002 -11.193 1.00 70.42  ?  343 LYS A C      1 
ATOM 5265  O O      . LYS A 1 339 ? 7.165   -46.692 -10.953 1.00 73.12  ?  343 LYS A O      1 
ATOM 5266  C CB     . LYS A 1 339 ? 5.907   -46.550 -13.602 1.00 71.37  ?  343 LYS A CB     1 
ATOM 5267  C CG     . LYS A 1 339 ? 5.314   -47.574 -14.553 1.00 82.17  ?  343 LYS A CG     1 
ATOM 5268  C CD     . LYS A 1 339 ? 4.587   -46.916 -15.707 1.00 79.56  ?  343 LYS A CD     1 
ATOM 5269  C CE     . LYS A 1 339 ? 5.565   -46.316 -16.701 1.00 80.70  ?  343 LYS A CE     1 
ATOM 5270  N NZ     . LYS A 1 339 ? 4.869   -45.704 -17.863 1.00 77.59  1  343 LYS A NZ     1 
ATOM 5271  H H      . LYS A 1 339 ? 4.037   -45.040 -12.982 1.00 108.38 ?  343 LYS A H      1 
ATOM 5272  H HA     . LYS A 1 339 ? 4.909   -47.371 -12.019 1.00 86.32  ?  343 LYS A HA     1 
ATOM 5273  H HB2    . LYS A 1 339 ? 5.859   -45.682 -14.033 1.00 85.65  ?  343 LYS A HB2    1 
ATOM 5274  H HB3    . LYS A 1 339 ? 6.834   -46.789 -13.448 1.00 85.65  ?  343 LYS A HB3    1 
ATOM 5275  H HG2    . LYS A 1 339 ? 6.027   -48.122 -14.917 1.00 98.60  ?  343 LYS A HG2    1 
ATOM 5276  H HG3    . LYS A 1 339 ? 4.679   -48.127 -14.071 1.00 98.60  ?  343 LYS A HG3    1 
ATOM 5277  H HD2    . LYS A 1 339 ? 4.051   -47.580 -16.169 1.00 95.48  ?  343 LYS A HD2    1 
ATOM 5278  H HD3    . LYS A 1 339 ? 4.022   -46.204 -15.367 1.00 95.48  ?  343 LYS A HD3    1 
ATOM 5279  H HE2    . LYS A 1 339 ? 6.084   -45.625 -16.261 1.00 96.84  ?  343 LYS A HE2    1 
ATOM 5280  H HE3    . LYS A 1 339 ? 6.151   -47.014 -17.033 1.00 96.84  ?  343 LYS A HE3    1 
ATOM 5281  H HZ1    . LYS A 1 339 ? 5.465   -45.361 -18.428 1.00 93.11  ?  343 LYS A HZ1    1 
ATOM 5282  H HZ2    . LYS A 1 339 ? 4.389   -46.321 -18.289 1.00 93.11  ?  343 LYS A HZ2    1 
ATOM 5283  H HZ3    . LYS A 1 339 ? 4.327   -45.055 -17.586 1.00 93.11  ?  343 LYS A HZ3    1 
ATOM 5284  N N      . ILE A 1 340 ? 5.929   -44.859 -10.554 1.00 88.85  ?  344 ILE A N      1 
ATOM 5285  C CA     . ILE A 1 340 ? 6.783   -44.468 -9.441  1.00 87.76  ?  344 ILE A CA     1 
ATOM 5286  C C      . ILE A 1 340 ? 6.655   -45.523 -8.356  1.00 92.64  ?  344 ILE A C      1 
ATOM 5287  O O      . ILE A 1 340 ? 5.547   -45.858 -7.918  1.00 96.31  ?  344 ILE A O      1 
ATOM 5288  C CB     . ILE A 1 340 ? 6.417   -43.073 -8.921  1.00 88.30  ?  344 ILE A CB     1 
ATOM 5289  C CG1    . ILE A 1 340 ? 5.058   -43.088 -8.219  1.00 82.52  ?  344 ILE A CG1    1 
ATOM 5290  C CG2    . ILE A 1 340 ? 6.429   -42.058 -10.052 1.00 61.82  ?  344 ILE A CG2    1 
ATOM 5291  C CD1    . ILE A 1 340 ? 5.143   -43.223 -6.704  1.00 67.80  ?  344 ILE A CD1    1 
ATOM 5292  H H      . ILE A 1 340 ? 5.295   -44.307 -10.739 1.00 106.62 ?  344 ILE A H      1 
ATOM 5293  H HA     . ILE A 1 340 ? 7.706   -44.448 -9.739  1.00 105.31 ?  344 ILE A HA     1 
ATOM 5294  H HB     . ILE A 1 340 ? 7.088   -42.808 -8.272  1.00 105.96 ?  344 ILE A HB     1 
ATOM 5295  H HG12   . ILE A 1 340 ? 4.596   -42.258 -8.416  1.00 99.02  ?  344 ILE A HG12   1 
ATOM 5296  H HG13   . ILE A 1 340 ? 4.542   -43.838 -8.554  1.00 99.02  ?  344 ILE A HG13   1 
ATOM 5297  H HG21   . ILE A 1 340 ? 6.195   -41.186 -9.696  1.00 74.19  ?  344 ILE A HG21   1 
ATOM 5298  H HG22   . ILE A 1 340 ? 7.317   -42.029 -10.441 1.00 74.19  ?  344 ILE A HG22   1 
ATOM 5299  H HG23   . ILE A 1 340 ? 5.782   -42.326 -10.723 1.00 74.19  ?  344 ILE A HG23   1 
ATOM 5300  H HD11   . ILE A 1 340 ? 4.245   -43.225 -6.337  1.00 81.36  ?  344 ILE A HD11   1 
ATOM 5301  H HD12   . ILE A 1 340 ? 5.591   -44.055 -6.486  1.00 81.36  ?  344 ILE A HD12   1 
ATOM 5302  H HD13   . ILE A 1 340 ? 5.645   -42.473 -6.348  1.00 81.36  ?  344 ILE A HD13   1 
ATOM 5303  N N      . LYS A 1 341 ? 7.785   -46.079 -7.942  1.00 99.43  ?  345 LYS A N      1 
ATOM 5304  C CA     . LYS A 1 341 ? 7.841   -46.988 -6.811  1.00 101.67 ?  345 LYS A CA     1 
ATOM 5305  C C      . LYS A 1 341 ? 8.727   -46.357 -5.753  1.00 82.44  ?  345 LYS A C      1 
ATOM 5306  O O      . LYS A 1 341 ? 9.828   -45.891 -6.061  1.00 81.78  ?  345 LYS A O      1 
ATOM 5307  C CB     . LYS A 1 341 ? 8.388   -48.360 -7.217  1.00 93.03  ?  345 LYS A CB     1 
ATOM 5308  C CG     . LYS A 1 341 ? 8.317   -49.415 -6.116  1.00 98.02  ?  345 LYS A CG     1 
ATOM 5309  C CD     . LYS A 1 341 ? 7.115   -50.335 -6.288  1.00 96.79  ?  345 LYS A CD     1 
ATOM 5310  C CE     . LYS A 1 341 ? 7.045   -51.375 -5.176  1.00 87.27  ?  345 LYS A CE     1 
ATOM 5311  N NZ     . LYS A 1 341 ? 5.861   -52.270 -5.306  1.00 74.24  1  345 LYS A NZ     1 
ATOM 5312  H H      . LYS A 1 341 ? 8.550   -45.941 -8.311  1.00 119.32 ?  345 LYS A H      1 
ATOM 5313  H HA     . LYS A 1 341 ? 6.952   -47.105 -6.442  1.00 122.00 ?  345 LYS A HA     1 
ATOM 5314  H HB2    . LYS A 1 341 ? 7.877   -48.688 -7.973  1.00 111.64 ?  345 LYS A HB2    1 
ATOM 5315  H HB3    . LYS A 1 341 ? 9.319   -48.261 -7.470  1.00 111.64 ?  345 LYS A HB3    1 
ATOM 5316  H HG2    . LYS A 1 341 ? 9.120   -49.958 -6.142  1.00 117.63 ?  345 LYS A HG2    1 
ATOM 5317  H HG3    . LYS A 1 341 ? 8.240   -48.973 -5.256  1.00 117.63 ?  345 LYS A HG3    1 
ATOM 5318  H HD2    . LYS A 1 341 ? 6.302   -49.807 -6.262  1.00 116.14 ?  345 LYS A HD2    1 
ATOM 5319  H HD3    . LYS A 1 341 ? 7.187   -50.801 -7.135  1.00 116.14 ?  345 LYS A HD3    1 
ATOM 5320  H HE2    . LYS A 1 341 ? 7.843   -51.925 -5.206  1.00 104.72 ?  345 LYS A HE2    1 
ATOM 5321  H HE3    . LYS A 1 341 ? 6.986   -50.921 -4.321  1.00 104.72 ?  345 LYS A HE3    1 
ATOM 5322  H HZ1    . LYS A 1 341 ? 5.854   -52.862 -4.642  1.00 89.09  ?  345 LYS A HZ1    1 
ATOM 5323  H HZ2    . LYS A 1 341 ? 5.112   -51.790 -5.274  1.00 89.09  ?  345 LYS A HZ2    1 
ATOM 5324  H HZ3    . LYS A 1 341 ? 5.893   -52.706 -6.081  1.00 89.09  ?  345 LYS A HZ3    1 
ATOM 5325  N N      . PHE A 1 342 ? 8.231   -46.303 -4.527  1.00 70.90  ?  346 PHE A N      1 
ATOM 5326  C CA     . PHE A 1 342 ? 9.080   -45.979 -3.392  1.00 80.42  ?  346 PHE A CA     1 
ATOM 5327  C C      . PHE A 1 342 ? 9.534   -47.302 -2.800  1.00 105.51 ?  346 PHE A C      1 
ATOM 5328  O O      . PHE A 1 342 ? 8.916   -47.799 -1.849  1.00 95.39  ?  346 PHE A O      1 
ATOM 5329  C CB     . PHE A 1 342 ? 8.341   -45.122 -2.366  1.00 94.66  ?  346 PHE A CB     1 
ATOM 5330  C CG     . PHE A 1 342 ? 8.606   -43.658 -2.518  1.00 92.52  ?  346 PHE A CG     1 
ATOM 5331  C CD1    . PHE A 1 342 ? 9.653   -43.060 -1.838  1.00 79.17  ?  346 PHE A CD1    1 
ATOM 5332  C CD2    . PHE A 1 342 ? 7.830   -42.884 -3.361  1.00 71.73  ?  346 PHE A CD2    1 
ATOM 5333  C CE1    . PHE A 1 342 ? 9.910   -41.716 -1.985  1.00 76.72  ?  346 PHE A CE1    1 
ATOM 5334  C CE2    . PHE A 1 342 ? 8.084   -41.540 -3.512  1.00 70.18  ?  346 PHE A CE2    1 
ATOM 5335  C CZ     . PHE A 1 342 ? 9.127   -40.957 -2.824  1.00 79.47  ?  346 PHE A CZ     1 
ATOM 5336  H H      . PHE A 1 342 ? 7.408   -46.450 -4.324  1.00 85.08  ?  346 PHE A H      1 
ATOM 5337  H HA     . PHE A 1 342 ? 9.861   -45.491 -3.698  1.00 96.51  ?  346 PHE A HA     1 
ATOM 5338  H HB2    . PHE A 1 342 ? 7.387   -45.264 -2.467  1.00 113.60 ?  346 PHE A HB2    1 
ATOM 5339  H HB3    . PHE A 1 342 ? 8.622   -45.385 -1.476  1.00 113.60 ?  346 PHE A HB3    1 
ATOM 5340  H HD1    . PHE A 1 342 ? 10.185  -43.571 -1.272  1.00 95.00  ?  346 PHE A HD1    1 
ATOM 5341  H HD2    . PHE A 1 342 ? 7.127   -43.275 -3.828  1.00 86.07  ?  346 PHE A HD2    1 
ATOM 5342  H HE1    . PHE A 1 342 ? 10.613  -41.323 -1.520  1.00 92.07  ?  346 PHE A HE1    1 
ATOM 5343  H HE2    . PHE A 1 342 ? 7.554   -41.027 -4.077  1.00 84.22  ?  346 PHE A HE2    1 
ATOM 5344  H HZ     . PHE A 1 342 ? 9.298   -40.048 -2.923  1.00 95.36  ?  346 PHE A HZ     1 
ATOM 5345  N N      . PRO A 1 343 ? 10.599  -47.902 -3.334  1.00 115.23 ?  347 PRO A N      1 
ATOM 5346  C CA     . PRO A 1 343 ? 10.866  -49.311 -3.041  1.00 95.68  ?  347 PRO A CA     1 
ATOM 5347  C C      . PRO A 1 343 ? 10.898  -49.561 -1.541  1.00 86.03  ?  347 PRO A C      1 
ATOM 5348  O O      . PRO A 1 343 ? 11.266  -48.692 -0.748  1.00 79.44  ?  347 PRO A O      1 
ATOM 5349  C CB     . PRO A 1 343 ? 12.226  -49.563 -3.702  1.00 95.26  ?  347 PRO A CB     1 
ATOM 5350  C CG     . PRO A 1 343 ? 12.398  -48.453 -4.679  1.00 91.84  ?  347 PRO A CG     1 
ATOM 5351  C CD     . PRO A 1 343 ? 11.714  -47.283 -4.068  1.00 104.39 ?  347 PRO A CD     1 
ATOM 5352  H HA     . PRO A 1 343 ? 10.194  -49.878 -3.451  1.00 114.81 ?  347 PRO A HA     1 
ATOM 5353  H HB2    . PRO A 1 343 ? 12.925  -49.541 -3.031  1.00 114.32 ?  347 PRO A HB2    1 
ATOM 5354  H HB3    . PRO A 1 343 ? 12.214  -50.420 -4.157  1.00 114.32 ?  347 PRO A HB3    1 
ATOM 5355  H HG2    . PRO A 1 343 ? 13.343  -48.271 -4.803  1.00 110.21 ?  347 PRO A HG2    1 
ATOM 5356  H HG3    . PRO A 1 343 ? 11.982  -48.692 -5.522  1.00 110.21 ?  347 PRO A HG3    1 
ATOM 5357  H HD2    . PRO A 1 343 ? 12.309  -46.823 -3.456  1.00 125.27 ?  347 PRO A HD2    1 
ATOM 5358  H HD3    . PRO A 1 343 ? 11.379  -46.688 -4.756  1.00 125.27 ?  347 PRO A HD3    1 
ATOM 5359  N N      . GLU A 1 344 ? 10.494  -50.765 -1.163  1.00 88.68  ?  348 GLU A N      1 
ATOM 5360  C CA     . GLU A 1 344 ? 10.075  -51.032 0.205   1.00 88.02  ?  348 GLU A CA     1 
ATOM 5361  C C      . GLU A 1 344 ? 11.263  -51.007 1.158   1.00 69.78  ?  348 GLU A C      1 
ATOM 5362  O O      . GLU A 1 344 ? 12.248  -51.725 0.960   1.00 58.60  ?  348 GLU A O      1 
ATOM 5363  C CB     . GLU A 1 344 ? 9.364   -52.378 0.266   1.00 98.74  ?  348 GLU A CB     1 
ATOM 5364  C CG     . GLU A 1 344 ? 8.242   -52.516 -0.754  1.00 77.43  ?  348 GLU A CG     1 
ATOM 5365  C CD     . GLU A 1 344 ? 8.200   -53.887 -1.388  1.00 81.18  ?  348 GLU A CD     1 
ATOM 5366  O OE1    . GLU A 1 344 ? 7.354   -54.705 -0.977  1.00 79.56  ?  348 GLU A OE1    1 
ATOM 5367  O OE2    . GLU A 1 344 ? 9.021   -54.149 -2.291  1.00 68.89  ?  348 GLU A OE2    1 
ATOM 5368  H H      . GLU A 1 344 ? 10.452  -51.449 -1.682  1.00 106.42 ?  348 GLU A H      1 
ATOM 5369  H HA     . GLU A 1 344 ? 9.449   -50.346 0.486   1.00 105.63 ?  348 GLU A HA     1 
ATOM 5370  H HB2    . GLU A 1 344 ? 10.009  -53.082 0.095   1.00 118.49 ?  348 GLU A HB2    1 
ATOM 5371  H HB3    . GLU A 1 344 ? 8.979   -52.491 1.149   1.00 118.49 ?  348 GLU A HB3    1 
ATOM 5372  H HG2    . GLU A 1 344 ? 7.392   -52.363 -0.312  1.00 92.91  ?  348 GLU A HG2    1 
ATOM 5373  H HG3    . GLU A 1 344 ? 8.372   -51.862 -1.458  1.00 92.91  ?  348 GLU A HG3    1 
ATOM 5374  N N      . SER A 1 345 ? 11.162  -50.170 2.188   1.00 63.08  ?  349 SER A N      1 
ATOM 5375  C CA     . SER A 1 345 ? 12.098  -50.162 3.310   1.00 63.95  ?  349 SER A CA     1 
ATOM 5376  C C      . SER A 1 345 ? 13.548  -50.204 2.835   1.00 68.04  ?  349 SER A C      1 
ATOM 5377  O O      . SER A 1 345 ? 14.364  -50.999 3.306   1.00 68.46  ?  349 SER A O      1 
ATOM 5378  C CB     . SER A 1 345 ? 11.803  -51.321 4.261   1.00 85.47  ?  349 SER A CB     1 
ATOM 5379  O OG     . SER A 1 345 ? 10.485  -51.233 4.771   1.00 68.77  ?  349 SER A OG     1 
ATOM 5380  H H      . SER A 1 345 ? 10.540  -49.581 2.262   1.00 75.70  ?  349 SER A H      1 
ATOM 5381  H HA     . SER A 1 345 ? 11.977  -49.338 3.807   1.00 76.74  ?  349 SER A HA     1 
ATOM 5382  H HB2    . SER A 1 345 ? 11.900  -52.157 3.778   1.00 102.56 ?  349 SER A HB2    1 
ATOM 5383  H HB3    . SER A 1 345 ? 12.431  -51.290 5.000   1.00 102.56 ?  349 SER A HB3    1 
ATOM 5384  H HG     . SER A 1 345 ? 10.335  -51.875 5.292   1.00 82.52  ?  349 SER A HG     1 
ATOM 5385  N N      . ILE A 1 346 ? 13.867  -49.330 1.885   1.00 91.25  ?  350 ILE A N      1 
ATOM 5386  C CA     . ILE A 1 346 ? 15.242  -49.147 1.437   1.00 83.12  ?  350 ILE A CA     1 
ATOM 5387  C C      . ILE A 1 346 ? 15.567  -47.666 1.535   1.00 91.40  ?  350 ILE A C      1 
ATOM 5388  O O      . ILE A 1 346 ? 16.333  -47.124 0.731   1.00 73.60  ?  350 ILE A O      1 
ATOM 5389  C CB     . ILE A 1 346 ? 15.447  -49.687 0.011   1.00 67.81  ?  350 ILE A CB     1 
ATOM 5390  C CG1    . ILE A 1 346 ? 14.292  -49.295 -0.907  1.00 86.64  ?  350 ILE A CG1    1 
ATOM 5391  C CG2    . ILE A 1 346 ? 15.524  -51.200 0.036   1.00 49.18  ?  350 ILE A CG2    1 
ATOM 5392  C CD1    . ILE A 1 346 ? 14.069  -47.807 -1.110  1.00 73.22  ?  350 ILE A CD1    1 
ATOM 5393  H H      . ILE A 1 346 ? 13.299  -48.826 1.481   1.00 109.50 ?  350 ILE A H      1 
ATOM 5394  H HA     . ILE A 1 346 ? 15.838  -49.629 2.032   1.00 99.74  ?  350 ILE A HA     1 
ATOM 5395  H HB     . ILE A 1 346 ? 16.275  -49.331 -0.348  1.00 81.38  ?  350 ILE A HB     1 
ATOM 5396  H HG12   . ILE A 1 346 ? 14.453  -49.685 -1.780  1.00 103.97 ?  350 ILE A HG12   1 
ATOM 5397  H HG13   . ILE A 1 346 ? 13.473  -49.661 -0.538  1.00 103.97 ?  350 ILE A HG13   1 
ATOM 5398  H HG21   . ILE A 1 346 ? 15.654  -51.524 -0.869  1.00 59.02  ?  350 ILE A HG21   1 
ATOM 5399  H HG22   . ILE A 1 346 ? 16.271  -51.469 0.594   1.00 59.02  ?  350 ILE A HG22   1 
ATOM 5400  H HG23   . ILE A 1 346 ? 14.697  -51.552 0.399   1.00 59.02  ?  350 ILE A HG23   1 
ATOM 5401  H HD11   . ILE A 1 346 ? 13.315  -47.679 -1.707  1.00 87.86  ?  350 ILE A HD11   1 
ATOM 5402  H HD12   . ILE A 1 346 ? 13.885  -47.395 -0.251  1.00 87.86  ?  350 ILE A HD12   1 
ATOM 5403  H HD13   . ILE A 1 346 ? 14.869  -47.418 -1.499  1.00 87.86  ?  350 ILE A HD13   1 
ATOM 5404  N N      . TRP A 1 347 ? 14.974  -47.003 2.522   1.00 90.63  ?  351 TRP A N      1 
ATOM 5405  C CA     . TRP A 1 347 ? 15.126  -45.569 2.690   1.00 65.17  ?  351 TRP A CA     1 
ATOM 5406  C C      . TRP A 1 347 ? 16.487  -45.190 3.264   1.00 76.69  ?  351 TRP A C      1 
ATOM 5407  O O      . TRP A 1 347 ? 16.687  -44.031 3.635   1.00 78.80  ?  351 TRP A O      1 
ATOM 5408  C CB     . TRP A 1 347 ? 14.007  -45.030 3.585   1.00 59.76  ?  351 TRP A CB     1 
ATOM 5409  C CG     . TRP A 1 347 ? 12.612  -45.295 3.068   1.00 67.88  ?  351 TRP A CG     1 
ATOM 5410  C CD1    . TRP A 1 347 ? 12.191  -46.367 2.329   1.00 70.03  ?  351 TRP A CD1    1 
ATOM 5411  C CD2    . TRP A 1 347 ? 11.459  -44.468 3.256   1.00 84.04  ?  351 TRP A CD2    1 
ATOM 5412  N NE1    . TRP A 1 347 ? 10.853  -46.258 2.051   1.00 81.87  ?  351 TRP A NE1    1 
ATOM 5413  C CE2    . TRP A 1 347 ? 10.379  -45.101 2.608   1.00 84.37  ?  351 TRP A CE2    1 
ATOM 5414  C CE3    . TRP A 1 347 ? 11.234  -43.254 3.910   1.00 77.67  ?  351 TRP A CE3    1 
ATOM 5415  C CZ2    . TRP A 1 347 ? 9.098   -44.561 2.596   1.00 77.76  ?  351 TRP A CZ2    1 
ATOM 5416  C CZ3    . TRP A 1 347 ? 9.961   -42.720 3.896   1.00 69.11  ?  351 TRP A CZ3    1 
ATOM 5417  C CH2    . TRP A 1 347 ? 8.909   -43.372 3.243   1.00 71.96  ?  351 TRP A CH2    1 
ATOM 5418  H H      . TRP A 1 347 ? 14.471  -47.371 3.114   1.00 108.76 ?  351 TRP A H      1 
ATOM 5419  H HA     . TRP A 1 347 ? 15.043  -45.143 1.823   1.00 78.21  ?  351 TRP A HA     1 
ATOM 5420  H HB2    . TRP A 1 347 ? 14.082  -45.444 4.459   1.00 71.72  ?  351 TRP A HB2    1 
ATOM 5421  H HB3    . TRP A 1 347 ? 14.113  -44.069 3.668   1.00 71.72  ?  351 TRP A HB3    1 
ATOM 5422  H HD1    . TRP A 1 347 ? 12.735  -47.072 2.058   1.00 84.04  ?  351 TRP A HD1    1 
ATOM 5423  H HE1    . TRP A 1 347 ? 10.387  -46.823 1.599   1.00 98.24  ?  351 TRP A HE1    1 
ATOM 5424  H HE3    . TRP A 1 347 ? 11.928  -42.815 4.347   1.00 93.20  ?  351 TRP A HE3    1 
ATOM 5425  H HZ2    . TRP A 1 347 ? 8.397   -44.991 2.162   1.00 93.31  ?  351 TRP A HZ2    1 
ATOM 5426  H HZ3    . TRP A 1 347 ? 9.799   -41.912 4.328   1.00 82.94  ?  351 TRP A HZ3    1 
ATOM 5427  H HH2    . TRP A 1 347 ? 8.062   -42.988 3.250   1.00 86.35  ?  351 TRP A HH2    1 
ATOM 5428  N N      . LYS A 1 348 ? 17.415  -46.145 3.351   1.00 91.42  ?  352 LYS A N      1 
ATOM 5429  C CA     . LYS A 1 348 ? 18.772  -45.849 3.796   1.00 91.76  ?  352 LYS A CA     1 
ATOM 5430  C C      . LYS A 1 348 ? 19.357  -44.654 3.054   1.00 94.20  ?  352 LYS A C      1 
ATOM 5431  O O      . LYS A 1 348 ? 20.008  -43.795 3.659   1.00 98.27  ?  352 LYS A O      1 
ATOM 5432  C CB     . LYS A 1 348 ? 19.647  -47.083 3.587   1.00 105.99 ?  352 LYS A CB     1 
ATOM 5433  C CG     . LYS A 1 348 ? 19.756  -47.469 2.115   1.00 104.05 ?  352 LYS A CG     1 
ATOM 5434  C CD     . LYS A 1 348 ? 19.571  -48.952 1.870   1.00 95.27  ?  352 LYS A CD     1 
ATOM 5435  C CE     . LYS A 1 348 ? 19.462  -49.230 0.376   1.00 76.84  ?  352 LYS A CE     1 
ATOM 5436  N NZ     . LYS A 1 348 ? 18.755  -50.503 0.088   1.00 76.96  ?  352 LYS A NZ     1 
ATOM 5437  H H      . LYS A 1 348 ? 17.281  -46.972 3.157   1.00 109.71 ?  352 LYS A H      1 
ATOM 5438  H HA     . LYS A 1 348 ? 18.760  -45.641 4.744   1.00 110.11 ?  352 LYS A HA     1 
ATOM 5439  H HB2    . LYS A 1 348 ? 20.540  -46.900 3.918   1.00 127.18 ?  352 LYS A HB2    1 
ATOM 5440  H HB3    . LYS A 1 348 ? 19.260  -47.832 4.068   1.00 127.18 ?  352 LYS A HB3    1 
ATOM 5441  H HG2    . LYS A 1 348 ? 19.072  -46.997 1.615   1.00 124.86 ?  352 LYS A HG2    1 
ATOM 5442  H HG3    . LYS A 1 348 ? 20.634  -47.220 1.789   1.00 124.86 ?  352 LYS A HG3    1 
ATOM 5443  H HD2    . LYS A 1 348 ? 20.337  -49.435 2.219   1.00 114.33 ?  352 LYS A HD2    1 
ATOM 5444  H HD3    . LYS A 1 348 ? 18.755  -49.252 2.300   1.00 114.33 ?  352 LYS A HD3    1 
ATOM 5445  H HE2    . LYS A 1 348 ? 18.969  -48.509 -0.046  1.00 92.21  ?  352 LYS A HE2    1 
ATOM 5446  H HE3    . LYS A 1 348 ? 20.354  -49.289 -0.002  1.00 92.21  ?  352 LYS A HE3    1 
ATOM 5447  H HZ1    . LYS A 1 348 ? 18.709  -50.634 -0.791  1.00 92.35  ?  352 LYS A HZ1    1 
ATOM 5448  H HZ2    . LYS A 1 348 ? 19.191  -51.184 0.459   1.00 92.35  ?  352 LYS A HZ2    1 
ATOM 5449  H HZ3    . LYS A 1 348 ? 17.929  -50.474 0.419   1.00 92.35  ?  352 LYS A HZ3    1 
ATOM 5450  N N      . ASP A 1 349 ? 19.136  -44.583 1.743   1.00 92.64  ?  353 ASP A N      1 
ATOM 5451  C CA     . ASP A 1 349 ? 19.712  -43.553 0.883   1.00 89.38  ?  353 ASP A CA     1 
ATOM 5452  C C      . ASP A 1 349 ? 18.550  -42.736 0.334   1.00 75.19  ?  353 ASP A C      1 
ATOM 5453  O O      . ASP A 1 349 ? 17.872  -43.159 -0.608  1.00 82.73  ?  353 ASP A O      1 
ATOM 5454  C CB     . ASP A 1 349 ? 20.543  -44.176 -0.233  1.00 108.71 ?  353 ASP A CB     1 
ATOM 5455  C CG     . ASP A 1 349 ? 21.418  -43.167 -0.943  1.00 112.79 ?  353 ASP A CG     1 
ATOM 5456  O OD1    . ASP A 1 349 ? 22.106  -42.386 -0.252  1.00 106.54 ?  353 ASP A OD1    1 
ATOM 5457  O OD2    . ASP A 1 349 ? 21.416  -43.151 -2.191  1.00 91.86  ?  353 ASP A OD2    1 
ATOM 5458  H H      . ASP A 1 349 ? 18.639  -45.140 1.316   1.00 111.16 ?  353 ASP A H      1 
ATOM 5459  H HA     . ASP A 1 349 ? 20.283  -42.969 1.407   1.00 107.25 ?  353 ASP A HA     1 
ATOM 5460  H HB2    . ASP A 1 349 ? 21.118  -44.859 0.145   1.00 130.45 ?  353 ASP A HB2    1 
ATOM 5461  H HB3    . ASP A 1 349 ? 19.946  -44.570 -0.889  1.00 130.45 ?  353 ASP A HB3    1 
ATOM 5462  N N      . PHE A 1 350 ? 18.317  -41.572 0.930   1.00 62.94  ?  354 PHE A N      1 
ATOM 5463  C CA     . PHE A 1 350 ? 17.151  -40.747 0.630   1.00 56.95  ?  354 PHE A CA     1 
ATOM 5464  C C      . PHE A 1 350 ? 17.663  -39.361 0.255   1.00 71.28  ?  354 PHE A C      1 
ATOM 5465  O O      . PHE A 1 350 ? 17.958  -38.539 1.128   1.00 86.45  ?  354 PHE A O      1 
ATOM 5466  C CB     . PHE A 1 350 ? 16.212  -40.708 1.831   1.00 54.78  ?  354 PHE A CB     1 
ATOM 5467  C CG     . PHE A 1 350 ? 14.762  -40.904 1.493   1.00 49.07  ?  354 PHE A CG     1 
ATOM 5468  C CD1    . PHE A 1 350 ? 14.363  -41.914 0.638   1.00 52.77  ?  354 PHE A CD1    1 
ATOM 5469  C CD2    . PHE A 1 350 ? 13.792  -40.105 2.073   1.00 53.53  ?  354 PHE A CD2    1 
ATOM 5470  C CE1    . PHE A 1 350 ? 13.031  -42.103 0.344   1.00 49.18  ?  354 PHE A CE1    1 
ATOM 5471  C CE2    . PHE A 1 350 ? 12.458  -40.294 1.781   1.00 47.67  ?  354 PHE A CE2    1 
ATOM 5472  C CZ     . PHE A 1 350 ? 12.079  -41.293 0.918   1.00 47.76  ?  354 PHE A CZ     1 
ATOM 5473  H H      . PHE A 1 350 ? 18.834  -41.229 1.526   1.00 75.53  ?  354 PHE A H      1 
ATOM 5474  H HA     . PHE A 1 350 ? 16.672  -41.118 -0.128  1.00 68.34  ?  354 PHE A HA     1 
ATOM 5475  H HB2    . PHE A 1 350 ? 16.468  -41.411 2.448   1.00 65.73  ?  354 PHE A HB2    1 
ATOM 5476  H HB3    . PHE A 1 350 ? 16.299  -39.845 2.265   1.00 65.73  ?  354 PHE A HB3    1 
ATOM 5477  H HD1    . PHE A 1 350 ? 15.002  -42.464 0.246   1.00 63.33  ?  354 PHE A HD1    1 
ATOM 5478  H HD2    . PHE A 1 350 ? 14.043  -39.427 2.657   1.00 64.24  ?  354 PHE A HD2    1 
ATOM 5479  H HE1    . PHE A 1 350 ? 12.775  -42.780 -0.240  1.00 59.02  ?  354 PHE A HE1    1 
ATOM 5480  H HE2    . PHE A 1 350 ? 11.815  -39.745 2.169   1.00 57.21  ?  354 PHE A HE2    1 
ATOM 5481  H HZ     . PHE A 1 350 ? 11.179  -41.420 0.720   1.00 57.31  ?  354 PHE A HZ     1 
ATOM 5482  N N      . THR A 1 351 ? 17.785  -39.109 -1.043  1.00 72.62  ?  355 THR A N      1 
ATOM 5483  C CA     . THR A 1 351 ? 18.355  -37.862 -1.517  1.00 64.73  ?  355 THR A CA     1 
ATOM 5484  C C      . THR A 1 351 ? 17.321  -36.747 -1.497  1.00 71.32  ?  355 THR A C      1 
ATOM 5485  O O      . THR A 1 351 ? 16.111  -36.986 -1.551  1.00 74.66  ?  355 THR A O      1 
ATOM 5486  C CB     . THR A 1 351 ? 18.901  -38.028 -2.932  1.00 72.93  ?  355 THR A CB     1 
ATOM 5487  O OG1    . THR A 1 351 ? 17.941  -38.729 -3.733  1.00 57.78  ?  355 THR A OG1    1 
ATOM 5488  C CG2    . THR A 1 351 ? 20.207  -38.798 -2.912  1.00 79.81  ?  355 THR A CG2    1 
ATOM 5489  H H      . THR A 1 351 ? 17.544  -39.648 -1.669  1.00 87.14  ?  355 THR A H      1 
ATOM 5490  H HA     . THR A 1 351 ? 19.089  -37.605 -0.937  1.00 77.68  ?  355 THR A HA     1 
ATOM 5491  H HB     . THR A 1 351 ? 19.066  -37.154 -3.319  1.00 87.52  ?  355 THR A HB     1 
ATOM 5492  H HG1    . THR A 1 351 ? 18.234  -38.825 -4.515  1.00 69.34  ?  355 THR A HG1    1 
ATOM 5493  H HG21   . THR A 1 351 ? 20.546  -38.900 -3.815  1.00 95.77  ?  355 THR A HG21   1 
ATOM 5494  H HG22   . THR A 1 351 ? 20.864  -38.323 -2.380  1.00 95.77  ?  355 THR A HG22   1 
ATOM 5495  H HG23   . THR A 1 351 ? 20.067  -39.678 -2.527  1.00 95.77  ?  355 THR A HG23   1 
ATOM 5496  N N      . VAL A 1 352 ? 17.819  -35.511 -1.423  1.00 68.38  ?  356 VAL A N      1 
ATOM 5497  C CA     . VAL A 1 352 ? 16.946  -34.342 -1.451  1.00 57.22  ?  356 VAL A CA     1 
ATOM 5498  C C      . VAL A 1 352 ? 15.975  -34.433 -2.615  1.00 61.86  ?  356 VAL A C      1 
ATOM 5499  O O      . VAL A 1 352 ? 14.853  -33.920 -2.542  1.00 64.24  ?  356 VAL A O      1 
ATOM 5500  C CB     . VAL A 1 352 ? 17.788  -33.052 -1.517  1.00 46.32  ?  356 VAL A CB     1 
ATOM 5501  C CG1    . VAL A 1 352 ? 18.623  -32.903 -0.261  1.00 47.81  ?  356 VAL A CG1    1 
ATOM 5502  C CG2    . VAL A 1 352 ? 18.679  -33.055 -2.747  1.00 58.88  ?  356 VAL A CG2    1 
ATOM 5503  H H      . VAL A 1 352 ? 18.657  -35.325 -1.357  1.00 82.06  ?  356 VAL A H      1 
ATOM 5504  H HA     . VAL A 1 352 ? 16.427  -34.318 -0.631  1.00 68.66  ?  356 VAL A HA     1 
ATOM 5505  H HB     . VAL A 1 352 ? 17.194  -32.288 -1.576  1.00 55.59  ?  356 VAL A HB     1 
ATOM 5506  H HG11   . VAL A 1 352 ? 19.144  -32.087 -0.323  1.00 57.38  ?  356 VAL A HG11   1 
ATOM 5507  H HG12   . VAL A 1 352 ? 18.032  -32.862 0.507   1.00 57.38  ?  356 VAL A HG12   1 
ATOM 5508  H HG13   . VAL A 1 352 ? 19.214  -33.668 -0.183  1.00 57.38  ?  356 VAL A HG13   1 
ATOM 5509  H HG21   . VAL A 1 352 ? 19.197  -32.234 -2.764  1.00 70.66  ?  356 VAL A HG21   1 
ATOM 5510  H HG22   . VAL A 1 352 ? 19.274  -33.820 -2.705  1.00 70.66  ?  356 VAL A HG22   1 
ATOM 5511  H HG23   . VAL A 1 352 ? 18.123  -33.111 -3.540  1.00 70.66  ?  356 VAL A HG23   1 
ATOM 5512  N N      . GLU A 1 353 ? 16.382  -35.091 -3.702  1.00 65.36  ?  357 GLU A N      1 
ATOM 5513  C CA     . GLU A 1 353 ? 15.474  -35.306 -4.821  1.00 51.03  ?  357 GLU A CA     1 
ATOM 5514  C C      . GLU A 1 353 ? 14.378  -36.292 -4.444  1.00 62.68  ?  357 GLU A C      1 
ATOM 5515  O O      . GLU A 1 353 ? 13.191  -36.037 -4.677  1.00 60.74  ?  357 GLU A O      1 
ATOM 5516  C CB     . GLU A 1 353 ? 16.247  -35.808 -6.040  1.00 59.80  ?  357 GLU A CB     1 
ATOM 5517  C CG     . GLU A 1 353 ? 17.208  -34.794 -6.638  1.00 69.09  ?  357 GLU A CG     1 
ATOM 5518  C CD     . GLU A 1 353 ? 18.463  -34.610 -5.809  1.00 69.19  ?  357 GLU A CD     1 
ATOM 5519  O OE1    . GLU A 1 353 ? 18.831  -35.545 -5.070  1.00 65.03  ?  357 GLU A OE1    1 
ATOM 5520  O OE2    . GLU A 1 353 ? 19.082  -33.529 -5.894  1.00 89.15  -1 357 GLU A OE2    1 
ATOM 5521  H H      . GLU A 1 353 ? 17.170  -35.417 -3.813  1.00 78.43  ?  357 GLU A H      1 
ATOM 5522  H HA     . GLU A 1 353 ? 15.054  -34.464 -5.056  1.00 61.23  ?  357 GLU A HA     1 
ATOM 5523  H HB2    . GLU A 1 353 ? 16.765  -36.586 -5.780  1.00 71.76  ?  357 GLU A HB2    1 
ATOM 5524  H HB3    . GLU A 1 353 ? 15.612  -36.055 -6.731  1.00 71.76  ?  357 GLU A HB3    1 
ATOM 5525  H HG2    . GLU A 1 353 ? 17.474  -35.093 -7.521  1.00 82.91  ?  357 GLU A HG2    1 
ATOM 5526  H HG3    . GLU A 1 353 ? 16.762  -33.935 -6.700  1.00 82.91  ?  357 GLU A HG3    1 
ATOM 5527  N N      . ILE A 1 354 ? 14.757  -37.424 -3.851  1.00 70.29  ?  358 ILE A N      1 
ATOM 5528  C CA     . ILE A 1 354 ? 13.771  -38.428 -3.470  1.00 68.45  ?  358 ILE A CA     1 
ATOM 5529  C C      . ILE A 1 354 ? 12.864  -37.885 -2.374  1.00 58.56  ?  358 ILE A C      1 
ATOM 5530  O O      . ILE A 1 354 ? 11.634  -37.919 -2.489  1.00 51.62  ?  358 ILE A O      1 
ATOM 5531  C CB     . ILE A 1 354 ? 14.471  -39.729 -3.035  1.00 60.97  ?  358 ILE A CB     1 
ATOM 5532  C CG1    . ILE A 1 354 ? 15.303  -40.292 -4.190  1.00 69.76  ?  358 ILE A CG1    1 
ATOM 5533  C CG2    . ILE A 1 354 ? 13.445  -40.762 -2.584  1.00 59.10  ?  358 ILE A CG2    1 
ATOM 5534  C CD1    . ILE A 1 354 ? 16.199  -41.454 -3.803  1.00 66.44  ?  358 ILE A CD1    1 
ATOM 5535  H H      . ILE A 1 354 ? 15.570  -37.631 -3.661  1.00 84.35  ?  358 ILE A H      1 
ATOM 5536  H HA     . ILE A 1 354 ? 13.217  -38.632 -4.240  1.00 82.13  ?  358 ILE A HA     1 
ATOM 5537  H HB     . ILE A 1 354 ? 15.062  -39.531 -2.292  1.00 73.16  ?  358 ILE A HB     1 
ATOM 5538  H HG12   . ILE A 1 354 ? 14.701  -40.602 -4.884  1.00 83.71  ?  358 ILE A HG12   1 
ATOM 5539  H HG13   . ILE A 1 354 ? 15.870  -39.586 -4.538  1.00 83.71  ?  358 ILE A HG13   1 
ATOM 5540  H HG21   . ILE A 1 354 ? 13.909  -41.570 -2.315  1.00 70.91  ?  358 ILE A HG21   1 
ATOM 5541  H HG22   . ILE A 1 354 ? 12.945  -40.403 -1.834  1.00 70.91  ?  358 ILE A HG22   1 
ATOM 5542  H HG23   . ILE A 1 354 ? 12.845  -40.953 -3.321  1.00 70.91  ?  358 ILE A HG23   1 
ATOM 5543  H HD11   . ILE A 1 354 ? 16.688  -41.749 -4.587  1.00 79.73  ?  358 ILE A HD11   1 
ATOM 5544  H HD12   . ILE A 1 354 ? 16.818  -41.160 -3.117  1.00 79.73  ?  358 ILE A HD12   1 
ATOM 5545  H HD13   . ILE A 1 354 ? 15.648  -42.177 -3.464  1.00 79.73  ?  358 ILE A HD13   1 
ATOM 5546  N N      . ALA A 1 355 ? 13.459  -37.369 -1.296  1.00 55.57  ?  359 ALA A N      1 
ATOM 5547  C CA     . ALA A 1 355 ? 12.662  -36.827 -0.202  1.00 43.09  ?  359 ALA A CA     1 
ATOM 5548  C C      . ALA A 1 355 ? 11.647  -35.820 -0.717  1.00 55.49  ?  359 ALA A C      1 
ATOM 5549  O O      . ALA A 1 355 ? 10.477  -35.843 -0.319  1.00 52.55  ?  359 ALA A O      1 
ATOM 5550  C CB     . ALA A 1 355 ? 13.575  -36.185 0.842   1.00 47.07  ?  359 ALA A CB     1 
ATOM 5551  H H      . ALA A 1 355 ? 14.309  -37.323 -1.177  1.00 66.68  ?  359 ALA A H      1 
ATOM 5552  H HA     . ALA A 1 355 ? 12.178  -37.551 0.226   1.00 51.71  ?  359 ALA A HA     1 
ATOM 5553  H HB1    . ALA A 1 355 ? 13.030  -35.830 1.561   1.00 56.48  ?  359 ALA A HB1    1 
ATOM 5554  H HB2    . ALA A 1 355 ? 14.182  -36.858 1.187   1.00 56.48  ?  359 ALA A HB2    1 
ATOM 5555  H HB3    . ALA A 1 355 ? 14.078  -35.469 0.423   1.00 56.48  ?  359 ALA A HB3    1 
ATOM 5556  N N      . PHE A 1 356 ? 12.074  -34.931 -1.613  1.00 73.65  ?  360 PHE A N      1 
ATOM 5557  C CA     . PHE A 1 356 ? 11.138  -34.006 -2.240  1.00 75.00  ?  360 PHE A CA     1 
ATOM 5558  C C      . PHE A 1 356 ? 10.138  -34.755 -3.107  1.00 60.48  ?  360 PHE A C      1 
ATOM 5559  O O      . PHE A 1 356 ? 8.932   -34.486 -3.056  1.00 64.95  ?  360 PHE A O      1 
ATOM 5560  C CB     . PHE A 1 356 ? 11.900  -32.971 -3.067  1.00 75.06  ?  360 PHE A CB     1 
ATOM 5561  C CG     . PHE A 1 356 ? 11.031  -32.196 -4.013  1.00 58.35  ?  360 PHE A CG     1 
ATOM 5562  C CD1    . PHE A 1 356 ? 11.093  -32.429 -5.375  1.00 55.98  ?  360 PHE A CD1    1 
ATOM 5563  C CD2    . PHE A 1 356 ? 10.152  -31.236 -3.543  1.00 61.18  ?  360 PHE A CD2    1 
ATOM 5564  C CE1    . PHE A 1 356 ? 10.299  -31.721 -6.248  1.00 44.70  ?  360 PHE A CE1    1 
ATOM 5565  C CE2    . PHE A 1 356 ? 9.355   -30.526 -4.414  1.00 58.06  ?  360 PHE A CE2    1 
ATOM 5566  C CZ     . PHE A 1 356 ? 9.429   -30.770 -5.768  1.00 54.71  ?  360 PHE A CZ     1 
ATOM 5567  H H      . PHE A 1 356 ? 12.890  -34.845 -1.871  1.00 88.38  ?  360 PHE A H      1 
ATOM 5568  H HA     . PHE A 1 356 ? 10.646  -33.536 -1.549  1.00 90.00  ?  360 PHE A HA     1 
ATOM 5569  H HB2    . PHE A 1 356 ? 12.321  -32.338 -2.465  1.00 90.07  ?  360 PHE A HB2    1 
ATOM 5570  H HB3    . PHE A 1 356 ? 12.576  -33.427 -3.591  1.00 90.07  ?  360 PHE A HB3    1 
ATOM 5571  H HD1    . PHE A 1 356 ? 11.680  -33.071 -5.704  1.00 67.18  ?  360 PHE A HD1    1 
ATOM 5572  H HD2    . PHE A 1 356 ? 10.099  -31.069 -2.630  1.00 73.41  ?  360 PHE A HD2    1 
ATOM 5573  H HE1    . PHE A 1 356 ? 10.350  -31.887 -7.162  1.00 53.64  ?  360 PHE A HE1    1 
ATOM 5574  H HE2    . PHE A 1 356 ? 8.767   -29.883 -4.089  1.00 69.67  ?  360 PHE A HE2    1 
ATOM 5575  H HZ     . PHE A 1 356 ? 8.892   -30.291 -6.357  1.00 65.65  ?  360 PHE A HZ     1 
ATOM 5576  N N      . LEU A 1 357 ? 10.621  -35.703 -3.912  1.00 59.84  ?  361 LEU A N      1 
ATOM 5577  C CA     . LEU A 1 357 ? 9.720   -36.532 -4.701  1.00 60.28  ?  361 LEU A CA     1 
ATOM 5578  C C      . LEU A 1 357 ? 8.600   -37.076 -3.828  1.00 60.50  ?  361 LEU A C      1 
ATOM 5579  O O      . LEU A 1 357 ? 7.422   -37.013 -4.192  1.00 57.57  ?  361 LEU A O      1 
ATOM 5580  C CB     . LEU A 1 357 ? 10.498  -37.676 -5.353  1.00 56.32  ?  361 LEU A CB     1 
ATOM 5581  C CG     . LEU A 1 357 ? 9.969   -38.219 -6.684  1.00 55.53  ?  361 LEU A CG     1 
ATOM 5582  C CD1    . LEU A 1 357 ? 8.477   -38.505 -6.629  1.00 62.88  ?  361 LEU A CD1    1 
ATOM 5583  C CD2    . LEU A 1 357 ? 10.278  -37.250 -7.808  1.00 73.02  ?  361 LEU A CD2    1 
ATOM 5584  H H      . LEU A 1 357 ? 11.456  -35.883 -4.015  1.00 71.81  ?  361 LEU A H      1 
ATOM 5585  H HA     . LEU A 1 357 ? 9.323   -35.994 -5.404  1.00 72.33  ?  361 LEU A HA     1 
ATOM 5586  H HB2    . LEU A 1 357 ? 11.404  -37.370 -5.512  1.00 67.58  ?  361 LEU A HB2    1 
ATOM 5587  H HB3    . LEU A 1 357 ? 10.517  -38.419 -4.731  1.00 67.58  ?  361 LEU A HB3    1 
ATOM 5588  H HG     . LEU A 1 357 ? 10.422  -39.053 -6.881  1.00 66.64  ?  361 LEU A HG     1 
ATOM 5589  H HD11   . LEU A 1 357 ? 8.189   -38.845 -7.490  1.00 75.45  ?  361 LEU A HD11   1 
ATOM 5590  H HD12   . LEU A 1 357 ? 8.308   -39.165 -5.938  1.00 75.45  ?  361 LEU A HD12   1 
ATOM 5591  H HD13   . LEU A 1 357 ? 8.005   -37.683 -6.423  1.00 75.45  ?  361 LEU A HD13   1 
ATOM 5592  H HD21   . LEU A 1 357 ? 9.935   -37.613 -8.639  1.00 87.62  ?  361 LEU A HD21   1 
ATOM 5593  H HD22   . LEU A 1 357 ? 9.853   -36.399 -7.617  1.00 87.62  ?  361 LEU A HD22   1 
ATOM 5594  H HD23   . LEU A 1 357 ? 11.239  -37.134 -7.868  1.00 87.62  ?  361 LEU A HD23   1 
ATOM 5595  N N      . PHE A 1 358 ? 8.956   -37.589 -2.649  1.00 60.07  ?  362 PHE A N      1 
ATOM 5596  C CA     . PHE A 1 358 ? 7.964   -38.148 -1.739  1.00 53.32  ?  362 PHE A CA     1 
ATOM 5597  C C      . PHE A 1 358 ? 6.886   -37.124 -1.415  1.00 63.93  ?  362 PHE A C      1 
ATOM 5598  O O      . PHE A 1 358 ? 5.691   -37.372 -1.613  1.00 64.59  ?  362 PHE A O      1 
ATOM 5599  C CB     . PHE A 1 358 ? 8.657   -38.635 -0.465  1.00 62.61  ?  362 PHE A CB     1 
ATOM 5600  C CG     . PHE A 1 358 ? 7.749   -39.360 0.483   1.00 54.47  ?  362 PHE A CG     1 
ATOM 5601  C CD1    . PHE A 1 358 ? 7.142   -40.547 0.113   1.00 72.48  ?  362 PHE A CD1    1 
ATOM 5602  C CD2    . PHE A 1 358 ? 7.515   -38.861 1.750   1.00 49.65  ?  362 PHE A CD2    1 
ATOM 5603  C CE1    . PHE A 1 358 ? 6.309   -41.214 0.988   1.00 61.47  ?  362 PHE A CE1    1 
ATOM 5604  C CE2    . PHE A 1 358 ? 6.685   -39.525 2.627   1.00 60.56  ?  362 PHE A CE2    1 
ATOM 5605  C CZ     . PHE A 1 358 ? 6.082   -40.703 2.246   1.00 64.02  ?  362 PHE A CZ     1 
ATOM 5606  H H      . PHE A 1 358 ? 9.764   -37.624 -2.357  1.00 72.09  ?  362 PHE A H      1 
ATOM 5607  H HA     . PHE A 1 358 ? 7.538   -38.911 -2.161  1.00 63.98  ?  362 PHE A HA     1 
ATOM 5608  H HB2    . PHE A 1 358 ? 9.373   -39.242 -0.712  1.00 75.13  ?  362 PHE A HB2    1 
ATOM 5609  H HB3    . PHE A 1 358 ? 9.024   -37.869 0.003   1.00 75.13  ?  362 PHE A HB3    1 
ATOM 5610  H HD1    . PHE A 1 358 ? 7.291   -40.895 -0.736  1.00 86.98  ?  362 PHE A HD1    1 
ATOM 5611  H HD2    . PHE A 1 358 ? 7.919   -38.066 2.013   1.00 59.58  ?  362 PHE A HD2    1 
ATOM 5612  H HE1    . PHE A 1 358 ? 5.903   -42.010 0.729   1.00 73.77  ?  362 PHE A HE1    1 
ATOM 5613  H HE2    . PHE A 1 358 ? 6.533   -39.178 3.477   1.00 72.67  ?  362 PHE A HE2    1 
ATOM 5614  H HZ     . PHE A 1 358 ? 5.522   -41.152 2.837   1.00 76.83  ?  362 PHE A HZ     1 
ATOM 5615  N N      . ARG A 1 359 ? 7.293   -35.956 -0.916  1.00 60.56  ?  363 ARG A N      1 
ATOM 5616  C CA     . ARG A 1 359 ? 6.323   -34.913 -0.606  1.00 60.99  ?  363 ARG A CA     1 
ATOM 5617  C C      . ARG A 1 359 ? 5.499   -34.553 -1.833  1.00 64.04  ?  363 ARG A C      1 
ATOM 5618  O O      . ARG A 1 359 ? 4.276   -34.392 -1.746  1.00 59.75  ?  363 ARG A O      1 
ATOM 5619  C CB     . ARG A 1 359 ? 7.040   -33.678 -0.063  1.00 67.54  ?  363 ARG A CB     1 
ATOM 5620  C CG     . ARG A 1 359 ? 6.124   -32.493 0.193   1.00 74.35  ?  363 ARG A CG     1 
ATOM 5621  C CD     . ARG A 1 359 ? 6.896   -31.319 0.763   1.00 87.14  ?  363 ARG A CD     1 
ATOM 5622  N NE     . ARG A 1 359 ? 7.729   -30.658 -0.238  1.00 67.89  ?  363 ARG A NE     1 
ATOM 5623  C CZ     . ARG A 1 359 ? 7.390   -29.552 -0.894  1.00 67.63  ?  363 ARG A CZ     1 
ATOM 5624  N NH1    . ARG A 1 359 ? 6.226   -28.956 -0.669  1.00 65.42  1  363 ARG A NH1    1 
ATOM 5625  N NH2    . ARG A 1 359 ? 8.223   -29.033 -1.783  1.00 85.87  ?  363 ARG A NH2    1 
ATOM 5626  H H      . ARG A 1 359 ? 8.111   -35.748 -0.751  1.00 72.67  ?  363 ARG A H      1 
ATOM 5627  H HA     . ARG A 1 359 ? 5.718   -35.236 0.080   1.00 73.18  ?  363 ARG A HA     1 
ATOM 5628  H HB2    . ARG A 1 359 ? 7.466   -33.910 0.777   1.00 81.04  ?  363 ARG A HB2    1 
ATOM 5629  H HB3    . ARG A 1 359 ? 7.711   -33.400 -0.706  1.00 81.04  ?  363 ARG A HB3    1 
ATOM 5630  H HG2    . ARG A 1 359 ? 5.718   -32.214 -0.643  1.00 89.22  ?  363 ARG A HG2    1 
ATOM 5631  H HG3    . ARG A 1 359 ? 5.440   -32.747 0.832   1.00 89.22  ?  363 ARG A HG3    1 
ATOM 5632  H HD2    . ARG A 1 359 ? 6.268   -30.666 1.110   1.00 104.57 ?  363 ARG A HD2    1 
ATOM 5633  H HD3    . ARG A 1 359 ? 7.474   -31.636 1.475   1.00 104.57 ?  363 ARG A HD3    1 
ATOM 5634  H HE     . ARG A 1 359 ? 8.494   -31.009 -0.415  1.00 81.47  ?  363 ARG A HE     1 
ATOM 5635  H HH11   . ARG A 1 359 ? 5.678   -29.285 -0.093  1.00 78.51  ?  363 ARG A HH11   1 
ATOM 5636  H HH12   . ARG A 1 359 ? 6.018   -28.241 -1.100  1.00 78.51  ?  363 ARG A HH12   1 
ATOM 5637  H HH21   . ARG A 1 359 ? 8.979   -29.412 -1.936  1.00 103.04 ?  363 ARG A HH21   1 
ATOM 5638  H HH22   . ARG A 1 359 ? 8.006   -28.318 -2.209  1.00 103.04 ?  363 ARG A HH22   1 
ATOM 5639  N N      . ALA A 1 360 ? 6.152   -34.431 -2.989  1.00 64.73  ?  364 ALA A N      1 
ATOM 5640  C CA     . ALA A 1 360 ? 5.453   -33.995 -4.192  1.00 64.71  ?  364 ALA A CA     1 
ATOM 5641  C C      . ALA A 1 360 ? 4.391   -35.002 -4.605  1.00 56.78  ?  364 ALA A C      1 
ATOM 5642  O O      . ALA A 1 360 ? 3.242   -34.635 -4.873  1.00 58.43  ?  364 ALA A O      1 
ATOM 5643  C CB     . ALA A 1 360 ? 6.455   -33.774 -5.324  1.00 59.13  ?  364 ALA A CB     1 
ATOM 5644  H H      . ALA A 1 360 ? 6.989   -34.592 -3.100  1.00 77.68  ?  364 ALA A H      1 
ATOM 5645  H HA     . ALA A 1 360 ? 5.012   -33.150 -4.012  1.00 77.66  ?  364 ALA A HA     1 
ATOM 5646  H HB1    . ALA A 1 360 ? 5.976   -33.484 -6.116  1.00 70.96  ?  364 ALA A HB1    1 
ATOM 5647  H HB2    . ALA A 1 360 ? 7.090   -33.093 -5.054  1.00 70.96  ?  364 ALA A HB2    1 
ATOM 5648  H HB3    . ALA A 1 360 ? 6.918   -34.607 -5.502  1.00 70.96  ?  364 ALA A HB3    1 
ATOM 5649  N N      . ILE A 1 361 ? 4.754   -36.284 -4.663  1.00 68.85  ?  365 ILE A N      1 
ATOM 5650  C CA     . ILE A 1 361 ? 3.806   -37.284 -5.138  1.00 67.56  ?  365 ILE A CA     1 
ATOM 5651  C C      . ILE A 1 361 ? 2.663   -37.453 -4.147  1.00 70.37  ?  365 ILE A C      1 
ATOM 5652  O O      . ILE A 1 361 ? 1.496   -37.558 -4.541  1.00 71.59  ?  365 ILE A O      1 
ATOM 5653  C CB     . ILE A 1 361 ? 4.516   -38.623 -5.413  1.00 52.53  ?  365 ILE A CB     1 
ATOM 5654  C CG1    . ILE A 1 361 ? 3.518   -39.670 -5.912  1.00 55.50  ?  365 ILE A CG1    1 
ATOM 5655  C CG2    . ILE A 1 361 ? 5.182   -39.162 -4.157  1.00 75.37  ?  365 ILE A CG2    1 
ATOM 5656  C CD1    . ILE A 1 361 ? 2.686   -39.244 -7.098  1.00 62.41  ?  365 ILE A CD1    1 
ATOM 5657  H H      . ILE A 1 361 ? 5.525   -36.592 -4.438  1.00 82.62  ?  365 ILE A H      1 
ATOM 5658  H HA     . ILE A 1 361 ? 3.425   -36.977 -5.976  1.00 81.08  ?  365 ILE A HA     1 
ATOM 5659  H HB     . ILE A 1 361 ? 5.193   -38.485 -6.094  1.00 63.04  ?  365 ILE A HB     1 
ATOM 5660  H HG12   . ILE A 1 361 ? 4.009   -40.466 -6.169  1.00 66.60  ?  365 ILE A HG12   1 
ATOM 5661  H HG13   . ILE A 1 361 ? 2.908   -39.884 -5.188  1.00 66.60  ?  365 ILE A HG13   1 
ATOM 5662  H HG21   . ILE A 1 361 ? 5.618   -40.003 -4.367  1.00 90.45  ?  365 ILE A HG21   1 
ATOM 5663  H HG22   . ILE A 1 361 ? 5.838   -38.518 -3.847  1.00 90.45  ?  365 ILE A HG22   1 
ATOM 5664  H HG23   . ILE A 1 361 ? 4.505   -39.300 -3.476  1.00 90.45  ?  365 ILE A HG23   1 
ATOM 5665  H HD11   . ILE A 1 361 ? 2.087   -39.967 -7.340  1.00 74.90  ?  365 ILE A HD11   1 
ATOM 5666  H HD12   . ILE A 1 361 ? 2.173   -38.456 -6.856  1.00 74.90  ?  365 ILE A HD12   1 
ATOM 5667  H HD13   . ILE A 1 361 ? 3.276   -39.040 -7.840  1.00 74.90  ?  365 ILE A HD13   1 
ATOM 5668  N N      . TYR A 1 362 ? 2.972   -37.477 -2.850  1.00 63.17  ?  366 TYR A N      1 
ATOM 5669  C CA     . TYR A 1 362 ? 1.942   -37.765 -1.859  1.00 64.85  ?  366 TYR A CA     1 
ATOM 5670  C C      . TYR A 1 362 ? 0.884   -36.670 -1.836  1.00 72.42  ?  366 TYR A C      1 
ATOM 5671  O O      . TYR A 1 362 ? -0.317  -36.951 -1.929  1.00 77.91  ?  366 TYR A O      1 
ATOM 5672  C CB     . TYR A 1 362 ? 2.570   -37.941 -0.477  1.00 67.31  ?  366 TYR A CB     1 
ATOM 5673  C CG     . TYR A 1 362 ? 1.575   -38.386 0.568   1.00 68.47  ?  366 TYR A CG     1 
ATOM 5674  C CD1    . TYR A 1 362 ? 1.070   -39.679 0.565   1.00 77.69  ?  366 TYR A CD1    1 
ATOM 5675  C CD2    . TYR A 1 362 ? 1.134   -37.515 1.552   1.00 62.13  ?  366 TYR A CD2    1 
ATOM 5676  C CE1    . TYR A 1 362 ? 0.157   -40.091 1.513   1.00 82.18  ?  366 TYR A CE1    1 
ATOM 5677  C CE2    . TYR A 1 362 ? 0.222   -37.918 2.506   1.00 66.11  ?  366 TYR A CE2    1 
ATOM 5678  C CZ     . TYR A 1 362 ? -0.263  -39.207 2.481   1.00 67.89  ?  366 TYR A CZ     1 
ATOM 5679  O OH     . TYR A 1 362 ? -1.173  -39.617 3.426   1.00 72.11  ?  366 TYR A OH     1 
ATOM 5680  H H      . TYR A 1 362 ? 3.756   -37.333 -2.525  1.00 75.81  ?  366 TYR A H      1 
ATOM 5681  H HA     . TYR A 1 362 ? 1.504   -38.598 -2.096  1.00 77.82  ?  366 TYR A HA     1 
ATOM 5682  H HB2    . TYR A 1 362 ? 3.268   -38.613 -0.531  1.00 80.77  ?  366 TYR A HB2    1 
ATOM 5683  H HB3    . TYR A 1 362 ? 2.946   -37.094 -0.191  1.00 80.77  ?  366 TYR A HB3    1 
ATOM 5684  H HD1    . TYR A 1 362 ? 1.352   -40.278 -0.088  1.00 93.23  ?  366 TYR A HD1    1 
ATOM 5685  H HD2    . TYR A 1 362 ? 1.460   -36.644 1.570   1.00 74.56  ?  366 TYR A HD2    1 
ATOM 5686  H HE1    . TYR A 1 362 ? -0.172  -40.961 1.500   1.00 98.62  ?  366 TYR A HE1    1 
ATOM 5687  H HE2    . TYR A 1 362 ? -0.064  -37.323 3.160   1.00 79.34  ?  366 TYR A HE2    1 
ATOM 5688  H HH     . TYR A 1 362 ? -1.383  -40.420 3.294   1.00 86.54  ?  366 TYR A HH     1 
ATOM 5689  N N      . LEU A 1 363 ? 1.308   -35.411 -1.714  1.00 74.52  ?  367 LEU A N      1 
ATOM 5690  C CA     . LEU A 1 363 ? 0.346   -34.316 -1.712  1.00 73.35  ?  367 LEU A CA     1 
ATOM 5691  C C      . LEU A 1 363 ? -0.405  -34.228 -3.034  1.00 75.32  ?  367 LEU A C      1 
ATOM 5692  O O      . LEU A 1 363 ? -1.534  -33.727 -3.072  1.00 93.81  ?  367 LEU A O      1 
ATOM 5693  C CB     . LEU A 1 363 ? 1.050   -32.992 -1.411  1.00 74.98  ?  367 LEU A CB     1 
ATOM 5694  C CG     . LEU A 1 363 ? 1.202   -32.651 0.074   1.00 64.82  ?  367 LEU A CG     1 
ATOM 5695  C CD1    . LEU A 1 363 ? 2.235   -33.543 0.740   1.00 75.87  ?  367 LEU A CD1    1 
ATOM 5696  C CD2    . LEU A 1 363 ? 1.560   -31.184 0.261   1.00 72.43  ?  367 LEU A CD2    1 
ATOM 5697  H H      . LEU A 1 363 ? 2.130   -35.171 -1.633  1.00 89.42  ?  367 LEU A H      1 
ATOM 5698  H HA     . LEU A 1 363 ? -0.306  -34.472 -1.011  1.00 88.01  ?  367 LEU A HA     1 
ATOM 5699  H HB2    . LEU A 1 363 ? 1.940   -33.023 -1.795  1.00 89.98  ?  367 LEU A HB2    1 
ATOM 5700  H HB3    . LEU A 1 363 ? 0.544   -32.274 -1.823  1.00 89.98  ?  367 LEU A HB3    1 
ATOM 5701  H HG     . LEU A 1 363 ? 0.353   -32.804 0.517   1.00 77.79  ?  367 LEU A HG     1 
ATOM 5702  H HD11   . LEU A 1 363 ? 2.306   -33.299 1.676   1.00 91.05  ?  367 LEU A HD11   1 
ATOM 5703  H HD12   . LEU A 1 363 ? 1.953   -34.467 0.658   1.00 91.05  ?  367 LEU A HD12   1 
ATOM 5704  H HD13   . LEU A 1 363 ? 3.091   -33.417 0.299   1.00 91.05  ?  367 LEU A HD13   1 
ATOM 5705  H HD21   . LEU A 1 363 ? 1.650   -30.999 1.209   1.00 86.91  ?  367 LEU A HD21   1 
ATOM 5706  H HD22   . LEU A 1 363 ? 2.399   -31.004 -0.192  1.00 86.91  ?  367 LEU A HD22   1 
ATOM 5707  H HD23   . LEU A 1 363 ? 0.855   -30.636 -0.118  1.00 86.91  ?  367 LEU A HD23   1 
ATOM 5708  N N      . TYR A 1 364 ? 0.194   -34.712 -4.123  1.00 62.63  ?  368 TYR A N      1 
ATOM 5709  C CA     . TYR A 1 364 ? -0.488  -34.680 -5.412  1.00 74.76  ?  368 TYR A CA     1 
ATOM 5710  C C      . TYR A 1 364 ? -1.696  -35.606 -5.410  1.00 84.77  ?  368 TYR A C      1 
ATOM 5711  O O      . TYR A 1 364 ? -2.799  -35.207 -5.800  1.00 85.85  ?  368 TYR A O      1 
ATOM 5712  C CB     . TYR A 1 364 ? 0.480   -35.068 -6.528  1.00 68.38  ?  368 TYR A CB     1 
ATOM 5713  C CG     . TYR A 1 364 ? -0.110  -34.937 -7.912  1.00 66.65  ?  368 TYR A CG     1 
ATOM 5714  C CD1    . TYR A 1 364 ? 0.032   -33.764 -8.637  1.00 82.46  ?  368 TYR A CD1    1 
ATOM 5715  C CD2    . TYR A 1 364 ? -0.811  -35.983 -8.491  1.00 67.59  ?  368 TYR A CD2    1 
ATOM 5716  C CE1    . TYR A 1 364 ? -0.504  -33.638 -9.901  1.00 78.53  ?  368 TYR A CE1    1 
ATOM 5717  C CE2    . TYR A 1 364 ? -1.352  -35.866 -9.755  1.00 66.05  ?  368 TYR A CE2    1 
ATOM 5718  C CZ     . TYR A 1 364 ? -1.195  -34.691 -10.455 1.00 63.76  ?  368 TYR A CZ     1 
ATOM 5719  O OH     . TYR A 1 364 ? -1.732  -34.570 -11.715 1.00 68.82  ?  368 TYR A OH     1 
ATOM 5720  H H      . TYR A 1 364 ? 0.981   -35.058 -4.141  1.00 75.16  ?  368 TYR A H      1 
ATOM 5721  H HA     . TYR A 1 364 ? -0.800  -33.778 -5.583  1.00 89.71  ?  368 TYR A HA     1 
ATOM 5722  H HB2    . TYR A 1 364 ? 1.259   -34.491 -6.481  1.00 82.05  ?  368 TYR A HB2    1 
ATOM 5723  H HB3    . TYR A 1 364 ? 0.746   -35.992 -6.405  1.00 82.05  ?  368 TYR A HB3    1 
ATOM 5724  H HD1    . TYR A 1 364 ? 0.499   -33.051 -8.265  1.00 98.95  ?  368 TYR A HD1    1 
ATOM 5725  H HD2    . TYR A 1 364 ? -0.918  -36.778 -8.020  1.00 81.11  ?  368 TYR A HD2    1 
ATOM 5726  H HE1    . TYR A 1 364 ? -0.400  -32.845 -10.376 1.00 94.23  ?  368 TYR A HE1    1 
ATOM 5727  H HE2    . TYR A 1 364 ? -1.819  -36.576 -10.131 1.00 79.26  ?  368 TYR A HE2    1 
ATOM 5728  H HH     . TYR A 1 364 ? -2.124  -35.281 -11.929 1.00 82.58  ?  368 TYR A HH     1 
ATOM 5729  N N      . CYS A 1 365 ? -1.505  -36.852 -4.975  1.00 86.91  ?  369 CYS A N      1 
ATOM 5730  C CA     . CYS A 1 365 ? -2.602  -37.811 -4.978  1.00 81.31  ?  369 CYS A CA     1 
ATOM 5731  C C      . CYS A 1 365 ? -3.739  -37.348 -4.076  1.00 84.27  ?  369 CYS A C      1 
ATOM 5732  O O      . CYS A 1 365 ? -4.916  -37.569 -4.385  1.00 95.81  ?  369 CYS A O      1 
ATOM 5733  C CB     . CYS A 1 365 ? -2.093  -39.184 -4.542  1.00 73.92  ?  369 CYS A CB     1 
ATOM 5734  S SG     . CYS A 1 365 ? -0.833  -39.876 -5.638  1.00 64.49  ?  369 CYS A SG     1 
ATOM 5735  H H      . CYS A 1 365 ? -0.759  -37.161 -4.678  1.00 104.29 ?  369 CYS A H      1 
ATOM 5736  H HA     . CYS A 1 365 ? -2.949  -37.892 -5.880  1.00 97.57  ?  369 CYS A HA     1 
ATOM 5737  H HB2    . CYS A 1 365 ? -1.706  -39.108 -3.656  1.00 88.70  ?  369 CYS A HB2    1 
ATOM 5738  H HB3    . CYS A 1 365 ? -2.840  -39.803 -4.522  1.00 88.70  ?  369 CYS A HB3    1 
ATOM 5739  H HG     . CYS A 1 365 ? 0.110   -39.134 -5.667  1.00 77.38  ?  369 CYS A HG     1 
ATOM 5740  N N      . LEU A 1 366 ? -3.410  -36.701 -2.957  1.00 80.73  ?  370 LEU A N      1 
ATOM 5741  C CA     . LEU A 1 366 ? -4.451  -36.211 -2.061  1.00 89.45  ?  370 LEU A CA     1 
ATOM 5742  C C      . LEU A 1 366 ? -5.273  -35.113 -2.722  1.00 101.88 ?  370 LEU A C      1 
ATOM 5743  O O      . LEU A 1 366 ? -6.500  -35.071 -2.570  1.00 110.20 ?  370 LEU A O      1 
ATOM 5744  C CB     . LEU A 1 366 ? -3.831  -35.697 -0.761  1.00 81.77  ?  370 LEU A CB     1 
ATOM 5745  C CG     . LEU A 1 366 ? -3.114  -36.708 0.135   1.00 76.05  ?  370 LEU A CG     1 
ATOM 5746  C CD1    . LEU A 1 366 ? -2.586  -36.015 1.380   1.00 72.47  ?  370 LEU A CD1    1 
ATOM 5747  C CD2    . LEU A 1 366 ? -4.029  -37.859 0.523   1.00 101.02 ?  370 LEU A CD2    1 
ATOM 5748  H H      . LEU A 1 366 ? -2.606  -36.537 -2.700  1.00 96.88  ?  370 LEU A H      1 
ATOM 5749  H HA     . LEU A 1 366 ? -5.048  -36.942 -1.841  1.00 107.33 ?  370 LEU A HA     1 
ATOM 5750  H HB2    . LEU A 1 366 ? -3.183  -35.012 -0.990  1.00 98.12  ?  370 LEU A HB2    1 
ATOM 5751  H HB3    . LEU A 1 366 ? -4.538  -35.299 -0.230  1.00 98.12  ?  370 LEU A HB3    1 
ATOM 5752  H HG     . LEU A 1 366 ? -2.357  -37.077 -0.346  1.00 91.25  ?  370 LEU A HG     1 
ATOM 5753  H HD11   . LEU A 1 366 ? -2.135  -36.669 1.937   1.00 86.96  ?  370 LEU A HD11   1 
ATOM 5754  H HD12   . LEU A 1 366 ? -1.963  -35.320 1.114   1.00 86.96  ?  370 LEU A HD12   1 
ATOM 5755  H HD13   . LEU A 1 366 ? -3.331  -35.625 1.864   1.00 86.96  ?  370 LEU A HD13   1 
ATOM 5756  H HD21   . LEU A 1 366 ? -3.538  -38.475 1.089   1.00 121.22 ?  370 LEU A HD21   1 
ATOM 5757  H HD22   . LEU A 1 366 ? -4.794  -37.505 1.003   1.00 121.22 ?  370 LEU A HD22   1 
ATOM 5758  H HD23   . LEU A 1 366 ? -4.324  -38.312 -0.283  1.00 121.22 ?  370 LEU A HD23   1 
ATOM 5759  N N      . ASP A 1 367 ? -4.618  -34.217 -3.462  1.00 99.49  ?  371 ASP A N      1 
ATOM 5760  C CA     . ASP A 1 367 ? -5.328  -33.089 -4.055  1.00 97.75  ?  371 ASP A CA     1 
ATOM 5761  C C      . ASP A 1 367 ? -6.324  -33.551 -5.111  1.00 101.20 ?  371 ASP A C      1 
ATOM 5762  O O      . ASP A 1 367 ? -7.438  -33.022 -5.193  1.00 102.36 ?  371 ASP A O      1 
ATOM 5763  C CB     . ASP A 1 367 ? -4.330  -32.104 -4.658  1.00 100.79 ?  371 ASP A CB     1 
ATOM 5764  C CG     . ASP A 1 367 ? -3.404  -31.513 -3.619  1.00 101.56 ?  371 ASP A CG     1 
ATOM 5765  O OD1    . ASP A 1 367 ? -2.714  -30.520 -3.929  1.00 102.86 ?  371 ASP A OD1    1 
ATOM 5766  O OD2    . ASP A 1 367 ? -3.374  -32.038 -2.486  1.00 96.01  -1 371 ASP A OD2    1 
ATOM 5767  H H      . ASP A 1 367 ? -3.775  -34.240 -3.632  1.00 119.39 ?  371 ASP A H      1 
ATOM 5768  H HA     . ASP A 1 367 ? -5.823  -32.627 -3.360  1.00 117.30 ?  371 ASP A HA     1 
ATOM 5769  H HB2    . ASP A 1 367 ? -3.787  -32.565 -5.316  1.00 120.95 ?  371 ASP A HB2    1 
ATOM 5770  H HB3    . ASP A 1 367 ? -4.816  -31.376 -5.077  1.00 120.95 ?  371 ASP A HB3    1 
ATOM 5771  N N      . ASN A 1 368 ? -5.944  -34.534 -5.926  1.00 93.03  ?  372 ASN A N      1 
ATOM 5772  C CA     . ASN A 1 368 ? -6.784  -35.007 -7.018  1.00 95.99  ?  372 ASN A CA     1 
ATOM 5773  C C      . ASN A 1 368 ? -7.404  -36.370 -6.740  1.00 98.85  ?  372 ASN A C      1 
ATOM 5774  O O      . ASN A 1 368 ? -8.044  -36.942 -7.629  1.00 95.60  ?  372 ASN A O      1 
ATOM 5775  C CB     . ASN A 1 368 ? -5.977  -35.054 -8.316  1.00 90.38  ?  372 ASN A CB     1 
ATOM 5776  C CG     . ASN A 1 368 ? -5.649  -33.674 -8.845  1.00 100.12 ?  372 ASN A CG     1 
ATOM 5777  O OD1    . ASN A 1 368 ? -6.489  -33.018 -9.461  1.00 110.36 ?  372 ASN A OD1    1 
ATOM 5778  N ND2    . ASN A 1 368 ? -4.423  -33.224 -8.609  1.00 89.43  ?  372 ASN A ND2    1 
ATOM 5779  H H      . ASN A 1 368 ? -5.192  -34.948 -5.863  1.00 111.63 ?  372 ASN A H      1 
ATOM 5780  H HA     . ASN A 1 368 ? -7.509  -34.376 -7.146  1.00 115.19 ?  372 ASN A HA     1 
ATOM 5781  H HB2    . ASN A 1 368 ? -5.142  -35.520 -8.153  1.00 108.45 ?  372 ASN A HB2    1 
ATOM 5782  H HB3    . ASN A 1 368 ? -6.492  -35.521 -8.993  1.00 108.45 ?  372 ASN A HB3    1 
ATOM 5783  H HD21   . ASN A 1 368 ? -4.189  -32.446 -8.889  1.00 107.32 ?  372 ASN A HD21   1 
ATOM 5784  H HD22   . ASN A 1 368 ? -3.863  -33.712 -8.175  1.00 107.32 ?  372 ASN A HD22   1 
ATOM 5785  N N      . ASN A 1 369 ? -7.231  -36.905 -5.533  1.00 100.16 ?  373 ASN A N      1 
ATOM 5786  C CA     . ASN A 1 369 ? -7.888  -38.146 -5.127  1.00 100.08 ?  373 ASN A CA     1 
ATOM 5787  C C      . ASN A 1 369 ? -7.490  -39.312 -6.031  1.00 109.81 ?  373 ASN A C      1 
ATOM 5788  O O      . ASN A 1 369 ? -8.332  -40.072 -6.512  1.00 110.09 ?  373 ASN A O      1 
ATOM 5789  C CB     . ASN A 1 369 ? -9.408  -37.973 -5.107  1.00 98.96  ?  373 ASN A CB     1 
ATOM 5790  C CG     . ASN A 1 369 ? -10.118 -39.149 -4.466  1.00 98.37  ?  373 ASN A CG     1 
ATOM 5791  O OD1    . ASN A 1 369 ? -9.509  -40.183 -4.192  1.00 94.33  ?  373 ASN A OD1    1 
ATOM 5792  N ND2    . ASN A 1 369 ? -11.414 -39.000 -4.232  1.00 106.53 ?  373 ASN A ND2    1 
ATOM 5793  H H      . ASN A 1 369 ? -6.730  -36.564 -4.923  1.00 120.20 ?  373 ASN A H      1 
ATOM 5794  H HA     . ASN A 1 369 ? -7.605  -38.364 -4.225  1.00 120.10 ?  373 ASN A HA     1 
ATOM 5795  H HB2    . ASN A 1 369 ? -9.629  -37.176 -4.600  1.00 118.75 ?  373 ASN A HB2    1 
ATOM 5796  H HB3    . ASN A 1 369 ? -9.729  -37.888 -6.018  1.00 118.75 ?  373 ASN A HB3    1 
ATOM 5797  H HD21   . ASN A 1 369 ? -11.862 -39.639 -3.870  1.00 127.84 ?  373 ASN A HD21   1 
ATOM 5798  H HD22   . ASN A 1 369 ? -11.807 -38.265 -4.442  1.00 127.84 ?  373 ASN A HD22   1 
ATOM 5799  N N      . ILE A 1 370 ? -6.187  -39.451 -6.267  1.00 107.42 ?  374 ILE A N      1 
ATOM 5800  C CA     . ILE A 1 370 ? -5.675  -40.652 -6.914  1.00 85.87  ?  374 ILE A CA     1 
ATOM 5801  C C      . ILE A 1 370 ? -5.855  -41.777 -5.904  1.00 95.71  ?  374 ILE A C      1 
ATOM 5802  O O      . ILE A 1 370 ? -4.962  -42.059 -5.098  1.00 94.88  ?  374 ILE A O      1 
ATOM 5803  C CB     . ILE A 1 370 ? -4.210  -40.486 -7.365  1.00 75.34  ?  374 ILE A CB     1 
ATOM 5804  C CG1    . ILE A 1 370 ? -4.125  -39.646 -8.644  1.00 81.76  ?  374 ILE A CG1    1 
ATOM 5805  C CG2    . ILE A 1 370 ? -3.563  -41.833 -7.665  1.00 77.61  ?  374 ILE A CG2    1 
ATOM 5806  C CD1    . ILE A 1 370 ? -4.750  -38.266 -8.566  1.00 90.94  ?  374 ILE A CD1    1 
ATOM 5807  H H      . ILE A 1 370 ? -5.586  -38.871 -6.063  1.00 128.90 ?  374 ILE A H      1 
ATOM 5808  H HA     . ILE A 1 370 ? -6.214  -40.852 -7.695  1.00 103.04 ?  374 ILE A HA     1 
ATOM 5809  H HB     . ILE A 1 370 ? -3.710  -40.044 -6.661  1.00 90.41  ?  374 ILE A HB     1 
ATOM 5810  H HG12   . ILE A 1 370 ? -3.190  -39.529 -8.872  1.00 98.11  ?  374 ILE A HG12   1 
ATOM 5811  H HG13   . ILE A 1 370 ? -4.574  -40.128 -9.357  1.00 98.11  ?  374 ILE A HG13   1 
ATOM 5812  H HG21   . ILE A 1 370 ? -2.645  -41.687 -7.944  1.00 93.13  ?  374 ILE A HG21   1 
ATOM 5813  H HG22   . ILE A 1 370 ? -3.582  -42.378 -6.863  1.00 93.13  ?  374 ILE A HG22   1 
ATOM 5814  H HG23   . ILE A 1 370 ? -4.059  -42.270 -8.375  1.00 93.13  ?  374 ILE A HG23   1 
ATOM 5815  H HD11   . ILE A 1 370 ? -4.642  -37.823 -9.422  1.00 109.13 ?  374 ILE A HD11   1 
ATOM 5816  H HD12   . ILE A 1 370 ? -5.693  -38.358 -8.357  1.00 109.13 ?  374 ILE A HD12   1 
ATOM 5817  H HD13   . ILE A 1 370 ? -4.305  -37.757 -7.871  1.00 109.13 ?  374 ILE A HD13   1 
ATOM 5818  N N      . THR A 1 371 ? -7.031  -42.406 -5.929  1.00 105.17 ?  375 THR A N      1 
ATOM 5819  C CA     . THR A 1 371 ? -7.416  -43.324 -4.862  1.00 98.22  ?  375 THR A CA     1 
ATOM 5820  C C      . THR A 1 371 ? -6.487  -44.529 -4.794  1.00 87.17  ?  375 THR A C      1 
ATOM 5821  O O      . THR A 1 371 ? -6.086  -44.951 -3.704  1.00 83.12  ?  375 THR A O      1 
ATOM 5822  C CB     . THR A 1 371 ? -8.865  -43.773 -5.070  1.00 96.09  ?  375 THR A CB     1 
ATOM 5823  O OG1    . THR A 1 371 ? -9.742  -42.654 -4.892  1.00 104.20 ?  375 THR A OG1    1 
ATOM 5824  C CG2    . THR A 1 371 ? -9.254  -44.873 -4.089  1.00 97.75  ?  375 THR A CG2    1 
ATOM 5825  H H      . THR A 1 371 ? -7.619  -42.318 -6.551  1.00 126.20 ?  375 THR A H      1 
ATOM 5826  H HA     . THR A 1 371 ? -7.366  -42.859 -4.012  1.00 117.87 ?  375 THR A HA     1 
ATOM 5827  H HB     . THR A 1 371 ? -8.966  -44.119 -5.970  1.00 115.31 ?  375 THR A HB     1 
ATOM 5828  H HG1    . THR A 1 371 ? -9.556  -42.052 -5.449  1.00 125.04 ?  375 THR A HG1    1 
ATOM 5829  H HG21   . THR A 1 371 ? -10.174 -45.140 -4.239  1.00 117.30 ?  375 THR A HG21   1 
ATOM 5830  H HG22   . THR A 1 371 ? -8.678  -45.644 -4.209  1.00 117.30 ?  375 THR A HG22   1 
ATOM 5831  H HG23   . THR A 1 371 ? -9.164  -44.552 -3.178  1.00 117.30 ?  375 THR A HG23   1 
ATOM 5832  N N      . GLU A 1 372 ? -6.139  -45.098 -5.948  1.00 77.93  ?  376 GLU A N      1 
ATOM 5833  C CA     . GLU A 1 372 ? -5.375  -46.341 -5.962  1.00 87.85  ?  376 GLU A CA     1 
ATOM 5834  C C      . GLU A 1 372 ? -4.063  -46.196 -5.197  1.00 84.48  ?  376 GLU A C      1 
ATOM 5835  O O      . GLU A 1 372 ? -3.725  -47.038 -4.358  1.00 87.95  ?  376 GLU A O      1 
ATOM 5836  C CB     . GLU A 1 372 ? -5.121  -46.769 -7.408  1.00 90.95  ?  376 GLU A CB     1 
ATOM 5837  C CG     . GLU A 1 372 ? -4.240  -47.997 -7.564  1.00 102.31 ?  376 GLU A CG     1 
ATOM 5838  C CD     . GLU A 1 372 ? -2.761  -47.662 -7.571  1.00 96.52  ?  376 GLU A CD     1 
ATOM 5839  O OE1    . GLU A 1 372 ? -2.118  -47.771 -6.506  1.00 95.13  ?  376 GLU A OE1    1 
ATOM 5840  O OE2    . GLU A 1 372 ? -2.243  -47.279 -8.640  1.00 84.71  -1 376 GLU A OE2    1 
ATOM 5841  H H      . GLU A 1 372 ? -6.331  -44.788 -6.726  1.00 93.51  ?  376 GLU A H      1 
ATOM 5842  H HA     . GLU A 1 372 ? -5.896  -47.036 -5.532  1.00 105.42 ?  376 GLU A HA     1 
ATOM 5843  H HB2    . GLU A 1 372 ? -5.974  -46.964 -7.827  1.00 109.13 ?  376 GLU A HB2    1 
ATOM 5844  H HB3    . GLU A 1 372 ? -4.689  -46.037 -7.876  1.00 109.13 ?  376 GLU A HB3    1 
ATOM 5845  H HG2    . GLU A 1 372 ? -4.407  -48.602 -6.825  1.00 122.78 ?  376 GLU A HG2    1 
ATOM 5846  H HG3    . GLU A 1 372 ? -4.452  -48.434 -8.404  1.00 122.78 ?  376 GLU A HG3    1 
ATOM 5847  N N      . MET A 1 373 ? -3.311  -45.130 -5.474  1.00 76.70  ?  377 MET A N      1 
ATOM 5848  C CA     . MET A 1 373 ? -1.980  -44.994 -4.889  1.00 70.61  ?  377 MET A CA     1 
ATOM 5849  C C      . MET A 1 373 ? -2.035  -44.928 -3.369  1.00 72.02  ?  377 MET A C      1 
ATOM 5850  O O      . MET A 1 373 ? -1.201  -45.532 -2.684  1.00 62.73  ?  377 MET A O      1 
ATOM 5851  C CB     . MET A 1 373 ? -1.294  -43.748 -5.438  1.00 86.77  ?  377 MET A CB     1 
ATOM 5852  C CG     . MET A 1 373 ? -0.669  -43.940 -6.796  1.00 79.57  ?  377 MET A CG     1 
ATOM 5853  S SD     . MET A 1 373 ? 0.903   -43.079 -6.892  1.00 84.42  ?  377 MET A SD     1 
ATOM 5854  C CE     . MET A 1 373 ? 1.556   -43.777 -8.395  1.00 85.94  ?  377 MET A CE     1 
ATOM 5855  H H      . MET A 1 373 ? -3.544  -44.482 -5.989  1.00 92.04  ?  377 MET A H      1 
ATOM 5856  H HA     . MET A 1 373 ? -1.447  -45.762 -5.147  1.00 84.73  ?  377 MET A HA     1 
ATOM 5857  H HB2    . MET A 1 373 ? -1.950  -43.037 -5.512  1.00 104.13 ?  377 MET A HB2    1 
ATOM 5858  H HB3    . MET A 1 373 ? -0.591  -43.483 -4.824  1.00 104.13 ?  377 MET A HB3    1 
ATOM 5859  H HG2    . MET A 1 373 ? -0.511  -44.885 -6.949  1.00 95.49  ?  377 MET A HG2    1 
ATOM 5860  H HG3    . MET A 1 373 ? -1.258  -43.580 -7.477  1.00 95.49  ?  377 MET A HG3    1 
ATOM 5861  H HE1    . MET A 1 373 ? 2.427   -43.388 -8.570  1.00 103.12 ?  377 MET A HE1    1 
ATOM 5862  H HE2    . MET A 1 373 ? 1.638   -44.738 -8.287  1.00 103.12 ?  377 MET A HE2    1 
ATOM 5863  H HE3    . MET A 1 373 ? 0.950   -43.576 -9.125  1.00 103.12 ?  377 MET A HE3    1 
ATOM 5864  N N      . LEU A 1 374 ? -3.014  -44.211 -2.822  1.00 88.36  ?  378 LEU A N      1 
ATOM 5865  C CA     . LEU A 1 374 ? -3.065  -43.938 -1.390  1.00 100.79 ?  378 LEU A CA     1 
ATOM 5866  C C      . LEU A 1 374 ? -3.224  -45.211 -0.567  1.00 97.77  ?  378 LEU A C      1 
ATOM 5867  O O      . LEU A 1 374 ? -3.188  -45.164 0.667   1.00 94.32  ?  378 LEU A O      1 
ATOM 5868  C CB     . LEU A 1 374 ? -4.214  -42.975 -1.077  1.00 107.68 ?  378 LEU A CB     1 
ATOM 5869  C CG     . LEU A 1 374 ? -4.156  -41.609 -1.764  1.00 97.35  ?  378 LEU A CG     1 
ATOM 5870  C CD1    . LEU A 1 374 ? -5.413  -40.809 -1.459  1.00 90.82  ?  378 LEU A CD1    1 
ATOM 5871  C CD2    . LEU A 1 374 ? -2.918  -40.834 -1.339  1.00 87.68  ?  378 LEU A CD2    1 
ATOM 5872  H H      . LEU A 1 374 ? -3.667  -43.868 -3.265  1.00 106.03 ?  378 LEU A H      1 
ATOM 5873  H HA     . LEU A 1 374 ? -2.236  -43.512 -1.122  1.00 120.94 ?  378 LEU A HA     1 
ATOM 5874  H HB2    . LEU A 1 374 ? -5.046  -43.397 -1.344  1.00 129.22 ?  378 LEU A HB2    1 
ATOM 5875  H HB3    . LEU A 1 374 ? -4.227  -42.816 -0.120  1.00 129.22 ?  378 LEU A HB3    1 
ATOM 5876  H HG     . LEU A 1 374 ? -4.112  -41.741 -2.724  1.00 116.82 ?  378 LEU A HG     1 
ATOM 5877  H HD11   . LEU A 1 374 ? -5.355  -39.949 -1.903  1.00 108.99 ?  378 LEU A HD11   1 
ATOM 5878  H HD12   . LEU A 1 374 ? -6.185  -41.299 -1.784  1.00 108.99 ?  378 LEU A HD12   1 
ATOM 5879  H HD13   . LEU A 1 374 ? -5.482  -40.683 -0.500  1.00 108.99 ?  378 LEU A HD13   1 
ATOM 5880  H HD21   . LEU A 1 374 ? -2.912  -39.976 -1.791  1.00 105.22 ?  378 LEU A HD21   1 
ATOM 5881  H HD22   . LEU A 1 374 ? -2.942  -40.703 -0.378  1.00 105.22 ?  378 LEU A HD22   1 
ATOM 5882  H HD23   . LEU A 1 374 ? -2.129  -41.343 -1.583  1.00 105.22 ?  378 LEU A HD23   1 
ATOM 5883  N N      . GLU A 1 375 ? -3.400  -46.354 -1.231  1.00 100.13 ?  379 GLU A N      1 
ATOM 5884  C CA     . GLU A 1 375 ? -3.623  -47.610 -0.525  1.00 101.38 ?  379 GLU A CA     1 
ATOM 5885  C C      . GLU A 1 375 ? -2.315  -48.342 -0.226  1.00 98.43  ?  379 GLU A C      1 
ATOM 5886  O O      . GLU A 1 375 ? -2.003  -48.609 0.940   1.00 90.51  ?  379 GLU A O      1 
ATOM 5887  C CB     . GLU A 1 375 ? -4.570  -48.498 -1.338  1.00 97.31  ?  379 GLU A CB     1 
ATOM 5888  C CG     . GLU A 1 375 ? -6.001  -47.985 -1.371  1.00 100.15 ?  379 GLU A CG     1 
ATOM 5889  C CD     . GLU A 1 375 ? -6.882  -48.778 -2.312  1.00 114.97 ?  379 GLU A CD     1 
ATOM 5890  O OE1    . GLU A 1 375 ? -8.086  -48.460 -2.411  1.00 118.85 ?  379 GLU A OE1    1 
ATOM 5891  O OE2    . GLU A 1 375 ? -6.372  -49.719 -2.954  1.00 108.43 -1 379 GLU A OE2    1 
ATOM 5892  H H      . GLU A 1 375 ? -3.394  -46.426 -2.088  1.00 120.16 ?  379 GLU A H      1 
ATOM 5893  H HA     . GLU A 1 375 ? -4.053  -47.418 0.323   1.00 121.65 ?  379 GLU A HA     1 
ATOM 5894  H HB2    . GLU A 1 375 ? -4.250  -48.544 -2.252  1.00 116.78 ?  379 GLU A HB2    1 
ATOM 5895  H HB3    . GLU A 1 375 ? -4.581  -49.385 -0.948  1.00 116.78 ?  379 GLU A HB3    1 
ATOM 5896  H HG2    . GLU A 1 375 ? -6.380  -48.048 -0.480  1.00 120.18 ?  379 GLU A HG2    1 
ATOM 5897  H HG3    . GLU A 1 375 ? -5.999  -47.062 -1.667  1.00 120.18 ?  379 GLU A HG3    1 
ATOM 5898  N N      . GLU A 1 376 ? -1.538  -48.670 -1.262  1.00 90.63  ?  380 GLU A N      1 
ATOM 5899  C CA     . GLU A 1 376 ? -0.327  -49.459 -1.082  1.00 93.89  ?  380 GLU A CA     1 
ATOM 5900  C C      . GLU A 1 376 ? 0.958   -48.734 -1.447  1.00 81.38  ?  380 GLU A C      1 
ATOM 5901  O O      . GLU A 1 376 ? 2.023   -49.138 -0.968  1.00 72.71  ?  380 GLU A O      1 
ATOM 5902  C CB     . GLU A 1 376 ? -0.399  -50.758 -1.906  1.00 108.55 ?  380 GLU A CB     1 
ATOM 5903  C CG     . GLU A 1 376 ? -0.256  -50.591 -3.417  1.00 105.68 ?  380 GLU A CG     1 
ATOM 5904  C CD     . GLU A 1 376 ? -1.504  -50.038 -4.072  1.00 102.01 ?  380 GLU A CD     1 
ATOM 5905  O OE1    . GLU A 1 376 ? -2.437  -49.651 -3.340  1.00 106.44 ?  380 GLU A OE1    1 
ATOM 5906  O OE2    . GLU A 1 376 ? -1.554  -49.998 -5.319  1.00 97.13  -1 380 GLU A OE2    1 
ATOM 5907  H H      . GLU A 1 376 ? -1.694  -48.446 -2.078  1.00 108.76 ?  380 GLU A H      1 
ATOM 5908  H HA     . GLU A 1 376 ? -0.263  -49.711 -0.148  1.00 112.67 ?  380 GLU A HA     1 
ATOM 5909  H HB2    . GLU A 1 376 ? 0.313   -51.347 -1.611  1.00 130.26 ?  380 GLU A HB2    1 
ATOM 5910  H HB3    . GLU A 1 376 ? -1.257  -51.179 -1.740  1.00 130.26 ?  380 GLU A HB3    1 
ATOM 5911  H HG2    . GLU A 1 376 ? 0.473   -49.978 -3.599  1.00 126.82 ?  380 GLU A HG2    1 
ATOM 5912  H HG3    . GLU A 1 376 ? -0.068  -51.456 -3.814  1.00 126.82 ?  380 GLU A HG3    1 
ATOM 5913  N N      . ASN A 1 377 ? 0.900   -47.691 -2.271  1.00 77.69  ?  381 ASN A N      1 
ATOM 5914  C CA     . ASN A 1 377 ? 2.121   -47.051 -2.742  1.00 75.15  ?  381 ASN A CA     1 
ATOM 5915  C C      . ASN A 1 377 ? 2.813   -46.212 -1.676  1.00 61.76  ?  381 ASN A C      1 
ATOM 5916  O O      . ASN A 1 377 ? 3.899   -45.691 -1.948  1.00 53.81  ?  381 ASN A O      1 
ATOM 5917  C CB     . ASN A 1 377 ? 1.813   -46.176 -3.957  1.00 70.47  ?  381 ASN A CB     1 
ATOM 5918  C CG     . ASN A 1 377 ? 1.352   -46.982 -5.151  1.00 92.56  ?  381 ASN A CG     1 
ATOM 5919  O OD1    . ASN A 1 377 ? 0.676   -48.000 -5.005  1.00 97.73  ?  381 ASN A OD1    1 
ATOM 5920  N ND2    . ASN A 1 377 ? 1.722   -46.535 -6.344  1.00 84.45  ?  381 ASN A ND2    1 
ATOM 5921  H H      . ASN A 1 377 ? 0.173   -47.340 -2.568  1.00 93.23  ?  381 ASN A H      1 
ATOM 5922  H HA     . ASN A 1 377 ? 2.743   -47.739 -3.024  1.00 90.18  ?  381 ASN A HA     1 
ATOM 5923  H HB2    . ASN A 1 377 ? 1.108   -45.550 -3.726  1.00 84.57  ?  381 ASN A HB2    1 
ATOM 5924  H HB3    . ASN A 1 377 ? 2.615   -45.694 -4.211  1.00 84.57  ?  381 ASN A HB3    1 
ATOM 5925  H HD21   . ASN A 1 377 ? 1.485   -46.958 -7.055  1.00 101.34 ?  381 ASN A HD21   1 
ATOM 5926  H HD22   . ASN A 1 377 ? 2.199   -45.822 -6.407  1.00 101.34 ?  381 ASN A HD22   1 
ATOM 5927  N N      . PHE A 1 378 ? 2.235   -46.073 -0.483  1.00 64.41  ?  382 PHE A N      1 
ATOM 5928  C CA     . PHE A 1 378 ? 2.808   -45.223 0.547   1.00 67.27  ?  382 PHE A CA     1 
ATOM 5929  C C      . PHE A 1 378 ? 2.868   -45.969 1.872   1.00 52.87  ?  382 PHE A C      1 
ATOM 5930  O O      . PHE A 1 378 ? 1.948   -46.729 2.199   1.00 70.38  ?  382 PHE A O      1 
ATOM 5931  C CB     . PHE A 1 378 ? 1.987   -43.940 0.719   1.00 77.16  ?  382 PHE A CB     1 
ATOM 5932  C CG     . PHE A 1 378 ? 1.981   -43.062 -0.495  1.00 76.14  ?  382 PHE A CG     1 
ATOM 5933  C CD1    . PHE A 1 378 ? 3.101   -42.322 -0.832  1.00 59.09  ?  382 PHE A CD1    1 
ATOM 5934  C CD2    . PHE A 1 378 ? 0.859   -42.977 -1.299  1.00 68.97  ?  382 PHE A CD2    1 
ATOM 5935  C CE1    . PHE A 1 378 ? 3.101   -41.517 -1.948  1.00 63.04  ?  382 PHE A CE1    1 
ATOM 5936  C CE2    . PHE A 1 378 ? 0.854   -42.171 -2.416  1.00 61.35  ?  382 PHE A CE2    1 
ATOM 5937  C CZ     . PHE A 1 378 ? 1.977   -41.440 -2.741  1.00 65.13  ?  382 PHE A CZ     1 
ATOM 5938  H H      . PHE A 1 378 ? 1.507   -46.465 -0.248  1.00 77.29  ?  382 PHE A H      1 
ATOM 5939  H HA     . PHE A 1 378 ? 3.712   -44.976 0.295   1.00 80.72  ?  382 PHE A HA     1 
ATOM 5940  H HB2    . PHE A 1 378 ? 1.068   -44.180 0.916   1.00 92.59  ?  382 PHE A HB2    1 
ATOM 5941  H HB3    . PHE A 1 378 ? 2.357   -43.427 1.455   1.00 92.59  ?  382 PHE A HB3    1 
ATOM 5942  H HD1    . PHE A 1 378 ? 3.862   -42.371 -0.301  1.00 70.91  ?  382 PHE A HD1    1 
ATOM 5943  H HD2    . PHE A 1 378 ? 0.100   -43.469 -1.083  1.00 82.76  ?  382 PHE A HD2    1 
ATOM 5944  H HE1    . PHE A 1 378 ? 3.859   -41.023 -2.166  1.00 75.65  ?  382 PHE A HE1    1 
ATOM 5945  H HE2    . PHE A 1 378 ? 0.095   -42.120 -2.950  1.00 73.62  ?  382 PHE A HE2    1 
ATOM 5946  H HZ     . PHE A 1 378 ? 1.975   -40.895 -3.494  1.00 78.16  ?  382 PHE A HZ     1 
ATOM 5947  N N      . PRO A 1 379 ? 3.921   -45.764 2.662   1.00 48.54  ?  383 PRO A N      1 
ATOM 5948  C CA     . PRO A 1 379 ? 4.039   -46.486 3.932   1.00 55.35  ?  383 PRO A CA     1 
ATOM 5949  C C      . PRO A 1 379 ? 2.918   -46.115 4.889   1.00 51.41  ?  383 PRO A C      1 
ATOM 5950  O O      . PRO A 1 379 ? 2.162   -45.164 4.682   1.00 55.20  ?  383 PRO A O      1 
ATOM 5951  C CB     . PRO A 1 379 ? 5.406   -46.046 4.465   1.00 45.70  ?  383 PRO A CB     1 
ATOM 5952  C CG     . PRO A 1 379 ? 5.628   -44.720 3.855   1.00 51.94  ?  383 PRO A CG     1 
ATOM 5953  C CD     . PRO A 1 379 ? 5.011   -44.789 2.490   1.00 59.40  ?  383 PRO A CD     1 
ATOM 5954  H HA     . PRO A 1 379 ? 4.040   -47.444 3.783   1.00 66.42  ?  383 PRO A HA     1 
ATOM 5955  H HB2    . PRO A 1 379 ? 5.376   -45.980 5.432   1.00 54.84  ?  383 PRO A HB2    1 
ATOM 5956  H HB3    . PRO A 1 379 ? 6.088   -46.675 4.182   1.00 54.84  ?  383 PRO A HB3    1 
ATOM 5957  H HG2    . PRO A 1 379 ? 5.194   -44.039 4.391   1.00 62.33  ?  383 PRO A HG2    1 
ATOM 5958  H HG3    . PRO A 1 379 ? 6.580   -44.548 3.790   1.00 62.33  ?  383 PRO A HG3    1 
ATOM 5959  H HD2    . PRO A 1 379 ? 4.655   -43.923 2.235   1.00 71.28  ?  383 PRO A HD2    1 
ATOM 5960  H HD3    . PRO A 1 379 ? 5.657   -45.114 1.842   1.00 71.28  ?  383 PRO A HD3    1 
ATOM 5961  N N      . GLU A 1 380 ? 2.814   -46.898 5.957   1.00 67.31  ?  384 GLU A N      1 
ATOM 5962  C CA     . GLU A 1 380 ? 1.822   -46.640 6.984   1.00 82.42  ?  384 GLU A CA     1 
ATOM 5963  C C      . GLU A 1 380 ? 2.243   -45.444 7.834   1.00 75.24  ?  384 GLU A C      1 
ATOM 5964  O O      . GLU A 1 380 ? 3.388   -44.987 7.796   1.00 70.62  ?  384 GLU A O      1 
ATOM 5965  C CB     . GLU A 1 380 ? 1.635   -47.872 7.868   1.00 87.37  ?  384 GLU A CB     1 
ATOM 5966  C CG     . GLU A 1 380 ? 1.320   -49.142 7.100   1.00 86.43  ?  384 GLU A CG     1 
ATOM 5967  C CD     . GLU A 1 380 ? 1.116   -50.334 8.010   1.00 87.01  ?  384 GLU A CD     1 
ATOM 5968  O OE1    . GLU A 1 380 ? 0.007   -50.908 7.999   1.00 83.72  ?  384 GLU A OE1    1 
ATOM 5969  O OE2    . GLU A 1 380 ? 2.061   -50.692 8.743   1.00 124.36 -1 384 GLU A OE2    1 
ATOM 5970  H H      . GLU A 1 380 ? 3.308   -47.586 6.107   1.00 80.77  ?  384 GLU A H      1 
ATOM 5971  H HA     . GLU A 1 380 ? 0.972   -46.433 6.565   1.00 98.91  ?  384 GLU A HA     1 
ATOM 5972  H HB2    . GLU A 1 380 ? 2.452   -48.024 8.368   1.00 104.85 ?  384 GLU A HB2    1 
ATOM 5973  H HB3    . GLU A 1 380 ? 0.901   -47.707 8.481   1.00 104.85 ?  384 GLU A HB3    1 
ATOM 5974  H HG2    . GLU A 1 380 ? 0.505   -49.010 6.590   1.00 103.72 ?  384 GLU A HG2    1 
ATOM 5975  H HG3    . GLU A 1 380 ? 2.058   -49.343 6.503   1.00 103.72 ?  384 GLU A HG3    1 
ATOM 5976  N N      . ALA A 1 381 ? 1.291   -44.938 8.618   1.00 64.63  ?  385 ALA A N      1 
ATOM 5977  C CA     . ALA A 1 381 ? 1.582   -43.807 9.490   1.00 63.20  ?  385 ALA A CA     1 
ATOM 5978  C C      . ALA A 1 381 ? 2.722   -44.139 10.442  1.00 59.34  ?  385 ALA A C      1 
ATOM 5979  O O      . ALA A 1 381 ? 3.699   -43.390 10.547  1.00 52.57  ?  385 ALA A O      1 
ATOM 5980  C CB     . ALA A 1 381 ? 0.327   -43.411 10.266  1.00 60.15  ?  385 ALA A CB     1 
ATOM 5981  H H      . ALA A 1 381 ? 0.482   -45.226 8.661   1.00 77.56  ?  385 ALA A H      1 
ATOM 5982  H HA     . ALA A 1 381 ? 1.853   -43.050 8.948   1.00 75.83  ?  385 ALA A HA     1 
ATOM 5983  H HB1    . ALA A 1 381 ? 0.537   -42.659 10.841  1.00 72.18  ?  385 ALA A HB1    1 
ATOM 5984  H HB2    . ALA A 1 381 ? -0.367  -43.163 9.636   1.00 72.18  ?  385 ALA A HB2    1 
ATOM 5985  H HB3    . ALA A 1 381 ? 0.036   -44.166 10.800  1.00 72.18  ?  385 ALA A HB3    1 
ATOM 5986  N N      . SER A 1 382 ? 2.620   -45.272 11.138  1.00 81.92  ?  386 SER A N      1 
ATOM 5987  C CA     . SER A 1 382 ? 3.664   -45.651 12.081  1.00 82.68  ?  386 SER A CA     1 
ATOM 5988  C C      . SER A 1 382 ? 4.970   -45.981 11.372  1.00 77.29  ?  386 SER A C      1 
ATOM 5989  O O      . SER A 1 382 ? 6.048   -45.766 11.937  1.00 73.95  ?  386 SER A O      1 
ATOM 5990  C CB     . SER A 1 382 ? 3.207   -46.843 12.921  1.00 79.42  ?  386 SER A CB     1 
ATOM 5991  O OG     . SER A 1 382 ? 2.682   -47.871 12.101  1.00 88.38  ?  386 SER A OG     1 
ATOM 5992  H H      . SER A 1 382 ? 1.966   -45.828 11.083  1.00 98.30  ?  386 SER A H      1 
ATOM 5993  H HA     . SER A 1 382 ? 3.831   -44.908 12.681  1.00 99.21  ?  386 SER A HA     1 
ATOM 5994  H HB2    . SER A 1 382 ? 3.966   -47.190 13.415  1.00 95.31  ?  386 SER A HB2    1 
ATOM 5995  H HB3    . SER A 1 382 ? 2.518   -46.548 13.537  1.00 95.31  ?  386 SER A HB3    1 
ATOM 5996  H HG     . SER A 1 382 ? 2.435   -48.519 12.576  1.00 106.06 ?  386 SER A HG     1 
ATOM 5997  N N      . LYS A 1 383 ? 4.905   -46.495 10.142  1.00 75.43  ?  387 LYS A N      1 
ATOM 5998  C CA     . LYS A 1 383 ? 6.133   -46.879 9.456   1.00 77.27  ?  387 LYS A CA     1 
ATOM 5999  C C      . LYS A 1 383 ? 6.897   -45.662 8.957   1.00 77.78  ?  387 LYS A C      1 
ATOM 6000  O O      . LYS A 1 383 ? 8.123   -45.719 8.815   1.00 81.08  ?  387 LYS A O      1 
ATOM 6001  C CB     . LYS A 1 383 ? 5.823   -47.821 8.292   1.00 79.70  ?  387 LYS A CB     1 
ATOM 6002  C CG     . LYS A 1 383 ? 7.054   -48.478 7.671   1.00 87.17  ?  387 LYS A CG     1 
ATOM 6003  C CD     . LYS A 1 383 ? 7.890   -49.209 8.718   1.00 98.57  ?  387 LYS A CD     1 
ATOM 6004  C CE     . LYS A 1 383 ? 9.041   -49.982 8.100   1.00 104.22 ?  387 LYS A CE     1 
ATOM 6005  N NZ     . LYS A 1 383 ? 9.991   -50.461 9.144   1.00 113.62 1  387 LYS A NZ     1 
ATOM 6006  H H      . LYS A 1 383 ? 4.182   -46.627 9.696   1.00 90.51  ?  387 LYS A H      1 
ATOM 6007  H HA     . LYS A 1 383 ? 6.705   -47.354 10.079  1.00 92.72  ?  387 LYS A HA     1 
ATOM 6008  H HB2    . LYS A 1 383 ? 5.241   -48.528 8.612   1.00 95.64  ?  387 LYS A HB2    1 
ATOM 6009  H HB3    . LYS A 1 383 ? 5.375   -47.317 7.595   1.00 95.64  ?  387 LYS A HB3    1 
ATOM 6010  H HG2    . LYS A 1 383 ? 6.770   -49.124 7.005   1.00 104.61 ?  387 LYS A HG2    1 
ATOM 6011  H HG3    . LYS A 1 383 ? 7.609   -47.796 7.262   1.00 104.61 ?  387 LYS A HG3    1 
ATOM 6012  H HD2    . LYS A 1 383 ? 8.261   -48.561 9.337   1.00 118.28 ?  387 LYS A HD2    1 
ATOM 6013  H HD3    . LYS A 1 383 ? 7.325   -49.838 9.193   1.00 118.28 ?  387 LYS A HD3    1 
ATOM 6014  H HE2    . LYS A 1 383 ? 8.692   -50.754 7.627   1.00 125.07 ?  387 LYS A HE2    1 
ATOM 6015  H HE3    . LYS A 1 383 ? 9.525   -49.403 7.490   1.00 125.07 ?  387 LYS A HE3    1 
ATOM 6016  H HZ1    . LYS A 1 383 ? 10.327  -49.769 9.591   1.00 136.34 ?  387 LYS A HZ1    1 
ATOM 6017  H HZ2    . LYS A 1 383 ? 9.569   -50.997 9.716   1.00 136.34 ?  387 LYS A HZ2    1 
ATOM 6018  H HZ3    . LYS A 1 383 ? 10.658  -50.912 8.765   1.00 136.34 ?  387 LYS A HZ3    1 
ATOM 6019  N N      . LEU A 1 384 ? 6.199   -44.560 8.682   1.00 80.08  ?  388 LEU A N      1 
ATOM 6020  C CA     . LEU A 1 384 ? 6.895   -43.332 8.320   1.00 82.32  ?  388 LEU A CA     1 
ATOM 6021  C C      . LEU A 1 384 ? 7.567   -42.712 9.536   1.00 70.11  ?  388 LEU A C      1 
ATOM 6022  O O      . LEU A 1 384 ? 8.673   -42.171 9.433   1.00 65.30  ?  388 LEU A O      1 
ATOM 6023  C CB     . LEU A 1 384 ? 5.922   -42.344 7.679   1.00 72.21  ?  388 LEU A CB     1 
ATOM 6024  C CG     . LEU A 1 384 ? 6.524   -40.996 7.275   1.00 61.63  ?  388 LEU A CG     1 
ATOM 6025  C CD1    . LEU A 1 384 ? 7.640   -41.176 6.258   1.00 61.20  ?  388 LEU A CD1    1 
ATOM 6026  C CD2    . LEU A 1 384 ? 5.452   -40.082 6.721   1.00 59.26  ?  388 LEU A CD2    1 
ATOM 6027  H H      . LEU A 1 384 ? 5.341   -44.499 8.699   1.00 96.10  ?  388 LEU A H      1 
ATOM 6028  H HA     . LEU A 1 384 ? 7.584   -43.539 7.669   1.00 98.78  ?  388 LEU A HA     1 
ATOM 6029  H HB2    . LEU A 1 384 ? 5.554   -42.750 6.878   1.00 86.65  ?  388 LEU A HB2    1 
ATOM 6030  H HB3    . LEU A 1 384 ? 5.206   -42.165 8.309   1.00 86.65  ?  388 LEU A HB3    1 
ATOM 6031  H HG     . LEU A 1 384 ? 6.902   -40.572 8.061   1.00 73.96  ?  388 LEU A HG     1 
ATOM 6032  H HD11   . LEU A 1 384 ? 7.998   -40.305 6.025   1.00 73.44  ?  388 LEU A HD11   1 
ATOM 6033  H HD12   . LEU A 1 384 ? 8.336   -41.727 6.648   1.00 73.44  ?  388 LEU A HD12   1 
ATOM 6034  H HD13   . LEU A 1 384 ? 7.279   -41.608 5.468   1.00 73.44  ?  388 LEU A HD13   1 
ATOM 6035  H HD21   . LEU A 1 384 ? 5.856   -39.236 6.472   1.00 71.12  ?  388 LEU A HD21   1 
ATOM 6036  H HD22   . LEU A 1 384 ? 5.053   -40.501 5.942   1.00 71.12  ?  388 LEU A HD22   1 
ATOM 6037  H HD23   . LEU A 1 384 ? 4.776   -39.939 7.402   1.00 71.12  ?  388 LEU A HD23   1 
ATOM 6038  N N      . SER A 1 385 ? 6.918   -42.791 10.701  1.00 61.21  ?  389 SER A N      1 
ATOM 6039  C CA     . SER A 1 385 ? 7.520   -42.260 11.918  1.00 57.24  ?  389 SER A CA     1 
ATOM 6040  C C      . SER A 1 385 ? 8.880   -42.889 12.177  1.00 62.61  ?  389 SER A C      1 
ATOM 6041  O O      . SER A 1 385 ? 9.754   -42.253 12.776  1.00 78.62  ?  389 SER A O      1 
ATOM 6042  C CB     . SER A 1 385 ? 6.595   -42.495 13.110  1.00 57.11  ?  389 SER A CB     1 
ATOM 6043  O OG     . SER A 1 385 ? 6.448   -43.876 13.375  1.00 84.06  ?  389 SER A OG     1 
ATOM 6044  H H      . SER A 1 385 ? 6.140   -43.141 10.809  1.00 73.45  ?  389 SER A H      1 
ATOM 6045  H HA     . SER A 1 385 ? 7.646   -41.304 11.818  1.00 68.69  ?  389 SER A HA     1 
ATOM 6046  H HB2    . SER A 1 385 ? 6.972   -42.062 13.892  1.00 68.53  ?  389 SER A HB2    1 
ATOM 6047  H HB3    . SER A 1 385 ? 5.723   -42.118 12.912  1.00 68.53  ?  389 SER A HB3    1 
ATOM 6048  H HG     . SER A 1 385 ? 6.122   -44.264 12.705  1.00 100.88 ?  389 SER A HG     1 
ATOM 6049  N N      . GLU A 1 386 ? 9.078   -44.133 11.741  1.00 65.78  ?  390 GLU A N      1 
ATOM 6050  C CA     . GLU A 1 386 ? 10.390  -44.757 11.859  1.00 69.05  ?  390 GLU A CA     1 
ATOM 6051  C C      . GLU A 1 386 ? 11.421  -44.011 11.024  1.00 63.15  ?  390 GLU A C      1 
ATOM 6052  O O      . GLU A 1 386 ? 12.518  -43.700 11.501  1.00 62.30  ?  390 GLU A O      1 
ATOM 6053  C CB     . GLU A 1 386 ? 10.315  -46.223 11.432  1.00 89.96  ?  390 GLU A CB     1 
ATOM 6054  C CG     . GLU A 1 386 ? 9.868   -47.173 12.531  1.00 97.87  ?  390 GLU A CG     1 
ATOM 6055  C CD     . GLU A 1 386 ? 10.103  -48.629 12.172  1.00 110.30 ?  390 GLU A CD     1 
ATOM 6056  O OE1    . GLU A 1 386 ? 9.256   -49.214 11.466  1.00 110.57 ?  390 GLU A OE1    1 
ATOM 6057  O OE2    . GLU A 1 386 ? 11.142  -49.185 12.588  1.00 113.54 -1 390 GLU A OE2    1 
ATOM 6058  H H      . GLU A 1 386 ? 8.476   -44.629 11.377  1.00 78.93  ?  390 GLU A H      1 
ATOM 6059  H HA     . GLU A 1 386 ? 10.673  -44.727 12.786  1.00 82.86  ?  390 GLU A HA     1 
ATOM 6060  H HB2    . GLU A 1 386 ? 9.683   -46.301 10.700  1.00 107.95 ?  390 GLU A HB2    1 
ATOM 6061  H HB3    . GLU A 1 386 ? 11.194  -46.506 11.137  1.00 107.95 ?  390 GLU A HB3    1 
ATOM 6062  H HG2    . GLU A 1 386 ? 10.366  -46.979 13.340  1.00 117.45 ?  390 GLU A HG2    1 
ATOM 6063  H HG3    . GLU A 1 386 ? 8.918   -47.052 12.688  1.00 117.45 ?  390 GLU A HG3    1 
ATOM 6064  N N      . HIS A 1 387 ? 11.082  -43.709 9.770   1.00 63.99  ?  391 HIS A N      1 
ATOM 6065  C CA     . HIS A 1 387 ? 12.038  -43.047 8.891   1.00 69.36  ?  391 HIS A CA     1 
ATOM 6066  C C      . HIS A 1 387 ? 12.187  -41.576 9.250   1.00 76.31  ?  391 HIS A C      1 
ATOM 6067  O O      . HIS A 1 387 ? 13.297  -41.033 9.218   1.00 72.03  ?  391 HIS A O      1 
ATOM 6068  C CB     . HIS A 1 387 ? 11.599  -43.203 7.437   1.00 83.03  ?  391 HIS A CB     1 
ATOM 6069  C CG     . HIS A 1 387 ? 11.350  -44.622 7.033   1.00 83.20  ?  391 HIS A CG     1 
ATOM 6070  N ND1    . HIS A 1 387 ? 10.142  -45.252 7.238   1.00 78.52  ?  391 HIS A ND1    1 
ATOM 6071  C CD2    . HIS A 1 387 ? 12.157  -45.535 6.446   1.00 73.85  ?  391 HIS A CD2    1 
ATOM 6072  C CE1    . HIS A 1 387 ? 10.214  -46.492 6.787   1.00 86.72  ?  391 HIS A CE1    1 
ATOM 6073  N NE2    . HIS A 1 387 ? 11.426  -46.689 6.302   1.00 90.16  ?  391 HIS A NE2    1 
ATOM 6074  H H      . HIS A 1 387 ? 10.318  -43.875 9.412   1.00 76.79  ?  391 HIS A H      1 
ATOM 6075  H HA     . HIS A 1 387 ? 12.905  -43.470 8.990   1.00 83.23  ?  391 HIS A HA     1 
ATOM 6076  H HB2    . HIS A 1 387 ? 10.777  -42.707 7.303   1.00 99.64  ?  391 HIS A HB2    1 
ATOM 6077  H HB3    . HIS A 1 387 ? 12.295  -42.848 6.861   1.00 99.64  ?  391 HIS A HB3    1 
ATOM 6078  H HD1    . HIS A 1 387 ? 9.449   -44.894 7.599   1.00 94.23  ?  391 HIS A HD1    1 
ATOM 6079  H HD2    . HIS A 1 387 ? 13.040  -45.405 6.185   1.00 88.63  ?  391 HIS A HD2    1 
ATOM 6080  H HE1    . HIS A 1 387 ? 9.528   -47.120 6.810   1.00 104.06 ?  391 HIS A HE1    1 
ATOM 6081  N N      . LEU A 1 388 ? 11.082  -40.912 9.592   1.00 76.05  ?  392 LEU A N      1 
ATOM 6082  C CA     . LEU A 1 388 ? 11.159  -39.509 9.979   1.00 57.78  ?  392 LEU A CA     1 
ATOM 6083  C C      . LEU A 1 388 ? 12.089  -39.330 11.169  1.00 59.62  ?  392 LEU A C      1 
ATOM 6084  O O      . LEU A 1 388 ? 13.033  -38.533 11.121  1.00 50.45  ?  392 LEU A O      1 
ATOM 6085  C CB     . LEU A 1 388 ? 9.763   -38.975 10.298  1.00 54.36  ?  392 LEU A CB     1 
ATOM 6086  C CG     . LEU A 1 388 ? 9.683   -37.559 10.875  1.00 52.79  ?  392 LEU A CG     1 
ATOM 6087  C CD1    . LEU A 1 388 ? 10.538  -36.582 10.084  1.00 62.51  ?  392 LEU A CD1    1 
ATOM 6088  C CD2    . LEU A 1 388 ? 8.238   -37.096 10.907  1.00 55.15  ?  392 LEU A CD2    1 
ATOM 6089  H H      . LEU A 1 388 ? 10.290  -41.247 9.607   1.00 91.26  ?  392 LEU A H      1 
ATOM 6090  H HA     . LEU A 1 388 ? 11.516  -38.994 9.238   1.00 69.33  ?  392 LEU A HA     1 
ATOM 6091  H HB2    . LEU A 1 388 ? 9.242   -38.981 9.480   1.00 65.23  ?  392 LEU A HB2    1 
ATOM 6092  H HB3    . LEU A 1 388 ? 9.351   -39.571 10.943  1.00 65.23  ?  392 LEU A HB3    1 
ATOM 6093  H HG     . LEU A 1 388 ? 10.012  -37.573 11.787  1.00 63.34  ?  392 LEU A HG     1 
ATOM 6094  H HD11   . LEU A 1 388 ? 10.459  -35.700 10.481  1.00 75.01  ?  392 LEU A HD11   1 
ATOM 6095  H HD12   . LEU A 1 388 ? 11.462  -36.876 10.112  1.00 75.01  ?  392 LEU A HD12   1 
ATOM 6096  H HD13   . LEU A 1 388 ? 10.225  -36.560 9.166   1.00 75.01  ?  392 LEU A HD13   1 
ATOM 6097  H HD21   . LEU A 1 388 ? 8.202   -36.199 11.274  1.00 66.18  ?  392 LEU A HD21   1 
ATOM 6098  H HD22   . LEU A 1 388 ? 7.886   -37.099 10.003  1.00 66.18  ?  392 LEU A HD22   1 
ATOM 6099  H HD23   . LEU A 1 388 ? 7.725   -37.703 11.463  1.00 66.18  ?  392 LEU A HD23   1 
ATOM 6100  N N      . ASN A 1 389 ? 11.845  -40.076 12.247  1.00 69.07  ?  393 ASN A N      1 
ATOM 6101  C CA     . ASN A 1 389 ? 12.721  -39.989 13.408  1.00 54.02  ?  393 ASN A CA     1 
ATOM 6102  C C      . ASN A 1 389 ? 14.144  -40.387 13.046  1.00 48.10  ?  393 ASN A C      1 
ATOM 6103  O O      . ASN A 1 389 ? 15.107  -39.778 13.525  1.00 48.13  ?  393 ASN A O      1 
ATOM 6104  C CB     . ASN A 1 389 ? 12.190  -40.873 14.533  1.00 40.82  ?  393 ASN A CB     1 
ATOM 6105  C CG     . ASN A 1 389 ? 12.743  -40.484 15.884  1.00 72.78  ?  393 ASN A CG     1 
ATOM 6106  O OD1    . ASN A 1 389 ? 12.759  -39.309 16.245  1.00 76.00  ?  393 ASN A OD1    1 
ATOM 6107  N ND2    . ASN A 1 389 ? 13.213  -41.469 16.635  1.00 87.27  ?  393 ASN A ND2    1 
ATOM 6108  H H      . ASN A 1 389 ? 11.192  -40.629 12.328  1.00 82.88  ?  393 ASN A H      1 
ATOM 6109  H HA     . ASN A 1 389 ? 12.736  -39.073 13.726  1.00 64.82  ?  393 ASN A HA     1 
ATOM 6110  H HB2    . ASN A 1 389 ? 11.224  -40.794 14.569  1.00 48.98  ?  393 ASN A HB2    1 
ATOM 6111  H HB3    . ASN A 1 389 ? 12.442  -41.794 14.358  1.00 48.98  ?  393 ASN A HB3    1 
ATOM 6112  H HD21   . ASN A 1 389 ? 13.539  -41.299 17.413  1.00 104.73 ?  393 ASN A HD21   1 
ATOM 6113  H HD22   . ASN A 1 389 ? 13.193  -42.279 16.345  1.00 104.73 ?  393 ASN A HD22   1 
ATOM 6114  N N      . HIS A 1 390 ? 14.296  -41.398 12.186  1.00 66.82  ?  394 HIS A N      1 
ATOM 6115  C CA     . HIS A 1 390 ? 15.623  -41.879 11.813  1.00 68.22  ?  394 HIS A CA     1 
ATOM 6116  C C      . HIS A 1 390 ? 16.555  -40.741 11.425  1.00 67.21  ?  394 HIS A C      1 
ATOM 6117  O O      . HIS A 1 390 ? 17.761  -40.810 11.686  1.00 67.40  ?  394 HIS A O      1 
ATOM 6118  C CB     . HIS A 1 390 ? 15.505  -42.880 10.662  1.00 67.09  ?  394 HIS A CB     1 
ATOM 6119  C CG     . HIS A 1 390 ? 16.818  -43.259 10.049  1.00 77.34  ?  394 HIS A CG     1 
ATOM 6120  N ND1    . HIS A 1 390 ? 18.004  -43.237 10.750  1.00 76.59  ?  394 HIS A ND1    1 
ATOM 6121  C CD2    . HIS A 1 390 ? 17.128  -43.669 8.796   1.00 82.37  ?  394 HIS A CD2    1 
ATOM 6122  C CE1    . HIS A 1 390 ? 18.989  -43.617 9.955   1.00 70.47  ?  394 HIS A CE1    1 
ATOM 6123  N NE2    . HIS A 1 390 ? 18.485  -43.885 8.765   1.00 69.08  ?  394 HIS A NE2    1 
ATOM 6124  H H      . HIS A 1 390 ? 13.648  -41.818 11.807  1.00 80.18  ?  394 HIS A H      1 
ATOM 6125  H HA     . HIS A 1 390 ? 16.014  -42.340 12.572  1.00 81.86  ?  394 HIS A HA     1 
ATOM 6126  H HB2    . HIS A 1 390 ? 15.088  -43.691 10.995  1.00 80.50  ?  394 HIS A HB2    1 
ATOM 6127  H HB3    . HIS A 1 390 ? 14.954  -42.491 9.965   1.00 80.50  ?  394 HIS A HB3    1 
ATOM 6128  H HD1    . HIS A 1 390 ? 18.089  -43.011 11.575  1.00 91.91  ?  394 HIS A HD1    1 
ATOM 6129  H HD2    . HIS A 1 390 ? 16.535  -43.783 8.090   1.00 98.85  ?  394 HIS A HD2    1 
ATOM 6130  H HE1    . HIS A 1 390 ? 19.886  -43.685 10.194  1.00 84.57  ?  394 HIS A HE1    1 
ATOM 6131  N N      . TYR A 1 391 ? 16.023  -39.689 10.808  1.00 69.36  ?  395 TYR A N      1 
ATOM 6132  C CA     . TYR A 1 391 ? 16.845  -38.567 10.382  1.00 60.19  ?  395 TYR A CA     1 
ATOM 6133  C C      . TYR A 1 391 ? 16.999  -37.498 11.452  1.00 53.68  ?  395 TYR A C      1 
ATOM 6134  O O      . TYR A 1 391 ? 17.908  -36.668 11.348  1.00 58.38  ?  395 TYR A O      1 
ATOM 6135  C CB     . TYR A 1 391 ? 16.255  -37.945 9.116   1.00 53.21  ?  395 TYR A CB     1 
ATOM 6136  C CG     . TYR A 1 391 ? 16.370  -38.850 7.917   1.00 51.19  ?  395 TYR A CG     1 
ATOM 6137  C CD1    . TYR A 1 391 ? 17.585  -39.014 7.269   1.00 49.79  ?  395 TYR A CD1    1 
ATOM 6138  C CD2    . TYR A 1 391 ? 15.271  -39.548 7.440   1.00 48.52  ?  395 TYR A CD2    1 
ATOM 6139  C CE1    . TYR A 1 391 ? 17.702  -39.842 6.180   1.00 55.27  ?  395 TYR A CE1    1 
ATOM 6140  C CE2    . TYR A 1 391 ? 15.379  -40.379 6.348   1.00 48.78  ?  395 TYR A CE2    1 
ATOM 6141  C CZ     . TYR A 1 391 ? 16.598  -40.521 5.724   1.00 59.59  ?  395 TYR A CZ     1 
ATOM 6142  O OH     . TYR A 1 391 ? 16.716  -41.348 4.638   1.00 73.98  ?  395 TYR A OH     1 
ATOM 6143  H H      . TYR A 1 391 ? 15.187  -39.602 10.626  1.00 83.23  ?  395 TYR A H      1 
ATOM 6144  H HA     . TYR A 1 391 ? 17.731  -38.896 10.164  1.00 72.23  ?  395 TYR A HA     1 
ATOM 6145  H HB2    . TYR A 1 391 ? 15.315  -37.760 9.263   1.00 63.85  ?  395 TYR A HB2    1 
ATOM 6146  H HB3    . TYR A 1 391 ? 16.729  -37.122 8.917   1.00 63.85  ?  395 TYR A HB3    1 
ATOM 6147  H HD1    . TYR A 1 391 ? 18.333  -38.555 7.578   1.00 59.75  ?  395 TYR A HD1    1 
ATOM 6148  H HD2    . TYR A 1 391 ? 14.448  -39.452 7.863   1.00 58.23  ?  395 TYR A HD2    1 
ATOM 6149  H HE1    . TYR A 1 391 ? 18.523  -39.942 5.754   1.00 66.32  ?  395 TYR A HE1    1 
ATOM 6150  H HE2    . TYR A 1 391 ? 14.636  -40.842 6.036   1.00 58.54  ?  395 TYR A HE2    1 
ATOM 6151  H HH     . TYR A 1 391 ? 15.974  -41.700 4.463   1.00 88.77  ?  395 TYR A HH     1 
ATOM 6152  N N      . ILE A 1 392 ? 16.150  -37.504 12.479  1.00 50.63  ?  396 ILE A N      1 
ATOM 6153  C CA     . ILE A 1 392 ? 16.264  -36.501 13.531  1.00 41.08  ?  396 ILE A CA     1 
ATOM 6154  C C      . ILE A 1 392 ? 17.464  -36.807 14.418  1.00 65.37  ?  396 ILE A C      1 
ATOM 6155  O O      . ILE A 1 392 ? 18.296  -35.934 14.685  1.00 76.98  ?  396 ILE A O      1 
ATOM 6156  C CB     . ILE A 1 392 ? 14.959  -36.421 14.342  1.00 45.97  ?  396 ILE A CB     1 
ATOM 6157  C CG1    . ILE A 1 392 ? 13.779  -36.157 13.402  1.00 41.84  ?  396 ILE A CG1    1 
ATOM 6158  C CG2    . ILE A 1 392 ? 15.056  -35.319 15.388  1.00 68.11  ?  396 ILE A CG2    1 
ATOM 6159  C CD1    . ILE A 1 392 ? 12.426  -36.141 14.076  1.00 45.93  ?  396 ILE A CD1    1 
ATOM 6160  H H      . ILE A 1 392 ? 15.510  -38.068 12.587  1.00 60.76  ?  396 ILE A H      1 
ATOM 6161  H HA     . ILE A 1 392 ? 16.413  -35.634 13.122  1.00 49.30  ?  396 ILE A HA     1 
ATOM 6162  H HB     . ILE A 1 392 ? 14.817  -37.268 14.792  1.00 55.16  ?  396 ILE A HB     1 
ATOM 6163  H HG12   . ILE A 1 392 ? 13.907  -35.293 12.980  1.00 50.21  ?  396 ILE A HG12   1 
ATOM 6164  H HG13   . ILE A 1 392 ? 13.762  -36.851 12.725  1.00 50.21  ?  396 ILE A HG13   1 
ATOM 6165  H HG21   . ILE A 1 392 ? 14.226  -35.284 15.887  1.00 81.73  ?  396 ILE A HG21   1 
ATOM 6166  H HG22   . ILE A 1 392 ? 15.794  -35.517 15.985  1.00 81.73  ?  396 ILE A HG22   1 
ATOM 6167  H HG23   . ILE A 1 392 ? 15.210  -34.472 14.940  1.00 81.73  ?  396 ILE A HG23   1 
ATOM 6168  H HD11   . ILE A 1 392 ? 11.744  -35.968 13.408  1.00 55.11  ?  396 ILE A HD11   1 
ATOM 6169  H HD12   . ILE A 1 392 ? 12.271  -37.003 14.492  1.00 55.11  ?  396 ILE A HD12   1 
ATOM 6170  H HD13   . ILE A 1 392 ? 12.417  -35.442 14.748  1.00 55.11  ?  396 ILE A HD13   1 
ATOM 6171  N N      . LEU A 1 393 ? 17.579  -38.055 14.880  1.00 81.81  ?  397 LEU A N      1 
ATOM 6172  C CA     . LEU A 1 393 ? 18.761  -38.451 15.639  1.00 77.77  ?  397 LEU A CA     1 
ATOM 6173  C C      . LEU A 1 393 ? 20.017  -38.256 14.804  1.00 81.01  ?  397 LEU A C      1 
ATOM 6174  O O      . LEU A 1 393 ? 21.023  -37.719 15.282  1.00 91.08  ?  397 LEU A O      1 
ATOM 6175  C CB     . LEU A 1 393 ? 18.656  -39.912 16.084  1.00 68.18  ?  397 LEU A CB     1 
ATOM 6176  C CG     . LEU A 1 393 ? 17.473  -40.396 16.929  1.00 80.88  ?  397 LEU A CG     1 
ATOM 6177  C CD1    . LEU A 1 393 ? 16.810  -39.270 17.693  1.00 79.59  ?  397 LEU A CD1    1 
ATOM 6178  C CD2    . LEU A 1 393 ? 16.465  -41.109 16.057  1.00 64.81  ?  397 LEU A CD2    1 
ATOM 6179  H H      . LEU A 1 393 ? 16.997  -38.679 14.770  1.00 98.17  ?  397 LEU A H      1 
ATOM 6180  H HA     . LEU A 1 393 ? 18.833  -37.896 16.432  1.00 93.33  ?  397 LEU A HA     1 
ATOM 6181  H HB2    . LEU A 1 393 ? 18.657  -40.457 15.281  1.00 81.81  ?  397 LEU A HB2    1 
ATOM 6182  H HB3    . LEU A 1 393 ? 19.455  -40.115 16.595  1.00 81.81  ?  397 LEU A HB3    1 
ATOM 6183  H HG     . LEU A 1 393 ? 17.802  -41.037 17.579  1.00 97.06  ?  397 LEU A HG     1 
ATOM 6184  H HD11   . LEU A 1 393 ? 16.072  -39.630 18.209  1.00 95.51  ?  397 LEU A HD11   1 
ATOM 6185  H HD12   . LEU A 1 393 ? 17.462  -38.865 18.287  1.00 95.51  ?  397 LEU A HD12   1 
ATOM 6186  H HD13   . LEU A 1 393 ? 16.482  -38.610 17.062  1.00 95.51  ?  397 LEU A HD13   1 
ATOM 6187  H HD21   . LEU A 1 393 ? 15.725  -41.408 16.609  1.00 77.77  ?  397 LEU A HD21   1 
ATOM 6188  H HD22   . LEU A 1 393 ? 16.144  -40.495 15.378  1.00 77.77  ?  397 LEU A HD22   1 
ATOM 6189  H HD23   . LEU A 1 393 ? 16.893  -41.872 15.637  1.00 77.77  ?  397 LEU A HD23   1 
ATOM 6190  N N      . LEU A 1 394 ? 19.971  -38.689 13.544  1.00 60.53  ?  398 LEU A N      1 
ATOM 6191  C CA     . LEU A 1 394 ? 21.125  -38.587 12.662  1.00 69.28  ?  398 LEU A CA     1 
ATOM 6192  C C      . LEU A 1 394 ? 21.570  -37.145 12.464  1.00 71.00  ?  398 LEU A C      1 
ATOM 6193  O O      . LEU A 1 394 ? 22.711  -36.911 12.052  1.00 60.03  ?  398 LEU A O      1 
ATOM 6194  C CB     . LEU A 1 394 ? 20.786  -39.229 11.314  1.00 59.93  ?  398 LEU A CB     1 
ATOM 6195  C CG     . LEU A 1 394 ? 21.888  -39.378 10.263  1.00 66.29  ?  398 LEU A CG     1 
ATOM 6196  C CD1    . LEU A 1 394 ? 23.165  -39.945 10.859  1.00 72.44  ?  398 LEU A CD1    1 
ATOM 6197  C CD2    . LEU A 1 394 ? 21.388  -40.260 9.129   1.00 42.85  ?  398 LEU A CD2    1 
ATOM 6198  H H      . LEU A 1 394 ? 19.279  -39.047 13.178  1.00 72.64  ?  398 LEU A H      1 
ATOM 6199  H HA     . LEU A 1 394 ? 21.865  -39.079 13.051  1.00 83.14  ?  398 LEU A HA     1 
ATOM 6200  H HB2    . LEU A 1 394 ? 20.448  -40.121 11.490  1.00 71.91  ?  398 LEU A HB2    1 
ATOM 6201  H HB3    . LEU A 1 394 ? 20.082  -38.702 10.906  1.00 71.91  ?  398 LEU A HB3    1 
ATOM 6202  H HG     . LEU A 1 394 ? 22.092  -38.504 9.895   1.00 79.55  ?  398 LEU A HG     1 
ATOM 6203  H HD11   . LEU A 1 394 ? 23.833  -40.021 10.160  1.00 86.93  ?  398 LEU A HD11   1 
ATOM 6204  H HD12   . LEU A 1 394 ? 23.481  -39.347 11.555  1.00 86.93  ?  398 LEU A HD12   1 
ATOM 6205  H HD13   . LEU A 1 394 ? 22.977  -40.819 11.234  1.00 86.93  ?  398 LEU A HD13   1 
ATOM 6206  H HD21   . LEU A 1 394 ? 22.091  -40.350 8.467   1.00 51.42  ?  398 LEU A HD21   1 
ATOM 6207  H HD22   . LEU A 1 394 ? 21.156  -41.131 9.486   1.00 51.42  ?  398 LEU A HD22   1 
ATOM 6208  H HD23   . LEU A 1 394 ? 20.607  -39.846 8.729   1.00 51.42  ?  398 LEU A HD23   1 
ATOM 6209  N N      . ARG A 1 395 ? 20.702  -36.179 12.759  1.00 81.79  ?  399 ARG A N      1 
ATOM 6210  C CA     . ARG A 1 395 ? 20.989  -34.764 12.562  1.00 82.80  ?  399 ARG A CA     1 
ATOM 6211  C C      . ARG A 1 395 ? 21.329  -34.047 13.862  1.00 83.72  ?  399 ARG A C      1 
ATOM 6212  O O      . ARG A 1 395 ? 22.372  -33.395 13.957  1.00 84.51  ?  399 ARG A O      1 
ATOM 6213  C CB     . ARG A 1 395 ? 19.783  -34.091 11.891  1.00 71.85  ?  399 ARG A CB     1 
ATOM 6214  C CG     . ARG A 1 395 ? 19.679  -32.576 12.068  1.00 74.67  ?  399 ARG A CG     1 
ATOM 6215  C CD     . ARG A 1 395 ? 20.865  -31.844 11.472  1.00 86.67  ?  399 ARG A CD     1 
ATOM 6216  N NE     . ARG A 1 395 ? 20.694  -30.393 11.537  1.00 83.95  ?  399 ARG A NE     1 
ATOM 6217  C CZ     . ARG A 1 395 ? 21.177  -29.613 12.501  1.00 80.35  ?  399 ARG A CZ     1 
ATOM 6218  N NH1    . ARG A 1 395 ? 21.880  -30.128 13.500  1.00 76.28  1  399 ARG A NH1    1 
ATOM 6219  N NH2    . ARG A 1 395 ? 20.960  -28.306 12.462  1.00 95.22  ?  399 ARG A NH2    1 
ATOM 6220  H H      . ARG A 1 395 ? 19.919  -36.326 13.083  1.00 98.15  ?  399 ARG A H      1 
ATOM 6221  H HA     . ARG A 1 395 ? 21.749  -34.677 11.967  1.00 99.36  ?  399 ARG A HA     1 
ATOM 6222  H HB2    . ARG A 1 395 ? 19.825  -34.268 10.938  1.00 86.22  ?  399 ARG A HB2    1 
ATOM 6223  H HB3    . ARG A 1 395 ? 18.973  -34.481 12.255  1.00 86.22  ?  399 ARG A HB3    1 
ATOM 6224  H HG2    . ARG A 1 395 ? 18.876  -32.259 11.626  1.00 89.60  ?  399 ARG A HG2    1 
ATOM 6225  H HG3    . ARG A 1 395 ? 19.642  -32.369 13.015  1.00 89.60  ?  399 ARG A HG3    1 
ATOM 6226  H HD2    . ARG A 1 395 ? 21.666  -32.077 11.967  1.00 104.00 ?  399 ARG A HD2    1 
ATOM 6227  H HD3    . ARG A 1 395 ? 20.961  -32.096 10.540  1.00 104.00 ?  399 ARG A HD3    1 
ATOM 6228  H HE     . ARG A 1 395 ? 20.249  -30.016 10.906  1.00 100.75 ?  399 ARG A HE     1 
ATOM 6229  H HH11   . ARG A 1 395 ? 22.024  -30.975 13.533  1.00 91.54  ?  399 ARG A HH11   1 
ATOM 6230  H HH12   . ARG A 1 395 ? 22.188  -29.615 14.118  1.00 91.54  ?  399 ARG A HH12   1 
ATOM 6231  H HH21   . ARG A 1 395 ? 20.507  -27.964 11.816  1.00 114.27 ?  399 ARG A HH21   1 
ATOM 6232  H HH22   . ARG A 1 395 ? 21.273  -27.799 13.082  1.00 114.27 ?  399 ARG A HH22   1 
ATOM 6233  N N      . TYR A 1 396 ? 20.469  -34.162 14.871  1.00 84.51  ?  400 TYR A N      1 
ATOM 6234  C CA     . TYR A 1 396 ? 20.551  -33.305 16.045  1.00 78.42  ?  400 TYR A CA     1 
ATOM 6235  C C      . TYR A 1 396 ? 21.205  -33.962 17.250  1.00 92.19  ?  400 TYR A C      1 
ATOM 6236  O O      . TYR A 1 396 ? 21.842  -33.265 18.045  1.00 97.97  ?  400 TYR A O      1 
ATOM 6237  C CB     . TYR A 1 396 ? 19.149  -32.829 16.438  1.00 56.07  ?  400 TYR A CB     1 
ATOM 6238  C CG     . TYR A 1 396 ? 18.590  -31.799 15.491  1.00 65.69  ?  400 TYR A CG     1 
ATOM 6239  C CD1    . TYR A 1 396 ? 19.196  -30.560 15.358  1.00 85.42  ?  400 TYR A CD1    1 
ATOM 6240  C CD2    . TYR A 1 396 ? 17.460  -32.061 14.729  1.00 62.91  ?  400 TYR A CD2    1 
ATOM 6241  C CE1    . TYR A 1 396 ? 18.697  -29.610 14.498  1.00 78.68  ?  400 TYR A CE1    1 
ATOM 6242  C CE2    . TYR A 1 396 ? 16.952  -31.114 13.861  1.00 61.94  ?  400 TYR A CE2    1 
ATOM 6243  C CZ     . TYR A 1 396 ? 17.578  -29.890 13.751  1.00 64.17  ?  400 TYR A CZ     1 
ATOM 6244  O OH     . TYR A 1 396 ? 17.093  -28.933 12.896  1.00 65.71  ?  400 TYR A OH     1 
ATOM 6245  H H      . TYR A 1 396 ? 19.826  -34.733 14.898  1.00 101.41 ?  400 TYR A H      1 
ATOM 6246  H HA     . TYR A 1 396 ? 21.076  -32.521 15.819  1.00 94.11  ?  400 TYR A HA     1 
ATOM 6247  H HB2    . TYR A 1 396 ? 18.548  -33.590 16.442  1.00 67.29  ?  400 TYR A HB2    1 
ATOM 6248  H HB3    . TYR A 1 396 ? 19.188  -32.433 17.323  1.00 67.29  ?  400 TYR A HB3    1 
ATOM 6249  H HD1    . TYR A 1 396 ? 19.954  -30.367 15.861  1.00 102.50 ?  400 TYR A HD1    1 
ATOM 6250  H HD2    . TYR A 1 396 ? 17.039  -32.887 14.803  1.00 75.49  ?  400 TYR A HD2    1 
ATOM 6251  H HE1    . TYR A 1 396 ? 19.116  -28.784 14.421  1.00 94.42  ?  400 TYR A HE1    1 
ATOM 6252  H HE2    . TYR A 1 396 ? 16.195  -31.300 13.355  1.00 74.32  ?  400 TYR A HE2    1 
ATOM 6253  H HH     . TYR A 1 396 ? 16.411  -29.222 12.499  1.00 78.85  ?  400 TYR A HH     1 
ATOM 6254  N N      . HIS A 1 397 ? 21.071  -35.277 17.414  1.00 96.77  ?  401 HIS A N      1 
ATOM 6255  C CA     . HIS A 1 397 ? 21.548  -35.915 18.641  1.00 99.93  ?  401 HIS A CA     1 
ATOM 6256  C C      . HIS A 1 397 ? 23.063  -36.093 18.627  1.00 107.77 ?  401 HIS A C      1 
ATOM 6257  O O      . HIS A 1 397 ? 23.778  -35.480 19.426  1.00 115.34 ?  401 HIS A O      1 
ATOM 6258  C CB     . HIS A 1 397 ? 20.832  -37.253 18.845  1.00 79.14  ?  401 HIS A CB     1 
ATOM 6259  C CG     . HIS A 1 397 ? 19.526  -37.126 19.563  1.00 76.64  ?  401 HIS A CG     1 
ATOM 6260  N ND1    . HIS A 1 397 ? 18.381  -36.665 18.950  1.00 70.22  ?  401 HIS A ND1    1 
ATOM 6261  C CD2    . HIS A 1 397 ? 19.188  -37.379 20.849  1.00 82.67  ?  401 HIS A CD2    1 
ATOM 6262  C CE1    . HIS A 1 397 ? 17.391  -36.652 19.825  1.00 73.32  ?  401 HIS A CE1    1 
ATOM 6263  N NE2    . HIS A 1 397 ? 17.854  -37.080 20.985  1.00 75.16  ?  401 HIS A NE2    1 
ATOM 6264  H H      . HIS A 1 397 ? 20.716  -35.813 16.843  1.00 116.12 ?  401 HIS A H      1 
ATOM 6265  H HA     . HIS A 1 397 ? 21.326  -35.345 19.393  1.00 119.91 ?  401 HIS A HA     1 
ATOM 6266  H HB2    . HIS A 1 397 ? 20.658  -37.651 17.978  1.00 94.97  ?  401 HIS A HB2    1 
ATOM 6267  H HB3    . HIS A 1 397 ? 21.403  -37.838 19.367  1.00 94.97  ?  401 HIS A HB3    1 
ATOM 6268  H HD2    . HIS A 1 397 ? 19.752  -37.702 21.514  1.00 99.20  ?  401 HIS A HD2    1 
ATOM 6269  H HE1    . HIS A 1 397 ? 16.516  -36.385 19.653  1.00 87.98  ?  401 HIS A HE1    1 
ATOM 6270  H HE2    . HIS A 1 397 ? 17.395  -37.159 21.708  1.00 90.19  ?  401 HIS A HE2    1 
ATOM 6271  N N      . HIS A 1 398 ? 23.570  -36.925 17.726  1.00 91.15  ?  402 HIS A N      1 
ATOM 6272  C CA     . HIS A 1 398 ? 24.988  -37.244 17.690  1.00 105.78 ?  402 HIS A CA     1 
ATOM 6273  C C      . HIS A 1 398 ? 25.688  -36.489 16.568  1.00 103.66 ?  402 HIS A C      1 
ATOM 6274  O O      . HIS A 1 398 ? 25.072  -36.063 15.588  1.00 97.58  ?  402 HIS A O      1 
ATOM 6275  C CB     . HIS A 1 398 ? 25.196  -38.751 17.526  1.00 105.49 ?  402 HIS A CB     1 
ATOM 6276  C CG     . HIS A 1 398 ? 24.752  -39.548 18.712  1.00 121.08 ?  402 HIS A CG     1 
ATOM 6277  N ND1    . HIS A 1 398 ? 23.439  -39.917 18.912  1.00 129.08 ?  402 HIS A ND1    1 
ATOM 6278  C CD2    . HIS A 1 398 ? 25.444  -40.034 19.769  1.00 116.61 ?  402 HIS A CD2    1 
ATOM 6279  C CE1    . HIS A 1 398 ? 23.343  -40.603 20.037  1.00 121.99 ?  402 HIS A CE1    1 
ATOM 6280  N NE2    . HIS A 1 398 ? 24.546  -40.688 20.577  1.00 115.34 ?  402 HIS A NE2    1 
ATOM 6281  H H      . HIS A 1 398 ? 23.107  -37.321 17.118  1.00 109.38 ?  402 HIS A H      1 
ATOM 6282  H HA     . HIS A 1 398 ? 25.393  -36.976 18.530  1.00 126.93 ?  402 HIS A HA     1 
ATOM 6283  H HB2    . HIS A 1 398 ? 24.690  -39.055 16.756  1.00 126.59 ?  402 HIS A HB2    1 
ATOM 6284  H HB3    . HIS A 1 398 ? 26.141  -38.923 17.388  1.00 126.59 ?  402 HIS A HB3    1 
ATOM 6285  H HD2    . HIS A 1 398 ? 26.358  -39.945 19.919  1.00 139.93 ?  402 HIS A HD2    1 
ATOM 6286  H HE1    . HIS A 1 398 ? 22.562  -40.964 20.389  1.00 146.39 ?  402 HIS A HE1    1 
ATOM 6287  H HE2    . HIS A 1 398 ? 24.735  -41.088 21.314  1.00 138.41 ?  402 HIS A HE2    1 
ATOM 6288  N N      . ASN A 1 399 ? 26.996  -36.327 16.733  1.00 111.72 ?  403 ASN A N      1 
ATOM 6289  C CA     . ASN A 1 399 ? 27.811  -35.567 15.795  1.00 107.70 ?  403 ASN A CA     1 
ATOM 6290  C C      . ASN A 1 399 ? 27.690  -36.131 14.384  1.00 100.77 ?  403 ASN A C      1 
ATOM 6291  O O      . ASN A 1 399 ? 27.169  -35.470 13.487  1.00 99.32  ?  403 ASN A O      1 
ATOM 6292  C CB     . ASN A 1 399 ? 29.274  -35.573 16.241  1.00 104.48 ?  403 ASN A CB     1 
ATOM 6293  C CG     . ASN A 1 399 ? 29.441  -35.154 17.689  1.00 98.70  ?  403 ASN A CG     1 
ATOM 6294  O OD1    . ASN A 1 399 ? 28.461  -34.966 18.409  1.00 107.42 ?  403 ASN A OD1    1 
ATOM 6295  N ND2    . ASN A 1 399 ? 30.687  -35.015 18.125  1.00 96.55  ?  403 ASN A ND2    1 
ATOM 6296  H H      . ASN A 1 399 ? 27.442  -36.653 17.393  1.00 134.06 ?  403 ASN A H      1 
ATOM 6297  H HA     . ASN A 1 399 ? 27.504  -34.647 15.780  1.00 129.24 ?  403 ASN A HA     1 
ATOM 6298  H HB2    . ASN A 1 399 ? 29.631  -36.470 16.145  1.00 125.37 ?  403 ASN A HB2    1 
ATOM 6299  H HB3    . ASN A 1 399 ? 29.776  -34.954 15.689  1.00 125.37 ?  403 ASN A HB3    1 
ATOM 6300  H HD21   . ASN A 1 399 ? 30.834  -34.779 18.939  1.00 115.86 ?  403 ASN A HD21   1 
ATOM 6301  H HD22   . ASN A 1 399 ? 31.347  -35.162 17.594  1.00 115.86 ?  403 ASN A HD22   1 
ATOM 6302  N N      . GLN A 1 406 ? 32.215  -30.330 4.712   1.00 119.67 ?  410 GLN A N      1 
ATOM 6303  C CA     . GLN A 1 406 ? 30.954  -30.839 4.185   1.00 112.17 ?  410 GLN A CA     1 
ATOM 6304  C C      . GLN A 1 406 ? 30.009  -31.251 5.307   1.00 116.51 ?  410 GLN A C      1 
ATOM 6305  O O      . GLN A 1 406 ? 28.953  -31.830 5.057   1.00 106.83 ?  410 GLN A O      1 
ATOM 6306  C CB     . GLN A 1 406 ? 31.208  -32.020 3.250   1.00 94.29  ?  410 GLN A CB     1 
ATOM 6307  C CG     . GLN A 1 406 ? 31.812  -31.617 1.918   1.00 107.25 ?  410 GLN A CG     1 
ATOM 6308  C CD     . GLN A 1 406 ? 32.757  -32.661 1.366   1.00 104.37 ?  410 GLN A CD     1 
ATOM 6309  O OE1    . GLN A 1 406 ? 32.501  -33.861 1.460   1.00 86.84  ?  410 GLN A OE1    1 
ATOM 6310  N NE2    . GLN A 1 406 ? 33.866  -32.208 0.791   1.00 108.26 ?  410 GLN A NE2    1 
ATOM 6311  H HA     . GLN A 1 406 ? 30.521  -30.138 3.672   1.00 134.61 ?  410 GLN A HA     1 
ATOM 6312  H HB2    . GLN A 1 406 ? 31.822  -32.635 3.681   1.00 113.15 ?  410 GLN A HB2    1 
ATOM 6313  H HB3    . GLN A 1 406 ? 30.365  -32.467 3.072   1.00 113.15 ?  410 GLN A HB3    1 
ATOM 6314  H HG2    . GLN A 1 406 ? 31.098  -31.487 1.274   1.00 128.70 ?  410 GLN A HG2    1 
ATOM 6315  H HG3    . GLN A 1 406 ? 32.309  -30.792 2.033   1.00 128.70 ?  410 GLN A HG3    1 
ATOM 6316  H HE21   . GLN A 1 406 ? 34.014  -31.362 0.749   1.00 129.92 ?  410 GLN A HE21   1 
ATOM 6317  H HE22   . GLN A 1 406 ? 34.436  -32.761 0.461   1.00 129.92 ?  410 GLN A HE22   1 
ATOM 6318  N N      . SER A 1 407 ? 30.392  -30.950 6.549   1.00 125.36 ?  411 SER A N      1 
ATOM 6319  C CA     . SER A 1 407 ? 29.511  -31.238 7.675   1.00 116.88 ?  411 SER A CA     1 
ATOM 6320  C C      . SER A 1 407 ? 28.213  -30.450 7.565   1.00 118.17 ?  411 SER A C      1 
ATOM 6321  O O      . SER A 1 407 ? 27.127  -30.990 7.810   1.00 114.61 ?  411 SER A O      1 
ATOM 6322  C CB     . SER A 1 407 ? 30.222  -30.923 8.991   1.00 101.19 ?  411 SER A CB     1 
ATOM 6323  O OG     . SER A 1 407 ? 30.660  -29.576 9.021   1.00 112.25 ?  411 SER A OG     1 
ATOM 6324  H H      . SER A 1 407 ? 31.141  -30.586 6.762   1.00 150.43 ?  411 SER A H      1 
ATOM 6325  H HA     . SER A 1 407 ? 29.291  -32.183 7.671   1.00 140.26 ?  411 SER A HA     1 
ATOM 6326  H HB2    . SER A 1 407 ? 29.605  -31.070 9.725   1.00 121.42 ?  411 SER A HB2    1 
ATOM 6327  H HB3    . SER A 1 407 ? 30.991  -31.507 9.082   1.00 121.42 ?  411 SER A HB3    1 
ATOM 6328  H HG     . SER A 1 407 ? 31.049  -29.417 9.748   1.00 134.70 ?  411 SER A HG     1 
ATOM 6329  N N      . HIS A 1 408 ? 28.301  -29.174 7.182   1.00 119.90 ?  412 HIS A N      1 
ATOM 6330  C CA     . HIS A 1 408 ? 27.101  -28.352 7.078   1.00 108.25 ?  412 HIS A CA     1 
ATOM 6331  C C      . HIS A 1 408 ? 26.256  -28.742 5.872   1.00 100.25 ?  412 HIS A C      1 
ATOM 6332  O O      . HIS A 1 408 ? 25.027  -28.621 5.919   1.00 93.67  ?  412 HIS A O      1 
ATOM 6333  C CB     . HIS A 1 408 ? 27.482  -26.873 7.022   1.00 112.65 ?  412 HIS A CB     1 
ATOM 6334  C CG     . HIS A 1 408 ? 27.565  -26.228 8.371   1.00 123.45 ?  412 HIS A CG     1 
ATOM 6335  N ND1    . HIS A 1 408 ? 26.909  -25.055 8.677   1.00 133.32 ?  412 HIS A ND1    1 
ATOM 6336  C CD2    . HIS A 1 408 ? 28.211  -26.603 9.500   1.00 117.69 ?  412 HIS A CD2    1 
ATOM 6337  C CE1    . HIS A 1 408 ? 27.156  -24.730 9.933   1.00 130.61 ?  412 HIS A CE1    1 
ATOM 6338  N NE2    . HIS A 1 408 ? 27.943  -25.653 10.455  1.00 129.19 ?  412 HIS A NE2    1 
ATOM 6339  H H      . HIS A 1 408 ? 29.033  -28.769 6.982   1.00 143.88 ?  412 HIS A H      1 
ATOM 6340  H HA     . HIS A 1 408 ? 26.561  -28.488 7.872   1.00 129.90 ?  412 HIS A HA     1 
ATOM 6341  H HB2    . HIS A 1 408 ? 28.350  -26.789 6.598   1.00 135.17 ?  412 HIS A HB2    1 
ATOM 6342  H HB3    . HIS A 1 408 ? 26.815  -26.397 6.505   1.00 135.17 ?  412 HIS A HB3    1 
ATOM 6343  H HD2    . HIS A 1 408 ? 28.741  -27.360 9.607   1.00 141.23 ?  412 HIS A HD2    1 
ATOM 6344  H HE1    . HIS A 1 408 ? 26.830  -23.979 10.375  1.00 156.73 ?  412 HIS A HE1    1 
ATOM 6345  H HE2    . HIS A 1 408 ? 28.240  -25.658 11.262  1.00 155.03 ?  412 HIS A HE2    1 
ATOM 6346  N N      . PHE A 1 409 ? 26.884  -29.210 4.792   1.00 110.21 ?  413 PHE A N      1 
ATOM 6347  C CA     . PHE A 1 409 ? 26.120  -29.824 3.711   1.00 120.62 ?  413 PHE A CA     1 
ATOM 6348  C C      . PHE A 1 409 ? 25.227  -30.927 4.263   1.00 109.22 ?  413 PHE A C      1 
ATOM 6349  O O      . PHE A 1 409 ? 24.017  -30.952 4.015   1.00 99.02  ?  413 PHE A O      1 
ATOM 6350  C CB     . PHE A 1 409 ? 27.070  -30.378 2.644   1.00 119.53 ?  413 PHE A CB     1 
ATOM 6351  C CG     . PHE A 1 409 ? 26.402  -31.278 1.636   1.00 117.28 ?  413 PHE A CG     1 
ATOM 6352  C CD1    . PHE A 1 409 ? 26.026  -30.792 0.395   1.00 118.86 ?  413 PHE A CD1    1 
ATOM 6353  C CD2    . PHE A 1 409 ? 26.162  -32.612 1.926   1.00 106.90 ?  413 PHE A CD2    1 
ATOM 6354  C CE1    . PHE A 1 409 ? 25.416  -31.618 -0.532  1.00 100.72 ?  413 PHE A CE1    1 
ATOM 6355  C CE2    . PHE A 1 409 ? 25.550  -33.438 1.006   1.00 94.81  ?  413 PHE A CE2    1 
ATOM 6356  C CZ     . PHE A 1 409 ? 25.179  -32.942 -0.225  1.00 84.95  ?  413 PHE A CZ     1 
ATOM 6357  H H      . PHE A 1 409 ? 27.734  -29.184 4.663   1.00 132.25 ?  413 PHE A H      1 
ATOM 6358  H HA     . PHE A 1 409 ? 25.555  -29.154 3.297   1.00 144.74 ?  413 PHE A HA     1 
ATOM 6359  H HB2    . PHE A 1 409 ? 27.465  -29.634 2.162   1.00 143.44 ?  413 PHE A HB2    1 
ATOM 6360  H HB3    . PHE A 1 409 ? 27.767  -30.891 3.082   1.00 143.44 ?  413 PHE A HB3    1 
ATOM 6361  H HD1    . PHE A 1 409 ? 26.183  -29.900 0.183   1.00 142.63 ?  413 PHE A HD1    1 
ATOM 6362  H HD2    . PHE A 1 409 ? 26.409  -32.953 2.755   1.00 128.28 ?  413 PHE A HD2    1 
ATOM 6363  H HE1    . PHE A 1 409 ? 25.165  -31.281 -1.362  1.00 120.86 ?  413 PHE A HE1    1 
ATOM 6364  H HE2    . PHE A 1 409 ? 25.393  -34.331 1.214   1.00 113.77 ?  413 PHE A HE2    1 
ATOM 6365  H HZ     . PHE A 1 409 ? 24.769  -33.498 -0.847  1.00 101.93 ?  413 PHE A HZ     1 
ATOM 6366  N N      . ASP A 1 410 ? 25.818  -31.849 5.023   1.00 98.85  ?  414 ASP A N      1 
ATOM 6367  C CA     . ASP A 1 410 ? 25.044  -32.927 5.626   1.00 90.10  ?  414 ASP A CA     1 
ATOM 6368  C C      . ASP A 1 410 ? 23.927  -32.371 6.499   1.00 88.54  ?  414 ASP A C      1 
ATOM 6369  O O      . ASP A 1 410 ? 22.774  -32.810 6.408   1.00 91.33  ?  414 ASP A O      1 
ATOM 6370  C CB     . ASP A 1 410 ? 25.968  -33.833 6.441   1.00 101.97 ?  414 ASP A CB     1 
ATOM 6371  C CG     . ASP A 1 410 ? 27.091  -34.419 5.609   1.00 105.07 ?  414 ASP A CG     1 
ATOM 6372  O OD1    . ASP A 1 410 ? 27.435  -33.823 4.567   1.00 109.56 ?  414 ASP A OD1    1 
ATOM 6373  O OD2    . ASP A 1 410 ? 27.633  -35.474 5.998   1.00 91.97  -1 414 ASP A OD2    1 
ATOM 6374  H H      . ASP A 1 410 ? 26.659  -31.872 5.202   1.00 118.62 ?  414 ASP A H      1 
ATOM 6375  H HA     . ASP A 1 410 ? 24.641  -33.461 4.923   1.00 108.12 ?  414 ASP A HA     1 
ATOM 6376  H HB2    . ASP A 1 410 ? 26.364  -33.316 7.159   1.00 122.37 ?  414 ASP A HB2    1 
ATOM 6377  H HB3    . ASP A 1 410 ? 25.450  -34.567 6.806   1.00 122.37 ?  414 ASP A HB3    1 
ATOM 6378  N N      . TYR A 1 411 ? 24.250  -31.395 7.350   1.00 92.53  ?  415 TYR A N      1 
ATOM 6379  C CA     . TYR A 1 411 ? 23.240  -30.796 8.216   1.00 88.57  ?  415 TYR A CA     1 
ATOM 6380  C C      . TYR A 1 411 ? 22.057  -30.283 7.404   1.00 82.45  ?  415 TYR A C      1 
ATOM 6381  O O      . TYR A 1 411 ? 20.898  -30.574 7.717   1.00 81.10  ?  415 TYR A O      1 
ATOM 6382  C CB     . TYR A 1 411 ? 23.857  -29.659 9.035   1.00 96.23  ?  415 TYR A CB     1 
ATOM 6383  C CG     . TYR A 1 411 ? 24.644  -30.113 10.246  1.00 98.84  ?  415 TYR A CG     1 
ATOM 6384  C CD1    . TYR A 1 411 ? 26.029  -30.007 10.285  1.00 101.69 ?  415 TYR A CD1    1 
ATOM 6385  C CD2    . TYR A 1 411 ? 24.000  -30.640 11.354  1.00 83.85  ?  415 TYR A CD2    1 
ATOM 6386  C CE1    . TYR A 1 411 ? 26.746  -30.417 11.394  1.00 97.68  ?  415 TYR A CE1    1 
ATOM 6387  C CE2    . TYR A 1 411 ? 24.706  -31.051 12.466  1.00 92.89  ?  415 TYR A CE2    1 
ATOM 6388  C CZ     . TYR A 1 411 ? 26.079  -30.938 12.481  1.00 100.65 ?  415 TYR A CZ     1 
ATOM 6389  O OH     . TYR A 1 411 ? 26.785  -31.348 13.587  1.00 103.24 ?  415 TYR A OH     1 
ATOM 6390  H H      . TYR A 1 411 ? 25.039  -31.067 7.443   1.00 111.03 ?  415 TYR A H      1 
ATOM 6391  H HA     . TYR A 1 411 ? 22.912  -31.468 8.834   1.00 106.28 ?  415 TYR A HA     1 
ATOM 6392  H HB2    . TYR A 1 411 ? 24.459  -29.158 8.463   1.00 115.48 ?  415 TYR A HB2    1 
ATOM 6393  H HB3    . TYR A 1 411 ? 23.145  -29.080 9.347   1.00 115.48 ?  415 TYR A HB3    1 
ATOM 6394  H HD1    . TYR A 1 411 ? 26.481  -29.655 9.553   1.00 122.03 ?  415 TYR A HD1    1 
ATOM 6395  H HD2    . TYR A 1 411 ? 23.073  -30.717 11.349  1.00 100.62 ?  415 TYR A HD2    1 
ATOM 6396  H HE1    . TYR A 1 411 ? 27.673  -30.341 11.406  1.00 117.22 ?  415 TYR A HE1    1 
ATOM 6397  H HE2    . TYR A 1 411 ? 24.258  -31.404 13.201  1.00 111.47 ?  415 TYR A HE2    1 
ATOM 6398  H HH     . TYR A 1 411 ? 26.258  -31.643 14.171  1.00 123.88 ?  415 TYR A HH     1 
ATOM 6399  N N      . ASN A 1 412 ? 22.336  -29.519 6.347   1.00 84.32  ?  416 ASN A N      1 
ATOM 6400  C CA     . ASN A 1 412 ? 21.263  -28.928 5.553   1.00 89.51  ?  416 ASN A CA     1 
ATOM 6401  C C      . ASN A 1 412 ? 20.432  -30.004 4.868   1.00 82.22  ?  416 ASN A C      1 
ATOM 6402  O O      . ASN A 1 412 ? 19.196  -29.956 4.883   1.00 69.80  ?  416 ASN A O      1 
ATOM 6403  C CB     . ASN A 1 412 ? 21.851  -27.965 4.522   1.00 100.15 ?  416 ASN A CB     1 
ATOM 6404  C CG     . ASN A 1 412 ? 22.342  -26.672 5.143   1.00 100.27 ?  416 ASN A CG     1 
ATOM 6405  O OD1    . ASN A 1 412 ? 21.752  -25.611 4.941   1.00 86.26  ?  416 ASN A OD1    1 
ATOM 6406  N ND2    . ASN A 1 412 ? 23.423  -26.754 5.912   1.00 101.99 ?  416 ASN A ND2    1 
ATOM 6407  H H      . ASN A 1 412 ? 23.129  -29.330 6.073   1.00 101.19 ?  416 ASN A H      1 
ATOM 6408  H HA     . ASN A 1 412 ? 20.678  -28.423 6.138   1.00 107.41 ?  416 ASN A HA     1 
ATOM 6409  H HB2    . ASN A 1 412 ? 22.603  -28.391 4.083   1.00 120.18 ?  416 ASN A HB2    1 
ATOM 6410  H HB3    . ASN A 1 412 ? 21.168  -27.744 3.870   1.00 120.18 ?  416 ASN A HB3    1 
ATOM 6411  H HD21   . ASN A 1 412 ? 23.739  -26.048 6.287   1.00 122.39 ?  416 ASN A HD21   1 
ATOM 6412  H HD22   . ASN A 1 412 ? 23.806  -27.514 6.035   1.00 122.39 ?  416 ASN A HD22   1 
ATOM 6413  N N      . THR A 1 413 ? 21.095  -30.987 4.257   1.00 81.92  ?  417 THR A N      1 
ATOM 6414  C CA     . THR A 1 413 ? 20.369  -32.036 3.549   1.00 68.39  ?  417 THR A CA     1 
ATOM 6415  C C      . THR A 1 413 ? 19.451  -32.800 4.493   1.00 69.44  ?  417 THR A C      1 
ATOM 6416  O O      . THR A 1 413 ? 18.305  -33.105 4.144   1.00 65.41  ?  417 THR A O      1 
ATOM 6417  C CB     . THR A 1 413 ? 21.352  -32.987 2.871   1.00 54.75  ?  417 THR A CB     1 
ATOM 6418  O OG1    . THR A 1 413 ? 22.276  -33.495 3.841   1.00 70.30  ?  417 THR A OG1    1 
ATOM 6419  C CG2    . THR A 1 413 ? 22.116  -32.265 1.770   1.00 65.53  ?  417 THR A CG2    1 
ATOM 6420  H H      . THR A 1 413 ? 21.951  -31.068 4.238   1.00 98.30  ?  417 THR A H      1 
ATOM 6421  H HA     . THR A 1 413 ? 19.820  -31.630 2.860   1.00 82.07  ?  417 THR A HA     1 
ATOM 6422  H HB     . THR A 1 413 ? 20.865  -33.725 2.472   1.00 65.70  ?  417 THR A HB     1 
ATOM 6423  H HG1    . THR A 1 413 ? 22.702  -32.862 4.191   1.00 84.36  ?  417 THR A HG1    1 
ATOM 6424  H HG21   . THR A 1 413 ? 22.738  -32.875 1.344   1.00 78.63  ?  417 THR A HG21   1 
ATOM 6425  H HG22   . THR A 1 413 ? 21.497  -31.930 1.103   1.00 78.63  ?  417 THR A HG22   1 
ATOM 6426  H HG23   . THR A 1 413 ? 22.611  -31.520 2.144   1.00 78.63  ?  417 THR A HG23   1 
ATOM 6427  N N      . LEU A 1 414 ? 19.932  -33.110 5.697   1.00 70.96  ?  418 LEU A N      1 
ATOM 6428  C CA     . LEU A 1 414 ? 19.099  -33.815 6.664   1.00 62.80  ?  418 LEU A CA     1 
ATOM 6429  C C      . LEU A 1 414 ? 17.863  -32.997 7.012   1.00 57.73  ?  418 LEU A C      1 
ATOM 6430  O O      . LEU A 1 414 ? 16.736  -33.504 6.969   1.00 44.26  ?  418 LEU A O      1 
ATOM 6431  C CB     . LEU A 1 414 ? 19.907  -34.132 7.922   1.00 71.75  ?  418 LEU A CB     1 
ATOM 6432  C CG     . LEU A 1 414 ? 21.036  -35.149 7.747   1.00 72.19  ?  418 LEU A CG     1 
ATOM 6433  C CD1    . LEU A 1 414 ? 21.930  -35.166 8.975   1.00 83.34  ?  418 LEU A CD1    1 
ATOM 6434  C CD2    . LEU A 1 414 ? 20.477  -36.539 7.479   1.00 80.90  ?  418 LEU A CD2    1 
ATOM 6435  H H      . LEU A 1 414 ? 20.726  -32.926 5.974   1.00 85.15  ?  418 LEU A H      1 
ATOM 6436  H HA     . LEU A 1 414 ? 18.805  -34.654 6.277   1.00 75.36  ?  418 LEU A HA     1 
ATOM 6437  H HB2    . LEU A 1 414 ? 20.307  -33.308 8.244   1.00 86.10  ?  418 LEU A HB2    1 
ATOM 6438  H HB3    . LEU A 1 414 ? 19.303  -34.482 8.595   1.00 86.10  ?  418 LEU A HB3    1 
ATOM 6439  H HG     . LEU A 1 414 ? 21.578  -34.892 6.985   1.00 86.62  ?  418 LEU A HG     1 
ATOM 6440  H HD11   . LEU A 1 414 ? 22.636  -35.817 8.842   1.00 100.00 ?  418 LEU A HD11   1 
ATOM 6441  H HD12   . LEU A 1 414 ? 22.312  -34.283 9.100   1.00 100.00 ?  418 LEU A HD12   1 
ATOM 6442  H HD13   . LEU A 1 414 ? 21.397  -35.409 9.749   1.00 100.00 ?  418 LEU A HD13   1 
ATOM 6443  H HD21   . LEU A 1 414 ? 21.214  -37.160 7.373   1.00 97.08  ?  418 LEU A HD21   1 
ATOM 6444  H HD22   . LEU A 1 414 ? 19.923  -36.806 8.230   1.00 97.08  ?  418 LEU A HD22   1 
ATOM 6445  H HD23   . LEU A 1 414 ? 19.945  -36.514 6.668   1.00 97.08  ?  418 LEU A HD23   1 
ATOM 6446  N N      . GLU A 1 415 ? 18.056  -31.722 7.355   1.00 74.13  ?  419 GLU A N      1 
ATOM 6447  C CA     . GLU A 1 415 ? 16.916  -30.855 7.631   1.00 73.04  ?  419 GLU A CA     1 
ATOM 6448  C C      . GLU A 1 415 ? 15.970  -30.811 6.440   1.00 66.00  ?  419 GLU A C      1 
ATOM 6449  O O      . GLU A 1 415 ? 14.745  -30.797 6.608   1.00 62.98  ?  419 GLU A O      1 
ATOM 6450  C CB     . GLU A 1 415 ? 17.395  -29.447 7.978   1.00 71.24  ?  419 GLU A CB     1 
ATOM 6451  C CG     . GLU A 1 415 ? 18.309  -29.378 9.184   1.00 67.36  ?  419 GLU A CG     1 
ATOM 6452  C CD     . GLU A 1 415 ? 18.899  -27.999 9.379   1.00 84.83  ?  419 GLU A CD     1 
ATOM 6453  O OE1    . GLU A 1 415 ? 19.789  -27.845 10.241  1.00 93.98  ?  419 GLU A OE1    1 
ATOM 6454  O OE2    . GLU A 1 415 ? 18.474  -27.067 8.666   1.00 87.93  -1 419 GLU A OE2    1 
ATOM 6455  H H      . GLU A 1 415 ? 18.824  -31.342 7.434   1.00 88.95  ?  419 GLU A H      1 
ATOM 6456  H HA     . GLU A 1 415 ? 16.427  -31.204 8.392   1.00 87.65  ?  419 GLU A HA     1 
ATOM 6457  H HB2    . GLU A 1 415 ? 17.882  -29.089 7.219   1.00 85.48  ?  419 GLU A HB2    1 
ATOM 6458  H HB3    . GLU A 1 415 ? 16.621  -28.892 8.162   1.00 85.48  ?  419 GLU A HB3    1 
ATOM 6459  H HG2    . GLU A 1 415 ? 17.802  -29.605 9.980   1.00 80.83  ?  419 GLU A HG2    1 
ATOM 6460  H HG3    . GLU A 1 415 ? 19.040  -30.005 9.065   1.00 80.83  ?  419 GLU A HG3    1 
ATOM 6461  N N      . PHE A 1 416 ? 16.521  -30.791 5.227   1.00 59.86  ?  420 PHE A N      1 
ATOM 6462  C CA     . PHE A 1 416 ? 15.679  -30.784 4.037   1.00 56.25  ?  420 PHE A CA     1 
ATOM 6463  C C      . PHE A 1 416 ? 14.825  -32.041 3.977   1.00 58.20  ?  420 PHE A C      1 
ATOM 6464  O O      . PHE A 1 416 ? 13.601  -31.970 3.820   1.00 53.74  ?  420 PHE A O      1 
ATOM 6465  C CB     . PHE A 1 416 ? 16.547  -30.659 2.786   1.00 60.66  ?  420 PHE A CB     1 
ATOM 6466  C CG     . PHE A 1 416 ? 15.781  -30.259 1.563   1.00 53.33  ?  420 PHE A CG     1 
ATOM 6467  C CD1    . PHE A 1 416 ? 15.581  -31.153 0.528   1.00 47.27  ?  420 PHE A CD1    1 
ATOM 6468  C CD2    . PHE A 1 416 ? 15.251  -28.985 1.454   1.00 79.75  ?  420 PHE A CD2    1 
ATOM 6469  C CE1    . PHE A 1 416 ? 14.874  -30.781 -0.595  1.00 47.61  ?  420 PHE A CE1    1 
ATOM 6470  C CE2    . PHE A 1 416 ? 14.543  -28.610 0.335   1.00 79.44  ?  420 PHE A CE2    1 
ATOM 6471  C CZ     . PHE A 1 416 ? 14.354  -29.507 -0.689  1.00 65.13  ?  420 PHE A CZ     1 
ATOM 6472  H H      . PHE A 1 416 ? 17.366  -30.782 5.069   1.00 71.83  ?  420 PHE A H      1 
ATOM 6473  H HA     . PHE A 1 416 ? 15.086  -30.017 4.072   1.00 67.50  ?  420 PHE A HA     1 
ATOM 6474  H HB2    . PHE A 1 416 ? 17.228  -29.987 2.944   1.00 72.80  ?  420 PHE A HB2    1 
ATOM 6475  H HB3    . PHE A 1 416 ? 16.965  -31.516 2.608   1.00 72.80  ?  420 PHE A HB3    1 
ATOM 6476  H HD1    . PHE A 1 416 ? 15.931  -32.013 0.588   1.00 56.73  ?  420 PHE A HD1    1 
ATOM 6477  H HD2    . PHE A 1 416 ? 15.377  -28.375 2.145   1.00 95.70  ?  420 PHE A HD2    1 
ATOM 6478  H HE1    . PHE A 1 416 ? 14.746  -31.388 -1.287  1.00 57.13  ?  420 PHE A HE1    1 
ATOM 6479  H HE2    . PHE A 1 416 ? 14.193  -27.750 0.272   1.00 95.33  ?  420 PHE A HE2    1 
ATOM 6480  H HZ     . PHE A 1 416 ? 13.876  -29.254 -1.446  1.00 78.15  ?  420 PHE A HZ     1 
ATOM 6481  N N      . ILE A 1 417 ? 15.456  -33.208 4.113   1.00 60.35  ?  421 ILE A N      1 
ATOM 6482  C CA     . ILE A 1 417 ? 14.710  -34.461 4.113   1.00 46.06  ?  421 ILE A CA     1 
ATOM 6483  C C      . ILE A 1 417 ? 13.662  -34.443 5.216   1.00 43.05  ?  421 ILE A C      1 
ATOM 6484  O O      . ILE A 1 417 ? 12.471  -34.665 4.969   1.00 48.69  ?  421 ILE A O      1 
ATOM 6485  C CB     . ILE A 1 417 ? 15.669  -35.654 4.262   1.00 39.84  ?  421 ILE A CB     1 
ATOM 6486  C CG1    . ILE A 1 417 ? 16.658  -35.682 3.095   1.00 53.45  ?  421 ILE A CG1    1 
ATOM 6487  C CG2    . ILE A 1 417 ? 14.891  -36.960 4.313   1.00 61.87  ?  421 ILE A CG2    1 
ATOM 6488  C CD1    . ILE A 1 417 ? 17.812  -36.634 3.286   1.00 57.67  ?  421 ILE A CD1    1 
ATOM 6489  H H      . ILE A 1 417 ? 16.306  -33.298 4.206   1.00 72.42  ?  421 ILE A H      1 
ATOM 6490  H HA     . ILE A 1 417 ? 14.249  -34.553 3.264   1.00 55.27  ?  421 ILE A HA     1 
ATOM 6491  H HB     . ILE A 1 417 ? 16.166  -35.554 5.090   1.00 47.80  ?  421 ILE A HB     1 
ATOM 6492  H HG12   . ILE A 1 417 ? 16.185  -35.949 2.292   1.00 64.14  ?  421 ILE A HG12   1 
ATOM 6493  H HG13   . ILE A 1 417 ? 17.026  -34.792 2.978   1.00 64.14  ?  421 ILE A HG13   1 
ATOM 6494  H HG21   . ILE A 1 417 ? 15.516  -37.696 4.407   1.00 74.25  ?  421 ILE A HG21   1 
ATOM 6495  H HG22   . ILE A 1 417 ? 14.288  -36.938 5.073   1.00 74.25  ?  421 ILE A HG22   1 
ATOM 6496  H HG23   . ILE A 1 417 ? 14.385  -37.058 3.492   1.00 74.25  ?  421 ILE A HG23   1 
ATOM 6497  H HD11   . ILE A 1 417 ? 18.388  -36.591 2.507   1.00 69.20  ?  421 ILE A HD11   1 
ATOM 6498  H HD12   . ILE A 1 417 ? 18.307  -36.374 4.079   1.00 69.20  ?  421 ILE A HD12   1 
ATOM 6499  H HD13   . ILE A 1 417 ? 17.464  -37.533 3.392   1.00 69.20  ?  421 ILE A HD13   1 
ATOM 6500  N N      . ILE A 1 418 ? 14.090  -34.166 6.449   1.00 32.47  ?  422 ILE A N      1 
ATOM 6501  C CA     . ILE A 1 418 ? 13.150  -34.073 7.563   1.00 34.86  ?  422 ILE A CA     1 
ATOM 6502  C C      . ILE A 1 418 ? 11.994  -33.157 7.199   1.00 51.31  ?  422 ILE A C      1 
ATOM 6503  O O      . ILE A 1 418 ? 10.833  -33.434 7.523   1.00 48.80  ?  422 ILE A O      1 
ATOM 6504  C CB     . ILE A 1 418 ? 13.872  -33.586 8.833   1.00 28.25  ?  422 ILE A CB     1 
ATOM 6505  C CG1    . ILE A 1 418 ? 14.918  -34.608 9.274   1.00 37.80  ?  422 ILE A CG1    1 
ATOM 6506  C CG2    . ILE A 1 418 ? 12.870  -33.344 9.958   1.00 32.07  ?  422 ILE A CG2    1 
ATOM 6507  C CD1    . ILE A 1 418 ? 15.813  -34.132 10.399  1.00 50.03  ?  422 ILE A CD1    1 
ATOM 6508  H H      . ILE A 1 418 ? 14.912  -34.030 6.664   1.00 38.96  ?  422 ILE A H      1 
ATOM 6509  H HA     . ILE A 1 418 ? 12.788  -34.954 7.744   1.00 41.84  ?  422 ILE A HA     1 
ATOM 6510  H HB     . ILE A 1 418 ? 14.321  -32.750 8.633   1.00 33.90  ?  422 ILE A HB     1 
ATOM 6511  H HG12   . ILE A 1 418 ? 14.462  -35.409 9.578   1.00 45.36  ?  422 ILE A HG12   1 
ATOM 6512  H HG13   . ILE A 1 418 ? 15.484  -34.821 8.516   1.00 45.36  ?  422 ILE A HG13   1 
ATOM 6513  H HG21   . ILE A 1 418 ? 13.348  -33.039 10.746  1.00 38.48  ?  422 ILE A HG21   1 
ATOM 6514  H HG22   . ILE A 1 418 ? 12.234  -32.669 9.674   1.00 38.48  ?  422 ILE A HG22   1 
ATOM 6515  H HG23   . ILE A 1 418 ? 12.407  -34.174 10.152  1.00 38.48  ?  422 ILE A HG23   1 
ATOM 6516  H HD11   . ILE A 1 418 ? 16.445  -34.834 10.618  1.00 60.03  ?  422 ILE A HD11   1 
ATOM 6517  H HD12   . ILE A 1 418 ? 16.289  -33.338 10.109  1.00 60.03  ?  422 ILE A HD12   1 
ATOM 6518  H HD13   . ILE A 1 418 ? 15.265  -33.926 11.172  1.00 60.03  ?  422 ILE A HD13   1 
ATOM 6519  N N      . GLU A 1 419 ? 12.289  -32.053 6.514   1.00 62.19  ?  423 GLU A N      1 
ATOM 6520  C CA     . GLU A 1 419 ? 11.240  -31.110 6.153   1.00 50.43  ?  423 GLU A CA     1 
ATOM 6521  C C      . GLU A 1 419 ? 10.243  -31.749 5.197   1.00 53.90  ?  423 GLU A C      1 
ATOM 6522  O O      . GLU A 1 419 ? 9.029   -31.692 5.417   1.00 57.25  ?  423 GLU A O      1 
ATOM 6523  C CB     . GLU A 1 419 ? 11.854  -29.857 5.533   1.00 50.23  ?  423 GLU A CB     1 
ATOM 6524  C CG     . GLU A 1 419 ? 10.849  -28.757 5.252   1.00 53.82  ?  423 GLU A CG     1 
ATOM 6525  C CD     . GLU A 1 419 ? 11.499  -27.517 4.684   1.00 52.76  ?  423 GLU A CD     1 
ATOM 6526  O OE1    . GLU A 1 419 ? 12.700  -27.300 4.947   1.00 45.21  ?  423 GLU A OE1    1 
ATOM 6527  O OE2    . GLU A 1 419 ? 10.811  -26.764 3.968   1.00 34.15  -1 423 GLU A OE2    1 
ATOM 6528  H H      . GLU A 1 419 ? 13.078  -31.831 6.252   1.00 74.63  ?  423 GLU A H      1 
ATOM 6529  H HA     . GLU A 1 419 ? 10.761  -30.846 6.954   1.00 60.51  ?  423 GLU A HA     1 
ATOM 6530  H HB2    . GLU A 1 419 ? 12.520  -29.501 6.142   1.00 60.27  ?  423 GLU A HB2    1 
ATOM 6531  H HB3    . GLU A 1 419 ? 12.272  -30.098 4.691   1.00 60.27  ?  423 GLU A HB3    1 
ATOM 6532  H HG2    . GLU A 1 419 ? 10.199  -29.079 4.608   1.00 64.58  ?  423 GLU A HG2    1 
ATOM 6533  H HG3    . GLU A 1 419 ? 10.407  -28.513 6.080   1.00 64.58  ?  423 GLU A HG3    1 
ATOM 6534  N N      . GLN A 1 420 ? 10.741  -32.376 4.131   1.00 56.80  ?  424 GLN A N      1 
ATOM 6535  C CA     . GLN A 1 420 ? 9.845   -32.947 3.131   1.00 63.39  ?  424 GLN A CA     1 
ATOM 6536  C C      . GLN A 1 420 ? 8.934   -33.997 3.750   1.00 60.10  ?  424 GLN A C      1 
ATOM 6537  O O      . GLN A 1 420 ? 7.711   -33.955 3.575   1.00 54.44  ?  424 GLN A O      1 
ATOM 6538  C CB     . GLN A 1 420 ? 10.654  -33.547 1.982   1.00 70.70  ?  424 GLN A CB     1 
ATOM 6539  C CG     . GLN A 1 420 ? 11.610  -32.579 1.303   1.00 69.46  ?  424 GLN A CG     1 
ATOM 6540  C CD     . GLN A 1 420 ? 10.901  -31.478 0.542   1.00 59.22  ?  424 GLN A CD     1 
ATOM 6541  O OE1    . GLN A 1 420 ? 9.756   -31.141 0.831   1.00 67.57  ?  424 GLN A OE1    1 
ATOM 6542  N NE2    . GLN A 1 420 ? 11.581  -30.918 -0.445  1.00 54.57  ?  424 GLN A NE2    1 
ATOM 6543  H H      . GLN A 1 420 ? 11.578  -32.483 3.967   1.00 68.16  ?  424 GLN A H      1 
ATOM 6544  H HA     . GLN A 1 420 ? 9.287   -32.242 2.768   1.00 76.07  ?  424 GLN A HA     1 
ATOM 6545  H HB2    . GLN A 1 420 ? 11.180  -34.286 2.326   1.00 84.85  ?  424 GLN A HB2    1 
ATOM 6546  H HB3    . GLN A 1 420 ? 10.038  -33.873 1.307   1.00 84.85  ?  424 GLN A HB3    1 
ATOM 6547  H HG2    . GLN A 1 420 ? 12.169  -32.163 1.978   1.00 83.35  ?  424 GLN A HG2    1 
ATOM 6548  H HG3    . GLN A 1 420 ? 12.161  -33.070 0.673   1.00 83.35  ?  424 GLN A HG3    1 
ATOM 6549  H HE21   . GLN A 1 420 ? 12.379  -31.184 -0.623  1.00 65.48  ?  424 GLN A HE21   1 
ATOM 6550  H HE22   . GLN A 1 420 ? 11.224  -30.288 -0.909  1.00 65.48  ?  424 GLN A HE22   1 
ATOM 6551  N N      . LEU A 1 421 ? 9.512   -34.951 4.483   1.00 67.39  ?  425 LEU A N      1 
ATOM 6552  C CA     . LEU A 1 421 ? 8.691   -35.974 5.118   1.00 51.82  ?  425 LEU A CA     1 
ATOM 6553  C C      . LEU A 1 421 ? 7.685   -35.357 6.076   1.00 49.39  ?  425 LEU A C      1 
ATOM 6554  O O      . LEU A 1 421 ? 6.563   -35.859 6.206   1.00 46.79  ?  425 LEU A O      1 
ATOM 6555  C CB     . LEU A 1 421 ? 9.569   -36.979 5.864   1.00 42.17  ?  425 LEU A CB     1 
ATOM 6556  C CG     . LEU A 1 421 ? 10.832  -37.477 5.160   1.00 28.99  ?  425 LEU A CG     1 
ATOM 6557  C CD1    . LEU A 1 421 ? 11.431  -38.650 5.916   1.00 37.19  ?  425 LEU A CD1    1 
ATOM 6558  C CD2    . LEU A 1 421 ? 10.557  -37.858 3.718   1.00 61.57  ?  425 LEU A CD2    1 
ATOM 6559  H H      . LEU A 1 421 ? 10.357  -35.025 4.623   1.00 80.87  ?  425 LEU A H      1 
ATOM 6560  H HA     . LEU A 1 421 ? 8.199   -36.455 4.434   1.00 62.18  ?  425 LEU A HA     1 
ATOM 6561  H HB2    . LEU A 1 421 ? 9.851   -36.570 6.697   1.00 50.60  ?  425 LEU A HB2    1 
ATOM 6562  H HB3    . LEU A 1 421 ? 9.028   -37.760 6.062   1.00 50.60  ?  425 LEU A HB3    1 
ATOM 6563  H HG     . LEU A 1 421 ? 11.488  -36.763 5.156   1.00 34.79  ?  425 LEU A HG     1 
ATOM 6564  H HD11   . LEU A 1 421 ? 12.229  -38.949 5.453   1.00 44.63  ?  425 LEU A HD11   1 
ATOM 6565  H HD12   . LEU A 1 421 ? 11.657  -38.364 6.815   1.00 44.63  ?  425 LEU A HD12   1 
ATOM 6566  H HD13   . LEU A 1 421 ? 10.780  -39.368 5.952   1.00 44.63  ?  425 LEU A HD13   1 
ATOM 6567  H HD21   . LEU A 1 421 ? 11.381  -38.167 3.311   1.00 73.88  ?  425 LEU A HD21   1 
ATOM 6568  H HD22   . LEU A 1 421 ? 9.893   -38.565 3.699   1.00 73.88  ?  425 LEU A HD22   1 
ATOM 6569  H HD23   . LEU A 1 421 ? 10.225  -37.079 3.244   1.00 73.88  ?  425 LEU A HD23   1 
ATOM 6570  N N      . SER A 1 422 ? 8.061   -34.267 6.744   1.00 47.21  ?  426 SER A N      1 
ATOM 6571  C CA     . SER A 1 422 ? 7.163   -33.648 7.710   1.00 39.18  ?  426 SER A CA     1 
ATOM 6572  C C      . SER A 1 422 ? 5.986   -32.982 7.014   1.00 49.27  ?  426 SER A C      1 
ATOM 6573  O O      . SER A 1 422 ? 4.849   -33.065 7.492   1.00 43.44  ?  426 SER A O      1 
ATOM 6574  C CB     . SER A 1 422 ? 7.931   -32.637 8.556   1.00 37.79  ?  426 SER A CB     1 
ATOM 6575  O OG     . SER A 1 422 ? 9.083   -33.232 9.125   1.00 36.18  ?  426 SER A OG     1 
ATOM 6576  H H      . SER A 1 422 ? 8.821   -33.873 6.658   1.00 56.65  ?  426 SER A H      1 
ATOM 6577  H HA     . SER A 1 422 ? 6.814   -34.332 8.302   1.00 47.01  ?  426 SER A HA     1 
ATOM 6578  H HB2    . SER A 1 422 ? 8.204   -31.896 7.992   1.00 45.35  ?  426 SER A HB2    1 
ATOM 6579  H HB3    . SER A 1 422 ? 7.355   -32.319 9.268   1.00 45.35  ?  426 SER A HB3    1 
ATOM 6580  H HG     . SER A 1 422 ? 9.591   -33.514 8.518   1.00 43.42  ?  426 SER A HG     1 
ATOM 6581  N N      . ILE A 1 423 ? 6.235   -32.317 5.884   1.00 54.72  ?  427 ILE A N      1 
ATOM 6582  C CA     . ILE A 1 423 ? 5.148   -31.671 5.157   1.00 52.12  ?  427 ILE A CA     1 
ATOM 6583  C C      . ILE A 1 423 ? 4.150   -32.713 4.677   1.00 50.76  ?  427 ILE A C      1 
ATOM 6584  O O      . ILE A 1 423 ? 2.933   -32.496 4.716   1.00 59.49  ?  427 ILE A O      1 
ATOM 6585  C CB     . ILE A 1 423 ? 5.702   -30.833 3.991   1.00 50.77  ?  427 ILE A CB     1 
ATOM 6586  C CG1    . ILE A 1 423 ? 6.636   -29.742 4.520   1.00 56.35  ?  427 ILE A CG1    1 
ATOM 6587  C CG2    . ILE A 1 423 ? 4.557   -30.200 3.206   1.00 46.09  ?  427 ILE A CG2    1 
ATOM 6588  C CD1    . ILE A 1 423 ? 7.400   -29.005 3.445   1.00 52.62  ?  427 ILE A CD1    1 
ATOM 6589  H H      . ILE A 1 423 ? 7.011   -32.228 5.525   1.00 65.66  ?  427 ILE A H      1 
ATOM 6590  H HA     . ILE A 1 423 ? 4.682   -31.070 5.760   1.00 62.54  ?  427 ILE A HA     1 
ATOM 6591  H HB     . ILE A 1 423 ? 6.204   -31.415 3.398   1.00 60.93  ?  427 ILE A HB     1 
ATOM 6592  H HG12   . ILE A 1 423 ? 6.108   -29.090 5.007   1.00 67.61  ?  427 ILE A HG12   1 
ATOM 6593  H HG13   . ILE A 1 423 ? 7.284   -30.150 5.116   1.00 67.61  ?  427 ILE A HG13   1 
ATOM 6594  H HG21   . ILE A 1 423 ? 4.926   -29.677 2.477   1.00 55.31  ?  427 ILE A HG21   1 
ATOM 6595  H HG22   . ILE A 1 423 ? 3.989   -30.904 2.855   1.00 55.31  ?  427 ILE A HG22   1 
ATOM 6596  H HG23   . ILE A 1 423 ? 4.047   -29.627 3.800   1.00 55.31  ?  427 ILE A HG23   1 
ATOM 6597  H HD11   . ILE A 1 423 ? 7.965   -28.335 3.862   1.00 63.15  ?  427 ILE A HD11   1 
ATOM 6598  H HD12   . ILE A 1 423 ? 7.946   -29.639 2.954   1.00 63.15  ?  427 ILE A HD12   1 
ATOM 6599  H HD13   . ILE A 1 423 ? 6.768   -28.578 2.845   1.00 63.15  ?  427 ILE A HD13   1 
ATOM 6600  N N      . ALA A 1 424 ? 4.646   -33.861 4.217   1.00 57.81  ?  428 ALA A N      1 
ATOM 6601  C CA     . ALA A 1 424 ? 3.750   -34.944 3.837   1.00 59.02  ?  428 ALA A CA     1 
ATOM 6602  C C      . ALA A 1 424 ? 3.073   -35.542 5.061   1.00 47.68  ?  428 ALA A C      1 
ATOM 6603  O O      . ALA A 1 424 ? 1.889   -35.894 5.016   1.00 39.73  ?  428 ALA A O      1 
ATOM 6604  C CB     . ALA A 1 424 ? 4.522   -36.015 3.069   1.00 62.16  ?  428 ALA A CB     1 
ATOM 6605  H H      . ALA A 1 424 ? 5.483   -34.033 4.117   1.00 69.37  ?  428 ALA A H      1 
ATOM 6606  H HA     . ALA A 1 424 ? 3.059   -34.594 3.252   1.00 70.83  ?  428 ALA A HA     1 
ATOM 6607  H HB1    . ALA A 1 424 ? 3.912   -36.728 2.824   1.00 74.59  ?  428 ALA A HB1    1 
ATOM 6608  H HB2    . ALA A 1 424 ? 4.905   -35.617 2.272   1.00 74.59  ?  428 ALA A HB2    1 
ATOM 6609  H HB3    . ALA A 1 424 ? 5.228   -36.363 3.637   1.00 74.59  ?  428 ALA A HB3    1 
ATOM 6610  N N      . ALA A 1 425 ? 3.807   -35.651 6.170   1.00 47.28  ?  429 ALA A N      1 
ATOM 6611  C CA     . ALA A 1 425 ? 3.233   -36.218 7.383   1.00 46.53  ?  429 ALA A CA     1 
ATOM 6612  C C      . ALA A 1 425 ? 2.085   -35.370 7.908   1.00 52.70  ?  429 ALA A C      1 
ATOM 6613  O O      . ALA A 1 425 ? 1.151   -35.901 8.518   1.00 57.14  ?  429 ALA A O      1 
ATOM 6614  C CB     . ALA A 1 425 ? 4.315   -36.363 8.450   1.00 50.57  ?  429 ALA A CB     1 
ATOM 6615  H H      . ALA A 1 425 ? 4.628   -35.407 6.242   1.00 56.73  ?  429 ALA A H      1 
ATOM 6616  H HA     . ALA A 1 425 ? 2.887   -37.102 7.185   1.00 55.83  ?  429 ALA A HA     1 
ATOM 6617  H HB1    . ALA A 1 425 ? 3.920   -36.741 9.251   1.00 60.69  ?  429 ALA A HB1    1 
ATOM 6618  H HB2    . ALA A 1 425 ? 5.011   -36.950 8.115   1.00 60.69  ?  429 ALA A HB2    1 
ATOM 6619  H HB3    . ALA A 1 425 ? 4.685   -35.488 8.644   1.00 60.69  ?  429 ALA A HB3    1 
ATOM 6620  N N      . GLU A 1 426 ? 2.136   -34.056 7.685   1.00 58.24  ?  430 GLU A N      1 
ATOM 6621  C CA     . GLU A 1 426 ? 1.057   -33.182 8.130   1.00 63.12  ?  430 GLU A CA     1 
ATOM 6622  C C      . GLU A 1 426 ? -0.295  -33.665 7.628   1.00 53.64  ?  430 GLU A C      1 
ATOM 6623  O O      . GLU A 1 426 ? -1.304  -33.525 8.329   1.00 45.95  ?  430 GLU A O      1 
ATOM 6624  C CB     . GLU A 1 426 ? 1.323   -31.753 7.650   1.00 67.23  ?  430 GLU A CB     1 
ATOM 6625  C CG     . GLU A 1 426 ? 0.189   -30.760 7.901   1.00 63.88  ?  430 GLU A CG     1 
ATOM 6626  C CD     . GLU A 1 426 ? 0.351   -29.485 7.101   1.00 79.47  ?  430 GLU A CD     1 
ATOM 6627  O OE1    . GLU A 1 426 ? -0.148  -28.431 7.548   1.00 103.99 ?  430 GLU A OE1    1 
ATOM 6628  O OE2    . GLU A 1 426 ? 0.980   -29.537 6.025   1.00 70.63  -1 430 GLU A OE2    1 
ATOM 6629  H H      . GLU A 1 426 ? 2.780   -33.651 7.283   1.00 69.89  ?  430 GLU A H      1 
ATOM 6630  H HA     . GLU A 1 426 ? 1.034   -33.175 9.099   1.00 75.74  ?  430 GLU A HA     1 
ATOM 6631  H HB2    . GLU A 1 426 ? 2.111   -31.417 8.104   1.00 80.68  ?  430 GLU A HB2    1 
ATOM 6632  H HB3    . GLU A 1 426 ? 1.485   -31.774 6.693   1.00 80.68  ?  430 GLU A HB3    1 
ATOM 6633  H HG2    . GLU A 1 426 ? -0.653  -31.169 7.647   1.00 76.65  ?  430 GLU A HG2    1 
ATOM 6634  H HG3    . GLU A 1 426 ? 0.176   -30.526 8.842   1.00 76.65  ?  430 GLU A HG3    1 
ATOM 6635  N N      . ARG A 1 427 ? -0.336  -34.235 6.426   1.00 51.21  ?  431 ARG A N      1 
ATOM 6636  C CA     . ARG A 1 427 ? -1.596  -34.622 5.808   1.00 62.90  ?  431 ARG A CA     1 
ATOM 6637  C C      . ARG A 1 427 ? -1.661  -36.122 5.552   1.00 62.41  ?  431 ARG A C      1 
ATOM 6638  O O      . ARG A 1 427 ? -1.816  -36.551 4.405   1.00 63.27  ?  431 ARG A O      1 
ATOM 6639  C CB     . ARG A 1 427 ? -1.790  -33.867 4.494   1.00 65.75  ?  431 ARG A CB     1 
ATOM 6640  C CG     . ARG A 1 427 ? -1.868  -32.359 4.644   1.00 75.94  ?  431 ARG A CG     1 
ATOM 6641  C CD     . ARG A 1 427 ? -1.985  -31.684 3.290   1.00 60.06  ?  431 ARG A CD     1 
ATOM 6642  N NE     . ARG A 1 427 ? -3.166  -32.130 2.559   1.00 57.30  ?  431 ARG A NE     1 
ATOM 6643  C CZ     . ARG A 1 427 ? -3.426  -31.819 1.294   1.00 73.76  ?  431 ARG A CZ     1 
ATOM 6644  N NH1    . ARG A 1 427 ? -2.585  -31.060 0.604   1.00 76.40  1  431 ARG A NH1    1 
ATOM 6645  N NH2    . ARG A 1 427 ? -4.528  -32.271 0.714   1.00 87.97  ?  431 ARG A NH2    1 
ATOM 6646  H H      . ARG A 1 427 ? 0.357   -34.408 5.947   1.00 61.45  ?  431 ARG A H      1 
ATOM 6647  H HA     . ARG A 1 427 ? -2.326  -34.386 6.402   1.00 75.48  ?  431 ARG A HA     1 
ATOM 6648  H HB2    . ARG A 1 427 ? -1.043  -34.067 3.908   1.00 78.90  ?  431 ARG A HB2    1 
ATOM 6649  H HB3    . ARG A 1 427 ? -2.617  -34.165 4.083   1.00 78.90  ?  431 ARG A HB3    1 
ATOM 6650  H HG2    . ARG A 1 427 ? -2.650  -32.128 5.169   1.00 91.13  ?  431 ARG A HG2    1 
ATOM 6651  H HG3    . ARG A 1 427 ? -1.063  -32.036 5.077   1.00 91.13  ?  431 ARG A HG3    1 
ATOM 6652  H HD2    . ARG A 1 427 ? -2.053  -30.725 3.417   1.00 72.07  ?  431 ARG A HD2    1 
ATOM 6653  H HD3    . ARG A 1 427 ? -1.202  -31.897 2.759   1.00 72.07  ?  431 ARG A HD3    1 
ATOM 6654  H HE     . ARG A 1 427 ? -3.732  -32.628 2.974   1.00 68.76  ?  431 ARG A HE     1 
ATOM 6655  H HH11   . ARG A 1 427 ? -1.869  -30.764 0.977   1.00 91.68  ?  431 ARG A HH11   1 
ATOM 6656  H HH12   . ARG A 1 427 ? -2.757  -30.862 -0.215  1.00 91.68  ?  431 ARG A HH12   1 
ATOM 6657  H HH21   . ARG A 1 427 ? -5.076  -32.765 1.157   1.00 105.57 ?  431 ARG A HH21   1 
ATOM 6658  H HH22   . ARG A 1 427 ? -4.696  -32.072 -0.106  1.00 105.57 ?  431 ARG A HH22   1 
ATOM 6659  N N      . TYR A 1 428 ? -1.549  -36.924 6.605   1.00 62.89  ?  432 TYR A N      1 
ATOM 6660  C CA     . TYR A 1 428 ? -1.636  -38.371 6.493   1.00 61.83  ?  432 TYR A CA     1 
ATOM 6661  C C      . TYR A 1 428 ? -2.946  -38.863 7.091   1.00 71.60  ?  432 TYR A C      1 
ATOM 6662  O O      . TYR A 1 428 ? -3.530  -38.220 7.967   1.00 75.93  ?  432 TYR A O      1 
ATOM 6663  C CB     . TYR A 1 428 ? -0.464  -39.056 7.200   1.00 57.64  ?  432 TYR A CB     1 
ATOM 6664  C CG     . TYR A 1 428 ? 0.388   -39.898 6.285   1.00 45.86  ?  432 TYR A CG     1 
ATOM 6665  C CD1    . TYR A 1 428 ? 1.689   -39.528 5.984   1.00 60.70  ?  432 TYR A CD1    1 
ATOM 6666  C CD2    . TYR A 1 428 ? -0.111  -41.059 5.716   1.00 55.32  ?  432 TYR A CD2    1 
ATOM 6667  C CE1    . TYR A 1 428 ? 2.470   -40.290 5.149   1.00 42.55  ?  432 TYR A CE1    1 
ATOM 6668  C CE2    . TYR A 1 428 ? 0.665   -41.828 4.876   1.00 77.13  ?  432 TYR A CE2    1 
ATOM 6669  C CZ     . TYR A 1 428 ? 1.956   -41.437 4.598   1.00 62.07  ?  432 TYR A CZ     1 
ATOM 6670  O OH     . TYR A 1 428 ? 2.739   -42.195 3.763   1.00 77.09  ?  432 TYR A OH     1 
ATOM 6671  H H      . TYR A 1 428 ? -1.421  -36.648 7.409   1.00 75.47  ?  432 TYR A H      1 
ATOM 6672  H HA     . TYR A 1 428 ? -1.616  -38.622 5.556   1.00 74.20  ?  432 TYR A HA     1 
ATOM 6673  H HB2    . TYR A 1 428 ? 0.105   -38.376 7.592   1.00 69.16  ?  432 TYR A HB2    1 
ATOM 6674  H HB3    . TYR A 1 428 ? -0.813  -39.634 7.896   1.00 69.16  ?  432 TYR A HB3    1 
ATOM 6675  H HD1    . TYR A 1 428 ? 2.040   -38.751 6.356   1.00 72.83  ?  432 TYR A HD1    1 
ATOM 6676  H HD2    . TYR A 1 428 ? -0.982  -41.323 5.904   1.00 66.38  ?  432 TYR A HD2    1 
ATOM 6677  H HE1    . TYR A 1 428 ? 3.342   -40.029 4.958   1.00 51.06  ?  432 TYR A HE1    1 
ATOM 6678  H HE2    . TYR A 1 428 ? 0.320   -42.606 4.502   1.00 92.55  ?  432 TYR A HE2    1 
ATOM 6679  H HH     . TYR A 1 428 ? 2.309   -42.865 3.495   1.00 92.50  ?  432 TYR A HH     1 
ATOM 6680  N N      . ASP A 1 429 ? -3.404  -40.013 6.605   1.00 78.88  ?  433 ASP A N      1 
ATOM 6681  C CA     . ASP A 1 429 ? -4.593  -40.645 7.163   1.00 88.89  ?  433 ASP A CA     1 
ATOM 6682  C C      . ASP A 1 429 ? -4.269  -41.200 8.544   1.00 86.42  ?  433 ASP A C      1 
ATOM 6683  O O      . ASP A 1 429 ? -3.400  -42.067 8.684   1.00 80.78  ?  433 ASP A O      1 
ATOM 6684  C CB     . ASP A 1 429 ? -5.087  -41.755 6.239   1.00 104.27 ?  433 ASP A CB     1 
ATOM 6685  C CG     . ASP A 1 429 ? -3.997  -42.746 5.881   1.00 115.00 ?  433 ASP A CG     1 
ATOM 6686  O OD1    . ASP A 1 429 ? -3.731  -43.659 6.690   1.00 109.44 ?  433 ASP A OD1    1 
ATOM 6687  O OD2    . ASP A 1 429 ? -3.405  -42.610 4.790   1.00 104.20 -1 433 ASP A OD2    1 
ATOM 6688  H H      . ASP A 1 429 ? -3.045  -40.446 5.955   1.00 94.65  ?  433 ASP A H      1 
ATOM 6689  H HA     . ASP A 1 429 ? -5.297  -39.985 7.254   1.00 106.67 ?  433 ASP A HA     1 
ATOM 6690  H HB2    . ASP A 1 429 ? -5.801  -42.240 6.681   1.00 125.12 ?  433 ASP A HB2    1 
ATOM 6691  H HB3    . ASP A 1 429 ? -5.415  -41.359 5.416   1.00 125.12 ?  433 ASP A HB3    1 
ATOM 6692  N N      . TYR A 1 430 ? -4.959  -40.697 9.564   1.00 84.46  ?  434 TYR A N      1 
ATOM 6693  C CA     . TYR A 1 430 ? -4.705  -41.075 10.947  1.00 85.26  ?  434 TYR A CA     1 
ATOM 6694  C C      . TYR A 1 430 ? -5.943  -41.686 11.591  1.00 89.19  ?  434 TYR A C      1 
ATOM 6695  O O      . TYR A 1 430 ? -6.266  -41.415 12.749  1.00 76.33  ?  434 TYR A O      1 
ATOM 6696  C CB     . TYR A 1 430 ? -4.210  -39.878 11.753  1.00 78.47  ?  434 TYR A CB     1 
ATOM 6697  C CG     . TYR A 1 430 ? -2.811  -39.431 11.390  1.00 70.86  ?  434 TYR A CG     1 
ATOM 6698  C CD1    . TYR A 1 430 ? -1.840  -40.352 11.021  1.00 74.64  ?  434 TYR A CD1    1 
ATOM 6699  C CD2    . TYR A 1 430 ? -2.462  -38.090 11.417  1.00 67.10  ?  434 TYR A CD2    1 
ATOM 6700  C CE1    . TYR A 1 430 ? -0.566  -39.950 10.691  1.00 67.95  ?  434 TYR A CE1    1 
ATOM 6701  C CE2    . TYR A 1 430 ? -1.189  -37.679 11.085  1.00 52.74  ?  434 TYR A CE2    1 
ATOM 6702  C CZ     . TYR A 1 430 ? -0.246  -38.614 10.726  1.00 47.30  ?  434 TYR A CZ     1 
ATOM 6703  O OH     . TYR A 1 430 ? 1.022   -38.208 10.398  1.00 46.26  ?  434 TYR A OH     1 
ATOM 6704  H H      . TYR A 1 430 ? -5.593  -40.122 9.476   1.00 101.35 ?  434 TYR A H      1 
ATOM 6705  H HA     . TYR A 1 430 ? -4.006  -41.748 10.961  1.00 102.31 ?  434 TYR A HA     1 
ATOM 6706  H HB2    . TYR A 1 430 ? -4.808  -39.130 11.601  1.00 94.17  ?  434 TYR A HB2    1 
ATOM 6707  H HB3    . TYR A 1 430 ? -4.211  -40.113 12.694  1.00 94.17  ?  434 TYR A HB3    1 
ATOM 6708  H HD1    . TYR A 1 430 ? -2.054  -41.257 10.997  1.00 89.56  ?  434 TYR A HD1    1 
ATOM 6709  H HD2    . TYR A 1 430 ? -3.098  -37.456 11.661  1.00 80.51  ?  434 TYR A HD2    1 
ATOM 6710  H HE1    . TYR A 1 430 ? 0.074   -40.579 10.446  1.00 81.54  ?  434 TYR A HE1    1 
ATOM 6711  H HE2    . TYR A 1 430 ? -0.967  -36.776 11.109  1.00 63.28  ?  434 TYR A HE2    1 
ATOM 6712  H HH     . TYR A 1 430 ? 1.082   -37.372 10.460  1.00 55.51  ?  434 TYR A HH     1 
ATOM 6713  N N      . SER A 1 431 ? -6.656  -42.523 10.838  1.00 99.42  ?  435 SER A N      1 
ATOM 6714  C CA     . SER A 1 431 ? -7.616  -43.421 11.464  1.00 98.68  ?  435 SER A CA     1 
ATOM 6715  C C      . SER A 1 431 ? -6.896  -44.411 12.368  1.00 97.60  ?  435 SER A C      1 
ATOM 6716  O O      . SER A 1 431 ? -7.385  -44.751 13.451  1.00 80.38  ?  435 SER A O      1 
ATOM 6717  C CB     . SER A 1 431 ? -8.423  -44.154 10.394  1.00 92.13  ?  435 SER A CB     1 
ATOM 6718  O OG     . SER A 1 431 ? -7.569  -44.857 9.509   1.00 79.77  ?  435 SER A OG     1 
ATOM 6719  H H      . SER A 1 431 ? -6.603  -42.588 9.982   1.00 119.31 ?  435 SER A H      1 
ATOM 6720  H HA     . SER A 1 431 ? -8.231  -42.905 12.008  1.00 118.42 ?  435 SER A HA     1 
ATOM 6721  H HB2    . SER A 1 431 ? -9.019  -44.786 10.826  1.00 110.56 ?  435 SER A HB2    1 
ATOM 6722  H HB3    . SER A 1 431 ? -8.938  -43.506 9.888   1.00 110.56 ?  435 SER A HB3    1 
ATOM 6723  H HG     . SER A 1 431 ? -8.024  -45.255 8.926   1.00 95.73  ?  435 SER A HG     1 
ATOM 6724  N N      . ASP A 1 432 ? -5.727  -44.878 11.936  1.00 91.18  ?  436 ASP A N      1 
ATOM 6725  C CA     . ASP A 1 432 ? -4.871  -45.685 12.791  1.00 84.19  ?  436 ASP A CA     1 
ATOM 6726  C C      . ASP A 1 432 ? -4.446  -44.878 14.009  1.00 83.12  ?  436 ASP A C      1 
ATOM 6727  O O      . ASP A 1 432 ? -3.954  -43.753 13.883  1.00 100.54 ?  436 ASP A O      1 
ATOM 6728  C CB     . ASP A 1 432 ? -3.643  -46.149 12.007  1.00 81.32  ?  436 ASP A CB     1 
ATOM 6729  C CG     . ASP A 1 432 ? -2.712  -47.016 12.832  1.00 93.22  ?  436 ASP A CG     1 
ATOM 6730  O OD1    . ASP A 1 432 ? -2.112  -47.951 12.261  1.00 78.05  ?  436 ASP A OD1    1 
ATOM 6731  O OD2    . ASP A 1 432 ? -2.575  -46.763 14.047  1.00 93.88  -1 436 ASP A OD2    1 
ATOM 6732  H H      . ASP A 1 432 ? -5.408  -44.740 11.149  1.00 109.41 ?  436 ASP A H      1 
ATOM 6733  H HA     . ASP A 1 432 ? -5.358  -46.468 13.094  1.00 101.03 ?  436 ASP A HA     1 
ATOM 6734  H HB2    . ASP A 1 432 ? -3.935  -46.667 11.241  1.00 97.59  ?  436 ASP A HB2    1 
ATOM 6735  H HB3    . ASP A 1 432 ? -3.145  -45.371 11.711  1.00 97.59  ?  436 ASP A HB3    1 
ATOM 6736  N N      . GLU A 1 433 ? -4.634  -45.456 15.194  1.00 74.24  ?  437 GLU A N      1 
ATOM 6737  C CA     . GLU A 1 433 ? -4.272  -44.774 16.429  1.00 79.19  ?  437 GLU A CA     1 
ATOM 6738  C C      . GLU A 1 433 ? -2.819  -45.018 16.812  1.00 71.97  ?  437 GLU A C      1 
ATOM 6739  O O      . GLU A 1 433 ? -2.165  -44.122 17.354  1.00 81.32  ?  437 GLU A O      1 
ATOM 6740  C CB     . GLU A 1 433 ? -5.193  -45.222 17.567  1.00 101.15 ?  437 GLU A CB     1 
ATOM 6741  C CG     . GLU A 1 433 ? -5.040  -44.415 18.847  1.00 105.16 ?  437 GLU A CG     1 
ATOM 6742  C CD     . GLU A 1 433 ? -5.557  -42.997 18.710  1.00 104.49 ?  437 GLU A CD     1 
ATOM 6743  O OE1    . GLU A 1 433 ? -6.056  -42.646 17.621  1.00 105.32 ?  437 GLU A OE1    1 
ATOM 6744  O OE2    . GLU A 1 433 ? -5.468  -42.234 19.694  1.00 105.11 -1 437 GLU A OE2    1 
ATOM 6745  H H      . GLU A 1 433 ? -4.968  -46.240 15.307  1.00 89.09  ?  437 GLU A H      1 
ATOM 6746  H HA     . GLU A 1 433 ? -4.392  -43.819 16.308  1.00 95.03  ?  437 GLU A HA     1 
ATOM 6747  H HB2    . GLU A 1 433 ? -6.114  -45.139 17.273  1.00 121.38 ?  437 GLU A HB2    1 
ATOM 6748  H HB3    . GLU A 1 433 ? -4.999  -46.149 17.777  1.00 121.38 ?  437 GLU A HB3    1 
ATOM 6749  H HG2    . GLU A 1 433 ? -5.540  -44.850 19.556  1.00 126.19 ?  437 GLU A HG2    1 
ATOM 6750  H HG3    . GLU A 1 433 ? -4.100  -44.370 19.083  1.00 126.19 ?  437 GLU A HG3    1 
ATOM 6751  N N      . VAL A 1 434 ? -2.299  -46.216 16.544  1.00 69.00  ?  438 VAL A N      1 
ATOM 6752  C CA     . VAL A 1 434 ? -0.892  -46.488 16.823  1.00 76.53  ?  438 VAL A CA     1 
ATOM 6753  C C      . VAL A 1 434 ? -0.007  -45.561 16.003  1.00 78.17  ?  438 VAL A C      1 
ATOM 6754  O O      . VAL A 1 434 ? 1.005   -45.047 16.495  1.00 76.18  ?  438 VAL A O      1 
ATOM 6755  C CB     . VAL A 1 434 ? -0.571  -47.970 16.549  1.00 91.28  ?  438 VAL A CB     1 
ATOM 6756  C CG1    . VAL A 1 434 ? 0.922   -48.243 16.715  1.00 93.25  ?  438 VAL A CG1    1 
ATOM 6757  C CG2    . VAL A 1 434 ? -1.378  -48.864 17.479  1.00 100.92 ?  438 VAL A CG2    1 
ATOM 6758  H H      . VAL A 1 434 ? -2.733  -46.878 16.207  1.00 82.80  ?  438 VAL A H      1 
ATOM 6759  H HA     . VAL A 1 434 ? -0.718  -46.314 17.761  1.00 91.83  ?  438 VAL A HA     1 
ATOM 6760  H HB     . VAL A 1 434 ? -0.817  -48.184 15.636  1.00 109.53 ?  438 VAL A HB     1 
ATOM 6761  H HG11   . VAL A 1 434 ? 1.092   -49.182 16.537  1.00 111.91 ?  438 VAL A HG11   1 
ATOM 6762  H HG12   . VAL A 1 434 ? 1.415   -47.692 16.087  1.00 111.91 ?  438 VAL A HG12   1 
ATOM 6763  H HG13   . VAL A 1 434 ? 1.183   -48.026 17.623  1.00 111.91 ?  438 VAL A HG13   1 
ATOM 6764  H HG21   . VAL A 1 434 ? -1.161  -49.791 17.291  1.00 121.11 ?  438 VAL A HG21   1 
ATOM 6765  H HG22   . VAL A 1 434 ? -1.151  -48.650 18.397  1.00 121.11 ?  438 VAL A HG22   1 
ATOM 6766  H HG23   . VAL A 1 434 ? -2.323  -48.707 17.325  1.00 121.11 ?  438 VAL A HG23   1 
ATOM 6767  N N      . GLY A 1 435 ? -0.373  -45.329 14.742  1.00 79.40  ?  439 GLY A N      1 
ATOM 6768  C CA     . GLY A 1 435 ? 0.415   -44.435 13.910  1.00 79.52  ?  439 GLY A CA     1 
ATOM 6769  C C      . GLY A 1 435 ? 0.402   -43.011 14.426  1.00 81.19  ?  439 GLY A C      1 
ATOM 6770  O O      . GLY A 1 435 ? 1.442   -42.353 14.504  1.00 78.78  ?  439 GLY A O      1 
ATOM 6771  H H      . GLY A 1 435 ? -1.061  -45.671 14.355  1.00 95.28  ?  439 GLY A H      1 
ATOM 6772  H HA2    . GLY A 1 435 ? 1.334   -44.745 13.883  1.00 95.43  ?  439 GLY A HA2    1 
ATOM 6773  H HA3    . GLY A 1 435 ? 0.062   -44.439 13.006  1.00 95.43  ?  439 GLY A HA3    1 
ATOM 6774  N N      . ARG A 1 436 ? -0.781  -42.516 14.794  1.00 77.91  ?  440 ARG A N      1 
ATOM 6775  C CA     . ARG A 1 436 ? -0.885  -41.154 15.301  1.00 64.73  ?  440 ARG A CA     1 
ATOM 6776  C C      . ARG A 1 436 ? -0.048  -40.980 16.561  1.00 64.04  ?  440 ARG A C      1 
ATOM 6777  O O      . ARG A 1 436 ? 0.761   -40.050 16.660  1.00 80.19  ?  440 ARG A O      1 
ATOM 6778  C CB     . ARG A 1 436 ? -2.349  -40.809 15.573  1.00 66.72  ?  440 ARG A CB     1 
ATOM 6779  C CG     . ARG A 1 436 ? -2.570  -39.376 16.020  1.00 80.76  ?  440 ARG A CG     1 
ATOM 6780  C CD     . ARG A 1 436 ? -4.027  -39.110 16.350  1.00 85.42  ?  440 ARG A CD     1 
ATOM 6781  N NE     . ARG A 1 436 ? -4.482  -39.905 17.485  1.00 83.73  ?  440 ARG A NE     1 
ATOM 6782  C CZ     . ARG A 1 436 ? -4.178  -39.643 18.753  1.00 89.10  ?  440 ARG A CZ     1 
ATOM 6783  N NH1    . ARG A 1 436 ? -4.640  -40.424 19.719  1.00 110.98 1  440 ARG A NH1    1 
ATOM 6784  N NH2    . ARG A 1 436 ? -3.406  -38.608 19.058  1.00 68.44  ?  440 ARG A NH2    1 
ATOM 6785  H H      . ARG A 1 436 ? -1.526  -42.944 14.760  1.00 93.49  ?  440 ARG A H      1 
ATOM 6786  H HA     . ARG A 1 436 ? -0.550  -40.539 14.630  1.00 77.68  ?  440 ARG A HA     1 
ATOM 6787  H HB2    . ARG A 1 436 ? -2.859  -40.948 14.760  1.00 80.06  ?  440 ARG A HB2    1 
ATOM 6788  H HB3    . ARG A 1 436 ? -2.682  -41.392 16.273  1.00 80.06  ?  440 ARG A HB3    1 
ATOM 6789  H HG2    . ARG A 1 436 ? -2.042  -39.204 16.815  1.00 96.92  ?  440 ARG A HG2    1 
ATOM 6790  H HG3    . ARG A 1 436 ? -2.306  -38.774 15.306  1.00 96.92  ?  440 ARG A HG3    1 
ATOM 6791  H HD2    . ARG A 1 436 ? -4.137  -38.172 16.574  1.00 102.50 ?  440 ARG A HD2    1 
ATOM 6792  H HD3    . ARG A 1 436 ? -4.574  -39.337 15.582  1.00 102.50 ?  440 ARG A HD3    1 
ATOM 6793  H HE     . ARG A 1 436 ? -4.979  -40.588 17.324  1.00 100.48 ?  440 ARG A HE     1 
ATOM 6794  H HH21   . ARG A 1 436 ? -3.104  -38.098 18.434  1.00 82.12  ?  440 ARG A HH21   1 
ATOM 6795  H HH22   . ARG A 1 436 ? -3.212  -38.444 19.879  1.00 82.12  ?  440 ARG A HH22   1 
ATOM 6796  N N      . ARG A 1 437 ? -0.223  -41.874 17.535  1.00 70.97  ?  441 ARG A N      1 
ATOM 6797  C CA     . ARG A 1 437 ? 0.515   -41.753 18.787  1.00 69.11  ?  441 ARG A CA     1 
ATOM 6798  C C      . ARG A 1 437 ? 2.010   -41.948 18.578  1.00 64.79  ?  441 ARG A C      1 
ATOM 6799  O O      . ARG A 1 437 ? 2.816   -41.362 19.308  1.00 68.60  ?  441 ARG A O      1 
ATOM 6800  C CB     . ARG A 1 437 ? -0.010  -42.762 19.807  1.00 69.86  ?  441 ARG A CB     1 
ATOM 6801  C CG     . ARG A 1 437 ? -1.494  -42.624 20.104  1.00 82.63  ?  441 ARG A CG     1 
ATOM 6802  C CD     . ARG A 1 437 ? -1.998  -43.784 20.945  1.00 95.64  ?  441 ARG A CD     1 
ATOM 6803  N NE     . ARG A 1 437 ? -1.552  -43.698 22.334  1.00 103.36 ?  441 ARG A NE     1 
ATOM 6804  C CZ     . ARG A 1 437 ? -2.241  -43.124 23.317  1.00 91.42  ?  441 ARG A CZ     1 
ATOM 6805  N NH1    . ARG A 1 437 ? -1.745  -43.102 24.545  1.00 67.76  1  441 ARG A NH1    1 
ATOM 6806  N NH2    . ARG A 1 437 ? -3.425  -42.571 23.082  1.00 88.53  ?  441 ARG A NH2    1 
ATOM 6807  H H      . ARG A 1 437 ? -0.755  -42.548 17.496  1.00 85.16  ?  441 ARG A H      1 
ATOM 6808  H HA     . ARG A 1 437 ? 0.378   -40.864 19.149  1.00 82.93  ?  441 ARG A HA     1 
ATOM 6809  H HB2    . ARG A 1 437 ? 0.141   -43.658 19.466  1.00 83.84  ?  441 ARG A HB2    1 
ATOM 6810  H HB3    . ARG A 1 437 ? 0.471   -42.643 20.640  1.00 83.84  ?  441 ARG A HB3    1 
ATOM 6811  H HG2    . ARG A 1 437 ? -1.648  -41.802 20.596  1.00 99.16  ?  441 ARG A HG2    1 
ATOM 6812  H HG3    . ARG A 1 437 ? -1.989  -42.615 19.270  1.00 99.16  ?  441 ARG A HG3    1 
ATOM 6813  H HD2    . ARG A 1 437 ? -2.968  -43.783 20.939  1.00 114.76 ?  441 ARG A HD2    1 
ATOM 6814  H HD3    . ARG A 1 437 ? -1.663  -44.615 20.572  1.00 114.76 ?  441 ARG A HD3    1 
ATOM 6815  H HE     . ARG A 1 437 ? -0.790  -44.044 22.531  1.00 124.04 ?  441 ARG A HE     1 
ATOM 6816  H HH11   . ARG A 1 437 ? -0.979  -43.458 24.706  1.00 81.31  ?  441 ARG A HH11   1 
ATOM 6817  H HH12   . ARG A 1 437 ? -2.188  -42.731 25.182  1.00 81.31  ?  441 ARG A HH12   1 
ATOM 6818  H HH21   . ARG A 1 437 ? -3.754  -42.581 22.287  1.00 106.24 ?  441 ARG A HH21   1 
ATOM 6819  H HH22   . ARG A 1 437 ? -3.862  -42.202 23.724  1.00 106.24 ?  441 ARG A HH22   1 
ATOM 6820  N N      . SER A 1 438 ? 2.400   -42.763 17.598  1.00 64.84  ?  442 SER A N      1 
ATOM 6821  C CA     . SER A 1 438 ? 3.817   -42.937 17.305  1.00 67.00  ?  442 SER A CA     1 
ATOM 6822  C C      . SER A 1 438 ? 4.426   -41.633 16.810  1.00 77.92  ?  442 SER A C      1 
ATOM 6823  O O      . SER A 1 438 ? 5.348   -41.088 17.426  1.00 89.64  ?  442 SER A O      1 
ATOM 6824  C CB     . SER A 1 438 ? 4.005   -44.049 16.273  1.00 85.77  ?  442 SER A CB     1 
ATOM 6825  O OG     . SER A 1 438 ? 5.376   -44.221 15.953  1.00 83.10  ?  442 SER A OG     1 
ATOM 6826  H H      . SER A 1 438 ? 1.871   -43.218 17.096  1.00 77.81  ?  442 SER A H      1 
ATOM 6827  H HA     . SER A 1 438 ? 4.280   -43.198 18.117  1.00 80.40  ?  442 SER A HA     1 
ATOM 6828  H HB2    . SER A 1 438 ? 3.660   -44.879 16.637  1.00 102.92 ?  442 SER A HB2    1 
ATOM 6829  H HB3    . SER A 1 438 ? 3.520   -43.815 15.466  1.00 102.92 ?  442 SER A HB3    1 
ATOM 6830  H HG     . SER A 1 438 ? 5.688   -43.509 15.636  1.00 99.72  ?  442 SER A HG     1 
ATOM 6831  N N      . MET A 1 439 ? 3.906   -41.109 15.698  1.00 73.42  ?  443 MET A N      1 
ATOM 6832  C CA     . MET A 1 439 ? 4.409   -39.852 15.154  1.00 74.36  ?  443 MET A CA     1 
ATOM 6833  C C      . MET A 1 439 ? 4.418   -38.766 16.220  1.00 71.32  ?  443 MET A C      1 
ATOM 6834  O O      . MET A 1 439 ? 5.416   -38.059 16.400  1.00 65.79  ?  443 MET A O      1 
ATOM 6835  C CB     . MET A 1 439 ? 3.550   -39.425 13.963  1.00 66.73  ?  443 MET A CB     1 
ATOM 6836  C CG     . MET A 1 439 ? 4.111   -38.255 13.183  1.00 57.64  ?  443 MET A CG     1 
ATOM 6837  S SD     . MET A 1 439 ? 5.151   -38.784 11.812  1.00 59.07  ?  443 MET A SD     1 
ATOM 6838  C CE     . MET A 1 439 ? 3.906   -39.288 10.631  1.00 55.56  ?  443 MET A CE     1 
ATOM 6839  H H      . MET A 1 439 ? 3.266   -41.462 15.244  1.00 88.10  ?  443 MET A H      1 
ATOM 6840  H HA     . MET A 1 439 ? 5.315   -39.988 14.835  1.00 89.24  ?  443 MET A HA     1 
ATOM 6841  H HB2    . MET A 1 439 ? 3.467   -40.175 13.354  1.00 80.08  ?  443 MET A HB2    1 
ATOM 6842  H HB3    . MET A 1 439 ? 2.672   -39.169 14.289  1.00 80.08  ?  443 MET A HB3    1 
ATOM 6843  H HG2    . MET A 1 439 ? 3.378   -37.734 12.821  1.00 69.16  ?  443 MET A HG2    1 
ATOM 6844  H HG3    . MET A 1 439 ? 4.650   -37.707 13.775  1.00 69.16  ?  443 MET A HG3    1 
ATOM 6845  H HE1    . MET A 1 439 ? 4.344   -39.603 9.826   1.00 66.67  ?  443 MET A HE1    1 
ATOM 6846  H HE2    . MET A 1 439 ? 3.374   -40.000 11.019  1.00 66.67  ?  443 MET A HE2    1 
ATOM 6847  H HE3    . MET A 1 439 ? 3.340   -38.527 10.425  1.00 66.67  ?  443 MET A HE3    1 
ATOM 6848  N N      . LEU A 1 440 ? 3.305   -38.629 16.943  1.00 72.68  ?  444 LEU A N      1 
ATOM 6849  C CA     . LEU A 1 440 ? 3.198   -37.623 17.993  1.00 46.61  ?  444 LEU A CA     1 
ATOM 6850  C C      . LEU A 1 440 ? 4.423   -37.629 18.898  1.00 50.46  ?  444 LEU A C      1 
ATOM 6851  O O      . LEU A 1 440 ? 4.945   -36.569 19.257  1.00 60.52  ?  444 LEU A O      1 
ATOM 6852  C CB     . LEU A 1 440 ? 1.931   -37.876 18.807  1.00 53.46  ?  444 LEU A CB     1 
ATOM 6853  C CG     . LEU A 1 440 ? 1.593   -36.896 19.925  1.00 49.39  ?  444 LEU A CG     1 
ATOM 6854  C CD1    . LEU A 1 440 ? 0.999   -35.625 19.346  1.00 61.09  ?  444 LEU A CD1    1 
ATOM 6855  C CD2    . LEU A 1 440 ? 0.640   -37.574 20.893  1.00 70.30  ?  444 LEU A CD2    1 
ATOM 6856  H H      . LEU A 1 440 ? 2.597   -39.108 16.842  1.00 87.22  ?  444 LEU A H      1 
ATOM 6857  H HA     . LEU A 1 440 ? 3.127   -36.745 17.587  1.00 55.94  ?  444 LEU A HA     1 
ATOM 6858  H HB2    . LEU A 1 440 ? 1.179   -37.876 18.194  1.00 64.15  ?  444 LEU A HB2    1 
ATOM 6859  H HB3    . LEU A 1 440 ? 2.008   -38.753 19.214  1.00 64.15  ?  444 LEU A HB3    1 
ATOM 6860  H HG     . LEU A 1 440 ? 2.403   -36.664 20.405  1.00 59.27  ?  444 LEU A HG     1 
ATOM 6861  H HD11   . LEU A 1 440 ? 0.790   -35.016 20.071  1.00 73.31  ?  444 LEU A HD11   1 
ATOM 6862  H HD12   . LEU A 1 440 ? 1.645   -35.219 18.747  1.00 73.31  ?  444 LEU A HD12   1 
ATOM 6863  H HD13   . LEU A 1 440 ? 0.191   -35.848 18.858  1.00 73.31  ?  444 LEU A HD13   1 
ATOM 6864  H HD21   . LEU A 1 440 ? 0.422   -36.954 21.606  1.00 84.37  ?  444 LEU A HD21   1 
ATOM 6865  H HD22   . LEU A 1 440 ? -0.165  -37.828 20.416  1.00 84.37  ?  444 LEU A HD22   1 
ATOM 6866  H HD23   . LEU A 1 440 ? 1.071   -38.362 21.259  1.00 84.37  ?  444 LEU A HD23   1 
ATOM 6867  N N      . THR A 1 441 ? 4.894   -38.815 19.278  1.00 62.28  ?  445 THR A N      1 
ATOM 6868  C CA     . THR A 1 441 ? 6.089   -38.915 20.105  1.00 67.82  ?  445 THR A CA     1 
ATOM 6869  C C      . THR A 1 441 ? 7.353   -38.536 19.348  1.00 63.60  ?  445 THR A C      1 
ATOM 6870  O O      . THR A 1 441 ? 8.390   -38.315 19.981  1.00 61.91  ?  445 THR A O      1 
ATOM 6871  C CB     . THR A 1 441 ? 6.221   -40.337 20.655  1.00 70.05  ?  445 THR A CB     1 
ATOM 6872  O OG1    . THR A 1 441 ? 4.956   -40.770 21.171  1.00 69.98  ?  445 THR A OG1    1 
ATOM 6873  C CG2    . THR A 1 441 ? 7.250   -40.391 21.771  1.00 61.61  ?  445 THR A CG2    1 
ATOM 6874  H H      . THR A 1 441 ? 4.541   -39.571 19.071  1.00 74.74  ?  445 THR A H      1 
ATOM 6875  H HA     . THR A 1 441 ? 6.000   -38.311 20.859  1.00 81.39  ?  445 THR A HA     1 
ATOM 6876  H HB     . THR A 1 441 ? 6.503   -40.934 19.945  1.00 84.06  ?  445 THR A HB     1 
ATOM 6877  H HG1    . THR A 1 441 ? 4.379   -40.763 20.561  1.00 83.98  ?  445 THR A HG1    1 
ATOM 6878  H HG21   . THR A 1 441 ? 7.324   -41.297 22.110  1.00 73.93  ?  445 THR A HG21   1 
ATOM 6879  H HG22   . THR A 1 441 ? 8.116   -40.108 21.437  1.00 73.93  ?  445 THR A HG22   1 
ATOM 6880  H HG23   . THR A 1 441 ? 6.985   -39.804 22.496  1.00 73.93  ?  445 THR A HG23   1 
ATOM 6881  N N      . VAL A 1 442 ? 7.292   -38.446 18.021  1.00 57.18  ?  446 VAL A N      1 
ATOM 6882  C CA     . VAL A 1 442 ? 8.459   -38.045 17.245  1.00 62.51  ?  446 VAL A CA     1 
ATOM 6883  C C      . VAL A 1 442 ? 8.555   -36.529 17.180  1.00 61.05  ?  446 VAL A C      1 
ATOM 6884  O O      . VAL A 1 442 ? 9.629   -35.950 17.381  1.00 61.44  ?  446 VAL A O      1 
ATOM 6885  C CB     . VAL A 1 442 ? 8.405   -38.661 15.835  1.00 73.73  ?  446 VAL A CB     1 
ATOM 6886  C CG1    . VAL A 1 442 ? 9.769   -38.591 15.186  1.00 74.37  ?  446 VAL A CG1    1 
ATOM 6887  C CG2    . VAL A 1 442 ? 7.920   -40.096 15.883  1.00 72.52  ?  446 VAL A CG2    1 
ATOM 6888  H H      . VAL A 1 442 ? 6.591   -38.612 17.550  1.00 68.62  ?  446 VAL A H      1 
ATOM 6889  H HA     . VAL A 1 442 ? 9.257   -38.377 17.684  1.00 75.02  ?  446 VAL A HA     1 
ATOM 6890  H HB     . VAL A 1 442 ? 7.785   -38.151 15.289  1.00 88.48  ?  446 VAL A HB     1 
ATOM 6891  H HG11   . VAL A 1 442 ? 9.717   -38.982 14.300  1.00 89.25  ?  446 VAL A HG11   1 
ATOM 6892  H HG12   . VAL A 1 442 ? 10.041  -37.662 15.123  1.00 89.25  ?  446 VAL A HG12   1 
ATOM 6893  H HG13   . VAL A 1 442 ? 10.402  -39.086 15.730  1.00 89.25  ?  446 VAL A HG13   1 
ATOM 6894  H HG21   . VAL A 1 442 ? 7.898   -40.452 14.981  1.00 87.02  ?  446 VAL A HG21   1 
ATOM 6895  H HG22   . VAL A 1 442 ? 8.530   -40.616 16.429  1.00 87.02  ?  446 VAL A HG22   1 
ATOM 6896  H HG23   . VAL A 1 442 ? 7.031   -40.115 16.268  1.00 87.02  ?  446 VAL A HG23   1 
ATOM 6897  N N      . VAL A 1 443 ? 7.435   -35.861 16.900  1.00 69.80  ?  447 VAL A N      1 
ATOM 6898  C CA     . VAL A 1 443 ? 7.443   -34.405 16.833  1.00 62.67  ?  447 VAL A CA     1 
ATOM 6899  C C      . VAL A 1 443 ? 7.668   -33.811 18.217  1.00 52.84  ?  447 VAL A C      1 
ATOM 6900  O O      . VAL A 1 443 ? 8.409   -32.834 18.373  1.00 60.68  ?  447 VAL A O      1 
ATOM 6901  C CB     . VAL A 1 443 ? 6.139   -33.887 16.195  1.00 53.41  ?  447 VAL A CB     1 
ATOM 6902  C CG1    . VAL A 1 443 ? 5.966   -34.461 14.796  1.00 66.54  ?  447 VAL A CG1    1 
ATOM 6903  C CG2    . VAL A 1 443 ? 4.933   -34.218 17.061  1.00 55.85  ?  447 VAL A CG2    1 
ATOM 6904  H H      . VAL A 1 443 ? 6.670   -36.224 16.748  1.00 83.76  ?  447 VAL A H      1 
ATOM 6905  H HA     . VAL A 1 443 ? 8.180   -34.124 16.268  1.00 75.20  ?  447 VAL A HA     1 
ATOM 6906  H HB     . VAL A 1 443 ? 6.192   -32.921 16.115  1.00 64.09  ?  447 VAL A HB     1 
ATOM 6907  H HG11   . VAL A 1 443 ? 5.141   -34.122 14.416  1.00 79.85  ?  447 VAL A HG11   1 
ATOM 6908  H HG12   . VAL A 1 443 ? 6.719   -34.190 14.248  1.00 79.85  ?  447 VAL A HG12   1 
ATOM 6909  H HG13   . VAL A 1 443 ? 5.930   -35.429 14.855  1.00 79.85  ?  447 VAL A HG13   1 
ATOM 6910  H HG21   . VAL A 1 443 ? 4.133   -33.878 16.630  1.00 67.02  ?  447 VAL A HG21   1 
ATOM 6911  H HG22   . VAL A 1 443 ? 4.872   -35.181 17.161  1.00 67.02  ?  447 VAL A HG22   1 
ATOM 6912  H HG23   . VAL A 1 443 ? 5.045   -33.801 17.929  1.00 67.02  ?  447 VAL A HG23   1 
ATOM 6913  N N      . ARG A 1 444 ? 7.048   -34.394 19.244  1.00 46.41  ?  448 ARG A N      1 
ATOM 6914  C CA     . ARG A 1 444 ? 7.193   -33.855 20.591  1.00 42.23  ?  448 ARG A CA     1 
ATOM 6915  C C      . ARG A 1 444 ? 8.644   -33.889 21.047  1.00 40.35  ?  448 ARG A C      1 
ATOM 6916  O O      . ARG A 1 444 ? 9.115   -32.961 21.711  1.00 47.54  ?  448 ARG A O      1 
ATOM 6917  C CB     . ARG A 1 444 ? 6.310   -34.629 21.565  1.00 48.76  ?  448 ARG A CB     1 
ATOM 6918  C CG     . ARG A 1 444 ? 4.853   -34.222 21.506  1.00 57.10  ?  448 ARG A CG     1 
ATOM 6919  C CD     . ARG A 1 444 ? 4.264   -34.036 22.890  1.00 67.01  ?  448 ARG A CD     1 
ATOM 6920  N NE     . ARG A 1 444 ? 3.780   -35.291 23.454  1.00 69.03  ?  448 ARG A NE     1 
ATOM 6921  C CZ     . ARG A 1 444 ? 3.055   -35.384 24.564  1.00 79.27  ?  448 ARG A CZ     1 
ATOM 6922  N NH1    . ARG A 1 444 ? 2.718   -34.290 25.233  1.00 91.37  1  448 ARG A NH1    1 
ATOM 6923  N NH2    . ARG A 1 444 ? 2.660   -36.571 25.003  1.00 61.43  ?  448 ARG A NH2    1 
ATOM 6924  H H      . ARG A 1 444 ? 6.548   -35.091 19.188  1.00 55.69  ?  448 ARG A H      1 
ATOM 6925  H HA     . ARG A 1 444 ? 6.901   -32.930 20.593  1.00 50.67  ?  448 ARG A HA     1 
ATOM 6926  H HB2    . ARG A 1 444 ? 6.364   -35.574 21.355  1.00 58.52  ?  448 ARG A HB2    1 
ATOM 6927  H HB3    . ARG A 1 444 ? 6.626   -34.472 22.468  1.00 58.52  ?  448 ARG A HB3    1 
ATOM 6928  H HG2    . ARG A 1 444 ? 4.775   -33.382 21.028  1.00 68.52  ?  448 ARG A HG2    1 
ATOM 6929  H HG3    . ARG A 1 444 ? 4.347   -34.914 21.052  1.00 68.52  ?  448 ARG A HG3    1 
ATOM 6930  H HD2    . ARG A 1 444 ? 4.946   -33.682 23.481  1.00 80.41  ?  448 ARG A HD2    1 
ATOM 6931  H HD3    . ARG A 1 444 ? 3.516   -33.421 22.837  1.00 80.41  ?  448 ARG A HD3    1 
ATOM 6932  H HE     . ARG A 1 444 ? 3.977   -36.020 23.041  1.00 82.84  ?  448 ARG A HE     1 
ATOM 6933  H HH11   . ARG A 1 444 ? 2.972   -33.518 24.952  1.00 109.64 ?  448 ARG A HH11   1 
ATOM 6934  H HH12   . ARG A 1 444 ? 2.247   -34.353 25.951  1.00 109.64 ?  448 ARG A HH12   1 
ATOM 6935  H HH21   . ARG A 1 444 ? 2.875   -37.283 24.571  1.00 73.72  ?  448 ARG A HH21   1 
ATOM 6936  H HH22   . ARG A 1 444 ? 2.189   -36.629 25.721  1.00 73.72  ?  448 ARG A HH22   1 
ATOM 6937  N N      . ASN A 1 445 ? 9.365   -34.955 20.712  1.00 50.37  ?  449 ASN A N      1 
ATOM 6938  C CA     . ASN A 1 445 ? 10.790  -35.010 21.003  1.00 64.66  ?  449 ASN A CA     1 
ATOM 6939  C C      . ASN A 1 445 ? 11.622  -34.290 19.954  1.00 57.12  ?  449 ASN A C      1 
ATOM 6940  O O      . ASN A 1 445 ? 12.822  -34.091 20.169  1.00 61.24  ?  449 ASN A O      1 
ATOM 6941  C CB     . ASN A 1 445 ? 11.245  -36.465 21.125  1.00 80.48  ?  449 ASN A CB     1 
ATOM 6942  C CG     . ASN A 1 445 ? 10.696  -37.140 22.367  1.00 85.33  ?  449 ASN A CG     1 
ATOM 6943  O OD1    . ASN A 1 445 ? 11.353  -37.180 23.406  1.00 96.26  ?  449 ASN A OD1    1 
ATOM 6944  N ND2    . ASN A 1 445 ? 9.482   -37.668 22.267  1.00 79.91  ?  449 ASN A ND2    1 
ATOM 6945  H H      . ASN A 1 445 ? 9.055   -35.654 20.319  1.00 60.45  ?  449 ASN A H      1 
ATOM 6946  H HA     . ASN A 1 445 ? 10.950  -34.577 21.856  1.00 77.59  ?  449 ASN A HA     1 
ATOM 6947  H HB2    . ASN A 1 445 ? 10.934  -36.960 20.351  1.00 96.58  ?  449 ASN A HB2    1 
ATOM 6948  H HB3    . ASN A 1 445 ? 12.213  -36.491 21.172  1.00 96.58  ?  449 ASN A HB3    1 
ATOM 6949  H HD21   . ASN A 1 445 ? 9.127   -38.062 22.944  1.00 95.89  ?  449 ASN A HD21   1 
ATOM 6950  H HD22   . ASN A 1 445 ? 9.050   -37.616 21.525  1.00 95.89  ?  449 ASN A HD22   1 
ATOM 6951  N N      . MET A 1 446 ? 11.018  -33.904 18.832  1.00 59.06  ?  450 MET A N      1 
ATOM 6952  C CA     . MET A 1 446 ? 11.670  -33.033 17.864  1.00 57.34  ?  450 MET A CA     1 
ATOM 6953  C C      . MET A 1 446 ? 11.478  -31.567 18.231  1.00 51.85  ?  450 MET A C      1 
ATOM 6954  O O      . MET A 1 446 ? 12.441  -30.795 18.246  1.00 54.14  ?  450 MET A O      1 
ATOM 6955  C CB     . MET A 1 446 ? 11.121  -33.300 16.459  1.00 58.90  ?  450 MET A CB     1 
ATOM 6956  C CG     . MET A 1 446 ? 11.804  -32.496 15.360  1.00 54.77  ?  450 MET A CG     1 
ATOM 6957  S SD     . MET A 1 446 ? 10.996  -32.653 13.755  1.00 65.57  ?  450 MET A SD     1 
ATOM 6958  C CE     . MET A 1 446 ? 9.449   -31.803 14.055  1.00 43.10  ?  450 MET A CE     1 
ATOM 6959  H H      . MET A 1 446 ? 10.221  -34.136 18.608  1.00 70.87  ?  450 MET A H      1 
ATOM 6960  H HA     . MET A 1 446 ? 12.620  -33.231 17.854  1.00 68.81  ?  450 MET A HA     1 
ATOM 6961  H HB2    . MET A 1 446 ? 11.238  -34.240 16.253  1.00 70.68  ?  450 MET A HB2    1 
ATOM 6962  H HB3    . MET A 1 446 ? 10.178  -33.076 16.446  1.00 70.68  ?  450 MET A HB3    1 
ATOM 6963  H HG2    . MET A 1 446 ? 11.797  -31.557 15.606  1.00 65.73  ?  450 MET A HG2    1 
ATOM 6964  H HG3    . MET A 1 446 ? 12.718  -32.805 15.265  1.00 65.73  ?  450 MET A HG3    1 
ATOM 6965  H HE1    . MET A 1 446 ? 8.917   -31.823 13.244  1.00 51.72  ?  450 MET A HE1    1 
ATOM 6966  H HE2    . MET A 1 446 ? 8.976   -32.252 14.773  1.00 51.72  ?  450 MET A HE2    1 
ATOM 6967  H HE3    . MET A 1 446 ? 9.637   -30.885 14.305  1.00 51.72  ?  450 MET A HE3    1 
ATOM 6968  N N      . LEU A 1 447 ? 10.240  -31.172 18.532  1.00 60.21  ?  451 LEU A N      1 
ATOM 6969  C CA     . LEU A 1 447 ? 9.976   -29.792 18.919  1.00 48.62  ?  451 LEU A CA     1 
ATOM 6970  C C      . LEU A 1 447 ? 10.708  -29.421 20.200  1.00 44.54  ?  451 LEU A C      1 
ATOM 6971  O O      . LEU A 1 447 ? 11.100  -28.263 20.378  1.00 64.95  ?  451 LEU A O      1 
ATOM 6972  C CB     . LEU A 1 447 ? 8.473   -29.574 19.088  1.00 50.57  ?  451 LEU A CB     1 
ATOM 6973  C CG     . LEU A 1 447 ? 7.612   -29.708 17.832  1.00 53.80  ?  451 LEU A CG     1 
ATOM 6974  C CD1    . LEU A 1 447 ? 6.141   -29.602 18.192  1.00 45.48  ?  451 LEU A CD1    1 
ATOM 6975  C CD2    . LEU A 1 447 ? 7.981   -28.657 16.804  1.00 51.00  ?  451 LEU A CD2    1 
ATOM 6976  H H      . LEU A 1 447 ? 9.545   -31.679 18.521  1.00 72.25  ?  451 LEU A H      1 
ATOM 6977  H HA     . LEU A 1 447 ? 10.287  -29.201 18.214  1.00 58.34  ?  451 LEU A HA     1 
ATOM 6978  H HB2    . LEU A 1 447 ? 8.144   -30.223 19.731  1.00 60.68  ?  451 LEU A HB2    1 
ATOM 6979  H HB3    . LEU A 1 447 ? 8.334   -28.680 19.437  1.00 60.68  ?  451 LEU A HB3    1 
ATOM 6980  H HG     . LEU A 1 447 ? 7.762   -30.581 17.437  1.00 64.56  ?  451 LEU A HG     1 
ATOM 6981  H HD11   . LEU A 1 447 ? 5.612   -29.689 17.384  1.00 54.58  ?  451 LEU A HD11   1 
ATOM 6982  H HD12   . LEU A 1 447 ? 5.916   -30.312 18.813  1.00 54.58  ?  451 LEU A HD12   1 
ATOM 6983  H HD13   . LEU A 1 447 ? 5.979   -28.738 18.603  1.00 54.58  ?  451 LEU A HD13   1 
ATOM 6984  H HD21   . LEU A 1 447 ? 7.419   -28.769 16.022  1.00 61.20  ?  451 LEU A HD21   1 
ATOM 6985  H HD22   . LEU A 1 447 ? 7.842   -27.777 17.189  1.00 61.20  ?  451 LEU A HD22   1 
ATOM 6986  H HD23   . LEU A 1 447 ? 8.914   -28.768 16.560  1.00 61.20  ?  451 LEU A HD23   1 
ATOM 6987  N N      . ALA A 1 448 ? 10.901  -30.381 21.104  1.00 45.24  ?  452 ALA A N      1 
ATOM 6988  C CA     . ALA A 1 448 ? 11.617  -30.101 22.340  1.00 42.89  ?  452 ALA A CA     1 
ATOM 6989  C C      . ALA A 1 448 ? 13.091  -29.814 22.097  1.00 44.06  ?  452 ALA A C      1 
ATOM 6990  O O      . ALA A 1 448 ? 13.751  -29.253 22.977  1.00 46.71  ?  452 ALA A O      1 
ATOM 6991  C CB     . ALA A 1 448 ? 11.471  -31.272 23.310  1.00 73.89  ?  452 ALA A CB     1 
ATOM 6992  H H      . ALA A 1 448 ? 10.629  -31.194 21.024  1.00 54.29  ?  452 ALA A H      1 
ATOM 6993  H HA     . ALA A 1 448 ? 11.226  -29.317 22.757  1.00 51.47  ?  452 ALA A HA     1 
ATOM 6994  H HB1    . ALA A 1 448 ? 11.954  -31.067 24.126  1.00 88.66  ?  452 ALA A HB1    1 
ATOM 6995  H HB2    . ALA A 1 448 ? 10.530  -31.403 23.505  1.00 88.66  ?  452 ALA A HB2    1 
ATOM 6996  H HB3    . ALA A 1 448 ? 11.839  -32.069 22.898  1.00 88.66  ?  452 ALA A HB3    1 
ATOM 6997  N N      . LEU A 1 449 ? 13.622  -30.190 20.937  1.00 46.65  ?  453 LEU A N      1 
ATOM 6998  C CA     . LEU A 1 449 ? 15.014  -29.900 20.629  1.00 50.41  ?  453 LEU A CA     1 
ATOM 6999  C C      . LEU A 1 449 ? 15.254  -28.396 20.637  1.00 63.01  ?  453 LEU A C      1 
ATOM 7000  O O      . LEU A 1 449 ? 14.469  -27.620 20.086  1.00 63.59  ?  453 LEU A O      1 
ATOM 7001  C CB     . LEU A 1 449 ? 15.390  -30.482 19.267  1.00 59.84  ?  453 LEU A CB     1 
ATOM 7002  C CG     . LEU A 1 449 ? 15.586  -31.995 19.206  1.00 38.76  ?  453 LEU A CG     1 
ATOM 7003  C CD1    . LEU A 1 449 ? 15.566  -32.478 17.770  1.00 27.82  ?  453 LEU A CD1    1 
ATOM 7004  C CD2    . LEU A 1 449 ? 16.893  -32.378 19.874  1.00 57.84  ?  453 LEU A CD2    1 
ATOM 7005  H H      . LEU A 1 449 ? 13.200  -30.611 20.317  1.00 55.98  ?  453 LEU A H      1 
ATOM 7006  H HA     . LEU A 1 449 ? 15.584  -30.304 21.302  1.00 60.49  ?  453 LEU A HA     1 
ATOM 7007  H HB2    . LEU A 1 449 ? 14.688  -30.257 18.636  1.00 71.81  ?  453 LEU A HB2    1 
ATOM 7008  H HB3    . LEU A 1 449 ? 16.221  -30.072 18.980  1.00 71.81  ?  453 LEU A HB3    1 
ATOM 7009  H HG     . LEU A 1 449 ? 14.862  -32.431 19.683  1.00 46.51  ?  453 LEU A HG     1 
ATOM 7010  H HD11   . LEU A 1 449 ? 15.692  -33.440 17.758  1.00 33.38  ?  453 LEU A HD11   1 
ATOM 7011  H HD12   . LEU A 1 449 ? 14.711  -32.251 17.372  1.00 33.38  ?  453 LEU A HD12   1 
ATOM 7012  H HD13   . LEU A 1 449 ? 16.283  -32.044 17.281  1.00 33.38  ?  453 LEU A HD13   1 
ATOM 7013  H HD21   . LEU A 1 449 ? 17.002  -33.340 19.826  1.00 69.41  ?  453 LEU A HD21   1 
ATOM 7014  H HD22   . LEU A 1 449 ? 17.624  -31.939 19.411  1.00 69.41  ?  453 LEU A HD22   1 
ATOM 7015  H HD23   . LEU A 1 449 ? 16.869  -32.092 20.800  1.00 69.41  ?  453 LEU A HD23   1 
ATOM 7016  N N      . THR A 1 450 ? 16.352  -27.986 21.267  1.00 74.22  ?  454 THR A N      1 
ATOM 7017  C CA     . THR A 1 450 ? 16.696  -26.576 21.364  1.00 76.04  ?  454 THR A CA     1 
ATOM 7018  C C      . THR A 1 450 ? 17.512  -26.080 20.179  1.00 70.20  ?  454 THR A C      1 
ATOM 7019  O O      . THR A 1 450 ? 17.756  -24.873 20.081  1.00 80.51  ?  454 THR A O      1 
ATOM 7020  C CB     . THR A 1 450 ? 17.481  -26.308 22.651  1.00 74.91  ?  454 THR A CB     1 
ATOM 7021  O OG1    . THR A 1 450 ? 18.761  -26.946 22.574  1.00 88.03  ?  454 THR A OG1    1 
ATOM 7022  C CG2    . THR A 1 450 ? 16.726  -26.838 23.858  1.00 61.47  ?  454 THR A CG2    1 
ATOM 7023  H H      . THR A 1 450 ? 16.916  -28.511 21.649  1.00 89.07  ?  454 THR A H      1 
ATOM 7024  H HA     . THR A 1 450 ? 15.878  -26.056 21.400  1.00 91.25  ?  454 THR A HA     1 
ATOM 7025  H HB     . THR A 1 450 ? 17.603  -25.352 22.761  1.00 89.89  ?  454 THR A HB     1 
ATOM 7026  H HG1    . THR A 1 450 ? 19.196  -26.803 23.277  1.00 105.63 ?  454 THR A HG1    1 
ATOM 7027  H HG21   . THR A 1 450 ? 17.232  -26.663 24.667  1.00 73.76  ?  454 THR A HG21   1 
ATOM 7028  H HG22   . THR A 1 450 ? 15.862  -26.402 23.926  1.00 73.76  ?  454 THR A HG22   1 
ATOM 7029  H HG23   . THR A 1 450 ? 16.592  -27.794 23.771  1.00 73.76  ?  454 THR A HG23   1 
ATOM 7030  N N      . THR A 1 451 ? 17.941  -26.971 19.286  1.00 52.55  ?  455 THR A N      1 
ATOM 7031  C CA     . THR A 1 451 ? 18.707  -26.588 18.107  1.00 52.90  ?  455 THR A CA     1 
ATOM 7032  C C      . THR A 1 451 ? 17.924  -26.818 16.821  1.00 48.87  ?  455 THR A C      1 
ATOM 7033  O O      . THR A 1 451 ? 18.519  -26.916 15.744  1.00 44.16  ?  455 THR A O      1 
ATOM 7034  C CB     . THR A 1 451 ? 20.039  -27.341 18.067  1.00 66.24  ?  455 THR A CB     1 
ATOM 7035  O OG1    . THR A 1 451 ? 20.674  -27.138 16.797  1.00 70.83  ?  455 THR A OG1    1 
ATOM 7036  C CG2    . THR A 1 451 ? 19.837  -28.833 18.309  1.00 83.76  ?  455 THR A CG2    1 
ATOM 7037  H H      . THR A 1 451 ? 17.798  -27.817 19.344  1.00 63.06  ?  455 THR A H      1 
ATOM 7038  H HA     . THR A 1 451 ? 18.907  -25.640 18.163  1.00 63.48  ?  455 THR A HA     1 
ATOM 7039  H HB     . THR A 1 451 ? 20.617  -26.999 18.767  1.00 79.49  ?  455 THR A HB     1 
ATOM 7040  H HG1    . THR A 1 451 ? 20.180  -27.422 16.180  1.00 84.99  ?  455 THR A HG1    1 
ATOM 7041  H HG21   . THR A 1 451 ? 20.691  -29.292 18.279  1.00 100.52 ?  455 THR A HG21   1 
ATOM 7042  H HG22   . THR A 1 451 ? 19.432  -28.975 19.179  1.00 100.52 ?  455 THR A HG22   1 
ATOM 7043  H HG23   . THR A 1 451 ? 19.256  -29.203 17.626  1.00 100.52 ?  455 THR A HG23   1 
ATOM 7044  N N      . LEU A 1 452 ? 16.600  -26.894 16.912  1.00 45.40  ?  456 LEU A N      1 
ATOM 7045  C CA     . LEU A 1 452 ? 15.764  -27.120 15.742  1.00 43.54  ?  456 LEU A CA     1 
ATOM 7046  C C      . LEU A 1 452 ? 15.662  -25.839 14.924  1.00 60.59  ?  456 LEU A C      1 
ATOM 7047  O O      . LEU A 1 452 ? 15.278  -24.789 15.446  1.00 59.72  ?  456 LEU A O      1 
ATOM 7048  C CB     . LEU A 1 452 ? 14.376  -27.591 16.174  1.00 39.65  ?  456 LEU A CB     1 
ATOM 7049  C CG     . LEU A 1 452 ? 13.433  -28.100 15.085  1.00 49.66  ?  456 LEU A CG     1 
ATOM 7050  C CD1    . LEU A 1 452 ? 14.010  -29.321 14.396  1.00 55.04  ?  456 LEU A CD1    1 
ATOM 7051  C CD2    . LEU A 1 452 ? 12.076  -28.426 15.682  1.00 51.50  ?  456 LEU A CD2    1 
ATOM 7052  H H      . LEU A 1 452 ? 16.159  -26.816 17.647  1.00 54.48  ?  456 LEU A H      1 
ATOM 7053  H HA     . LEU A 1 452 ? 16.164  -27.808 15.188  1.00 52.24  ?  456 LEU A HA     1 
ATOM 7054  H HB2    . LEU A 1 452 ? 14.489  -28.313 16.811  1.00 47.59  ?  456 LEU A HB2    1 
ATOM 7055  H HB3    . LEU A 1 452 ? 13.930  -26.848 16.611  1.00 47.59  ?  456 LEU A HB3    1 
ATOM 7056  H HG     . LEU A 1 452 ? 13.311  -27.405 14.418  1.00 59.59  ?  456 LEU A HG     1 
ATOM 7057  H HD11   . LEU A 1 452 ? 13.391  -29.620 13.712  1.00 66.05  ?  456 LEU A HD11   1 
ATOM 7058  H HD12   . LEU A 1 452 ? 14.860  -29.084 13.993  1.00 66.05  ?  456 LEU A HD12   1 
ATOM 7059  H HD13   . LEU A 1 452 ? 14.140  -30.022 15.054  1.00 66.05  ?  456 LEU A HD13   1 
ATOM 7060  H HD21   . LEU A 1 452 ? 11.491  -28.747 14.978  1.00 61.81  ?  456 LEU A HD21   1 
ATOM 7061  H HD22   . LEU A 1 452 ? 12.187  -29.112 16.359  1.00 61.81  ?  456 LEU A HD22   1 
ATOM 7062  H HD23   . LEU A 1 452 ? 11.706  -27.623 16.080  1.00 61.81  ?  456 LEU A HD23   1 
ATOM 7063  N N      . SER A 1 453 ? 16.008  -25.926 13.643  1.00 58.07  ?  457 SER A N      1 
ATOM 7064  C CA     . SER A 1 453 ? 15.952  -24.759 12.777  1.00 42.86  ?  457 SER A CA     1 
ATOM 7065  C C      . SER A 1 453 ? 14.506  -24.367 12.504  1.00 47.34  ?  457 SER A C      1 
ATOM 7066  O O      . SER A 1 453 ? 13.594  -25.197 12.544  1.00 51.94  ?  457 SER A O      1 
ATOM 7067  C CB     . SER A 1 453 ? 16.674  -25.034 11.461  1.00 49.92  ?  457 SER A CB     1 
ATOM 7068  O OG     . SER A 1 453 ? 15.943  -25.948 10.665  1.00 63.24  ?  457 SER A OG     1 
ATOM 7069  H H      . SER A 1 453 ? 16.276  -26.645 13.255  1.00 69.69  ?  457 SER A H      1 
ATOM 7070  H HA     . SER A 1 453 ? 16.392  -24.014 13.215  1.00 51.43  ?  457 SER A HA     1 
ATOM 7071  H HB2    . SER A 1 453 ? 16.773  -24.201 10.974  1.00 59.91  ?  457 SER A HB2    1 
ATOM 7072  H HB3    . SER A 1 453 ? 17.547  -25.411 11.652  1.00 59.91  ?  457 SER A HB3    1 
ATOM 7073  H HG     . SER A 1 453 ? 16.350  -26.091 9.944   1.00 75.89  ?  457 SER A HG     1 
ATOM 7074  N N      . GLU A 1 454 ? 14.304  -23.085 12.206  1.00 52.25  ?  458 GLU A N      1 
ATOM 7075  C CA     . GLU A 1 454 ? 12.947  -22.562 12.086  1.00 53.86  ?  458 GLU A CA     1 
ATOM 7076  C C      . GLU A 1 454 ? 12.109  -23.299 11.050  1.00 52.54  ?  458 GLU A C      1 
ATOM 7077  O O      . GLU A 1 454 ? 10.937  -23.591 11.344  1.00 63.13  ?  458 GLU A O      1 
ATOM 7078  C CB     . GLU A 1 454 ? 12.999  -21.062 11.769  1.00 69.70  ?  458 GLU A CB     1 
ATOM 7079  C CG     . GLU A 1 454 ? 11.631  -20.399 11.742  1.00 64.36  ?  458 GLU A CG     1 
ATOM 7080  C CD     . GLU A 1 454 ? 11.712  -18.888 11.726  1.00 66.97  ?  458 GLU A CD     1 
ATOM 7081  O OE1    . GLU A 1 454 ? 12.838  -18.351 11.683  1.00 83.95  ?  458 GLU A OE1    1 
ATOM 7082  O OE2    . GLU A 1 454 ? 10.647  -18.238 11.758  1.00 69.62  -1 458 GLU A OE2    1 
ATOM 7083  H H      . GLU A 1 454 ? 14.926  -22.507 12.071  1.00 62.70  ?  458 GLU A H      1 
ATOM 7084  H HA     . GLU A 1 454 ? 12.504  -22.663 12.942  1.00 64.64  ?  458 GLU A HA     1 
ATOM 7085  H HB2    . GLU A 1 454 ? 13.531  -20.617 12.447  1.00 83.63  ?  458 GLU A HB2    1 
ATOM 7086  H HB3    . GLU A 1 454 ? 13.406  -20.940 10.897  1.00 83.63  ?  458 GLU A HB3    1 
ATOM 7087  H HG2    . GLU A 1 454 ? 11.159  -20.682 10.943  1.00 77.23  ?  458 GLU A HG2    1 
ATOM 7088  H HG3    . GLU A 1 454 ? 11.135  -20.664 12.532  1.00 77.23  ?  458 GLU A HG3    1 
ATOM 7089  N N      . PRO A 1 455 ? 12.611  -23.622 9.855   1.00 45.88  ?  459 PRO A N      1 
ATOM 7090  C CA     . PRO A 1 455 ? 11.766  -24.353 8.896   1.00 45.61  ?  459 PRO A CA     1 
ATOM 7091  C C      . PRO A 1 455 ? 11.172  -25.620 9.477   1.00 52.65  ?  459 PRO A C      1 
ATOM 7092  O O      . PRO A 1 455 ? 10.023  -25.963 9.175   1.00 47.75  ?  459 PRO A O      1 
ATOM 7093  C CB     . PRO A 1 455 ? 12.732  -24.652 7.742   1.00 39.35  ?  459 PRO A CB     1 
ATOM 7094  C CG     . PRO A 1 455 ? 13.783  -23.616 7.849   1.00 56.20  ?  459 PRO A CG     1 
ATOM 7095  C CD     . PRO A 1 455 ? 13.952  -23.354 9.311   1.00 42.14  ?  459 PRO A CD     1 
ATOM 7096  H HA     . PRO A 1 455 ? 11.051  -23.782 8.575   1.00 54.73  ?  459 PRO A HA     1 
ATOM 7097  H HB2    . PRO A 1 455 ? 13.110  -25.538 7.853   1.00 47.22  ?  459 PRO A HB2    1 
ATOM 7098  H HB3    . PRO A 1 455 ? 12.263  -24.580 6.896   1.00 47.22  ?  459 PRO A HB3    1 
ATOM 7099  H HG2    . PRO A 1 455 ? 14.609  -23.951 7.465   1.00 67.44  ?  459 PRO A HG2    1 
ATOM 7100  H HG3    . PRO A 1 455 ? 13.495  -22.812 7.389   1.00 67.44  ?  459 PRO A HG3    1 
ATOM 7101  H HD2    . PRO A 1 455 ? 14.601  -23.965 9.692   1.00 50.56  ?  459 PRO A HD2    1 
ATOM 7102  H HD3    . PRO A 1 455 ? 14.201  -22.429 9.462   1.00 50.56  ?  459 PRO A HD3    1 
ATOM 7103  N N      . LEU A 1 456 ? 11.930  -26.326 10.317  1.00 54.15  ?  460 LEU A N      1 
ATOM 7104  C CA     . LEU A 1 456 ? 11.422  -27.537 10.943  1.00 47.10  ?  460 LEU A CA     1 
ATOM 7105  C C      . LEU A 1 456 ? 10.490  -27.223 12.104  1.00 44.96  ?  460 LEU A C      1 
ATOM 7106  O O      . LEU A 1 456 ? 9.546   -27.980 12.353  1.00 43.43  ?  460 LEU A O      1 
ATOM 7107  C CB     . LEU A 1 456 ? 12.588  -28.402 11.418  1.00 39.80  ?  460 LEU A CB     1 
ATOM 7108  C CG     . LEU A 1 456 ? 13.655  -28.690 10.359  1.00 29.79  ?  460 LEU A CG     1 
ATOM 7109  C CD1    . LEU A 1 456 ? 14.800  -29.464 10.966  1.00 34.96  ?  460 LEU A CD1    1 
ATOM 7110  C CD2    . LEU A 1 456 ? 13.074  -29.443 9.181   1.00 37.36  ?  460 LEU A CD2    1 
ATOM 7111  H H      . LEU A 1 456 ? 12.736  -26.123 10.537  1.00 64.98  ?  460 LEU A H      1 
ATOM 7112  H HA     . LEU A 1 456 ? 10.921  -28.045 10.286  1.00 56.53  ?  460 LEU A HA     1 
ATOM 7113  H HB2    . LEU A 1 456 ? 13.025  -27.952 12.158  1.00 47.76  ?  460 LEU A HB2    1 
ATOM 7114  H HB3    . LEU A 1 456 ? 12.237  -29.255 11.719  1.00 47.76  ?  460 LEU A HB3    1 
ATOM 7115  H HG     . LEU A 1 456 ? 14.006  -27.848 10.030  1.00 35.75  ?  460 LEU A HG     1 
ATOM 7116  H HD11   . LEU A 1 456 ? 15.464  -29.636 10.280  1.00 41.95  ?  460 LEU A HD11   1 
ATOM 7117  H HD12   . LEU A 1 456 ? 15.192  -28.938 11.681  1.00 41.95  ?  460 LEU A HD12   1 
ATOM 7118  H HD13   . LEU A 1 456 ? 14.463  -30.302 11.319  1.00 41.95  ?  460 LEU A HD13   1 
ATOM 7119  H HD21   . LEU A 1 456 ? 13.777  -29.607 8.533   1.00 44.83  ?  460 LEU A HD21   1 
ATOM 7120  H HD22   . LEU A 1 456 ? 12.709  -30.286 9.494   1.00 44.83  ?  460 LEU A HD22   1 
ATOM 7121  H HD23   . LEU A 1 456 ? 12.372  -28.907 8.779   1.00 44.83  ?  460 LEU A HD23   1 
ATOM 7122  N N      . ILE A 1 457 ? 10.728  -26.119 12.816  1.00 53.03  ?  461 ILE A N      1 
ATOM 7123  C CA     . ILE A 1 457 ? 9.809   -25.713 13.875  1.00 49.65  ?  461 ILE A CA     1 
ATOM 7124  C C      . ILE A 1 457 ? 8.435   -25.435 13.288  1.00 50.48  ?  461 ILE A C      1 
ATOM 7125  O O      . ILE A 1 457 ? 7.410   -25.874 13.821  1.00 49.34  ?  461 ILE A O      1 
ATOM 7126  C CB     . ILE A 1 457 ? 10.348  -24.482 14.626  1.00 47.36  ?  461 ILE A CB     1 
ATOM 7127  C CG1    . ILE A 1 457 ? 11.733  -24.770 15.207  1.00 43.93  ?  461 ILE A CG1    1 
ATOM 7128  C CG2    . ILE A 1 457 ? 9.374   -24.083 15.731  1.00 35.86  ?  461 ILE A CG2    1 
ATOM 7129  C CD1    . ILE A 1 457 ? 12.355  -23.602 15.938  1.00 39.67  ?  461 ILE A CD1    1 
ATOM 7130  H H      . ILE A 1 457 ? 11.403  -25.598 12.707  1.00 63.63  ?  461 ILE A H      1 
ATOM 7131  H HA     . ILE A 1 457 ? 9.721   -26.438 14.512  1.00 59.58  ?  461 ILE A HA     1 
ATOM 7132  H HB     . ILE A 1 457 ? 10.423  -23.746 13.999  1.00 56.83  ?  461 ILE A HB     1 
ATOM 7133  H HG12   . ILE A 1 457 ? 11.660  -25.506 15.835  1.00 52.71  ?  461 ILE A HG12   1 
ATOM 7134  H HG13   . ILE A 1 457 ? 12.329  -25.016 14.482  1.00 52.71  ?  461 ILE A HG13   1 
ATOM 7135  H HG21   . ILE A 1 457 ? 9.726   -23.307 16.195  1.00 43.03  ?  461 ILE A HG21   1 
ATOM 7136  H HG22   . ILE A 1 457 ? 8.516   -23.869 15.333  1.00 43.03  ?  461 ILE A HG22   1 
ATOM 7137  H HG23   . ILE A 1 457 ? 9.278   -24.824 16.349  1.00 43.03  ?  461 ILE A HG23   1 
ATOM 7138  H HD11   . ILE A 1 457 ? 13.226  -23.867 16.273  1.00 47.60  ?  461 ILE A HD11   1 
ATOM 7139  H HD12   . ILE A 1 457 ? 12.450  -22.858 15.322  1.00 47.60  ?  461 ILE A HD12   1 
ATOM 7140  H HD13   . ILE A 1 457 ? 11.780  -23.349 16.677  1.00 47.60  ?  461 ILE A HD13   1 
ATOM 7141  N N      . LYS A 1 458 ? 8.395   -24.690 12.183  1.00 53.86  ?  462 LYS A N      1 
ATOM 7142  C CA     . LYS A 1 458 ? 7.120   -24.363 11.558  1.00 51.77  ?  462 LYS A CA     1 
ATOM 7143  C C      . LYS A 1 458 ? 6.324   -25.622 11.263  1.00 44.07  ?  462 LYS A C      1 
ATOM 7144  O O      . LYS A 1 458 ? 5.174   -25.760 11.690  1.00 38.21  ?  462 LYS A O      1 
ATOM 7145  C CB     . LYS A 1 458 ? 7.351   -23.568 10.272  1.00 57.74  ?  462 LYS A CB     1 
ATOM 7146  C CG     . LYS A 1 458 ? 6.074   -23.296 9.488   1.00 58.43  ?  462 LYS A CG     1 
ATOM 7147  C CD     . LYS A 1 458 ? 6.302   -22.308 8.356   1.00 55.81  ?  462 LYS A CD     1 
ATOM 7148  C CE     . LYS A 1 458 ? 6.684   -23.009 7.063   1.00 70.49  ?  462 LYS A CE     1 
ATOM 7149  N NZ     . LYS A 1 458 ? 5.571   -23.842 6.529   1.00 69.57  1  462 LYS A NZ     1 
ATOM 7150  H H      . LYS A 1 458 ? 9.083   -24.367 11.781  1.00 64.64  ?  462 LYS A H      1 
ATOM 7151  H HA     . LYS A 1 458 ? 6.601   -23.812 12.164  1.00 62.12  ?  462 LYS A HA     1 
ATOM 7152  H HB2    . LYS A 1 458 ? 7.749   -22.713 10.499  1.00 69.29  ?  462 LYS A HB2    1 
ATOM 7153  H HB3    . LYS A 1 458 ? 7.952   -24.069 9.697   1.00 69.29  ?  462 LYS A HB3    1 
ATOM 7154  H HG2    . LYS A 1 458 ? 5.752   -24.127 9.105   1.00 70.12  ?  462 LYS A HG2    1 
ATOM 7155  H HG3    . LYS A 1 458 ? 5.407   -22.923 10.086  1.00 70.12  ?  462 LYS A HG3    1 
ATOM 7156  H HD2    . LYS A 1 458 ? 5.486   -21.808 8.200   1.00 66.98  ?  462 LYS A HD2    1 
ATOM 7157  H HD3    . LYS A 1 458 ? 7.023   -21.706 8.599   1.00 66.98  ?  462 LYS A HD3    1 
ATOM 7158  H HE2    . LYS A 1 458 ? 6.910   -22.343 6.395   1.00 84.59  ?  462 LYS A HE2    1 
ATOM 7159  H HE3    . LYS A 1 458 ? 7.443   -23.589 7.228   1.00 84.59  ?  462 LYS A HE3    1 
ATOM 7160  H HZ1    . LYS A 1 458 ? 5.823   -24.238 5.773   1.00 83.49  ?  462 LYS A HZ1    1 
ATOM 7161  H HZ2    . LYS A 1 458 ? 5.346   -24.466 7.122   1.00 83.49  ?  462 LYS A HZ2    1 
ATOM 7162  H HZ3    . LYS A 1 458 ? 4.861   -23.331 6.364   1.00 83.49  ?  462 LYS A HZ3    1 
ATOM 7163  N N      . ILE A 1 459 ? 6.931   -26.566 10.543  1.00 56.41  ?  463 ILE A N      1 
ATOM 7164  C CA     . ILE A 1 459 ? 6.179   -27.725 10.085  1.00 42.26  ?  463 ILE A CA     1 
ATOM 7165  C C      . ILE A 1 459 ? 5.901   -28.677 11.238  1.00 42.29  ?  463 ILE A C      1 
ATOM 7166  O O      . ILE A 1 459 ? 4.842   -29.314 11.283  1.00 38.94  ?  463 ILE A O      1 
ATOM 7167  C CB     . ILE A 1 459 ? 6.931   -28.417 8.933   1.00 27.36  ?  463 ILE A CB     1 
ATOM 7168  C CG1    . ILE A 1 459 ? 5.987   -29.338 8.163   1.00 44.01  ?  463 ILE A CG1    1 
ATOM 7169  C CG2    . ILE A 1 459 ? 8.148   -29.178 9.450   1.00 34.74  ?  463 ILE A CG2    1 
ATOM 7170  C CD1    . ILE A 1 459 ? 4.903   -28.600 7.401   1.00 40.61  ?  463 ILE A CD1    1 
ATOM 7171  H H      . ILE A 1 459 ? 7.759   -26.557 10.312  1.00 67.70  ?  463 ILE A H      1 
ATOM 7172  H HA     . ILE A 1 459 ? 5.324   -27.424 9.739   1.00 50.71  ?  463 ILE A HA     1 
ATOM 7173  H HB     . ILE A 1 459 ? 7.244   -27.730 8.324   1.00 32.84  ?  463 ILE A HB     1 
ATOM 7174  H HG12   . ILE A 1 459 ? 6.504   -29.851 7.522   1.00 52.82  ?  463 ILE A HG12   1 
ATOM 7175  H HG13   . ILE A 1 459 ? 5.553   -29.937 8.790   1.00 52.82  ?  463 ILE A HG13   1 
ATOM 7176  H HG21   . ILE A 1 459 ? 8.597   -29.601 8.701   1.00 41.69  ?  463 ILE A HG21   1 
ATOM 7177  H HG22   . ILE A 1 459 ? 8.748   -28.554 9.887   1.00 41.69  ?  463 ILE A HG22   1 
ATOM 7178  H HG23   . ILE A 1 459 ? 7.853   -29.852 10.083  1.00 41.69  ?  463 ILE A HG23   1 
ATOM 7179  H HD11   . ILE A 1 459 ? 4.346   -29.246 6.939   1.00 48.74  ?  463 ILE A HD11   1 
ATOM 7180  H HD12   . ILE A 1 459 ? 4.368   -28.090 8.028   1.00 48.74  ?  463 ILE A HD12   1 
ATOM 7181  H HD13   . ILE A 1 459 ? 5.320   -28.003 6.759   1.00 48.74  ?  463 ILE A HD13   1 
ATOM 7182  N N      . GLY A 1 460 ? 6.831   -28.792 12.186  1.00 36.38  ?  464 GLY A N      1 
ATOM 7183  C CA     . GLY A 1 460 ? 6.574   -29.614 13.356  1.00 30.97  ?  464 GLY A CA     1 
ATOM 7184  C C      . GLY A 1 460 ? 5.272   -29.248 14.036  1.00 37.07  ?  464 GLY A C      1 
ATOM 7185  O O      . GLY A 1 460 ? 4.444   -30.112 14.331  1.00 46.06  ?  464 GLY A O      1 
ATOM 7186  H H      . GLY A 1 460 ? 7.602   -28.412 12.172  1.00 43.65  ?  464 GLY A H      1 
ATOM 7187  H HA2    . GLY A 1 460 ? 6.534   -30.547 13.095  1.00 37.17  ?  464 GLY A HA2    1 
ATOM 7188  H HA3    . GLY A 1 460 ? 7.296   -29.503 13.994  1.00 37.17  ?  464 GLY A HA3    1 
ATOM 7189  N N      . ILE A 1 461 ? 5.066   -27.954 14.284  1.00 41.03  ?  465 ILE A N      1 
ATOM 7190  C CA     . ILE A 1 461 ? 3.801   -27.501 14.853  1.00 34.91  ?  465 ILE A CA     1 
ATOM 7191  C C      . ILE A 1 461 ? 2.653   -27.854 13.920  1.00 36.42  ?  465 ILE A C      1 
ATOM 7192  O O      . ILE A 1 461 ? 1.585   -28.292 14.362  1.00 49.98  ?  465 ILE A O      1 
ATOM 7193  C CB     . ILE A 1 461 ? 3.849   -25.988 15.134  1.00 45.17  ?  465 ILE A CB     1 
ATOM 7194  C CG1    . ILE A 1 461 ? 5.022   -25.634 16.057  1.00 33.95  ?  465 ILE A CG1    1 
ATOM 7195  C CG2    . ILE A 1 461 ? 2.528   -25.514 15.733  1.00 65.12  ?  465 ILE A CG2    1 
ATOM 7196  C CD1    . ILE A 1 461 ? 4.877   -26.114 17.485  1.00 42.32  ?  465 ILE A CD1    1 
ATOM 7197  H H      . ILE A 1 461 ? 5.636   -27.328 14.134  1.00 49.23  ?  465 ILE A H      1 
ATOM 7198  H HA     . ILE A 1 461 ? 3.653   -27.958 15.696  1.00 41.90  ?  465 ILE A HA     1 
ATOM 7199  H HB     . ILE A 1 461 ? 3.980   -25.528 14.290  1.00 54.21  ?  465 ILE A HB     1 
ATOM 7200  H HG12   . ILE A 1 461 ? 5.830   -26.030 15.695  1.00 40.74  ?  465 ILE A HG12   1 
ATOM 7201  H HG13   . ILE A 1 461 ? 5.115   -24.668 16.080  1.00 40.74  ?  465 ILE A HG13   1 
ATOM 7202  H HG21   . ILE A 1 461 ? 2.583   -24.560 15.901  1.00 78.15  ?  465 ILE A HG21   1 
ATOM 7203  H HG22   . ILE A 1 461 ? 1.813   -25.700 15.105  1.00 78.15  ?  465 ILE A HG22   1 
ATOM 7204  H HG23   . ILE A 1 461 ? 2.371   -25.988 16.565  1.00 78.15  ?  465 ILE A HG23   1 
ATOM 7205  H HD11   . ILE A 1 461 ? 5.661   -25.845 17.989  1.00 50.78  ?  465 ILE A HD11   1 
ATOM 7206  H HD12   . ILE A 1 461 ? 4.082   -25.716 17.872  1.00 50.78  ?  465 ILE A HD12   1 
ATOM 7207  H HD13   . ILE A 1 461 ? 4.798   -27.080 17.486  1.00 50.78  ?  465 ILE A HD13   1 
ATOM 7208  N N      . ARG A 1 462 ? 2.854   -27.672 12.614  1.00 38.40  ?  466 ARG A N      1 
ATOM 7209  C CA     . ARG A 1 462 ? 1.799   -27.981 11.657  1.00 46.42  ?  466 ARG A CA     1 
ATOM 7210  C C      . ARG A 1 462 ? 1.391   -29.443 11.754  1.00 56.33  ?  466 ARG A C      1 
ATOM 7211  O O      . ARG A 1 462 ? 0.200   -29.769 11.691  1.00 57.60  ?  466 ARG A O      1 
ATOM 7212  C CB     . ARG A 1 462 ? 2.263   -27.650 10.239  1.00 72.62  ?  466 ARG A CB     1 
ATOM 7213  C CG     . ARG A 1 462 ? 2.630   -26.190 10.027  1.00 64.29  ?  466 ARG A CG     1 
ATOM 7214  C CD     . ARG A 1 462 ? 1.412   -25.314 9.798   1.00 63.68  ?  466 ARG A CD     1 
ATOM 7215  N NE     . ARG A 1 462 ? 1.798   -23.958 9.422   1.00 72.87  ?  466 ARG A NE     1 
ATOM 7216  C CZ     . ARG A 1 462 ? 2.053   -23.566 8.177   1.00 78.07  ?  466 ARG A CZ     1 
ATOM 7217  N NH1    . ARG A 1 462 ? 1.964   -24.425 7.170   1.00 74.85  1  466 ARG A NH1    1 
ATOM 7218  N NH2    . ARG A 1 462 ? 2.401   -22.311 7.934   1.00 81.93  ?  466 ARG A NH2    1 
ATOM 7219  H H      . ARG A 1 462 ? 3.582   -27.376 12.263  1.00 46.07  ?  466 ARG A H      1 
ATOM 7220  H HA     . ARG A 1 462 ? 1.021   -27.437 11.855  1.00 55.70  ?  466 ARG A HA     1 
ATOM 7221  H HB2    . ARG A 1 462 ? 3.047   -28.184 10.036  1.00 87.15  ?  466 ARG A HB2    1 
ATOM 7222  H HB3    . ARG A 1 462 ? 1.549   -27.868 9.619   1.00 87.15  ?  466 ARG A HB3    1 
ATOM 7223  H HG2    . ARG A 1 462 ? 3.093   -25.862 10.814  1.00 77.15  ?  466 ARG A HG2    1 
ATOM 7224  H HG3    . ARG A 1 462 ? 3.204   -26.117 9.249   1.00 77.15  ?  466 ARG A HG3    1 
ATOM 7225  H HD2    . ARG A 1 462 ? 0.878   -25.690 9.081   1.00 76.42  ?  466 ARG A HD2    1 
ATOM 7226  H HD3    . ARG A 1 462 ? 0.893   -25.268 10.616  1.00 76.42  ?  466 ARG A HD3    1 
ATOM 7227  H HE     . ARG A 1 462 ? 1.865   -23.372 10.048  1.00 87.44  ?  466 ARG A HE     1 
ATOM 7228  H HH11   . ARG A 1 462 ? 1.740   -25.241 7.320   1.00 89.83  ?  466 ARG A HH11   1 
ATOM 7229  H HH12   . ARG A 1 462 ? 2.130   -24.165 6.368   1.00 89.83  ?  466 ARG A HH12   1 
ATOM 7230  H HH21   . ARG A 1 462 ? 2.460   -21.748 8.581   1.00 98.32  ?  466 ARG A HH21   1 
ATOM 7231  H HH22   . ARG A 1 462 ? 2.564   -22.058 7.128   1.00 98.32  ?  466 ARG A HH22   1 
ATOM 7232  N N      . VAL A 1 463 ? 2.366   -30.338 11.914  1.00 66.54  ?  467 VAL A N      1 
ATOM 7233  C CA     . VAL A 1 463 ? 2.057   -31.757 12.038  1.00 58.41  ?  467 VAL A CA     1 
ATOM 7234  C C      . VAL A 1 463 ? 1.341   -32.024 13.354  1.00 45.85  ?  467 VAL A C      1 
ATOM 7235  O O      . VAL A 1 463 ? 0.305   -32.695 13.391  1.00 47.29  ?  467 VAL A O      1 
ATOM 7236  C CB     . VAL A 1 463 ? 3.342   -32.597 11.909  1.00 50.52  ?  467 VAL A CB     1 
ATOM 7237  C CG1    . VAL A 1 463 ? 3.059   -34.068 12.166  1.00 54.87  ?  467 VAL A CG1    1 
ATOM 7238  C CG2    . VAL A 1 463 ? 3.946   -32.418 10.530  1.00 46.80  ?  467 VAL A CG2    1 
ATOM 7239  H H      . VAL A 1 463 ? 3.204   -30.149 11.953  1.00 79.85  ?  467 VAL A H      1 
ATOM 7240  H HA     . VAL A 1 463 ? 1.461   -32.013 11.317  1.00 70.10  ?  467 VAL A HA     1 
ATOM 7241  H HB     . VAL A 1 463 ? 3.988   -32.293 12.566  1.00 60.63  ?  467 VAL A HB     1 
ATOM 7242  H HG11   . VAL A 1 463 ? 3.885   -34.568 12.077  1.00 65.84  ?  467 VAL A HG11   1 
ATOM 7243  H HG12   . VAL A 1 463 ? 2.705   -34.169 13.063  1.00 65.84  ?  467 VAL A HG12   1 
ATOM 7244  H HG13   . VAL A 1 463 ? 2.411   -34.382 11.516  1.00 65.84  ?  467 VAL A HG13   1 
ATOM 7245  H HG21   . VAL A 1 463 ? 4.753   -32.953 10.468  1.00 56.16  ?  467 VAL A HG21   1 
ATOM 7246  H HG22   . VAL A 1 463 ? 3.304   -32.709 9.864   1.00 56.16  ?  467 VAL A HG22   1 
ATOM 7247  H HG23   . VAL A 1 463 ? 4.159   -31.481 10.398  1.00 56.16  ?  467 VAL A HG23   1 
ATOM 7248  N N      . MET A 1 464 ? 1.873   -31.484 14.451  1.00 49.10  ?  468 MET A N      1 
ATOM 7249  C CA     . MET A 1 464 ? 1.261   -31.712 15.754  1.00 55.31  ?  468 MET A CA     1 
ATOM 7250  C C      . MET A 1 464 ? -0.155  -31.155 15.804  1.00 47.09  ?  468 MET A C      1 
ATOM 7251  O O      . MET A 1 464 ? -1.004  -31.679 16.533  1.00 43.12  ?  468 MET A O      1 
ATOM 7252  C CB     . MET A 1 464 ? 2.119   -31.086 16.852  1.00 47.29  ?  468 MET A CB     1 
ATOM 7253  C CG     . MET A 1 464 ? 1.840   -31.634 18.239  1.00 58.18  ?  468 MET A CG     1 
ATOM 7254  S SD     . MET A 1 464 ? 2.875   -30.883 19.506  1.00 84.49  ?  468 MET A SD     1 
ATOM 7255  C CE     . MET A 1 464 ? 2.179   -29.237 19.582  1.00 70.25  ?  468 MET A CE     1 
ATOM 7256  H H      . MET A 1 464 ? 2.577   -30.989 14.467  1.00 58.92  ?  468 MET A H      1 
ATOM 7257  H HA     . MET A 1 464 ? 1.224   -32.668 15.917  1.00 66.37  ?  468 MET A HA     1 
ATOM 7258  H HB2    . MET A 1 464 ? 3.053   -31.253 16.650  1.00 56.75  ?  468 MET A HB2    1 
ATOM 7259  H HB3    . MET A 1 464 ? 1.953   -30.131 16.871  1.00 56.75  ?  468 MET A HB3    1 
ATOM 7260  H HG2    . MET A 1 464 ? 0.913   -31.459 18.466  1.00 69.81  ?  468 MET A HG2    1 
ATOM 7261  H HG3    . MET A 1 464 ? 2.008   -32.589 18.241  1.00 69.81  ?  468 MET A HG3    1 
ATOM 7262  H HE1    . MET A 1 464 ? 2.662   -28.721 20.245  1.00 84.30  ?  468 MET A HE1    1 
ATOM 7263  H HE2    . MET A 1 464 ? 2.262   -28.819 18.711  1.00 84.30  ?  468 MET A HE2    1 
ATOM 7264  H HE3    . MET A 1 464 ? 1.243   -29.302 19.830  1.00 84.30  ?  468 MET A HE3    1 
ATOM 7265  N N      . LYS A 1 465 ? -0.428  -30.094 15.044  1.00 50.25  ?  469 LYS A N      1 
ATOM 7266  C CA     . LYS A 1 465 ? -1.792  -29.589 14.943  1.00 58.80  ?  469 LYS A CA     1 
ATOM 7267  C C      . LYS A 1 465 ? -2.707  -30.615 14.291  1.00 56.04  ?  469 LYS A C      1 
ATOM 7268  O O      . LYS A 1 465 ? -3.890  -30.714 14.634  1.00 55.33  ?  469 LYS A O      1 
ATOM 7269  C CB     . LYS A 1 465 ? -1.804  -28.283 14.150  1.00 65.70  ?  469 LYS A CB     1 
ATOM 7270  C CG     . LYS A 1 465 ? -3.192  -27.766 13.782  1.00 66.38  ?  469 LYS A CG     1 
ATOM 7271  C CD     . LYS A 1 465 ? -4.042  -27.491 15.011  1.00 60.01  ?  469 LYS A CD     1 
ATOM 7272  C CE     . LYS A 1 465 ? -5.362  -26.841 14.628  1.00 62.85  ?  469 LYS A CE     1 
ATOM 7273  N NZ     . LYS A 1 465 ? -6.220  -26.563 15.812  1.00 74.65  1  469 LYS A NZ     1 
ATOM 7274  H H      . LYS A 1 465 ? 0.152   -29.655 14.584  1.00 60.30  ?  469 LYS A H      1 
ATOM 7275  H HA     . LYS A 1 465 ? -2.131  -29.405 15.833  1.00 70.55  ?  469 LYS A HA     1 
ATOM 7276  H HB2    . LYS A 1 465 ? -1.367  -27.597 14.679  1.00 78.84  ?  469 LYS A HB2    1 
ATOM 7277  H HB3    . LYS A 1 465 ? -1.314  -28.418 13.324  1.00 78.84  ?  469 LYS A HB3    1 
ATOM 7278  H HG2    . LYS A 1 465 ? -3.102  -26.938 13.286  1.00 79.66  ?  469 LYS A HG2    1 
ATOM 7279  H HG3    . LYS A 1 465 ? -3.646  -28.432 13.243  1.00 79.66  ?  469 LYS A HG3    1 
ATOM 7280  H HD2    . LYS A 1 465 ? -4.234  -28.328 15.463  1.00 72.01  ?  469 LYS A HD2    1 
ATOM 7281  H HD3    . LYS A 1 465 ? -3.566  -26.889 15.604  1.00 72.01  ?  469 LYS A HD3    1 
ATOM 7282  H HE2    . LYS A 1 465 ? -5.183  -25.999 14.181  1.00 75.42  ?  469 LYS A HE2    1 
ATOM 7283  H HE3    . LYS A 1 465 ? -5.849  -27.435 14.036  1.00 75.42  ?  469 LYS A HE3    1 
ATOM 7284  H HZ1    . LYS A 1 465 ? -6.982  -26.183 15.552  1.00 89.58  ?  469 LYS A HZ1    1 
ATOM 7285  H HZ2    . LYS A 1 465 ? -6.405  -27.322 16.238  1.00 89.58  ?  469 LYS A HZ2    1 
ATOM 7286  H HZ3    . LYS A 1 465 ? -5.798  -26.013 16.370  1.00 89.58  ?  469 LYS A HZ3    1 
ATOM 7287  N N      . SER A 1 466 ? -2.176  -31.382 13.337  1.00 57.52  ?  470 SER A N      1 
ATOM 7288  C CA     . SER A 1 466 ? -2.983  -32.380 12.646  1.00 57.16  ?  470 SER A CA     1 
ATOM 7289  C C      . SER A 1 466 ? -3.248  -33.599 13.518  1.00 53.50  ?  470 SER A C      1 
ATOM 7290  O O      . SER A 1 466 ? -4.275  -34.266 13.349  1.00 45.67  ?  470 SER A O      1 
ATOM 7291  C CB     . SER A 1 466 ? -2.286  -32.799 11.354  1.00 52.02  ?  470 SER A CB     1 
ATOM 7292  O OG     . SER A 1 466 ? -3.099  -33.673 10.595  1.00 64.98  ?  470 SER A OG     1 
ATOM 7293  H H      . SER A 1 466 ? -1.358  -31.343 13.076  1.00 69.03  ?  470 SER A H      1 
ATOM 7294  H HA     . SER A 1 466 ? -3.838  -31.987 12.411  1.00 68.60  ?  470 SER A HA     1 
ATOM 7295  H HB2    . SER A 1 466 ? -2.098  -32.007 10.826  1.00 62.42  ?  470 SER A HB2    1 
ATOM 7296  H HB3    . SER A 1 466 ? -1.457  -33.253 11.575  1.00 62.42  ?  470 SER A HB3    1 
ATOM 7297  H HG     . SER A 1 466 ? -2.703  -33.894 9.888   1.00 77.98  ?  470 SER A HG     1 
ATOM 7298  N N      . LEU A 1 467 ? -2.344  -33.908 14.449  1.00 62.36  ?  471 LEU A N      1 
ATOM 7299  C CA     . LEU A 1 467 ? -2.526  -35.074 15.305  1.00 52.55  ?  471 LEU A CA     1 
ATOM 7300  C C      . LEU A 1 467 ? -3.560  -34.815 16.393  1.00 52.85  ?  471 LEU A C      1 
ATOM 7301  O O      . LEU A 1 467 ? -4.385  -35.686 16.686  1.00 61.64  ?  471 LEU A O      1 
ATOM 7302  C CB     . LEU A 1 467 ? -1.196  -35.476 15.941  1.00 44.97  ?  471 LEU A CB     1 
ATOM 7303  C CG     . LEU A 1 467 ? 0.031   -35.564 15.032  1.00 44.94  ?  471 LEU A CG     1 
ATOM 7304  C CD1    . LEU A 1 467 ? 1.169   -36.256 15.757  1.00 54.71  ?  471 LEU A CD1    1 
ATOM 7305  C CD2    . LEU A 1 467 ? -0.288  -36.283 13.743  1.00 46.02  ?  471 LEU A CD2    1 
ATOM 7306  H H      . LEU A 1 467 ? -1.624  -33.463 14.601  1.00 74.83  ?  471 LEU A H      1 
ATOM 7307  H HA     . LEU A 1 467 ? -2.838  -35.817 14.765  1.00 63.06  ?  471 LEU A HA     1 
ATOM 7308  H HB2    . LEU A 1 467 ? -0.988  -34.830 16.635  1.00 53.97  ?  471 LEU A HB2    1 
ATOM 7309  H HB3    . LEU A 1 467 ? -1.310  -36.350 16.347  1.00 53.97  ?  471 LEU A HB3    1 
ATOM 7310  H HG     . LEU A 1 467 ? 0.321   -34.666 14.808  1.00 53.93  ?  471 LEU A HG     1 
ATOM 7311  H HD11   . LEU A 1 467 ? 1.937   -36.302 15.167  1.00 65.66  ?  471 LEU A HD11   1 
ATOM 7312  H HD12   . LEU A 1 467 ? 1.392   -35.746 16.552  1.00 65.66  ?  471 LEU A HD12   1 
ATOM 7313  H HD13   . LEU A 1 467 ? 0.887   -37.150 16.006  1.00 65.66  ?  471 LEU A HD13   1 
ATOM 7314  H HD21   . LEU A 1 467 ? 0.512   -36.318 13.195  1.00 55.22  ?  471 LEU A HD21   1 
ATOM 7315  H HD22   . LEU A 1 467 ? -0.587  -37.182 13.949  1.00 55.22  ?  471 LEU A HD22   1 
ATOM 7316  H HD23   . LEU A 1 467 ? -0.988  -35.800 13.277  1.00 55.22  ?  471 LEU A HD23   1 
ATOM 7317  N N      . SER A 1 468 ? -3.527  -33.630 16.998  1.00 65.35  ?  472 SER A N      1 
ATOM 7318  C CA     . SER A 1 468 ? -4.394  -33.329 18.129  1.00 63.51  ?  472 SER A CA     1 
ATOM 7319  C C      . SER A 1 468 ? -5.847  -33.651 17.809  1.00 61.92  ?  472 SER A C      1 
ATOM 7320  O O      . SER A 1 468 ? -6.302  -33.493 16.674  1.00 57.84  ?  472 SER A O      1 
ATOM 7321  C CB     . SER A 1 468 ? -4.259  -31.856 18.509  1.00 76.02  ?  472 SER A CB     1 
ATOM 7322  O OG     . SER A 1 468 ? -5.277  -31.476 19.415  1.00 88.31  ?  472 SER A OG     1 
ATOM 7323  H H      . SER A 1 468 ? -3.010  -32.982 16.770  1.00 78.42  ?  472 SER A H      1 
ATOM 7324  H HA     . SER A 1 468 ? -4.124  -33.866 18.890  1.00 76.21  ?  472 SER A HA     1 
ATOM 7325  H HB2    . SER A 1 468 ? -3.395  -31.716 18.928  1.00 91.22  ?  472 SER A HB2    1 
ATOM 7326  H HB3    . SER A 1 468 ? -4.330  -31.315 17.708  1.00 91.22  ?  472 SER A HB3    1 
ATOM 7327  H HG     . SER A 1 468 ? -5.193  -30.665 19.617  1.00 105.98 ?  472 SER A HG     1 
ATOM 7328  N N      . ILE A 1 469 ? -6.577  -34.106 18.828  1.00 66.99  ?  473 ILE A N      1 
ATOM 7329  C CA     . ILE A 1 469 ? -7.987  -34.432 18.644  1.00 76.95  ?  473 ILE A CA     1 
ATOM 7330  C C      . ILE A 1 469 ? -8.835  -33.170 18.687  1.00 78.51  ?  473 ILE A C      1 
ATOM 7331  O O      . ILE A 1 469 ? -9.823  -33.046 17.955  1.00 66.93  ?  473 ILE A O      1 
ATOM 7332  C CB     . ILE A 1 469 ? -8.443  -35.464 19.697  1.00 88.38  ?  473 ILE A CB     1 
ATOM 7333  C CG1    . ILE A 1 469 ? -8.572  -34.823 21.085  1.00 84.15  ?  473 ILE A CG1    1 
ATOM 7334  C CG2    . ILE A 1 469 ? -7.469  -36.636 19.742  1.00 82.34  ?  473 ILE A CG2    1 
ATOM 7335  C CD1    . ILE A 1 469 ? -9.127  -35.752 22.151  1.00 76.80  ?  473 ILE A CD1    1 
ATOM 7336  H H      . ILE A 1 469 ? -6.282  -34.233 19.626  1.00 80.38  ?  473 ILE A H      1 
ATOM 7337  H HA     . ILE A 1 469 ? -8.101  -34.835 17.769  1.00 92.34  ?  473 ILE A HA     1 
ATOM 7338  H HB     . ILE A 1 469 ? -9.314  -35.801 19.435  1.00 106.05 ?  473 ILE A HB     1 
ATOM 7339  H HG12   . ILE A 1 469 ? -7.695  -34.530 21.376  1.00 100.98 ?  473 ILE A HG12   1 
ATOM 7340  H HG13   . ILE A 1 469 ? -9.167  -34.059 21.021  1.00 100.98 ?  473 ILE A HG13   1 
ATOM 7341  H HG21   . ILE A 1 469 ? -7.772  -37.272 20.409  1.00 98.81  ?  473 ILE A HG21   1 
ATOM 7342  H HG22   . ILE A 1 469 ? -7.443  -37.058 18.869  1.00 98.81  ?  473 ILE A HG22   1 
ATOM 7343  H HG23   . ILE A 1 469 ? -6.588  -36.304 19.977  1.00 98.81  ?  473 ILE A HG23   1 
ATOM 7344  H HD11   . ILE A 1 469 ? -9.176  -35.273 22.993  1.00 92.17  ?  473 ILE A HD11   1 
ATOM 7345  H HD12   . ILE A 1 469 ? -10.012 -36.045 21.884  1.00 92.17  ?  473 ILE A HD12   1 
ATOM 7346  H HD13   . ILE A 1 469 ? -8.537  -36.517 22.239  1.00 92.17  ?  473 ILE A HD13   1 
ATOM 7347  N N      . ASN A 1 470 ? -8.465  -32.216 19.539  1.00 87.71  ?  474 ASN A N      1 
ATOM 7348  C CA     . ASN A 1 470 ? -9.177  -30.956 19.658  1.00 86.92  ?  474 ASN A CA     1 
ATOM 7349  C C      . ASN A 1 470 ? -8.162  -29.842 19.862  1.00 85.22  ?  474 ASN A C      1 
ATOM 7350  O O      . ASN A 1 470 ? -6.960  -30.083 20.003  1.00 86.45  ?  474 ASN A O      1 
ATOM 7351  C CB     . ASN A 1 470 ? -10.188 -30.985 20.811  1.00 84.63  ?  474 ASN A CB     1 
ATOM 7352  C CG     . ASN A 1 470 ? -9.526  -30.876 22.167  1.00 85.24  ?  474 ASN A CG     1 
ATOM 7353  O OD1    . ASN A 1 470 ? -8.421  -31.373 22.373  1.00 80.05  ?  474 ASN A OD1    1 
ATOM 7354  N ND2    . ASN A 1 470 ? -10.198 -30.216 23.101  1.00 77.52  ?  474 ASN A ND2    1 
ATOM 7355  H H      . ASN A 1 470 ? -7.789  -32.281 20.067  1.00 105.26 ?  474 ASN A H      1 
ATOM 7356  H HA     . ASN A 1 470 ? -9.660  -30.781 18.834  1.00 104.31 ?  474 ASN A HA     1 
ATOM 7357  H HB2    . ASN A 1 470 ? -10.800 -30.238 20.714  1.00 101.56 ?  474 ASN A HB2    1 
ATOM 7358  H HB3    . ASN A 1 470 ? -10.677 -31.821 20.782  1.00 101.56 ?  474 ASN A HB3    1 
ATOM 7359  H HD21   . ASN A 1 470 ? -9.865  -30.127 23.889  1.00 93.02  ?  474 ASN A HD21   1 
ATOM 7360  H HD22   . ASN A 1 470 ? -10.968 -29.878 22.919  1.00 93.02  ?  474 ASN A HD22   1 
ATOM 7361  N N      . GLU A 1 471 ? -8.660  -28.607 19.883  1.00 77.41  ?  475 GLU A N      1 
ATOM 7362  C CA     . GLU A 1 471 ? -7.773  -27.457 20.007  1.00 83.40  ?  475 GLU A CA     1 
ATOM 7363  C C      . GLU A 1 471 ? -7.067  -27.451 21.357  1.00 76.38  ?  475 GLU A C      1 
ATOM 7364  O O      . GLU A 1 471 ? -5.834  -27.389 21.421  1.00 74.74  ?  475 GLU A O      1 
ATOM 7365  C CB     . GLU A 1 471 ? -8.561  -26.163 19.808  1.00 92.77  ?  475 GLU A CB     1 
ATOM 7366  C CG     . GLU A 1 471 ? -7.730  -25.020 19.247  1.00 81.66  ?  475 GLU A CG     1 
ATOM 7367  C CD     . GLU A 1 471 ? -8.401  -23.672 19.409  1.00 85.40  ?  475 GLU A CD     1 
ATOM 7368  O OE1    . GLU A 1 471 ? -9.077  -23.460 20.437  1.00 85.17  ?  475 GLU A OE1    1 
ATOM 7369  O OE2    . GLU A 1 471 ? -8.252  -22.822 18.507  1.00 91.15  -1 475 GLU A OE2    1 
ATOM 7370  H H      . GLU A 1 471 ? -9.496  -28.411 19.827  1.00 92.89  ?  475 GLU A H      1 
ATOM 7371  H HA     . GLU A 1 471 ? -7.095  -27.504 19.314  1.00 100.08 ?  475 GLU A HA     1 
ATOM 7372  H HB2    . GLU A 1 471 ? -9.289  -26.332 19.189  1.00 111.32 ?  475 GLU A HB2    1 
ATOM 7373  H HB3    . GLU A 1 471 ? -8.917  -25.879 20.664  1.00 111.32 ?  475 GLU A HB3    1 
ATOM 7374  H HG2    . GLU A 1 471 ? -6.880  -24.990 19.714  1.00 97.99  ?  475 GLU A HG2    1 
ATOM 7375  H HG3    . GLU A 1 471 ? -7.584  -25.171 18.300  1.00 97.99  ?  475 GLU A HG3    1 
ATOM 7376  N N      . LYS A 1 472 ? -7.835  -27.517 22.449  1.00 77.96  ?  476 LYS A N      1 
ATOM 7377  C CA     . LYS A 1 472 ? -7.238  -27.463 23.780  1.00 77.01  ?  476 LYS A CA     1 
ATOM 7378  C C      . LYS A 1 472 ? -6.081  -28.442 23.901  1.00 74.07  ?  476 LYS A C      1 
ATOM 7379  O O      . LYS A 1 472 ? -5.029  -28.106 24.455  1.00 67.87  ?  476 LYS A O      1 
ATOM 7380  C CB     . LYS A 1 472 ? -8.292  -27.749 24.849  1.00 82.96  ?  476 LYS A CB     1 
ATOM 7381  C CG     . LYS A 1 472 ? -9.368  -26.679 24.955  1.00 88.14  ?  476 LYS A CG     1 
ATOM 7382  C CD     . LYS A 1 472 ? -10.196 -26.819 26.226  1.00 84.60  ?  476 LYS A CD     1 
ATOM 7383  C CE     . LYS A 1 472 ? -9.393  -26.452 27.465  1.00 89.79  ?  476 LYS A CE     1 
ATOM 7384  N NZ     . LYS A 1 472 ? -10.245 -26.373 28.684  1.00 84.80  1  476 LYS A NZ     1 
ATOM 7385  H H      . LYS A 1 472 ? -8.692  -27.592 22.444  1.00 93.55  ?  476 LYS A H      1 
ATOM 7386  H HA     . LYS A 1 472 ? -6.891  -26.570 23.933  1.00 92.41  ?  476 LYS A HA     1 
ATOM 7387  H HB2    . LYS A 1 472 ? -8.729  -28.589 24.640  1.00 99.56  ?  476 LYS A HB2    1 
ATOM 7388  H HB3    . LYS A 1 472 ? -7.852  -27.814 25.712  1.00 99.56  ?  476 LYS A HB3    1 
ATOM 7389  H HG2    . LYS A 1 472 ? -8.947  -25.805 24.964  1.00 105.77 ?  476 LYS A HG2    1 
ATOM 7390  H HG3    . LYS A 1 472 ? -9.966  -26.754 24.195  1.00 105.77 ?  476 LYS A HG3    1 
ATOM 7391  H HD2    . LYS A 1 472 ? -10.963 -26.227 26.174  1.00 101.52 ?  476 LYS A HD2    1 
ATOM 7392  H HD3    . LYS A 1 472 ? -10.489 -27.740 26.316  1.00 101.52 ?  476 LYS A HD3    1 
ATOM 7393  H HE2    . LYS A 1 472 ? -8.713  -27.127 27.615  1.00 107.75 ?  476 LYS A HE2    1 
ATOM 7394  H HE3    . LYS A 1 472 ? -8.979  -25.585 27.330  1.00 107.75 ?  476 LYS A HE3    1 
ATOM 7395  H HZ1    . LYS A 1 472 ? -9.747  -26.157 29.389  1.00 101.77 ?  476 LYS A HZ1    1 
ATOM 7396  H HZ2    . LYS A 1 472 ? -10.876 -25.755 28.574  1.00 101.77 ?  476 LYS A HZ2    1 
ATOM 7397  H HZ3    . LYS A 1 472 ? -10.633 -27.160 28.834  1.00 101.77 ?  476 LYS A HZ3    1 
ATOM 7398  N N      . ASP A 1 473 ? -6.251  -29.657 23.379  1.00 76.53  ?  477 ASP A N      1 
ATOM 7399  C CA     . ASP A 1 473 ? -5.145  -30.604 23.350  1.00 73.61  ?  477 ASP A CA     1 
ATOM 7400  C C      . ASP A 1 473 ? -3.930  -29.979 22.675  1.00 69.72  ?  477 ASP A C      1 
ATOM 7401  O O      . ASP A 1 473 ? -2.868  -29.836 23.287  1.00 68.04  ?  477 ASP A O      1 
ATOM 7402  C CB     . ASP A 1 473 ? -5.571  -31.886 22.632  1.00 80.08  ?  477 ASP A CB     1 
ATOM 7403  C CG     . ASP A 1 473 ? -4.475  -32.931 22.608  1.00 80.17  ?  477 ASP A CG     1 
ATOM 7404  O OD1    . ASP A 1 473 ? -3.720  -33.019 23.598  1.00 71.88  ?  477 ASP A OD1    1 
ATOM 7405  O OD2    . ASP A 1 473 ? -4.368  -33.663 21.603  1.00 74.37  -1 477 ASP A OD2    1 
ATOM 7406  H H      . ASP A 1 473 ? -6.985  -29.950 23.041  1.00 91.84  ?  477 ASP A H      1 
ATOM 7407  H HA     . ASP A 1 473 ? -4.900  -30.835 24.259  1.00 88.33  ?  477 ASP A HA     1 
ATOM 7408  H HB2    . ASP A 1 473 ? -6.338  -32.265 23.089  1.00 96.09  ?  477 ASP A HB2    1 
ATOM 7409  H HB3    . ASP A 1 473 ? -5.803  -31.673 21.715  1.00 96.09  ?  477 ASP A HB3    1 
ATOM 7410  N N      . PHE A 1 474 ? -4.090  -29.561 21.417  1.00 70.54  ?  478 PHE A N      1 
ATOM 7411  C CA     . PHE A 1 474 ? -2.968  -29.003 20.668  1.00 73.03  ?  478 PHE A CA     1 
ATOM 7412  C C      . PHE A 1 474 ? -2.277  -27.893 21.447  1.00 69.39  ?  478 PHE A C      1 
ATOM 7413  O O      . PHE A 1 474 ? -1.043  -27.830 21.495  1.00 62.18  ?  478 PHE A O      1 
ATOM 7414  C CB     . PHE A 1 474 ? -3.451  -28.480 19.316  1.00 72.53  ?  478 PHE A CB     1 
ATOM 7415  C CG     . PHE A 1 474 ? -2.435  -27.649 18.592  1.00 65.89  ?  478 PHE A CG     1 
ATOM 7416  C CD1    . PHE A 1 474 ? -1.179  -28.157 18.308  1.00 72.20  ?  478 PHE A CD1    1 
ATOM 7417  C CD2    . PHE A 1 474 ? -2.737  -26.362 18.189  1.00 68.18  ?  478 PHE A CD2    1 
ATOM 7418  C CE1    . PHE A 1 474 ? -0.243  -27.392 17.640  1.00 60.04  ?  478 PHE A CE1    1 
ATOM 7419  C CE2    . PHE A 1 474 ? -1.806  -25.595 17.521  1.00 69.36  ?  478 PHE A CE2    1 
ATOM 7420  C CZ     . PHE A 1 474 ? -0.558  -26.111 17.246  1.00 62.55  ?  478 PHE A CZ     1 
ATOM 7421  H H      . PHE A 1 474 ? -4.830  -29.590 20.980  1.00 84.65  ?  478 PHE A H      1 
ATOM 7422  H HA     . PHE A 1 474 ? -2.317  -29.703 20.504  1.00 87.64  ?  478 PHE A HA     1 
ATOM 7423  H HB2    . PHE A 1 474 ? -3.674  -29.235 18.750  1.00 87.04  ?  478 PHE A HB2    1 
ATOM 7424  H HB3    . PHE A 1 474 ? -4.238  -27.930 19.457  1.00 87.04  ?  478 PHE A HB3    1 
ATOM 7425  H HD1    . PHE A 1 474 ? -0.962  -29.021 18.573  1.00 86.64  ?  478 PHE A HD1    1 
ATOM 7426  H HD2    . PHE A 1 474 ? -3.578  -26.008 18.373  1.00 81.81  ?  478 PHE A HD2    1 
ATOM 7427  H HE1    . PHE A 1 474 ? 0.598   -27.743 17.455  1.00 72.05  ?  478 PHE A HE1    1 
ATOM 7428  H HE2    . PHE A 1 474 ? -2.020  -24.729 17.256  1.00 83.23  ?  478 PHE A HE2    1 
ATOM 7429  H HZ     . PHE A 1 474 ? 0.070   -25.595 16.796  1.00 75.06  ?  478 PHE A HZ     1 
ATOM 7430  N N      . VAL A 1 475 ? -3.058  -27.008 22.067  1.00 73.70  ?  479 VAL A N      1 
ATOM 7431  C CA     . VAL A 1 475 ? -2.475  -25.925 22.853  1.00 59.39  ?  479 VAL A CA     1 
ATOM 7432  C C      . VAL A 1 475 ? -1.643  -26.495 23.995  1.00 65.83  ?  479 VAL A C      1 
ATOM 7433  O O      . VAL A 1 475 ? -0.457  -26.181 24.140  1.00 63.46  ?  479 VAL A O      1 
ATOM 7434  C CB     . VAL A 1 475 ? -3.577  -24.985 23.373  1.00 60.80  ?  479 VAL A CB     1 
ATOM 7435  C CG1    . VAL A 1 475 ? -2.973  -23.829 24.156  1.00 72.55  ?  479 VAL A CG1    1 
ATOM 7436  C CG2    . VAL A 1 475 ? -4.418  -24.455 22.219  1.00 67.49  ?  479 VAL A CG2    1 
ATOM 7437  H H      . VAL A 1 475 ? -3.917  -27.014 22.049  1.00 88.44  ?  479 VAL A H      1 
ATOM 7438  H HA     . VAL A 1 475 ? -1.885  -25.407 22.284  1.00 71.27  ?  479 VAL A HA     1 
ATOM 7439  H HB     . VAL A 1 475 ? -4.161  -25.480 23.969  1.00 72.96  ?  479 VAL A HB     1 
ATOM 7440  H HG11   . VAL A 1 475 ? -3.687  -23.254 24.471  1.00 87.06  ?  479 VAL A HG11   1 
ATOM 7441  H HG12   . VAL A 1 475 ? -2.477  -24.185 24.910  1.00 87.06  ?  479 VAL A HG12   1 
ATOM 7442  H HG13   . VAL A 1 475 ? -2.379  -23.331 23.573  1.00 87.06  ?  479 VAL A HG13   1 
ATOM 7443  H HG21   . VAL A 1 475 ? -5.103  -23.867 22.573  1.00 80.99  ?  479 VAL A HG21   1 
ATOM 7444  H HG22   . VAL A 1 475 ? -3.844  -23.966 21.610  1.00 80.99  ?  479 VAL A HG22   1 
ATOM 7445  H HG23   . VAL A 1 475 ? -4.829  -25.203 21.759  1.00 80.99  ?  479 VAL A HG23   1 
ATOM 7446  N N      . THR A 1 476 ? -2.252  -27.357 24.811  1.00 73.86  ?  480 THR A N      1 
ATOM 7447  C CA     . THR A 1 476 ? -1.577  -27.876 25.996  1.00 69.50  ?  480 THR A CA     1 
ATOM 7448  C C      . THR A 1 476 ? -0.218  -28.469 25.648  1.00 67.16  ?  480 THR A C      1 
ATOM 7449  O O      . THR A 1 476 ? 0.799   -28.127 26.262  1.00 67.71  ?  480 THR A O      1 
ATOM 7450  C CB     . THR A 1 476 ? -2.453  -28.927 26.677  1.00 64.90  ?  480 THR A CB     1 
ATOM 7451  O OG1    . THR A 1 476 ? -2.824  -29.931 25.725  1.00 80.20  ?  480 THR A OG1    1 
ATOM 7452  C CG2    . THR A 1 476 ? -3.702  -28.292 27.258  1.00 59.90  ?  480 THR A CG2    1 
ATOM 7453  H H      . THR A 1 476 ? -3.052  -27.655 24.700  1.00 88.63  ?  480 THR A H      1 
ATOM 7454  H HA     . THR A 1 476 ? -1.436  -27.150 26.624  1.00 83.40  ?  480 THR A HA     1 
ATOM 7455  H HB     . THR A 1 476 ? -1.955  -29.340 27.400  1.00 77.88  ?  480 THR A HB     1 
ATOM 7456  H HG1    . THR A 1 476 ? -3.253  -29.582 25.092  1.00 96.24  ?  480 THR A HG1    1 
ATOM 7457  H HG21   . THR A 1 476 ? -4.249  -28.969 27.687  1.00 71.88  ?  480 THR A HG21   1 
ATOM 7458  H HG22   . THR A 1 476 ? -3.458  -27.621 27.915  1.00 71.88  ?  480 THR A HG22   1 
ATOM 7459  H HG23   . THR A 1 476 ? -4.217  -27.870 26.553  1.00 71.88  ?  480 THR A HG23   1 
ATOM 7460  N N      . MET A 1 477 ? -0.180  -29.366 24.661  1.00 65.64  ?  481 MET A N      1 
ATOM 7461  C CA     . MET A 1 477 ? 1.073   -30.028 24.317  1.00 69.06  ?  481 MET A CA     1 
ATOM 7462  C C      . MET A 1 477 ? 2.124   -29.006 23.909  1.00 69.44  ?  481 MET A C      1 
ATOM 7463  O O      . MET A 1 477 ? 3.261   -29.037 24.392  1.00 55.75  ?  481 MET A O      1 
ATOM 7464  C CB     . MET A 1 477 ? 0.852   -31.040 23.193  1.00 66.68  ?  481 MET A CB     1 
ATOM 7465  C CG     . MET A 1 477 ? -0.446  -31.827 23.295  1.00 77.90  ?  481 MET A CG     1 
ATOM 7466  S SD     . MET A 1 477 ? -0.572  -33.166 22.104  1.00 85.37  ?  481 MET A SD     1 
ATOM 7467  C CE     . MET A 1 477 ? 0.664   -34.266 22.763  1.00 71.47  ?  481 MET A CE     1 
ATOM 7468  H H      . MET A 1 477 ? -0.855  -29.604 24.184  1.00 78.77  ?  481 MET A H      1 
ATOM 7469  H HA     . MET A 1 477 ? 1.394   -30.512 25.094  1.00 82.88  ?  481 MET A HA     1 
ATOM 7470  H HB2    . MET A 1 477 ? 0.843   -30.566 22.347  1.00 80.02  ?  481 MET A HB2    1 
ATOM 7471  H HB3    . MET A 1 477 ? 1.584   -31.677 23.202  1.00 80.02  ?  481 MET A HB3    1 
ATOM 7472  H HG2    . MET A 1 477 ? -0.510  -32.212 24.183  1.00 93.48  ?  481 MET A HG2    1 
ATOM 7473  H HG3    . MET A 1 477 ? -1.190  -31.223 23.144  1.00 93.48  ?  481 MET A HG3    1 
ATOM 7474  H HE1    . MET A 1 477 ? 1.521   -33.813 22.765  1.00 85.76  ?  481 MET A HE1    1 
ATOM 7475  H HE2    . MET A 1 477 ? 0.417   -34.512 23.668  1.00 85.76  ?  481 MET A HE2    1 
ATOM 7476  H HE3    . MET A 1 477 ? 0.710   -35.059 22.206  1.00 85.76  ?  481 MET A HE3    1 
ATOM 7477  N N      . ALA A 1 478 ? 1.754   -28.086 23.019  1.00 73.24  ?  482 ALA A N      1 
ATOM 7478  C CA     . ALA A 1 478 ? 2.685   -27.046 22.601  1.00 67.47  ?  482 ALA A CA     1 
ATOM 7479  C C      . ALA A 1 478 ? 3.189   -26.256 23.801  1.00 76.47  ?  482 ALA A C      1 
ATOM 7480  O O      . ALA A 1 478 ? 4.401   -26.125 24.007  1.00 74.64  ?  482 ALA A O      1 
ATOM 7481  C CB     . ALA A 1 478 ? 2.009   -26.123 21.590  1.00 72.23  ?  482 ALA A CB     1 
ATOM 7482  H H      . ALA A 1 478 ? 0.979   -28.044 22.647  1.00 87.89  ?  482 ALA A H      1 
ATOM 7483  H HA     . ALA A 1 478 ? 3.450   -27.458 22.169  1.00 80.97  ?  482 ALA A HA     1 
ATOM 7484  H HB1    . ALA A 1 478 ? 2.638   -25.436 21.320  1.00 86.67  ?  482 ALA A HB1    1 
ATOM 7485  H HB2    . ALA A 1 478 ? 1.738   -26.645 20.819  1.00 86.67  ?  482 ALA A HB2    1 
ATOM 7486  H HB3    . ALA A 1 478 ? 1.232   -25.717 22.005  1.00 86.67  ?  482 ALA A HB3    1 
ATOM 7487  N N      . ILE A 1 479 ? 2.269   -25.731 24.614  1.00 81.78  ?  483 ILE A N      1 
ATOM 7488  C CA     . ILE A 1 479 ? 2.661   -24.938 25.777  1.00 77.49  ?  483 ILE A CA     1 
ATOM 7489  C C      . ILE A 1 479 ? 3.670   -25.701 26.623  1.00 75.98  ?  483 ILE A C      1 
ATOM 7490  O O      . ILE A 1 479 ? 4.665   -25.136 27.091  1.00 74.69  ?  483 ILE A O      1 
ATOM 7491  C CB     . ILE A 1 479 ? 1.419   -24.546 26.601  1.00 78.95  ?  483 ILE A CB     1 
ATOM 7492  C CG1    . ILE A 1 479 ? 0.467   -23.679 25.768  1.00 66.60  ?  483 ILE A CG1    1 
ATOM 7493  C CG2    . ILE A 1 479 ? 1.822   -23.823 27.883  1.00 72.78  ?  483 ILE A CG2    1 
ATOM 7494  C CD1    . ILE A 1 479 ? 0.995   -22.301 25.428  1.00 62.77  ?  483 ILE A CD1    1 
ATOM 7495  H H      . ILE A 1 479 ? 1.419   -25.819 24.514  1.00 98.14  ?  483 ILE A H      1 
ATOM 7496  H HA     . ILE A 1 479 ? 3.085   -24.121 25.471  1.00 92.99  ?  483 ILE A HA     1 
ATOM 7497  H HB     . ILE A 1 479 ? 0.950   -25.359 26.847  1.00 94.74  ?  483 ILE A HB     1 
ATOM 7498  H HG12   . ILE A 1 479 ? 0.283   -24.137 24.933  1.00 79.92  ?  483 ILE A HG12   1 
ATOM 7499  H HG13   . ILE A 1 479 ? -0.358  -23.562 26.265  1.00 79.92  ?  483 ILE A HG13   1 
ATOM 7500  H HG21   . ILE A 1 479 ? 1.022   -23.589 28.378  1.00 87.34  ?  483 ILE A HG21   1 
ATOM 7501  H HG22   . ILE A 1 479 ? 2.381   -24.411 28.414  1.00 87.34  ?  483 ILE A HG22   1 
ATOM 7502  H HG23   . ILE A 1 479 ? 2.314   -23.019 27.650  1.00 87.34  ?  483 ILE A HG23   1 
ATOM 7503  H HD11   . ILE A 1 479 ? 0.329   -21.829 24.903  1.00 75.33  ?  483 ILE A HD11   1 
ATOM 7504  H HD12   . ILE A 1 479 ? 1.172   -21.818 26.250  1.00 75.33  ?  483 ILE A HD12   1 
ATOM 7505  H HD13   . ILE A 1 479 ? 1.814   -22.394 24.916  1.00 75.33  ?  483 ILE A HD13   1 
ATOM 7506  N N      . GLU A 1 480 ? 3.431   -26.997 26.830  1.00 68.55  ?  484 GLU A N      1 
ATOM 7507  C CA     . GLU A 1 480 ? 4.335   -27.788 27.658  1.00 63.78  ?  484 GLU A CA     1 
ATOM 7508  C C      . GLU A 1 480 ? 5.745   -27.776 27.084  1.00 56.81  ?  484 GLU A C      1 
ATOM 7509  O O      . GLU A 1 480 ? 6.724   -27.591 27.815  1.00 59.67  ?  484 GLU A O      1 
ATOM 7510  C CB     . GLU A 1 480 ? 3.819   -29.221 27.784  1.00 72.71  ?  484 GLU A CB     1 
ATOM 7511  C CG     . GLU A 1 480 ? 4.366   -29.959 28.998  1.00 88.13  ?  484 GLU A CG     1 
ATOM 7512  C CD     . GLU A 1 480 ? 4.159   -31.460 28.920  1.00 98.31  ?  484 GLU A CD     1 
ATOM 7513  O OE1    . GLU A 1 480 ? 3.496   -31.925 27.970  1.00 86.82  ?  484 GLU A OE1    1 
ATOM 7514  O OE2    . GLU A 1 480 ? 4.664   -32.176 29.811  1.00 88.86  -1 484 GLU A OE2    1 
ATOM 7515  H H      . GLU A 1 480 ? 2.764   -27.434 26.507  1.00 82.26  ?  484 GLU A H      1 
ATOM 7516  H HA     . GLU A 1 480 ? 4.369   -27.401 28.547  1.00 76.54  ?  484 GLU A HA     1 
ATOM 7517  H HB2    . GLU A 1 480 ? 2.852   -29.200 27.860  1.00 87.25  ?  484 GLU A HB2    1 
ATOM 7518  H HB3    . GLU A 1 480 ? 4.077   -29.718 26.992  1.00 87.25  ?  484 GLU A HB3    1 
ATOM 7519  H HG2    . GLU A 1 480 ? 5.319   -29.792 29.066  1.00 105.76 ?  484 GLU A HG2    1 
ATOM 7520  H HG3    . GLU A 1 480 ? 3.915   -29.636 29.794  1.00 105.76 ?  484 GLU A HG3    1 
ATOM 7521  N N      . ILE A 1 481 ? 5.867   -27.968 25.769  1.00 60.21  ?  485 ILE A N      1 
ATOM 7522  C CA     . ILE A 1 481 ? 7.184   -27.932 25.141  1.00 61.32  ?  485 ILE A CA     1 
ATOM 7523  C C      . ILE A 1 481 ? 7.808   -26.557 25.315  1.00 60.54  ?  485 ILE A C      1 
ATOM 7524  O O      . ILE A 1 481 ? 9.020   -26.428 25.525  1.00 64.69  ?  485 ILE A O      1 
ATOM 7525  C CB     . ILE A 1 481 ? 7.084   -28.317 23.653  1.00 51.58  ?  485 ILE A CB     1 
ATOM 7526  C CG1    . ILE A 1 481 ? 6.433   -29.693 23.498  1.00 47.21  ?  485 ILE A CG1    1 
ATOM 7527  C CG2    . ILE A 1 481 ? 8.471   -28.314 23.016  1.00 53.53  ?  485 ILE A CG2    1 
ATOM 7528  C CD1    . ILE A 1 481 ? 6.146   -30.079 22.065  1.00 49.33  ?  485 ILE A CD1    1 
ATOM 7529  H H      . ILE A 1 481 ? 5.215   -28.118 25.229  1.00 72.26  ?  485 ILE A H      1 
ATOM 7530  H HA     . ILE A 1 481 ? 7.759   -28.579 25.579  1.00 73.58  ?  485 ILE A HA     1 
ATOM 7531  H HB     . ILE A 1 481 ? 6.533   -27.661 23.199  1.00 61.90  ?  485 ILE A HB     1 
ATOM 7532  H HG12   . ILE A 1 481 ? 7.027   -30.363 23.872  1.00 56.65  ?  485 ILE A HG12   1 
ATOM 7533  H HG13   . ILE A 1 481 ? 5.591   -29.696 23.980  1.00 56.65  ?  485 ILE A HG13   1 
ATOM 7534  H HG21   . ILE A 1 481 ? 8.389   -28.558 22.081  1.00 64.23  ?  485 ILE A HG21   1 
ATOM 7535  H HG22   . ILE A 1 481 ? 8.852   -27.425 23.094  1.00 64.23  ?  485 ILE A HG22   1 
ATOM 7536  H HG23   . ILE A 1 481 ? 9.032   -28.956 23.479  1.00 64.23  ?  485 ILE A HG23   1 
ATOM 7537  H HD11   . ILE A 1 481 ? 5.736   -30.958 22.051  1.00 59.20  ?  485 ILE A HD11   1 
ATOM 7538  H HD12   . ILE A 1 481 ? 5.542   -29.426 21.678  1.00 59.20  ?  485 ILE A HD12   1 
ATOM 7539  H HD13   . ILE A 1 481 ? 6.979   -30.094 21.569  1.00 59.20  ?  485 ILE A HD13   1 
ATOM 7540  N N      . ILE A 1 482 ? 6.991   -25.508 25.234  1.00 66.92  ?  486 ILE A N      1 
ATOM 7541  C CA     . ILE A 1 482 ? 7.508   -24.152 25.364  1.00 71.48  ?  486 ILE A CA     1 
ATOM 7542  C C      . ILE A 1 482 ? 8.048   -23.924 26.770  1.00 67.11  ?  486 ILE A C      1 
ATOM 7543  O O      . ILE A 1 482 ? 9.177   -23.455 26.951  1.00 56.18  ?  486 ILE A O      1 
ATOM 7544  C CB     . ILE A 1 482 ? 6.417   -23.130 24.997  1.00 62.99  ?  486 ILE A CB     1 
ATOM 7545  C CG1    . ILE A 1 482 ? 5.994   -23.324 23.538  1.00 66.42  ?  486 ILE A CG1    1 
ATOM 7546  C CG2    . ILE A 1 482 ? 6.922   -21.712 25.219  1.00 67.72  ?  486 ILE A CG2    1 
ATOM 7547  C CD1    . ILE A 1 482 ? 4.879   -22.405 23.071  1.00 67.59  ?  486 ILE A CD1    1 
ATOM 7548  H H      . ILE A 1 482 ? 6.142   -25.555 25.104  1.00 80.30  ?  486 ILE A H      1 
ATOM 7549  H HA     . ILE A 1 482 ? 8.244   -24.036 24.742  1.00 85.77  ?  486 ILE A HA     1 
ATOM 7550  H HB     . ILE A 1 482 ? 5.647   -23.279 25.567  1.00 75.59  ?  486 ILE A HB     1 
ATOM 7551  H HG12   . ILE A 1 482 ? 6.763   -23.163 22.969  1.00 79.70  ?  486 ILE A HG12   1 
ATOM 7552  H HG13   . ILE A 1 482 ? 5.689   -24.237 23.423  1.00 79.70  ?  486 ILE A HG13   1 
ATOM 7553  H HG21   . ILE A 1 482 ? 6.220   -21.087 24.983  1.00 81.26  ?  486 ILE A HG21   1 
ATOM 7554  H HG22   . ILE A 1 482 ? 7.160   -21.605 26.153  1.00 81.26  ?  486 ILE A HG22   1 
ATOM 7555  H HG23   . ILE A 1 482 ? 7.701   -21.564 24.660  1.00 81.26  ?  486 ILE A HG23   1 
ATOM 7556  H HD11   . ILE A 1 482 ? 4.680   -22.599 22.142  1.00 81.10  ?  486 ILE A HD11   1 
ATOM 7557  H HD12   . ILE A 1 482 ? 4.093   -22.560 23.618  1.00 81.10  ?  486 ILE A HD12   1 
ATOM 7558  H HD13   . ILE A 1 482 ? 5.170   -21.484 23.163  1.00 81.10  ?  486 ILE A HD13   1 
ATOM 7559  N N      . ASN A 1 483 ? 7.253   -24.260 27.787  1.00 68.48  ?  487 ASN A N      1 
ATOM 7560  C CA     . ASN A 1 483 ? 7.673   -24.012 29.162  1.00 61.05  ?  487 ASN A CA     1 
ATOM 7561  C C      . ASN A 1 483 ? 8.883   -24.857 29.535  1.00 60.24  ?  487 ASN A C      1 
ATOM 7562  O O      . ASN A 1 483 ? 9.756   -24.403 30.283  1.00 61.96  ?  487 ASN A O      1 
ATOM 7563  C CB     . ASN A 1 483 ? 6.515   -24.284 30.119  1.00 50.01  ?  487 ASN A CB     1 
ATOM 7564  C CG     . ASN A 1 483 ? 5.496   -23.168 30.126  1.00 44.10  ?  487 ASN A CG     1 
ATOM 7565  O OD1    . ASN A 1 483 ? 4.459   -23.255 29.471  1.00 45.12  ?  487 ASN A OD1    1 
ATOM 7566  N ND2    . ASN A 1 483 ? 5.791   -22.105 30.863  1.00 56.28  ?  487 ASN A ND2    1 
ATOM 7567  H H      . ASN A 1 483 ? 6.479   -24.627 27.708  1.00 82.18  ?  487 ASN A H      1 
ATOM 7568  H HA     . ASN A 1 483 ? 7.921   -23.079 29.251  1.00 73.26  ?  487 ASN A HA     1 
ATOM 7569  H HB2    . ASN A 1 483 ? 6.065   -25.100 29.849  1.00 60.01  ?  487 ASN A HB2    1 
ATOM 7570  H HB3    . ASN A 1 483 ? 6.864   -24.378 31.019  1.00 60.01  ?  487 ASN A HB3    1 
ATOM 7571  H HD21   . ASN A 1 483 ? 5.244   -21.442 30.901  1.00 67.54  ?  487 ASN A HD21   1 
ATOM 7572  H HD22   . ASN A 1 483 ? 6.530   -22.078 31.303  1.00 67.54  ?  487 ASN A HD22   1 
ATOM 7573  N N      . ASP A 1 484 ? 8.955   -26.089 29.028  1.00 71.93  ?  488 ASP A N      1 
ATOM 7574  C CA     . ASP A 1 484 ? 10.085  -26.952 29.350  1.00 76.88  ?  488 ASP A CA     1 
ATOM 7575  C C      . ASP A 1 484 ? 11.393  -26.332 28.877  1.00 78.09  ?  488 ASP A C      1 
ATOM 7576  O O      . ASP A 1 484 ? 12.364  -26.245 29.636  1.00 79.67  ?  488 ASP A O      1 
ATOM 7577  C CB     . ASP A 1 484 ? 9.883   -28.334 28.730  1.00 67.04  ?  488 ASP A CB     1 
ATOM 7578  C CG     . ASP A 1 484 ? 8.686   -29.058 29.306  1.00 77.42  ?  488 ASP A CG     1 
ATOM 7579  O OD1    . ASP A 1 484 ? 8.403   -28.876 30.509  1.00 63.39  ?  488 ASP A OD1    1 
ATOM 7580  O OD2    . ASP A 1 484 ? 8.022   -29.803 28.557  1.00 86.45  -1 488 ASP A OD2    1 
ATOM 7581  H H      . ASP A 1 484 ? 8.371   -26.441 28.503  1.00 86.32  ?  488 ASP A H      1 
ATOM 7582  H HA     . ASP A 1 484 ? 10.136  -27.060 30.313  1.00 92.25  ?  488 ASP A HA     1 
ATOM 7583  H HB2    . ASP A 1 484 ? 9.744   -28.235 27.775  1.00 80.45  ?  488 ASP A HB2    1 
ATOM 7584  H HB3    . ASP A 1 484 ? 10.671  -28.874 28.897  1.00 80.45  ?  488 ASP A HB3    1 
ATOM 7585  N N      . ILE A 1 485 ? 11.434  -25.888 27.619  1.00 81.04  ?  489 ILE A N      1 
ATOM 7586  C CA     . ILE A 1 485 ? 12.629  -25.220 27.117  1.00 82.51  ?  489 ILE A CA     1 
ATOM 7587  C C      . ILE A 1 485 ? 12.884  -23.950 27.912  1.00 76.80  ?  489 ILE A C      1 
ATOM 7588  O O      . ILE A 1 485 ? 14.038  -23.569 28.144  1.00 77.82  ?  489 ILE A O      1 
ATOM 7589  C CB     . ILE A 1 485 ? 12.493  -24.923 25.610  1.00 76.23  ?  489 ILE A CB     1 
ATOM 7590  C CG1    . ILE A 1 485 ? 12.135  -26.195 24.837  1.00 74.72  ?  489 ILE A CG1    1 
ATOM 7591  C CG2    . ILE A 1 485 ? 13.795  -24.355 25.074  1.00 67.69  ?  489 ILE A CG2    1 
ATOM 7592  C CD1    . ILE A 1 485 ? 11.746  -25.948 23.396  1.00 73.20  ?  489 ILE A CD1    1 
ATOM 7593  H H      . ILE A 1 485 ? 10.795  -25.960 27.048  1.00 97.24  ?  489 ILE A H      1 
ATOM 7594  H HA     . ILE A 1 485 ? 13.392  -25.806 27.238  1.00 99.01  ?  489 ILE A HA     1 
ATOM 7595  H HB     . ILE A 1 485 ? 11.789  -24.269 25.482  1.00 91.47  ?  489 ILE A HB     1 
ATOM 7596  H HG12   . ILE A 1 485 ? 12.902  -26.788 24.839  1.00 89.66  ?  489 ILE A HG12   1 
ATOM 7597  H HG13   . ILE A 1 485 ? 11.385  -26.626 25.276  1.00 89.66  ?  489 ILE A HG13   1 
ATOM 7598  H HG21   . ILE A 1 485 ? 13.694  -24.174 24.127  1.00 81.23  ?  489 ILE A HG21   1 
ATOM 7599  H HG22   . ILE A 1 485 ? 14.000  -23.534 25.548  1.00 81.23  ?  489 ILE A HG22   1 
ATOM 7600  H HG23   . ILE A 1 485 ? 14.503  -25.003 25.214  1.00 81.23  ?  489 ILE A HG23   1 
ATOM 7601  H HD11   . ILE A 1 485 ? 11.534  -26.797 22.977  1.00 87.85  ?  489 ILE A HD11   1 
ATOM 7602  H HD12   . ILE A 1 485 ? 10.971  -25.366 23.374  1.00 87.85  ?  489 ILE A HD12   1 
ATOM 7603  H HD13   . ILE A 1 485 ? 12.489  -25.528 22.936  1.00 87.85  ?  489 ILE A HD13   1 
ATOM 7604  N N      . ARG A 1 486 ? 11.817  -23.278 28.344  1.00 72.82  ?  490 ARG A N      1 
ATOM 7605  C CA     . ARG A 1 486 ? 11.968  -22.107 29.198  1.00 74.28  ?  490 ARG A CA     1 
ATOM 7606  C C      . ARG A 1 486 ? 12.569  -22.489 30.543  1.00 80.82  ?  490 ARG A C      1 
ATOM 7607  O O      . ARG A 1 486 ? 13.561  -21.900 30.986  1.00 77.22  ?  490 ARG A O      1 
ATOM 7608  C CB     . ARG A 1 486 ? 10.609  -21.431 29.388  1.00 68.68  ?  490 ARG A CB     1 
ATOM 7609  C CG     . ARG A 1 486 ? 10.562  -20.406 30.512  1.00 65.45  ?  490 ARG A CG     1 
ATOM 7610  C CD     . ARG A 1 486 ? 9.180   -19.800 30.648  1.00 55.81  ?  490 ARG A CD     1 
ATOM 7611  N NE     . ARG A 1 486 ? 9.237   -18.471 31.246  1.00 84.71  ?  490 ARG A NE     1 
ATOM 7612  C CZ     . ARG A 1 486 ? 9.228   -18.220 32.552  1.00 96.33  ?  490 ARG A CZ     1 
ATOM 7613  N NH1    . ARG A 1 486 ? 9.290   -16.966 32.978  1.00 101.22 1  490 ARG A NH1    1 
ATOM 7614  N NH2    . ARG A 1 486 ? 9.157   -19.211 33.433  1.00 77.49  ?  490 ARG A NH2    1 
ATOM 7615  H H      . ARG A 1 486 ? 11.002  -23.480 28.157  1.00 87.39  ?  490 ARG A H      1 
ATOM 7616  H HA     . ARG A 1 486 ? 12.564  -21.473 28.769  1.00 89.14  ?  490 ARG A HA     1 
ATOM 7617  H HB2    . ARG A 1 486 ? 10.371  -20.975 28.565  1.00 82.42  ?  490 ARG A HB2    1 
ATOM 7618  H HB3    . ARG A 1 486 ? 9.948   -22.113 29.585  1.00 82.42  ?  490 ARG A HB3    1 
ATOM 7619  H HG2    . ARG A 1 486 ? 10.790  -20.839 31.350  1.00 78.54  ?  490 ARG A HG2    1 
ATOM 7620  H HG3    . ARG A 1 486 ? 11.190  -19.692 30.321  1.00 78.54  ?  490 ARG A HG3    1 
ATOM 7621  H HD2    . ARG A 1 486 ? 8.776   -19.722 29.770  1.00 66.97  ?  490 ARG A HD2    1 
ATOM 7622  H HD3    . ARG A 1 486 ? 8.637   -20.367 31.219  1.00 66.97  ?  490 ARG A HD3    1 
ATOM 7623  H HE     . ARG A 1 486 ? 9.280   -17.797 30.712  1.00 101.65 ?  490 ARG A HE     1 
ATOM 7624  H HH11   . ARG A 1 486 ? 9.335   -16.320 32.411  1.00 121.46 ?  490 ARG A HH11   1 
ATOM 7625  H HH12   . ARG A 1 486 ? 9.282   -16.797 33.822  1.00 121.46 ?  490 ARG A HH12   1 
ATOM 7626  H HH21   . ARG A 1 486 ? 9.118   -20.026 33.161  1.00 92.99  ?  490 ARG A HH21   1 
ATOM 7627  H HH22   . ARG A 1 486 ? 9.151   -19.038 34.275  1.00 92.99  ?  490 ARG A HH22   1 
ATOM 7628  N N      . ASP A 1 487 ? 11.978  -23.483 31.208  1.00 83.99  ?  491 ASP A N      1 
ATOM 7629  C CA     . ASP A 1 487 ? 12.390  -23.817 32.565  1.00 76.66  ?  491 ASP A CA     1 
ATOM 7630  C C      . ASP A 1 487 ? 13.745  -24.511 32.594  1.00 73.64  ?  491 ASP A C      1 
ATOM 7631  O O      . ASP A 1 487 ? 14.466  -24.413 33.593  1.00 78.30  ?  491 ASP A O      1 
ATOM 7632  C CB     . ASP A 1 487 ? 11.332  -24.699 33.223  1.00 86.13  ?  491 ASP A CB     1 
ATOM 7633  C CG     . ASP A 1 487 ? 9.953   -24.081 33.174  1.00 75.34  ?  491 ASP A CG     1 
ATOM 7634  O OD1    . ASP A 1 487 ? 9.861   -22.837 33.178  1.00 77.06  ?  491 ASP A OD1    1 
ATOM 7635  O OD2    . ASP A 1 487 ? 8.960   -24.836 33.125  1.00 75.52  -1 491 ASP A OD2    1 
ATOM 7636  H H      . ASP A 1 487 ? 11.342  -23.972 30.897  1.00 100.78 ?  491 ASP A H      1 
ATOM 7637  H HA     . ASP A 1 487 ? 12.462  -23.000 33.082  1.00 91.99  ?  491 ASP A HA     1 
ATOM 7638  H HB2    . ASP A 1 487 ? 11.297  -25.551 32.760  1.00 103.36 ?  491 ASP A HB2    1 
ATOM 7639  H HB3    . ASP A 1 487 ? 11.568  -24.836 34.154  1.00 103.36 ?  491 ASP A HB3    1 
ATOM 7640  N N      . ASP A 1 488 ? 14.110  -25.211 31.519  1.00 71.92  ?  492 ASP A N      1 
ATOM 7641  C CA     . ASP A 1 488 ? 15.367  -25.949 31.517  1.00 83.43  ?  492 ASP A CA     1 
ATOM 7642  C C      . ASP A 1 488 ? 16.565  -25.023 31.667  1.00 85.21  ?  492 ASP A C      1 
ATOM 7643  O O      . ASP A 1 488 ? 17.599  -25.430 32.208  1.00 87.26  ?  492 ASP A O      1 
ATOM 7644  C CB     . ASP A 1 488 ? 15.491  -26.771 30.236  1.00 76.97  ?  492 ASP A CB     1 
ATOM 7645  C CG     . ASP A 1 488 ? 14.657  -28.033 30.273  1.00 81.81  ?  492 ASP A CG     1 
ATOM 7646  O OD1    . ASP A 1 488 ? 13.647  -28.059 31.007  1.00 77.51  ?  492 ASP A OD1    1 
ATOM 7647  O OD2    . ASP A 1 488 ? 15.012  -29.001 29.570  1.00 77.46  -1 492 ASP A OD2    1 
ATOM 7648  H H      . ASP A 1 488 ? 13.655  -25.272 30.791  1.00 86.31  ?  492 ASP A H      1 
ATOM 7649  H HA     . ASP A 1 488 ? 15.371  -26.564 32.267  1.00 100.11 ?  492 ASP A HA     1 
ATOM 7650  H HB2    . ASP A 1 488 ? 15.191  -26.234 29.486  1.00 92.36  ?  492 ASP A HB2    1 
ATOM 7651  H HB3    . ASP A 1 488 ? 16.419  -27.027 30.113  1.00 92.36  ?  492 ASP A HB3    1 
ATOM 7652  N N      . ASP A 1 489 ? 16.451  -23.781 31.200  1.00 89.84  ?  493 ASP A N      1 
ATOM 7653  C CA     . ASP A 1 489 ? 17.547  -22.828 31.315  1.00 87.91  ?  493 ASP A CA     1 
ATOM 7654  C C      . ASP A 1 489 ? 17.518  -22.081 32.640  1.00 92.47  ?  493 ASP A C      1 
ATOM 7655  O O      . ASP A 1 489 ? 18.576  -21.767 33.197  1.00 94.82  ?  493 ASP A O      1 
ATOM 7656  C CB     . ASP A 1 489 ? 17.500  -21.829 30.158  1.00 79.18  ?  493 ASP A CB     1 
ATOM 7657  C CG     . ASP A 1 489 ? 18.636  -20.832 30.208  1.00 95.67  ?  493 ASP A CG     1 
ATOM 7658  O OD1    . ASP A 1 489 ? 18.516  -19.758 29.583  1.00 98.50  ?  493 ASP A OD1    1 
ATOM 7659  O OD2    . ASP A 1 489 ? 19.649  -21.122 30.877  1.00 103.72 -1 493 ASP A OD2    1 
ATOM 7660  H H      . ASP A 1 489 ? 15.749  -23.468 30.813  1.00 107.80 ?  493 ASP A H      1 
ATOM 7661  H HA     . ASP A 1 489 ? 18.388  -23.309 31.261  1.00 105.49 ?  493 ASP A HA     1 
ATOM 7662  H HB2    . ASP A 1 489 ? 17.561  -22.313 29.319  1.00 95.02  ?  493 ASP A HB2    1 
ATOM 7663  H HB3    . ASP A 1 489 ? 16.665  -21.337 30.198  1.00 95.02  ?  493 ASP A HB3    1 
ATOM 7664  N N      . ILE A 1 490 ? 16.325  -21.790 33.158  1.00 92.98  ?  494 ILE A N      1 
ATOM 7665  C CA     . ILE A 1 490 ? 16.222  -21.096 34.437  1.00 89.28  ?  494 ILE A CA     1 
ATOM 7666  C C      . ILE A 1 490 ? 16.771  -21.970 35.557  1.00 95.81  ?  494 ILE A C      1 
ATOM 7667  O O      . ILE A 1 490 ? 17.613  -21.535 36.351  1.00 94.94  ?  494 ILE A O      1 
ATOM 7668  C CB     . ILE A 1 490 ? 14.763  -20.681 34.702  1.00 82.82  ?  494 ILE A CB     1 
ATOM 7669  C CG1    . ILE A 1 490 ? 14.286  -19.721 33.609  1.00 86.28  ?  494 ILE A CG1    1 
ATOM 7670  C CG2    . ILE A 1 490 ? 14.632  -20.029 36.075  1.00 98.52  ?  494 ILE A CG2    1 
ATOM 7671  C CD1    . ILE A 1 490 ? 12.811  -19.387 33.676  1.00 86.97  ?  494 ILE A CD1    1 
ATOM 7672  H H      . ILE A 1 490 ? 15.571  -21.981 32.793  1.00 111.57 ?  494 ILE A H      1 
ATOM 7673  H HA     . ILE A 1 490 ? 16.759  -20.289 34.400  1.00 107.13 ?  494 ILE A HA     1 
ATOM 7674  H HB     . ILE A 1 490 ? 14.207  -21.475 34.681  1.00 99.38  ?  494 ILE A HB     1 
ATOM 7675  H HG12   . ILE A 1 490 ? 14.780  -18.890 33.686  1.00 103.53 ?  494 ILE A HG12   1 
ATOM 7676  H HG13   . ILE A 1 490 ? 14.457  -20.125 32.743  1.00 103.53 ?  494 ILE A HG13   1 
ATOM 7677  H HG21   . ILE A 1 490 ? 13.706  -19.777 36.217  1.00 118.23 ?  494 ILE A HG21   1 
ATOM 7678  H HG22   . ILE A 1 490 ? 14.910  -20.664 36.753  1.00 118.23 ?  494 ILE A HG22   1 
ATOM 7679  H HG23   . ILE A 1 490 ? 15.198  -19.242 36.106  1.00 118.23 ?  494 ILE A HG23   1 
ATOM 7680  H HD11   . ILE A 1 490 ? 12.592  -18.777 32.953  1.00 104.36 ?  494 ILE A HD11   1 
ATOM 7681  H HD12   . ILE A 1 490 ? 12.297  -20.205 33.586  1.00 104.36 ?  494 ILE A HD12   1 
ATOM 7682  H HD13   . ILE A 1 490 ? 12.621  -18.968 34.531  1.00 104.36 ?  494 ILE A HD13   1 
ATOM 7683  N N      . GLU A 1 491 ? 16.308  -23.219 35.636  1.00 102.07 ?  495 GLU A N      1 
ATOM 7684  C CA     . GLU A 1 491 ? 16.766  -24.112 36.691  1.00 96.06  ?  495 GLU A CA     1 
ATOM 7685  C C      . GLU A 1 491 ? 18.239  -24.467 36.550  1.00 96.99  ?  495 GLU A C      1 
ATOM 7686  O O      . GLU A 1 491 ? 18.860  -24.877 37.536  1.00 102.26 ?  495 GLU A O      1 
ATOM 7687  C CB     . GLU A 1 491 ? 15.924  -25.387 36.705  1.00 96.03  ?  495 GLU A CB     1 
ATOM 7688  C CG     . GLU A 1 491 ? 14.552  -25.205 37.330  1.00 104.43 ?  495 GLU A CG     1 
ATOM 7689  C CD     . GLU A 1 491 ? 13.769  -26.500 37.401  1.00 109.69 ?  495 GLU A CD     1 
ATOM 7690  O OE1    . GLU A 1 491 ? 14.023  -27.395 36.567  1.00 106.52 ?  495 GLU A OE1    1 
ATOM 7691  O OE2    . GLU A 1 491 ? 12.904  -26.626 38.293  1.00 93.86  -1 495 GLU A OE2    1 
ATOM 7692  H H      . GLU A 1 491 ? 15.735  -23.567 35.096  1.00 122.48 ?  495 GLU A H      1 
ATOM 7693  H HA     . GLU A 1 491 ? 16.649  -23.671 37.547  1.00 115.28 ?  495 GLU A HA     1 
ATOM 7694  H HB2    . GLU A 1 491 ? 15.796  -25.687 35.791  1.00 115.24 ?  495 GLU A HB2    1 
ATOM 7695  H HB3    . GLU A 1 491 ? 16.393  -26.067 37.212  1.00 115.24 ?  495 GLU A HB3    1 
ATOM 7696  H HG2    . GLU A 1 491 ? 14.658  -24.869 38.234  1.00 125.31 ?  495 GLU A HG2    1 
ATOM 7697  H HG3    . GLU A 1 491 ? 14.042  -24.574 36.799  1.00 125.31 ?  495 GLU A HG3    1 
ATOM 7698  N N      . LYS A 1 492 ? 18.813  -24.320 35.355  1.00 96.34  ?  496 LYS A N      1 
ATOM 7699  C CA     . LYS A 1 492 ? 20.237  -24.586 35.189  1.00 98.25  ?  496 LYS A CA     1 
ATOM 7700  C C      . LYS A 1 492 ? 21.080  -23.479 35.806  1.00 91.66  ?  496 LYS A C      1 
ATOM 7701  O O      . LYS A 1 492 ? 22.214  -23.727 36.231  1.00 98.89  ?  496 LYS A O      1 
ATOM 7702  C CB     . LYS A 1 492 ? 20.571  -24.749 33.707  1.00 98.24  ?  496 LYS A CB     1 
ATOM 7703  C CG     . LYS A 1 492 ? 21.561  -25.868 33.418  1.00 114.39 ?  496 LYS A CG     1 
ATOM 7704  C CD     . LYS A 1 492 ? 21.739  -26.094 31.923  1.00 116.62 ?  496 LYS A CD     1 
ATOM 7705  C CE     . LYS A 1 492 ? 22.344  -24.883 31.231  1.00 105.01 ?  496 LYS A CE     1 
ATOM 7706  N NZ     . LYS A 1 492 ? 23.645  -24.482 31.834  1.00 112.08 1  496 LYS A NZ     1 
ATOM 7707  H H      . LYS A 1 492 ? 18.407  -24.071 34.639  1.00 115.61 ?  496 LYS A H      1 
ATOM 7708  H HA     . LYS A 1 492 ? 20.457  -25.417 35.639  1.00 117.90 ?  496 LYS A HA     1 
ATOM 7709  H HB2    . LYS A 1 492 ? 19.754  -24.944 33.222  1.00 117.88 ?  496 LYS A HB2    1 
ATOM 7710  H HB3    . LYS A 1 492 ? 20.957  -23.921 33.381  1.00 117.88 ?  496 LYS A HB3    1 
ATOM 7711  H HG2    . LYS A 1 492 ? 22.424  -25.635 33.795  1.00 137.26 ?  496 LYS A HG2    1 
ATOM 7712  H HG3    . LYS A 1 492 ? 21.235  -26.692 33.813  1.00 137.26 ?  496 LYS A HG3    1 
ATOM 7713  H HD2    . LYS A 1 492 ? 22.332  -26.849 31.784  1.00 139.94 ?  496 LYS A HD2    1 
ATOM 7714  H HD3    . LYS A 1 492 ? 20.874  -26.271 31.523  1.00 139.94 ?  496 LYS A HD3    1 
ATOM 7715  H HE2    . LYS A 1 492 ? 22.497  -25.094 30.297  1.00 126.02 ?  496 LYS A HE2    1 
ATOM 7716  H HE3    . LYS A 1 492 ? 21.732  -24.134 31.308  1.00 126.02 ?  496 LYS A HE3    1 
ATOM 7717  H HZ1    . LYS A 1 492 ? 23.972  -23.773 31.408  1.00 134.50 ?  496 LYS A HZ1    1 
ATOM 7718  H HZ2    . LYS A 1 492 ? 23.531  -24.277 32.693  1.00 134.50 ?  496 LYS A HZ2    1 
ATOM 7719  H HZ3    . LYS A 1 492 ? 24.228  -25.152 31.772  1.00 134.50 ?  496 LYS A HZ3    1 
ATOM 7720  N N      . GLN A 1 493 ? 20.547  -22.261 35.863  1.00 88.89  ?  497 GLN A N      1 
ATOM 7721  C CA     . GLN A 1 493 ? 21.209  -21.149 36.529  1.00 97.01  ?  497 GLN A CA     1 
ATOM 7722  C C      . GLN A 1 493 ? 20.909  -21.092 38.020  1.00 101.61 ?  497 GLN A C      1 
ATOM 7723  O O      . GLN A 1 493 ? 21.588  -20.356 38.744  1.00 96.51  ?  497 GLN A O      1 
ATOM 7724  C CB     . GLN A 1 493 ? 20.786  -19.825 35.885  1.00 96.94  ?  497 GLN A CB     1 
ATOM 7725  C CG     . GLN A 1 493 ? 21.200  -19.672 34.432  1.00 98.22  ?  497 GLN A CG     1 
ATOM 7726  C CD     . GLN A 1 493 ? 20.553  -18.471 33.770  1.00 99.65  ?  497 GLN A CD     1 
ATOM 7727  O OE1    . GLN A 1 493 ? 19.506  -17.996 34.209  1.00 104.80 ?  497 GLN A OE1    1 
ATOM 7728  N NE2    . GLN A 1 493 ? 21.176  -17.971 32.711  1.00 90.76  ?  497 GLN A NE2    1 
ATOM 7729  H H      . GLN A 1 493 ? 19.789  -22.052 35.516  1.00 106.67 ?  497 GLN A H      1 
ATOM 7730  H HA     . GLN A 1 493 ? 22.168  -21.242 36.420  1.00 116.41 ?  497 GLN A HA     1 
ATOM 7731  H HB2    . GLN A 1 493 ? 19.819  -19.756 35.924  1.00 116.32 ?  497 GLN A HB2    1 
ATOM 7732  H HB3    . GLN A 1 493 ? 21.185  -19.095 36.384  1.00 116.32 ?  497 GLN A HB3    1 
ATOM 7733  H HG2    . GLN A 1 493 ? 22.163  -19.558 34.388  1.00 117.86 ?  497 GLN A HG2    1 
ATOM 7734  H HG3    . GLN A 1 493 ? 20.936  -20.465 33.942  1.00 117.86 ?  497 GLN A HG3    1 
ATOM 7735  H HE21   . GLN A 1 493 ? 21.908  -18.328 32.434  1.00 108.92 ?  497 GLN A HE21   1 
ATOM 7736  H HE22   . GLN A 1 493 ? 20.848  -17.290 32.301  1.00 108.92 ?  497 GLN A HE22   1 
ATOM 7737  N N      . GLU A 1 494 ? 19.917  -21.843 38.488  1.00 103.40 ?  498 GLU A N      1 
ATOM 7738  C CA     . GLU A 1 494 ? 19.495  -21.798 39.882  1.00 96.35  ?  498 GLU A CA     1 
ATOM 7739  C C      . GLU A 1 494 ? 20.678  -22.009 40.821  1.00 93.18  ?  498 GLU A C      1 
ATOM 7740  O O      . GLU A 1 494 ? 20.631  -21.625 41.989  1.00 93.87  ?  498 GLU A O      1 
ATOM 7741  C CB     . GLU A 1 494 ? 18.424  -22.858 40.146  1.00 98.43  ?  498 GLU A CB     1 
ATOM 7742  C CG     . GLU A 1 494 ? 17.372  -22.449 41.163  1.00 102.83 ?  498 GLU A CG     1 
ATOM 7743  C CD     . GLU A 1 494 ? 16.373  -21.458 40.600  1.00 103.62 ?  498 GLU A CD     1 
ATOM 7744  O OE1    . GLU A 1 494 ? 16.706  -20.772 39.612  1.00 89.48  ?  498 GLU A OE1    1 
ATOM 7745  O OE2    . GLU A 1 494 ? 15.251  -21.372 41.141  1.00 111.49 ?  498 GLU A OE2    1 
ATOM 7746  H H      . GLU A 1 494 ? 19.466  -22.397 38.008  1.00 124.08 ?  498 GLU A H      1 
ATOM 7747  H HA     . GLU A 1 494 ? 19.111  -20.927 40.070  1.00 115.62 ?  498 GLU A HA     1 
ATOM 7748  H HB2    . GLU A 1 494 ? 17.967  -23.052 39.312  1.00 118.12 ?  498 GLU A HB2    1 
ATOM 7749  H HB3    . GLU A 1 494 ? 18.856  -23.662 40.476  1.00 118.12 ?  498 GLU A HB3    1 
ATOM 7750  H HG2    . GLU A 1 494 ? 16.885  -23.238 41.450  1.00 123.39 ?  498 GLU A HG2    1 
ATOM 7751  H HG3    . GLU A 1 494 ? 17.811  -22.035 41.923  1.00 123.39 ?  498 GLU A HG3    1 
ATOM 7752  N N      . GLU A 1 506 ? 17.809  -13.152 38.862  1.00 90.46  ?  567 GLU A N      1 
ATOM 7753  C CA     . GLU A 1 506 ? 18.305  -13.559 37.553  1.00 107.85 ?  567 GLU A CA     1 
ATOM 7754  C C      . GLU A 1 506 ? 17.446  -14.676 36.964  1.00 109.03 ?  567 GLU A C      1 
ATOM 7755  O O      . GLU A 1 506 ? 17.913  -15.468 36.146  1.00 106.41 ?  567 GLU A O      1 
ATOM 7756  C CB     . GLU A 1 506 ? 19.764  -14.012 37.656  1.00 121.34 ?  567 GLU A CB     1 
ATOM 7757  C CG     . GLU A 1 506 ? 20.774  -12.953 37.240  1.00 142.03 ?  567 GLU A CG     1 
ATOM 7758  C CD     . GLU A 1 506 ? 22.171  -13.516 37.065  1.00 134.15 ?  567 GLU A CD     1 
ATOM 7759  O OE1    . GLU A 1 506 ? 22.320  -14.756 37.089  1.00 130.11 ?  567 GLU A OE1    1 
ATOM 7760  O OE2    . GLU A 1 506 ? 23.118  -12.721 36.900  1.00 128.80 ?  567 GLU A OE2    1 
ATOM 7761  H HA     . GLU A 1 506 ? 18.267  -12.801 36.950  1.00 129.42 ?  567 GLU A HA     1 
ATOM 7762  H HB2    . GLU A 1 506 ? 19.951  -14.253 38.577  1.00 145.61 ?  567 GLU A HB2    1 
ATOM 7763  H HB3    . GLU A 1 506 ? 19.892  -14.784 37.083  1.00 145.61 ?  567 GLU A HB3    1 
ATOM 7764  H HG2    . GLU A 1 506 ? 20.497  -12.567 36.395  1.00 170.43 ?  567 GLU A HG2    1 
ATOM 7765  H HG3    . GLU A 1 506 ? 20.811  -12.265 37.924  1.00 170.43 ?  567 GLU A HG3    1 
ATOM 7766  N N      . LYS A 1 507 ? 16.181  -14.729 37.378  1.00 108.29 ?  568 LYS A N      1 
ATOM 7767  C CA     . LYS A 1 507 ? 15.268  -15.786 36.938  1.00 106.12 ?  568 LYS A CA     1 
ATOM 7768  C C      . LYS A 1 507 ? 14.556  -15.376 35.646  1.00 101.07 ?  568 LYS A C      1 
ATOM 7769  O O      . LYS A 1 507 ? 13.371  -15.041 35.618  1.00 99.24  ?  568 LYS A O      1 
ATOM 7770  C CB     . LYS A 1 507 ? 14.270  -16.112 38.039  1.00 109.05 ?  568 LYS A CB     1 
ATOM 7771  C CG     . LYS A 1 507 ? 14.712  -17.229 38.973  1.00 112.41 ?  568 LYS A CG     1 
ATOM 7772  C CD     . LYS A 1 507 ? 13.731  -17.407 40.123  1.00 111.70 ?  568 LYS A CD     1 
ATOM 7773  C CE     . LYS A 1 507 ? 12.384  -17.951 39.658  1.00 103.26 ?  568 LYS A CE     1 
ATOM 7774  N NZ     . LYS A 1 507 ? 11.263  -17.416 40.478  1.00 89.09  1  568 LYS A NZ     1 
ATOM 7775  H H      . LYS A 1 507 ? 15.825  -14.163 37.919  1.00 129.95 ?  568 LYS A H      1 
ATOM 7776  H HA     . LYS A 1 507 ? 15.781  -16.588 36.753  1.00 127.34 ?  568 LYS A HA     1 
ATOM 7777  H HB2    . LYS A 1 507 ? 14.128  -15.317 38.576  1.00 130.86 ?  568 LYS A HB2    1 
ATOM 7778  H HB3    . LYS A 1 507 ? 13.433  -16.383 37.630  1.00 130.86 ?  568 LYS A HB3    1 
ATOM 7779  H HG2    . LYS A 1 507 ? 14.756  -18.062 38.478  1.00 134.90 ?  568 LYS A HG2    1 
ATOM 7780  H HG3    . LYS A 1 507 ? 15.581  -17.011 39.345  1.00 134.90 ?  568 LYS A HG3    1 
ATOM 7781  H HD2    . LYS A 1 507 ? 14.104  -18.034 40.763  1.00 134.04 ?  568 LYS A HD2    1 
ATOM 7782  H HD3    . LYS A 1 507 ? 13.579  -16.548 40.547  1.00 134.04 ?  568 LYS A HD3    1 
ATOM 7783  H HE2    . LYS A 1 507 ? 12.236  -17.691 38.735  1.00 123.91 ?  568 LYS A HE2    1 
ATOM 7784  H HE3    . LYS A 1 507 ? 12.385  -18.917 39.738  1.00 123.91 ?  568 LYS A HE3    1 
ATOM 7785  H HZ1    . LYS A 1 507 ? 10.489  -17.747 40.187  1.00 106.90 ?  568 LYS A HZ1    1 
ATOM 7786  H HZ2    . LYS A 1 507 ? 11.373  -17.645 41.331  1.00 106.90 ?  568 LYS A HZ2    1 
ATOM 7787  H HZ3    . LYS A 1 507 ? 11.238  -16.528 40.417  1.00 106.90 ?  568 LYS A HZ3    1 
ATOM 7788  N N      . GLU A 1 508 ? 15.317  -15.422 34.555  1.00 97.36  ?  569 GLU A N      1 
ATOM 7789  C CA     . GLU A 1 508 ? 14.767  -15.218 33.224  1.00 92.71  ?  569 GLU A CA     1 
ATOM 7790  C C      . GLU A 1 508 ? 15.621  -15.972 32.218  1.00 85.79  ?  569 GLU A C      1 
ATOM 7791  O O      . GLU A 1 508 ? 16.852  -15.912 32.267  1.00 68.76  ?  569 GLU A O      1 
ATOM 7792  C CB     . GLU A 1 508 ? 14.702  -13.732 32.854  1.00 96.02  ?  569 GLU A CB     1 
ATOM 7793  C CG     . GLU A 1 508 ? 13.421  -13.039 33.288  1.00 98.34  ?  569 GLU A CG     1 
ATOM 7794  C CD     . GLU A 1 508 ? 12.184  -13.670 32.678  1.00 99.97  ?  569 GLU A CD     1 
ATOM 7795  O OE1    . GLU A 1 508 ? 12.327  -14.420 31.691  1.00 94.18  ?  569 GLU A OE1    1 
ATOM 7796  O OE2    . GLU A 1 508 ? 11.072  -13.422 33.188  1.00 95.70  -1 569 GLU A OE2    1 
ATOM 7797  H H      . GLU A 1 508 ? 16.164  -15.572 34.563  1.00 116.83 ?  569 GLU A H      1 
ATOM 7798  H HA     . GLU A 1 508 ? 13.867  -15.579 33.191  1.00 111.25 ?  569 GLU A HA     1 
ATOM 7799  H HB2    . GLU A 1 508 ? 15.444  -13.273 33.277  1.00 115.22 ?  569 GLU A HB2    1 
ATOM 7800  H HB3    . GLU A 1 508 ? 14.771  -13.648 31.890  1.00 115.22 ?  569 GLU A HB3    1 
ATOM 7801  H HG2    . GLU A 1 508 ? 13.342  -13.094 34.253  1.00 118.00 ?  569 GLU A HG2    1 
ATOM 7802  H HG3    . GLU A 1 508 ? 13.454  -12.110 33.009  1.00 118.00 ?  569 GLU A HG3    1 
ATOM 7803  N N      . ALA A 1 509 ? 14.954  -16.677 31.308  1.00 85.82  ?  570 ALA A N      1 
ATOM 7804  C CA     . ALA A 1 509 ? 15.648  -17.509 30.339  1.00 91.59  ?  570 ALA A CA     1 
ATOM 7805  C C      . ALA A 1 509 ? 16.594  -16.670 29.487  1.00 78.00  ?  570 ALA A C      1 
ATOM 7806  O O      . ALA A 1 509 ? 16.420  -15.460 29.319  1.00 67.63  ?  570 ALA A O      1 
ATOM 7807  C CB     . ALA A 1 509 ? 14.643  -18.236 29.447  1.00 96.69  ?  570 ALA A CB     1 
ATOM 7808  H H      . ALA A 1 509 ? 14.098  -16.688 31.232  1.00 102.98 ?  570 ALA A H      1 
ATOM 7809  H HA     . ALA A 1 509 ? 16.174  -18.175 30.809  1.00 109.91 ?  570 ALA A HA     1 
ATOM 7810  H HB1    . ALA A 1 509 ? 15.127  -18.784 28.810  1.00 116.02 ?  570 ALA A HB1    1 
ATOM 7811  H HB2    . ALA A 1 509 ? 14.076  -18.794 30.001  1.00 116.02 ?  570 ALA A HB2    1 
ATOM 7812  H HB3    . ALA A 1 509 ? 14.105  -17.579 28.978  1.00 116.02 ?  570 ALA A HB3    1 
ATOM 7813  N N      . SER A 1 510 ? 17.611  -17.335 28.946  1.00 91.92  ?  571 SER A N      1 
ATOM 7814  C CA     . SER A 1 510 ? 18.573  -16.661 28.088  1.00 90.46  ?  571 SER A CA     1 
ATOM 7815  C C      . SER A 1 510 ? 17.870  -16.061 26.878  1.00 92.27  ?  571 SER A C      1 
ATOM 7816  O O      . SER A 1 510 ? 16.841  -16.562 26.416  1.00 96.55  ?  571 SER A O      1 
ATOM 7817  C CB     . SER A 1 510 ? 19.658  -17.639 27.638  1.00 83.32  ?  571 SER A CB     1 
ATOM 7818  O OG     . SER A 1 510 ? 20.675  -16.975 26.910  1.00 84.27  ?  571 SER A OG     1 
ATOM 7819  H H      . SER A 1 510 ? 17.764  -18.173 29.061  1.00 110.30 ?  571 SER A H      1 
ATOM 7820  H HA     . SER A 1 510 ? 18.997  -15.942 28.583  1.00 108.55 ?  571 SER A HA     1 
ATOM 7821  H HB2    . SER A 1 510 ? 20.051  -18.055 28.421  1.00 99.98  ?  571 SER A HB2    1 
ATOM 7822  H HB3    . SER A 1 510 ? 19.255  -18.315 27.071  1.00 99.98  ?  571 SER A HB3    1 
ATOM 7823  H HG     . SER A 1 510 ? 21.262  -17.525 26.670  1.00 101.12 ?  571 SER A HG     1 
ATOM 7824  N N      . SER A 1 511 ? 18.440  -14.970 26.362  1.00 80.33  ?  572 SER A N      1 
ATOM 7825  C CA     . SER A 1 511 ? 17.838  -14.284 25.224  1.00 73.78  ?  572 SER A CA     1 
ATOM 7826  C C      . SER A 1 511 ? 17.524  -15.258 24.096  1.00 81.83  ?  572 SER A C      1 
ATOM 7827  O O      . SER A 1 511 ? 16.459  -15.178 23.475  1.00 80.71  ?  572 SER A O      1 
ATOM 7828  C CB     . SER A 1 511 ? 18.768  -13.177 24.731  1.00 69.36  ?  572 SER A CB     1 
ATOM 7829  O OG     . SER A 1 511 ? 20.033  -13.700 24.366  1.00 69.54  ?  572 SER A OG     1 
ATOM 7830  H H      . SER A 1 511 ? 19.167  -14.612 26.650  1.00 96.40  ?  572 SER A H      1 
ATOM 7831  H HA     . SER A 1 511 ? 17.006  -13.874 25.507  1.00 88.54  ?  572 SER A HA     1 
ATOM 7832  H HB2    . SER A 1 511 ? 18.368  -12.751 23.956  1.00 83.23  ?  572 SER A HB2    1 
ATOM 7833  H HB3    . SER A 1 511 ? 18.889  -12.527 25.440  1.00 83.23  ?  572 SER A HB3    1 
ATOM 7834  H HG     . SER A 1 511 ? 20.533  -13.082 24.097  1.00 83.45  ?  572 SER A HG     1 
ATOM 7835  N N      . ALA A 1 512 ? 18.438  -16.190 23.824  1.00 83.68  ?  573 ALA A N      1 
ATOM 7836  C CA     . ALA A 1 512 ? 18.191  -17.188 22.789  1.00 71.27  ?  573 ALA A CA     1 
ATOM 7837  C C      . ALA A 1 512 ? 16.898  -17.940 23.068  1.00 73.29  ?  573 ALA A C      1 
ATOM 7838  O O      . ALA A 1 512 ? 15.952  -17.896 22.274  1.00 80.59  ?  573 ALA A O      1 
ATOM 7839  C CB     . ALA A 1 512 ? 19.372  -18.155 22.702  1.00 59.85  ?  573 ALA A CB     1 
ATOM 7840  H H      . ALA A 1 512 ? 19.198  -16.265 24.220  1.00 100.42 ?  573 ALA A H      1 
ATOM 7841  H HA     . ALA A 1 512 ? 18.102  -16.742 21.933  1.00 85.52  ?  573 ALA A HA     1 
ATOM 7842  H HB1    . ALA A 1 512 ? 19.192  -18.810 22.010  1.00 71.82  ?  573 ALA A HB1    1 
ATOM 7843  H HB2    . ALA A 1 512 ? 20.174  -17.654 22.483  1.00 71.82  ?  573 ALA A HB2    1 
ATOM 7844  H HB3    . ALA A 1 512 ? 19.481  -18.597 23.558  1.00 71.82  ?  573 ALA A HB3    1 
ATOM 7845  N N      . THR A 1 513 ? 16.837  -18.626 24.208  1.00 67.95  ?  574 THR A N      1 
ATOM 7846  C CA     . THR A 1 513 ? 15.656  -19.385 24.599  1.00 75.57  ?  574 THR A CA     1 
ATOM 7847  C C      . THR A 1 513 ? 14.387  -18.576 24.372  1.00 78.84  ?  574 THR A C      1 
ATOM 7848  O O      . THR A 1 513 ? 13.378  -19.113 23.902  1.00 84.85  ?  574 THR A O      1 
ATOM 7849  C CB     . THR A 1 513 ? 15.763  -19.801 26.067  1.00 80.41  ?  574 THR A CB     1 
ATOM 7850  O OG1    . THR A 1 513 ? 16.965  -20.556 26.259  1.00 86.22  ?  574 THR A OG1    1 
ATOM 7851  C CG2    . THR A 1 513 ? 14.567  -20.648 26.482  1.00 88.64  ?  574 THR A CG2    1 
ATOM 7852  H H      . THR A 1 513 ? 17.479  -18.667 24.780  1.00 81.53  ?  574 THR A H      1 
ATOM 7853  H HA     . THR A 1 513 ? 15.603  -20.189 24.059  1.00 90.68  ?  574 THR A HA     1 
ATOM 7854  H HB     . THR A 1 513 ? 15.787  -19.009 26.626  1.00 96.49  ?  574 THR A HB     1 
ATOM 7855  H HG1    . THR A 1 513 ? 17.032  -20.789 27.064  1.00 103.46 ?  574 THR A HG1    1 
ATOM 7856  H HG21   . THR A 1 513 ? 14.649  -20.903 27.414  1.00 106.36 ?  574 THR A HG21   1 
ATOM 7857  H HG22   . THR A 1 513 ? 13.747  -20.142 26.365  1.00 106.36 ?  574 THR A HG22   1 
ATOM 7858  H HG23   . THR A 1 513 ? 14.523  -21.449 25.938  1.00 106.36 ?  574 THR A HG23   1 
ATOM 7859  N N      . ILE A 1 514 ? 14.431  -17.282 24.690  1.00 77.02  ?  575 ILE A N      1 
ATOM 7860  C CA     . ILE A 1 514 ? 13.251  -16.441 24.519  1.00 69.11  ?  575 ILE A CA     1 
ATOM 7861  C C      . ILE A 1 514 ? 12.830  -16.416 23.057  1.00 73.65  ?  575 ILE A C      1 
ATOM 7862  O O      . ILE A 1 514 ? 11.634  -16.398 22.739  1.00 65.75  ?  575 ILE A O      1 
ATOM 7863  C CB     . ILE A 1 514 ? 13.525  -15.026 25.062  1.00 58.24  ?  575 ILE A CB     1 
ATOM 7864  C CG1    . ILE A 1 514 ? 13.841  -15.102 26.557  1.00 55.10  ?  575 ILE A CG1    1 
ATOM 7865  C CG2    . ILE A 1 514 ? 12.329  -14.116 24.808  1.00 70.20  ?  575 ILE A CG2    1 
ATOM 7866  C CD1    . ILE A 1 514 ? 14.167  -13.776 27.202  1.00 62.82  ?  575 ILE A CD1    1 
ATOM 7867  H H      . ILE A 1 514 ? 15.121  -16.874 25.001  1.00 92.42  ?  575 ILE A H      1 
ATOM 7868  H HA     . ILE A 1 514 ? 12.520  -16.819 25.032  1.00 82.93  ?  575 ILE A HA     1 
ATOM 7869  H HB     . ILE A 1 514 ? 14.296  -14.660 24.600  1.00 69.88  ?  575 ILE A HB     1 
ATOM 7870  H HG12   . ILE A 1 514 ? 13.071  -15.470 27.018  1.00 66.12  ?  575 ILE A HG12   1 
ATOM 7871  H HG13   . ILE A 1 514 ? 14.605  -15.685 26.683  1.00 66.12  ?  575 ILE A HG13   1 
ATOM 7872  H HG21   . ILE A 1 514 ? 12.525  -13.233 25.158  1.00 84.24  ?  575 ILE A HG21   1 
ATOM 7873  H HG22   . ILE A 1 514 ? 12.169  -14.066 23.853  1.00 84.24  ?  575 ILE A HG22   1 
ATOM 7874  H HG23   . ILE A 1 514 ? 11.552  -14.485 25.255  1.00 84.24  ?  575 ILE A HG23   1 
ATOM 7875  H HD11   . ILE A 1 514 ? 14.353  -13.920 28.143  1.00 75.39  ?  575 ILE A HD11   1 
ATOM 7876  H HD12   . ILE A 1 514 ? 14.946  -13.396 26.766  1.00 75.39  ?  575 ILE A HD12   1 
ATOM 7877  H HD13   . ILE A 1 514 ? 13.408  -13.181 27.102  1.00 75.39  ?  575 ILE A HD13   1 
ATOM 7878  N N      . VAL A 1 515 ? 13.800  -16.425 22.142  1.00 76.65  ?  576 VAL A N      1 
ATOM 7879  C CA     . VAL A 1 515 ? 13.476  -16.476 20.720  1.00 71.33  ?  576 VAL A CA     1 
ATOM 7880  C C      . VAL A 1 515 ? 12.730  -17.763 20.401  1.00 69.26  ?  576 VAL A C      1 
ATOM 7881  O O      . VAL A 1 515 ? 11.651  -17.747 19.798  1.00 56.73  ?  576 VAL A O      1 
ATOM 7882  C CB     . VAL A 1 515 ? 14.755  -16.348 19.870  1.00 61.51  ?  576 VAL A CB     1 
ATOM 7883  C CG1    . VAL A 1 515 ? 14.419  -16.374 18.384  1.00 66.33  ?  576 VAL A CG1    1 
ATOM 7884  C CG2    . VAL A 1 515 ? 15.504  -15.077 20.220  1.00 59.99  ?  576 VAL A CG2    1 
ATOM 7885  H H      . VAL A 1 515 ? 14.642  -16.403 22.317  1.00 91.98  ?  576 VAL A H      1 
ATOM 7886  H HA     . VAL A 1 515 ? 12.896  -15.730 20.501  1.00 85.60  ?  576 VAL A HA     1 
ATOM 7887  H HB     . VAL A 1 515 ? 15.336  -17.101 20.060  1.00 73.82  ?  576 VAL A HB     1 
ATOM 7888  H HG11   . VAL A 1 515 ? 15.240  -16.292 17.874  1.00 79.60  ?  576 VAL A HG11   1 
ATOM 7889  H HG12   . VAL A 1 515 ? 13.982  -17.214 18.174  1.00 79.60  ?  576 VAL A HG12   1 
ATOM 7890  H HG13   . VAL A 1 515 ? 13.828  -15.632 18.181  1.00 79.60  ?  576 VAL A HG13   1 
ATOM 7891  H HG21   . VAL A 1 515 ? 16.302  -15.021 19.673  1.00 71.99  ?  576 VAL A HG21   1 
ATOM 7892  H HG22   . VAL A 1 515 ? 14.929  -14.315 20.048  1.00 71.99  ?  576 VAL A HG22   1 
ATOM 7893  H HG23   . VAL A 1 515 ? 15.747  -15.102 21.159  1.00 71.99  ?  576 VAL A HG23   1 
ATOM 7894  N N      . LEU A 1 516 ? 13.288  -18.899 20.822  1.00 69.77  ?  577 LEU A N      1 
ATOM 7895  C CA     . LEU A 1 516 ? 12.732  -20.188 20.427  1.00 52.60  ?  577 LEU A CA     1 
ATOM 7896  C C      . LEU A 1 516 ? 11.298  -20.340 20.915  1.00 52.50  ?  577 LEU A C      1 
ATOM 7897  O O      . LEU A 1 516 ? 10.421  -20.780 20.163  1.00 60.33  ?  577 LEU A O      1 
ATOM 7898  C CB     . LEU A 1 516 ? 13.610  -21.319 20.960  1.00 32.35  ?  577 LEU A CB     1 
ATOM 7899  C CG     . LEU A 1 516 ? 14.981  -21.479 20.294  1.00 53.54  ?  577 LEU A CG     1 
ATOM 7900  C CD1    . LEU A 1 516 ? 15.997  -20.490 20.843  1.00 59.29  ?  577 LEU A CD1    1 
ATOM 7901  C CD2    . LEU A 1 516 ? 15.487  -22.897 20.458  1.00 62.13  ?  577 LEU A CD2    1 
ATOM 7902  H H      . LEU A 1 516 ? 13.981  -18.949 21.329  1.00 83.73  ?  577 LEU A H      1 
ATOM 7903  H HA     . LEU A 1 516 ? 12.726  -20.244 19.459  1.00 63.12  ?  577 LEU A HA     1 
ATOM 7904  H HB2    . LEU A 1 516 ? 13.765  -21.166 21.905  1.00 38.82  ?  577 LEU A HB2    1 
ATOM 7905  H HB3    . LEU A 1 516 ? 13.134  -22.156 20.843  1.00 38.82  ?  577 LEU A HB3    1 
ATOM 7906  H HG     . LEU A 1 516 ? 14.887  -21.307 19.344  1.00 64.25  ?  577 LEU A HG     1 
ATOM 7907  H HD11   . LEU A 1 516 ? 16.845  -20.628 20.394  1.00 71.15  ?  577 LEU A HD11   1 
ATOM 7908  H HD12   . LEU A 1 516 ? 15.679  -19.588 20.681  1.00 71.15  ?  577 LEU A HD12   1 
ATOM 7909  H HD13   . LEU A 1 516 ? 16.098  -20.639 21.796  1.00 71.15  ?  577 LEU A HD13   1 
ATOM 7910  H HD21   . LEU A 1 516 ? 16.354  -22.974 20.029  1.00 74.55  ?  577 LEU A HD21   1 
ATOM 7911  H HD22   . LEU A 1 516 ? 15.567  -23.096 21.404  1.00 74.55  ?  577 LEU A HD22   1 
ATOM 7912  H HD23   . LEU A 1 516 ? 14.858  -23.506 20.042  1.00 74.55  ?  577 LEU A HD23   1 
ATOM 7913  N N      . CYS A 1 517 ? 11.037  -19.967 22.167  1.00 49.12  ?  578 CYS A N      1 
ATOM 7914  C CA     . CYS A 1 517 ? 9.683   -20.061 22.697  1.00 58.30  ?  578 CYS A CA     1 
ATOM 7915  C C      . CYS A 1 517 ? 8.719   -19.192 21.903  1.00 61.85  ?  578 CYS A C      1 
ATOM 7916  O O      . CYS A 1 517 ? 7.581   -19.594 21.636  1.00 53.73  ?  578 CYS A O      1 
ATOM 7917  C CB     . CYS A 1 517 ? 9.674   -19.653 24.168  1.00 57.45  ?  578 CYS A CB     1 
ATOM 7918  S SG     . CYS A 1 517 ? 10.679  -20.707 25.235  1.00 89.36  ?  578 CYS A SG     1 
ATOM 7919  H H      . CYS A 1 517 ? 11.619  -19.661 22.722  1.00 58.94  ?  578 CYS A H      1 
ATOM 7920  H HA     . CYS A 1 517 ? 9.380   -20.981 22.636  1.00 69.96  ?  578 CYS A HA     1 
ATOM 7921  H HB2    . CYS A 1 517 ? 10.015  -18.748 24.241  1.00 68.93  ?  578 CYS A HB2    1 
ATOM 7922  H HB3    . CYS A 1 517 ? 8.761   -19.687 24.494  1.00 68.93  ?  578 CYS A HB3    1 
ATOM 7923  H HG     . CYS A 1 517 ? 11.819  -20.669 24.861  1.00 107.23 ?  578 CYS A HG     1 
ATOM 7924  N N      . LEU A 1 518 ? 9.156   -17.994 21.515  1.00 70.41  ?  579 LEU A N      1 
ATOM 7925  C CA     . LEU A 1 518 ? 8.251   -17.056 20.863  1.00 64.21  ?  579 LEU A CA     1 
ATOM 7926  C C      . LEU A 1 518 ? 7.928   -17.491 19.439  1.00 57.44  ?  579 LEU A C      1 
ATOM 7927  O O      . LEU A 1 518 ? 6.773   -17.398 19.006  1.00 66.10  ?  579 LEU A O      1 
ATOM 7928  C CB     . LEU A 1 518 ? 8.859   -15.655 20.884  1.00 65.61  ?  579 LEU A CB     1 
ATOM 7929  C CG     . LEU A 1 518 ? 8.842   -14.992 22.262  1.00 49.06  ?  579 LEU A CG     1 
ATOM 7930  C CD1    . LEU A 1 518 ? 9.824   -13.841 22.316  1.00 60.69  ?  579 LEU A CD1    1 
ATOM 7931  C CD2    . LEU A 1 518 ? 7.443   -14.510 22.601  1.00 41.34  ?  579 LEU A CD2    1 
ATOM 7932  H H      . LEU A 1 518 ? 9.960   -17.706 21.616  1.00 84.49  ?  579 LEU A H      1 
ATOM 7933  H HA     . LEU A 1 518 ? 7.419   -17.027 21.361  1.00 77.05  ?  579 LEU A HA     1 
ATOM 7934  H HB2    . LEU A 1 518 ? 9.782   -15.712 20.594  1.00 78.74  ?  579 LEU A HB2    1 
ATOM 7935  H HB3    . LEU A 1 518 ? 8.358   -15.089 20.277  1.00 78.74  ?  579 LEU A HB3    1 
ATOM 7936  H HG     . LEU A 1 518 ? 9.105   -15.643 22.931  1.00 58.88  ?  579 LEU A HG     1 
ATOM 7937  H HD11   . LEU A 1 518 ? 9.792   -13.440 23.198  1.00 72.83  ?  579 LEU A HD11   1 
ATOM 7938  H HD12   . LEU A 1 518 ? 10.715  -14.179 22.137  1.00 72.83  ?  579 LEU A HD12   1 
ATOM 7939  H HD13   . LEU A 1 518 ? 9.578   -13.185 21.645  1.00 72.83  ?  579 LEU A HD13   1 
ATOM 7940  H HD21   . LEU A 1 518 ? 7.456   -14.094 23.477  1.00 49.61  ?  579 LEU A HD21   1 
ATOM 7941  H HD22   . LEU A 1 518 ? 7.161   -13.866 21.932  1.00 49.61  ?  579 LEU A HD22   1 
ATOM 7942  H HD23   . LEU A 1 518 ? 6.840   -15.270 22.604  1.00 49.61  ?  579 LEU A HD23   1 
ATOM 7943  N N      . THR A 1 519 ? 8.925   -17.972 18.695  1.00 48.11  ?  580 THR A N      1 
ATOM 7944  C CA     . THR A 1 519 ? 8.651   -18.459 17.348  1.00 50.71  ?  580 THR A CA     1 
ATOM 7945  C C      . THR A 1 519 ? 7.711   -19.654 17.393  1.00 62.52  ?  580 THR A C      1 
ATOM 7946  O O      . THR A 1 519 ? 6.806   -19.777 16.560  1.00 49.44  ?  580 THR A O      1 
ATOM 7947  C CB     . THR A 1 519 ? 9.950   -18.835 16.636  1.00 41.00  ?  580 THR A CB     1 
ATOM 7948  O OG1    . THR A 1 519 ? 10.535  -19.978 17.269  1.00 61.04  ?  580 THR A OG1    1 
ATOM 7949  C CG2    . THR A 1 519 ? 10.941  -17.683 16.663  1.00 32.27  ?  580 THR A CG2    1 
ATOM 7950  H H      . THR A 1 519 ? 9.747   -18.025 18.940  1.00 57.73  ?  580 THR A H      1 
ATOM 7951  H HA     . THR A 1 519 ? 8.220   -17.756 16.837  1.00 60.85  ?  580 THR A HA     1 
ATOM 7952  H HB     . THR A 1 519 ? 9.757   -19.047 15.709  1.00 49.20  ?  580 THR A HB     1 
ATOM 7953  H HG1    . THR A 1 519 ? 10.703  -19.807 18.074  1.00 73.25  ?  580 THR A HG1    1 
ATOM 7954  H HG21   . THR A 1 519 ? 11.758  -17.939 16.208  1.00 38.72  ?  580 THR A HG21   1 
ATOM 7955  H HG22   . THR A 1 519 ? 10.561  -16.909 16.219  1.00 38.72  ?  580 THR A HG22   1 
ATOM 7956  H HG23   . THR A 1 519 ? 11.151  -17.449 17.581  1.00 38.72  ?  580 THR A HG23   1 
ATOM 7957  N N      . ARG A 1 520 ? 7.905   -20.542 18.369  1.00 56.16  ?  581 ARG A N      1 
ATOM 7958  C CA     . ARG A 1 520 ? 7.008   -21.681 18.524  1.00 48.95  ?  581 ARG A CA     1 
ATOM 7959  C C      . ARG A 1 520 ? 5.593   -21.222 18.846  1.00 47.40  ?  581 ARG A C      1 
ATOM 7960  O O      . ARG A 1 520 ? 4.616   -21.815 18.373  1.00 57.83  ?  581 ARG A O      1 
ATOM 7961  C CB     . ARG A 1 520 ? 7.530   -22.610 19.620  1.00 45.72  ?  581 ARG A CB     1 
ATOM 7962  C CG     . ARG A 1 520 ? 8.630   -23.562 19.174  1.00 44.56  ?  581 ARG A CG     1 
ATOM 7963  C CD     . ARG A 1 520 ? 9.299   -24.223 20.368  1.00 42.28  ?  581 ARG A CD     1 
ATOM 7964  N NE     . ARG A 1 520 ? 10.299  -25.210 19.973  1.00 35.81  ?  581 ARG A NE     1 
ATOM 7965  C CZ     . ARG A 1 520 ? 11.529  -24.913 19.566  1.00 39.45  ?  581 ARG A CZ     1 
ATOM 7966  N NH1    . ARG A 1 520 ? 11.921  -23.651 19.485  1.00 56.68  1  581 ARG A NH1    1 
ATOM 7967  N NH2    . ARG A 1 520 ? 12.367  -25.881 19.233  1.00 46.63  ?  581 ARG A NH2    1 
ATOM 7968  H H      . ARG A 1 520 ? 8.541   -20.507 18.946  1.00 67.39  ?  581 ARG A H      1 
ATOM 7969  H HA     . ARG A 1 520 ? 6.982   -22.180 17.693  1.00 58.74  ?  581 ARG A HA     1 
ATOM 7970  H HB2    . ARG A 1 520 ? 7.885   -22.068 20.342  1.00 54.86  ?  581 ARG A HB2    1 
ATOM 7971  H HB3    . ARG A 1 520 ? 6.792   -23.147 19.948  1.00 54.86  ?  581 ARG A HB3    1 
ATOM 7972  H HG2    . ARG A 1 520 ? 8.247   -24.257 18.615  1.00 53.48  ?  581 ARG A HG2    1 
ATOM 7973  H HG3    . ARG A 1 520 ? 9.304   -23.067 18.682  1.00 53.48  ?  581 ARG A HG3    1 
ATOM 7974  H HD2    . ARG A 1 520 ? 9.742   -23.543 20.900  1.00 50.73  ?  581 ARG A HD2    1 
ATOM 7975  H HD3    . ARG A 1 520 ? 8.625   -24.675 20.899  1.00 50.73  ?  581 ARG A HD3    1 
ATOM 7976  H HE     . ARG A 1 520 ? 10.078  -26.041 20.007  1.00 42.97  ?  581 ARG A HE     1 
ATOM 7977  H HH11   . ARG A 1 520 ? 11.381  -23.018 19.701  1.00 68.02  ?  581 ARG A HH11   1 
ATOM 7978  H HH12   . ARG A 1 520 ? 12.718  -23.464 19.219  1.00 68.02  ?  581 ARG A HH12   1 
ATOM 7979  H HH21   . ARG A 1 520 ? 12.117  -26.703 19.282  1.00 55.96  ?  581 ARG A HH21   1 
ATOM 7980  H HH22   . ARG A 1 520 ? 13.162  -25.689 18.966  1.00 55.96  ?  581 ARG A HH22   1 
ATOM 7981  N N      . SER A 1 521 ? 5.461   -20.160 19.642  1.00 48.68  ?  582 SER A N      1 
ATOM 7982  C CA     . SER A 1 521 ? 4.136   -19.708 20.049  1.00 56.62  ?  582 SER A CA     1 
ATOM 7983  C C      . SER A 1 521 ? 3.373   -19.103 18.878  1.00 58.00  ?  582 SER A C      1 
ATOM 7984  O O      . SER A 1 521 ? 2.167   -19.330 18.731  1.00 61.49  ?  582 SER A O      1 
ATOM 7985  C CB     . SER A 1 521 ? 4.258   -18.697 21.186  1.00 43.15  ?  582 SER A CB     1 
ATOM 7986  O OG     . SER A 1 521 ? 4.890   -17.513 20.739  1.00 67.95  ?  582 SER A OG     1 
ATOM 7987  H H      . SER A 1 521 ? 6.112   -19.693 19.954  1.00 58.41  ?  582 SER A H      1 
ATOM 7988  H HA     . SER A 1 521 ? 3.629   -20.468 20.376  1.00 67.95  ?  582 SER A HA     1 
ATOM 7989  H HB2    . SER A 1 521 ? 3.371   -18.479 21.511  1.00 51.78  ?  582 SER A HB2    1 
ATOM 7990  H HB3    . SER A 1 521 ? 4.787   -19.087 21.900  1.00 51.78  ?  582 SER A HB3    1 
ATOM 7991  H HG     . SER A 1 521 ? 4.442   -17.164 20.119  1.00 81.55  ?  582 SER A HG     1 
ATOM 7992  N N      . SER A 1 522 ? 4.057   -18.328 18.036  1.00 47.85  ?  583 SER A N      1 
ATOM 7993  C CA     . SER A 1 522 ? 3.388   -17.703 16.902  1.00 43.62  ?  583 SER A CA     1 
ATOM 7994  C C      . SER A 1 522 ? 2.793   -18.752 15.974  1.00 54.84  ?  583 SER A C      1 
ATOM 7995  O O      . SER A 1 522 ? 1.619   -18.670 15.594  1.00 55.69  ?  583 SER A O      1 
ATOM 7996  C CB     . SER A 1 522 ? 4.372   -16.814 16.147  1.00 45.50  ?  583 SER A CB     1 
ATOM 7997  O OG     . SER A 1 522 ? 5.541   -17.535 15.810  1.00 50.36  ?  583 SER A OG     1 
ATOM 7998  H H      . SER A 1 522 ? 4.896   -18.152 18.099  1.00 57.42  ?  583 SER A H      1 
ATOM 7999  H HA     . SER A 1 522 ? 2.665   -17.144 17.228  1.00 52.35  ?  583 SER A HA     1 
ATOM 8000  H HB2    . SER A 1 522 ? 3.951   -16.497 15.332  1.00 54.60  ?  583 SER A HB2    1 
ATOM 8001  H HB3    . SER A 1 522 ? 4.615   -16.062 16.709  1.00 54.60  ?  583 SER A HB3    1 
ATOM 8002  H HG     . SER A 1 522 ? 5.916   -17.816 16.508  1.00 60.43  ?  583 SER A HG     1 
ATOM 8003  N N      . TYR A 1 523 ? 3.591   -19.753 15.597  1.00 55.69  ?  584 TYR A N      1 
ATOM 8004  C CA     . TYR A 1 523 ? 3.083   -20.805 14.727  1.00 46.60  ?  584 TYR A CA     1 
ATOM 8005  C C      . TYR A 1 523 ? 1.911   -21.533 15.366  1.00 54.95  ?  584 TYR A C      1 
ATOM 8006  O O      . TYR A 1 523 ? 0.978   -21.942 14.666  1.00 68.80  ?  584 TYR A O      1 
ATOM 8007  C CB     . TYR A 1 523 ? 4.199   -21.787 14.383  1.00 36.93  ?  584 TYR A CB     1 
ATOM 8008  C CG     . TYR A 1 523 ? 5.217   -21.230 13.421  1.00 28.09  ?  584 TYR A CG     1 
ATOM 8009  C CD1    . TYR A 1 523 ? 6.509   -20.940 13.833  1.00 25.40  ?  584 TYR A CD1    1 
ATOM 8010  C CD2    . TYR A 1 523 ? 4.883   -20.989 12.097  1.00 50.15  ?  584 TYR A CD2    1 
ATOM 8011  C CE1    . TYR A 1 523 ? 7.440   -20.431 12.953  1.00 36.25  ?  584 TYR A CE1    1 
ATOM 8012  C CE2    . TYR A 1 523 ? 5.806   -20.478 11.211  1.00 67.89  ?  584 TYR A CE2    1 
ATOM 8013  C CZ     . TYR A 1 523 ? 7.083   -20.202 11.643  1.00 55.44  ?  584 TYR A CZ     1 
ATOM 8014  O OH     . TYR A 1 523 ? 8.006   -19.694 10.761  1.00 58.31  ?  584 TYR A OH     1 
ATOM 8015  H H      . TYR A 1 523 ? 4.415   -19.842 15.828  1.00 66.82  ?  584 TYR A H      1 
ATOM 8016  H HA     . TYR A 1 523 ? 2.771   -20.406 13.900  1.00 55.92  ?  584 TYR A HA     1 
ATOM 8017  H HB2    . TYR A 1 523 ? 4.664   -22.031 15.199  1.00 44.31  ?  584 TYR A HB2    1 
ATOM 8018  H HB3    . TYR A 1 523 ? 3.808   -22.577 13.978  1.00 44.31  ?  584 TYR A HB3    1 
ATOM 8019  H HD1    . TYR A 1 523 ? 6.752   -21.096 14.717  1.00 30.48  ?  584 TYR A HD1    1 
ATOM 8020  H HD2    . TYR A 1 523 ? 4.021   -21.175 11.803  1.00 60.19  ?  584 TYR A HD2    1 
ATOM 8021  H HE1    . TYR A 1 523 ? 8.304   -20.243 13.243  1.00 43.49  ?  584 TYR A HE1    1 
ATOM 8022  H HE2    . TYR A 1 523 ? 5.568   -20.323 10.325  1.00 81.47  ?  584 TYR A HE2    1 
ATOM 8023  H HH     . TYR A 1 523 ? 8.740   -19.572 11.152  1.00 69.97  ?  584 TYR A HH     1 
ATOM 8024  N N      . MET A 1 524 ? 1.936   -21.702 16.688  1.00 51.46  ?  585 MET A N      1 
ATOM 8025  C CA     . MET A 1 524 ? 0.778   -22.248 17.385  1.00 60.14  ?  585 MET A CA     1 
ATOM 8026  C C      . MET A 1 524 ? -0.394  -21.281 17.317  1.00 63.24  ?  585 MET A C      1 
ATOM 8027  O O      . MET A 1 524 ? -1.491  -21.645 16.878  1.00 60.06  ?  585 MET A O      1 
ATOM 8028  C CB     . MET A 1 524 ? 1.141   -22.549 18.840  1.00 57.09  ?  585 MET A CB     1 
ATOM 8029  C CG     . MET A 1 524 ? -0.052  -22.856 19.744  1.00 60.58  ?  585 MET A CG     1 
ATOM 8030  S SD     . MET A 1 524 ? 0.424   -23.068 21.469  1.00 82.94  ?  585 MET A SD     1 
ATOM 8031  C CE     . MET A 1 524 ? 0.985   -21.418 21.872  1.00 68.80  ?  585 MET A CE     1 
ATOM 8032  H H      . MET A 1 524 ? 2.603   -21.510 17.196  1.00 61.75  ?  585 MET A H      1 
ATOM 8033  H HA     . MET A 1 524 ? 0.522   -23.083 16.963  1.00 72.17  ?  585 MET A HA     1 
ATOM 8034  H HB2    . MET A 1 524 ? 1.729   -23.320 18.859  1.00 68.51  ?  585 MET A HB2    1 
ATOM 8035  H HB3    . MET A 1 524 ? 1.600   -21.779 19.210  1.00 68.51  ?  585 MET A HB3    1 
ATOM 8036  H HG2    . MET A 1 524 ? -0.683  -22.121 19.694  1.00 72.70  ?  585 MET A HG2    1 
ATOM 8037  H HG3    . MET A 1 524 ? -0.472  -23.677 19.445  1.00 72.70  ?  585 MET A HG3    1 
ATOM 8038  H HE1    . MET A 1 524 ? 1.725   -21.186 21.289  1.00 82.55  ?  585 MET A HE1    1 
ATOM 8039  H HE2    . MET A 1 524 ? 0.253   -20.796 21.742  1.00 82.55  ?  585 MET A HE2    1 
ATOM 8040  H HE3    . MET A 1 524 ? 1.275   -21.401 22.797  1.00 82.55  ?  585 MET A HE3    1 
ATOM 8041  N N      . LEU A 1 525 ? -0.176  -20.038 17.750  1.00 59.53  ?  586 LEU A N      1 
ATOM 8042  C CA     . LEU A 1 525 ? -1.258  -19.063 17.783  1.00 48.86  ?  586 LEU A CA     1 
ATOM 8043  C C      . LEU A 1 525 ? -1.845  -18.831 16.399  1.00 50.81  ?  586 LEU A C      1 
ATOM 8044  O O      . LEU A 1 525 ? -3.029  -18.500 16.276  1.00 56.55  ?  586 LEU A O      1 
ATOM 8045  C CB     . LEU A 1 525 ? -0.749  -17.754 18.379  1.00 40.83  ?  586 LEU A CB     1 
ATOM 8046  C CG     . LEU A 1 525 ? -0.344  -17.827 19.851  1.00 34.82  ?  586 LEU A CG     1 
ATOM 8047  C CD1    . LEU A 1 525 ? 0.398   -16.573 20.252  1.00 41.63  ?  586 LEU A CD1    1 
ATOM 8048  C CD2    . LEU A 1 525 ? -1.565  -18.022 20.733  1.00 51.47  ?  586 LEU A CD2    1 
ATOM 8049  H H      . LEU A 1 525 ? 0.581   -19.740 18.026  1.00 71.44  ?  586 LEU A H      1 
ATOM 8050  H HA     . LEU A 1 525 ? -1.966  -19.397 18.356  1.00 58.63  ?  586 LEU A HA     1 
ATOM 8051  H HB2    . LEU A 1 525 ? 0.030   -17.468 17.876  1.00 49.00  ?  586 LEU A HB2    1 
ATOM 8052  H HB3    . LEU A 1 525 ? -1.449  -17.087 18.301  1.00 49.00  ?  586 LEU A HB3    1 
ATOM 8053  H HG     . LEU A 1 525 ? 0.248   -18.584 19.982  1.00 41.79  ?  586 LEU A HG     1 
ATOM 8054  H HD11   . LEU A 1 525 ? 0.646   -16.639 21.187  1.00 49.96  ?  586 LEU A HD11   1 
ATOM 8055  H HD12   . LEU A 1 525 ? 1.194   -16.489 19.703  1.00 49.96  ?  586 LEU A HD12   1 
ATOM 8056  H HD13   . LEU A 1 525 ? -0.180  -15.807 20.115  1.00 49.96  ?  586 LEU A HD13   1 
ATOM 8057  H HD21   . LEU A 1 525 ? -1.282  -18.065 21.659  1.00 61.77  ?  586 LEU A HD21   1 
ATOM 8058  H HD22   . LEU A 1 525 ? -2.169  -17.273 20.605  1.00 61.77  ?  586 LEU A HD22   1 
ATOM 8059  H HD23   . LEU A 1 525 ? -2.006  -18.849 20.482  1.00 61.77  ?  586 LEU A HD23   1 
ATOM 8060  N N      . GLU A 1 526 ? -1.042  -19.001 15.348  1.00 45.00  ?  587 GLU A N      1 
ATOM 8061  C CA     . GLU A 1 526 ? -1.572  -18.889 13.995  1.00 53.38  ?  587 GLU A CA     1 
ATOM 8062  C C      . GLU A 1 526 ? -2.644  -19.937 13.732  1.00 68.55  ?  587 GLU A C      1 
ATOM 8063  O O      . GLU A 1 526 ? -3.523  -19.729 12.888  1.00 67.36  ?  587 GLU A O      1 
ATOM 8064  C CB     . GLU A 1 526 ? -0.440  -19.025 12.977  1.00 48.07  ?  587 GLU A CB     1 
ATOM 8065  C CG     . GLU A 1 526 ? -0.894  -18.986 11.527  1.00 49.25  ?  587 GLU A CG     1 
ATOM 8066  C CD     . GLU A 1 526 ? 0.255   -19.150 10.558  1.00 69.41  ?  587 GLU A CD     1 
ATOM 8067  O OE1    . GLU A 1 526 ? 1.414   -19.208 11.016  1.00 62.50  ?  587 GLU A OE1    1 
ATOM 8068  O OE2    . GLU A 1 526 ? 0.001   -19.223 9.338   1.00 75.85  -1 587 GLU A OE2    1 
ATOM 8069  H H      . GLU A 1 526 ? -0.201  -19.179 15.392  1.00 54.00  ?  587 GLU A H      1 
ATOM 8070  H HA     . GLU A 1 526 ? -1.974  -18.013 13.884  1.00 64.05  ?  587 GLU A HA     1 
ATOM 8071  H HB2    . GLU A 1 526 ? 0.186   -18.296 13.110  1.00 57.68  ?  587 GLU A HB2    1 
ATOM 8072  H HB3    . GLU A 1 526 ? 0.009   -19.872 13.123  1.00 57.68  ?  587 GLU A HB3    1 
ATOM 8073  H HG2    . GLU A 1 526 ? -1.524  -19.708 11.373  1.00 59.10  ?  587 GLU A HG2    1 
ATOM 8074  H HG3    . GLU A 1 526 ? -1.318  -18.131 11.351  1.00 59.10  ?  587 GLU A HG3    1 
ATOM 8075  N N      . LEU A 1 527 ? -2.588  -21.062 14.442  1.00 77.66  ?  588 LEU A N      1 
ATOM 8076  C CA     . LEU A 1 527 ? -3.524  -22.159 14.242  1.00 71.61  ?  588 LEU A CA     1 
ATOM 8077  C C      . LEU A 1 527 ? -4.692  -22.135 15.216  1.00 68.88  ?  588 LEU A C      1 
ATOM 8078  O O      . LEU A 1 527 ? -5.767  -22.644 14.887  1.00 69.14  ?  588 LEU A O      1 
ATOM 8079  C CB     . LEU A 1 527 ? -2.783  -23.495 14.365  1.00 65.43  ?  588 LEU A CB     1 
ATOM 8080  C CG     . LEU A 1 527 ? -1.605  -23.648 13.397  1.00 62.35  ?  588 LEU A CG     1 
ATOM 8081  C CD1    . LEU A 1 527 ? -0.698  -24.793 13.806  1.00 72.61  ?  588 LEU A CD1    1 
ATOM 8082  C CD2    . LEU A 1 527 ? -2.101  -23.855 11.976  1.00 64.88  ?  588 LEU A CD2    1 
ATOM 8083  H H      . LEU A 1 527 ? -2.006  -21.213 15.057  1.00 93.19  ?  588 LEU A H      1 
ATOM 8084  H HA     . LEU A 1 527 ? -3.885  -22.102 13.343  1.00 85.93  ?  588 LEU A HA     1 
ATOM 8085  H HB2    . LEU A 1 527 ? -2.437  -23.577 15.268  1.00 78.52  ?  588 LEU A HB2    1 
ATOM 8086  H HB3    . LEU A 1 527 ? -3.408  -24.215 14.187  1.00 78.52  ?  588 LEU A HB3    1 
ATOM 8087  H HG     . LEU A 1 527 ? -1.079  -22.833 13.412  1.00 74.82  ?  588 LEU A HG     1 
ATOM 8088  H HD11   . LEU A 1 527 ? 0.033   -24.858 13.172  1.00 87.13  ?  588 LEU A HD11   1 
ATOM 8089  H HD12   . LEU A 1 527 ? -0.351  -24.618 14.695  1.00 87.13  ?  588 LEU A HD12   1 
ATOM 8090  H HD13   . LEU A 1 527 ? -1.210  -25.616 13.807  1.00 87.13  ?  588 LEU A HD13   1 
ATOM 8091  H HD21   . LEU A 1 527 ? -1.338  -23.949 11.385  1.00 77.86  ?  588 LEU A HD21   1 
ATOM 8092  H HD22   . LEU A 1 527 ? -2.644  -24.658 11.945  1.00 77.86  ?  588 LEU A HD22   1 
ATOM 8093  H HD23   . LEU A 1 527 ? -2.632  -23.087 11.712  1.00 77.86  ?  588 LEU A HD23   1 
ATOM 8094  N N      . VAL A 1 528 ? -4.507  -21.556 16.402  1.00 64.67  ?  589 VAL A N      1 
ATOM 8095  C CA     . VAL A 1 528 ? -5.603  -21.407 17.348  1.00 71.93  ?  589 VAL A CA     1 
ATOM 8096  C C      . VAL A 1 528 ? -6.605  -20.398 16.805  1.00 82.71  ?  589 VAL A C      1 
ATOM 8097  O O      . VAL A 1 528 ? -6.229  -19.331 16.302  1.00 86.36  ?  589 VAL A O      1 
ATOM 8098  C CB     . VAL A 1 528 ? -5.064  -20.969 18.721  1.00 79.06  ?  589 VAL A CB     1 
ATOM 8099  C CG1    . VAL A 1 528 ? -6.193  -20.852 19.731  1.00 80.37  ?  589 VAL A CG1    1 
ATOM 8100  C CG2    . VAL A 1 528 ? -4.007  -21.944 19.213  1.00 73.85  ?  589 VAL A CG2    1 
ATOM 8101  H H      . VAL A 1 528 ? -3.756  -21.242 16.679  1.00 77.60  ?  589 VAL A H      1 
ATOM 8102  H HA     . VAL A 1 528 ? -6.055  -22.259 17.455  1.00 86.31  ?  589 VAL A HA     1 
ATOM 8103  H HB     . VAL A 1 528 ? -4.649  -20.097 18.633  1.00 94.87  ?  589 VAL A HB     1 
ATOM 8104  H HG11   . VAL A 1 528 ? -5.824  -20.575 20.585  1.00 96.44  ?  589 VAL A HG11   1 
ATOM 8105  H HG12   . VAL A 1 528 ? -6.830  -20.192 19.417  1.00 96.44  ?  589 VAL A HG12   1 
ATOM 8106  H HG13   . VAL A 1 528 ? -6.626  -21.715 19.822  1.00 96.44  ?  589 VAL A HG13   1 
ATOM 8107  H HG21   . VAL A 1 528 ? -3.683  -21.648 20.078  1.00 88.63  ?  589 VAL A HG21   1 
ATOM 8108  H HG22   . VAL A 1 528 ? -4.404  -22.826 19.293  1.00 88.63  ?  589 VAL A HG22   1 
ATOM 8109  H HG23   . VAL A 1 528 ? -3.276  -21.966 18.576  1.00 88.63  ?  589 VAL A HG23   1 
ATOM 8110  N N      . ASN A 1 529 ? -7.891  -20.725 16.912  1.00 84.16  ?  590 ASN A N      1 
ATOM 8111  C CA     . ASN A 1 529 ? -8.954  -19.891 16.355  1.00 82.96  ?  590 ASN A CA     1 
ATOM 8112  C C      . ASN A 1 529 ? -10.161 -19.861 17.291  1.00 90.94  ?  590 ASN A C      1 
ATOM 8113  O O      . ASN A 1 529 ? -11.305 -20.040 16.873  1.00 110.22 ?  590 ASN A O      1 
ATOM 8114  C CB     . ASN A 1 529 ? -9.363  -20.385 14.968  1.00 82.47  ?  590 ASN A CB     1 
ATOM 8115  C CG     . ASN A 1 529 ? -8.347  -20.039 13.900  1.00 72.55  ?  590 ASN A CG     1 
ATOM 8116  O OD1    . ASN A 1 529 ? -7.469  -19.205 14.110  1.00 68.85  ?  590 ASN A OD1    1 
ATOM 8117  N ND2    . ASN A 1 529 ? -8.473  -20.668 12.739  1.00 76.74  ?  590 ASN A ND2    1 
ATOM 8118  H H      . ASN A 1 529 ? -8.177  -21.433 17.308  1.00 100.99 ?  590 ASN A H      1 
ATOM 8119  H HA     . ASN A 1 529 ? -8.626  -18.983 16.263  1.00 99.55  ?  590 ASN A HA     1 
ATOM 8120  H HB2    . ASN A 1 529 ? -9.456  -21.351 14.992  1.00 98.97  ?  590 ASN A HB2    1 
ATOM 8121  H HB3    . ASN A 1 529 ? -10.208 -19.976 14.723  1.00 98.97  ?  590 ASN A HB3    1 
ATOM 8122  H HD21   . ASN A 1 529 ? -7.921  -20.506 12.100  1.00 92.09  ?  590 ASN A HD21   1 
ATOM 8123  H HD22   . ASN A 1 529 ? -9.107  -21.238 12.625  1.00 92.09  ?  590 ASN A HD22   1 
ATOM 8124  N N      . THR A 1 530 ? -9.915  -19.622 18.573  1.00 80.58  ?  591 THR A N      1 
ATOM 8125  C CA     . THR A 1 530 ? -10.992 -19.479 19.549  1.00 83.63  ?  591 THR A CA     1 
ATOM 8126  C C      . THR A 1 530 ? -10.522 -18.532 20.634  1.00 66.61  ?  591 THR A C      1 
ATOM 8127  O O      . THR A 1 530 ? -9.318  -18.298 20.789  1.00 75.77  ?  591 THR A O      1 
ATOM 8128  C CB     . THR A 1 530 ? -11.403 -20.836 20.142  1.00 91.75  ?  591 THR A CB     1 
ATOM 8129  O OG1    . THR A 1 530 ? -10.245 -21.551 20.587  1.00 103.83 ?  591 THR A OG1    1 
ATOM 8130  C CG2    . THR A 1 530 ? -12.152 -21.679 19.111  1.00 80.94  ?  591 THR A CG2    1 
ATOM 8131  H H      . THR A 1 530 ? -9.128  -19.538 18.907  1.00 96.70  ?  591 THR A H      1 
ATOM 8132  H HA     . THR A 1 530 ? -11.767 -19.088 19.116  1.00 100.36 ?  591 THR A HA     1 
ATOM 8133  H HB     . THR A 1 530 ? -11.994 -20.687 20.896  1.00 110.10 ?  591 THR A HB     1 
ATOM 8134  H HG1    . THR A 1 530 ? -10.471 -22.292 20.911  1.00 124.59 ?  591 THR A HG1    1 
ATOM 8135  H HG21   . THR A 1 530 ? -12.405 -22.531 19.500  1.00 97.12  ?  591 THR A HG21   1 
ATOM 8136  H HG22   . THR A 1 530 ? -12.954 -21.214 18.823  1.00 97.12  ?  591 THR A HG22   1 
ATOM 8137  H HG23   . THR A 1 530 ? -11.586 -21.839 18.340  1.00 97.12  ?  591 THR A HG23   1 
ATOM 8138  N N      . PRO A 1 531 ? -11.447 -17.954 21.412  1.00 70.40  ?  592 PRO A N      1 
ATOM 8139  C CA     . PRO A 1 531 ? -11.063 -16.916 22.374  1.00 84.22  ?  592 PRO A CA     1 
ATOM 8140  C C      . PRO A 1 531 ? -9.990  -17.389 23.345  1.00 83.52  ?  592 PRO A C      1 
ATOM 8141  O O      . PRO A 1 531 ? -9.721  -18.583 23.491  1.00 76.95  ?  592 PRO A O      1 
ATOM 8142  C CB     . PRO A 1 531 ? -12.375 -16.609 23.107  1.00 91.20  ?  592 PRO A CB     1 
ATOM 8143  C CG     . PRO A 1 531 ? -13.443 -17.020 22.161  1.00 81.18  ?  592 PRO A CG     1 
ATOM 8144  C CD     . PRO A 1 531 ? -12.899 -18.203 21.421  1.00 73.73  ?  592 PRO A CD     1 
ATOM 8145  H HA     . PRO A 1 531 ? -10.756 -16.120 21.913  1.00 101.06 ?  592 PRO A HA     1 
ATOM 8146  H HB2    . PRO A 1 531 ? -12.422 -17.127 23.926  1.00 109.44 ?  592 PRO A HB2    1 
ATOM 8147  H HB3    . PRO A 1 531 ? -12.429 -15.659 23.297  1.00 109.44 ?  592 PRO A HB3    1 
ATOM 8148  H HG2    . PRO A 1 531 ? -14.240 -17.265 22.657  1.00 97.42  ?  592 PRO A HG2    1 
ATOM 8149  H HG3    . PRO A 1 531 ? -13.633 -16.292 21.548  1.00 97.42  ?  592 PRO A HG3    1 
ATOM 8150  H HD2    . PRO A 1 531 ? -13.100 -19.023 21.899  1.00 88.48  ?  592 PRO A HD2    1 
ATOM 8151  H HD3    . PRO A 1 531 ? -13.245 -18.224 20.515  1.00 88.48  ?  592 PRO A HD3    1 
ATOM 8152  N N      . LEU A 1 532 ? -9.365  -16.415 24.016  1.00 86.64  ?  593 LEU A N      1 
ATOM 8153  C CA     . LEU A 1 532 ? -8.354  -16.721 25.023  1.00 86.40  ?  593 LEU A CA     1 
ATOM 8154  C C      . LEU A 1 532 ? -8.966  -17.239 26.317  1.00 88.23  ?  593 LEU A C      1 
ATOM 8155  O O      . LEU A 1 532 ? -8.352  -18.068 26.998  1.00 75.12  ?  593 LEU A O      1 
ATOM 8156  C CB     . LEU A 1 532 ? -7.515  -15.480 25.338  1.00 81.73  ?  593 LEU A CB     1 
ATOM 8157  C CG     . LEU A 1 532 ? -6.609  -14.881 24.259  1.00 80.48  ?  593 LEU A CG     1 
ATOM 8158  C CD1    . LEU A 1 532 ? -5.429  -14.179 24.915  1.00 79.81  ?  593 LEU A CD1    1 
ATOM 8159  C CD2    . LEU A 1 532 ? -6.127  -15.924 23.271  1.00 89.78  ?  593 LEU A CD2    1 
ATOM 8160  H H      . LEU A 1 532 ? -9.510  -15.575 23.905  1.00 103.97 ?  593 LEU A H      1 
ATOM 8161  H HA     . LEU A 1 532 ? -7.760  -17.405 24.677  1.00 103.68 ?  593 LEU A HA     1 
ATOM 8162  H HB2    . LEU A 1 532 ? -8.126  -14.776 25.606  1.00 98.07  ?  593 LEU A HB2    1 
ATOM 8163  H HB3    . LEU A 1 532 ? -6.942  -15.699 26.089  1.00 98.07  ?  593 LEU A HB3    1 
ATOM 8164  H HG     . LEU A 1 532 ? -7.112  -14.215 23.765  1.00 96.57  ?  593 LEU A HG     1 
ATOM 8165  H HD11   . LEU A 1 532 ? -4.862  -13.803 24.223  1.00 95.77  ?  593 LEU A HD11   1 
ATOM 8166  H HD12   . LEU A 1 532 ? -5.763  -13.472 25.490  1.00 95.77  ?  593 LEU A HD12   1 
ATOM 8167  H HD13   . LEU A 1 532 ? -4.930  -14.824 25.439  1.00 95.77  ?  593 LEU A HD13   1 
ATOM 8168  H HD21   . LEU A 1 532 ? -5.559  -15.495 22.612  1.00 107.74 ?  593 LEU A HD21   1 
ATOM 8169  H HD22   . LEU A 1 532 ? -5.625  -16.603 23.749  1.00 107.74 ?  593 LEU A HD22   1 
ATOM 8170  H HD23   . LEU A 1 532 ? -6.895  -16.325 22.836  1.00 107.74 ?  593 LEU A HD23   1 
ATOM 8171  N N      . THR A 1 533 ? -10.154 -16.753 26.678  1.00 91.01  ?  594 THR A N      1 
ATOM 8172  C CA     . THR A 1 533 ? -10.785 -17.189 27.917  1.00 93.52  ?  594 THR A CA     1 
ATOM 8173  C C      . THR A 1 533 ? -10.964 -18.699 27.943  1.00 102.23 ?  594 THR A C      1 
ATOM 8174  O O      . THR A 1 533 ? -10.878 -19.317 29.010  1.00 105.78 ?  594 THR A O      1 
ATOM 8175  C CB     . THR A 1 533 ? -12.140 -16.503 28.091  1.00 86.32  ?  594 THR A CB     1 
ATOM 8176  O OG1    . THR A 1 533 ? -13.047 -16.977 27.089  1.00 82.72  ?  594 THR A OG1    1 
ATOM 8177  C CG2    . THR A 1 533 ? -12.007 -14.988 27.972  1.00 81.04  ?  594 THR A CG2    1 
ATOM 8178  H H      . THR A 1 533 ? -10.608 -16.177 26.228  1.00 109.22 ?  594 THR A H      1 
ATOM 8179  H HA     . THR A 1 533 ? -10.222 -16.939 28.666  1.00 112.23 ?  594 THR A HA     1 
ATOM 8180  H HB     . THR A 1 533 ? -12.495 -16.710 28.969  1.00 103.59 ?  594 THR A HB     1 
ATOM 8181  H HG1    . THR A 1 533 ? -13.795 -16.604 27.178  1.00 99.27  ?  594 THR A HG1    1 
ATOM 8182  H HG21   . THR A 1 533 ? -12.874 -14.569 28.084  1.00 97.25  ?  594 THR A HG21   1 
ATOM 8183  H HG22   . THR A 1 533 ? -11.405 -14.654 28.655  1.00 97.25  ?  594 THR A HG22   1 
ATOM 8184  H HG23   . THR A 1 533 ? -11.654 -14.753 27.099  1.00 97.25  ?  594 THR A HG23   1 
ATOM 8185  N N      . GLU A 1 534 ? -11.205 -19.308 26.782  1.00 101.48 ?  595 GLU A N      1 
ATOM 8186  C CA     . GLU A 1 534 ? -11.423 -20.745 26.711  1.00 93.37  ?  595 GLU A CA     1 
ATOM 8187  C C      . GLU A 1 534 ? -10.126 -21.538 26.803  1.00 91.44  ?  595 GLU A C      1 
ATOM 8188  O O      . GLU A 1 534 ? -10.173 -22.747 27.049  1.00 101.94 ?  595 GLU A O      1 
ATOM 8189  C CB     . GLU A 1 534 ? -12.157 -21.095 25.415  1.00 90.51  ?  595 GLU A CB     1 
ATOM 8190  C CG     . GLU A 1 534 ? -13.291 -20.136 25.082  1.00 100.21 ?  595 GLU A CG     1 
ATOM 8191  C CD     . GLU A 1 534 ? -14.230 -20.683 24.026  1.00 118.35 ?  595 GLU A CD     1 
ATOM 8192  O OE1    . GLU A 1 534 ? -13.898 -21.717 23.410  1.00 112.75 ?  595 GLU A OE1    1 
ATOM 8193  O OE2    . GLU A 1 534 ? -15.302 -20.078 23.815  1.00 121.03 -1 595 GLU A OE2    1 
ATOM 8194  H H      . GLU A 1 534 ? -11.247 -18.908 26.022  1.00 121.78 ?  595 GLU A H      1 
ATOM 8195  H HA     . GLU A 1 534 ? -11.988 -21.013 27.454  1.00 112.04 ?  595 GLU A HA     1 
ATOM 8196  H HB2    . GLU A 1 534 ? -11.523 -21.073 24.681  1.00 108.61 ?  595 GLU A HB2    1 
ATOM 8197  H HB3    . GLU A 1 534 ? -12.534 -21.985 25.498  1.00 108.61 ?  595 GLU A HB3    1 
ATOM 8198  H HG2    . GLU A 1 534 ? -13.808 -19.968 25.885  1.00 120.26 ?  595 GLU A HG2    1 
ATOM 8199  H HG3    . GLU A 1 534 ? -12.915 -19.307 24.748  1.00 120.26 ?  595 GLU A HG3    1 
ATOM 8200  N N      . ASN A 1 535 ? -8.979  -20.889 26.615  1.00 93.74  ?  596 ASN A N      1 
ATOM 8201  C CA     . ASN A 1 535 ? -7.671  -21.527 26.748  1.00 86.10  ?  596 ASN A CA     1 
ATOM 8202  C C      . ASN A 1 535 ? -6.863  -20.711 27.752  1.00 80.94  ?  596 ASN A C      1 
ATOM 8203  O O      . ASN A 1 535 ? -6.241  -19.707 27.393  1.00 80.40  ?  596 ASN A O      1 
ATOM 8204  C CB     . ASN A 1 535 ? -6.964  -21.616 25.401  1.00 84.56  ?  596 ASN A CB     1 
ATOM 8205  C CG     . ASN A 1 535 ? -7.845  -22.209 24.322  1.00 94.54  ?  596 ASN A CG     1 
ATOM 8206  O OD1    . ASN A 1 535 ? -7.911  -23.427 24.159  1.00 97.35  ?  596 ASN A OD1    1 
ATOM 8207  N ND2    . ASN A 1 535 ? -8.530  -21.349 23.580  1.00 91.10  ?  596 ASN A ND2    1 
ATOM 8208  H H      . ASN A 1 535 ? -8.932  -20.057 26.403  1.00 112.49 ?  596 ASN A H      1 
ATOM 8209  H HA     . ASN A 1 535 ? -7.781  -22.424 27.098  1.00 103.33 ?  596 ASN A HA     1 
ATOM 8210  H HB2    . ASN A 1 535 ? -6.704  -20.724 25.120  1.00 101.47 ?  596 ASN A HB2    1 
ATOM 8211  H HB3    . ASN A 1 535 ? -6.179  -22.178 25.491  1.00 101.47 ?  596 ASN A HB3    1 
ATOM 8212  H HD21   . ASN A 1 535 ? -9.045  -21.636 22.954  1.00 109.32 ?  596 ASN A HD21   1 
ATOM 8213  H HD22   . ASN A 1 535 ? -8.459  -20.504 23.725  1.00 109.32 ?  596 ASN A HD22   1 
ATOM 8214  N N      . ILE A 1 536 ? -6.871  -21.152 29.011  1.00 78.52  ?  597 ILE A N      1 
ATOM 8215  C CA     . ILE A 1 536 ? -6.229  -20.387 30.074  1.00 77.02  ?  597 ILE A CA     1 
ATOM 8216  C C      . ILE A 1 536 ? -4.717  -20.368 29.902  1.00 64.81  ?  597 ILE A C      1 
ATOM 8217  O O      . ILE A 1 536 ? -4.050  -19.426 30.345  1.00 83.65  ?  597 ILE A O      1 
ATOM 8218  C CB     . ILE A 1 536 ? -6.626  -20.956 31.449  1.00 82.93  ?  597 ILE A CB     1 
ATOM 8219  C CG1    . ILE A 1 536 ? -5.962  -20.148 32.568  1.00 83.16  ?  597 ILE A CG1    1 
ATOM 8220  C CG2    . ILE A 1 536 ? -6.241  -22.430 31.552  1.00 89.20  ?  597 ILE A CG2    1 
ATOM 8221  C CD1    . ILE A 1 536 ? -6.407  -20.536 33.963  1.00 80.39  ?  597 ILE A CD1    1 
ATOM 8222  H H      . ILE A 1 536 ? -7.239  -21.884 29.271  1.00 94.23  ?  597 ILE A H      1 
ATOM 8223  H HA     . ILE A 1 536 ? -6.543  -19.470 30.031  1.00 92.42  ?  597 ILE A HA     1 
ATOM 8224  H HB     . ILE A 1 536 ? -7.588  -20.883 31.546  1.00 99.52  ?  597 ILE A HB     1 
ATOM 8225  H HG12   . ILE A 1 536 ? -5.002  -20.277 32.518  1.00 99.79  ?  597 ILE A HG12   1 
ATOM 8226  H HG13   . ILE A 1 536 ? -6.174  -19.210 32.441  1.00 99.79  ?  597 ILE A HG13   1 
ATOM 8227  H HG21   . ILE A 1 536 ? -6.500  -22.763 32.426  1.00 107.05 ?  597 ILE A HG21   1 
ATOM 8228  H HG22   . ILE A 1 536 ? -6.702  -22.926 30.858  1.00 107.05 ?  597 ILE A HG22   1 
ATOM 8229  H HG23   . ILE A 1 536 ? -5.281  -22.514 31.438  1.00 107.05 ?  597 ILE A HG23   1 
ATOM 8230  H HD11   . ILE A 1 536 ? -5.943  -19.980 34.608  1.00 96.47  ?  597 ILE A HD11   1 
ATOM 8231  H HD12   . ILE A 1 536 ? -7.365  -20.400 34.038  1.00 96.47  ?  597 ILE A HD12   1 
ATOM 8232  H HD13   . ILE A 1 536 ? -6.192  -21.469 34.115  1.00 96.47  ?  597 ILE A HD13   1 
ATOM 8233  N N      . LEU A 1 537 ? -4.147  -21.391 29.265  1.00 69.03  ?  598 LEU A N      1 
ATOM 8234  C CA     . LEU A 1 537 ? -2.694  -21.488 29.196  1.00 76.58  ?  598 LEU A CA     1 
ATOM 8235  C C      . LEU A 1 537 ? -2.097  -20.377 28.344  1.00 85.34  ?  598 LEU A C      1 
ATOM 8236  O O      . LEU A 1 537 ? -0.995  -19.900 28.637  1.00 78.35  ?  598 LEU A O      1 
ATOM 8237  C CB     . LEU A 1 537 ? -2.285  -22.854 28.650  1.00 83.53  ?  598 LEU A CB     1 
ATOM 8238  C CG     . LEU A 1 537 ? -2.936  -24.056 29.337  1.00 84.21  ?  598 LEU A CG     1 
ATOM 8239  C CD1    . LEU A 1 537 ? -2.360  -25.341 28.788  1.00 73.44  ?  598 LEU A CD1    1 
ATOM 8240  C CD2    . LEU A 1 537 ? -2.757  -24.001 30.845  1.00 75.23  ?  598 LEU A CD2    1 
ATOM 8241  H H      . LEU A 1 537 ? -4.571  -22.029 28.873  1.00 82.83  ?  598 LEU A H      1 
ATOM 8242  H HA     . LEU A 1 537 ? -2.332  -21.404 30.092  1.00 91.90  ?  598 LEU A HA     1 
ATOM 8243  H HB2    . LEU A 1 537 ? -2.521  -22.892 27.710  1.00 100.24 ?  598 LEU A HB2    1 
ATOM 8244  H HB3    . LEU A 1 537 ? -1.325  -22.948 28.747  1.00 100.24 ?  598 LEU A HB3    1 
ATOM 8245  H HG     . LEU A 1 537 ? -3.888  -24.049 29.148  1.00 101.05 ?  598 LEU A HG     1 
ATOM 8246  H HD11   . LEU A 1 537 ? -2.783  -26.092 29.233  1.00 88.12  ?  598 LEU A HD11   1 
ATOM 8247  H HD12   . LEU A 1 537 ? -2.533  -25.382 27.834  1.00 88.12  ?  598 LEU A HD12   1 
ATOM 8248  H HD13   . LEU A 1 537 ? -1.404  -25.354 28.952  1.00 88.12  ?  598 LEU A HD13   1 
ATOM 8249  H HD21   . LEU A 1 537 ? -3.182  -24.778 31.241  1.00 90.27  ?  598 LEU A HD21   1 
ATOM 8250  H HD22   . LEU A 1 537 ? -1.809  -24.002 31.050  1.00 90.27  ?  598 LEU A HD22   1 
ATOM 8251  H HD23   . LEU A 1 537 ? -3.168  -23.190 31.182  1.00 90.27  ?  598 LEU A HD23   1 
ATOM 8252  N N      . ILE A 1 538 ? -2.803  -19.951 27.296  1.00 94.53  ?  599 ILE A N      1 
ATOM 8253  C CA     . ILE A 1 538 ? -2.294  -18.876 26.449  1.00 75.77  ?  599 ILE A CA     1 
ATOM 8254  C C      . ILE A 1 538 ? -2.006  -17.643 27.292  1.00 72.92  ?  599 ILE A C      1 
ATOM 8255  O O      . ILE A 1 538 ? -0.912  -17.068 27.235  1.00 69.02  ?  599 ILE A O      1 
ATOM 8256  C CB     . ILE A 1 538 ? -3.288  -18.562 25.315  1.00 80.44  ?  599 ILE A CB     1 
ATOM 8257  C CG1    . ILE A 1 538 ? -3.556  -19.813 24.474  1.00 93.63  ?  599 ILE A CG1    1 
ATOM 8258  C CG2    . ILE A 1 538 ? -2.741  -17.450 24.428  1.00 84.55  ?  599 ILE A CG2    1 
ATOM 8259  C CD1    . ILE A 1 538 ? -4.649  -19.642 23.435  1.00 91.61  ?  599 ILE A CD1    1 
ATOM 8260  H H      . ILE A 1 538 ? -3.568  -20.263 27.057  1.00 113.43 ?  599 ILE A H      1 
ATOM 8261  H HA     . ILE A 1 538 ? -1.460  -19.163 26.044  1.00 90.92  ?  599 ILE A HA     1 
ATOM 8262  H HB     . ILE A 1 538 ? -4.124  -18.265 25.708  1.00 96.53  ?  599 ILE A HB     1 
ATOM 8263  H HG12   . ILE A 1 538 ? -2.741  -20.054 24.007  1.00 112.36 ?  599 ILE A HG12   1 
ATOM 8264  H HG13   . ILE A 1 538 ? -3.821  -20.534 25.065  1.00 112.36 ?  599 ILE A HG13   1 
ATOM 8265  H HG21   . ILE A 1 538 ? -3.380  -17.267 23.722  1.00 101.46 ?  599 ILE A HG21   1 
ATOM 8266  H HG22   . ILE A 1 538 ? -2.605  -16.655 24.966  1.00 101.46 ?  599 ILE A HG22   1 
ATOM 8267  H HG23   . ILE A 1 538 ? -1.897  -17.739 24.045  1.00 101.46 ?  599 ILE A HG23   1 
ATOM 8268  H HD11   . ILE A 1 538 ? -4.755  -20.474 22.949  1.00 109.93 ?  599 ILE A HD11   1 
ATOM 8269  H HD12   . ILE A 1 538 ? -5.477  -19.412 23.884  1.00 109.93 ?  599 ILE A HD12   1 
ATOM 8270  H HD13   . ILE A 1 538 ? -4.395  -18.932 22.825  1.00 109.93 ?  599 ILE A HD13   1 
ATOM 8271  N N      . ALA A 1 539 ? -2.983  -17.227 28.100  1.00 76.78  ?  600 ALA A N      1 
ATOM 8272  C CA     . ALA A 1 539 ? -2.811  -16.030 28.913  1.00 76.57  ?  600 ALA A CA     1 
ATOM 8273  C C      . ALA A 1 539 ? -1.604  -16.155 29.832  1.00 70.95  ?  600 ALA A C      1 
ATOM 8274  O O      . ALA A 1 539 ? -0.827  -15.205 29.982  1.00 79.44  ?  600 ALA A O      1 
ATOM 8275  C CB     . ALA A 1 539 ? -4.080  -15.765 29.723  1.00 62.13  ?  600 ALA A CB     1 
ATOM 8276  H H      . ALA A 1 539 ? -3.744  -17.617 28.192  1.00 92.14  ?  600 ALA A H      1 
ATOM 8277  H HA     . ALA A 1 539 ? -2.665  -15.269 28.329  1.00 91.88  ?  600 ALA A HA     1 
ATOM 8278  H HB1    . ALA A 1 539 ? -3.951  -14.967 30.258  1.00 74.56  ?  600 ALA A HB1    1 
ATOM 8279  H HB2    . ALA A 1 539 ? -4.823  -15.638 29.112  1.00 74.56  ?  600 ALA A HB2    1 
ATOM 8280  H HB3    . ALA A 1 539 ? -4.251  -16.526 30.299  1.00 74.56  ?  600 ALA A HB3    1 
ATOM 8281  N N      . SER A 1 540 ? -1.423  -17.322 30.453  1.00 70.46  ?  601 SER A N      1 
ATOM 8282  C CA     . SER A 1 540 ? -0.269  -17.521 31.321  1.00 76.47  ?  601 SER A CA     1 
ATOM 8283  C C      . SER A 1 540 ? 1.028   -17.363 30.540  1.00 78.19  ?  601 SER A C      1 
ATOM 8284  O O      . SER A 1 540 ? 1.930   -16.624 30.953  1.00 77.81  ?  601 SER A O      1 
ATOM 8285  C CB     . SER A 1 540 ? -0.337  -18.899 31.978  1.00 97.77  ?  601 SER A CB     1 
ATOM 8286  O OG     . SER A 1 540 ? 0.817   -19.143 32.761  1.00 103.62 ?  601 SER A OG     1 
ATOM 8287  H H      . SER A 1 540 ? -1.947  -18.001 30.389  1.00 84.55  ?  601 SER A H      1 
ATOM 8288  H HA     . SER A 1 540 ? -0.281  -16.852 32.023  1.00 91.77  ?  601 SER A HA     1 
ATOM 8289  H HB2    . SER A 1 540 ? -1.120  -18.938 32.549  1.00 117.33 ?  601 SER A HB2    1 
ATOM 8290  H HB3    . SER A 1 540 ? -0.398  -19.576 31.285  1.00 117.33 ?  601 SER A HB3    1 
ATOM 8291  H HG     . SER A 1 540 ? 0.768   -19.903 33.117  1.00 124.34 ?  601 SER A HG     1 
ATOM 8292  N N      . LEU A 1 541 ? 1.140   -18.054 29.404  1.00 77.50  ?  602 LEU A N      1 
ATOM 8293  C CA     . LEU A 1 541 ? 2.300   -17.874 28.540  1.00 74.85  ?  602 LEU A CA     1 
ATOM 8294  C C      . LEU A 1 541 ? 2.494   -16.405 28.204  1.00 80.50  ?  602 LEU A C      1 
ATOM 8295  O O      . LEU A 1 541 ? 3.587   -15.853 28.371  1.00 89.12  ?  602 LEU A O      1 
ATOM 8296  C CB     . LEU A 1 541 ? 2.132   -18.696 27.262  1.00 77.33  ?  602 LEU A CB     1 
ATOM 8297  C CG     . LEU A 1 541 ? 3.075   -18.347 26.105  1.00 58.98  ?  602 LEU A CG     1 
ATOM 8298  C CD1    . LEU A 1 541 ? 4.525   -18.586 26.493  1.00 65.04  ?  602 LEU A CD1    1 
ATOM 8299  C CD2    . LEU A 1 541 ? 2.712   -19.139 24.865  1.00 69.06  ?  602 LEU A CD2    1 
ATOM 8300  H H      . LEU A 1 541 ? 0.564   -18.624 29.117  1.00 93.00  ?  602 LEU A H      1 
ATOM 8301  H HA     . LEU A 1 541 ? 3.093   -18.188 29.001  1.00 89.82  ?  602 LEU A HA     1 
ATOM 8302  H HB2    . LEU A 1 541 ? 2.276   -19.630 27.479  1.00 92.80  ?  602 LEU A HB2    1 
ATOM 8303  H HB3    . LEU A 1 541 ? 1.225   -18.577 26.940  1.00 92.80  ?  602 LEU A HB3    1 
ATOM 8304  H HG     . LEU A 1 541 ? 2.976   -17.405 25.895  1.00 70.78  ?  602 LEU A HG     1 
ATOM 8305  H HD11   . LEU A 1 541 ? 5.094   -18.356 25.741  1.00 78.05  ?  602 LEU A HD11   1 
ATOM 8306  H HD12   . LEU A 1 541 ? 4.744   -18.029 27.256  1.00 78.05  ?  602 LEU A HD12   1 
ATOM 8307  H HD13   . LEU A 1 541 ? 4.641   -19.521 26.722  1.00 78.05  ?  602 LEU A HD13   1 
ATOM 8308  H HD21   . LEU A 1 541 ? 3.322   -18.901 24.149  1.00 82.88  ?  602 LEU A HD21   1 
ATOM 8309  H HD22   . LEU A 1 541 ? 2.787   -20.086 25.062  1.00 82.88  ?  602 LEU A HD22   1 
ATOM 8310  H HD23   . LEU A 1 541 ? 1.802   -18.925 24.609  1.00 82.88  ?  602 LEU A HD23   1 
ATOM 8311  N N      . MET A 1 542 ? 1.432   -15.753 27.732  1.00 83.12  ?  603 MET A N      1 
ATOM 8312  C CA     . MET A 1 542 ? 1.542   -14.353 27.345  1.00 74.33  ?  603 MET A CA     1 
ATOM 8313  C C      . MET A 1 542 ? 2.036   -13.503 28.506  1.00 70.85  ?  603 MET A C      1 
ATOM 8314  O O      . MET A 1 542 ? 2.874   -12.613 28.321  1.00 73.15  ?  603 MET A O      1 
ATOM 8315  C CB     . MET A 1 542 ? 0.193   -13.846 26.843  1.00 73.57  ?  603 MET A CB     1 
ATOM 8316  C CG     . MET A 1 542 ? 0.140   -12.353 26.588  1.00 76.32  ?  603 MET A CG     1 
ATOM 8317  S SD     . MET A 1 542 ? -1.423  -11.861 25.843  1.00 84.07  ?  603 MET A SD     1 
ATOM 8318  C CE     . MET A 1 542 ? -2.585  -12.360 27.112  1.00 77.24  ?  603 MET A CE     1 
ATOM 8319  H H      . MET A 1 542 ? 0.649   -16.094 27.628  1.00 99.74  ?  603 MET A H      1 
ATOM 8320  H HA     . MET A 1 542 ? 2.176   -14.280 26.614  1.00 89.20  ?  603 MET A HA     1 
ATOM 8321  H HB2    . MET A 1 542 ? -0.016  -14.294 26.008  1.00 88.29  ?  603 MET A HB2    1 
ATOM 8322  H HB3    . MET A 1 542 ? -0.483  -14.055 27.505  1.00 88.29  ?  603 MET A HB3    1 
ATOM 8323  H HG2    . MET A 1 542 ? 0.237   -11.881 27.430  1.00 91.58  ?  603 MET A HG2    1 
ATOM 8324  H HG3    . MET A 1 542 ? 0.855   -12.107 25.981  1.00 91.58  ?  603 MET A HG3    1 
ATOM 8325  H HE1    . MET A 1 542 ? -3.483  -12.142 26.820  1.00 92.69  ?  603 MET A HE1    1 
ATOM 8326  H HE2    . MET A 1 542 ? -2.505  -13.316 27.254  1.00 92.69  ?  603 MET A HE2    1 
ATOM 8327  H HE3    . MET A 1 542 ? -2.378  -11.886 27.933  1.00 92.69  ?  603 MET A HE3    1 
ATOM 8328  N N      . ASP A 1 543 ? 1.528   -13.762 29.711  1.00 85.56  ?  604 ASP A N      1 
ATOM 8329  C CA     . ASP A 1 543 ? 1.964   -13.003 30.876  1.00 80.60  ?  604 ASP A CA     1 
ATOM 8330  C C      . ASP A 1 543 ? 3.448   -13.192 31.148  1.00 71.23  ?  604 ASP A C      1 
ATOM 8331  O O      . ASP A 1 543 ? 4.103   -12.280 31.663  1.00 71.57  ?  604 ASP A O      1 
ATOM 8332  C CB     . ASP A 1 543 ? 1.150   -13.412 32.101  1.00 90.00  ?  604 ASP A CB     1 
ATOM 8333  C CG     . ASP A 1 543 ? -0.219  -12.768 32.129  1.00 91.58  ?  604 ASP A CG     1 
ATOM 8334  O OD1    . ASP A 1 543 ? -0.831  -12.717 33.216  1.00 101.14 ?  604 ASP A OD1    1 
ATOM 8335  O OD2    . ASP A 1 543 ? -0.680  -12.306 31.065  1.00 78.25  -1 604 ASP A OD2    1 
ATOM 8336  H H      . ASP A 1 543 ? 0.937   -14.365 29.877  1.00 102.67 ?  604 ASP A H      1 
ATOM 8337  H HA     . ASP A 1 543 ? 1.808   -12.059 30.713  1.00 96.72  ?  604 ASP A HA     1 
ATOM 8338  H HB2    . ASP A 1 543 ? 1.029   -14.374 32.094  1.00 108.00 ?  604 ASP A HB2    1 
ATOM 8339  H HB3    . ASP A 1 543 ? 1.626   -13.142 32.902  1.00 108.00 ?  604 ASP A HB3    1 
ATOM 8340  N N      . THR A 1 544 ? 4.000   -14.355 30.805  1.00 61.95  ?  605 THR A N      1 
ATOM 8341  C CA     . THR A 1 544 ? 5.396   -14.635 31.142  1.00 61.10  ?  605 THR A CA     1 
ATOM 8342  C C      . THR A 1 544 ? 6.347   -13.877 30.222  1.00 70.57  ?  605 THR A C      1 
ATOM 8343  O O      . THR A 1 544 ? 7.065   -12.977 30.668  1.00 93.44  ?  605 THR A O      1 
ATOM 8344  C CB     . THR A 1 544 ? 5.662   -16.143 31.094  1.00 72.15  ?  605 THR A CB     1 
ATOM 8345  O OG1    . THR A 1 544 ? 5.154   -16.688 29.870  1.00 91.95  ?  605 THR A OG1    1 
ATOM 8346  C CG2    . THR A 1 544 ? 5.007   -16.831 32.286  1.00 78.63  ?  605 THR A CG2    1 
ATOM 8347  H H      . THR A 1 544 ? 3.598   -14.988 30.386  1.00 74.35  ?  605 THR A H      1 
ATOM 8348  H HA     . THR A 1 544 ? 5.562   -14.335 32.050  1.00 73.32  ?  605 THR A HA     1 
ATOM 8349  H HB     . THR A 1 544 ? 6.618   -16.300 31.141  1.00 86.58  ?  605 THR A HB     1 
ATOM 8350  H HG1    . THR A 1 544 ? 4.326   -16.554 29.818  1.00 110.33 ?  605 THR A HG1    1 
ATOM 8351  H HG21   . THR A 1 544 ? 5.178   -17.785 32.253  1.00 94.35  ?  605 THR A HG21   1 
ATOM 8352  H HG22   . THR A 1 544 ? 5.369   -16.475 33.113  1.00 94.35  ?  605 THR A HG22   1 
ATOM 8353  H HG23   . THR A 1 544 ? 4.049   -16.681 32.270  1.00 94.35  ?  605 THR A HG23   1 
ATOM 8354  N N      . LEU A 1 545 ? 6.374   -14.223 28.931  1.00 61.02  ?  606 LEU A N      1 
ATOM 8355  C CA     . LEU A 1 545 ? 7.381   -13.680 28.026  1.00 71.34  ?  606 LEU A CA     1 
ATOM 8356  C C      . LEU A 1 545 ? 6.836   -12.819 26.897  1.00 78.96  ?  606 LEU A C      1 
ATOM 8357  O O      . LEU A 1 545 ? 7.545   -11.913 26.454  1.00 89.24  ?  606 LEU A O      1 
ATOM 8358  C CB     . LEU A 1 545 ? 8.220   -14.808 27.407  1.00 56.39  ?  606 LEU A CB     1 
ATOM 8359  C CG     . LEU A 1 545 ? 9.472   -15.212 28.188  1.00 84.87  ?  606 LEU A CG     1 
ATOM 8360  C CD1    . LEU A 1 545 ? 10.465  -14.065 28.314  1.00 66.15  ?  606 LEU A CD1    1 
ATOM 8361  C CD2    . LEU A 1 545 ? 9.093   -15.725 29.553  1.00 81.99  ?  606 LEU A CD2    1 
ATOM 8362  H H      . LEU A 1 545 ? 5.822   -14.768 28.560  1.00 73.23  ?  606 LEU A H      1 
ATOM 8363  H HA     . LEU A 1 545 ? 7.984   -13.124 28.544  1.00 85.61  ?  606 LEU A HA     1 
ATOM 8364  H HB2    . LEU A 1 545 ? 7.660   -15.597 27.328  1.00 67.67  ?  606 LEU A HB2    1 
ATOM 8365  H HB3    . LEU A 1 545 ? 8.507   -14.527 26.524  1.00 67.67  ?  606 LEU A HB3    1 
ATOM 8366  H HG     . LEU A 1 545 ? 9.914   -15.934 27.714  1.00 101.85 ?  606 LEU A HG     1 
ATOM 8367  H HD11   . LEU A 1 545 ? 11.237  -14.371 28.815  1.00 79.38  ?  606 LEU A HD11   1 
ATOM 8368  H HD12   . LEU A 1 545 ? 10.735  -13.784 27.426  1.00 79.38  ?  606 LEU A HD12   1 
ATOM 8369  H HD13   . LEU A 1 545 ? 10.038  -13.329 28.780  1.00 79.38  ?  606 LEU A HD13   1 
ATOM 8370  H HD21   . LEU A 1 545 ? 9.899   -15.976 30.031  1.00 98.39  ?  606 LEU A HD21   1 
ATOM 8371  H HD22   . LEU A 1 545 ? 8.626   -15.025 30.035  1.00 98.39  ?  606 LEU A HD22   1 
ATOM 8372  H HD23   . LEU A 1 545 ? 8.516   -16.498 29.450  1.00 98.39  ?  606 LEU A HD23   1 
ATOM 8373  N N      . ILE A 1 546 ? 5.618   -13.066 26.408  1.00 66.31  ?  607 ILE A N      1 
ATOM 8374  C CA     . ILE A 1 546 ? 5.089   -12.216 25.342  1.00 65.91  ?  607 ILE A CA     1 
ATOM 8375  C C      . ILE A 1 546 ? 5.168   -10.756 25.756  1.00 57.57  ?  607 ILE A C      1 
ATOM 8376  O O      . ILE A 1 546 ? 5.415   -9.871  24.929  1.00 54.74  ?  607 ILE A O      1 
ATOM 8377  C CB     . ILE A 1 546 ? 3.647   -12.621 24.979  1.00 62.22  ?  607 ILE A CB     1 
ATOM 8378  C CG1    . ILE A 1 546 ? 3.655   -13.968 24.247  1.00 57.74  ?  607 ILE A CG1    1 
ATOM 8379  C CG2    . ILE A 1 546 ? 2.975   -11.534 24.128  1.00 52.76  ?  607 ILE A CG2    1 
ATOM 8380  C CD1    . ILE A 1 546 ? 2.314   -14.401 23.673  1.00 67.54  ?  607 ILE A CD1    1 
ATOM 8381  H H      . ILE A 1 546 ? 5.095   -13.699 26.666  1.00 79.58  ?  607 ILE A H      1 
ATOM 8382  H HA     . ILE A 1 546 ? 5.638   -12.330 24.550  1.00 79.10  ?  607 ILE A HA     1 
ATOM 8383  H HB     . ILE A 1 546 ? 3.142   -12.722 25.800  1.00 74.66  ?  607 ILE A HB     1 
ATOM 8384  H HG12   . ILE A 1 546 ? 4.283   -13.914 23.510  1.00 69.29  ?  607 ILE A HG12   1 
ATOM 8385  H HG13   . ILE A 1 546 ? 3.941   -14.655 24.869  1.00 69.29  ?  607 ILE A HG13   1 
ATOM 8386  H HG21   . ILE A 1 546 ? 2.072   -11.815 23.914  1.00 63.31  ?  607 ILE A HG21   1 
ATOM 8387  H HG22   . ILE A 1 546 ? 2.955   -10.707 24.633  1.00 63.31  ?  607 ILE A HG22   1 
ATOM 8388  H HG23   . ILE A 1 546 ? 3.486   -11.412 23.312  1.00 63.31  ?  607 ILE A HG23   1 
ATOM 8389  H HD11   . ILE A 1 546 ? 2.422   -15.258 23.233  1.00 81.05  ?  607 ILE A HD11   1 
ATOM 8390  H HD12   . ILE A 1 546 ? 1.672   -14.477 24.396  1.00 81.05  ?  607 ILE A HD12   1 
ATOM 8391  H HD13   . ILE A 1 546 ? 2.015   -13.735 23.034  1.00 81.05  ?  607 ILE A HD13   1 
ATOM 8392  N N      . THR A 1 547 ? 4.970   -10.480 27.041  1.00 57.29  ?  608 THR A N      1 
ATOM 8393  C CA     . THR A 1 547 ? 4.973   -9.105  27.515  1.00 44.96  ?  608 THR A CA     1 
ATOM 8394  C C      . THR A 1 547 ? 6.413   -8.636  27.723  1.00 51.03  ?  608 THR A C      1 
ATOM 8395  O O      . THR A 1 547 ? 6.820   -7.650  27.097  1.00 68.06  ?  608 THR A O      1 
ATOM 8396  C CB     . THR A 1 547 ? 4.123   -8.978  28.783  1.00 51.05  ?  608 THR A CB     1 
ATOM 8397  O OG1    . THR A 1 547 ? 2.738   -9.081  28.433  1.00 40.28  ?  608 THR A OG1    1 
ATOM 8398  C CG2    . THR A 1 547 ? 4.348   -7.641  29.476  1.00 76.83  ?  608 THR A CG2    1 
ATOM 8399  H H      . THR A 1 547 ? 4.832   -11.068 27.653  1.00 68.75  ?  608 THR A H      1 
ATOM 8400  H HA     . THR A 1 547 ? 4.575   -8.540  26.835  1.00 53.95  ?  608 THR A HA     1 
ATOM 8401  H HB     . THR A 1 547 ? 4.354   -9.688  29.402  1.00 61.26  ?  608 THR A HB     1 
ATOM 8402  H HG1    . THR A 1 547 ? 2.261   -9.013  29.121  1.00 48.34  ?  608 THR A HG1    1 
ATOM 8403  H HG21   . THR A 1 547 ? 3.800   -7.585  30.274  1.00 92.20  ?  608 THR A HG21   1 
ATOM 8404  H HG22   . THR A 1 547 ? 5.281   -7.552  29.727  1.00 92.20  ?  608 THR A HG22   1 
ATOM 8405  H HG23   . THR A 1 547 ? 4.111   -6.915  28.879  1.00 92.20  ?  608 THR A HG23   1 
ATOM 8406  N N      . PRO A 1 548 ? 7.226   -9.296  28.573  1.00 52.64  ?  609 PRO A N      1 
ATOM 8407  C CA     . PRO A 1 548 ? 8.655   -8.951  28.621  1.00 56.41  ?  609 PRO A CA     1 
ATOM 8408  C C      . PRO A 1 548 ? 9.340   -8.967  27.266  1.00 50.10  ?  609 PRO A C      1 
ATOM 8409  O O      . PRO A 1 548 ? 10.375  -8.317  27.087  1.00 52.04  ?  609 PRO A O      1 
ATOM 8410  C CB     . PRO A 1 548 ? 9.234   -10.026 29.545  1.00 61.08  ?  609 PRO A CB     1 
ATOM 8411  C CG     . PRO A 1 548 ? 8.156   -10.244 30.513  1.00 61.08  ?  609 PRO A CG     1 
ATOM 8412  C CD     . PRO A 1 548 ? 6.855   -10.129 29.731  1.00 53.28  ?  609 PRO A CD     1 
ATOM 8413  H HA     . PRO A 1 548 ? 8.777   -8.080  29.030  1.00 67.69  ?  609 PRO A HA     1 
ATOM 8414  H HB2    . PRO A 1 548 ? 9.419   -10.834 29.040  1.00 73.30  ?  609 PRO A HB2    1 
ATOM 8415  H HB3    . PRO A 1 548 ? 10.034  -9.694  29.982  1.00 73.30  ?  609 PRO A HB3    1 
ATOM 8416  H HG2    . PRO A 1 548 ? 8.242   -11.129 30.900  1.00 73.30  ?  609 PRO A HG2    1 
ATOM 8417  H HG3    . PRO A 1 548 ? 8.198   -9.564  31.204  1.00 73.30  ?  609 PRO A HG3    1 
ATOM 8418  H HD2    . PRO A 1 548 ? 6.558   -11.004 29.437  1.00 63.93  ?  609 PRO A HD2    1 
ATOM 8419  H HD3    . PRO A 1 548 ? 6.178   -9.684  30.265  1.00 63.93  ?  609 PRO A HD3    1 
ATOM 8420  N N      . ALA A 1 549 ? 8.792   -9.713  26.307  1.00 49.68  ?  610 ALA A N      1 
ATOM 8421  C CA     . ALA A 1 549 ? 9.343   -9.674  24.957  1.00 49.88  ?  610 ALA A CA     1 
ATOM 8422  C C      . ALA A 1 549 ? 9.126   -8.308  24.324  1.00 47.59  ?  610 ALA A C      1 
ATOM 8423  O O      . ALA A 1 549 ? 10.018  -7.779  23.651  1.00 57.51  ?  610 ALA A O      1 
ATOM 8424  C CB     . ALA A 1 549 ? 8.717   -10.768 24.095  1.00 63.19  ?  610 ALA A CB     1 
ATOM 8425  H H      . ALA A 1 549 ? 8.117   -10.237 26.409  1.00 59.62  ?  610 ALA A H      1 
ATOM 8426  H HA     . ALA A 1 549 ? 10.298  -9.837  25.001  1.00 59.86  ?  610 ALA A HA     1 
ATOM 8427  H HB1    . ALA A 1 549 ? 9.097   -10.724 23.204  1.00 75.83  ?  610 ALA A HB1    1 
ATOM 8428  H HB2    . ALA A 1 549 ? 8.907   -11.632 24.494  1.00 75.83  ?  610 ALA A HB2    1 
ATOM 8429  H HB3    . ALA A 1 549 ? 7.758   -10.627 24.054  1.00 75.83  ?  610 ALA A HB3    1 
ATOM 8430  N N      . VAL A 1 550 ? 7.948   -7.720  24.535  1.00 52.66  ?  611 VAL A N      1 
ATOM 8431  C CA     . VAL A 1 550 ? 7.678   -6.382  24.020  1.00 45.92  ?  611 VAL A CA     1 
ATOM 8432  C C      . VAL A 1 550 ? 8.586   -5.364  24.694  1.00 42.41  ?  611 VAL A C      1 
ATOM 8433  O O      . VAL A 1 550 ? 9.104   -4.446  24.048  1.00 57.04  ?  611 VAL A O      1 
ATOM 8434  C CB     . VAL A 1 550 ? 6.190   -6.032  24.214  1.00 49.71  ?  611 VAL A CB     1 
ATOM 8435  C CG1    . VAL A 1 550 ? 5.911   -4.589  23.820  1.00 54.64  ?  611 VAL A CG1    1 
ATOM 8436  C CG2    . VAL A 1 550 ? 5.319   -6.976  23.407  1.00 60.86  ?  611 VAL A CG2    1 
ATOM 8437  H H      . VAL A 1 550 ? 7.295   -8.073  24.969  1.00 63.19  ?  611 VAL A H      1 
ATOM 8438  H HA     . VAL A 1 550 ? 7.866   -6.367  23.068  1.00 55.10  ?  611 VAL A HA     1 
ATOM 8439  H HB     . VAL A 1 550 ? 5.960   -6.138  25.151  1.00 59.65  ?  611 VAL A HB     1 
ATOM 8440  H HG11   . VAL A 1 550 ? 4.968   -4.402  23.954  1.00 65.57  ?  611 VAL A HG11   1 
ATOM 8441  H HG12   . VAL A 1 550 ? 6.447   -4.001  24.375  1.00 65.57  ?  611 VAL A HG12   1 
ATOM 8442  H HG13   . VAL A 1 550 ? 6.143   -4.466  22.886  1.00 65.57  ?  611 VAL A HG13   1 
ATOM 8443  H HG21   . VAL A 1 550 ? 4.388   -6.739  23.543  1.00 73.03  ?  611 VAL A HG21   1 
ATOM 8444  H HG22   . VAL A 1 550 ? 5.548   -6.892  22.468  1.00 73.03  ?  611 VAL A HG22   1 
ATOM 8445  H HG23   . VAL A 1 550 ? 5.477   -7.885  23.706  1.00 73.03  ?  611 VAL A HG23   1 
ATOM 8446  N N      . ARG A 1 551 ? 8.797   -5.511  25.999  1.00 47.71  ?  612 ARG A N      1 
ATOM 8447  C CA     . ARG A 1 551 ? 9.606   -4.574  26.766  1.00 54.54  ?  612 ARG A CA     1 
ATOM 8448  C C      . ARG A 1 551 ? 11.101  -4.846  26.655  1.00 52.78  ?  612 ARG A C      1 
ATOM 8449  O O      . ARG A 1 551 ? 11.883  -4.218  27.376  1.00 53.77  ?  612 ARG A O      1 
ATOM 8450  C CB     . ARG A 1 551 ? 9.195   -4.610  28.240  1.00 53.10  ?  612 ARG A CB     1 
ATOM 8451  C CG     . ARG A 1 551 ? 7.699   -4.532  28.486  1.00 58.46  ?  612 ARG A CG     1 
ATOM 8452  C CD     . ARG A 1 551 ? 7.076   -3.346  27.775  1.00 89.66  ?  612 ARG A CD     1 
ATOM 8453  N NE     . ARG A 1 551 ? 5.733   -3.056  28.269  1.00 96.29  ?  612 ARG A NE     1 
ATOM 8454  C CZ     . ARG A 1 551 ? 4.636   -3.703  27.890  1.00 84.74  ?  612 ARG A CZ     1 
ATOM 8455  N NH1    . ARG A 1 551 ? 4.712   -4.690  27.008  1.00 66.13  1  612 ARG A NH1    1 
ATOM 8456  N NH2    . ARG A 1 551 ? 3.458   -3.365  28.396  1.00 97.75  ?  612 ARG A NH2    1 
ATOM 8457  H H      . ARG A 1 551 ? 8.477   -6.156  26.469  1.00 57.25  ?  612 ARG A H      1 
ATOM 8458  H HA     . ARG A 1 551 ? 9.443   -3.677  26.434  1.00 65.45  ?  612 ARG A HA     1 
ATOM 8459  H HB2    . ARG A 1 551 ? 9.513   -5.440  28.629  1.00 63.72  ?  612 ARG A HB2    1 
ATOM 8460  H HB3    . ARG A 1 551 ? 9.607   -3.858  28.695  1.00 63.72  ?  612 ARG A HB3    1 
ATOM 8461  H HG2    . ARG A 1 551 ? 7.278   -5.340  28.153  1.00 70.15  ?  612 ARG A HG2    1 
ATOM 8462  H HG3    . ARG A 1 551 ? 7.535   -4.436  29.437  1.00 70.15  ?  612 ARG A HG3    1 
ATOM 8463  H HD2    . ARG A 1 551 ? 7.628   -2.562  27.920  1.00 107.59 ?  612 ARG A HD2    1 
ATOM 8464  H HD3    . ARG A 1 551 ? 7.013   -3.540  26.826  1.00 107.59 ?  612 ARG A HD3    1 
ATOM 8465  H HE     . ARG A 1 551 ? 5.646   -2.423  28.845  1.00 115.54 ?  612 ARG A HE     1 
ATOM 8466  H HH11   . ARG A 1 551 ? 5.474   -4.913  26.677  1.00 79.35  ?  612 ARG A HH11   1 
ATOM 8467  H HH12   . ARG A 1 551 ? 3.999   -5.107  26.767  1.00 79.35  ?  612 ARG A HH12   1 
ATOM 8468  H HH21   . ARG A 1 551 ? 3.404   -2.726  28.969  1.00 117.30 ?  612 ARG A HH21   1 
ATOM 8469  H HH22   . ARG A 1 551 ? 2.749   -3.785  28.152  1.00 117.30 ?  612 ARG A HH22   1 
ATOM 8470  N N      . ASN A 1 552 ? 11.517  -5.762  25.786  1.00 46.89  ?  613 ASN A N      1 
ATOM 8471  C CA     . ASN A 1 552 ? 12.926  -6.096  25.674  1.00 60.03  ?  613 ASN A CA     1 
ATOM 8472  C C      . ASN A 1 552 ? 13.680  -4.978  24.956  1.00 57.23  ?  613 ASN A C      1 
ATOM 8473  O O      . ASN A 1 552 ? 13.091  -4.046  24.403  1.00 52.76  ?  613 ASN A O      1 
ATOM 8474  C CB     . ASN A 1 552 ? 13.098  -7.419  24.930  1.00 63.96  ?  613 ASN A CB     1 
ATOM 8475  C CG     . ASN A 1 552 ? 14.477  -8.016  25.115  1.00 66.02  ?  613 ASN A CG     1 
ATOM 8476  O OD1    . ASN A 1 552 ? 15.484  -7.313  25.056  1.00 63.31  ?  613 ASN A OD1    1 
ATOM 8477  N ND2    . ASN A 1 552 ? 14.528  -9.319  25.350  1.00 74.85  ?  613 ASN A ND2    1 
ATOM 8478  H H      . ASN A 1 552 ? 11.004  -6.200  25.254  1.00 56.26  ?  613 ASN A H      1 
ATOM 8479  H HA     . ASN A 1 552 ? 13.303  -6.195  26.562  1.00 72.03  ?  613 ASN A HA     1 
ATOM 8480  H HB2    . ASN A 1 552 ? 12.447  -8.056  25.262  1.00 76.75  ?  613 ASN A HB2    1 
ATOM 8481  H HB3    . ASN A 1 552 ? 12.961  -7.269  23.981  1.00 76.75  ?  613 ASN A HB3    1 
ATOM 8482  H HD21   . ASN A 1 552 ? 15.287  -9.707  25.463  1.00 89.82  ?  613 ASN A HD21   1 
ATOM 8483  H HD22   . ASN A 1 552 ? 13.801  -9.778  25.390  1.00 89.82  ?  613 ASN A HD22   1 
ATOM 8484  N N      . THR A 1 553 ? 15.009  -5.075  24.979  1.00 58.63  ?  614 THR A N      1 
ATOM 8485  C CA     . THR A 1 553 ? 15.866  -4.131  24.279  1.00 53.34  ?  614 THR A CA     1 
ATOM 8486  C C      . THR A 1 553 ? 16.392  -4.676  22.959  1.00 70.85  ?  614 THR A C      1 
ATOM 8487  O O      . THR A 1 553 ? 17.003  -3.920  22.197  1.00 75.35  ?  614 THR A O      1 
ATOM 8488  C CB     . THR A 1 553 ? 17.056  -3.731  25.161  1.00 53.96  ?  614 THR A CB     1 
ATOM 8489  O OG1    . THR A 1 553 ? 17.976  -4.824  25.253  1.00 56.54  ?  614 THR A OG1    1 
ATOM 8490  C CG2    . THR A 1 553 ? 16.590  -3.346  26.560  1.00 68.98  ?  614 THR A CG2    1 
ATOM 8491  H H      . THR A 1 553 ? 15.440  -5.689  25.399  1.00 70.36  ?  614 THR A H      1 
ATOM 8492  H HA     . THR A 1 553 ? 15.356  -3.329  24.087  1.00 64.01  ?  614 THR A HA     1 
ATOM 8493  H HB     . THR A 1 553 ? 17.504  -2.966  24.768  1.00 64.76  ?  614 THR A HB     1 
ATOM 8494  H HG1    . THR A 1 553 ? 18.630  -4.609  25.735  1.00 67.84  ?  614 THR A HG1    1 
ATOM 8495  H HG21   . THR A 1 553 ? 17.352  -3.096  27.105  1.00 82.78  ?  614 THR A HG21   1 
ATOM 8496  H HG22   . THR A 1 553 ? 15.977  -2.596  26.510  1.00 82.78  ?  614 THR A HG22   1 
ATOM 8497  H HG23   . THR A 1 553 ? 16.136  -4.096  26.976  1.00 82.78  ?  614 THR A HG23   1 
ATOM 8498  N N      . ALA A 1 554 ? 16.175  -5.957  22.673  1.00 68.67  ?  615 ALA A N      1 
ATOM 8499  C CA     . ALA A 1 554 ? 16.631  -6.549  21.422  1.00 63.34  ?  615 ALA A CA     1 
ATOM 8500  C C      . ALA A 1 554 ? 15.587  -6.342  20.327  1.00 59.48  ?  615 ALA A C      1 
ATOM 8501  O O      . ALA A 1 554 ? 14.390  -6.514  20.574  1.00 56.22  ?  615 ALA A O      1 
ATOM 8502  C CB     . ALA A 1 554 ? 16.889  -8.041  21.598  1.00 67.67  ?  615 ALA A CB     1 
ATOM 8503  H H      . ALA A 1 554 ? 15.763  -6.506  23.191  1.00 82.40  ?  615 ALA A H      1 
ATOM 8504  H HA     . ALA A 1 554 ? 17.457  -6.124  21.145  1.00 76.01  ?  615 ALA A HA     1 
ATOM 8505  H HB1    . ALA A 1 554 ? 17.191  -8.410  20.753  1.00 81.20  ?  615 ALA A HB1    1 
ATOM 8506  H HB2    . ALA A 1 554 ? 17.572  -8.165  22.276  1.00 81.20  ?  615 ALA A HB2    1 
ATOM 8507  H HB3    . ALA A 1 554 ? 16.066  -8.473  21.873  1.00 81.20  ?  615 ALA A HB3    1 
ATOM 8508  N N      . PRO A 1 555 ? 15.987  -5.972  19.108  1.00 64.19  ?  616 PRO A N      1 
ATOM 8509  C CA     . PRO A 1 555 ? 14.995  -5.801  18.037  1.00 62.38  ?  616 PRO A CA     1 
ATOM 8510  C C      . PRO A 1 555 ? 14.240  -7.083  17.726  1.00 60.50  ?  616 PRO A C      1 
ATOM 8511  O O      . PRO A 1 555 ? 13.010  -7.127  17.826  1.00 54.62  ?  616 PRO A O      1 
ATOM 8512  C CB     . PRO A 1 555 ? 15.841  -5.346  16.840  1.00 78.43  ?  616 PRO A CB     1 
ATOM 8513  C CG     . PRO A 1 555 ? 17.082  -4.799  17.433  1.00 61.02  ?  616 PRO A CG     1 
ATOM 8514  C CD     . PRO A 1 555 ? 17.340  -5.598  18.664  1.00 59.03  ?  616 PRO A CD     1 
ATOM 8515  H HA     . PRO A 1 555 ? 14.363  -5.103  18.270  1.00 74.85  ?  616 PRO A HA     1 
ATOM 8516  H HB2    . PRO A 1 555 ? 16.038  -6.106  16.271  1.00 94.12  ?  616 PRO A HB2    1 
ATOM 8517  H HB3    . PRO A 1 555 ? 15.365  -4.661  16.345  1.00 94.12  ?  616 PRO A HB3    1 
ATOM 8518  H HG2    . PRO A 1 555 ? 17.813  -4.898  16.803  1.00 73.23  ?  616 PRO A HG2    1 
ATOM 8519  H HG3    . PRO A 1 555 ? 16.950  -3.864  17.656  1.00 73.23  ?  616 PRO A HG3    1 
ATOM 8520  H HD2    . PRO A 1 555 ? 17.858  -6.390  18.451  1.00 70.83  ?  616 PRO A HD2    1 
ATOM 8521  H HD3    . PRO A 1 555 ? 17.779  -5.053  19.336  1.00 70.83  ?  616 PRO A HD3    1 
ATOM 8522  N N      . ASN A 1 556 ? 14.975  -8.134  17.354  1.00 71.26  ?  617 ASN A N      1 
ATOM 8523  C CA     . ASN A 1 556 ? 14.335  -9.372  16.918  1.00 70.33  ?  617 ASN A CA     1 
ATOM 8524  C C      . ASN A 1 556 ? 13.372  -9.901  17.971  1.00 52.65  ?  617 ASN A C      1 
ATOM 8525  O O      . ASN A 1 556 ? 12.253  -10.316 17.645  1.00 53.27  ?  617 ASN A O      1 
ATOM 8526  C CB     . ASN A 1 556 ? 15.397  -10.420 16.590  1.00 62.86  ?  617 ASN A CB     1 
ATOM 8527  C CG     . ASN A 1 556 ? 16.330  -10.684 17.751  1.00 49.26  ?  617 ASN A CG     1 
ATOM 8528  O OD1    . ASN A 1 556 ? 16.174  -10.112 18.828  1.00 41.01  ?  617 ASN A OD1    1 
ATOM 8529  N ND2    . ASN A 1 556 ? 17.300  -11.565 17.542  1.00 82.77  ?  617 ASN A ND2    1 
ATOM 8530  H H      . ASN A 1 556 ? 15.834  -8.155  17.345  1.00 85.51  ?  617 ASN A H      1 
ATOM 8531  H HA     . ASN A 1 556 ? 13.828  -9.197  16.110  1.00 84.40  ?  617 ASN A HA     1 
ATOM 8532  H HB2    . ASN A 1 556 ? 14.958  -11.254 16.360  1.00 75.43  ?  617 ASN A HB2    1 
ATOM 8533  H HB3    . ASN A 1 556 ? 15.929  -10.107 15.841  1.00 75.43  ?  617 ASN A HB3    1 
ATOM 8534  H HD21   . ASN A 1 556 ? 17.856  -11.749 18.172  1.00 99.32  ?  617 ASN A HD21   1 
ATOM 8535  H HD22   . ASN A 1 556 ? 17.372  -11.951 16.777  1.00 99.32  ?  617 ASN A HD22   1 
ATOM 8536  N N      . ILE A 1 557 ? 13.783  -9.900  19.240  1.00 54.27  ?  618 ILE A N      1 
ATOM 8537  C CA     . ILE A 1 557 ? 12.888  -10.350 20.300  1.00 51.88  ?  618 ILE A CA     1 
ATOM 8538  C C      . ILE A 1 557 ? 11.663  -9.451  20.369  1.00 55.40  ?  618 ILE A C      1 
ATOM 8539  O O      . ILE A 1 557 ? 10.535  -9.926  20.540  1.00 63.90  ?  618 ILE A O      1 
ATOM 8540  C CB     . ILE A 1 557 ? 13.633  -10.401 21.646  1.00 49.99  ?  618 ILE A CB     1 
ATOM 8541  C CG1    . ILE A 1 557 ? 14.702  -11.494 21.601  1.00 47.88  ?  618 ILE A CG1    1 
ATOM 8542  C CG2    . ILE A 1 557 ? 12.654  -10.646 22.793  1.00 54.32  ?  618 ILE A CG2    1 
ATOM 8543  C CD1    . ILE A 1 557 ? 15.555  -11.598 22.847  1.00 68.12  ?  618 ILE A CD1    1 
ATOM 8544  H H      . ILE A 1 557 ? 14.561  -9.649  19.507  1.00 65.12  ?  618 ILE A H      1 
ATOM 8545  H HA     . ILE A 1 557 ? 12.586  -11.248 20.094  1.00 62.25  ?  618 ILE A HA     1 
ATOM 8546  H HB     . ILE A 1 557 ? 14.069  -9.547  21.791  1.00 59.99  ?  618 ILE A HB     1 
ATOM 8547  H HG12   . ILE A 1 557 ? 14.265  -12.350 21.472  1.00 57.46  ?  618 ILE A HG12   1 
ATOM 8548  H HG13   . ILE A 1 557 ? 15.295  -11.315 20.854  1.00 57.46  ?  618 ILE A HG13   1 
ATOM 8549  H HG21   . ILE A 1 557 ? 13.147  -10.674 23.628  1.00 65.19  ?  618 ILE A HG21   1 
ATOM 8550  H HG22   . ILE A 1 557 ? 12.006  -9.925  22.814  1.00 65.19  ?  618 ILE A HG22   1 
ATOM 8551  H HG23   . ILE A 1 557 ? 12.202  -11.492 22.646  1.00 65.19  ?  618 ILE A HG23   1 
ATOM 8552  H HD11   . ILE A 1 557 ? 16.200  -12.312 22.729  1.00 81.75  ?  618 ILE A HD11   1 
ATOM 8553  H HD12   . ILE A 1 557 ? 16.014  -10.755 22.986  1.00 81.75  ?  618 ILE A HD12   1 
ATOM 8554  H HD13   . ILE A 1 557 ? 14.982  -11.792 23.605  1.00 81.75  ?  618 ILE A HD13   1 
ATOM 8555  N N      . ARG A 1 558 ? 11.864  -8.139  20.238  1.00 47.97  ?  619 ARG A N      1 
ATOM 8556  C CA     . ARG A 1 558 ? 10.729  -7.224  20.239  1.00 42.33  ?  619 ARG A CA     1 
ATOM 8557  C C      . ARG A 1 558 ? 9.765   -7.562  19.113  1.00 40.56  ?  619 ARG A C      1 
ATOM 8558  O O      . ARG A 1 558 ? 8.576   -7.800  19.351  1.00 45.27  ?  619 ARG A O      1 
ATOM 8559  C CB     . ARG A 1 558 ? 11.218  -5.780  20.127  1.00 56.99  ?  619 ARG A CB     1 
ATOM 8560  C CG     . ARG A 1 558 ? 11.193  -5.031  21.451  1.00 60.08  ?  619 ARG A CG     1 
ATOM 8561  C CD     . ARG A 1 558 ? 12.045  -3.771  21.420  1.00 57.38  ?  619 ARG A CD     1 
ATOM 8562  N NE     . ARG A 1 558 ? 11.372  -2.638  20.792  1.00 46.37  ?  619 ARG A NE     1 
ATOM 8563  C CZ     . ARG A 1 558 ? 10.413  -1.923  21.372  1.00 54.76  ?  619 ARG A CZ     1 
ATOM 8564  N NH1    . ARG A 1 558 ? 9.865   -0.903  20.729  1.00 63.75  1  619 ARG A NH1    1 
ATOM 8565  N NH2    . ARG A 1 558 ? 9.988   -2.232  22.589  1.00 60.77  ?  619 ARG A NH2    1 
ATOM 8566  H H      . ARG A 1 558 ? 12.632  -7.762  20.149  1.00 57.56  ?  619 ARG A H      1 
ATOM 8567  H HA     . ARG A 1 558 ? 10.252  -7.314  21.079  1.00 50.80  ?  619 ARG A HA     1 
ATOM 8568  H HB2    . ARG A 1 558 ? 12.132  -5.782  19.803  1.00 68.38  ?  619 ARG A HB2    1 
ATOM 8569  H HB3    . ARG A 1 558 ? 10.647  -5.303  19.504  1.00 68.38  ?  619 ARG A HB3    1 
ATOM 8570  H HG2    . ARG A 1 558 ? 10.280  -4.772  21.652  1.00 72.10  ?  619 ARG A HG2    1 
ATOM 8571  H HG3    . ARG A 1 558 ? 11.536  -5.609  22.150  1.00 72.10  ?  619 ARG A HG3    1 
ATOM 8572  H HD2    . ARG A 1 558 ? 12.268  -3.519  22.330  1.00 68.86  ?  619 ARG A HD2    1 
ATOM 8573  H HD3    . ARG A 1 558 ? 12.856  -3.952  20.919  1.00 68.86  ?  619 ARG A HD3    1 
ATOM 8574  H HE     . ARG A 1 558 ? 11.612  -2.418  19.996  1.00 55.64  ?  619 ARG A HE     1 
ATOM 8575  H HH11   . ARG A 1 558 ? 10.132  -0.700  19.937  1.00 76.50  ?  619 ARG A HH11   1 
ATOM 8576  H HH12   . ARG A 1 558 ? 9.239   -0.446  21.102  1.00 76.50  ?  619 ARG A HH12   1 
ATOM 8577  H HH21   . ARG A 1 558 ? 10.341  -2.892  23.013  1.00 72.92  ?  619 ARG A HH21   1 
ATOM 8578  H HH22   . ARG A 1 558 ? 9.365   -1.768  22.958  1.00 72.92  ?  619 ARG A HH22   1 
ATOM 8579  N N      . GLU A 1 559 ? 10.267  -7.616  17.878  1.00 44.60  ?  620 GLU A N      1 
ATOM 8580  C CA     . GLU A 1 559 ? 9.416   -7.950  16.740  1.00 52.44  ?  620 GLU A CA     1 
ATOM 8581  C C      . GLU A 1 559 ? 8.596   -9.203  17.019  1.00 57.65  ?  620 GLU A C      1 
ATOM 8582  O O      . GLU A 1 559 ? 7.379   -9.226  16.806  1.00 64.36  ?  620 GLU A O      1 
ATOM 8583  C CB     . GLU A 1 559 ? 10.272  -8.137  15.487  1.00 65.52  ?  620 GLU A CB     1 
ATOM 8584  C CG     . GLU A 1 559 ? 11.135  -6.936  15.138  1.00 63.96  ?  620 GLU A CG     1 
ATOM 8585  C CD     . GLU A 1 559 ? 11.935  -7.144  13.870  1.00 83.33  ?  620 GLU A CD     1 
ATOM 8586  O OE1    . GLU A 1 559 ? 11.485  -7.922  13.002  1.00 90.73  ?  620 GLU A OE1    1 
ATOM 8587  O OE2    . GLU A 1 559 ? 13.018  -6.536  13.743  1.00 66.64  -1 620 GLU A OE2    1 
ATOM 8588  H H      . GLU A 1 559 ? 11.088  -7.464  17.675  1.00 53.52  ?  620 GLU A H      1 
ATOM 8589  H HA     . GLU A 1 559 ? 8.801   -7.217  16.578  1.00 62.93  ?  620 GLU A HA     1 
ATOM 8590  H HB2    . GLU A 1 559 ? 10.863  -8.894  15.624  1.00 78.63  ?  620 GLU A HB2    1 
ATOM 8591  H HB3    . GLU A 1 559 ? 9.687   -8.309  14.733  1.00 78.63  ?  620 GLU A HB3    1 
ATOM 8592  H HG2    . GLU A 1 559 ? 10.563  -6.163  15.009  1.00 76.75  ?  620 GLU A HG2    1 
ATOM 8593  H HG3    . GLU A 1 559 ? 11.758  -6.771  15.863  1.00 76.75  ?  620 GLU A HG3    1 
ATOM 8594  N N      . LEU A 1 560 ? 9.251   -10.260 17.506  1.00 54.30  ?  621 LEU A N      1 
ATOM 8595  C CA     . LEU A 1 560 ? 8.532   -11.486 17.832  1.00 48.19  ?  621 LEU A CA     1 
ATOM 8596  C C      . LEU A 1 560 ? 7.457   -11.231 18.879  1.00 49.33  ?  621 LEU A C      1 
ATOM 8597  O O      . LEU A 1 560 ? 6.334   -11.735 18.762  1.00 62.08  ?  621 LEU A O      1 
ATOM 8598  C CB     . LEU A 1 560 ? 9.512   -12.552 18.318  1.00 39.99  ?  621 LEU A CB     1 
ATOM 8599  C CG     . LEU A 1 560 ? 10.387  -13.179 17.231  1.00 45.42  ?  621 LEU A CG     1 
ATOM 8600  C CD1    . LEU A 1 560 ? 11.561  -13.918 17.843  1.00 44.70  ?  621 LEU A CD1    1 
ATOM 8601  C CD2    . LEU A 1 560 ? 9.562   -14.116 16.366  1.00 49.36  ?  621 LEU A CD2    1 
ATOM 8602  H H      . LEU A 1 560 ? 10.097  -10.290 17.654  1.00 65.16  ?  621 LEU A H      1 
ATOM 8603  H HA     . LEU A 1 560 ? 8.098   -11.821 17.031  1.00 57.83  ?  621 LEU A HA     1 
ATOM 8604  H HB2    . LEU A 1 560 ? 10.104  -12.150 18.973  1.00 47.99  ?  621 LEU A HB2    1 
ATOM 8605  H HB3    . LEU A 1 560 ? 9.007   -13.268 18.734  1.00 47.99  ?  621 LEU A HB3    1 
ATOM 8606  H HG     . LEU A 1 560 ? 10.737  -12.475 16.663  1.00 54.50  ?  621 LEU A HG     1 
ATOM 8607  H HD11   . LEU A 1 560 ? 12.096  -14.304 17.131  1.00 53.64  ?  621 LEU A HD11   1 
ATOM 8608  H HD12   . LEU A 1 560 ? 12.095  -13.292 18.356  1.00 53.64  ?  621 LEU A HD12   1 
ATOM 8609  H HD13   . LEU A 1 560 ? 11.225  -14.620 18.421  1.00 53.64  ?  621 LEU A HD13   1 
ATOM 8610  H HD21   . LEU A 1 560 ? 10.135  -14.502 15.685  1.00 59.23  ?  621 LEU A HD21   1 
ATOM 8611  H HD22   . LEU A 1 560 ? 9.193   -14.818 16.925  1.00 59.23  ?  621 LEU A HD22   1 
ATOM 8612  H HD23   . LEU A 1 560 ? 8.845   -13.613 15.950  1.00 59.23  ?  621 LEU A HD23   1 
ATOM 8613  N N      . GLY A 1 561 ? 7.778   -10.445 19.907  1.00 46.23  ?  622 GLY A N      1 
ATOM 8614  C CA     . GLY A 1 561 ? 6.789   -10.138 20.925  1.00 42.50  ?  622 GLY A CA     1 
ATOM 8615  C C      . GLY A 1 561 ? 5.547   -9.489  20.349  1.00 41.12  ?  622 GLY A C      1 
ATOM 8616  O O      . GLY A 1 561 ? 4.426   -9.809  20.749  1.00 33.53  ?  622 GLY A O      1 
ATOM 8617  H H      . GLY A 1 561 ? 8.549   -10.086 20.032  1.00 55.48  ?  622 GLY A H      1 
ATOM 8618  H HA2    . GLY A 1 561 ? 6.527   -10.955 21.378  1.00 51.00  ?  622 GLY A HA2    1 
ATOM 8619  H HA3    . GLY A 1 561 ? 7.175   -9.534  21.579  1.00 51.00  ?  622 GLY A HA3    1 
ATOM 8620  N N      . VAL A 1 562 ? 5.727   -8.572  19.397  1.00 62.18  ?  623 VAL A N      1 
ATOM 8621  C CA     . VAL A 1 562 ? 4.575   -7.933  18.772  1.00 56.79  ?  623 VAL A CA     1 
ATOM 8622  C C      . VAL A 1 562 ? 3.836   -8.938  17.901  1.00 45.05  ?  623 VAL A C      1 
ATOM 8623  O O      . VAL A 1 562 ? 2.600   -8.968  17.870  1.00 37.30  ?  623 VAL A O      1 
ATOM 8624  C CB     . VAL A 1 562 ? 5.005   -6.695  17.961  1.00 45.55  ?  623 VAL A CB     1 
ATOM 8625  C CG1    . VAL A 1 562 ? 3.812   -5.787  17.723  1.00 58.90  ?  623 VAL A CG1    1 
ATOM 8626  C CG2    . VAL A 1 562 ? 6.113   -5.916  18.657  1.00 38.44  ?  623 VAL A CG2    1 
ATOM 8627  H H      . VAL A 1 562 ? 6.490   -8.309  19.101  1.00 74.62  ?  623 VAL A H      1 
ATOM 8628  H HA     . VAL A 1 562 ? 3.966   -7.637  19.467  1.00 68.15  ?  623 VAL A HA     1 
ATOM 8629  H HB     . VAL A 1 562 ? 5.338   -6.984  17.097  1.00 54.66  ?  623 VAL A HB     1 
ATOM 8630  H HG11   . VAL A 1 562 ? 4.100   -5.015  17.212  1.00 70.68  ?  623 VAL A HG11   1 
ATOM 8631  H HG12   . VAL A 1 562 ? 3.136   -6.278  17.229  1.00 70.68  ?  623 VAL A HG12   1 
ATOM 8632  H HG13   . VAL A 1 562 ? 3.456   -5.504  18.579  1.00 70.68  ?  623 VAL A HG13   1 
ATOM 8633  H HG21   . VAL A 1 562 ? 6.349   -5.149  18.111  1.00 46.13  ?  623 VAL A HG21   1 
ATOM 8634  H HG22   . VAL A 1 562 ? 5.793   -5.620  19.523  1.00 46.13  ?  623 VAL A HG22   1 
ATOM 8635  H HG23   . VAL A 1 562 ? 6.883   -6.494  18.767  1.00 46.13  ?  623 VAL A HG23   1 
ATOM 8636  N N      . LYS A 1 563 ? 4.582   -9.785  17.191  1.00 45.43  ?  624 LYS A N      1 
ATOM 8637  C CA     . LYS A 1 563 ? 3.971   -10.813 16.358  1.00 46.70  ?  624 LYS A CA     1 
ATOM 8638  C C      . LYS A 1 563 ? 3.020   -11.675 17.178  1.00 68.29  ?  624 LYS A C      1 
ATOM 8639  O O      . LYS A 1 563 ? 1.827   -11.776 16.873  1.00 68.95  ?  624 LYS A O      1 
ATOM 8640  C CB     . LYS A 1 563 ? 5.066   -11.668 15.717  1.00 46.97  ?  624 LYS A CB     1 
ATOM 8641  C CG     . LYS A 1 563 ? 4.639   -12.432 14.473  1.00 55.82  ?  624 LYS A CG     1 
ATOM 8642  C CD     . LYS A 1 563 ? 5.730   -13.402 14.037  1.00 69.26  ?  624 LYS A CD     1 
ATOM 8643  C CE     . LYS A 1 563 ? 5.410   -14.062 12.706  1.00 62.86  ?  624 LYS A CE     1 
ATOM 8644  N NZ     . LYS A 1 563 ? 6.329   -15.200 12.423  1.00 54.23  1  624 LYS A NZ     1 
ATOM 8645  H H      . LYS A 1 563 ? 5.441   -9.783  17.177  1.00 54.51  ?  624 LYS A H      1 
ATOM 8646  H HA     . LYS A 1 563 ? 3.462   -10.390 15.649  1.00 56.04  ?  624 LYS A HA     1 
ATOM 8647  H HB2    . LYS A 1 563 ? 5.802   -11.088 15.466  1.00 56.36  ?  624 LYS A HB2    1 
ATOM 8648  H HB3    . LYS A 1 563 ? 5.372   -12.317 16.369  1.00 56.36  ?  624 LYS A HB3    1 
ATOM 8649  H HG2    . LYS A 1 563 ? 3.836   -12.941 14.667  1.00 66.98  ?  624 LYS A HG2    1 
ATOM 8650  H HG3    . LYS A 1 563 ? 4.478   -11.806 13.750  1.00 66.98  ?  624 LYS A HG3    1 
ATOM 8651  H HD2    . LYS A 1 563 ? 6.566   -12.918 13.941  1.00 83.11  ?  624 LYS A HD2    1 
ATOM 8652  H HD3    . LYS A 1 563 ? 5.822   -14.098 14.706  1.00 83.11  ?  624 LYS A HD3    1 
ATOM 8653  H HE2    . LYS A 1 563 ? 4.502   -14.404 12.729  1.00 75.43  ?  624 LYS A HE2    1 
ATOM 8654  H HE3    . LYS A 1 563 ? 5.505   -13.410 11.995  1.00 75.43  ?  624 LYS A HE3    1 
ATOM 8655  H HZ1    . LYS A 1 563 ? 6.122   -15.570 11.640  1.00 65.07  ?  624 LYS A HZ1    1 
ATOM 8656  H HZ2    . LYS A 1 563 ? 7.170   -14.911 12.393  1.00 65.07  ?  624 LYS A HZ2    1 
ATOM 8657  H HZ3    . LYS A 1 563 ? 6.257   -15.815 13.062  1.00 65.07  ?  624 LYS A HZ3    1 
ATOM 8658  N N      . ASN A 1 564 ? 3.536   -12.299 18.239  1.00 67.40  ?  625 ASN A N      1 
ATOM 8659  C CA     . ASN A 1 564 ? 2.687   -13.116 19.098  1.00 48.10  ?  625 ASN A CA     1 
ATOM 8660  C C      . ASN A 1 564 ? 1.594   -12.276 19.740  1.00 48.60  ?  625 ASN A C      1 
ATOM 8661  O O      . ASN A 1 564 ? 0.439   -12.709 19.830  1.00 55.64  ?  625 ASN A O      1 
ATOM 8662  C CB     . ASN A 1 564 ? 3.530   -13.802 20.170  1.00 46.22  ?  625 ASN A CB     1 
ATOM 8663  C CG     . ASN A 1 564 ? 4.674   -14.603 19.586  1.00 48.77  ?  625 ASN A CG     1 
ATOM 8664  O OD1    . ASN A 1 564 ? 4.517   -15.774 19.245  1.00 69.95  ?  625 ASN A OD1    1 
ATOM 8665  N ND2    . ASN A 1 564 ? 5.835   -13.972 19.465  1.00 51.75  ?  625 ASN A ND2    1 
ATOM 8666  H H      . ASN A 1 564 ? 4.361   -12.265 18.479  1.00 80.88  ?  625 ASN A H      1 
ATOM 8667  H HA     . ASN A 1 564 ? 2.262   -13.804 18.562  1.00 57.73  ?  625 ASN A HA     1 
ATOM 8668  H HB2    . ASN A 1 564 ? 3.905   -13.128 20.758  1.00 55.47  ?  625 ASN A HB2    1 
ATOM 8669  H HB3    . ASN A 1 564 ? 2.967   -14.409 20.676  1.00 55.47  ?  625 ASN A HB3    1 
ATOM 8670  H HD21   . ASN A 1 564 ? 6.516   -14.384 19.139  1.00 62.10  ?  625 ASN A HD21   1 
ATOM 8671  H HD22   . ASN A 1 564 ? 5.907   -13.152 19.714  1.00 62.10  ?  625 ASN A HD22   1 
ATOM 8672  N N      . LEU A 1 565 ? 1.937   -11.068 20.188  1.00 47.85  ?  626 LEU A N      1 
ATOM 8673  C CA     . LEU A 1 565 ? 0.940   -10.195 20.797  1.00 51.36  ?  626 LEU A CA     1 
ATOM 8674  C C      . LEU A 1 565 ? -0.229  -9.969  19.849  1.00 55.16  ?  626 LEU A C      1 
ATOM 8675  O O      . LEU A 1 565 ? -1.395  -10.064 20.246  1.00 55.53  ?  626 LEU A O      1 
ATOM 8676  C CB     . LEU A 1 565 ? 1.587   -8.868  21.193  1.00 42.46  ?  626 LEU A CB     1 
ATOM 8677  C CG     . LEU A 1 565 ? 0.661   -7.773  21.723  1.00 49.36  ?  626 LEU A CG     1 
ATOM 8678  C CD1    . LEU A 1 565 ? -0.243  -8.289  22.826  1.00 66.26  ?  626 LEU A CD1    1 
ATOM 8679  C CD2    . LEU A 1 565 ? 1.492   -6.605  22.223  1.00 52.67  ?  626 LEU A CD2    1 
ATOM 8680  H H      . LEU A 1 565 ? 2.730   -10.736 20.152  1.00 57.42  ?  626 LEU A H      1 
ATOM 8681  H HA     . LEU A 1 565 ? 0.599   -10.616 21.601  1.00 61.64  ?  626 LEU A HA     1 
ATOM 8682  H HB2    . LEU A 1 565 ? 2.242   -9.048  21.886  1.00 50.95  ?  626 LEU A HB2    1 
ATOM 8683  H HB3    . LEU A 1 565 ? 2.037   -8.508  20.413  1.00 50.95  ?  626 LEU A HB3    1 
ATOM 8684  H HG     . LEU A 1 565 ? 0.100   -7.454  20.998  1.00 59.23  ?  626 LEU A HG     1 
ATOM 8685  H HD11   . LEU A 1 565 ? -0.811  -7.565  23.133  1.00 79.51  ?  626 LEU A HD11   1 
ATOM 8686  H HD12   . LEU A 1 565 ? -0.787  -9.011  22.476  1.00 79.51  ?  626 LEU A HD12   1 
ATOM 8687  H HD13   . LEU A 1 565 ? 0.305   -8.612  23.558  1.00 79.51  ?  626 LEU A HD13   1 
ATOM 8688  H HD21   . LEU A 1 565 ? 0.898   -5.915  22.557  1.00 63.21  ?  626 LEU A HD21   1 
ATOM 8689  H HD22   . LEU A 1 565 ? 2.074   -6.914  22.935  1.00 63.21  ?  626 LEU A HD22   1 
ATOM 8690  H HD23   . LEU A 1 565 ? 2.023   -6.258  21.488  1.00 63.21  ?  626 LEU A HD23   1 
ATOM 8691  N N      . GLY A 1 566 ? 0.066   -9.684  18.580  1.00 52.68  ?  627 GLY A N      1 
ATOM 8692  C CA     . GLY A 1 566 ? -0.999  -9.495  17.611  1.00 51.68  ?  627 GLY A CA     1 
ATOM 8693  C C      . GLY A 1 566 ? -1.859  -10.732 17.448  1.00 54.47  ?  627 GLY A C      1 
ATOM 8694  O O      . GLY A 1 566 ? -3.086  -10.640 17.357  1.00 50.49  ?  627 GLY A O      1 
ATOM 8695  H H      . GLY A 1 566 ? 0.861   -9.598  18.265  1.00 63.22  ?  627 GLY A H      1 
ATOM 8696  H HA2    . GLY A 1 566 ? -1.567  -8.761  17.895  1.00 62.02  ?  627 GLY A HA2    1 
ATOM 8697  H HA3    . GLY A 1 566 ? -0.615  -9.272  16.749  1.00 62.02  ?  627 GLY A HA3    1 
ATOM 8698  N N      . LEU A 1 567 ? -1.227  -11.907 17.417  1.00 72.71  ?  628 LEU A N      1 
ATOM 8699  C CA     . LEU A 1 567 ? -1.978  -13.146 17.257  1.00 57.03  ?  628 LEU A CA     1 
ATOM 8700  C C      . LEU A 1 567 ? -2.928  -13.377 18.423  1.00 55.64  ?  628 LEU A C      1 
ATOM 8701  O O      . LEU A 1 567 ? -4.005  -13.953 18.240  1.00 53.34  ?  628 LEU A O      1 
ATOM 8702  C CB     . LEU A 1 567 ? -1.012  -14.319 17.110  1.00 33.79  ?  628 LEU A CB     1 
ATOM 8703  C CG     . LEU A 1 567 ? -0.182  -14.302 15.827  1.00 36.23  ?  628 LEU A CG     1 
ATOM 8704  C CD1    . LEU A 1 567 ? 0.988   -15.261 15.924  1.00 38.27  ?  628 LEU A CD1    1 
ATOM 8705  C CD2    . LEU A 1 567 ? -1.052  -14.649 14.634  1.00 39.98  ?  628 LEU A CD2    1 
ATOM 8706  H H      . LEU A 1 567 ? -0.376  -12.010 17.486  1.00 87.26  ?  628 LEU A H      1 
ATOM 8707  H HA     . LEU A 1 567 ? -2.507  -13.091 16.447  1.00 68.43  ?  628 LEU A HA     1 
ATOM 8708  H HB2    . LEU A 1 567 ? -0.396  -14.310 17.859  1.00 40.55  ?  628 LEU A HB2    1 
ATOM 8709  H HB3    . LEU A 1 567 ? -1.523  -15.144 17.119  1.00 40.55  ?  628 LEU A HB3    1 
ATOM 8710  H HG     . LEU A 1 567 ? 0.173   -13.409 15.691  1.00 43.47  ?  628 LEU A HG     1 
ATOM 8711  H HD11   . LEU A 1 567 ? 1.493   -15.226 15.097  1.00 45.92  ?  628 LEU A HD11   1 
ATOM 8712  H HD12   . LEU A 1 567 ? 1.551   -14.996 16.668  1.00 45.92  ?  628 LEU A HD12   1 
ATOM 8713  H HD13   . LEU A 1 567 ? 0.649   -16.158 16.068  1.00 45.92  ?  628 LEU A HD13   1 
ATOM 8714  H HD21   . LEU A 1 567 ? -0.508  -14.632 13.831  1.00 47.98  ?  628 LEU A HD21   1 
ATOM 8715  H HD22   . LEU A 1 567 ? -1.426  -15.534 14.763  1.00 47.98  ?  628 LEU A HD22   1 
ATOM 8716  H HD23   . LEU A 1 567 ? -1.766  -13.995 14.564  1.00 47.98  ?  628 LEU A HD23   1 
ATOM 8717  N N      . CYS A 1 568 ? -2.553  -12.935 19.625  1.00 60.56  ?  629 CYS A N      1 
ATOM 8718  C CA     . CYS A 1 568 ? -3.462  -13.021 20.761  1.00 53.13  ?  629 CYS A CA     1 
ATOM 8719  C C      . CYS A 1 568 ? -4.541  -11.951 20.699  1.00 59.11  ?  629 CYS A C      1 
ATOM 8720  O O      . CYS A 1 568 ? -5.672  -12.191 21.134  1.00 70.07  ?  629 CYS A O      1 
ATOM 8721  C CB     . CYS A 1 568 ? -2.687  -12.892 22.071  1.00 57.75  ?  629 CYS A CB     1 
ATOM 8722  S SG     . CYS A 1 568 ? -1.454  -14.177 22.347  1.00 51.60  ?  629 CYS A SG     1 
ATOM 8723  H H      . CYS A 1 568 ? -1.788  -12.587 19.804  1.00 72.67  ?  629 CYS A H      1 
ATOM 8724  H HA     . CYS A 1 568 ? -3.897  -13.887 20.753  1.00 63.75  ?  629 CYS A HA     1 
ATOM 8725  H HB2    . CYS A 1 568 ? -2.226  -12.038 22.076  1.00 69.30  ?  629 CYS A HB2    1 
ATOM 8726  H HB3    . CYS A 1 568 ? -3.317  -12.926 22.808  1.00 69.30  ?  629 CYS A HB3    1 
ATOM 8727  H HG     . CYS A 1 568 ? -0.649  -14.144 21.458  1.00 61.91  ?  629 CYS A HG     1 
ATOM 8728  N N      . CYS A 1 569 ? -4.214  -10.772 20.165  1.00 56.42  ?  630 CYS A N      1 
ATOM 8729  C CA     . CYS A 1 569 ? -5.199  -9.701  20.083  1.00 54.05  ?  630 CYS A CA     1 
ATOM 8730  C C      . CYS A 1 569 ? -6.346  -10.067 19.151  1.00 56.08  ?  630 CYS A C      1 
ATOM 8731  O O      . CYS A 1 569 ? -7.479  -9.618  19.359  1.00 52.50  ?  630 CYS A O      1 
ATOM 8732  C CB     . CYS A 1 569 ? -4.528  -8.408  19.624  1.00 64.12  ?  630 CYS A CB     1 
ATOM 8733  S SG     . CYS A 1 569 ? -3.478  -7.630  20.883  1.00 70.75  ?  630 CYS A SG     1 
ATOM 8734  H H      . CYS A 1 569 ? -3.440  -10.571 19.850  1.00 67.70  ?  630 CYS A H      1 
ATOM 8735  H HA     . CYS A 1 569 ? -5.571  -9.548  20.966  1.00 64.86  ?  630 CYS A HA     1 
ATOM 8736  H HB2    . CYS A 1 569 ? -3.971  -8.603  18.854  1.00 76.94  ?  630 CYS A HB2    1 
ATOM 8737  H HB3    . CYS A 1 569 ? -5.216  -7.770  19.378  1.00 76.94  ?  630 CYS A HB3    1 
ATOM 8738  H HG     . CYS A 1 569 ? -2.607  -8.395  21.193  1.00 84.90  ?  630 CYS A HG     1 
ATOM 8739  N N      . LEU A 1 570 ? -6.081  -10.877 18.125  1.00 53.85  ?  631 LEU A N      1 
ATOM 8740  C CA     . LEU A 1 570 ? -7.149  -11.337 17.249  1.00 48.11  ?  631 LEU A CA     1 
ATOM 8741  C C      . LEU A 1 570 ? -8.125  -12.264 17.957  1.00 56.74  ?  631 LEU A C      1 
ATOM 8742  O O      . LEU A 1 570 ? -9.211  -12.515 17.425  1.00 58.28  ?  631 LEU A O      1 
ATOM 8743  C CB     . LEU A 1 570 ? -6.563  -12.057 16.034  1.00 58.51  ?  631 LEU A CB     1 
ATOM 8744  C CG     . LEU A 1 570 ? -5.686  -11.239 15.085  1.00 47.72  ?  631 LEU A CG     1 
ATOM 8745  C CD1    . LEU A 1 570 ? -5.209  -12.110 13.939  1.00 60.45  ?  631 LEU A CD1    1 
ATOM 8746  C CD2    . LEU A 1 570 ? -6.428  -10.031 14.548  1.00 54.01  ?  631 LEU A CD2    1 
ATOM 8747  H H      . LEU A 1 570 ? -5.299  -11.169 17.920  1.00 64.62  ?  631 LEU A H      1 
ATOM 8748  H HA     . LEU A 1 570 ? -7.646  -10.568 16.929  1.00 57.74  ?  631 LEU A HA     1 
ATOM 8749  H HB2    . LEU A 1 570 ? -6.022  -12.796 16.355  1.00 70.21  ?  631 LEU A HB2    1 
ATOM 8750  H HB3    . LEU A 1 570 ? -7.299  -12.407 15.509  1.00 70.21  ?  631 LEU A HB3    1 
ATOM 8751  H HG     . LEU A 1 570 ? -4.905  -10.924 15.568  1.00 57.27  ?  631 LEU A HG     1 
ATOM 8752  H HD11   . LEU A 1 570 ? -4.655  -11.578 13.347  1.00 72.54  ?  631 LEU A HD11   1 
ATOM 8753  H HD12   . LEU A 1 570 ? -4.695  -12.850 14.298  1.00 72.54  ?  631 LEU A HD12   1 
ATOM 8754  H HD13   . LEU A 1 570 ? -5.981  -12.446 13.457  1.00 72.54  ?  631 LEU A HD13   1 
ATOM 8755  H HD21   . LEU A 1 570 ? -5.841  -9.539  13.952  1.00 64.82  ?  631 LEU A HD21   1 
ATOM 8756  H HD22   . LEU A 1 570 ? -7.213  -10.333 14.065  1.00 64.82  ?  631 LEU A HD22   1 
ATOM 8757  H HD23   . LEU A 1 570 ? -6.693  -9.467  15.292  1.00 64.82  ?  631 LEU A HD23   1 
ATOM 8758  N N      . LEU A 1 571 ? -7.767  -12.774 19.133  1.00 63.38  ?  632 LEU A N      1 
ATOM 8759  C CA     . LEU A 1 571 ? -8.608  -13.707 19.872  1.00 57.06  ?  632 LEU A CA     1 
ATOM 8760  C C      . LEU A 1 571 ? -9.383  -13.040 21.000  1.00 70.37  ?  632 LEU A C      1 
ATOM 8761  O O      . LEU A 1 571 ? -10.529 -13.417 21.262  1.00 64.25  ?  632 LEU A O      1 
ATOM 8762  C CB     . LEU A 1 571 ? -7.750  -14.843 20.439  1.00 51.01  ?  632 LEU A CB     1 
ATOM 8763  C CG     . LEU A 1 571 ? -7.408  -15.990 19.478  1.00 59.76  ?  632 LEU A CG     1 
ATOM 8764  C CD1    . LEU A 1 571 ? -6.995  -15.481 18.106  1.00 70.51  ?  632 LEU A CD1    1 
ATOM 8765  C CD2    . LEU A 1 571 ? -6.315  -16.878 20.056  1.00 58.22  ?  632 LEU A CD2    1 
ATOM 8766  H H      . LEU A 1 571 ? -7.027  -12.591 19.530  1.00 76.06  ?  632 LEU A H      1 
ATOM 8767  H HA     . LEU A 1 571 ? -9.252  -14.098 19.261  1.00 68.48  ?  632 LEU A HA     1 
ATOM 8768  H HB2    . LEU A 1 571 ? -6.910  -14.466 20.746  1.00 61.21  ?  632 LEU A HB2    1 
ATOM 8769  H HB3    . LEU A 1 571 ? -8.221  -15.232 21.193  1.00 61.21  ?  632 LEU A HB3    1 
ATOM 8770  H HG     . LEU A 1 571 ? -8.199  -16.539 19.360  1.00 71.71  ?  632 LEU A HG     1 
ATOM 8771  H HD11   . LEU A 1 571 ? -6.790  -16.239 17.537  1.00 84.61  ?  632 LEU A HD11   1 
ATOM 8772  H HD12   . LEU A 1 571 ? -7.727  -14.970 17.726  1.00 84.61  ?  632 LEU A HD12   1 
ATOM 8773  H HD13   . LEU A 1 571 ? -6.212  -14.917 18.202  1.00 84.61  ?  632 LEU A HD13   1 
ATOM 8774  H HD21   . LEU A 1 571 ? -6.122  -17.591 19.427  1.00 69.86  ?  632 LEU A HD21   1 
ATOM 8775  H HD22   . LEU A 1 571 ? -5.520  -16.343 20.205  1.00 69.86  ?  632 LEU A HD22   1 
ATOM 8776  H HD23   . LEU A 1 571 ? -6.625  -17.252 20.896  1.00 69.86  ?  632 LEU A HD23   1 
ATOM 8777  N N      . ASP A 1 572 ? -8.792  -12.051 21.667  1.00 70.24  ?  633 ASP A N      1 
ATOM 8778  C CA     . ASP A 1 572 ? -9.446  -11.326 22.750  1.00 71.05  ?  633 ASP A CA     1 
ATOM 8779  C C      . ASP A 1 572 ? -9.565  -9.863  22.350  1.00 72.60  ?  633 ASP A C      1 
ATOM 8780  O O      . ASP A 1 572 ? -8.552  -9.203  22.096  1.00 69.08  ?  633 ASP A O      1 
ATOM 8781  C CB     . ASP A 1 572 ? -8.665  -11.466 24.057  1.00 78.74  ?  633 ASP A CB     1 
ATOM 8782  C CG     . ASP A 1 572 ? -9.414  -10.899 25.245  1.00 88.21  ?  633 ASP A CG     1 
ATOM 8783  O OD1    . ASP A 1 572 ? -9.243  -11.427 26.364  1.00 90.07  ?  633 ASP A OD1    1 
ATOM 8784  O OD2    . ASP A 1 572 ? -10.180 -9.930  25.060  1.00 82.22  -1 633 ASP A OD2    1 
ATOM 8785  H H      . ASP A 1 572 ? -7.993  -11.776 21.505  1.00 84.28  ?  633 ASP A H      1 
ATOM 8786  H HA     . ASP A 1 572 ? -10.339 -11.682 22.885  1.00 85.26  ?  633 ASP A HA     1 
ATOM 8787  H HB2    . ASP A 1 572 ? -8.499  -12.406 24.227  1.00 94.48  ?  633 ASP A HB2    1 
ATOM 8788  H HB3    . ASP A 1 572 ? -7.825  -10.989 23.976  1.00 94.48  ?  633 ASP A HB3    1 
ATOM 8789  N N      . VAL A 1 573 ? -10.799 -9.360  22.299  1.00 72.67  ?  634 VAL A N      1 
ATOM 8790  C CA     . VAL A 1 573 ? -11.020 -7.985  21.864  1.00 62.59  ?  634 VAL A CA     1 
ATOM 8791  C C      . VAL A 1 573 ? -10.481 -7.006  22.900  1.00 72.41  ?  634 VAL A C      1 
ATOM 8792  O O      . VAL A 1 573 ? -9.751  -6.067  22.564  1.00 75.78  ?  634 VAL A O      1 
ATOM 8793  C CB     . VAL A 1 573 ? -12.513 -7.743  21.567  1.00 63.31  ?  634 VAL A CB     1 
ATOM 8794  C CG1    . VAL A 1 573 ? -13.393 -8.096  22.761  1.00 56.51  ?  634 VAL A CG1    1 
ATOM 8795  C CG2    . VAL A 1 573 ? -12.749 -6.300  21.140  1.00 73.75  ?  634 VAL A CG2    1 
ATOM 8796  H H      . VAL A 1 573 ? -11.514 -9.789  22.508  1.00 87.20  ?  634 VAL A H      1 
ATOM 8797  H HA     . VAL A 1 573 ? -10.530 -7.838  21.040  1.00 75.11  ?  634 VAL A HA     1 
ATOM 8798  H HB     . VAL A 1 573 ? -12.778 -8.313  20.829  1.00 75.98  ?  634 VAL A HB     1 
ATOM 8799  H HG11   . VAL A 1 573 ? -14.320 -7.929  22.530  1.00 67.82  ?  634 VAL A HG11   1 
ATOM 8800  H HG12   . VAL A 1 573 ? -13.270 -9.034  22.977  1.00 67.82  ?  634 VAL A HG12   1 
ATOM 8801  H HG13   . VAL A 1 573 ? -13.136 -7.545  23.517  1.00 67.82  ?  634 VAL A HG13   1 
ATOM 8802  H HG21   . VAL A 1 573 ? -13.693 -6.175  20.960  1.00 88.51  ?  634 VAL A HG21   1 
ATOM 8803  H HG22   . VAL A 1 573 ? -12.467 -5.710  21.856  1.00 88.51  ?  634 VAL A HG22   1 
ATOM 8804  H HG23   . VAL A 1 573 ? -12.232 -6.120  20.339  1.00 88.51  ?  634 VAL A HG23   1 
ATOM 8805  N N      . LYS A 1 574 ? -10.824 -7.210  24.174  1.00 78.08  ?  635 LYS A N      1 
ATOM 8806  C CA     . LYS A 1 574 ? -10.354 -6.296  25.210  1.00 76.10  ?  635 LYS A CA     1 
ATOM 8807  C C      . LYS A 1 574 ? -8.835  -6.243  25.248  1.00 70.02  ?  635 LYS A C      1 
ATOM 8808  O O      . LYS A 1 574 ? -8.258  -5.191  25.547  1.00 81.04  ?  635 LYS A O      1 
ATOM 8809  C CB     . LYS A 1 574 ? -10.903 -6.712  26.575  1.00 67.88  ?  635 LYS A CB     1 
ATOM 8810  C CG     . LYS A 1 574 ? -10.423 -5.847  27.739  1.00 65.53  ?  635 LYS A CG     1 
ATOM 8811  C CD     . LYS A 1 574 ? -10.784 -4.381  27.550  1.00 79.57  ?  635 LYS A CD     1 
ATOM 8812  C CE     . LYS A 1 574 ? -10.352 -3.542  28.742  1.00 75.58  ?  635 LYS A CE     1 
ATOM 8813  N NZ     . LYS A 1 574 ? -10.621 -2.092  28.535  1.00 54.98  1  635 LYS A NZ     1 
ATOM 8814  H H      . LYS A 1 574 ? -11.317 -7.855  24.457  1.00 93.69  ?  635 LYS A H      1 
ATOM 8815  H HA     . LYS A 1 574 ? -10.680 -5.404  25.015  1.00 91.32  ?  635 LYS A HA     1 
ATOM 8816  H HB2    . LYS A 1 574 ? -11.871 -6.659  26.549  1.00 81.46  ?  635 LYS A HB2    1 
ATOM 8817  H HB3    . LYS A 1 574 ? -10.631 -7.625  26.754  1.00 81.46  ?  635 LYS A HB3    1 
ATOM 8818  H HG2    . LYS A 1 574 ? -10.838 -6.158  28.558  1.00 78.64  ?  635 LYS A HG2    1 
ATOM 8819  H HG3    . LYS A 1 574 ? -9.457  -5.914  27.807  1.00 78.64  ?  635 LYS A HG3    1 
ATOM 8820  H HD2    . LYS A 1 574 ? -10.337 -4.039  26.760  1.00 95.49  ?  635 LYS A HD2    1 
ATOM 8821  H HD3    . LYS A 1 574 ? -11.746 -4.298  27.453  1.00 95.49  ?  635 LYS A HD3    1 
ATOM 8822  H HE2    . LYS A 1 574 ? -10.840 -3.831  29.529  1.00 90.70  ?  635 LYS A HE2    1 
ATOM 8823  H HE3    . LYS A 1 574 ? -9.398  -3.655  28.881  1.00 90.70  ?  635 LYS A HE3    1 
ATOM 8824  H HZ1    . LYS A 1 574 ? -10.358 -1.629  29.248  1.00 65.97  ?  635 LYS A HZ1    1 
ATOM 8825  H HZ2    . LYS A 1 574 ? -10.179 -1.800  27.821  1.00 65.97  ?  635 LYS A HZ2    1 
ATOM 8826  H HZ3    . LYS A 1 574 ? -11.493 -1.960  28.410  1.00 65.97  ?  635 LYS A HZ3    1 
ATOM 8827  N N      . LEU A 1 575 ? -8.173  -7.360  24.952  1.00 62.12  ?  636 LEU A N      1 
ATOM 8828  C CA     . LEU A 1 575 ? -6.717  -7.357  24.890  1.00 60.91  ?  636 LEU A CA     1 
ATOM 8829  C C      . LEU A 1 575 ? -6.226  -6.457  23.766  1.00 67.42  ?  636 LEU A C      1 
ATOM 8830  O O      . LEU A 1 575 ? -5.209  -5.769  23.909  1.00 68.09  ?  636 LEU A O      1 
ATOM 8831  C CB     . LEU A 1 575 ? -6.203  -8.782  24.703  1.00 58.53  ?  636 LEU A CB     1 
ATOM 8832  C CG     . LEU A 1 575 ? -4.691  -8.970  24.598  1.00 55.46  ?  636 LEU A CG     1 
ATOM 8833  C CD1    . LEU A 1 575 ? -3.960  -8.293  25.744  1.00 58.40  ?  636 LEU A CD1    1 
ATOM 8834  C CD2    . LEU A 1 575 ? -4.377  -10.451 24.572  1.00 56.66  ?  636 LEU A CD2    1 
ATOM 8835  H H      . LEU A 1 575 ? -8.538  -8.121  24.786  1.00 74.55  ?  636 LEU A H      1 
ATOM 8836  H HA     . LEU A 1 575 ? -6.364  -7.015  25.726  1.00 73.09  ?  636 LEU A HA     1 
ATOM 8837  H HB2    . LEU A 1 575 ? -6.505  -9.312  25.457  1.00 70.23  ?  636 LEU A HB2    1 
ATOM 8838  H HB3    . LEU A 1 575 ? -6.591  -9.137  23.888  1.00 70.23  ?  636 LEU A HB3    1 
ATOM 8839  H HG     . LEU A 1 575 ? -4.378  -8.580  23.767  1.00 66.55  ?  636 LEU A HG     1 
ATOM 8840  H HD11   . LEU A 1 575 ? -3.006  -8.437  25.639  1.00 70.08  ?  636 LEU A HD11   1 
ATOM 8841  H HD12   . LEU A 1 575 ? -4.155  -7.343  25.725  1.00 70.08  ?  636 LEU A HD12   1 
ATOM 8842  H HD13   . LEU A 1 575 ? -4.262  -8.676  26.582  1.00 70.08  ?  636 LEU A HD13   1 
ATOM 8843  H HD21   . LEU A 1 575 ? -3.416  -10.568 24.506  1.00 67.99  ?  636 LEU A HD21   1 
ATOM 8844  H HD22   . LEU A 1 575 ? -4.705  -10.857 25.389  1.00 67.99  ?  636 LEU A HD22   1 
ATOM 8845  H HD23   . LEU A 1 575 ? -4.814  -10.852 23.804  1.00 67.99  ?  636 LEU A HD23   1 
ATOM 8846  N N      . ALA A 1 576 ? -6.936  -6.447  22.638  1.00 67.62  ?  637 ALA A N      1 
ATOM 8847  C CA     . ALA A 1 576 ? -6.575  -5.547  21.549  1.00 58.69  ?  637 ALA A CA     1 
ATOM 8848  C C      . ALA A 1 576 ? -6.699  -4.094  21.987  1.00 61.34  ?  637 ALA A C      1 
ATOM 8849  O O      . ALA A 1 576 ? -5.784  -3.289  21.778  1.00 69.45  ?  637 ALA A O      1 
ATOM 8850  C CB     . ALA A 1 576 ? -7.456  -5.822  20.331  1.00 65.96  ?  637 ALA A CB     1 
ATOM 8851  H H      . ALA A 1 576 ? -7.620  -6.944  22.481  1.00 81.14  ?  637 ALA A H      1 
ATOM 8852  H HA     . ALA A 1 576 ? -5.652  -5.708  21.297  1.00 70.42  ?  637 ALA A HA     1 
ATOM 8853  H HB1    . ALA A 1 576 ? -7.204  -5.217  19.616  1.00 79.15  ?  637 ALA A HB1    1 
ATOM 8854  H HB2    . ALA A 1 576 ? -7.325  -6.741  20.048  1.00 79.15  ?  637 ALA A HB2    1 
ATOM 8855  H HB3    . ALA A 1 576 ? -8.384  -5.680  20.574  1.00 79.15  ?  637 ALA A HB3    1 
ATOM 8856  N N      . ILE A 1 577 ? -7.824  -3.743  22.613  1.00 58.98  ?  638 ILE A N      1 
ATOM 8857  C CA     . ILE A 1 577 ? -8.050  -2.360  23.023  1.00 54.29  ?  638 ILE A CA     1 
ATOM 8858  C C      . ILE A 1 577 ? -6.956  -1.912  23.982  1.00 52.11  ?  638 ILE A C      1 
ATOM 8859  O O      . ILE A 1 577 ? -6.378  -0.830  23.834  1.00 73.21  ?  638 ILE A O      1 
ATOM 8860  C CB     . ILE A 1 577 ? -9.446  -2.204  23.653  1.00 59.19  ?  638 ILE A CB     1 
ATOM 8861  C CG1    . ILE A 1 577 ? -10.515 -2.807  22.735  1.00 67.31  ?  638 ILE A CG1    1 
ATOM 8862  C CG2    . ILE A 1 577 ? -9.729  -0.734  23.915  1.00 70.44  ?  638 ILE A CG2    1 
ATOM 8863  C CD1    . ILE A 1 577 ? -11.942 -2.660  23.233  1.00 65.21  ?  638 ILE A CD1    1 
ATOM 8864  H H      . ILE A 1 577 ? -8.465  -4.282  22.809  1.00 70.77  ?  638 ILE A H      1 
ATOM 8865  H HA     . ILE A 1 577 ? -8.012  -1.790  22.240  1.00 65.14  ?  638 ILE A HA     1 
ATOM 8866  H HB     . ILE A 1 577 ? -9.460  -2.679  24.499  1.00 71.02  ?  638 ILE A HB     1 
ATOM 8867  H HG12   . ILE A 1 577 ? -10.461 -2.371  21.870  1.00 80.77  ?  638 ILE A HG12   1 
ATOM 8868  H HG13   . ILE A 1 577 ? -10.337 -3.755  22.633  1.00 80.77  ?  638 ILE A HG13   1 
ATOM 8869  H HG21   . ILE A 1 577 ? -10.611 -0.648  24.311  1.00 84.53  ?  638 ILE A HG21   1 
ATOM 8870  H HG22   . ILE A 1 577 ? -9.058  -0.387  24.523  1.00 84.53  ?  638 ILE A HG22   1 
ATOM 8871  H HG23   . ILE A 1 577 ? -9.696  -0.251  23.074  1.00 84.53  ?  638 ILE A HG23   1 
ATOM 8872  H HD11   . ILE A 1 577 ? -12.544 -3.068  22.591  1.00 78.25  ?  638 ILE A HD11   1 
ATOM 8873  H HD12   . ILE A 1 577 ? -12.024 -3.104  24.092  1.00 78.25  ?  638 ILE A HD12   1 
ATOM 8874  H HD13   . ILE A 1 577 ? -12.148 -1.717  23.327  1.00 78.25  ?  638 ILE A HD13   1 
ATOM 8875  N N      . ASP A 1 578 ? -6.653  -2.744  24.979  1.00 50.00  ?  639 ASP A N      1 
ATOM 8876  C CA     . ASP A 1 578 ? -5.598  -2.420  25.929  1.00 63.79  ?  639 ASP A CA     1 
ATOM 8877  C C      . ASP A 1 578 ? -4.243  -2.263  25.257  1.00 57.09  ?  639 ASP A C      1 
ATOM 8878  O O      . ASP A 1 578 ? -3.329  -1.690  25.859  1.00 65.40  ?  639 ASP A O      1 
ATOM 8879  C CB     . ASP A 1 578 ? -5.512  -3.503  27.005  1.00 74.74  ?  639 ASP A CB     1 
ATOM 8880  C CG     . ASP A 1 578 ? -6.609  -3.384  28.041  1.00 71.15  ?  639 ASP A CG     1 
ATOM 8881  O OD1    . ASP A 1 578 ? -7.528  -2.563  27.843  1.00 58.99  ?  639 ASP A OD1    1 
ATOM 8882  O OD2    . ASP A 1 578 ? -6.553  -4.115  29.051  1.00 74.29  -1 639 ASP A OD2    1 
ATOM 8883  H H      . ASP A 1 578 ? -7.043  -3.497  25.124  1.00 60.00  ?  639 ASP A H      1 
ATOM 8884  H HA     . ASP A 1 578 ? -5.814  -1.581  26.366  1.00 76.54  ?  639 ASP A HA     1 
ATOM 8885  H HB2    . ASP A 1 578 ? -5.589  -4.373  26.585  1.00 89.68  ?  639 ASP A HB2    1 
ATOM 8886  H HB3    . ASP A 1 578 ? -4.659  -3.429  27.461  1.00 89.68  ?  639 ASP A HB3    1 
ATOM 8887  N N      . ASN A 1 579 ? -4.090  -2.755  24.027  1.00 50.94  ?  640 ASN A N      1 
ATOM 8888  C CA     . ASN A 1 579 ? -2.809  -2.720  23.336  1.00 57.76  ?  640 ASN A CA     1 
ATOM 8889  C C      . ASN A 1 579 ? -2.856  -1.921  22.040  1.00 56.05  ?  640 ASN A C      1 
ATOM 8890  O O      . ASN A 1 579 ? -1.866  -1.909  21.299  1.00 51.10  ?  640 ASN A O      1 
ATOM 8891  C CB     . ASN A 1 579 ? -2.328  -4.145  23.051  1.00 66.07  ?  640 ASN A CB     1 
ATOM 8892  C CG     . ASN A 1 579 ? -2.115  -4.947  24.316  1.00 65.65  ?  640 ASN A CG     1 
ATOM 8893  O OD1    . ASN A 1 579 ? -3.057  -5.220  25.056  1.00 82.68  ?  640 ASN A OD1    1 
ATOM 8894  N ND2    . ASN A 1 579 ? -0.872  -5.334  24.569  1.00 66.29  ?  640 ASN A ND2    1 
ATOM 8895  H H      . ASN A 1 579 ? -4.722  -3.117  23.570  1.00 61.13  ?  640 ASN A H      1 
ATOM 8896  H HA     . ASN A 1 579 ? -2.155  -2.300  23.916  1.00 69.31  ?  640 ASN A HA     1 
ATOM 8897  H HB2    . ASN A 1 579 ? -2.994  -4.602  22.513  1.00 79.28  ?  640 ASN A HB2    1 
ATOM 8898  H HB3    . ASN A 1 579 ? -1.485  -4.105  22.573  1.00 79.28  ?  640 ASN A HB3    1 
ATOM 8899  H HD21   . ASN A 1 579 ? -0.700  -5.793  25.276  1.00 79.54  ?  640 ASN A HD21   1 
ATOM 8900  H HD22   . ASN A 1 579 ? -0.238  -5.127  24.026  1.00 79.54  ?  640 ASN A HD22   1 
ATOM 8901  N N      . MET A 1 580 ? -3.974  -1.259  21.739  1.00 60.58  ?  641 MET A N      1 
ATOM 8902  C CA     . MET A 1 580 ? -4.034  -0.419  20.547  1.00 51.10  ?  641 MET A CA     1 
ATOM 8903  C C      . MET A 1 580 ? -3.001  0.698   20.615  1.00 57.15  ?  641 MET A C      1 
ATOM 8904  O O      . MET A 1 580 ? -2.267  0.943   19.652  1.00 59.03  ?  641 MET A O      1 
ATOM 8905  C CB     . MET A 1 580 ? -5.438  0.167   20.384  1.00 64.64  ?  641 MET A CB     1 
ATOM 8906  C CG     . MET A 1 580 ? -6.469  -0.780  19.790  1.00 69.17  ?  641 MET A CG     1 
ATOM 8907  S SD     . MET A 1 580 ? -5.984  -1.505  18.212  1.00 60.72  ?  641 MET A SD     1 
ATOM 8908  C CE     . MET A 1 580 ? -5.486  -0.060  17.284  1.00 60.50  ?  641 MET A CE     1 
ATOM 8909  H H      . MET A 1 580 ? -4.699  -1.279  22.201  1.00 72.70  ?  641 MET A H      1 
ATOM 8910  H HA     . MET A 1 580 ? -3.850  -0.968  19.768  1.00 61.32  ?  641 MET A HA     1 
ATOM 8911  H HB2    . MET A 1 580 ? -5.761  0.439   21.258  1.00 77.57  ?  641 MET A HB2    1 
ATOM 8912  H HB3    . MET A 1 580 ? -5.383  0.941   19.803  1.00 77.57  ?  641 MET A HB3    1 
ATOM 8913  H HG2    . MET A 1 580 ? -6.621  -1.507  20.414  1.00 83.00  ?  641 MET A HG2    1 
ATOM 8914  H HG3    . MET A 1 580 ? -7.295  -0.291  19.648  1.00 83.00  ?  641 MET A HG3    1 
ATOM 8915  H HE1    . MET A 1 580 ? -5.199  -0.336  16.399  1.00 72.60  ?  641 MET A HE1    1 
ATOM 8916  H HE2    . MET A 1 580 ? -6.241  0.545   17.213  1.00 72.60  ?  641 MET A HE2    1 
ATOM 8917  H HE3    . MET A 1 580 ? -4.754  0.376   17.748  1.00 72.60  ?  641 MET A HE3    1 
ATOM 8918  N N      . TYR A 1 581 ? -2.927  1.385   21.755  1.00 60.83  ?  642 TYR A N      1 
ATOM 8919  C CA     . TYR A 1 581 ? -2.028  2.527   21.881  1.00 60.37  ?  642 TYR A CA     1 
ATOM 8920  C C      . TYR A 1 581 ? -0.570  2.096   21.773  1.00 62.04  ?  642 TYR A C      1 
ATOM 8921  O O      . TYR A 1 581 ? 0.202   2.676   21.001  1.00 77.30  ?  642 TYR A O      1 
ATOM 8922  C CB     . TYR A 1 581 ? -2.284  3.244   23.207  1.00 83.38  ?  642 TYR A CB     1 
ATOM 8923  C CG     . TYR A 1 581 ? -1.313  4.364   23.515  1.00 79.26  ?  642 TYR A CG     1 
ATOM 8924  C CD1    . TYR A 1 581 ? -0.078  4.101   24.095  1.00 66.45  ?  642 TYR A CD1    1 
ATOM 8925  C CD2    . TYR A 1 581 ? -1.638  5.687   23.242  1.00 82.18  ?  642 TYR A CD2    1 
ATOM 8926  C CE1    . TYR A 1 581 ? 0.809   5.117   24.381  1.00 67.62  ?  642 TYR A CE1    1 
ATOM 8927  C CE2    . TYR A 1 581 ? -0.756  6.712   23.528  1.00 74.10  ?  642 TYR A CE2    1 
ATOM 8928  C CZ     . TYR A 1 581 ? 0.466   6.421   24.097  1.00 78.30  ?  642 TYR A CZ     1 
ATOM 8929  O OH     . TYR A 1 581 ? 1.349   7.435   24.385  1.00 75.25  ?  642 TYR A OH     1 
ATOM 8930  H H      . TYR A 1 581 ? -3.383  1.212   22.464  1.00 72.99  ?  642 TYR A H      1 
ATOM 8931  H HA     . TYR A 1 581 ? -2.209  3.153   21.162  1.00 72.44  ?  642 TYR A HA     1 
ATOM 8932  H HB2    . TYR A 1 581 ? -3.176  3.625   23.187  1.00 100.06 ?  642 TYR A HB2    1 
ATOM 8933  H HB3    . TYR A 1 581 ? -2.223  2.596   23.927  1.00 100.06 ?  642 TYR A HB3    1 
ATOM 8934  H HD1    . TYR A 1 581 ? 0.157   3.222   24.287  1.00 79.74  ?  642 TYR A HD1    1 
ATOM 8935  H HD2    . TYR A 1 581 ? -2.460  5.885   22.858  1.00 98.62  ?  642 TYR A HD2    1 
ATOM 8936  H HE1    . TYR A 1 581 ? 1.633   4.924   24.766  1.00 81.15  ?  642 TYR A HE1    1 
ATOM 8937  H HE2    . TYR A 1 581 ? -0.985  7.593   23.337  1.00 88.92  ?  642 TYR A HE2    1 
ATOM 8938  H HH     . TYR A 1 581 ? 1.018   8.175   24.164  1.00 90.30  ?  642 TYR A HH     1 
ATOM 8939  N N      . ILE A 1 582 ? -0.173  1.082   22.545  1.00 60.14  ?  643 ILE A N      1 
ATOM 8940  C CA     . ILE A 1 582 ? 1.233   0.683   22.591  1.00 63.26  ?  643 ILE A CA     1 
ATOM 8941  C C      . ILE A 1 582 ? 1.755   0.395   21.192  1.00 64.01  ?  643 ILE A C      1 
ATOM 8942  O O      . ILE A 1 582 ? 2.893   0.738   20.853  1.00 70.05  ?  643 ILE A O      1 
ATOM 8943  C CB     . ILE A 1 582 ? 1.418   -0.529  23.524  1.00 63.79  ?  643 ILE A CB     1 
ATOM 8944  C CG1    . ILE A 1 582 ? 2.869   -1.019  23.506  1.00 57.55  ?  643 ILE A CG1    1 
ATOM 8945  C CG2    . ILE A 1 582 ? 0.493   -1.664  23.124  1.00 52.78  ?  643 ILE A CG2    1 
ATOM 8946  C CD1    . ILE A 1 582 ? 3.884   0.027   23.894  1.00 44.46  ?  643 ILE A CD1    1 
ATOM 8947  H H      . ILE A 1 582 ? -0.693  0.614   23.046  1.00 72.16  ?  643 ILE A H      1 
ATOM 8948  H HA     . ILE A 1 582 ? 1.753   1.417   22.955  1.00 75.92  ?  643 ILE A HA     1 
ATOM 8949  H HB     . ILE A 1 582 ? 1.197   -0.258  24.429  1.00 76.55  ?  643 ILE A HB     1 
ATOM 8950  H HG12   . ILE A 1 582 ? 2.955   -1.758  24.128  1.00 69.06  ?  643 ILE A HG12   1 
ATOM 8951  H HG13   . ILE A 1 582 ? 3.084   -1.320  22.609  1.00 69.06  ?  643 ILE A HG13   1 
ATOM 8952  H HG21   . ILE A 1 582 ? 0.631   -2.411  23.727  1.00 63.34  ?  643 ILE A HG21   1 
ATOM 8953  H HG22   . ILE A 1 582 ? -0.426  -1.358  23.181  1.00 63.34  ?  643 ILE A HG22   1 
ATOM 8954  H HG23   . ILE A 1 582 ? 0.697   -1.931  22.214  1.00 63.34  ?  643 ILE A HG23   1 
ATOM 8955  H HD11   . ILE A 1 582 ? 4.771   -0.364  23.856  1.00 53.35  ?  643 ILE A HD11   1 
ATOM 8956  H HD12   . ILE A 1 582 ? 3.823   0.771   23.274  1.00 53.35  ?  643 ILE A HD12   1 
ATOM 8957  H HD13   . ILE A 1 582 ? 3.694   0.331   24.795  1.00 53.35  ?  643 ILE A HD13   1 
ATOM 8958  N N      . LEU A 1 583 ? 0.935   -0.245  20.357  1.00 55.40  ?  644 LEU A N      1 
ATOM 8959  C CA     . LEU A 1 583 ? 1.363   -0.537  18.995  1.00 54.52  ?  644 LEU A CA     1 
ATOM 8960  C C      . LEU A 1 583 ? 1.605   0.749   18.216  1.00 61.24  ?  644 LEU A C      1 
ATOM 8961  O O      . LEU A 1 583 ? 2.576   0.853   17.459  1.00 59.33  ?  644 LEU A O      1 
ATOM 8962  C CB     . LEU A 1 583 ? 0.319   -1.407  18.293  1.00 70.20  ?  644 LEU A CB     1 
ATOM 8963  C CG     . LEU A 1 583 ? 0.060   -2.786  18.910  1.00 68.31  ?  644 LEU A CG     1 
ATOM 8964  C CD1    . LEU A 1 583 ? -1.341  -3.265  18.580  1.00 50.57  ?  644 LEU A CD1    1 
ATOM 8965  C CD2    . LEU A 1 583 ? 1.083   -3.805  18.430  1.00 40.70  ?  644 LEU A CD2    1 
ATOM 8966  H H      . LEU A 1 583 ? 0.142   -0.515  20.552  1.00 66.48  ?  644 LEU A H      1 
ATOM 8967  H HA     . LEU A 1 583 ? 2.197   -1.032  19.024  1.00 65.42  ?  644 LEU A HA     1 
ATOM 8968  H HB2    . LEU A 1 583 ? -0.525  -0.928  18.293  1.00 84.24  ?  644 LEU A HB2    1 
ATOM 8969  H HB3    . LEU A 1 583 ? 0.608   -1.549  17.378  1.00 84.24  ?  644 LEU A HB3    1 
ATOM 8970  H HG     . LEU A 1 583 ? 0.134   -2.719  19.874  1.00 81.97  ?  644 LEU A HG     1 
ATOM 8971  H HD11   . LEU A 1 583 ? -1.479  -4.138  18.980  1.00 60.68  ?  644 LEU A HD11   1 
ATOM 8972  H HD12   . LEU A 1 583 ? -1.983  -2.632  18.937  1.00 60.68  ?  644 LEU A HD12   1 
ATOM 8973  H HD13   . LEU A 1 583 ? -1.436  -3.324  17.616  1.00 60.68  ?  644 LEU A HD13   1 
ATOM 8974  H HD21   . LEU A 1 583 ? 0.889   -4.663  18.839  1.00 48.84  ?  644 LEU A HD21   1 
ATOM 8975  H HD22   . LEU A 1 583 ? 1.027   -3.878  17.464  1.00 48.84  ?  644 LEU A HD22   1 
ATOM 8976  H HD23   . LEU A 1 583 ? 1.969   -3.507  18.689  1.00 48.84  ?  644 LEU A HD23   1 
ATOM 8977  N N      . GLY A 1 584 ? 0.742   1.748   18.408  1.00 68.65  ?  645 GLY A N      1 
ATOM 8978  C CA     . GLY A 1 584 ? 0.874   2.988   17.662  1.00 64.97  ?  645 GLY A CA     1 
ATOM 8979  C C      . GLY A 1 584 ? 2.195   3.693   17.896  1.00 69.54  ?  645 GLY A C      1 
ATOM 8980  O O      . GLY A 1 584 ? 2.680   4.414   17.020  1.00 81.81  ?  645 GLY A O      1 
ATOM 8981  H H      . GLY A 1 584 ? 0.081   1.730   18.958  1.00 82.38  ?  645 GLY A H      1 
ATOM 8982  H HA2    . GLY A 1 584 ? 0.793   2.800   16.714  1.00 77.96  ?  645 GLY A HA2    1 
ATOM 8983  H HA3    . GLY A 1 584 ? 0.158   3.591   17.915  1.00 77.96  ?  645 GLY A HA3    1 
ATOM 8984  N N      . MET A 1 585 ? 2.794   3.501   19.071  1.00 63.83  ?  646 MET A N      1 
ATOM 8985  C CA     . MET A 1 585 ? 4.071   4.142   19.359  1.00 76.95  ?  646 MET A CA     1 
ATOM 8986  C C      . MET A 1 585 ? 5.227   3.430   18.671  1.00 78.84  ?  646 MET A C      1 
ATOM 8987  O O      . MET A 1 585 ? 6.202   4.080   18.278  1.00 85.68  ?  646 MET A O      1 
ATOM 8988  C CB     . MET A 1 585 ? 4.307   4.189   20.869  1.00 80.63  ?  646 MET A CB     1 
ATOM 8989  C CG     . MET A 1 585 ? 3.241   4.958   21.635  1.00 82.24  ?  646 MET A CG     1 
ATOM 8990  S SD     . MET A 1 585 ? 3.165   6.705   21.193  1.00 84.22  ?  646 MET A SD     1 
ATOM 8991  C CE     . MET A 1 585 ? 4.563   7.351   22.106  1.00 83.59  ?  646 MET A CE     1 
ATOM 8992  H H      . MET A 1 585 ? 2.486   3.012   19.708  1.00 76.59  ?  646 MET A H      1 
ATOM 8993  H HA     . MET A 1 585 ? 4.036   5.057   19.039  1.00 92.34  ?  646 MET A HA     1 
ATOM 8994  H HB2    . MET A 1 585 ? 4.321   3.281   21.211  1.00 96.76  ?  646 MET A HB2    1 
ATOM 8995  H HB3    . MET A 1 585 ? 5.160   4.617   21.039  1.00 96.76  ?  646 MET A HB3    1 
ATOM 8996  H HG2    . MET A 1 585 ? 2.374   4.565   21.447  1.00 98.69  ?  646 MET A HG2    1 
ATOM 8997  H HG3    . MET A 1 585 ? 3.432   4.898   22.584  1.00 98.69  ?  646 MET A HG3    1 
ATOM 8998  H HE1    . MET A 1 585 ? 4.629   8.306   21.946  1.00 100.31 ?  646 MET A HE1    1 
ATOM 8999  H HE2    . MET A 1 585 ? 4.427   7.182   23.051  1.00 100.31 ?  646 MET A HE2    1 
ATOM 9000  H HE3    . MET A 1 585 ? 5.370   6.907   21.802  1.00 100.31 ?  646 MET A HE3    1 
ATOM 9001  N N      . CYS A 1 586 ? 5.138   2.109   18.511  1.00 77.82  ?  647 CYS A N      1 
ATOM 9002  C CA     . CYS A 1 586 ? 6.181   1.383   17.799  1.00 70.72  ?  647 CYS A CA     1 
ATOM 9003  C C      . CYS A 1 586 ? 6.125   1.655   16.303  1.00 66.85  ?  647 CYS A C      1 
ATOM 9004  O O      . CYS A 1 586 ? 7.158   1.612   15.626  1.00 60.43  ?  647 CYS A O      1 
ATOM 9005  C CB     . CYS A 1 586 ? 6.056   -0.114  18.074  1.00 65.14  ?  647 CYS A CB     1 
ATOM 9006  S SG     . CYS A 1 586 ? 6.324   -0.558  19.805  1.00 89.41  ?  647 CYS A SG     1 
ATOM 9007  H H      . CYS A 1 586 ? 4.493   1.619   18.801  1.00 93.38  ?  647 CYS A H      1 
ATOM 9008  H HA     . CYS A 1 586 ? 7.047   1.675   18.124  1.00 84.87  ?  647 CYS A HA     1 
ATOM 9009  H HB2    . CYS A 1 586 ? 5.163   -0.404  17.828  1.00 78.16  ?  647 CYS A HB2    1 
ATOM 9010  H HB3    . CYS A 1 586 ? 6.714   -0.587  17.541  1.00 78.16  ?  647 CYS A HB3    1 
ATOM 9011  H HG     . CYS A 1 586 ? 6.207   -1.746  19.927  1.00 107.29 ?  647 CYS A HG     1 
ATOM 9012  N N      . VAL A 1 587 ? 4.935   1.939   15.772  1.00 73.10  ?  648 VAL A N      1 
ATOM 9013  C CA     . VAL A 1 587 ? 4.815   2.295   14.364  1.00 66.04  ?  648 VAL A CA     1 
ATOM 9014  C C      . VAL A 1 587 ? 5.294   3.715   14.106  1.00 82.14  ?  648 VAL A C      1 
ATOM 9015  O O      . VAL A 1 587 ? 5.562   4.071   12.954  1.00 90.00  ?  648 VAL A O      1 
ATOM 9016  C CB     . VAL A 1 587 ? 3.361   2.128   13.890  1.00 63.38  ?  648 VAL A CB     1 
ATOM 9017  C CG1    . VAL A 1 587 ? 3.234   2.408   12.398  1.00 70.47  ?  648 VAL A CG1    1 
ATOM 9018  C CG2    . VAL A 1 587 ? 2.862   0.725   14.196  1.00 72.89  ?  648 VAL A CG2    1 
ATOM 9019  H H      . VAL A 1 587 ? 4.191   1.933   16.203  1.00 87.72  ?  648 VAL A H      1 
ATOM 9020  H HA     . VAL A 1 587 ? 5.369   1.695   13.841  1.00 79.24  ?  648 VAL A HA     1 
ATOM 9021  H HB     . VAL A 1 587 ? 2.798   2.759   14.364  1.00 76.05  ?  648 VAL A HB     1 
ATOM 9022  H HG11   . VAL A 1 587 ? 2.308   2.294   12.133  1.00 84.57  ?  648 VAL A HG11   1 
ATOM 9023  H HG12   . VAL A 1 587 ? 3.519   3.319   12.223  1.00 84.57  ?  648 VAL A HG12   1 
ATOM 9024  H HG13   . VAL A 1 587 ? 3.797   1.786   11.911  1.00 84.57  ?  648 VAL A HG13   1 
ATOM 9025  H HG21   . VAL A 1 587 ? 1.945   0.642   13.889  1.00 87.46  ?  648 VAL A HG21   1 
ATOM 9026  H HG22   . VAL A 1 587 ? 3.424   0.082   13.736  1.00 87.46  ?  648 VAL A HG22   1 
ATOM 9027  H HG23   . VAL A 1 587 ? 2.905   0.577   15.154  1.00 87.46  ?  648 VAL A HG23   1 
ATOM 9028  N N      . SER A 1 588 ? 5.423   4.533   15.148  1.00 77.45  ?  649 SER A N      1 
ATOM 9029  C CA     . SER A 1 588 ? 5.868   5.908   14.975  1.00 60.93  ?  649 SER A CA     1 
ATOM 9030  C C      . SER A 1 588 ? 7.364   6.044   15.227  1.00 62.52  ?  649 SER A C      1 
ATOM 9031  O O      . SER A 1 588 ? 8.075   6.677   14.441  1.00 67.05  ?  649 SER A O      1 
ATOM 9032  C CB     . SER A 1 588 ? 5.082   6.830   15.909  1.00 57.87  ?  649 SER A CB     1 
ATOM 9033  O OG     . SER A 1 588 ? 3.689   6.623   15.760  1.00 52.84  ?  649 SER A OG     1 
ATOM 9034  H H      . SER A 1 588 ? 5.259   4.315   15.963  1.00 92.95  ?  649 SER A H      1 
ATOM 9035  H HA     . SER A 1 588 ? 5.692   6.184   14.062  1.00 73.11  ?  649 SER A HA     1 
ATOM 9036  H HB2    . SER A 1 588 ? 5.334   6.639   16.826  1.00 69.45  ?  649 SER A HB2    1 
ATOM 9037  H HB3    . SER A 1 588 ? 5.291   7.752   15.692  1.00 69.45  ?  649 SER A HB3    1 
ATOM 9038  H HG     . SER A 1 588 ? 3.495   5.827   15.944  1.00 63.41  ?  649 SER A HG     1 
ATOM 9039  N N      . LYS A 1 589 ? 7.857   5.441   16.309  1.00 67.21  ?  650 LYS A N      1 
ATOM 9040  C CA     . LYS A 1 589 ? 9.245   5.587   16.716  1.00 57.48  ?  650 LYS A CA     1 
ATOM 9041  C C      . LYS A 1 589 ? 10.081  4.336   16.489  1.00 66.11  ?  650 LYS A C      1 
ATOM 9042  O O      . LYS A 1 589 ? 11.302  4.391   16.666  1.00 80.43  ?  650 LYS A O      1 
ATOM 9043  C CB     . LYS A 1 589 ? 9.320   5.967   18.202  1.00 67.51  ?  650 LYS A CB     1 
ATOM 9044  C CG     . LYS A 1 589 ? 8.334   7.040   18.620  1.00 77.82  ?  650 LYS A CG     1 
ATOM 9045  C CD     . LYS A 1 589 ? 8.394   7.295   20.113  1.00 77.82  ?  650 LYS A CD     1 
ATOM 9046  C CE     . LYS A 1 589 ? 7.403   8.366   20.522  1.00 76.20  ?  650 LYS A CE     1 
ATOM 9047  N NZ     . LYS A 1 589 ? 7.410   8.589   21.990  1.00 77.22  1  650 LYS A NZ     1 
ATOM 9048  H H      . LYS A 1 589 ? 7.395   4.934   16.828  1.00 80.66  ?  650 LYS A H      1 
ATOM 9049  H HA     . LYS A 1 589 ? 9.646   6.308   16.205  1.00 68.97  ?  650 LYS A HA     1 
ATOM 9050  H HB2    . LYS A 1 589 ? 9.140   5.176   18.734  1.00 81.01  ?  650 LYS A HB2    1 
ATOM 9051  H HB3    . LYS A 1 589 ? 10.213  6.295   18.394  1.00 81.01  ?  650 LYS A HB3    1 
ATOM 9052  H HG2    . LYS A 1 589 ? 8.548   7.867   18.161  1.00 93.39  ?  650 LYS A HG2    1 
ATOM 9053  H HG3    . LYS A 1 589 ? 7.435   6.753   18.396  1.00 93.39  ?  650 LYS A HG3    1 
ATOM 9054  H HD2    . LYS A 1 589 ? 8.175   6.479   20.588  1.00 93.38  ?  650 LYS A HD2    1 
ATOM 9055  H HD3    . LYS A 1 589 ? 9.285   7.596   20.352  1.00 93.38  ?  650 LYS A HD3    1 
ATOM 9056  H HE2    . LYS A 1 589 ? 7.637   9.201   20.088  1.00 91.44  ?  650 LYS A HE2    1 
ATOM 9057  H HE3    . LYS A 1 589 ? 6.510   8.092   20.262  1.00 91.44  ?  650 LYS A HE3    1 
ATOM 9058  H HZ1    . LYS A 1 589 ? 6.821   9.220   22.204  1.00 92.66  ?  650 LYS A HZ1    1 
ATOM 9059  H HZ2    . LYS A 1 589 ? 7.194   7.836   22.413  1.00 92.66  ?  650 LYS A HZ2    1 
ATOM 9060  H HZ3    . LYS A 1 589 ? 8.220   8.846   22.254  1.00 92.66  ?  650 LYS A HZ3    1 
ATOM 9061  N N      . GLY A 1 590 ? 9.467   3.219   16.110  1.00 55.18  ?  651 GLY A N      1 
ATOM 9062  C CA     . GLY A 1 590 ? 10.211  1.986   15.955  1.00 55.07  ?  651 GLY A CA     1 
ATOM 9063  C C      . GLY A 1 590 ? 11.042  1.965   14.686  1.00 57.73  ?  651 GLY A C      1 
ATOM 9064  O O      . GLY A 1 590 ? 10.718  2.603   13.686  1.00 59.08  ?  651 GLY A O      1 
ATOM 9065  H H      . GLY A 1 590 ? 8.627   3.153   15.940  1.00 66.22  ?  651 GLY A H      1 
ATOM 9066  H HA2    . GLY A 1 590 ? 10.804  1.869   16.713  1.00 66.09  ?  651 GLY A HA2    1 
ATOM 9067  H HA3    . GLY A 1 590 ? 9.594   1.237   15.929  1.00 66.09  ?  651 GLY A HA3    1 
ATOM 9068  N N      . ASN A 1 591 ? 12.137  1.211   14.736  1.00 71.24  ?  652 ASN A N      1 
ATOM 9069  C CA     . ASN A 1 591 ? 12.962  1.038   13.554  1.00 76.13  ?  652 ASN A CA     1 
ATOM 9070  C C      . ASN A 1 591 ? 12.159  0.331   12.463  1.00 67.05  ?  652 ASN A C      1 
ATOM 9071  O O      . ASN A 1 591 ? 11.052  -0.165  12.684  1.00 75.53  ?  652 ASN A O      1 
ATOM 9072  C CB     . ASN A 1 591 ? 14.234  0.258   13.892  1.00 73.39  ?  652 ASN A CB     1 
ATOM 9073  C CG     . ASN A 1 591 ? 13.949  -1.055  14.587  1.00 72.32  ?  652 ASN A CG     1 
ATOM 9074  O OD1    . ASN A 1 591 ? 12.799  -1.466  14.717  1.00 71.14  ?  652 ASN A OD1    1 
ATOM 9075  N ND2    . ASN A 1 591 ? 15.002  -1.726  15.035  1.00 72.03  ?  652 ASN A ND2    1 
ATOM 9076  H H      . ASN A 1 591 ? 12.418  0.795   15.434  1.00 85.48  ?  652 ASN A H      1 
ATOM 9077  H HA     . ASN A 1 591 ? 13.224  1.910   13.219  1.00 91.35  ?  652 ASN A HA     1 
ATOM 9078  H HB2    . ASN A 1 591 ? 14.713  0.065   13.072  1.00 88.07  ?  652 ASN A HB2    1 
ATOM 9079  H HB3    . ASN A 1 591 ? 14.786  0.795   14.481  1.00 88.07  ?  652 ASN A HB3    1 
ATOM 9080  H HD21   . ASN A 1 591 ? 14.894  -2.479  15.437  1.00 86.43  ?  652 ASN A HD21   1 
ATOM 9081  H HD22   . ASN A 1 591 ? 15.794  -1.409  14.922  1.00 86.43  ?  652 ASN A HD22   1 
ATOM 9082  N N      . ALA A 1 592 ? 12.740  0.293   11.262  1.00 54.98  ?  653 ALA A N      1 
ATOM 9083  C CA     . ALA A 1 592 ? 12.024  -0.222  10.100  1.00 66.42  ?  653 ALA A CA     1 
ATOM 9084  C C      . ALA A 1 592 ? 11.451  -1.608  10.368  1.00 69.61  ?  653 ALA A C      1 
ATOM 9085  O O      . ALA A 1 592 ? 10.268  -1.864  10.119  1.00 70.06  ?  653 ALA A O      1 
ATOM 9086  C CB     . ALA A 1 592 ? 12.956  -0.253  8.890   1.00 85.11  ?  653 ALA A CB     1 
ATOM 9087  H H      . ALA A 1 592 ? 13.541  0.559   11.097  1.00 65.98  ?  653 ALA A H      1 
ATOM 9088  H HA     . ALA A 1 592 ? 11.285  0.373   9.895   1.00 79.70  ?  653 ALA A HA     1 
ATOM 9089  H HB1    . ALA A 1 592 ? 12.468  -0.597  8.125   1.00 102.13 ?  653 ALA A HB1    1 
ATOM 9090  H HB2    . ALA A 1 592 ? 13.266  0.647   8.707   1.00 102.13 ?  653 ALA A HB2    1 
ATOM 9091  H HB3    . ALA A 1 592 ? 13.710  -0.830  9.087   1.00 102.13 ?  653 ALA A HB3    1 
ATOM 9092  N N      . SER A 1 593 ? 12.280  -2.517  10.881  1.00 68.13  ?  654 SER A N      1 
ATOM 9093  C CA     . SER A 1 593 ? 11.836  -3.891  11.087  1.00 62.24  ?  654 SER A CA     1 
ATOM 9094  C C      . SER A 1 593 ? 10.649  -3.943  12.041  1.00 51.16  ?  654 SER A C      1 
ATOM 9095  O O      . SER A 1 593 ? 9.626   -4.570  11.746  1.00 52.66  ?  654 SER A O      1 
ATOM 9096  C CB     . SER A 1 593 ? 12.994  -4.737  11.614  1.00 69.29  ?  654 SER A CB     1 
ATOM 9097  O OG     . SER A 1 593 ? 14.152  -4.559  10.818  1.00 74.81  ?  654 SER A OG     1 
ATOM 9098  H H      . SER A 1 593 ? 13.094  -2.365  11.114  1.00 81.76  ?  654 SER A H      1 
ATOM 9099  H HA     . SER A 1 593 ? 11.554  -4.263  10.237  1.00 74.68  ?  654 SER A HA     1 
ATOM 9100  H HB2    . SER A 1 593 ? 13.192  -4.468  12.524  1.00 83.14  ?  654 SER A HB2    1 
ATOM 9101  H HB3    . SER A 1 593 ? 12.737  -5.672  11.592  1.00 83.14  ?  654 SER A HB3    1 
ATOM 9102  H HG     . SER A 1 593 ? 14.781  -5.029  11.117  1.00 89.77  ?  654 SER A HG     1 
ATOM 9103  N N      . LEU A 1 594 ? 10.765  -3.281  13.192  1.00 56.73  ?  655 LEU A N      1 
ATOM 9104  C CA     . LEU A 1 594 ? 9.668   -3.268  14.152  1.00 52.74  ?  655 LEU A CA     1 
ATOM 9105  C C      . LEU A 1 594 ? 8.470   -2.512  13.596  1.00 52.96  ?  655 LEU A C      1 
ATOM 9106  O O      . LEU A 1 594 ? 7.335   -2.999  13.645  1.00 57.37  ?  655 LEU A O      1 
ATOM 9107  C CB     . LEU A 1 594 ? 10.143  -2.645  15.463  1.00 46.73  ?  655 LEU A CB     1 
ATOM 9108  C CG     . LEU A 1 594 ? 9.102   -2.291  16.521  1.00 45.13  ?  655 LEU A CG     1 
ATOM 9109  C CD1    . LEU A 1 594 ? 8.107   -3.410  16.751  1.00 63.47  ?  655 LEU A CD1    1 
ATOM 9110  C CD2    . LEU A 1 594 ? 9.820   -1.955  17.812  1.00 47.70  ?  655 LEU A CD2    1 
ATOM 9111  H H      . LEU A 1 594 ? 11.461  -2.839  13.436  1.00 68.08  ?  655 LEU A H      1 
ATOM 9112  H HA     . LEU A 1 594 ? 9.392   -4.180  14.333  1.00 63.29  ?  655 LEU A HA     1 
ATOM 9113  H HB2    . LEU A 1 594 ? 10.764  -3.265  15.877  1.00 56.08  ?  655 LEU A HB2    1 
ATOM 9114  H HB3    . LEU A 1 594 ? 10.614  -1.825  15.248  1.00 56.08  ?  655 LEU A HB3    1 
ATOM 9115  H HG     . LEU A 1 594 ? 8.612   -1.504  16.235  1.00 54.16  ?  655 LEU A HG     1 
ATOM 9116  H HD11   . LEU A 1 594 ? 7.471   -3.132  17.429  1.00 76.16  ?  655 LEU A HD11   1 
ATOM 9117  H HD12   . LEU A 1 594 ? 7.643   -3.595  15.919  1.00 76.16  ?  655 LEU A HD12   1 
ATOM 9118  H HD13   . LEU A 1 594 ? 8.584   -4.201  17.047  1.00 76.16  ?  655 LEU A HD13   1 
ATOM 9119  H HD21   . LEU A 1 594 ? 9.162   -1.729  18.489  1.00 57.24  ?  655 LEU A HD21   1 
ATOM 9120  H HD22   . LEU A 1 594 ? 10.336  -2.726  18.096  1.00 57.24  ?  655 LEU A HD22   1 
ATOM 9121  H HD23   . LEU A 1 594 ? 10.410  -1.201  17.658  1.00 57.24  ?  655 LEU A HD23   1 
ATOM 9122  N N      . LYS A 1 595 ? 8.707   -1.315  13.060  1.00 57.85  ?  656 LYS A N      1 
ATOM 9123  C CA     . LYS A 1 595 ? 7.637   -0.558  12.424  1.00 58.93  ?  656 LYS A CA     1 
ATOM 9124  C C      . LYS A 1 595 ? 6.945   -1.390  11.354  1.00 51.12  ?  656 LYS A C      1 
ATOM 9125  O O      . LYS A 1 595 ? 5.728   -1.294  11.165  1.00 42.78  ?  656 LYS A O      1 
ATOM 9126  C CB     . LYS A 1 595 ? 8.216   0.725   11.829  1.00 66.30  ?  656 LYS A CB     1 
ATOM 9127  C CG     . LYS A 1 595 ? 7.194   1.717   11.316  1.00 66.47  ?  656 LYS A CG     1 
ATOM 9128  C CD     . LYS A 1 595 ? 7.712   3.145   11.434  1.00 69.23  ?  656 LYS A CD     1 
ATOM 9129  C CE     . LYS A 1 595 ? 9.030   3.360   10.704  1.00 74.17  ?  656 LYS A CE     1 
ATOM 9130  N NZ     . LYS A 1 595 ? 10.076  3.889   11.620  1.00 79.40  1  656 LYS A NZ     1 
ATOM 9131  H H      . LYS A 1 595 ? 9.473   -0.924  13.053  1.00 69.42  ?  656 LYS A H      1 
ATOM 9132  H HA     . LYS A 1 595 ? 6.978   -0.312  13.092  1.00 70.72  ?  656 LYS A HA     1 
ATOM 9133  H HB2    . LYS A 1 595 ? 8.739   1.172   12.512  1.00 79.56  ?  656 LYS A HB2    1 
ATOM 9134  H HB3    . LYS A 1 595 ? 8.790   0.486   11.084  1.00 79.56  ?  656 LYS A HB3    1 
ATOM 9135  H HG2    . LYS A 1 595 ? 7.011   1.535   10.381  1.00 79.76  ?  656 LYS A HG2    1 
ATOM 9136  H HG3    . LYS A 1 595 ? 6.381   1.642   11.840  1.00 79.76  ?  656 LYS A HG3    1 
ATOM 9137  H HD2    . LYS A 1 595 ? 7.057   3.751   11.054  1.00 83.07  ?  656 LYS A HD2    1 
ATOM 9138  H HD3    . LYS A 1 595 ? 7.851   3.354   12.371  1.00 83.07  ?  656 LYS A HD3    1 
ATOM 9139  H HE2    . LYS A 1 595 ? 9.339   2.513   10.346  1.00 89.00  ?  656 LYS A HE2    1 
ATOM 9140  H HE3    . LYS A 1 595 ? 8.899   4.001   9.988   1.00 89.00  ?  656 LYS A HE3    1 
ATOM 9141  H HZ1    . LYS A 1 595 ? 10.838  4.008   11.175  1.00 95.28  ?  656 LYS A HZ1    1 
ATOM 9142  H HZ2    . LYS A 1 595 ? 9.816   4.669   11.961  1.00 95.28  ?  656 LYS A HZ2    1 
ATOM 9143  H HZ3    . LYS A 1 595 ? 10.216  3.315   12.286  1.00 95.28  ?  656 LYS A HZ3    1 
ATOM 9144  N N      . TYR A 1 596 ? 7.711   -2.227  10.654  1.00 50.79  ?  657 TYR A N      1 
ATOM 9145  C CA     . TYR A 1 596 ? 7.141   -3.080  9.617   1.00 52.76  ?  657 TYR A CA     1 
ATOM 9146  C C      . TYR A 1 596 ? 6.135   -4.063  10.203  1.00 47.65  ?  657 TYR A C      1 
ATOM 9147  O O      . TYR A 1 596 ? 4.991   -4.146  9.743   1.00 39.40  ?  657 TYR A O      1 
ATOM 9148  C CB     . TYR A 1 596 ? 8.269   -3.816  8.892   1.00 57.51  ?  657 TYR A CB     1 
ATOM 9149  C CG     . TYR A 1 596 ? 7.820   -4.887  7.923   1.00 62.20  ?  657 TYR A CG     1 
ATOM 9150  C CD1    . TYR A 1 596 ? 7.452   -4.567  6.624   1.00 51.72  ?  657 TYR A CD1    1 
ATOM 9151  C CD2    . TYR A 1 596 ? 7.790   -6.223  8.301   1.00 70.81  ?  657 TYR A CD2    1 
ATOM 9152  C CE1    . TYR A 1 596 ? 7.051   -5.545  5.734   1.00 52.44  ?  657 TYR A CE1    1 
ATOM 9153  C CE2    . TYR A 1 596 ? 7.391   -7.207  7.419   1.00 61.44  ?  657 TYR A CE2    1 
ATOM 9154  C CZ     . TYR A 1 596 ? 7.024   -6.862  6.137   1.00 58.57  ?  657 TYR A CZ     1 
ATOM 9155  O OH     . TYR A 1 596 ? 6.627   -7.841  5.257   1.00 70.89  ?  657 TYR A OH     1 
ATOM 9156  H H      . TYR A 1 596 ? 8.560   -2.318  10.760  1.00 60.95  ?  657 TYR A H      1 
ATOM 9157  H HA     . TYR A 1 596 ? 6.678   -2.526  8.969   1.00 63.31  ?  657 TYR A HA     1 
ATOM 9158  H HB2    . TYR A 1 596 ? 8.788   -3.168  8.391   1.00 69.01  ?  657 TYR A HB2    1 
ATOM 9159  H HB3    . TYR A 1 596 ? 8.835   -4.241  9.555   1.00 69.01  ?  657 TYR A HB3    1 
ATOM 9160  H HD1    . TYR A 1 596 ? 7.469   -3.678  6.350   1.00 62.06  ?  657 TYR A HD1    1 
ATOM 9161  H HD2    . TYR A 1 596 ? 8.037   -6.458  9.166   1.00 84.97  ?  657 TYR A HD2    1 
ATOM 9162  H HE1    . TYR A 1 596 ? 6.802   -5.315  4.868   1.00 62.93  ?  657 TYR A HE1    1 
ATOM 9163  H HE2    . TYR A 1 596 ? 7.372   -8.097  7.688   1.00 73.73  ?  657 TYR A HE2    1 
ATOM 9164  H HH     . TYR A 1 596 ? 6.657   -8.593  5.630   1.00 85.07  ?  657 TYR A HH     1 
ATOM 9165  N N      . ILE A 1 597 ? 6.541   -4.812  11.229  1.00 61.13  ?  658 ILE A N      1 
ATOM 9166  C CA     . ILE A 1 597 ? 5.674   -5.850  11.776  1.00 61.38  ?  658 ILE A CA     1 
ATOM 9167  C C      . ILE A 1 597 ? 4.538   -5.233  12.579  1.00 51.74  ?  658 ILE A C      1 
ATOM 9168  O O      . ILE A 1 597 ? 3.409   -5.738  12.572  1.00 55.92  ?  658 ILE A O      1 
ATOM 9169  C CB     . ILE A 1 597 ? 6.497   -6.836  12.625  1.00 47.17  ?  658 ILE A CB     1 
ATOM 9170  C CG1    . ILE A 1 597 ? 5.654   -8.052  13.018  1.00 49.01  ?  658 ILE A CG1    1 
ATOM 9171  C CG2    . ILE A 1 597 ? 7.050   -6.155  13.868  1.00 60.05  ?  658 ILE A CG2    1 
ATOM 9172  C CD1    . ILE A 1 597 ? 5.478   -9.056  11.904  1.00 61.24  ?  658 ILE A CD1    1 
ATOM 9173  H H      . ILE A 1 597 ? 7.303   -4.739  11.621  1.00 73.35  ?  658 ILE A H      1 
ATOM 9174  H HA     . ILE A 1 597 ? 5.281   -6.348  11.042  1.00 73.66  ?  658 ILE A HA     1 
ATOM 9175  H HB     . ILE A 1 597 ? 7.245   -7.146  12.090  1.00 56.60  ?  658 ILE A HB     1 
ATOM 9176  H HG12   . ILE A 1 597 ? 6.085   -8.505  13.760  1.00 58.81  ?  658 ILE A HG12   1 
ATOM 9177  H HG13   . ILE A 1 597 ? 4.773   -7.748  13.285  1.00 58.81  ?  658 ILE A HG13   1 
ATOM 9178  H HG21   . ILE A 1 597 ? 7.562   -6.801  14.379  1.00 72.06  ?  658 ILE A HG21   1 
ATOM 9179  H HG22   . ILE A 1 597 ? 7.621   -5.420  13.596  1.00 72.06  ?  658 ILE A HG22   1 
ATOM 9180  H HG23   . ILE A 1 597 ? 6.311   -5.822  14.400  1.00 72.06  ?  658 ILE A HG23   1 
ATOM 9181  H HD11   . ILE A 1 597 ? 4.937   -9.793  12.226  1.00 73.49  ?  658 ILE A HD11   1 
ATOM 9182  H HD12   . ILE A 1 597 ? 5.037   -8.623  11.156  1.00 73.49  ?  658 ILE A HD12   1 
ATOM 9183  H HD13   . ILE A 1 597 ? 6.351   -9.381  11.631  1.00 73.49  ?  658 ILE A HD13   1 
ATOM 9184  N N      . ALA A 1 598 ? 4.812   -4.134  13.282  1.00 54.43  ?  659 ALA A N      1 
ATOM 9185  C CA     . ALA A 1 598 ? 3.796   -3.543  14.144  1.00 54.19  ?  659 ALA A CA     1 
ATOM 9186  C C      . ALA A 1 598 ? 2.590   -3.085  13.338  1.00 51.19  ?  659 ALA A C      1 
ATOM 9187  O O      . ALA A 1 598 ? 1.444   -3.279  13.757  1.00 43.39  ?  659 ALA A O      1 
ATOM 9188  C CB     . ALA A 1 598 ? 4.389   -2.375  14.928  1.00 58.56  ?  659 ALA A CB     1 
ATOM 9189  H H      . ALA A 1 598 ? 5.566   -3.720  13.278  1.00 65.32  ?  659 ALA A H      1 
ATOM 9190  H HA     . ALA A 1 598 ? 3.495   -4.210  14.781  1.00 65.02  ?  659 ALA A HA     1 
ATOM 9191  H HB1    . ALA A 1 598 ? 3.701   -1.994  15.495  1.00 70.27  ?  659 ALA A HB1    1 
ATOM 9192  H HB2    . ALA A 1 598 ? 5.124   -2.701  15.472  1.00 70.27  ?  659 ALA A HB2    1 
ATOM 9193  H HB3    . ALA A 1 598 ? 4.711   -1.707  14.303  1.00 70.27  ?  659 ALA A HB3    1 
ATOM 9194  N N      . LEU A 1 599 ? 2.826   -2.477  12.176  1.00 55.75  ?  660 LEU A N      1 
ATOM 9195  C CA     . LEU A 1 599 ? 1.714   -1.995  11.368  1.00 51.44  ?  660 LEU A CA     1 
ATOM 9196  C C      . LEU A 1 599 ? 0.829   -3.147  10.913  1.00 54.80  ?  660 LEU A C      1 
ATOM 9197  O O      . LEU A 1 599 ? -0.402  -3.054  10.977  1.00 57.42  ?  660 LEU A O      1 
ATOM 9198  C CB     . LEU A 1 599 ? 2.240   -1.210  10.169  1.00 44.23  ?  660 LEU A CB     1 
ATOM 9199  C CG     . LEU A 1 599 ? 1.203   -0.506  9.291   1.00 55.44  ?  660 LEU A CG     1 
ATOM 9200  C CD1    . LEU A 1 599 ? 0.347   0.454   10.099  1.00 58.44  ?  660 LEU A CD1    1 
ATOM 9201  C CD2    . LEU A 1 599 ? 1.904   0.237   8.172   1.00 67.11  ?  660 LEU A CD2    1 
ATOM 9202  H H      . LEU A 1 599 ? 3.605   -2.334  11.841  1.00 66.90  ?  660 LEU A H      1 
ATOM 9203  H HA     . LEU A 1 599 ? 1.171   -1.395  11.904  1.00 61.72  ?  660 LEU A HA     1 
ATOM 9204  H HB2    . LEU A 1 599 ? 2.847   -0.528  10.497  1.00 53.07  ?  660 LEU A HB2    1 
ATOM 9205  H HB3    . LEU A 1 599 ? 2.728   -1.824  9.598   1.00 53.07  ?  660 LEU A HB3    1 
ATOM 9206  H HG     . LEU A 1 599 ? 0.619   -1.171  8.894   1.00 66.53  ?  660 LEU A HG     1 
ATOM 9207  H HD11   . LEU A 1 599 ? -0.295  0.878   9.508   1.00 70.13  ?  660 LEU A HD11   1 
ATOM 9208  H HD12   . LEU A 1 599 ? -0.118  -0.043  10.790  1.00 70.13  ?  660 LEU A HD12   1 
ATOM 9209  H HD13   . LEU A 1 599 ? 0.919   1.126   10.501  1.00 70.13  ?  660 LEU A HD13   1 
ATOM 9210  H HD21   . LEU A 1 599 ? 1.238   0.679   7.622   1.00 80.54  ?  660 LEU A HD21   1 
ATOM 9211  H HD22   . LEU A 1 599 ? 2.505   0.893   8.558   1.00 80.54  ?  660 LEU A HD22   1 
ATOM 9212  H HD23   . LEU A 1 599 ? 2.406   -0.399  7.638   1.00 80.54  ?  660 LEU A HD23   1 
ATOM 9213  N N      . GLN A 1 600 ? 1.436   -4.247  10.461  1.00 53.98  ?  661 GLN A N      1 
ATOM 9214  C CA     . GLN A 1 600 ? 0.647   -5.392  10.020  1.00 49.56  ?  661 GLN A CA     1 
ATOM 9215  C C      . GLN A 1 600 ? -0.324  -5.833  11.102  1.00 50.29  ?  661 GLN A C      1 
ATOM 9216  O O      . GLN A 1 600 ? -1.489  -6.137  10.820  1.00 45.52  ?  661 GLN A O      1 
ATOM 9217  C CB     . GLN A 1 600 ? 1.566   -6.548  9.637   1.00 32.66  ?  661 GLN A CB     1 
ATOM 9218  C CG     . GLN A 1 600 ? 2.663   -6.173  8.668   1.00 32.49  ?  661 GLN A CG     1 
ATOM 9219  C CD     . GLN A 1 600 ? 3.070   -7.330  7.788   1.00 35.00  ?  661 GLN A CD     1 
ATOM 9220  O OE1    . GLN A 1 600 ? 2.294   -7.788  6.954   1.00 34.03  ?  661 GLN A OE1    1 
ATOM 9221  N NE2    . GLN A 1 600 ? 4.287   -7.816  7.976   1.00 35.09  ?  661 GLN A NE2    1 
ATOM 9222  H H      . GLN A 1 600 ? 2.287   -4.352  10.402  1.00 64.77  ?  661 GLN A H      1 
ATOM 9223  H HA     . GLN A 1 600 ? 0.133   -5.141  9.237   1.00 59.47  ?  661 GLN A HA     1 
ATOM 9224  H HB2    . GLN A 1 600 ? 1.987   -6.891  10.441  1.00 39.20  ?  661 GLN A HB2    1 
ATOM 9225  H HB3    . GLN A 1 600 ? 1.033   -7.245  9.223   1.00 39.20  ?  661 GLN A HB3    1 
ATOM 9226  H HG2    . GLN A 1 600 ? 2.350   -5.455  8.096   1.00 38.99  ?  661 GLN A HG2    1 
ATOM 9227  H HG3    . GLN A 1 600 ? 3.444   -5.885  9.167   1.00 38.99  ?  661 GLN A HG3    1 
ATOM 9228  H HE21   . GLN A 1 600 ? 4.800   -7.472  8.575   1.00 42.11  ?  661 GLN A HE21   1 
ATOM 9229  H HE22   . GLN A 1 600 ? 4.565   -8.475  7.499   1.00 42.11  ?  661 GLN A HE22   1 
ATOM 9230  N N      . VAL A 1 601 ? 0.138   -5.869  12.352  1.00 43.67  ?  662 VAL A N      1 
ATOM 9231  C CA     . VAL A 1 601 ? -0.729  -6.255  13.460  1.00 29.14  ?  662 VAL A CA     1 
ATOM 9232  C C      . VAL A 1 601 ? -1.971  -5.376  13.483  1.00 53.78  ?  662 VAL A C      1 
ATOM 9233  O O      . VAL A 1 601 ? -3.102  -5.867  13.569  1.00 54.19  ?  662 VAL A O      1 
ATOM 9234  C CB     . VAL A 1 601 ? 0.042   -6.178  14.789  1.00 41.17  ?  662 VAL A CB     1 
ATOM 9235  C CG1    . VAL A 1 601 ? -0.876  -6.465  15.968  1.00 45.42  ?  662 VAL A CG1    1 
ATOM 9236  C CG2    . VAL A 1 601 ? 1.210   -7.149  14.774  1.00 42.44  ?  662 VAL A CG2    1 
ATOM 9237  H H      . VAL A 1 601 ? 0.944   -5.675  12.582  1.00 52.40  ?  662 VAL A H      1 
ATOM 9238  H HA     . VAL A 1 601 ? -1.015  -7.174  13.332  1.00 34.97  ?  662 VAL A HA     1 
ATOM 9239  H HB     . VAL A 1 601 ? 0.397   -5.282  14.897  1.00 49.40  ?  662 VAL A HB     1 
ATOM 9240  H HG11   . VAL A 1 601 ? -0.363  -6.408  16.788  1.00 54.50  ?  662 VAL A HG11   1 
ATOM 9241  H HG12   . VAL A 1 601 ? -1.590  -5.808  15.978  1.00 54.50  ?  662 VAL A HG12   1 
ATOM 9242  H HG13   . VAL A 1 601 ? -1.247  -7.355  15.869  1.00 54.50  ?  662 VAL A HG13   1 
ATOM 9243  H HG21   . VAL A 1 601 ? 1.683   -7.086  15.618  1.00 50.93  ?  662 VAL A HG21   1 
ATOM 9244  H HG22   . VAL A 1 601 ? 0.871   -8.049  14.650  1.00 50.93  ?  662 VAL A HG22   1 
ATOM 9245  H HG23   . VAL A 1 601 ? 1.804   -6.915  14.043  1.00 50.93  ?  662 VAL A HG23   1 
ATOM 9246  N N      . ILE A 1 602 ? -1.775  -4.059  13.391  1.00 61.40  ?  663 ILE A N      1 
ATOM 9247  C CA     . ILE A 1 602 ? -2.898  -3.134  13.510  1.00 53.26  ?  663 ILE A CA     1 
ATOM 9248  C C      . ILE A 1 602 ? -3.903  -3.373  12.394  1.00 49.27  ?  663 ILE A C      1 
ATOM 9249  O O      . ILE A 1 602 ? -5.119  -3.290  12.605  1.00 42.51  ?  663 ILE A O      1 
ATOM 9250  C CB     . ILE A 1 602 ? -2.396  -1.679  13.519  1.00 33.91  ?  663 ILE A CB     1 
ATOM 9251  C CG1    . ILE A 1 602 ? -1.410  -1.465  14.671  1.00 50.66  ?  663 ILE A CG1    1 
ATOM 9252  C CG2    . ILE A 1 602 ? -3.575  -0.720  13.637  1.00 44.17  ?  663 ILE A CG2    1 
ATOM 9253  C CD1    . ILE A 1 602 ? -0.798  -0.083  14.721  1.00 50.53  ?  663 ILE A CD1    1 
ATOM 9254  H H      . ILE A 1 602 ? -1.013  -3.683  13.261  1.00 73.68  ?  663 ILE A H      1 
ATOM 9255  H HA     . ILE A 1 602 ? -3.348  -3.297  14.354  1.00 63.92  ?  663 ILE A HA     1 
ATOM 9256  H HB     . ILE A 1 602 ? -1.937  -1.504  12.682  1.00 40.70  ?  663 ILE A HB     1 
ATOM 9257  H HG12   . ILE A 1 602 ? -1.876  -1.612  15.509  1.00 60.80  ?  663 ILE A HG12   1 
ATOM 9258  H HG13   . ILE A 1 602 ? -0.687  -2.105  14.584  1.00 60.80  ?  663 ILE A HG13   1 
ATOM 9259  H HG21   . ILE A 1 602 ? -3.241  0.191   13.641  1.00 53.00  ?  663 ILE A HG21   1 
ATOM 9260  H HG22   . ILE A 1 602 ? -4.167  -0.853  12.880  1.00 53.00  ?  663 ILE A HG22   1 
ATOM 9261  H HG23   . ILE A 1 602 ? -4.048  -0.902  14.464  1.00 53.00  ?  663 ILE A HG23   1 
ATOM 9262  H HD11   . ILE A 1 602 ? -0.190  -0.034  15.476  1.00 60.64  ?  663 ILE A HD11   1 
ATOM 9263  H HD12   . ILE A 1 602 ? -0.314  0.078   13.896  1.00 60.64  ?  663 ILE A HD12   1 
ATOM 9264  H HD13   . ILE A 1 602 ? -1.506  0.572   14.824  1.00 60.64  ?  663 ILE A HD13   1 
ATOM 9265  N N      . VAL A 1 603 ? -3.417  -3.670  11.188  1.00 52.81  ?  664 VAL A N      1 
ATOM 9266  C CA     . VAL A 1 603 ? -4.322  -3.888  10.066  1.00 55.81  ?  664 VAL A CA     1 
ATOM 9267  C C      . VAL A 1 603 ? -5.222  -5.084  10.338  1.00 60.62  ?  664 VAL A C      1 
ATOM 9268  O O      . VAL A 1 603 ? -6.427  -5.051  10.060  1.00 66.44  ?  664 VAL A O      1 
ATOM 9269  C CB     . VAL A 1 603 ? -3.526  -4.070  8.760   1.00 53.90  ?  664 VAL A CB     1 
ATOM 9270  C CG1    . VAL A 1 603 ? -4.473  -4.235  7.585   1.00 69.13  ?  664 VAL A CG1    1 
ATOM 9271  C CG2    . VAL A 1 603 ? -2.600  -2.891  8.526   1.00 54.00  ?  664 VAL A CG2    1 
ATOM 9272  H H      . VAL A 1 603 ? -2.582  -3.751  10.999  1.00 63.37  ?  664 VAL A H      1 
ATOM 9273  H HA     . VAL A 1 603 ? -4.888  -3.107  9.963   1.00 66.97  ?  664 VAL A HA     1 
ATOM 9274  H HB     . VAL A 1 603 ? -2.984  -4.872  8.827   1.00 64.68  ?  664 VAL A HB     1 
ATOM 9275  H HG11   . VAL A 1 603 ? -3.952  -4.348  6.774   1.00 82.95  ?  664 VAL A HG11   1 
ATOM 9276  H HG12   . VAL A 1 603 ? -5.028  -5.016  7.734   1.00 82.95  ?  664 VAL A HG12   1 
ATOM 9277  H HG13   . VAL A 1 603 ? -5.028  -3.442  7.514   1.00 82.95  ?  664 VAL A HG13   1 
ATOM 9278  H HG21   . VAL A 1 603 ? -2.113  -3.032  7.699   1.00 64.80  ?  664 VAL A HG21   1 
ATOM 9279  H HG22   . VAL A 1 603 ? -3.131  -2.081  8.463   1.00 64.80  ?  664 VAL A HG22   1 
ATOM 9280  H HG23   . VAL A 1 603 ? -1.980  -2.824  9.269   1.00 64.80  ?  664 VAL A HG23   1 
ATOM 9281  N N      . ASP A 1 604 ? -4.656  -6.156  10.892  1.00 63.61  ?  665 ASP A N      1 
ATOM 9282  C CA     . ASP A 1 604 ? -5.430  -7.375  11.086  1.00 54.82  ?  665 ASP A CA     1 
ATOM 9283  C C      . ASP A 1 604 ? -6.385  -7.242  12.266  1.00 53.97  ?  665 ASP A C      1 
ATOM 9284  O O      . ASP A 1 604 ? -7.517  -7.735  12.208  1.00 62.70  ?  665 ASP A O      1 
ATOM 9285  C CB     . ASP A 1 604 ? -4.490  -8.565  11.271  1.00 63.92  ?  665 ASP A CB     1 
ATOM 9286  C CG     . ASP A 1 604 ? -3.744  -8.916  9.998   1.00 86.29  ?  665 ASP A CG     1 
ATOM 9287  O OD1    . ASP A 1 604 ? -4.170  -8.462  8.916   1.00 85.16  ?  665 ASP A OD1    1 
ATOM 9288  O OD2    . ASP A 1 604 ? -2.738  -9.649  10.075  1.00 89.08  -1 665 ASP A OD2    1 
ATOM 9289  H H      . ASP A 1 604 ? -3.839  -6.201  11.159  1.00 76.33  ?  665 ASP A H      1 
ATOM 9290  H HA     . ASP A 1 604 ? -5.962  -7.538  10.291  1.00 65.79  ?  665 ASP A HA     1 
ATOM 9291  H HB2    . ASP A 1 604 ? -3.836  -8.348  11.954  1.00 76.71  ?  665 ASP A HB2    1 
ATOM 9292  H HB3    . ASP A 1 604 ? -5.008  -9.339  11.540  1.00 76.71  ?  665 ASP A HB3    1 
ATOM 9293  N N      . ILE A 1 605 ? -5.953  -6.581  13.343  1.00 45.12  ?  666 ILE A N      1 
ATOM 9294  C CA     . ILE A 1 605 ? -6.864  -6.319  14.455  1.00 38.97  ?  666 ILE A CA     1 
ATOM 9295  C C      . ILE A 1 605 ? -8.133  -5.659  13.940  1.00 49.99  ?  666 ILE A C      1 
ATOM 9296  O O      . ILE A 1 605 ? -9.243  -5.965  14.392  1.00 56.99  ?  666 ILE A O      1 
ATOM 9297  C CB     . ILE A 1 605 ? -6.178  -5.453  15.529  1.00 39.11  ?  666 ILE A CB     1 
ATOM 9298  C CG1    . ILE A 1 605 ? -5.002  -6.207  16.153  1.00 39.04  ?  666 ILE A CG1    1 
ATOM 9299  C CG2    . ILE A 1 605 ? -7.184  -5.055  16.610  1.00 50.99  ?  666 ILE A CG2    1 
ATOM 9300  C CD1    . ILE A 1 605 ? -4.212  -5.402  17.165  1.00 29.28  ?  666 ILE A CD1    1 
ATOM 9301  H H      . ILE A 1 605 ? -5.155  -6.280  13.452  1.00 54.15  ?  666 ILE A H      1 
ATOM 9302  H HA     . ILE A 1 605 ? -7.111  -7.163  14.865  1.00 46.77  ?  666 ILE A HA     1 
ATOM 9303  H HB     . ILE A 1 605 ? -5.840  -4.647  15.108  1.00 46.93  ?  666 ILE A HB     1 
ATOM 9304  H HG12   . ILE A 1 605 ? -5.343  -6.995  16.604  1.00 46.85  ?  666 ILE A HG12   1 
ATOM 9305  H HG13   . ILE A 1 605 ? -4.393  -6.471  15.446  1.00 46.85  ?  666 ILE A HG13   1 
ATOM 9306  H HG21   . ILE A 1 605 ? -6.734  -4.512  17.275  1.00 61.19  ?  666 ILE A HG21   1 
ATOM 9307  H HG22   . ILE A 1 605 ? -7.903  -4.549  16.200  1.00 61.19  ?  666 ILE A HG22   1 
ATOM 9308  H HG23   . ILE A 1 605 ? -7.538  -5.859  17.023  1.00 61.19  ?  666 ILE A HG23   1 
ATOM 9309  H HD11   . ILE A 1 605 ? -3.490  -5.950  17.510  1.00 35.14  ?  666 ILE A HD11   1 
ATOM 9310  H HD12   . ILE A 1 605 ? -3.851  -4.614  16.729  1.00 35.14  ?  666 ILE A HD12   1 
ATOM 9311  H HD13   . ILE A 1 605 ? -4.802  -5.138  17.888  1.00 35.14  ?  666 ILE A HD13   1 
ATOM 9312  N N      . PHE A 1 606 ? -7.988  -4.738  12.987  1.00 59.68  ?  667 PHE A N      1 
ATOM 9313  C CA     . PHE A 1 606 ? -9.150  -4.063  12.424  1.00 61.93  ?  667 PHE A CA     1 
ATOM 9314  C C      . PHE A 1 606 ? -9.967  -5.005  11.551  1.00 53.67  ?  667 PHE A C      1 
ATOM 9315  O O      . PHE A 1 606 ? -11.202 -4.948  11.552  1.00 76.41  ?  667 PHE A O      1 
ATOM 9316  C CB     . PHE A 1 606 ? -8.704  -2.844  11.620  1.00 65.08  ?  667 PHE A CB     1 
ATOM 9317  C CG     . PHE A 1 606 ? -8.609  -1.587  12.430  1.00 49.18  ?  667 PHE A CG     1 
ATOM 9318  C CD1    . PHE A 1 606 ? -9.748  -0.864  12.736  1.00 43.01  ?  667 PHE A CD1    1 
ATOM 9319  C CD2    . PHE A 1 606 ? -7.385  -1.124  12.880  1.00 38.36  ?  667 PHE A CD2    1 
ATOM 9320  C CE1    . PHE A 1 606 ? -9.669  0.293   13.477  1.00 53.58  ?  667 PHE A CE1    1 
ATOM 9321  C CE2    . PHE A 1 606 ? -7.301  0.034   13.622  1.00 55.16  ?  667 PHE A CE2    1 
ATOM 9322  C CZ     . PHE A 1 606 ? -8.445  0.744   13.920  1.00 67.65  ?  667 PHE A CZ     1 
ATOM 9323  H H      . PHE A 1 606 ? -7.234  -4.491  12.654  1.00 71.61  ?  667 PHE A H      1 
ATOM 9324  H HA     . PHE A 1 606 ? -9.718  -3.755  13.147  1.00 74.32  ?  667 PHE A HA     1 
ATOM 9325  H HB2    . PHE A 1 606 ? -7.828  -3.021  11.244  1.00 78.10  ?  667 PHE A HB2    1 
ATOM 9326  H HB3    . PHE A 1 606 ? -9.343  -2.689  10.907  1.00 78.10  ?  667 PHE A HB3    1 
ATOM 9327  H HD1    . PHE A 1 606 ? -10.577 -1.163  12.439  1.00 51.62  ?  667 PHE A HD1    1 
ATOM 9328  H HD2    . PHE A 1 606 ? -6.611  -1.600  12.680  1.00 46.04  ?  667 PHE A HD2    1 
ATOM 9329  H HE1    . PHE A 1 606 ? -10.442 0.771   13.677  1.00 64.29  ?  667 PHE A HE1    1 
ATOM 9330  H HE2    . PHE A 1 606 ? -6.474  0.337   13.921  1.00 66.19  ?  667 PHE A HE2    1 
ATOM 9331  H HZ     . PHE A 1 606 ? -8.390  1.526   14.421  1.00 81.17  ?  667 PHE A HZ     1 
ATOM 9332  N N      . SER A 1 607 ? -9.296  -5.879  10.800  1.00 42.12  ?  668 SER A N      1 
ATOM 9333  C CA     . SER A 1 607 ? -10.004 -6.766  9.884   1.00 62.33  ?  668 SER A CA     1 
ATOM 9334  C C      . SER A 1 607 ? -11.034 -7.614  10.618  1.00 71.10  ?  668 SER A C      1 
ATOM 9335  O O      . SER A 1 607 ? -12.124 -7.873  10.095  1.00 72.52  ?  668 SER A O      1 
ATOM 9336  C CB     . SER A 1 607 ? -9.007  -7.661  9.153   1.00 61.33  ?  668 SER A CB     1 
ATOM 9337  O OG     . SER A 1 607 ? -8.211  -6.910  8.256   1.00 50.42  ?  668 SER A OG     1 
ATOM 9338  H H      . SER A 1 607 ? -8.442  -5.977  10.803  1.00 50.54  ?  668 SER A H      1 
ATOM 9339  H HA     . SER A 1 607 ? -10.471 -6.232  9.222   1.00 74.79  ?  668 SER A HA     1 
ATOM 9340  H HB2    . SER A 1 607 ? -8.429  -8.088  9.805   1.00 73.59  ?  668 SER A HB2    1 
ATOM 9341  H HB3    . SER A 1 607 ? -9.494  -8.334  8.653   1.00 73.59  ?  668 SER A HB3    1 
ATOM 9342  H HG     . SER A 1 607 ? -8.699  -6.535  7.684   1.00 60.51  ?  668 SER A HG     1 
ATOM 9343  N N      . VAL A 1 608 ? -10.708 -8.052  11.830  1.00 76.32  ?  669 VAL A N      1 
ATOM 9344  C CA     . VAL A 1 608 ? -11.561 -8.981  12.564  1.00 69.86  ?  669 VAL A CA     1 
ATOM 9345  C C      . VAL A 1 608 ? -12.507 -8.249  13.506  1.00 74.39  ?  669 VAL A C      1 
ATOM 9346  O O      . VAL A 1 608 ? -13.664 -8.647  13.661  1.00 75.78  ?  669 VAL A O      1 
ATOM 9347  C CB     . VAL A 1 608 ? -10.690 -9.995  13.334  1.00 53.62  ?  669 VAL A CB     1 
ATOM 9348  C CG1    . VAL A 1 608 ? -11.545 -11.149 13.832  1.00 65.23  ?  669 VAL A CG1    1 
ATOM 9349  C CG2    . VAL A 1 608 ? -9.555  -10.508 12.467  1.00 39.60  ?  669 VAL A CG2    1 
ATOM 9350  H H      . VAL A 1 608 ? -9.994  -7.824  12.252  1.00 91.59  ?  669 VAL A H      1 
ATOM 9351  H HA     . VAL A 1 608 ? -12.101 -9.477  11.929  1.00 83.84  ?  669 VAL A HA     1 
ATOM 9352  H HB     . VAL A 1 608 ? -10.302 -9.555  14.106  1.00 64.35  ?  669 VAL A HB     1 
ATOM 9353  H HG11   . VAL A 1 608 ? -10.980 -11.774 14.313  1.00 78.28  ?  669 VAL A HG11   1 
ATOM 9354  H HG12   . VAL A 1 608 ? -12.231 -10.801 14.423  1.00 78.28  ?  669 VAL A HG12   1 
ATOM 9355  H HG13   . VAL A 1 608 ? -11.954 -11.590 13.072  1.00 78.28  ?  669 VAL A HG13   1 
ATOM 9356  H HG21   . VAL A 1 608 ? -9.028  -11.141 12.979  1.00 47.52  ?  669 VAL A HG21   1 
ATOM 9357  H HG22   . VAL A 1 608 ? -9.927  -10.943 11.685  1.00 47.52  ?  669 VAL A HG22   1 
ATOM 9358  H HG23   . VAL A 1 608 ? -9.001  -9.759  12.197  1.00 47.52  ?  669 VAL A HG23   1 
ATOM 9359  N N      . HIS A 1 609 ? -12.038 -7.180  14.152  1.00 68.90  ?  670 HIS A N      1 
ATOM 9360  C CA     . HIS A 1 609 ? -12.824 -6.501  15.173  1.00 67.63  ?  670 HIS A CA     1 
ATOM 9361  C C      . HIS A 1 609 ? -13.477 -5.216  14.685  1.00 61.12  ?  670 HIS A C      1 
ATOM 9362  O O      . HIS A 1 609 ? -14.408 -4.732  15.337  1.00 67.66  ?  670 HIS A O      1 
ATOM 9363  C CB     . HIS A 1 609 ? -11.945 -6.188  16.388  1.00 61.27  ?  670 HIS A CB     1 
ATOM 9364  C CG     . HIS A 1 609 ? -11.328 -7.401  17.010  1.00 57.93  ?  670 HIS A CG     1 
ATOM 9365  N ND1    . HIS A 1 609 ? -12.073 -8.370  17.647  1.00 52.25  ?  670 HIS A ND1    1 
ATOM 9366  C CD2    . HIS A 1 609 ? -10.039 -7.806  17.089  1.00 53.44  ?  670 HIS A CD2    1 
ATOM 9367  C CE1    . HIS A 1 609 ? -11.269 -9.318  18.092  1.00 52.03  ?  670 HIS A CE1    1 
ATOM 9368  N NE2    . HIS A 1 609 ? -10.029 -9.000  17.767  1.00 50.68  ?  670 HIS A NE2    1 
ATOM 9369  H H      . HIS A 1 609 ? -11.264 -6.831  14.014  1.00 82.68  ?  670 HIS A H      1 
ATOM 9370  H HA     . HIS A 1 609 ? -13.531 -7.097  15.466  1.00 81.16  ?  670 HIS A HA     1 
ATOM 9371  H HB2    . HIS A 1 609 ? -11.226 -5.598  16.111  1.00 73.52  ?  670 HIS A HB2    1 
ATOM 9372  H HB3    . HIS A 1 609 ? -12.487 -5.751  17.063  1.00 73.52  ?  670 HIS A HB3    1 
ATOM 9373  H HD2    . HIS A 1 609 ? -9.298  -7.358  16.748  1.00 64.13  ?  670 HIS A HD2    1 
ATOM 9374  H HE1    . HIS A 1 609 ? -11.531 -10.080 18.557  1.00 62.44  ?  670 HIS A HE1    1 
ATOM 9375  H HE2    . HIS A 1 609 ? -9.329  -9.465  17.951  1.00 60.82  ?  670 HIS A HE2    1 
ATOM 9376  N N      . GLY A 1 610 ? -13.023 -4.660  13.570  1.00 61.39  ?  671 GLY A N      1 
ATOM 9377  C CA     . GLY A 1 610 ? -13.653 -3.458  13.048  1.00 74.08  ?  671 GLY A CA     1 
ATOM 9378  C C      . GLY A 1 610 ? -13.274 -2.236  13.861  1.00 69.59  ?  671 GLY A C      1 
ATOM 9379  O O      . GLY A 1 610 ? -12.103 -2.020  14.193  1.00 59.31  ?  671 GLY A O      1 
ATOM 9380  H H      . GLY A 1 610 ? -12.363 -4.953  13.103  1.00 73.67  ?  671 GLY A H      1 
ATOM 9381  H HA2    . GLY A 1 610 ? -13.377 -3.317  12.129  1.00 88.89  ?  671 GLY A HA2    1 
ATOM 9382  H HA3    . GLY A 1 610 ? -14.618 -3.558  13.070  1.00 88.89  ?  671 GLY A HA3    1 
ATOM 9383  N N      . ASN A 1 611 ? -14.275 -1.420  14.185  1.00 76.04  ?  672 ASN A N      1 
ATOM 9384  C CA     . ASN A 1 611 ? -14.070 -0.180  14.921  1.00 81.65  ?  672 ASN A CA     1 
ATOM 9385  C C      . ASN A 1 611 ? -14.314 -0.330  16.416  1.00 86.17  ?  672 ASN A C      1 
ATOM 9386  O O      . ASN A 1 611 ? -14.243 0.665   17.144  1.00 82.76  ?  672 ASN A O      1 
ATOM 9387  C CB     . ASN A 1 611 ? -14.983 0.916   14.366  1.00 88.60  ?  672 ASN A CB     1 
ATOM 9388  C CG     . ASN A 1 611 ? -14.876 1.054   12.863  1.00 82.47  ?  672 ASN A CG     1 
ATOM 9389  O OD1    . ASN A 1 611 ? -13.786 0.980   12.297  1.00 56.57  ?  672 ASN A OD1    1 
ATOM 9390  N ND2    . ASN A 1 611 ? -16.013 1.250   12.205  1.00 77.90  ?  672 ASN A ND2    1 
ATOM 9391  H H      . ASN A 1 611 ? -15.098 -1.568  13.984  1.00 91.25  ?  672 ASN A H      1 
ATOM 9392  H HA     . ASN A 1 611 ? -13.152 0.107   14.799  1.00 97.98  ?  672 ASN A HA     1 
ATOM 9393  H HB2    . ASN A 1 611 ? -15.904 0.702   14.583  1.00 106.31 ?  672 ASN A HB2    1 
ATOM 9394  H HB3    . ASN A 1 611 ? -14.736 1.766   14.764  1.00 106.31 ?  672 ASN A HB3    1 
ATOM 9395  H HD21   . ASN A 1 611 ? -16.006 1.335   11.350  1.00 93.48  ?  672 ASN A HD21   1 
ATOM 9396  H HD22   . ASN A 1 611 ? -16.757 1.292   12.635  1.00 93.48  ?  672 ASN A HD22   1 
ATOM 9397  N N      . THR A 1 612 ? -14.600 -1.543  16.893  1.00 84.44  ?  673 THR A N      1 
ATOM 9398  C CA     . THR A 1 612 ? -14.842 -1.741  18.316  1.00 79.34  ?  673 THR A CA     1 
ATOM 9399  C C      . THR A 1 612 ? -13.608 -1.442  19.153  1.00 71.95  ?  673 THR A C      1 
ATOM 9400  O O      . THR A 1 612 ? -13.733 -1.221  20.362  1.00 78.85  ?  673 THR A O      1 
ATOM 9401  C CB     . THR A 1 612 ? -15.298 -3.176  18.585  1.00 65.46  ?  673 THR A CB     1 
ATOM 9402  O OG1    . THR A 1 612 ? -14.234 -4.082  18.273  1.00 56.78  ?  673 THR A OG1    1 
ATOM 9403  C CG2    . THR A 1 612 ? -16.518 -3.525  17.747  1.00 66.11  ?  673 THR A CG2    1 
ATOM 9404  H H      . THR A 1 612 ? -14.659 -2.257  16.417  1.00 101.32 ?  673 THR A H      1 
ATOM 9405  H HA     . THR A 1 612 ? -15.551 -1.143  18.602  1.00 95.21  ?  673 THR A HA     1 
ATOM 9406  H HB     . THR A 1 612 ? -15.534 -3.268  19.522  1.00 78.55  ?  673 THR A HB     1 
ATOM 9407  H HG1    . THR A 1 612 ? -14.021 -4.007  17.463  1.00 68.14  ?  673 THR A HG1    1 
ATOM 9408  H HG21   . THR A 1 612 ? -16.794 -4.437  17.929  1.00 79.33  ?  673 THR A HG21   1 
ATOM 9409  H HG22   . THR A 1 612 ? -17.249 -2.925  17.961  1.00 79.33  ?  673 THR A HG22   1 
ATOM 9410  H HG23   . THR A 1 612 ? -16.306 -3.441  16.804  1.00 79.33  ?  673 THR A HG23   1 
ATOM 9411  N N      . VAL A 1 613 ? -12.419 -1.426  18.539  1.00 61.83  ?  674 VAL A N      1 
ATOM 9412  C CA     . VAL A 1 613 ? -11.182 -1.211  19.282  1.00 60.75  ?  674 VAL A CA     1 
ATOM 9413  C C      . VAL A 1 613 ? -10.747 0.246   19.296  1.00 63.60  ?  674 VAL A C      1 
ATOM 9414  O O      . VAL A 1 613 ? -9.672  0.553   19.828  1.00 66.12  ?  674 VAL A O      1 
ATOM 9415  C CB     . VAL A 1 613 ? -10.030 -2.068  18.716  1.00 59.67  ?  674 VAL A CB     1 
ATOM 9416  C CG1    . VAL A 1 613 ? -10.300 -3.542  18.947  1.00 67.36  ?  674 VAL A CG1    1 
ATOM 9417  C CG2    . VAL A 1 613 ? -9.818  -1.789  17.236  1.00 61.24  ?  674 VAL A CG2    1 
ATOM 9418  H H      . VAL A 1 613 ? -12.306 -1.538  17.694  1.00 74.19  ?  674 VAL A H      1 
ATOM 9419  H HA     . VAL A 1 613 ? -11.325 -1.482  20.202  1.00 72.89  ?  674 VAL A HA     1 
ATOM 9420  H HB     . VAL A 1 613 ? -9.211  -1.839  19.182  1.00 71.60  ?  674 VAL A HB     1 
ATOM 9421  H HG11   . VAL A 1 613 ? -9.563  -4.058  18.584  1.00 80.84  ?  674 VAL A HG11   1 
ATOM 9422  H HG12   . VAL A 1 613 ? -10.378 -3.702  19.901  1.00 80.84  ?  674 VAL A HG12   1 
ATOM 9423  H HG13   . VAL A 1 613 ? -11.126 -3.785  18.502  1.00 80.84  ?  674 VAL A HG13   1 
ATOM 9424  H HG21   . VAL A 1 613 ? -9.090  -2.342  16.912  1.00 73.48  ?  674 VAL A HG21   1 
ATOM 9425  H HG22   . VAL A 1 613 ? -10.634 -2.000  16.756  1.00 73.48  ?  674 VAL A HG22   1 
ATOM 9426  H HG23   . VAL A 1 613 ? -9.599  -0.851  17.120  1.00 73.48  ?  674 VAL A HG23   1 
ATOM 9427  N N      . VAL A 1 614 ? -11.542 1.156   18.731  1.00 68.74  ?  675 VAL A N      1 
ATOM 9428  C CA     . VAL A 1 614 ? -11.200 2.571   18.675  1.00 74.89  ?  675 VAL A CA     1 
ATOM 9429  C C      . VAL A 1 614 ? -12.441 3.397   18.988  1.00 76.64  ?  675 VAL A C      1 
ATOM 9430  O O      . VAL A 1 614 ? -13.570 2.904   18.969  1.00 78.27  ?  675 VAL A O      1 
ATOM 9431  C CB     . VAL A 1 614 ? -10.629 2.983   17.302  1.00 61.82  ?  675 VAL A CB     1 
ATOM 9432  C CG1    . VAL A 1 614 ? -9.299  2.304   17.058  1.00 63.21  ?  675 VAL A CG1    1 
ATOM 9433  C CG2    . VAL A 1 614 ? -11.615 2.648   16.191  1.00 67.84  ?  675 VAL A CG2    1 
ATOM 9434  H H      . VAL A 1 614 ? -12.298 0.970   18.366  1.00 82.48  ?  675 VAL A H      1 
ATOM 9435  H HA     . VAL A 1 614 ? -10.531 2.764   19.350  1.00 89.86  ?  675 VAL A HA     1 
ATOM 9436  H HB     . VAL A 1 614 ? -10.483 3.942   17.295  1.00 74.18  ?  675 VAL A HB     1 
ATOM 9437  H HG11   . VAL A 1 614 ? -8.960  2.577   16.191  1.00 75.85  ?  675 VAL A HG11   1 
ATOM 9438  H HG12   . VAL A 1 614 ? -8.678  2.569   17.755  1.00 75.85  ?  675 VAL A HG12   1 
ATOM 9439  H HG13   . VAL A 1 614 ? -9.427  1.343   17.076  1.00 75.85  ?  675 VAL A HG13   1 
ATOM 9440  H HG21   . VAL A 1 614 ? -11.234 2.915   15.340  1.00 81.41  ?  675 VAL A HG21   1 
ATOM 9441  H HG22   . VAL A 1 614 ? -11.781 1.692   16.194  1.00 81.41  ?  675 VAL A HG22   1 
ATOM 9442  H HG23   . VAL A 1 614 ? -12.443 3.128   16.349  1.00 81.41  ?  675 VAL A HG23   1 
ATOM 9443  N N      . ASP A 1 615 ? -12.209 4.679   19.269  1.00 79.78  ?  676 ASP A N      1 
ATOM 9444  C CA     . ASP A 1 615 ? -13.287 5.634   19.487  1.00 85.21  ?  676 ASP A CA     1 
ATOM 9445  C C      . ASP A 1 615 ? -14.255 5.141   20.554  1.00 75.72  ?  676 ASP A C      1 
ATOM 9446  O O      . ASP A 1 615 ? -15.344 4.651   20.238  1.00 64.27  ?  676 ASP A O      1 
ATOM 9447  C CB     . ASP A 1 615 ? -14.025 5.901   18.175  1.00 87.77  ?  676 ASP A CB     1 
ATOM 9448  C CG     . ASP A 1 615 ? -13.112 6.456   17.099  1.00 81.08  ?  676 ASP A CG     1 
ATOM 9449  O OD1    . ASP A 1 615 ? -13.354 6.175   15.907  1.00 63.95  ?  676 ASP A OD1    1 
ATOM 9450  O OD2    . ASP A 1 615 ? -12.149 7.171   17.446  1.00 78.24  -1 676 ASP A OD2    1 
ATOM 9451  H H      . ASP A 1 615 ? -11.424 5.021   19.340  1.00 95.74  ?  676 ASP A H      1 
ATOM 9452  H HA     . ASP A 1 615 ? -12.907 6.473   19.793  1.00 102.26 ?  676 ASP A HA     1 
ATOM 9453  H HB2    . ASP A 1 615 ? -14.403 5.069   17.849  1.00 105.32 ?  676 ASP A HB2    1 
ATOM 9454  H HB3    . ASP A 1 615 ? -14.731 6.547   18.334  1.00 105.32 ?  676 ASP A HB3    1 
ATOM 9455  N N      . GLY A 1 616 ? -13.865 5.269   21.815  1.00 69.20  ?  677 GLY A N      1 
ATOM 9456  C CA     . GLY A 1 616 ? -14.720 4.861   22.912  1.00 64.15  ?  677 GLY A CA     1 
ATOM 9457  C C      . GLY A 1 616 ? -13.991 5.036   24.223  1.00 70.02  ?  677 GLY A C      1 
ATOM 9458  O O      . GLY A 1 616 ? -12.810 5.397   24.263  1.00 68.68  ?  677 GLY A O      1 
ATOM 9459  H H      . GLY A 1 616 ? -13.107 5.591   22.060  1.00 83.04  ?  677 GLY A H      1 
ATOM 9460  H HA2    . GLY A 1 616 ? -15.525 5.402   22.925  1.00 76.98  ?  677 GLY A HA2    1 
ATOM 9461  H HA3    . GLY A 1 616 ? -14.968 3.929   22.811  1.00 76.98  ?  677 GLY A HA3    1 
ATOM 9462  N N      . GLU A 1 617 ? -14.715 4.771   25.307  1.00 70.06  ?  678 GLU A N      1 
ATOM 9463  C CA     . GLU A 1 617 ? -14.130 4.883   26.636  1.00 81.58  ?  678 GLU A CA     1 
ATOM 9464  C C      . GLU A 1 617 ? -12.967 3.911   26.771  1.00 72.00  ?  678 GLU A C      1 
ATOM 9465  O O      . GLU A 1 617 ? -13.131 2.702   26.580  1.00 54.05  ?  678 GLU A O      1 
ATOM 9466  C CB     . GLU A 1 617 ? -15.188 4.607   27.703  1.00 78.45  ?  678 GLU A CB     1 
ATOM 9467  C CG     . GLU A 1 617 ? -14.709 4.865   29.123  1.00 96.61  ?  678 GLU A CG     1 
ATOM 9468  C CD     . GLU A 1 617 ? -15.776 4.574   30.158  1.00 88.26  ?  678 GLU A CD     1 
ATOM 9469  O OE1    . GLU A 1 617 ? -16.912 4.240   29.763  1.00 78.73  ?  678 GLU A OE1    1 
ATOM 9470  O OE2    . GLU A 1 617 ? -15.480 4.680   31.366  1.00 91.76  -1 678 GLU A OE2    1 
ATOM 9471  H H      . GLU A 1 617 ? -15.539 4.528   25.299  1.00 84.07  ?  678 GLU A H      1 
ATOM 9472  H HA     . GLU A 1 617 ? -13.793 5.783   26.765  1.00 97.89  ?  678 GLU A HA     1 
ATOM 9473  H HB2    . GLU A 1 617 ? -15.953 5.180   27.540  1.00 94.14  ?  678 GLU A HB2    1 
ATOM 9474  H HB3    . GLU A 1 617 ? -15.455 3.677   27.645  1.00 94.14  ?  678 GLU A HB3    1 
ATOM 9475  H HG2    . GLU A 1 617 ? -13.947 4.294   29.308  1.00 115.93 ?  678 GLU A HG2    1 
ATOM 9476  H HG3    . GLU A 1 617 ? -14.455 5.797   29.207  1.00 115.93 ?  678 GLU A HG3    1 
ATOM 9477  N N      . GLY A 1 618 ? -11.792 4.440   27.100  1.00 70.54  ?  679 GLY A N      1 
ATOM 9478  C CA     . GLY A 1 618 ? -10.603 3.618   27.175  1.00 77.66  ?  679 GLY A CA     1 
ATOM 9479  C C      . GLY A 1 618 ? -10.116 3.091   25.847  1.00 75.78  ?  679 GLY A C      1 
ATOM 9480  O O      . GLY A 1 618 ? -9.194  2.271   25.823  1.00 65.86  ?  679 GLY A O      1 
ATOM 9481  H H      . GLY A 1 618 ? -11.662 5.270   27.282  1.00 84.65  ?  679 GLY A H      1 
ATOM 9482  H HA2    . GLY A 1 618 ? -9.886  4.135   27.574  1.00 93.19  ?  679 GLY A HA2    1 
ATOM 9483  H HA3    . GLY A 1 618 ? -10.781 2.858   27.751  1.00 93.19  ?  679 GLY A HA3    1 
ATOM 9484  N N      . LYS A 1 619 ? -10.703 3.538   24.741  1.00 73.33  ?  680 LYS A N      1 
ATOM 9485  C CA     . LYS A 1 619 ? -10.317 3.100   23.409  1.00 66.06  ?  680 LYS A CA     1 
ATOM 9486  C C      . LYS A 1 619 ? -9.686  4.266   22.662  1.00 70.56  ?  680 LYS A C      1 
ATOM 9487  O O      . LYS A 1 619 ? -10.161 5.402   22.749  1.00 80.52  ?  680 LYS A O      1 
ATOM 9488  C CB     . LYS A 1 619 ? -11.525 2.572   22.632  1.00 72.90  ?  680 LYS A CB     1 
ATOM 9489  C CG     . LYS A 1 619 ? -12.550 1.852   23.493  1.00 58.96  ?  680 LYS A CG     1 
ATOM 9490  C CD     . LYS A 1 619 ? -13.630 1.212   22.638  1.00 62.29  ?  680 LYS A CD     1 
ATOM 9491  C CE     . LYS A 1 619 ? -14.914 1.005   23.420  1.00 61.14  ?  680 LYS A CE     1 
ATOM 9492  N NZ     . LYS A 1 619 ? -15.969 0.373   22.585  1.00 60.50  1  680 LYS A NZ     1 
ATOM 9493  H H      . LYS A 1 619 ? -11.344 4.111   24.739  1.00 87.99  ?  680 LYS A H      1 
ATOM 9494  H HA     . LYS A 1 619 ? -9.662  2.388   23.479  1.00 79.27  ?  680 LYS A HA     1 
ATOM 9495  H HB2    . LYS A 1 619 ? -11.972 3.320   22.205  1.00 87.48  ?  680 LYS A HB2    1 
ATOM 9496  H HB3    . LYS A 1 619 ? -11.214 1.948   21.958  1.00 87.48  ?  680 LYS A HB3    1 
ATOM 9497  H HG2    . LYS A 1 619 ? -12.109 1.153   24.000  1.00 70.75  ?  680 LYS A HG2    1 
ATOM 9498  H HG3    . LYS A 1 619 ? -12.972 2.488   24.091  1.00 70.75  ?  680 LYS A HG3    1 
ATOM 9499  H HD2    . LYS A 1 619 ? -13.824 1.790   21.883  1.00 74.75  ?  680 LYS A HD2    1 
ATOM 9500  H HD3    . LYS A 1 619 ? -13.321 0.347   22.327  1.00 74.75  ?  680 LYS A HD3    1 
ATOM 9501  H HE2    . LYS A 1 619 ? -14.737 0.425   24.176  1.00 73.37  ?  680 LYS A HE2    1 
ATOM 9502  H HE3    . LYS A 1 619 ? -15.244 1.864   23.726  1.00 73.37  ?  680 LYS A HE3    1 
ATOM 9503  H HZ1    . LYS A 1 619 ? -16.710 0.262   23.065  1.00 72.60  ?  680 LYS A HZ1    1 
ATOM 9504  H HZ2    . LYS A 1 619 ? -16.152 0.889   21.884  1.00 72.60  ?  680 LYS A HZ2    1 
ATOM 9505  H HZ3    . LYS A 1 619 ? -15.691 -0.421  22.294  1.00 72.60  ?  680 LYS A HZ3    1 
ATOM 9506  N N      . VAL A 1 620 ? -8.612  3.977   21.925  1.00 71.53  ?  681 VAL A N      1 
ATOM 9507  C CA     . VAL A 1 620 ? -7.868  5.031   21.249  1.00 71.75  ?  681 VAL A CA     1 
ATOM 9508  C C      . VAL A 1 620 ? -8.745  5.693   20.196  1.00 77.77  ?  681 VAL A C      1 
ATOM 9509  O O      . VAL A 1 620 ? -9.571  5.043   19.542  1.00 79.70  ?  681 VAL A O      1 
ATOM 9510  C CB     . VAL A 1 620 ? -6.585  4.461   20.623  1.00 62.38  ?  681 VAL A CB     1 
ATOM 9511  C CG1    . VAL A 1 620 ? -5.771  5.566   19.969  1.00 58.93  ?  681 VAL A CG1    1 
ATOM 9512  C CG2    . VAL A 1 620 ? -5.750  3.743   21.675  1.00 78.37  ?  681 VAL A CG2    1 
ATOM 9513  H H      . VAL A 1 620 ? -8.298  3.186   21.803  1.00 85.83  ?  681 VAL A H      1 
ATOM 9514  H HA     . VAL A 1 620 ? -7.613  5.706   21.898  1.00 86.10  ?  681 VAL A HA     1 
ATOM 9515  H HB     . VAL A 1 620 ? -6.824  3.817   19.938  1.00 74.86  ?  681 VAL A HB     1 
ATOM 9516  H HG11   . VAL A 1 620 ? -4.969  5.180   19.583  1.00 70.71  ?  681 VAL A HG11   1 
ATOM 9517  H HG12   . VAL A 1 620 ? -6.306  5.982   19.275  1.00 70.71  ?  681 VAL A HG12   1 
ATOM 9518  H HG13   . VAL A 1 620 ? -5.533  6.222   20.642  1.00 70.71  ?  681 VAL A HG13   1 
ATOM 9519  H HG21   . VAL A 1 620 ? -4.948  3.393   21.256  1.00 94.04  ?  681 VAL A HG21   1 
ATOM 9520  H HG22   . VAL A 1 620 ? -5.512  4.374   22.372  1.00 94.04  ?  681 VAL A HG22   1 
ATOM 9521  H HG23   . VAL A 1 620 ? -6.272  3.016   22.049  1.00 94.04  ?  681 VAL A HG23   1 
ATOM 9522  N N      . ASP A 1 621 ? -8.567  7.001   20.031  1.00 87.38  ?  682 ASP A N      1 
ATOM 9523  C CA     . ASP A 1 621 ? -9.293  7.735   19.006  1.00 82.57  ?  682 ASP A CA     1 
ATOM 9524  C C      . ASP A 1 621 ? -8.749  7.391   17.627  1.00 74.69  ?  682 ASP A C      1 
ATOM 9525  O O      . ASP A 1 621 ? -7.536  7.283   17.428  1.00 75.97  ?  682 ASP A O      1 
ATOM 9526  C CB     . ASP A 1 621 ? -9.183  9.239   19.252  1.00 98.49  ?  682 ASP A CB     1 
ATOM 9527  C CG     . ASP A 1 621 ? -9.566  9.627   20.665  1.00 111.04 ?  682 ASP A CG     1 
ATOM 9528  O OD1    . ASP A 1 621 ? -10.761 9.895   20.905  1.00 112.53 ?  682 ASP A OD1    1 
ATOM 9529  O OD2    . ASP A 1 621 ? -8.671  9.662   21.535  1.00 105.91 -1 682 ASP A OD2    1 
ATOM 9530  H H      . ASP A 1 621 ? -8.032  7.484   20.500  1.00 104.85 ?  682 ASP A H      1 
ATOM 9531  H HA     . ASP A 1 621 ? -10.231 7.488   19.036  1.00 99.09  ?  682 ASP A HA     1 
ATOM 9532  H HB2    . ASP A 1 621 ? -8.266  9.518   19.102  1.00 118.19 ?  682 ASP A HB2    1 
ATOM 9533  H HB3    . ASP A 1 621 ? -9.776  9.704   18.641  1.00 118.19 ?  682 ASP A HB3    1 
ATOM 9534  N N      . SER A 1 622 ? -9.657  7.229   16.664  1.00 74.33  ?  683 SER A N      1 
ATOM 9535  C CA     . SER A 1 622 ? -9.247  6.864   15.316  1.00 71.44  ?  683 SER A CA     1 
ATOM 9536  C C      . SER A 1 622 ? -8.394  7.943   14.669  1.00 78.22  ?  683 SER A C      1 
ATOM 9537  O O      . SER A 1 622 ? -7.609  7.637   13.765  1.00 76.37  ?  683 SER A O      1 
ATOM 9538  C CB     . SER A 1 622 ? -10.477 6.589   14.452  1.00 61.73  ?  683 SER A CB     1 
ATOM 9539  O OG     . SER A 1 622 ? -11.255 7.760   14.296  1.00 79.82  ?  683 SER A OG     1 
ATOM 9540  H H      . SER A 1 622 ? -10.506 7.323   16.767  1.00 89.19  ?  683 SER A H      1 
ATOM 9541  H HA     . SER A 1 622 ? -8.720  6.050   15.356  1.00 85.72  ?  683 SER A HA     1 
ATOM 9542  H HB2    . SER A 1 622 ? -10.187 6.283   13.578  1.00 74.07  ?  683 SER A HB2    1 
ATOM 9543  H HB3    . SER A 1 622 ? -11.017 5.906   14.880  1.00 74.07  ?  683 SER A HB3    1 
ATOM 9544  H HG     . SER A 1 622 ? -11.513 8.036   15.046  1.00 95.79  ?  683 SER A HG     1 
ATOM 9545  N N      . ILE A 1 623 ? -8.521  9.196   15.113  1.00 77.96  ?  684 ILE A N      1 
ATOM 9546  C CA     . ILE A 1 623 ? -7.795  10.284  14.465  1.00 65.74  ?  684 ILE A CA     1 
ATOM 9547  C C      . ILE A 1 623 ? -6.297  10.075  14.619  1.00 73.46  ?  684 ILE A C      1 
ATOM 9548  O O      . ILE A 1 623 ? -5.521  10.306  13.683  1.00 78.32  ?  684 ILE A O      1 
ATOM 9549  C CB     . ILE A 1 623 ? -8.228  11.650  15.032  1.00 84.14  ?  684 ILE A CB     1 
ATOM 9550  C CG1    . ILE A 1 623 ? -9.735  11.696  15.310  1.00 81.86  ?  684 ILE A CG1    1 
ATOM 9551  C CG2    . ILE A 1 623 ? -7.854  12.760  14.056  1.00 99.80  ?  684 ILE A CG2    1 
ATOM 9552  C CD1    . ILE A 1 623 ? -10.607 11.273  14.148  1.00 57.68  ?  684 ILE A CD1    1 
ATOM 9553  H H      . ILE A 1 623 ? -9.013  9.436   15.776  1.00 93.55  ?  684 ILE A H      1 
ATOM 9554  H HA     . ILE A 1 623 ? -8.000  10.277  13.517  1.00 78.89  ?  684 ILE A HA     1 
ATOM 9555  H HB     . ILE A 1 623 ? -7.756  11.801  15.866  1.00 100.96 ?  684 ILE A HB     1 
ATOM 9556  H HG12   . ILE A 1 623 ? -9.930  11.104  16.054  1.00 98.24  ?  684 ILE A HG12   1 
ATOM 9557  H HG13   . ILE A 1 623 ? -9.979  12.605  15.544  1.00 98.24  ?  684 ILE A HG13   1 
ATOM 9558  H HG21   . ILE A 1 623 ? -8.132  13.613  14.426  1.00 119.76 ?  684 ILE A HG21   1 
ATOM 9559  H HG22   . ILE A 1 623 ? -6.893  12.754  13.925  1.00 119.76 ?  684 ILE A HG22   1 
ATOM 9560  H HG23   . ILE A 1 623 ? -8.304  12.603  13.211  1.00 119.76 ?  684 ILE A HG23   1 
ATOM 9561  H HD11   . ILE A 1 623 ? -11.538 11.333  14.414  1.00 69.22  ?  684 ILE A HD11   1 
ATOM 9562  H HD12   . ILE A 1 623 ? -10.438 11.863  13.397  1.00 69.22  ?  684 ILE A HD12   1 
ATOM 9563  H HD13   . ILE A 1 623 ? -10.390 10.359  13.907  1.00 69.22  ?  684 ILE A HD13   1 
ATOM 9564  N N      . SER A 1 624 ? -5.866  9.632   15.800  1.00 77.82  ?  685 SER A N      1 
ATOM 9565  C CA     . SER A 1 624 ? -4.450  9.362   16.013  1.00 70.27  ?  685 SER A CA     1 
ATOM 9566  C C      . SER A 1 624 ? -3.953  8.281   15.067  1.00 68.50  ?  685 SER A C      1 
ATOM 9567  O O      . SER A 1 624 ? -2.854  8.389   14.511  1.00 75.76  ?  685 SER A O      1 
ATOM 9568  C CB     . SER A 1 624 ? -4.209  8.951   17.464  1.00 68.89  ?  685 SER A CB     1 
ATOM 9569  O OG     . SER A 1 624 ? -4.589  9.984   18.355  1.00 87.38  ?  685 SER A OG     1 
ATOM 9570  H H      . SER A 1 624 ? -6.366  9.483   16.483  1.00 93.39  ?  685 SER A H      1 
ATOM 9571  H HA     . SER A 1 624 ? -3.942  10.171  15.840  1.00 84.33  ?  685 SER A HA     1 
ATOM 9572  H HB2    . SER A 1 624 ? -4.733  8.159   17.658  1.00 82.67  ?  685 SER A HB2    1 
ATOM 9573  H HB3    . SER A 1 624 ? -3.265  8.762   17.586  1.00 82.67  ?  685 SER A HB3    1 
ATOM 9574  H HG     . SER A 1 624 ? -4.452  9.745   19.148  1.00 104.86 ?  685 SER A HG     1 
ATOM 9575  N N      . LEU A 1 625 ? -4.753  7.233   14.862  1.00 76.34  ?  686 LEU A N      1 
ATOM 9576  C CA     . LEU A 1 625 ? -4.318  6.134   14.010  1.00 79.99  ?  686 LEU A CA     1 
ATOM 9577  C C      . LEU A 1 625 ? -4.299  6.548   12.545  1.00 78.20  ?  686 LEU A C      1 
ATOM 9578  O O      . LEU A 1 625 ? -3.397  6.155   11.796  1.00 73.27  ?  686 LEU A O      1 
ATOM 9579  C CB     . LEU A 1 625 ? -5.221  4.920   14.222  1.00 70.14  ?  686 LEU A CB     1 
ATOM 9580  C CG     . LEU A 1 625 ? -5.091  4.254   15.595  1.00 59.39  ?  686 LEU A CG     1 
ATOM 9581  C CD1    . LEU A 1 625 ? -6.165  3.202   15.778  1.00 61.21  ?  686 LEU A CD1    1 
ATOM 9582  C CD2    . LEU A 1 625 ? -3.711  3.639   15.781  1.00 61.05  ?  686 LEU A CD2    1 
ATOM 9583  H H      . LEU A 1 625 ? -5.538  7.138   15.201  1.00 91.61  ?  686 LEU A H      1 
ATOM 9584  H HA     . LEU A 1 625 ? -3.415  5.881   14.259  1.00 95.99  ?  686 LEU A HA     1 
ATOM 9585  H HB2    . LEU A 1 625 ? -6.144  5.199   14.119  1.00 84.17  ?  686 LEU A HB2    1 
ATOM 9586  H HB3    . LEU A 1 625 ? -5.005  4.253   13.552  1.00 84.17  ?  686 LEU A HB3    1 
ATOM 9587  H HG     . LEU A 1 625 ? -5.212  4.927   16.283  1.00 71.27  ?  686 LEU A HG     1 
ATOM 9588  H HD11   . LEU A 1 625 ? -6.062  2.795   16.652  1.00 73.45  ?  686 LEU A HD11   1 
ATOM 9589  H HD12   . LEU A 1 625 ? -7.035  3.624   15.709  1.00 73.45  ?  686 LEU A HD12   1 
ATOM 9590  H HD13   . LEU A 1 625 ? -6.068  2.528   15.086  1.00 73.45  ?  686 LEU A HD13   1 
ATOM 9591  H HD21   . LEU A 1 625 ? -3.665  3.228   16.658  1.00 73.26  ?  686 LEU A HD21   1 
ATOM 9592  H HD22   . LEU A 1 625 ? -3.569  2.970   15.093  1.00 73.26  ?  686 LEU A HD22   1 
ATOM 9593  H HD23   . LEU A 1 625 ? -3.042  4.337   15.707  1.00 73.26  ?  686 LEU A HD23   1 
ATOM 9594  N N      . HIS A 1 626 ? -5.279  7.344   12.116  1.00 75.18  ?  687 HIS A N      1 
ATOM 9595  C CA     . HIS A 1 626 ? -5.237  7.878   10.760  1.00 58.56  ?  687 HIS A CA     1 
ATOM 9596  C C      . HIS A 1 626 ? -3.979  8.707   10.548  1.00 62.10  ?  687 HIS A C      1 
ATOM 9597  O O      . HIS A 1 626 ? -3.402  8.707   9.454   1.00 73.77  ?  687 HIS A O      1 
ATOM 9598  C CB     . HIS A 1 626 ? -6.483  8.715   10.483  1.00 56.28  ?  687 HIS A CB     1 
ATOM 9599  C CG     . HIS A 1 626 ? -7.754  7.928   10.502  1.00 62.25  ?  687 HIS A CG     1 
ATOM 9600  N ND1    . HIS A 1 626 ? -8.997  8.520   10.449  1.00 74.66  ?  687 HIS A ND1    1 
ATOM 9601  C CD2    . HIS A 1 626 ? -7.975  6.594   10.565  1.00 64.34  ?  687 HIS A CD2    1 
ATOM 9602  C CE1    . HIS A 1 626 ? -9.929  7.585   10.480  1.00 68.64  ?  687 HIS A CE1    1 
ATOM 9603  N NE2    . HIS A 1 626 ? -9.336  6.408   10.550  1.00 59.42  ?  687 HIS A NE2    1 
ATOM 9604  H H      . HIS A 1 626 ? -5.963  7.584   12.579  1.00 90.21  ?  687 HIS A H      1 
ATOM 9605  H HA     . HIS A 1 626 ? -5.222  7.141   10.130  1.00 70.27  ?  687 HIS A HA     1 
ATOM 9606  H HB2    . HIS A 1 626 ? -6.552  9.406   11.160  1.00 67.53  ?  687 HIS A HB2    1 
ATOM 9607  H HB3    . HIS A 1 626 ? -6.398  9.121   9.606   1.00 67.53  ?  687 HIS A HB3    1 
ATOM 9608  H HD2    . HIS A 1 626 ? -7.327  5.928   10.610  1.00 77.20  ?  687 HIS A HD2    1 
ATOM 9609  H HE1    . HIS A 1 626 ? -10.847 7.732   10.457  1.00 82.37  ?  687 HIS A HE1    1 
ATOM 9610  H HE2    . HIS A 1 626 ? -9.737  5.647   10.582  1.00 71.30  ?  687 HIS A HE2    1 
ATOM 9611  N N      . LYS A 1 627 ? -3.533  9.416   11.587  1.00 67.47  ?  688 LYS A N      1 
ATOM 9612  C CA     . LYS A 1 627 ? -2.303  10.191  11.477  1.00 71.64  ?  688 LYS A CA     1 
ATOM 9613  C C      . LYS A 1 627 ? -1.081  9.289   11.372  1.00 78.54  ?  688 LYS A C      1 
ATOM 9614  O O      . LYS A 1 627 ? -0.091  9.666   10.735  1.00 90.67  ?  688 LYS A O      1 
ATOM 9615  C CB     . LYS A 1 627 ? -2.163  11.131  12.674  1.00 63.37  ?  688 LYS A CB     1 
ATOM 9616  C CG     . LYS A 1 627 ? -3.034  12.380  12.604  1.00 74.59  ?  688 LYS A CG     1 
ATOM 9617  C CD     . LYS A 1 627 ? -2.651  13.265  11.425  1.00 84.71  ?  688 LYS A CD     1 
ATOM 9618  C CE     . LYS A 1 627 ? -3.207  14.672  11.571  1.00 91.52  ?  688 LYS A CE     1 
ATOM 9619  N NZ     . LYS A 1 627 ? -2.693  15.580  10.507  1.00 67.29  1  688 LYS A NZ     1 
ATOM 9620  H H      . LYS A 1 627 ? -3.919  9.462   12.354  1.00 80.96  ?  688 LYS A H      1 
ATOM 9621  H HA     . LYS A 1 627 ? -2.344  10.733  10.674  1.00 85.96  ?  688 LYS A HA     1 
ATOM 9622  H HB2    . LYS A 1 627 ? -2.406  10.648  13.479  1.00 76.05  ?  688 LYS A HB2    1 
ATOM 9623  H HB3    . LYS A 1 627 ? -1.239  11.421  12.734  1.00 76.05  ?  688 LYS A HB3    1 
ATOM 9624  H HG2    . LYS A 1 627 ? -3.962  12.117  12.497  1.00 89.50  ?  688 LYS A HG2    1 
ATOM 9625  H HG3    . LYS A 1 627 ? -2.923  12.894  13.419  1.00 89.50  ?  688 LYS A HG3    1 
ATOM 9626  H HD2    . LYS A 1 627 ? -1.684  13.325  11.373  1.00 101.65 ?  688 LYS A HD2    1 
ATOM 9627  H HD3    . LYS A 1 627 ? -3.008  12.881  10.609  1.00 101.65 ?  688 LYS A HD3    1 
ATOM 9628  H HE2    . LYS A 1 627 ? -4.174  14.642  11.502  1.00 109.82 ?  688 LYS A HE2    1 
ATOM 9629  H HE3    . LYS A 1 627 ? -2.943  15.033  12.431  1.00 109.82 ?  688 LYS A HE3    1 
ATOM 9630  H HZ1    . LYS A 1 627 ? -3.032  16.396  10.614  1.00 80.75  ?  688 LYS A HZ1    1 
ATOM 9631  H HZ2    . LYS A 1 627 ? -1.805  15.628  10.552  1.00 80.75  ?  688 LYS A HZ2    1 
ATOM 9632  H HZ3    . LYS A 1 627 ? -2.926  15.272  9.706   1.00 80.75  ?  688 LYS A HZ3    1 
ATOM 9633  N N      . ILE A 1 628 ? -1.125  8.104   11.984  1.00 74.48  ?  689 ILE A N      1 
ATOM 9634  C CA     . ILE A 1 628 ? -0.005  7.178   11.859  1.00 70.15  ?  689 ILE A CA     1 
ATOM 9635  C C      . ILE A 1 628 ? 0.012   6.558   10.469  1.00 66.04  ?  689 ILE A C      1 
ATOM 9636  O O      . ILE A 1 628 ? 1.079   6.354   9.879   1.00 78.28  ?  689 ILE A O      1 
ATOM 9637  C CB     . ILE A 1 628 ? -0.063  6.108   12.965  1.00 66.36  ?  689 ILE A CB     1 
ATOM 9638  C CG1    . ILE A 1 628 ? 0.049   6.776   14.340  1.00 85.22  ?  689 ILE A CG1    1 
ATOM 9639  C CG2    . ILE A 1 628 ? 1.054   5.084   12.774  1.00 58.48  ?  689 ILE A CG2    1 
ATOM 9640  C CD1    . ILE A 1 628 ? 0.021   5.818   15.518  1.00 72.66  ?  689 ILE A CD1    1 
ATOM 9641  H H      . ILE A 1 628 ? -1.777  7.819   12.466  1.00 89.37  ?  689 ILE A H      1 
ATOM 9642  H HA     . ILE A 1 628 ? 0.822   7.673   11.971  1.00 84.18  ?  689 ILE A HA     1 
ATOM 9643  H HB     . ILE A 1 628 ? -0.917  5.651   12.910  1.00 79.63  ?  689 ILE A HB     1 
ATOM 9644  H HG12   . ILE A 1 628 ? 0.887   7.263   14.379  1.00 102.26 ?  689 ILE A HG12   1 
ATOM 9645  H HG13   . ILE A 1 628 ? -0.692  7.392   14.445  1.00 102.26 ?  689 ILE A HG13   1 
ATOM 9646  H HG21   . ILE A 1 628 ? 0.998   4.421   13.480  1.00 70.17  ?  689 ILE A HG21   1 
ATOM 9647  H HG22   . ILE A 1 628 ? 0.947   4.657   11.910  1.00 70.17  ?  689 ILE A HG22   1 
ATOM 9648  H HG23   . ILE A 1 628 ? 1.910   5.539   12.814  1.00 70.17  ?  689 ILE A HG23   1 
ATOM 9649  H HD11   . ILE A 1 628 ? 0.097   6.327   16.340  1.00 87.19  ?  689 ILE A HD11   1 
ATOM 9650  H HD12   . ILE A 1 628 ? -0.817  5.329   15.508  1.00 87.19  ?  689 ILE A HD12   1 
ATOM 9651  H HD13   . ILE A 1 628 ? 0.765   5.200   15.441  1.00 87.19  ?  689 ILE A HD13   1 
ATOM 9652  N N      . PHE A 1 629 ? -1.166  6.252   9.919   1.00 70.97  ?  690 PHE A N      1 
ATOM 9653  C CA     . PHE A 1 629 ? -1.230  5.797   8.535   1.00 58.21  ?  690 PHE A CA     1 
ATOM 9654  C C      . PHE A 1 629 ? -0.654  6.846   7.593   1.00 62.85  ?  690 PHE A C      1 
ATOM 9655  O O      . PHE A 1 629 ? 0.104   6.517   6.673   1.00 56.50  ?  690 PHE A O      1 
ATOM 9656  C CB     . PHE A 1 629 ? -2.675  5.470   8.154   1.00 58.75  ?  690 PHE A CB     1 
ATOM 9657  C CG     . PHE A 1 629 ? -3.120  4.088   8.556   1.00 69.14  ?  690 PHE A CG     1 
ATOM 9658  C CD1    . PHE A 1 629 ? -2.364  2.973   8.232   1.00 75.88  ?  690 PHE A CD1    1 
ATOM 9659  C CD2    . PHE A 1 629 ? -4.302  3.906   9.256   1.00 55.16  ?  690 PHE A CD2    1 
ATOM 9660  C CE1    . PHE A 1 629 ? -2.778  1.707   8.600   1.00 51.46  ?  690 PHE A CE1    1 
ATOM 9661  C CE2    . PHE A 1 629 ? -4.718  2.642   9.625   1.00 49.68  ?  690 PHE A CE2    1 
ATOM 9662  C CZ     . PHE A 1 629 ? -3.955  1.543   9.297   1.00 48.89  ?  690 PHE A CZ     1 
ATOM 9663  H H      . PHE A 1 629 ? -1.925  6.300   10.319  1.00 85.17  ?  690 PHE A H      1 
ATOM 9664  H HA     . PHE A 1 629 ? -0.703  4.988   8.443   1.00 69.85  ?  690 PHE A HA     1 
ATOM 9665  H HB2    . PHE A 1 629 ? -3.263  6.108   8.588   1.00 70.50  ?  690 PHE A HB2    1 
ATOM 9666  H HB3    . PHE A 1 629 ? -2.767  5.541   7.191   1.00 70.50  ?  690 PHE A HB3    1 
ATOM 9667  H HD1    . PHE A 1 629 ? -1.568  3.078   7.761   1.00 91.05  ?  690 PHE A HD1    1 
ATOM 9668  H HD2    . PHE A 1 629 ? -4.821  4.644   9.480   1.00 66.19  ?  690 PHE A HD2    1 
ATOM 9669  H HE1    . PHE A 1 629 ? -2.262  0.966   8.378   1.00 61.75  ?  690 PHE A HE1    1 
ATOM 9670  H HE2    . PHE A 1 629 ? -5.513  2.533   10.095  1.00 59.62  ?  690 PHE A HE2    1 
ATOM 9671  H HZ     . PHE A 1 629 ? -4.234  0.692   9.545   1.00 58.67  ?  690 PHE A HZ     1 
ATOM 9672  N N      . TYR A 1 630 ? -1.001  8.116   7.809   1.00 60.23  ?  691 TYR A N      1 
ATOM 9673  C CA     . TYR A 1 630 ? -0.424  9.195   7.015   1.00 56.92  ?  691 TYR A CA     1 
ATOM 9674  C C      . TYR A 1 630 ? 1.097   9.135   7.028   1.00 56.27  ?  691 TYR A C      1 
ATOM 9675  O O      . TYR A 1 630 ? 1.741   9.114   5.974   1.00 64.54  ?  691 TYR A O      1 
ATOM 9676  C CB     . TYR A 1 630 ? -0.901  10.545  7.551   1.00 76.07  ?  691 TYR A CB     1 
ATOM 9677  C CG     . TYR A 1 630 ? -2.155  11.083  6.902   1.00 88.03  ?  691 TYR A CG     1 
ATOM 9678  C CD1    . TYR A 1 630 ? -2.149  12.317  6.265   1.00 74.78  ?  691 TYR A CD1    1 
ATOM 9679  C CD2    . TYR A 1 630 ? -3.344  10.367  6.931   1.00 90.30  ?  691 TYR A CD2    1 
ATOM 9680  C CE1    . TYR A 1 630 ? -3.289  12.822  5.675   1.00 73.81  ?  691 TYR A CE1    1 
ATOM 9681  C CE2    . TYR A 1 630 ? -4.492  10.865  6.342   1.00 83.08  ?  691 TYR A CE2    1 
ATOM 9682  C CZ     . TYR A 1 630 ? -4.458  12.092  5.715   1.00 77.21  ?  691 TYR A CZ     1 
ATOM 9683  O OH     . TYR A 1 630 ? -5.596  12.592  5.127   1.00 69.40  ?  691 TYR A OH     1 
ATOM 9684  H H      . TYR A 1 630 ? -1.564  8.375   8.405   1.00 72.28  ?  691 TYR A H      1 
ATOM 9685  H HA     . TYR A 1 630 ? -0.723  9.111   6.096   1.00 68.30  ?  691 TYR A HA     1 
ATOM 9686  H HB2    . TYR A 1 630 ? -1.079  10.454  8.500   1.00 91.28  ?  691 TYR A HB2    1 
ATOM 9687  H HB3    . TYR A 1 630 ? -0.197  11.198  7.413   1.00 91.28  ?  691 TYR A HB3    1 
ATOM 9688  H HD1    . TYR A 1 630 ? -1.363  12.812  6.236   1.00 89.74  ?  691 TYR A HD1    1 
ATOM 9689  H HD2    . TYR A 1 630 ? -3.369  9.539   7.355   1.00 108.35 ?  691 TYR A HD2    1 
ATOM 9690  H HE1    . TYR A 1 630 ? -3.269  13.649  5.251   1.00 88.57  ?  691 TYR A HE1    1 
ATOM 9691  H HE2    . TYR A 1 630 ? -5.281  10.375  6.368   1.00 99.70  ?  691 TYR A HE2    1 
ATOM 9692  H HH     . TYR A 1 630 ? -5.436  13.342  4.784   1.00 83.28  ?  691 TYR A HH     1 
ATOM 9693  N N      . LYS A 1 631 ? 1.690   9.105   8.223   1.00 57.12  ?  692 LYS A N      1 
ATOM 9694  C CA     . LYS A 1 631 ? 3.142   9.189   8.337   1.00 58.70  ?  692 LYS A CA     1 
ATOM 9695  C C      . LYS A 1 631 ? 3.819   8.050   7.586   1.00 66.26  ?  692 LYS A C      1 
ATOM 9696  O O      . LYS A 1 631 ? 4.754   8.272   6.809   1.00 71.27  ?  692 LYS A O      1 
ATOM 9697  C CB     . LYS A 1 631 ? 3.549   9.180   9.810   1.00 65.30  ?  692 LYS A CB     1 
ATOM 9698  C CG     . LYS A 1 631 ? 5.040   9.354   10.053  1.00 72.11  ?  692 LYS A CG     1 
ATOM 9699  C CD     . LYS A 1 631 ? 5.502   10.761  9.715   1.00 76.78  ?  692 LYS A CD     1 
ATOM 9700  C CE     . LYS A 1 631 ? 7.015   10.874  9.765   1.00 74.27  ?  692 LYS A CE     1 
ATOM 9701  N NZ     . LYS A 1 631 ? 7.652   10.360  8.524   1.00 71.22  1  692 LYS A NZ     1 
ATOM 9702  H H      . LYS A 1 631 ? 1.277   9.038   8.974   1.00 68.55  ?  692 LYS A H      1 
ATOM 9703  H HA     . LYS A 1 631 ? 3.442   10.025  7.947   1.00 70.44  ?  692 LYS A HA     1 
ATOM 9704  H HB2    . LYS A 1 631 ? 3.090   9.906   10.263  1.00 78.36  ?  692 LYS A HB2    1 
ATOM 9705  H HB3    . LYS A 1 631 ? 3.284   8.333   10.200  1.00 78.36  ?  692 LYS A HB3    1 
ATOM 9706  H HG2    . LYS A 1 631 ? 5.233   9.188   10.989  1.00 86.53  ?  692 LYS A HG2    1 
ATOM 9707  H HG3    . LYS A 1 631 ? 5.530   8.731   9.493   1.00 86.53  ?  692 LYS A HG3    1 
ATOM 9708  H HD2    . LYS A 1 631 ? 5.209   10.987  8.818   1.00 92.14  ?  692 LYS A HD2    1 
ATOM 9709  H HD3    . LYS A 1 631 ? 5.129   11.384  10.358  1.00 92.14  ?  692 LYS A HD3    1 
ATOM 9710  H HE2    . LYS A 1 631 ? 7.261   11.807  9.868   1.00 89.12  ?  692 LYS A HE2    1 
ATOM 9711  H HE3    . LYS A 1 631 ? 7.348   10.356  10.514  1.00 89.12  ?  692 LYS A HE3    1 
ATOM 9712  H HZ1    . LYS A 1 631 ? 8.536   10.439  8.581   1.00 85.47  ?  692 LYS A HZ1    1 
ATOM 9713  H HZ2    . LYS A 1 631 ? 7.444   9.502   8.409   1.00 85.47  ?  692 LYS A HZ2    1 
ATOM 9714  H HZ3    . LYS A 1 631 ? 7.365   10.823  7.820   1.00 85.47  ?  692 LYS A HZ3    1 
ATOM 9715  N N      . VAL A 1 632 ? 3.362   6.817   7.812   1.00 76.37  ?  693 VAL A N      1 
ATOM 9716  C CA     . VAL A 1 632 ? 3.955   5.669   7.131   1.00 51.65  ?  693 VAL A CA     1 
ATOM 9717  C C      . VAL A 1 632 ? 3.812   5.824   5.624   1.00 50.52  ?  693 VAL A C      1 
ATOM 9718  O O      . VAL A 1 632 ? 4.780   5.675   4.869   1.00 47.11  ?  693 VAL A O      1 
ATOM 9719  C CB     . VAL A 1 632 ? 3.309   4.364   7.626   1.00 48.35  ?  693 VAL A CB     1 
ATOM 9720  C CG1    . VAL A 1 632 ? 3.873   3.166   6.874   1.00 65.81  ?  693 VAL A CG1    1 
ATOM 9721  C CG2    . VAL A 1 632 ? 3.524   4.202   9.120   1.00 63.34  ?  693 VAL A CG2    1 
ATOM 9722  H H      . VAL A 1 632 ? 2.718   6.622   8.347   1.00 91.64  ?  693 VAL A H      1 
ATOM 9723  H HA     . VAL A 1 632 ? 4.902   5.633   7.340   1.00 61.99  ?  693 VAL A HA     1 
ATOM 9724  H HB     . VAL A 1 632 ? 2.354   4.400   7.461   1.00 58.02  ?  693 VAL A HB     1 
ATOM 9725  H HG11   . VAL A 1 632 ? 3.450   2.359   7.204   1.00 78.97  ?  693 VAL A HG11   1 
ATOM 9726  H HG12   . VAL A 1 632 ? 3.690   3.273   5.928   1.00 78.97  ?  693 VAL A HG12   1 
ATOM 9727  H HG13   . VAL A 1 632 ? 4.831   3.123   7.023   1.00 78.97  ?  693 VAL A HG13   1 
ATOM 9728  H HG21   . VAL A 1 632 ? 3.110   3.375   9.411   1.00 76.00  ?  693 VAL A HG21   1 
ATOM 9729  H HG22   . VAL A 1 632 ? 4.477   4.177   9.301   1.00 76.00  ?  693 VAL A HG22   1 
ATOM 9730  H HG23   . VAL A 1 632 ? 3.119   4.955   9.580   1.00 76.00  ?  693 VAL A HG23   1 
ATOM 9731  N N      . LEU A 1 633 ? 2.598   6.132   5.168   1.00 57.09  ?  694 LEU A N      1 
ATOM 9732  C CA     . LEU A 1 633 ? 2.344   6.256   3.738   1.00 44.41  ?  694 LEU A CA     1 
ATOM 9733  C C      . LEU A 1 633 ? 3.222   7.336   3.119   1.00 44.67  ?  694 LEU A C      1 
ATOM 9734  O O      . LEU A 1 633 ? 3.846   7.123   2.073   1.00 36.45  ?  694 LEU A O      1 
ATOM 9735  C CB     . LEU A 1 633 ? 0.861   6.553   3.512   1.00 28.65  ?  694 LEU A CB     1 
ATOM 9736  C CG     . LEU A 1 633 ? 0.312   6.645   2.088   1.00 39.13  ?  694 LEU A CG     1 
ATOM 9737  C CD1    . LEU A 1 633 ? 1.067   5.764   1.112   1.00 58.52  ?  694 LEU A CD1    1 
ATOM 9738  C CD2    . LEU A 1 633 ? -1.163  6.279   2.100   1.00 39.46  ?  694 LEU A CD2    1 
ATOM 9739  H H      . LEU A 1 633 ? 1.910   6.273   5.665   1.00 68.51  ?  694 LEU A H      1 
ATOM 9740  H HA     . LEU A 1 633 ? 2.552   5.414   3.304   1.00 53.29  ?  694 LEU A HA     1 
ATOM 9741  H HB2    . LEU A 1 633 ? 0.353   5.857   3.959   1.00 34.38  ?  694 LEU A HB2    1 
ATOM 9742  H HB3    . LEU A 1 633 ? 0.665   7.402   3.938   1.00 34.38  ?  694 LEU A HB3    1 
ATOM 9743  H HG     . LEU A 1 633 ? 0.388   7.562   1.782   1.00 46.96  ?  694 LEU A HG     1 
ATOM 9744  H HD11   . LEU A 1 633 ? 0.676   5.864   0.229   1.00 70.22  ?  694 LEU A HD11   1 
ATOM 9745  H HD12   . LEU A 1 633 ? 1.998   6.039   1.094   1.00 70.22  ?  694 LEU A HD12   1 
ATOM 9746  H HD13   . LEU A 1 633 ? 1.000   4.841   1.402   1.00 70.22  ?  694 LEU A HD13   1 
ATOM 9747  H HD21   . LEU A 1 633 ? -1.509  6.337   1.195   1.00 47.35  ?  694 LEU A HD21   1 
ATOM 9748  H HD22   . LEU A 1 633 ? -1.260  5.373   2.433   1.00 47.35  ?  694 LEU A HD22   1 
ATOM 9749  H HD23   . LEU A 1 633 ? -1.637  6.897   2.677   1.00 47.35  ?  694 LEU A HD23   1 
ATOM 9750  N N      . LYS A 1 634 ? 3.296   8.502   3.761   1.00 65.80  ?  695 LYS A N      1 
ATOM 9751  C CA     . LYS A 1 634 ? 4.101   9.596   3.228   1.00 44.40  ?  695 LYS A CA     1 
ATOM 9752  C C      . LYS A 1 634 ? 5.578   9.223   3.193   1.00 50.25  ?  695 LYS A C      1 
ATOM 9753  O O      . LYS A 1 634 ? 6.270   9.477   2.201   1.00 51.41  ?  695 LYS A O      1 
ATOM 9754  C CB     . LYS A 1 634 ? 3.885   10.854  4.070   1.00 43.18  ?  695 LYS A CB     1 
ATOM 9755  C CG     . LYS A 1 634 ? 4.756   12.045  3.681   1.00 84.35  ?  695 LYS A CG     1 
ATOM 9756  C CD     . LYS A 1 634 ? 4.963   12.975  4.863   1.00 87.42  ?  695 LYS A CD     1 
ATOM 9757  C CE     . LYS A 1 634 ? 5.932   14.095  4.530   1.00 58.26  ?  695 LYS A CE     1 
ATOM 9758  N NZ     . LYS A 1 634 ? 6.189   14.970  5.704   1.00 53.00  1  695 LYS A NZ     1 
ATOM 9759  H H      . LYS A 1 634 ? 2.892   8.683   4.498   1.00 78.96  ?  695 LYS A H      1 
ATOM 9760  H HA     . LYS A 1 634 ? 3.817   9.787   2.321   1.00 53.28  ?  695 LYS A HA     1 
ATOM 9761  H HB2    . LYS A 1 634 ? 2.959   11.127  3.983   1.00 51.82  ?  695 LYS A HB2    1 
ATOM 9762  H HB3    . LYS A 1 634 ? 4.076   10.641  4.997   1.00 51.82  ?  695 LYS A HB3    1 
ATOM 9763  H HG2    . LYS A 1 634 ? 5.624   11.727  3.386   1.00 101.22 ?  695 LYS A HG2    1 
ATOM 9764  H HG3    . LYS A 1 634 ? 4.320   12.544  2.972   1.00 101.22 ?  695 LYS A HG3    1 
ATOM 9765  H HD2    . LYS A 1 634 ? 4.113   13.372  5.110   1.00 104.91 ?  695 LYS A HD2    1 
ATOM 9766  H HD3    . LYS A 1 634 ? 5.326   12.470  5.607   1.00 104.91 ?  695 LYS A HD3    1 
ATOM 9767  H HE2    . LYS A 1 634 ? 6.777   13.712  4.247   1.00 69.91  ?  695 LYS A HE2    1 
ATOM 9768  H HE3    . LYS A 1 634 ? 5.557   14.641  3.821   1.00 69.91  ?  695 LYS A HE3    1 
ATOM 9769  H HZ1    . LYS A 1 634 ? 6.759   15.617  5.482   1.00 63.60  ?  695 LYS A HZ1    1 
ATOM 9770  H HZ2    . LYS A 1 634 ? 5.428   15.338  5.981   1.00 63.60  ?  695 LYS A HZ2    1 
ATOM 9771  H HZ3    . LYS A 1 634 ? 6.538   14.492  6.369   1.00 63.60  ?  695 LYS A HZ3    1 
ATOM 9772  N N      . ASN A 1 635 ? 6.077   8.627   4.273   1.00 67.84  ?  696 ASN A N      1 
ATOM 9773  C CA     . ASN A 1 635 ? 7.505   8.376   4.423   1.00 67.87  ?  696 ASN A CA     1 
ATOM 9774  C C      . ASN A 1 635 ? 8.090   7.753   3.164   1.00 52.50  ?  696 ASN A C      1 
ATOM 9775  O O      . ASN A 1 635 ? 7.694   6.658   2.757   1.00 51.98  ?  696 ASN A O      1 
ATOM 9776  C CB     . ASN A 1 635 ? 7.743   7.462   5.627   1.00 74.42  ?  696 ASN A CB     1 
ATOM 9777  C CG     . ASN A 1 635 ? 9.215   7.270   5.931   1.00 74.98  ?  696 ASN A CG     1 
ATOM 9778  O OD1    . ASN A 1 635 ? 10.069  7.430   5.061   1.00 67.85  ?  696 ASN A OD1    1 
ATOM 9779  N ND2    . ASN A 1 635 ? 9.518   6.921   7.174   1.00 81.86  ?  696 ASN A ND2    1 
ATOM 9780  H H      . ASN A 1 635 ? 5.604   8.356   4.938   1.00 81.41  ?  696 ASN A H      1 
ATOM 9781  H HA     . ASN A 1 635 ? 7.962   9.216   4.586   1.00 81.44  ?  696 ASN A HA     1 
ATOM 9782  H HB2    . ASN A 1 635 ? 7.323   7.854   6.409   1.00 89.30  ?  696 ASN A HB2    1 
ATOM 9783  H HB3    . ASN A 1 635 ? 7.357   6.591   5.444   1.00 89.30  ?  696 ASN A HB3    1 
ATOM 9784  H HD21   . ASN A 1 635 ? 10.340  6.800   7.398   1.00 98.23  ?  696 ASN A HD21   1 
ATOM 9785  H HD22   . ASN A 1 635 ? 8.894   6.817   7.756   1.00 98.23  ?  696 ASN A HD22   1 
ATOM 9786  N N      . ASN A 1 636 ? 9.040   8.459   2.553   1.00 76.55  ?  697 ASN A N      1 
ATOM 9787  C CA     . ASN A 1 636 ? 9.704   7.984   1.348   1.00 66.56  ?  697 ASN A CA     1 
ATOM 9788  C C      . ASN A 1 636 ? 10.909  7.103   1.639   1.00 60.67  ?  697 ASN A C      1 
ATOM 9789  O O      . ASN A 1 636 ? 11.376  6.400   0.736   1.00 46.39  ?  697 ASN A O      1 
ATOM 9790  C CB     . ASN A 1 636 ? 10.151  9.173   0.493   1.00 63.28  ?  697 ASN A CB     1 
ATOM 9791  C CG     . ASN A 1 636 ? 10.716  8.746   -0.844  1.00 81.46  ?  697 ASN A CG     1 
ATOM 9792  O OD1    . ASN A 1 636 ? 10.407  7.666   -1.345  1.00 83.85  ?  697 ASN A OD1    1 
ATOM 9793  N ND2    . ASN A 1 636 ? 11.554  9.593   -1.429  1.00 89.82  ?  697 ASN A ND2    1 
ATOM 9794  H H      . ASN A 1 636 ? 9.319   9.226   2.823   1.00 91.87  ?  697 ASN A H      1 
ATOM 9795  H HA     . ASN A 1 636 ? 9.073   7.462   0.828   1.00 79.88  ?  697 ASN A HA     1 
ATOM 9796  H HB2    . ASN A 1 636 ? 9.388   9.748   0.327   1.00 75.94  ?  697 ASN A HB2    1 
ATOM 9797  H HB3    . ASN A 1 636 ? 10.840  9.663   0.968   1.00 75.94  ?  697 ASN A HB3    1 
ATOM 9798  H HD21   . ASN A 1 636 ? 11.902  9.396   -2.190  1.00 107.79 ?  697 ASN A HD21   1 
ATOM 9799  H HD22   . ASN A 1 636 ? 11.748  10.338  -1.047  1.00 107.79 ?  697 ASN A HD22   1 
ATOM 9800  N N      . GLY A 1 637 ? 11.418  7.117   2.872   1.00 73.04  ?  698 GLY A N      1 
ATOM 9801  C CA     . GLY A 1 637 ? 12.663  6.425   3.161   1.00 80.34  ?  698 GLY A CA     1 
ATOM 9802  C C      . GLY A 1 637 ? 12.520  4.920   3.248   1.00 75.83  ?  698 GLY A C      1 
ATOM 9803  O O      . GLY A 1 637 ? 13.454  4.187   2.909   1.00 77.40  ?  698 GLY A O      1 
ATOM 9804  H H      . GLY A 1 637 ? 11.064  7.515   3.547   1.00 87.64  ?  698 GLY A H      1 
ATOM 9805  H HA2    . GLY A 1 637 ? 13.308  6.628   2.466   1.00 96.40  ?  698 GLY A HA2    1 
ATOM 9806  H HA3    . GLY A 1 637 ? 13.016  6.745   4.006   1.00 96.40  ?  698 GLY A HA3    1 
ATOM 9807  N N      . LEU A 1 638 ? 11.366  4.438   3.699   1.00 67.87  ?  699 LEU A N      1 
ATOM 9808  C CA     . LEU A 1 638 ? 11.132  3.007   3.889   1.00 68.32  ?  699 LEU A CA     1 
ATOM 9809  C C      . LEU A 1 638 ? 10.032  2.548   2.944   1.00 56.34  ?  699 LEU A C      1 
ATOM 9810  O O      . LEU A 1 638 ? 8.837   2.675   3.269   1.00 49.76  ?  699 LEU A O      1 
ATOM 9811  C CB     . LEU A 1 638 ? 10.756  2.715   5.339   1.00 69.13  ?  699 LEU A CB     1 
ATOM 9812  C CG     . LEU A 1 638 ? 11.796  3.179   6.363   1.00 65.92  ?  699 LEU A CG     1 
ATOM 9813  C CD1    . LEU A 1 638 ? 11.304  2.929   7.776   1.00 72.69  ?  699 LEU A CD1    1 
ATOM 9814  C CD2    . LEU A 1 638 ? 13.137  2.494   6.139   1.00 73.97  ?  699 LEU A CD2    1 
ATOM 9815  H H      . LEU A 1 638 ? 10.691  4.928   3.907   1.00 81.44  ?  699 LEU A H      1 
ATOM 9816  H HA     . LEU A 1 638 ? 11.941  2.517   3.678   1.00 81.99  ?  699 LEU A HA     1 
ATOM 9817  H HB2    . LEU A 1 638 ? 9.921   3.165   5.542   1.00 82.96  ?  699 LEU A HB2    1 
ATOM 9818  H HB3    . LEU A 1 638 ? 10.645  1.757   5.445   1.00 82.96  ?  699 LEU A HB3    1 
ATOM 9819  H HG     . LEU A 1 638 ? 11.930  4.134   6.261   1.00 79.10  ?  699 LEU A HG     1 
ATOM 9820  H HD11   . LEU A 1 638 ? 11.980  3.231   8.403   1.00 87.23  ?  699 LEU A HD11   1 
ATOM 9821  H HD12   . LEU A 1 638 ? 10.480  3.420   7.915   1.00 87.23  ?  699 LEU A HD12   1 
ATOM 9822  H HD13   . LEU A 1 638 ? 11.147  1.978   7.891   1.00 87.23  ?  699 LEU A HD13   1 
ATOM 9823  H HD21   . LEU A 1 638 ? 13.768  2.812   6.804   1.00 88.76  ?  699 LEU A HD21   1 
ATOM 9824  H HD22   . LEU A 1 638 ? 13.020  1.535   6.226   1.00 88.76  ?  699 LEU A HD22   1 
ATOM 9825  H HD23   . LEU A 1 638 ? 13.456  2.710   5.249   1.00 88.76  ?  699 LEU A HD23   1 
ATOM 9826  N N      . PRO A 1 639 ? 10.372  2.008   1.770   1.00 41.93  ?  700 PRO A N      1 
ATOM 9827  C CA     . PRO A 1 639 ? 9.331   1.651   0.798   1.00 40.19  ?  700 PRO A CA     1 
ATOM 9828  C C      . PRO A 1 639 ? 8.430   0.527   1.278   1.00 60.94  ?  700 PRO A C      1 
ATOM 9829  O O      . PRO A 1 639 ? 7.205   0.678   1.302   1.00 54.57  ?  700 PRO A O      1 
ATOM 9830  C CB     . PRO A 1 639 ? 10.133  1.230   -0.441  1.00 57.65  ?  700 PRO A CB     1 
ATOM 9831  C CG     . PRO A 1 639 ? 11.508  1.761   -0.228  1.00 56.06  ?  700 PRO A CG     1 
ATOM 9832  C CD     . PRO A 1 639 ? 11.722  1.755   1.242   1.00 59.70  ?  700 PRO A CD     1 
ATOM 9833  H HA     . PRO A 1 639 ? 8.790   2.427   0.582   1.00 48.23  ?  700 PRO A HA     1 
ATOM 9834  H HB2    . PRO A 1 639 ? 10.147  0.262   -0.506  1.00 69.17  ?  700 PRO A HB2    1 
ATOM 9835  H HB3    . PRO A 1 639 ? 9.735   1.620   -1.235  1.00 69.17  ?  700 PRO A HB3    1 
ATOM 9836  H HG2    . PRO A 1 639 ? 12.151  1.184   -0.669  1.00 67.28  ?  700 PRO A HG2    1 
ATOM 9837  H HG3    . PRO A 1 639 ? 11.565  2.665   -0.577  1.00 67.28  ?  700 PRO A HG3    1 
ATOM 9838  H HD2    . PRO A 1 639 ? 12.044  0.888   1.535   1.00 71.64  ?  700 PRO A HD2    1 
ATOM 9839  H HD3    . PRO A 1 639 ? 12.327  2.468   1.501   1.00 71.64  ?  700 PRO A HD3    1 
ATOM 9840  N N      . GLU A 1 640 ? 9.027   -0.606  1.659   1.00 74.68  ?  701 GLU A N      1 
ATOM 9841  C CA     . GLU A 1 640 ? 8.234   -1.765  2.059   1.00 67.52  ?  701 GLU A CA     1 
ATOM 9842  C C      . GLU A 1 640 ? 7.162   -1.381  3.068   1.00 64.73  ?  701 GLU A C      1 
ATOM 9843  O O      . GLU A 1 640 ? 6.039   -1.895  3.019   1.00 74.64  ?  701 GLU A O      1 
ATOM 9844  C CB     . GLU A 1 640 ? 9.138   -2.861  2.631   1.00 60.12  ?  701 GLU A CB     1 
ATOM 9845  C CG     . GLU A 1 640 ? 10.092  -2.409  3.734   1.00 81.49  ?  701 GLU A CG     1 
ATOM 9846  C CD     . GLU A 1 640 ? 11.415  -1.890  3.202   1.00 87.56  ?  701 GLU A CD     1 
ATOM 9847  O OE1    . GLU A 1 640 ? 11.698  -2.082  2.002   1.00 88.82  ?  701 GLU A OE1    1 
ATOM 9848  O OE2    . GLU A 1 640 ? 12.177  -1.290  3.989   1.00 93.56  -1 701 GLU A OE2    1 
ATOM 9849  H H      . GLU A 1 640 ? 9.878   -0.726  1.694   1.00 89.61  ?  701 GLU A H      1 
ATOM 9850  H HA     . GLU A 1 640 ? 7.789   -2.125  1.275   1.00 81.02  ?  701 GLU A HA     1 
ATOM 9851  H HB2    . GLU A 1 640 ? 8.578   -3.562  2.999   1.00 72.14  ?  701 GLU A HB2    1 
ATOM 9852  H HB3    . GLU A 1 640 ? 9.677   -3.223  1.910   1.00 72.14  ?  701 GLU A HB3    1 
ATOM 9853  H HG2    . GLU A 1 640 ? 9.672   -1.695  4.239   1.00 97.79  ?  701 GLU A HG2    1 
ATOM 9854  H HG3    . GLU A 1 640 ? 10.278  -3.161  4.317   1.00 97.79  ?  701 GLU A HG3    1 
ATOM 9855  N N      . CYS A 1 641 ? 7.485   -0.469  3.988   1.00 60.69  ?  702 CYS A N      1 
ATOM 9856  C CA     . CYS A 1 641 ? 6.491   -0.025  4.957   1.00 48.99  ?  702 CYS A CA     1 
ATOM 9857  C C      . CYS A 1 641 ? 5.361   0.740   4.284   1.00 51.22  ?  702 CYS A C      1 
ATOM 9858  O O      . CYS A 1 641 ? 4.212   0.666   4.734   1.00 45.76  ?  702 CYS A O      1 
ATOM 9859  C CB     . CYS A 1 641 ? 7.154   0.833   6.031   1.00 53.50  ?  702 CYS A CB     1 
ATOM 9860  S SG     . CYS A 1 641 ? 8.520   0.005   6.871   1.00 46.03  ?  702 CYS A SG     1 
ATOM 9861  H H      . CYS A 1 641 ? 8.257   -0.101  4.068   1.00 72.83  ?  702 CYS A H      1 
ATOM 9862  H HA     . CYS A 1 641 ? 6.107   -0.802  5.392   1.00 58.79  ?  702 CYS A HA     1 
ATOM 9863  H HB2    . CYS A 1 641 ? 7.503   1.638   5.617   1.00 64.20  ?  702 CYS A HB2    1 
ATOM 9864  H HB3    . CYS A 1 641 ? 6.491   1.067   6.699   1.00 64.20  ?  702 CYS A HB3    1 
ATOM 9865  H HG     . CYS A 1 641 ? 8.980   0.748   7.694   1.00 55.23  ?  702 CYS A HG     1 
ATOM 9866  N N      . GLN A 1 642 ? 5.658   1.481   3.213   1.00 52.53  ?  703 GLN A N      1 
ATOM 9867  C CA     . GLN A 1 642 ? 4.587   2.083   2.429   1.00 54.04  ?  703 GLN A CA     1 
ATOM 9868  C C      . GLN A 1 642 ? 3.659   1.013   1.874   1.00 53.43  ?  703 GLN A C      1 
ATOM 9869  O O      . GLN A 1 642 ? 2.434   1.177   1.876   1.00 52.71  ?  703 GLN A O      1 
ATOM 9870  C CB     . GLN A 1 642 ? 5.157   2.909   1.278   1.00 58.72  ?  703 GLN A CB     1 
ATOM 9871  C CG     . GLN A 1 642 ? 6.089   4.028   1.678   1.00 65.72  ?  703 GLN A CG     1 
ATOM 9872  C CD     . GLN A 1 642 ? 6.355   4.964   0.522   1.00 56.01  ?  703 GLN A CD     1 
ATOM 9873  O OE1    . GLN A 1 642 ? 5.683   4.900   -0.505  1.00 42.63  ?  703 GLN A OE1    1 
ATOM 9874  N NE2    . GLN A 1 642 ? 7.339   5.831   0.676   1.00 52.57  ?  703 GLN A NE2    1 
ATOM 9875  H H      . GLN A 1 642 ? 6.453   1.645   2.929   1.00 63.03  ?  703 GLN A H      1 
ATOM 9876  H HA     . GLN A 1 642 ? 4.066   2.671   2.997   1.00 64.84  ?  703 GLN A HA     1 
ATOM 9877  H HB2    . GLN A 1 642 ? 5.651   2.316   0.691   1.00 70.47  ?  703 GLN A HB2    1 
ATOM 9878  H HB3    . GLN A 1 642 ? 4.419   3.306   0.791   1.00 70.47  ?  703 GLN A HB3    1 
ATOM 9879  H HG2    . GLN A 1 642 ? 5.685   4.540   2.397   1.00 78.86  ?  703 GLN A HG2    1 
ATOM 9880  H HG3    . GLN A 1 642 ? 6.935   3.653   1.967   1.00 78.86  ?  703 GLN A HG3    1 
ATOM 9881  H HE21   . GLN A 1 642 ? 7.791   5.844   1.407   1.00 63.09  ?  703 GLN A HE21   1 
ATOM 9882  H HE22   . GLN A 1 642 ? 7.528   6.384   0.045   1.00 63.09  ?  703 GLN A HE22   1 
ATOM 9883  N N      . VAL A 1 643 ? 4.231   -0.094  1.399   1.00 57.57  ?  704 VAL A N      1 
ATOM 9884  C CA     . VAL A 1 643 ? 3.441   -1.120  0.725   1.00 51.10  ?  704 VAL A CA     1 
ATOM 9885  C C      . VAL A 1 643 ? 2.372   -1.664  1.662   1.00 57.43  ?  704 VAL A C      1 
ATOM 9886  O O      . VAL A 1 643 ? 1.187   -1.723  1.315   1.00 51.57  ?  704 VAL A O      1 
ATOM 9887  C CB     . VAL A 1 643 ? 4.357   -2.243  0.205   1.00 49.33  ?  704 VAL A CB     1 
ATOM 9888  C CG1    . VAL A 1 643 ? 3.553   -3.269  -0.576  1.00 64.44  ?  704 VAL A CG1    1 
ATOM 9889  C CG2    . VAL A 1 643 ? 5.470   -1.674  -0.663  1.00 56.21  ?  704 VAL A CG2    1 
ATOM 9890  H H      . VAL A 1 643 ? 5.070   -0.273  1.454   1.00 69.09  ?  704 VAL A H      1 
ATOM 9891  H HA     . VAL A 1 643 ? 2.993   -0.722  -0.038  1.00 61.32  ?  704 VAL A HA     1 
ATOM 9892  H HB     . VAL A 1 643 ? 4.765   -2.693  0.960   1.00 59.20  ?  704 VAL A HB     1 
ATOM 9893  H HG11   . VAL A 1 643 ? 4.151   -3.963  -0.892  1.00 77.32  ?  704 VAL A HG11   1 
ATOM 9894  H HG12   . VAL A 1 643 ? 2.880   -3.652  0.008   1.00 77.32  ?  704 VAL A HG12   1 
ATOM 9895  H HG13   . VAL A 1 643 ? 3.128   -2.829  -1.329  1.00 77.32  ?  704 VAL A HG13   1 
ATOM 9896  H HG21   . VAL A 1 643 ? 6.030   -2.402  -0.976  1.00 67.45  ?  704 VAL A HG21   1 
ATOM 9897  H HG22   . VAL A 1 643 ? 5.076   -1.211  -1.419  1.00 67.45  ?  704 VAL A HG22   1 
ATOM 9898  H HG23   . VAL A 1 643 ? 5.997   -1.055  -0.134  1.00 67.45  ?  704 VAL A HG23   1 
ATOM 9899  N N      . ILE A 1 644 ? 2.775   -2.071  2.869   1.00 63.16  ?  705 ILE A N      1 
ATOM 9900  C CA     . ILE A 1 644 ? 1.815   -2.642  3.809   1.00 55.04  ?  705 ILE A CA     1 
ATOM 9901  C C      . ILE A 1 644 ? 0.835   -1.581  4.286   1.00 42.01  ?  705 ILE A C      1 
ATOM 9902  O O      . ILE A 1 644 ? -0.332  -1.886  4.560   1.00 26.58  ?  705 ILE A O      1 
ATOM 9903  C CB     . ILE A 1 644 ? 2.525   -3.323  4.997   1.00 44.04  ?  705 ILE A CB     1 
ATOM 9904  C CG1    . ILE A 1 644 ? 3.786   -2.561  5.416   1.00 54.11  ?  705 ILE A CG1    1 
ATOM 9905  C CG2    . ILE A 1 644 ? 2.855   -4.762  4.644   1.00 48.54  ?  705 ILE A CG2    1 
ATOM 9906  C CD1    . ILE A 1 644 ? 4.409   -3.055  6.703   1.00 72.62  ?  705 ILE A CD1    1 
ATOM 9907  H H      . ILE A 1 644 ? 3.583   -2.028  3.161   1.00 75.79  ?  705 ILE A H      1 
ATOM 9908  H HA     . ILE A 1 644 ? 1.302   -3.324  3.348   1.00 66.05  ?  705 ILE A HA     1 
ATOM 9909  H HB     . ILE A 1 644 ? 1.913   -3.330  5.750   1.00 52.85  ?  705 ILE A HB     1 
ATOM 9910  H HG12   . ILE A 1 644 ? 4.450   -2.647  4.714   1.00 64.93  ?  705 ILE A HG12   1 
ATOM 9911  H HG13   . ILE A 1 644 ? 3.559   -1.626  5.538   1.00 64.93  ?  705 ILE A HG13   1 
ATOM 9912  H HG21   . ILE A 1 644 ? 3.300   -5.178  5.399   1.00 58.25  ?  705 ILE A HG21   1 
ATOM 9913  H HG22   . ILE A 1 644 ? 2.031   -5.235  4.445   1.00 58.25  ?  705 ILE A HG22   1 
ATOM 9914  H HG23   . ILE A 1 644 ? 3.438   -4.772  3.869   1.00 58.25  ?  705 ILE A HG23   1 
ATOM 9915  H HD11   . ILE A 1 644 ? 5.197   -2.523  6.896   1.00 87.14  ?  705 ILE A HD11   1 
ATOM 9916  H HD12   . ILE A 1 644 ? 3.764   -2.964  7.421   1.00 87.14  ?  705 ILE A HD12   1 
ATOM 9917  H HD13   . ILE A 1 644 ? 4.656   -3.987  6.596   1.00 87.14  ?  705 ILE A HD13   1 
ATOM 9918  N N      . ALA A 1 645 ? 1.277   -0.327  4.396   1.00 64.15  ?  706 ALA A N      1 
ATOM 9919  C CA     . ALA A 1 645 ? 0.346   0.751   4.707   1.00 67.84  ?  706 ALA A CA     1 
ATOM 9920  C C      . ALA A 1 645 ? -0.669  0.926   3.589   1.00 55.48  ?  706 ALA A C      1 
ATOM 9921  O O      . ALA A 1 645 ? -1.862  1.126   3.844   1.00 41.22  ?  706 ALA A O      1 
ATOM 9922  C CB     . ALA A 1 645 ? 1.107   2.052   4.946   1.00 55.18  ?  706 ALA A CB     1 
ATOM 9923  H H      . ALA A 1 645 ? 2.095   -0.080  4.297   1.00 76.99  ?  706 ALA A H      1 
ATOM 9924  H HA     . ALA A 1 645 ? -0.136  0.530   5.520   1.00 81.41  ?  706 ALA A HA     1 
ATOM 9925  H HB1    . ALA A 1 645 ? 0.472   2.756   5.151   1.00 66.22  ?  706 ALA A HB1    1 
ATOM 9926  H HB2    . ALA A 1 645 ? 1.717   1.929   5.690   1.00 66.22  ?  706 ALA A HB2    1 
ATOM 9927  H HB3    . ALA A 1 645 ? 1.604   2.278   4.144   1.00 66.22  ?  706 ALA A HB3    1 
ATOM 9928  N N      . ALA A 1 646 ? -0.212  0.853   2.339   1.00 55.35  ?  707 ALA A N      1 
ATOM 9929  C CA     . ALA A 1 646 ? -1.131  0.916   1.211   1.00 52.99  ?  707 ALA A CA     1 
ATOM 9930  C C      . ALA A 1 646 ? -2.000  -0.331  1.148   1.00 60.12  ?  707 ALA A C      1 
ATOM 9931  O O      . ALA A 1 646 ? -3.232  -0.241  1.121   1.00 55.44  ?  707 ALA A O      1 
ATOM 9932  C CB     . ALA A 1 646 ? -0.348  1.092   -0.088  1.00 49.63  ?  707 ALA A CB     1 
ATOM 9933  H H      . ALA A 1 646 ? 0.616   0.767   2.123   1.00 66.42  ?  707 ALA A H      1 
ATOM 9934  H HA     . ALA A 1 646 ? -1.713  1.685   1.318   1.00 63.59  ?  707 ALA A HA     1 
ATOM 9935  H HB1    . ALA A 1 646 ? -0.972  1.132   -0.829  1.00 59.56  ?  707 ALA A HB1    1 
ATOM 9936  H HB2    . ALA A 1 646 ? 0.163   1.915   -0.040  1.00 59.56  ?  707 ALA A HB2    1 
ATOM 9937  H HB3    . ALA A 1 646 ? 0.250   0.336   -0.200  1.00 59.56  ?  707 ALA A HB3    1 
ATOM 9938  N N      . GLU A 1 647 ? -1.374  -1.509  1.135   1.00 68.81  ?  708 GLU A N      1 
ATOM 9939  C CA     . GLU A 1 647 ? -2.137  -2.746  1.027   1.00 49.23  ?  708 GLU A CA     1 
ATOM 9940  C C      . GLU A 1 647 ? -3.133  -2.876  2.170   1.00 38.82  ?  708 GLU A C      1 
ATOM 9941  O O      . GLU A 1 647 ? -4.260  -3.344  1.972   1.00 42.28  ?  708 GLU A O      1 
ATOM 9942  C CB     . GLU A 1 647 ? -1.189  -3.944  1.002   1.00 55.81  ?  708 GLU A CB     1 
ATOM 9943  C CG     . GLU A 1 647 ? -1.795  -5.193  0.393   1.00 50.63  ?  708 GLU A CG     1 
ATOM 9944  C CD     . GLU A 1 647 ? -0.871  -6.389  0.475   1.00 57.46  ?  708 GLU A CD     1 
ATOM 9945  O OE1    . GLU A 1 647 ? 0.352   -6.190  0.625   1.00 55.15  ?  708 GLU A OE1    1 
ATOM 9946  O OE2    . GLU A 1 647 ? -1.369  -7.530  0.393   1.00 65.59  -1 708 GLU A OE2    1 
ATOM 9947  H H      . GLU A 1 647 ? -0.522  -1.615  1.187   1.00 82.57  ?  708 GLU A H      1 
ATOM 9948  H HA     . GLU A 1 647 ? -2.634  -2.740  0.194   1.00 59.08  ?  708 GLU A HA     1 
ATOM 9949  H HB2    . GLU A 1 647 ? -0.404  -3.711  0.481   1.00 66.97  ?  708 GLU A HB2    1 
ATOM 9950  H HB3    . GLU A 1 647 ? -0.928  -4.154  1.912   1.00 66.97  ?  708 GLU A HB3    1 
ATOM 9951  H HG2    . GLU A 1 647 ? -2.612  -5.412  0.868   1.00 60.76  ?  708 GLU A HG2    1 
ATOM 9952  H HG3    . GLU A 1 647 ? -1.989  -5.027  -0.543  1.00 60.76  ?  708 GLU A HG3    1 
ATOM 9953  N N      . GLY A 1 648 ? -2.742  -2.458  3.373   1.00 41.94  ?  709 GLY A N      1 
ATOM 9954  C CA     . GLY A 1 648 ? -3.651  -2.542  4.502   1.00 40.74  ?  709 GLY A CA     1 
ATOM 9955  C C      . GLY A 1 648 ? -4.851  -1.626  4.349   1.00 43.73  ?  709 GLY A C      1 
ATOM 9956  O O      . GLY A 1 648 ? -5.997  -2.055  4.498   1.00 46.21  ?  709 GLY A O      1 
ATOM 9957  H H      . GLY A 1 648 ? -1.968  -2.128  3.555   1.00 50.33  ?  709 GLY A H      1 
ATOM 9958  H HA2    . GLY A 1 648 ? -3.971  -3.454  4.593   1.00 48.89  ?  709 GLY A HA2    1 
ATOM 9959  H HA3    . GLY A 1 648 ? -3.181  -2.299  5.315   1.00 48.89  ?  709 GLY A HA3    1 
ATOM 9960  N N      . LEU A 1 649 ? -4.601  -0.351  4.043   1.00 54.08  ?  710 LEU A N      1 
ATOM 9961  C CA     . LEU A 1 649 ? -5.692  0.615   3.951   1.00 45.68  ?  710 LEU A CA     1 
ATOM 9962  C C      . LEU A 1 649 ? -6.750  0.165   2.953   1.00 40.75  ?  710 LEU A C      1 
ATOM 9963  O O      . LEU A 1 649 ? -7.950  0.346   3.186   1.00 40.79  ?  710 LEU A O      1 
ATOM 9964  C CB     . LEU A 1 649 ? -5.140  1.988   3.569   1.00 53.75  ?  710 LEU A CB     1 
ATOM 9965  C CG     . LEU A 1 649 ? -4.439  2.768   4.684   1.00 71.85  ?  710 LEU A CG     1 
ATOM 9966  C CD1    . LEU A 1 649 ? -3.710  3.970   4.115   1.00 69.68  ?  710 LEU A CD1    1 
ATOM 9967  C CD2    . LEU A 1 649 ? -5.435  3.215   5.740   1.00 73.74  ?  710 LEU A CD2    1 
ATOM 9968  H H      . LEU A 1 649 ? -3.821  -0.026  3.886   1.00 64.90  ?  710 LEU A H      1 
ATOM 9969  H HA     . LEU A 1 649 ? -6.116  0.694   4.820   1.00 54.82  ?  710 LEU A HA     1 
ATOM 9970  H HB2    . LEU A 1 649 ? -4.497  1.869   2.852   1.00 64.50  ?  710 LEU A HB2    1 
ATOM 9971  H HB3    . LEU A 1 649 ? -5.876  2.535   3.253   1.00 64.50  ?  710 LEU A HB3    1 
ATOM 9972  H HG     . LEU A 1 649 ? -3.785  2.193   5.111   1.00 86.22  ?  710 LEU A HG     1 
ATOM 9973  H HD11   . LEU A 1 649 ? -3.275  4.447   4.840   1.00 83.61  ?  710 LEU A HD11   1 
ATOM 9974  H HD12   . LEU A 1 649 ? -3.048  3.664   3.476   1.00 83.61  ?  710 LEU A HD12   1 
ATOM 9975  H HD13   . LEU A 1 649 ? -4.352  4.550   3.676   1.00 83.61  ?  710 LEU A HD13   1 
ATOM 9976  H HD21   . LEU A 1 649 ? -4.963  3.706   6.431   1.00 88.49  ?  710 LEU A HD21   1 
ATOM 9977  H HD22   . LEU A 1 649 ? -6.100  3.786   5.324   1.00 88.49  ?  710 LEU A HD22   1 
ATOM 9978  H HD23   . LEU A 1 649 ? -5.862  2.433   6.122   1.00 88.49  ?  710 LEU A HD23   1 
ATOM 9979  N N      . CYS A 1 650 ? -6.328  -0.430  1.837   1.00 38.17  ?  711 CYS A N      1 
ATOM 9980  C CA     . CYS A 1 650 ? -7.290  -0.896  0.845   1.00 38.08  ?  711 CYS A CA     1 
ATOM 9981  C C      . CYS A 1 650 ? -8.178  -1.989  1.422   1.00 52.22  ?  711 CYS A C      1 
ATOM 9982  O O      . CYS A 1 650 ? -9.403  -1.967  1.252   1.00 55.15  ?  711 CYS A O      1 
ATOM 9983  C CB     . CYS A 1 650 ? -6.559  -1.398  -0.397  1.00 54.30  ?  711 CYS A CB     1 
ATOM 9984  S SG     . CYS A 1 650 ? -5.618  -0.122  -1.260  1.00 63.24  ?  711 CYS A SG     1 
ATOM 9985  H H      . CYS A 1 650 ? -5.505  -0.573  1.634   1.00 45.80  ?  711 CYS A H      1 
ATOM 9986  H HA     . CYS A 1 650 ? -7.858  -0.155  0.581   1.00 45.69  ?  711 CYS A HA     1 
ATOM 9987  H HB2    . CYS A 1 650 ? -5.938  -2.096  -0.133  1.00 65.15  ?  711 CYS A HB2    1 
ATOM 9988  H HB3    . CYS A 1 650 ? -7.211  -1.757  -1.019  1.00 65.15  ?  711 CYS A HB3    1 
ATOM 9989  H HG     . CYS A 1 650 ? -4.792  0.327   -0.514  1.00 75.88  ?  711 CYS A HG     1 
ATOM 9990  N N      . LYS A 1 651 ? -7.575  -2.960  2.109   1.00 52.23  ?  712 LYS A N      1 
ATOM 9991  C CA     . LYS A 1 651 ? -8.361  -4.028  2.716   1.00 51.83  ?  712 LYS A CA     1 
ATOM 9992  C C      . LYS A 1 651 ? -9.405  -3.462  3.667   1.00 54.22  ?  712 LYS A C      1 
ATOM 9993  O O      . LYS A 1 651 ? -10.557 -3.911  3.679   1.00 46.98  ?  712 LYS A O      1 
ATOM 9994  C CB     . LYS A 1 651 ? -7.443  -5.001  3.452   1.00 57.21  ?  712 LYS A CB     1 
ATOM 9995  C CG     . LYS A 1 651 ? -6.387  -5.653  2.577   1.00 48.77  ?  712 LYS A CG     1 
ATOM 9996  C CD     . LYS A 1 651 ? -5.292  -6.297  3.415   1.00 52.31  ?  712 LYS A CD     1 
ATOM 9997  C CE     . LYS A 1 651 ? -5.817  -7.468  4.224   1.00 59.68  ?  712 LYS A CE     1 
ATOM 9998  N NZ     . LYS A 1 651 ? -4.810  -7.962  5.196   1.00 49.78  1  712 LYS A NZ     1 
ATOM 9999  H H      . LYS A 1 651 ? -6.727  -3.021  2.237   1.00 62.67  ?  712 LYS A H      1 
ATOM 10000 H HA     . LYS A 1 651 ? -8.823  -4.518  2.018   1.00 62.20  ?  712 LYS A HA     1 
ATOM 10001 H HB2    . LYS A 1 651 ? -6.984  -4.521  4.159   1.00 68.65  ?  712 LYS A HB2    1 
ATOM 10002 H HB3    . LYS A 1 651 ? -7.984  -5.708  3.836   1.00 68.65  ?  712 LYS A HB3    1 
ATOM 10003 H HG2    . LYS A 1 651 ? -6.801  -6.343  2.035   1.00 58.53  ?  712 LYS A HG2    1 
ATOM 10004 H HG3    . LYS A 1 651 ? -5.980  -4.979  2.010   1.00 58.53  ?  712 LYS A HG3    1 
ATOM 10005 H HD2    . LYS A 1 651 ? -4.592  -6.623  2.829   1.00 62.78  ?  712 LYS A HD2    1 
ATOM 10006 H HD3    . LYS A 1 651 ? -4.934  -5.639  4.031   1.00 62.78  ?  712 LYS A HD3    1 
ATOM 10007 H HE2    . LYS A 1 651 ? -6.603  -7.187  4.719   1.00 71.61  ?  712 LYS A HE2    1 
ATOM 10008 H HE3    . LYS A 1 651 ? -6.041  -8.196  3.624   1.00 71.61  ?  712 LYS A HE3    1 
ATOM 10009 H HZ1    . LYS A 1 651 ? -4.078  -8.231  4.766   1.00 59.74  ?  712 LYS A HZ1    1 
ATOM 10010 H HZ2    . LYS A 1 651 ? -4.590  -7.312  5.763   1.00 59.74  ?  712 LYS A HZ2    1 
ATOM 10011 H HZ3    . LYS A 1 651 ? -5.143  -8.647  5.656   1.00 59.74  ?  712 LYS A HZ3    1 
ATOM 10012 N N      . LEU A 1 652 ? -9.022  -2.469  4.469   1.00 57.97  ?  713 LEU A N      1 
ATOM 10013 C CA     . LEU A 1 652 ? -9.954  -1.891  5.430   1.00 48.60  ?  713 LEU A CA     1 
ATOM 10014 C C      . LEU A 1 652 ? -11.080 -1.151  4.719   1.00 56.64  ?  713 LEU A C      1 
ATOM 10015 O O      . LEU A 1 652 ? -12.261 -1.372  5.010   1.00 68.48  ?  713 LEU A O      1 
ATOM 10016 C CB     . LEU A 1 652 ? -9.203  -0.963  6.383   1.00 49.00  ?  713 LEU A CB     1 
ATOM 10017 C CG     . LEU A 1 652 ? -7.979  -1.573  7.071   1.00 40.96  ?  713 LEU A CG     1 
ATOM 10018 C CD1    . LEU A 1 652 ? -7.480  -0.657  8.173   1.00 52.60  ?  713 LEU A CD1    1 
ATOM 10019 C CD2    . LEU A 1 652 ? -8.275  -2.957  7.625   1.00 52.86  ?  713 LEU A CD2    1 
ATOM 10020 H H      . LEU A 1 652 ? -8.238  -2.117  4.476   1.00 69.56  ?  713 LEU A H      1 
ATOM 10021 H HA     . LEU A 1 652 ? -10.349 -2.605  5.955   1.00 58.32  ?  713 LEU A HA     1 
ATOM 10022 H HB2    . LEU A 1 652 ? -8.900  -0.190  5.882   1.00 58.80  ?  713 LEU A HB2    1 
ATOM 10023 H HB3    . LEU A 1 652 ? -9.816  -0.677  7.079   1.00 58.80  ?  713 LEU A HB3    1 
ATOM 10024 H HG     . LEU A 1 652 ? -7.268  -1.663  6.417   1.00 49.15  ?  713 LEU A HG     1 
ATOM 10025 H HD11   . LEU A 1 652 ? -6.706  -1.063  8.594   1.00 63.12  ?  713 LEU A HD11   1 
ATOM 10026 H HD12   . LEU A 1 652 ? -7.237  0.199   7.787   1.00 63.12  ?  713 LEU A HD12   1 
ATOM 10027 H HD13   . LEU A 1 652 ? -8.187  -0.536  8.827   1.00 63.12  ?  713 LEU A HD13   1 
ATOM 10028 H HD21   . LEU A 1 652 ? -7.475  -3.304  8.050   1.00 63.44  ?  713 LEU A HD21   1 
ATOM 10029 H HD22   . LEU A 1 652 ? -8.993  -2.889  8.274   1.00 63.44  ?  713 LEU A HD22   1 
ATOM 10030 H HD23   . LEU A 1 652 ? -8.541  -3.538  6.896   1.00 63.44  ?  713 LEU A HD23   1 
ATOM 10031 N N      . PHE A 1 653 ? -10.735 -0.274  3.775   1.00 48.30  ?  714 PHE A N      1 
ATOM 10032 C CA     . PHE A 1 653 ? -11.766 0.406   3.000   1.00 63.27  ?  714 PHE A CA     1 
ATOM 10033 C C      . PHE A 1 653 ? -12.661 -0.589  2.279   1.00 61.70  ?  714 PHE A C      1 
ATOM 10034 O O      . PHE A 1 653 ? -13.855 -0.329  2.093   1.00 65.50  ?  714 PHE A O      1 
ATOM 10035 C CB     . PHE A 1 653 ? -11.126 1.367   1.999   1.00 58.10  ?  714 PHE A CB     1 
ATOM 10036 C CG     . PHE A 1 653 ? -10.839 2.726   2.565   1.00 59.68  ?  714 PHE A CG     1 
ATOM 10037 C CD1    . PHE A 1 653 ? -11.840 3.677   2.648   1.00 58.80  ?  714 PHE A CD1    1 
ATOM 10038 C CD2    . PHE A 1 653 ? -9.570  3.055   3.009   1.00 56.49  ?  714 PHE A CD2    1 
ATOM 10039 C CE1    . PHE A 1 653 ? -11.583 4.928   3.167   1.00 65.20  ?  714 PHE A CE1    1 
ATOM 10040 C CE2    . PHE A 1 653 ? -9.308  4.305   3.529   1.00 49.42  ?  714 PHE A CE2    1 
ATOM 10041 C CZ     . PHE A 1 653 ? -10.316 5.242   3.608   1.00 60.47  ?  714 PHE A CZ     1 
ATOM 10042 H H      . PHE A 1 653 ? -9.928  -0.060  3.568   1.00 57.97  ?  714 PHE A H      1 
ATOM 10043 H HA     . PHE A 1 653 ? -12.321 0.926   3.602   1.00 75.93  ?  714 PHE A HA     1 
ATOM 10044 H HB2    . PHE A 1 653 ? -10.287 0.989   1.695   1.00 69.72  ?  714 PHE A HB2    1 
ATOM 10045 H HB3    . PHE A 1 653 ? -11.728 1.481   1.246   1.00 69.72  ?  714 PHE A HB3    1 
ATOM 10046 H HD1    . PHE A 1 653 ? -12.697 3.470   2.352   1.00 70.56  ?  714 PHE A HD1    1 
ATOM 10047 H HD2    . PHE A 1 653 ? -8.887  2.426   2.959   1.00 67.78  ?  714 PHE A HD2    1 
ATOM 10048 H HE1    . PHE A 1 653 ? -12.264 5.559   3.219   1.00 78.24  ?  714 PHE A HE1    1 
ATOM 10049 H HE2    . PHE A 1 653 ? -8.453  4.516   3.826   1.00 59.31  ?  714 PHE A HE2    1 
ATOM 10050 H HZ     . PHE A 1 653 ? -10.141 6.086   3.957   1.00 72.57  ?  714 PHE A HZ     1 
ATOM 10051 N N      . LEU A 1 654 ? -12.109 -1.734  1.873   1.00 64.68  ?  715 LEU A N      1 
ATOM 10052 C CA     . LEU A 1 654 ? -12.915 -2.751  1.206   1.00 57.55  ?  715 LEU A CA     1 
ATOM 10053 C C      . LEU A 1 654 ? -13.990 -3.290  2.140   1.00 61.42  ?  715 LEU A C      1 
ATOM 10054 O O      . LEU A 1 654 ? -15.168 -3.365  1.773   1.00 61.97  ?  715 LEU A O      1 
ATOM 10055 C CB     . LEU A 1 654 ? -12.021 -3.887  0.713   1.00 49.63  ?  715 LEU A CB     1 
ATOM 10056 C CG     . LEU A 1 654 ? -11.791 -4.040  -0.794  1.00 40.98  ?  715 LEU A CG     1 
ATOM 10057 C CD1    . LEU A 1 654 ? -13.106 -4.142  -1.560  1.00 58.91  ?  715 LEU A CD1    1 
ATOM 10058 C CD2    . LEU A 1 654 ? -10.942 -2.908  -1.330  1.00 36.04  ?  715 LEU A CD2    1 
ATOM 10059 H H      . LEU A 1 654 ? -11.280 -1.942  1.971   1.00 77.61  ?  715 LEU A H      1 
ATOM 10060 H HA     . LEU A 1 654 ? -13.354 -2.355  0.437   1.00 69.06  ?  715 LEU A HA     1 
ATOM 10061 H HB2    . LEU A 1 654 ? -11.147 -3.774  1.119   1.00 59.55  ?  715 LEU A HB2    1 
ATOM 10062 H HB3    . LEU A 1 654 ? -12.406 -4.722  1.023   1.00 59.55  ?  715 LEU A HB3    1 
ATOM 10063 H HG     . LEU A 1 654 ? -11.303 -4.864  -0.946  1.00 49.17  ?  715 LEU A HG     1 
ATOM 10064 H HD11   . LEU A 1 654 ? -12.913 -4.238  -2.506  1.00 70.69  ?  715 LEU A HD11   1 
ATOM 10065 H HD12   . LEU A 1 654 ? -13.596 -4.917  -1.243  1.00 70.69  ?  715 LEU A HD12   1 
ATOM 10066 H HD13   . LEU A 1 654 ? -13.624 -3.337  -1.407  1.00 70.69  ?  715 LEU A HD13   1 
ATOM 10067 H HD21   . LEU A 1 654 ? -10.815 -3.033  -2.284  1.00 43.25  ?  715 LEU A HD21   1 
ATOM 10068 H HD22   . LEU A 1 654 ? -11.396 -2.067  -1.165  1.00 43.25  ?  715 LEU A HD22   1 
ATOM 10069 H HD23   . LEU A 1 654 ? -10.084 -2.915  -0.878  1.00 43.25  ?  715 LEU A HD23   1 
ATOM 10070 N N      . ALA A 1 655 ? -13.601 -3.674  3.355   1.00 54.61  ?  716 ALA A N      1 
ATOM 10071 C CA     . ALA A 1 655 ? -14.549 -4.192  4.331   1.00 55.54  ?  716 ALA A CA     1 
ATOM 10072 C C      . ALA A 1 655 ? -15.454 -3.115  4.907   1.00 71.82  ?  716 ALA A C      1 
ATOM 10073 O O      . ALA A 1 655 ? -16.295 -3.430  5.756   1.00 75.42  ?  716 ALA A O      1 
ATOM 10074 C CB     . ALA A 1 655 ? -13.799 -4.889  5.466   1.00 65.36  ?  716 ALA A CB     1 
ATOM 10075 H H      . ALA A 1 655 ? -12.789 -3.643  3.637   1.00 65.54  ?  716 ALA A H      1 
ATOM 10076 H HA     . ALA A 1 655 ? -15.113 -4.852  3.899   1.00 66.64  ?  716 ALA A HA     1 
ATOM 10077 H HB1    . ALA A 1 655 ? -14.443 -5.229  6.107   1.00 78.43  ?  716 ALA A HB1    1 
ATOM 10078 H HB2    . ALA A 1 655 ? -13.281 -5.622  5.098   1.00 78.43  ?  716 ALA A HB2    1 
ATOM 10079 H HB3    . ALA A 1 655 ? -13.210 -4.249  5.895   1.00 78.43  ?  716 ALA A HB3    1 
ATOM 10080 N N      . ASP A 1 656 ? -15.301 -1.863  4.477   1.00 78.15  ?  717 ASP A N      1 
ATOM 10081 C CA     . ASP A 1 656 ? -16.107 -0.742  4.948   1.00 66.51  ?  717 ASP A CA     1 
ATOM 10082 C C      . ASP A 1 656 ? -15.878 -0.435  6.422   1.00 58.70  ?  717 ASP A C      1 
ATOM 10083 O O      . ASP A 1 656 ? -16.735 0.177   7.067   1.00 57.41  ?  717 ASP A O      1 
ATOM 10084 C CB     . ASP A 1 656 ? -17.599 -0.982  4.691   1.00 61.57  ?  717 ASP A CB     1 
ATOM 10085 C CG     . ASP A 1 656 ? -17.921 -1.126  3.217   1.00 68.15  ?  717 ASP A CG     1 
ATOM 10086 O OD1    . ASP A 1 656 ? -18.144 -0.093  2.555   1.00 67.38  ?  717 ASP A OD1    1 
ATOM 10087 O OD2    . ASP A 1 656 ? -17.953 -2.271  2.720   1.00 70.69  -1 717 ASP A OD2    1 
ATOM 10088 H H      . ASP A 1 656 ? -14.715 -1.633  3.892   1.00 93.78  ?  717 ASP A H      1 
ATOM 10089 H HA     . ASP A 1 656 ? -15.851 0.047   4.446   1.00 79.81  ?  717 ASP A HA     1 
ATOM 10090 H HB2    . ASP A 1 656 ? -17.870 -1.798  5.139   1.00 73.88  ?  717 ASP A HB2    1 
ATOM 10091 H HB3    . ASP A 1 656 ? -18.105 -0.229  5.037   1.00 73.88  ?  717 ASP A HB3    1 
ATOM 10092 N N      . VAL A 1 657 ? -14.740 -0.852  6.980   1.00 55.45  ?  718 VAL A N      1 
ATOM 10093 C CA     . VAL A 1 657 ? -14.374 -0.411  8.321   1.00 56.28  ?  718 VAL A CA     1 
ATOM 10094 C C      . VAL A 1 657 ? -13.771 0.987   8.294   1.00 67.48  ?  718 VAL A C      1 
ATOM 10095 O O      . VAL A 1 657 ? -13.795 1.685   9.314   1.00 88.92  ?  718 VAL A O      1 
ATOM 10096 C CB     . VAL A 1 657 ? -13.403 -1.403  8.985   1.00 72.37  ?  718 VAL A CB     1 
ATOM 10097 C CG1    . VAL A 1 657 ? -14.036 -2.781  9.083   1.00 60.81  ?  718 VAL A CG1    1 
ATOM 10098 C CG2    . VAL A 1 657 ? -12.092 -1.476  8.223   1.00 68.61  ?  718 VAL A CG2    1 
ATOM 10099 H H      . VAL A 1 657 ? -14.173 -1.381  6.609   1.00 66.54  ?  718 VAL A H      1 
ATOM 10100 H HA     . VAL A 1 657 ? -15.176 -0.375  8.866   1.00 67.53  ?  718 VAL A HA     1 
ATOM 10101 H HB     . VAL A 1 657 ? -13.209 -1.099  9.885   1.00 86.85  ?  718 VAL A HB     1 
ATOM 10102 H HG11   . VAL A 1 657 ? -13.408 -3.388  9.503   1.00 72.97  ?  718 VAL A HG11   1 
ATOM 10103 H HG12   . VAL A 1 657 ? -14.844 -2.719  9.616   1.00 72.97  ?  718 VAL A HG12   1 
ATOM 10104 H HG13   . VAL A 1 657 ? -14.251 -3.093  8.190   1.00 72.97  ?  718 VAL A HG13   1 
ATOM 10105 H HG21   . VAL A 1 657 ? -11.504 -2.108  8.666   1.00 82.33  ?  718 VAL A HG21   1 
ATOM 10106 H HG22   . VAL A 1 657 ? -12.270 -1.770  7.316   1.00 82.33  ?  718 VAL A HG22   1 
ATOM 10107 H HG23   . VAL A 1 657 ? -11.684 -0.596  8.212   1.00 82.33  ?  718 VAL A HG23   1 
ATOM 10108 N N      . PHE A 1 658 ? -13.226 1.408   7.155   1.00 59.86  ?  719 PHE A N      1 
ATOM 10109 C CA     . PHE A 1 658 ? -12.754 2.770   6.946   1.00 61.17  ?  719 PHE A CA     1 
ATOM 10110 C C      . PHE A 1 658 ? -13.615 3.448   5.890   1.00 63.61  ?  719 PHE A C      1 
ATOM 10111 O O      . PHE A 1 658 ? -13.935 2.848   4.859   1.00 54.20  ?  719 PHE A O      1 
ATOM 10112 C CB     . PHE A 1 658 ? -11.291 2.793   6.497   1.00 58.90  ?  719 PHE A CB     1 
ATOM 10113 C CG     . PHE A 1 658 ? -10.299 2.645   7.618   1.00 60.32  ?  719 PHE A CG     1 
ATOM 10114 C CD1    . PHE A 1 658 ? -9.000  3.102   7.464   1.00 62.62  ?  719 PHE A CD1    1 
ATOM 10115 C CD2    . PHE A 1 658 ? -10.651 2.045   8.814   1.00 61.88  ?  719 PHE A CD2    1 
ATOM 10116 C CE1    . PHE A 1 658 ? -8.079  2.972   8.481   1.00 54.12  ?  719 PHE A CE1    1 
ATOM 10117 C CE2    . PHE A 1 658 ? -9.731  1.913   9.834   1.00 62.25  ?  719 PHE A CE2    1 
ATOM 10118 C CZ     . PHE A 1 658 ? -8.444  2.376   9.666   1.00 50.80  ?  719 PHE A CZ     1 
ATOM 10119 H H      . PHE A 1 658 ? -13.116 0.904   6.467   1.00 71.84  ?  719 PHE A H      1 
ATOM 10120 H HA     . PHE A 1 658 ? -12.831 3.270   7.774   1.00 73.40  ?  719 PHE A HA     1 
ATOM 10121 H HB2    . PHE A 1 658 ? -11.145 2.063   5.875   1.00 70.68  ?  719 PHE A HB2    1 
ATOM 10122 H HB3    . PHE A 1 658 ? -11.114 3.639   6.056   1.00 70.68  ?  719 PHE A HB3    1 
ATOM 10123 H HD1    . PHE A 1 658 ? -8.748  3.506   6.665   1.00 75.14  ?  719 PHE A HD1    1 
ATOM 10124 H HD2    . PHE A 1 658 ? -11.519 1.731   8.933   1.00 74.26  ?  719 PHE A HD2    1 
ATOM 10125 H HE1    . PHE A 1 658 ? -7.210  3.285   8.366   1.00 64.95  ?  719 PHE A HE1    1 
ATOM 10126 H HE2    . PHE A 1 658 ? -9.979  1.510   10.635  1.00 74.70  ?  719 PHE A HE2    1 
ATOM 10127 H HZ     . PHE A 1 658 ? -7.823  2.287   10.353  1.00 60.96  ?  719 PHE A HZ     1 
ATOM 10128 N N      . THR A 1 659 ? -13.983 4.710   6.145   1.00 71.50  ?  720 THR A N      1 
ATOM 10129 C CA     . THR A 1 659 ? -14.824 5.450   5.210   1.00 61.41  ?  720 THR A CA     1 
ATOM 10130 C C      . THR A 1 659 ? -14.514 6.942   5.226   1.00 51.69  ?  720 THR A C      1 
ATOM 10131 O O      . THR A 1 659 ? -15.404 7.760   4.966   1.00 63.43  ?  720 THR A O      1 
ATOM 10132 C CB     . THR A 1 659 ? -16.309 5.229   5.525   1.00 67.79  ?  720 THR A CB     1 
ATOM 10133 O OG1    . THR A 1 659 ? -16.500 5.188   6.945   1.00 79.10  ?  720 THR A OG1    1 
ATOM 10134 C CG2    . THR A 1 659 ? -16.804 3.931   4.907   1.00 67.18  ?  720 THR A CG2    1 
ATOM 10135 H H      . THR A 1 659 ? -13.758 5.152   6.848   1.00 85.80  ?  720 THR A H      1 
ATOM 10136 H HA     . THR A 1 659 ? -14.658 5.122   4.313   1.00 73.69  ?  720 THR A HA     1 
ATOM 10137 H HB     . THR A 1 659 ? -16.827 5.960   5.153   1.00 81.34  ?  720 THR A HB     1 
ATOM 10138 H HG1    . THR A 1 659 ? -17.312 5.067   7.122   1.00 94.92  ?  720 THR A HG1    1 
ATOM 10139 H HG21   . THR A 1 659 ? -17.744 3.803   5.113   1.00 80.62  ?  720 THR A HG21   1 
ATOM 10140 H HG22   . THR A 1 659 ? -16.694 3.960   3.943   1.00 80.62  ?  720 THR A HG22   1 
ATOM 10141 H HG23   . THR A 1 659 ? -16.299 3.182   5.260   1.00 80.62  ?  720 THR A HG23   1 
ATOM 10142 N N      . ASP A 1 660 ? -13.273 7.315   5.519   1.00 47.73  ?  721 ASP A N      1 
ATOM 10143 C CA     . ASP A 1 660 ? -12.880 8.717   5.572   1.00 58.23  ?  721 ASP A CA     1 
ATOM 10144 C C      . ASP A 1 660 ? -12.339 9.141   4.212   1.00 57.13  ?  721 ASP A C      1 
ATOM 10145 O O      . ASP A 1 660 ? -11.347 8.584   3.731   1.00 51.40  ?  721 ASP A O      1 
ATOM 10146 C CB     . ASP A 1 660 ? -11.834 8.942   6.662   1.00 64.18  ?  721 ASP A CB     1 
ATOM 10147 C CG     . ASP A 1 660 ? -11.695 10.402  7.038   1.00 84.75  ?  721 ASP A CG     1 
ATOM 10148 O OD1    . ASP A 1 660 ? -12.665 11.164  6.841   1.00 66.84  ?  721 ASP A OD1    1 
ATOM 10149 O OD2    . ASP A 1 660 ? -10.618 10.787  7.536   1.00 87.75  -1 721 ASP A OD2    1 
ATOM 10150 H H      . ASP A 1 660 ? -12.632 6.768   5.693   1.00 57.28  ?  721 ASP A H      1 
ATOM 10151 H HA     . ASP A 1 660 ? -13.656 9.261   5.776   1.00 69.88  ?  721 ASP A HA     1 
ATOM 10152 H HB2    . ASP A 1 660 ? -12.094 8.450   7.456   1.00 77.01  ?  721 ASP A HB2    1 
ATOM 10153 H HB3    . ASP A 1 660 ? -10.973 8.630   6.343   1.00 77.01  ?  721 ASP A HB3    1 
ATOM 10154 N N      . ASP A 1 661 ? -12.987 10.134  3.602   1.00 64.22  ?  722 ASP A N      1 
ATOM 10155 C CA     . ASP A 1 661 ? -12.604 10.561  2.260   1.00 54.28  ?  722 ASP A CA     1 
ATOM 10156 C C      . ASP A 1 661 ? -11.236 11.231  2.261   1.00 51.77  ?  722 ASP A C      1 
ATOM 10157 O O      . ASP A 1 661 ? -10.361 10.876  1.464   1.00 57.63  ?  722 ASP A O      1 
ATOM 10158 C CB     . ASP A 1 661 ? -13.663 11.503  1.696   1.00 43.31  ?  722 ASP A CB     1 
ATOM 10159 C CG     . ASP A 1 661 ? -14.977 10.806  1.439   1.00 63.73  ?  722 ASP A CG     1 
ATOM 10160 O OD1    . ASP A 1 661 ? -14.979 9.563   1.336   1.00 80.95  ?  722 ASP A OD1    1 
ATOM 10161 O OD2    . ASP A 1 661 ? -16.011 11.497  1.335   1.00 80.33  -1 722 ASP A OD2    1 
ATOM 10162 H H      . ASP A 1 661 ? -13.645 10.572  3.940   1.00 77.06  ?  722 ASP A H      1 
ATOM 10163 H HA     . ASP A 1 661 ? -12.556 9.783   1.683   1.00 65.13  ?  722 ASP A HA     1 
ATOM 10164 H HB2    . ASP A 1 661 ? -13.822 12.219  2.331   1.00 51.97  ?  722 ASP A HB2    1 
ATOM 10165 H HB3    . ASP A 1 661 ? -13.347 11.869  0.855   1.00 51.97  ?  722 ASP A HB3    1 
ATOM 10166 N N      . ASP A 1 662 ? -11.035 12.208  3.147   1.00 52.88  ?  723 ASP A N      1 
ATOM 10167 C CA     . ASP A 1 662 ? -9.758  12.913  3.191   1.00 64.84  ?  723 ASP A CA     1 
ATOM 10168 C C      . ASP A 1 662 ? -8.591  11.947  3.340   1.00 61.09  ?  723 ASP A C      1 
ATOM 10169 O O      . ASP A 1 662 ? -7.474  12.248  2.905   1.00 69.06  ?  723 ASP A O      1 
ATOM 10170 C CB     . ASP A 1 662 ? -9.761  13.929  4.334   1.00 89.05  ?  723 ASP A CB     1 
ATOM 10171 C CG     . ASP A 1 662 ? -10.577 15.166  4.010   1.00 92.85  ?  723 ASP A CG     1 
ATOM 10172 O OD1    . ASP A 1 662 ? -9.977  16.186  3.610   1.00 83.59  ?  723 ASP A OD1    1 
ATOM 10173 O OD2    . ASP A 1 662 ? -11.817 15.119  4.149   1.00 82.85  -1 723 ASP A OD2    1 
ATOM 10174 H H      . ASP A 1 662 ? -11.613 12.478  3.723   1.00 63.45  ?  723 ASP A H      1 
ATOM 10175 H HA     . ASP A 1 662 ? -9.638  13.399  2.360   1.00 77.80  ?  723 ASP A HA     1 
ATOM 10176 H HB2    . ASP A 1 662 ? -10.143 13.515  5.124   1.00 106.86 ?  723 ASP A HB2    1 
ATOM 10177 H HB3    . ASP A 1 662 ? -8.849  14.208  4.512   1.00 106.86 ?  723 ASP A HB3    1 
ATOM 10178 N N      . LEU A 1 663 ? -8.826  10.786  3.954   1.00 71.30  ?  724 LEU A N      1 
ATOM 10179 C CA     . LEU A 1 663 ? -7.817  9.734   3.963   1.00 64.88  ?  724 LEU A CA     1 
ATOM 10180 C C      . LEU A 1 663 ? -7.822  8.961   2.653   1.00 43.94  ?  724 LEU A C      1 
ATOM 10181 O O      . LEU A 1 663 ? -6.759  8.688   2.085   1.00 41.37  ?  724 LEU A O      1 
ATOM 10182 C CB     . LEU A 1 663 ? -8.053  8.787   5.139   1.00 45.81  ?  724 LEU A CB     1 
ATOM 10183 C CG     . LEU A 1 663 ? -7.214  7.507   5.158   1.00 43.65  ?  724 LEU A CG     1 
ATOM 10184 C CD1    . LEU A 1 663 ? -5.731  7.810   5.039   1.00 50.97  ?  724 LEU A CD1    1 
ATOM 10185 C CD2    . LEU A 1 663 ? -7.492  6.727   6.428   1.00 78.67  ?  724 LEU A CD2    1 
ATOM 10186 H H      . LEU A 1 663 ? -9.553  10.587  4.368   1.00 85.56  ?  724 LEU A H      1 
ATOM 10187 H HA     . LEU A 1 663 ? -6.941  10.136  4.072   1.00 77.86  ?  724 LEU A HA     1 
ATOM 10188 H HB2    . LEU A 1 663 ? -7.862  9.268   5.960   1.00 54.97  ?  724 LEU A HB2    1 
ATOM 10189 H HB3    . LEU A 1 663 ? -8.985  8.520   5.132   1.00 54.97  ?  724 LEU A HB3    1 
ATOM 10190 H HG     . LEU A 1 663 ? -7.468  6.952   4.403   1.00 52.37  ?  724 LEU A HG     1 
ATOM 10191 H HD11   . LEU A 1 663 ? -5.236  6.975   5.055   1.00 61.16  ?  724 LEU A HD11   1 
ATOM 10192 H HD12   . LEU A 1 663 ? -5.570  8.274   4.203   1.00 61.16  ?  724 LEU A HD12   1 
ATOM 10193 H HD13   . LEU A 1 663 ? -5.462  8.368   5.785   1.00 61.16  ?  724 LEU A HD13   1 
ATOM 10194 H HD21   . LEU A 1 663 ? -6.955  5.919   6.426   1.00 94.40  ?  724 LEU A HD21   1 
ATOM 10195 H HD22   . LEU A 1 663 ? -7.261  7.277   7.193   1.00 94.40  ?  724 LEU A HD22   1 
ATOM 10196 H HD23   . LEU A 1 663 ? -8.434  6.497   6.457   1.00 94.40  ?  724 LEU A HD23   1 
ATOM 10197 N N      . PHE A 1 664 ? -9.008  8.607   2.156   1.00 45.94  ?  725 PHE A N      1 
ATOM 10198 C CA     . PHE A 1 664 ? -9.092  7.917   0.875   1.00 51.89  ?  725 PHE A CA     1 
ATOM 10199 C C      . PHE A 1 664 ? -8.509  8.763   -0.245  1.00 55.25  ?  725 PHE A C      1 
ATOM 10200 O O      . PHE A 1 664 ? -7.931  8.222   -1.195  1.00 45.68  ?  725 PHE A O      1 
ATOM 10201 C CB     . PHE A 1 664 ? -10.544 7.557   0.572   1.00 52.80  ?  725 PHE A CB     1 
ATOM 10202 C CG     . PHE A 1 664 ? -10.728 6.835   -0.726  1.00 46.94  ?  725 PHE A CG     1 
ATOM 10203 C CD1    . PHE A 1 664 ? -10.371 5.504   -0.848  1.00 63.36  ?  725 PHE A CD1    1 
ATOM 10204 C CD2    . PHE A 1 664 ? -11.265 7.483   -1.822  1.00 40.84  ?  725 PHE A CD2    1 
ATOM 10205 C CE1    . PHE A 1 664 ? -10.542 4.837   -2.041  1.00 61.98  ?  725 PHE A CE1    1 
ATOM 10206 C CE2    . PHE A 1 664 ? -11.438 6.820   -3.017  1.00 46.30  ?  725 PHE A CE2    1 
ATOM 10207 C CZ     . PHE A 1 664 ? -11.076 5.495   -3.126  1.00 47.97  ?  725 PHE A CZ     1 
ATOM 10208 H H      . PHE A 1 664 ? -9.766  8.752   2.536   1.00 55.13  ?  725 PHE A H      1 
ATOM 10209 H HA     . PHE A 1 664 ? -8.582  7.093   0.926   1.00 62.27  ?  725 PHE A HA     1 
ATOM 10210 H HB2    . PHE A 1 664 ? -10.879 6.984   1.280   1.00 63.36  ?  725 PHE A HB2    1 
ATOM 10211 H HB3    . PHE A 1 664 ? -11.067 8.373   0.535   1.00 63.36  ?  725 PHE A HB3    1 
ATOM 10212 H HD1    . PHE A 1 664 ? -10.010 5.056   -0.118  1.00 76.03  ?  725 PHE A HD1    1 
ATOM 10213 H HD2    . PHE A 1 664 ? -11.511 8.377   -1.753  1.00 49.00  ?  725 PHE A HD2    1 
ATOM 10214 H HE1    . PHE A 1 664 ? -10.297 3.942   -2.113  1.00 74.37  ?  725 PHE A HE1    1 
ATOM 10215 H HE2    . PHE A 1 664 ? -11.798 7.265   -3.749  1.00 55.56  ?  725 PHE A HE2    1 
ATOM 10216 H HZ     . PHE A 1 664 ? -11.192 5.045   -3.932  1.00 57.56  ?  725 PHE A HZ     1 
ATOM 10217 N N      . GLU A 1 665 ? -8.644  10.086  -0.152  1.00 64.62  ?  726 GLU A N      1 
ATOM 10218 C CA     . GLU A 1 665 ? -8.040  10.964  -1.146  1.00 56.97  ?  726 GLU A CA     1 
ATOM 10219 C C      . GLU A 1 665 ? -6.521  10.869  -1.097  1.00 49.31  ?  726 GLU A C      1 
ATOM 10220 O O      . GLU A 1 665 ? -5.868  10.671  -2.126  1.00 40.88  ?  726 GLU A O      1 
ATOM 10221 C CB     . GLU A 1 665 ? -8.503  12.403  -0.917  1.00 73.71  ?  726 GLU A CB     1 
ATOM 10222 C CG     . GLU A 1 665 ? -8.123  13.370  -2.025  1.00 72.19  ?  726 GLU A CG     1 
ATOM 10223 C CD     . GLU A 1 665 ? -8.604  14.780  -1.749  1.00 68.90  ?  726 GLU A CD     1 
ATOM 10224 O OE1    . GLU A 1 665 ? -9.511  14.944  -0.907  1.00 66.31  ?  726 GLU A OE1    1 
ATOM 10225 O OE2    . GLU A 1 665 ? -8.074  15.724  -2.369  1.00 64.25  -1 726 GLU A OE2    1 
ATOM 10226 H H      . GLU A 1 665 ? -9.075  10.493  0.471   1.00 77.54  ?  726 GLU A H      1 
ATOM 10227 H HA     . GLU A 1 665 ? -8.331  10.691  -2.030  1.00 68.36  ?  726 GLU A HA     1 
ATOM 10228 H HB2    . GLU A 1 665 ? -9.470  12.410  -0.839  1.00 88.45  ?  726 GLU A HB2    1 
ATOM 10229 H HB3    . GLU A 1 665 ? -8.107  12.729  -0.094  1.00 88.45  ?  726 GLU A HB3    1 
ATOM 10230 H HG2    . GLU A 1 665 ? -7.157  13.392  -2.110  1.00 86.62  ?  726 GLU A HG2    1 
ATOM 10231 H HG3    . GLU A 1 665 ? -8.524  13.072  -2.857  1.00 86.62  ?  726 GLU A HG3    1 
ATOM 10232 N N      . THR A 1 666 ? -5.941  10.998  0.098   1.00 50.12  ?  727 THR A N      1 
ATOM 10233 C CA     . THR A 1 666 ? -4.501  10.837  0.250   1.00 56.30  ?  727 THR A CA     1 
ATOM 10234 C C      . THR A 1 666 ? -4.033  9.465   -0.209  1.00 48.76  ?  727 THR A C      1 
ATOM 10235 O O      . THR A 1 666 ? -2.864  9.309   -0.576  1.00 46.15  ?  727 THR A O      1 
ATOM 10236 C CB     . THR A 1 666 ? -4.095  11.046  1.709   1.00 64.49  ?  727 THR A CB     1 
ATOM 10237 O OG1    . THR A 1 666 ? -4.705  12.238  2.217   1.00 75.80  ?  727 THR A OG1    1 
ATOM 10238 C CG2    . THR A 1 666 ? -2.582  11.164  1.833   1.00 54.58  ?  727 THR A CG2    1 
ATOM 10239 H H      . THR A 1 666 ? -6.358  11.178  0.829   1.00 60.15  ?  727 THR A H      1 
ATOM 10240 H HA     . THR A 1 666 ? -4.048  11.506  -0.289  1.00 67.56  ?  727 THR A HA     1 
ATOM 10241 H HB     . THR A 1 666 ? -4.386  10.286  2.236   1.00 77.39  ?  727 THR A HB     1 
ATOM 10242 H HG1    . THR A 1 666 ? -5.541  12.175  2.172   1.00 90.96  ?  727 THR A HG1    1 
ATOM 10243 H HG21   . THR A 1 666 ? -2.335  11.296  2.762   1.00 65.49  ?  727 THR A HG21   1 
ATOM 10244 H HG22   . THR A 1 666 ? -2.159  10.354  1.507   1.00 65.49  ?  727 THR A HG22   1 
ATOM 10245 H HG23   . THR A 1 666 ? -2.264  11.918  1.312   1.00 65.49  ?  727 THR A HG23   1 
ATOM 10246 N N      . LEU A 1 667 ? -4.920  8.471   -0.191  1.00 52.77  ?  728 LEU A N      1 
ATOM 10247 C CA     . LEU A 1 667 ? -4.538  7.127   -0.602  1.00 54.94  ?  728 LEU A CA     1 
ATOM 10248 C C      . LEU A 1 667 ? -4.303  7.060   -2.104  1.00 46.79  ?  728 LEU A C      1 
ATOM 10249 O O      . LEU A 1 667 ? -3.331  6.449   -2.561  1.00 40.56  ?  728 LEU A O      1 
ATOM 10250 C CB     . LEU A 1 667 ? -5.624  6.140   -0.173  1.00 49.07  ?  728 LEU A CB     1 
ATOM 10251 C CG     . LEU A 1 667 ? -5.330  4.644   -0.239  1.00 33.05  ?  728 LEU A CG     1 
ATOM 10252 C CD1    . LEU A 1 667 ? -4.056  4.297   0.512   1.00 41.83  ?  728 LEU A CD1    1 
ATOM 10253 C CD2    . LEU A 1 667 ? -6.504  3.867   0.328   1.00 46.13  ?  728 LEU A CD2    1 
ATOM 10254 H H      . LEU A 1 667 ? -5.741  8.550   0.052   1.00 63.32  ?  728 LEU A H      1 
ATOM 10255 H HA     . LEU A 1 667 ? -3.713  6.880   -0.156  1.00 65.92  ?  728 LEU A HA     1 
ATOM 10256 H HB2    . LEU A 1 667 ? -5.855  6.339   0.748   1.00 58.89  ?  728 LEU A HB2    1 
ATOM 10257 H HB3    . LEU A 1 667 ? -6.401  6.296   -0.732  1.00 58.89  ?  728 LEU A HB3    1 
ATOM 10258 H HG     . LEU A 1 667 ? -5.214  4.383   -1.166  1.00 39.66  ?  728 LEU A HG     1 
ATOM 10259 H HD11   . LEU A 1 667 ? -3.903  3.341   0.448   1.00 50.20  ?  728 LEU A HD11   1 
ATOM 10260 H HD12   . LEU A 1 667 ? -3.315  4.779   0.114   1.00 50.20  ?  728 LEU A HD12   1 
ATOM 10261 H HD13   . LEU A 1 667 ? -4.158  4.555   1.441   1.00 50.20  ?  728 LEU A HD13   1 
ATOM 10262 H HD21   . LEU A 1 667 ? -6.307  2.919   0.282   1.00 55.36  ?  728 LEU A HD21   1 
ATOM 10263 H HD22   . LEU A 1 667 ? -6.642  4.132   1.251   1.00 55.36  ?  728 LEU A HD22   1 
ATOM 10264 H HD23   . LEU A 1 667 ? -7.297  4.067   -0.195  1.00 55.36  ?  728 LEU A HD23   1 
ATOM 10265 N N      . VAL A 1 668 ? -5.175  7.696   -2.888  1.00 50.88  ?  729 VAL A N      1 
ATOM 10266 C CA     . VAL A 1 668 ? -5.033  7.666   -4.339  1.00 32.55  ?  729 VAL A CA     1 
ATOM 10267 C C      . VAL A 1 668 ? -3.871  8.539   -4.791  1.00 36.09  ?  729 VAL A C      1 
ATOM 10268 O O      . VAL A 1 668 ? -3.196  8.220   -5.776  1.00 33.83  ?  729 VAL A O      1 
ATOM 10269 C CB     . VAL A 1 668 ? -6.353  8.099   -5.003  1.00 24.08  ?  729 VAL A CB     1 
ATOM 10270 C CG1    . VAL A 1 668 ? -6.230  8.070   -6.514  1.00 29.50  ?  729 VAL A CG1    1 
ATOM 10271 C CG2    . VAL A 1 668 ? -7.490  7.206   -4.554  1.00 19.53  ?  729 VAL A CG2    1 
ATOM 10272 H H      . VAL A 1 668 ? -5.850  8.147   -2.606  1.00 61.06  ?  729 VAL A H      1 
ATOM 10273 H HA     . VAL A 1 668 ? -4.846  6.756   -4.616  1.00 39.06  ?  729 VAL A HA     1 
ATOM 10274 H HB     . VAL A 1 668 ? -6.559  9.008   -4.735  1.00 28.89  ?  729 VAL A HB     1 
ATOM 10275 H HG11   . VAL A 1 668 ? -7.074  8.347   -6.904  1.00 35.40  ?  729 VAL A HG11   1 
ATOM 10276 H HG12   . VAL A 1 668 ? -5.524  8.679   -6.784  1.00 35.40  ?  729 VAL A HG12   1 
ATOM 10277 H HG13   . VAL A 1 668 ? -6.014  7.167   -6.796  1.00 35.40  ?  729 VAL A HG13   1 
ATOM 10278 H HG21   . VAL A 1 668 ? -8.309  7.497   -4.985  1.00 23.44  ?  729 VAL A HG21   1 
ATOM 10279 H HG22   . VAL A 1 668 ? -7.291  6.291   -4.806  1.00 23.44  ?  729 VAL A HG22   1 
ATOM 10280 H HG23   . VAL A 1 668 ? -7.581  7.272   -3.590  1.00 23.44  ?  729 VAL A HG23   1 
ATOM 10281 N N      . LEU A 1 669 ? -3.614  9.649   -4.095  1.00 46.90  ?  730 LEU A N      1 
ATOM 10282 C CA     . LEU A 1 669 ? -2.532  10.540  -4.501  1.00 43.32  ?  730 LEU A CA     1 
ATOM 10283 C C      . LEU A 1 669 ? -1.195  9.813   -4.492  1.00 44.66  ?  730 LEU A C      1 
ATOM 10284 O O      . LEU A 1 669 ? -0.391  9.953   -5.420  1.00 50.17  ?  730 LEU A O      1 
ATOM 10285 C CB     . LEU A 1 669 ? -2.468  11.760  -3.581  1.00 48.35  ?  730 LEU A CB     1 
ATOM 10286 C CG     . LEU A 1 669 ? -3.708  12.643  -3.443  1.00 40.21  ?  730 LEU A CG     1 
ATOM 10287 C CD1    . LEU A 1 669 ? -3.312  13.985  -2.857  1.00 49.20  ?  730 LEU A CD1    1 
ATOM 10288 C CD2    . LEU A 1 669 ? -4.428  12.827  -4.764  1.00 35.84  ?  730 LEU A CD2    1 
ATOM 10289 H H      . LEU A 1 669 ? -4.045  9.903   -3.396  1.00 56.28  ?  730 LEU A H      1 
ATOM 10290 H HA     . LEU A 1 669 ? -2.699  10.852  -5.404  1.00 51.98  ?  730 LEU A HA     1 
ATOM 10291 H HB2    . LEU A 1 669 ? -2.248  11.446  -2.690  1.00 58.02  ?  730 LEU A HB2    1 
ATOM 10292 H HB3    . LEU A 1 669 ? -1.752  12.332  -3.899  1.00 58.02  ?  730 LEU A HB3    1 
ATOM 10293 H HG     . LEU A 1 669 ? -4.326  12.221  -2.826  1.00 48.25  ?  730 LEU A HG     1 
ATOM 10294 H HD11   . LEU A 1 669 ? -4.104  14.539  -2.772  1.00 59.05  ?  730 LEU A HD11   1 
ATOM 10295 H HD12   . LEU A 1 669 ? -2.913  13.843  -1.984  1.00 59.05  ?  730 LEU A HD12   1 
ATOM 10296 H HD13   . LEU A 1 669 ? -2.672  14.411  -3.448  1.00 59.05  ?  730 LEU A HD13   1 
ATOM 10297 H HD21   . LEU A 1 669 ? -5.204  13.393  -4.624  1.00 43.00  ?  730 LEU A HD21   1 
ATOM 10298 H HD22   . LEU A 1 669 ? -3.824  13.245  -5.397  1.00 43.00  ?  730 LEU A HD22   1 
ATOM 10299 H HD23   . LEU A 1 669 ? -4.706  11.959  -5.095  1.00 43.00  ?  730 LEU A HD23   1 
ATOM 10300 N N      . SER A 1 670 ? -0.938  9.033   -3.442  1.00 49.09  ?  731 SER A N      1 
ATOM 10301 C CA     . SER A 1 670 ? 0.330   8.326   -3.324  1.00 42.38  ?  731 SER A CA     1 
ATOM 10302 C C      . SER A 1 670 ? 0.571   7.351   -4.468  1.00 33.56  ?  731 SER A C      1 
ATOM 10303 O O      . SER A 1 670 ? 1.699   6.870   -4.620  1.00 27.65  ?  731 SER A O      1 
ATOM 10304 C CB     . SER A 1 670 ? 0.381   7.588   -1.988  1.00 35.15  ?  731 SER A CB     1 
ATOM 10305 O OG     . SER A 1 670 ? -0.873  7.001   -1.690  1.00 48.70  ?  731 SER A OG     1 
ATOM 10306 H H      . SER A 1 670 ? -1.480  8.899   -2.789  1.00 58.91  ?  731 SER A H      1 
ATOM 10307 H HA     . SER A 1 670 ? 1.051   8.975   -3.332  1.00 50.85  ?  731 SER A HA     1 
ATOM 10308 H HB2    . SER A 1 670 ? 1.053   6.890   -2.039  1.00 42.19  ?  731 SER A HB2    1 
ATOM 10309 H HB3    . SER A 1 670 ? 0.609   8.218   -1.288  1.00 42.19  ?  731 SER A HB3    1 
ATOM 10310 H HG     . SER A 1 670 ? -1.083  6.452   -2.290  1.00 58.44  ?  731 SER A HG     1 
ATOM 10311 N N      . TYR A 1 671 ? -0.449  7.055   -5.274  1.00 34.52  ?  732 TYR A N      1 
ATOM 10312 C CA     . TYR A 1 671 ? -0.278  6.160   -6.414  1.00 36.07  ?  732 TYR A CA     1 
ATOM 10313 C C      . TYR A 1 671 ? 0.430   6.865   -7.566  1.00 53.52  ?  732 TYR A C      1 
ATOM 10314 O O      . TYR A 1 671 ? 1.482   6.413   -8.031  1.00 51.01  ?  732 TYR A O      1 
ATOM 10315 C CB     . TYR A 1 671 ? -1.645  5.623   -6.852  1.00 33.52  ?  732 TYR A CB     1 
ATOM 10316 C CG     . TYR A 1 671 ? -1.665  4.901   -8.182  1.00 26.18  ?  732 TYR A CG     1 
ATOM 10317 C CD1    . TYR A 1 671 ? -0.672  3.996   -8.524  1.00 31.44  ?  732 TYR A CD1    1 
ATOM 10318 C CD2    . TYR A 1 671 ? -2.698  5.110   -9.086  1.00 35.25  ?  732 TYR A CD2    1 
ATOM 10319 C CE1    . TYR A 1 671 ? -0.698  3.335   -9.738  1.00 36.78  ?  732 TYR A CE1    1 
ATOM 10320 C CE2    . TYR A 1 671 ? -2.732  4.452   -10.298 1.00 40.47  ?  732 TYR A CE2    1 
ATOM 10321 C CZ     . TYR A 1 671 ? -1.731  3.567   -10.618 1.00 40.48  ?  732 TYR A CZ     1 
ATOM 10322 O OH     . TYR A 1 671 ? -1.762  2.911   -11.825 1.00 45.16  ?  732 TYR A OH     1 
ATOM 10323 H H      . TYR A 1 671 ? -1.247  7.360   -5.182  1.00 41.43  ?  732 TYR A H      1 
ATOM 10324 H HA     . TYR A 1 671 ? 0.268   5.405   -6.144  1.00 43.28  ?  732 TYR A HA     1 
ATOM 10325 H HB2    . TYR A 1 671 ? -1.961  5.001   -6.178  1.00 40.22  ?  732 TYR A HB2    1 
ATOM 10326 H HB3    . TYR A 1 671 ? -2.262  6.370   -6.918  1.00 40.22  ?  732 TYR A HB3    1 
ATOM 10327 H HD1    . TYR A 1 671 ? 0.029   3.839   -7.933  1.00 37.73  ?  732 TYR A HD1    1 
ATOM 10328 H HD2    . TYR A 1 671 ? -3.376  5.709   -8.873  1.00 42.30  ?  732 TYR A HD2    1 
ATOM 10329 H HE1    . TYR A 1 671 ? -0.022  2.735   -9.957  1.00 44.14  ?  732 TYR A HE1    1 
ATOM 10330 H HE2    . TYR A 1 671 ? -3.428  4.607   -10.895 1.00 48.57  ?  732 TYR A HE2    1 
ATOM 10331 H HH     . TYR A 1 671 ? -1.095  2.404   -11.894 1.00 54.19  ?  732 TYR A HH     1 
ATOM 10332 N N      . PHE A 1 672 ? -0.130  7.981   -8.036  1.00 47.18  ?  733 PHE A N      1 
ATOM 10333 C CA     . PHE A 1 672 ? 0.458   8.696   -9.159  1.00 27.14  ?  733 PHE A CA     1 
ATOM 10334 C C      . PHE A 1 672 ? 1.621   9.590   -8.754  1.00 35.48  ?  733 PHE A C      1 
ATOM 10335 O O      . PHE A 1 672 ? 2.413   9.974   -9.620  1.00 50.35  ?  733 PHE A O      1 
ATOM 10336 C CB     . PHE A 1 672 ? -0.583  9.574   -9.848  1.00 20.88  ?  733 PHE A CB     1 
ATOM 10337 C CG     . PHE A 1 672 ? -1.898  8.899   -10.102 1.00 21.86  ?  733 PHE A CG     1 
ATOM 10338 C CD1    . PHE A 1 672 ? -2.141  8.256   -11.302 1.00 30.17  ?  733 PHE A CD1    1 
ATOM 10339 C CD2    . PHE A 1 672 ? -2.906  8.940   -9.156  1.00 16.95  ?  733 PHE A CD2    1 
ATOM 10340 C CE1    . PHE A 1 672 ? -3.357  7.652   -11.543 1.00 30.10  ?  733 PHE A CE1    1 
ATOM 10341 C CE2    . PHE A 1 672 ? -4.121  8.338   -9.396  1.00 19.84  ?  733 PHE A CE2    1 
ATOM 10342 C CZ     . PHE A 1 672 ? -4.346  7.695   -10.588 1.00 28.10  ?  733 PHE A CZ     1 
ATOM 10343 H H      . PHE A 1 672 ? -0.846  8.340   -7.721  1.00 56.62  ?  733 PHE A H      1 
ATOM 10344 H HA     . PHE A 1 672 ? 0.785   8.053   -9.807  1.00 32.57  ?  733 PHE A HA     1 
ATOM 10345 H HB2    . PHE A 1 672 ? -0.753  10.349  -9.289  1.00 25.06  ?  733 PHE A HB2    1 
ATOM 10346 H HB3    . PHE A 1 672 ? -0.229  9.861   -10.704 1.00 25.06  ?  733 PHE A HB3    1 
ATOM 10347 H HD1    . PHE A 1 672 ? -1.475  8.225   -11.951 1.00 36.20  ?  733 PHE A HD1    1 
ATOM 10348 H HD2    . PHE A 1 672 ? -2.760  9.375   -8.347  1.00 20.35  ?  733 PHE A HD2    1 
ATOM 10349 H HE1    . PHE A 1 672 ? -3.508  7.216   -12.350 1.00 36.12  ?  733 PHE A HE1    1 
ATOM 10350 H HE2    . PHE A 1 672 ? -4.789  8.366   -8.749  1.00 23.81  ?  733 PHE A HE2    1 
ATOM 10351 H HZ     . PHE A 1 672 ? -5.165  7.285   -10.748 1.00 33.73  ?  733 PHE A HZ     1 
ATOM 10352 N N      . SER A 1 673 ? 1.735   9.939   -7.479  1.00 35.03  ?  734 SER A N      1 
ATOM 10353 C CA     . SER A 1 673 ? 2.705   10.939  -7.065  1.00 43.21  ?  734 SER A CA     1 
ATOM 10354 C C      . SER A 1 673 ? 4.095   10.573  -7.592  1.00 37.47  ?  734 SER A C      1 
ATOM 10355 O O      . SER A 1 673 ? 4.478   9.399   -7.551  1.00 47.96  ?  734 SER A O      1 
ATOM 10356 C CB     . SER A 1 673 ? 2.734   11.050  -5.539  1.00 51.75  ?  734 SER A CB     1 
ATOM 10357 O OG     . SER A 1 673 ? 3.713   11.982  -5.116  1.00 49.59  ?  734 SER A OG     1 
ATOM 10358 H H      . SER A 1 673 ? 1.264   9.612   -6.838  1.00 42.04  ?  734 SER A H      1 
ATOM 10359 H HA     . SER A 1 673 ? 2.456   11.802  -7.431  1.00 51.85  ?  734 SER A HA     1 
ATOM 10360 H HB2    . SER A 1 673 ? 1.863   11.345  -5.228  1.00 62.10  ?  734 SER A HB2    1 
ATOM 10361 H HB3    . SER A 1 673 ? 2.943   10.181  -5.164  1.00 62.10  ?  734 SER A HB3    1 
ATOM 10362 H HG     . SER A 1 673 ? 3.717   12.033  -4.278  1.00 59.51  ?  734 SER A HG     1 
ATOM 10363 N N      . PRO A 1 674 ? 4.868   11.539  -8.095  1.00 40.20  ?  735 PRO A N      1 
ATOM 10364 C CA     . PRO A 1 674 ? 6.202   11.197  -8.616  1.00 40.68  ?  735 PRO A CA     1 
ATOM 10365 C C      . PRO A 1 674 ? 7.155   10.691  -7.557  1.00 42.79  ?  735 PRO A C      1 
ATOM 10366 O O      . PRO A 1 674 ? 8.183   10.099  -7.906  1.00 59.90  ?  735 PRO A O      1 
ATOM 10367 C CB     . PRO A 1 674 ? 6.704   12.520  -9.216  1.00 72.98  ?  735 PRO A CB     1 
ATOM 10368 C CG     . PRO A 1 674 ? 5.511   13.398  -9.317  1.00 67.69  ?  735 PRO A CG     1 
ATOM 10369 C CD     . PRO A 1 674 ? 4.577   12.973  -8.241  1.00 61.68  ?  735 PRO A CD     1 
ATOM 10370 H HA     . PRO A 1 674 ? 6.127   10.535  -9.321  1.00 48.81  ?  735 PRO A HA     1 
ATOM 10371 H HB2    . PRO A 1 674 ? 7.367   12.913  -8.628  1.00 87.58  ?  735 PRO A HB2    1 
ATOM 10372 H HB3    . PRO A 1 674 ? 7.081   12.356  -10.095 1.00 87.58  ?  735 PRO A HB3    1 
ATOM 10373 H HG2    . PRO A 1 674 ? 5.779   14.321  -9.189  1.00 81.23  ?  735 PRO A HG2    1 
ATOM 10374 H HG3    . PRO A 1 674 ? 5.099   13.283  -10.188 1.00 81.23  ?  735 PRO A HG3    1 
ATOM 10375 H HD2    . PRO A 1 674 ? 4.773   13.445  -7.416  1.00 74.02  ?  735 PRO A HD2    1 
ATOM 10376 H HD3    . PRO A 1 674 ? 3.657   13.106  -8.518  1.00 74.02  ?  735 PRO A HD3    1 
ATOM 10377 N N      . ILE A 1 675 ? 6.862   10.911  -6.276  1.00 38.94  ?  736 ILE A N      1 
ATOM 10378 C CA     . ILE A 1 675 ? 7.781   10.479  -5.230  1.00 49.50  ?  736 ILE A CA     1 
ATOM 10379 C C      . ILE A 1 675 ? 7.659   8.979   -4.998  1.00 49.62  ?  736 ILE A C      1 
ATOM 10380 O O      . ILE A 1 675 ? 8.608   8.340   -4.530  1.00 45.29  ?  736 ILE A O      1 
ATOM 10381 C CB     . ILE A 1 675 ? 7.533   11.262  -3.930  1.00 52.62  ?  736 ILE A CB     1 
ATOM 10382 C CG1    . ILE A 1 675 ? 7.365   12.758  -4.221  1.00 57.78  ?  736 ILE A CG1    1 
ATOM 10383 C CG2    . ILE A 1 675 ? 8.689   11.038  -2.967  1.00 67.42  ?  736 ILE A CG2    1 
ATOM 10384 C CD1    . ILE A 1 675 ? 7.077   13.609  -2.998  1.00 56.70  ?  736 ILE A CD1    1 
ATOM 10385 H H      . ILE A 1 675 ? 6.150   11.302  -5.992  1.00 46.73  ?  736 ILE A H      1 
ATOM 10386 H HA     . ILE A 1 675 ? 8.689   10.662  -5.517  1.00 59.40  ?  736 ILE A HA     1 
ATOM 10387 H HB     . ILE A 1 675 ? 6.718   10.933  -3.519  1.00 63.15  ?  736 ILE A HB     1 
ATOM 10388 H HG12   . ILE A 1 675 ? 8.183   13.090  -4.624  1.00 69.34  ?  736 ILE A HG12   1 
ATOM 10389 H HG13   . ILE A 1 675 ? 6.627   12.873  -4.840  1.00 69.34  ?  736 ILE A HG13   1 
ATOM 10390 H HG21   . ILE A 1 675 ? 8.522   11.536  -2.151  1.00 80.91  ?  736 ILE A HG21   1 
ATOM 10391 H HG22   . ILE A 1 675 ? 8.755   10.091  -2.768  1.00 80.91  ?  736 ILE A HG22   1 
ATOM 10392 H HG23   . ILE A 1 675 ? 9.510   11.348  -3.382  1.00 80.91  ?  736 ILE A HG23