data_5OT2
# 
_entry.id   5OT2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.312 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5OT2         
WWPDB D_1200006309 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5OT2 
_pdbx_database_status.recvd_initial_deposition_date   2017-08-19 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Malvezzi, S.' 1 ? 
'Farnung, L.'  2 ? 
'Aloisi, C.'   3 ? 
'Angelov, T.'  4 ? 
'Cramer, P.'   5 ? 
'Sturla, S.J.' 6 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                12172 
_citation.page_last                 12177 
_citation.title                     'Mechanism of RNA polymerase II stalling by DNA alkylation.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1706592114 
_citation.pdbx_database_id_PubMed   29087308 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Malvezzi, S.'   1 ? 
primary 'Farnung, L.'    2 ? 
primary 'Aloisi, C.M.N.' 3 ? 
primary 'Angelov, T.'    4 ? 
primary 'Cramer, P.'     5 ? 
primary 'Sturla, S.J.'   6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5OT2 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     221.350 
_cell.length_a_esd                 ? 
_cell.length_b                     394.930 
_cell.length_b_esd                 ? 
_cell.length_c                     283.710 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5OT2 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                20 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 2 2 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase II subunit RPB1'                191821.578 1 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase II subunit RPB2'                138937.297 1 2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerase II subunit RPB3'                35330.457  1 ?       ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase II subunit RPB4'                25451.191  1 ?       ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 25117.094  1 ?       ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 17931.834  1 ?       ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerase II subunit RPB7'                19081.053  1 ?       ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 16525.363  1 ?       ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerase II subunit RPB9'                14308.161  1 ?       ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8290.732   1 ?       ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerase II subunit RPB11'               13633.493  1 ?       ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7729.969   1 ?       ? ? ? 
13 polymer     syn 'DNA template strand'                                        7841.912   1 ?       ? ? ? 
14 polymer     syn 'DNA non-template strand'                                    4359.852   1 ?       ? ? ? 
15 polymer     syn 'RNA product strand'                                         3602.202   1 ?       ? ? ? 
16 non-polymer nat 'ZINC ION'                                                   65.409     8 2.7.7.6 ? ? ? 
17 non-polymer nat 'MAGNESIUM ION'                                              24.305     1 2.7.7.6 ? ? ? 
18 non-polymer syn 2-ethyl-7-methoxy-naphthalene                                186.250    1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'RNA polymerase II subunit B1,DNA-directed RNA polymerase III largest subunit,RNA polymerase II subunit B220' 
2  'RNA polymerase II subunit 2,B150,DNA-directed RNA polymerase II 140 kDa polypeptide' 
3  'RNA polymerase II subunit B3,B44.5,DNA-directed RNA polymerase II 45 kDa polypeptide' 
4  'RNA polymerase II subunit B4,B32,DNA-directed RNA polymerase II 32 kDa polypeptide' 
5  'RNA polymerases I,II,and III subunit ABC1,ABC27,DNA-directed RNA polymerases I,and III 27 kDa polypeptide' 
6  'RNA polymerases I,II,and III subunit ABC2,ABC23,DNA-directed RNA polymerases I,and III 23 kDa polypeptide' 
7  'RNA polymerase II subunit B7,B16' 
8  'RNA polymerases I,II,and III subunit ABC3,ABC14.4,ABC14.5,DNA-directed RNA polymerases I,and III 14.5 kDa polypeptide' 
9  
'RNA polymerase II subunit B9,B12.6,DNA-directed RNA polymerase II 14.2 kDa polypeptide,DNA-directed RNA polymerase II subunit 9' 
10 'RNA polymerases I,II,and III subunit ABC5,ABC10-beta,ABC8,DNA-directed RNA polymerases I,and III 8.3 kDa polypeptide' 
11 'RNA polymerase II subunit B11,B13.6,DNA-directed RNA polymerase II 13.6 kDa polypeptide' 
12 'RNA polymerases I,II,and III subunit ABC4,ABC10-alpha' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
D ? 
5  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)'        no no  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
G ? 
8  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
10 'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
12 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 polydeoxyribonucleotide no yes 
;(DA)(DC)(DC)(DT)(DC)(DA)(DA)(DC)(DT)(DA)(DC)(DT)(DT)(DG)(4DU)(DC)(DC)(DC)(BRU)
(DC)(DC)(DT)(DC)(DA)(DT)(DT)
;
ACCTCAACTACTTGXCCCUCCTCATT T ? 
14 polydeoxyribonucleotide no no  '(DC)(DA)(DA)(DG)(DT)(DA)(DG)(DT)(DT)(DG)(DA)(DG)(DG)(DT)' CAAGTAGTTGAGGT N ? 
15 polyribonucleotide      no no  UUCGAGGAGGG UUCGAGGAGGG P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASN n 
4  3    VAL n 
4  4    SER n 
4  5    THR n 
4  6    SER n 
4  7    THR n 
4  8    PHE n 
4  9    GLN n 
4  10   THR n 
4  11   ARG n 
4  12   ARG n 
4  13   ARG n 
4  14   ARG n 
4  15   LEU n 
4  16   LYS n 
4  17   LYS n 
4  18   VAL n 
4  19   GLU n 
4  20   GLU n 
4  21   GLU n 
4  22   GLU n 
4  23   ASN n 
4  24   ALA n 
4  25   ALA n 
4  26   THR n 
4  27   LEU n 
4  28   GLN n 
4  29   LEU n 
4  30   GLY n 
4  31   GLN n 
4  32   GLU n 
4  33   PHE n 
4  34   GLN n 
4  35   LEU n 
4  36   LYS n 
4  37   GLN n 
4  38   ILE n 
4  39   ASN n 
4  40   HIS n 
4  41   GLN n 
4  42   GLY n 
4  43   GLU n 
4  44   GLU n 
4  45   GLU n 
4  46   GLU n 
4  47   LEU n 
4  48   ILE n 
4  49   ALA n 
4  50   LEU n 
4  51   ASN n 
4  52   LEU n 
4  53   SER n 
4  54   GLU n 
4  55   ALA n 
4  56   ARG n 
4  57   LEU n 
4  58   VAL n 
4  59   ILE n 
4  60   LYS n 
4  61   GLU n 
4  62   ALA n 
4  63   LEU n 
4  64   VAL n 
4  65   GLU n 
4  66   ARG n 
4  67   ARG n 
4  68   ARG n 
4  69   ALA n 
4  70   PHE n 
4  71   LYS n 
4  72   ARG n 
4  73   SER n 
4  74   GLN n 
4  75   LYS n 
4  76   LYS n 
4  77   HIS n 
4  78   LYS n 
4  79   LYS n 
4  80   LYS n 
4  81   HIS n 
4  82   LEU n 
4  83   LYS n 
4  84   HIS n 
4  85   GLU n 
4  86   ASN n 
4  87   ALA n 
4  88   ASN n 
4  89   ASP n 
4  90   GLU n 
4  91   THR n 
4  92   THR n 
4  93   ALA n 
4  94   VAL n 
4  95   GLU n 
4  96   ASP n 
4  97   GLU n 
4  98   ASP n 
4  99   ASP n 
4  100  ASP n 
4  101  LEU n 
4  102  ASP n 
4  103  GLU n 
4  104  ASP n 
4  105  ASP n 
4  106  VAL n 
4  107  ASN n 
4  108  ALA n 
4  109  ASP n 
4  110  ASP n 
4  111  ASP n 
4  112  ASP n 
4  113  PHE n 
4  114  MET n 
4  115  HIS n 
4  116  SER n 
4  117  GLU n 
4  118  THR n 
4  119  ARG n 
4  120  GLU n 
4  121  LYS n 
4  122  GLU n 
4  123  LEU n 
4  124  GLU n 
4  125  SER n 
4  126  ILE n 
4  127  ASP n 
4  128  VAL n 
4  129  LEU n 
4  130  LEU n 
4  131  GLU n 
4  132  GLN n 
4  133  THR n 
4  134  THR n 
4  135  GLY n 
4  136  GLY n 
4  137  ASN n 
4  138  ASN n 
4  139  LYS n 
4  140  ASP n 
4  141  LEU n 
4  142  LYS n 
4  143  ASN n 
4  144  THR n 
4  145  MET n 
4  146  GLN n 
4  147  TYR n 
4  148  LEU n 
4  149  THR n 
4  150  ASN n 
4  151  PHE n 
4  152  SER n 
4  153  ARG n 
4  154  PHE n 
4  155  ARG n 
4  156  ASP n 
4  157  GLN n 
4  158  GLU n 
4  159  THR n 
4  160  VAL n 
4  161  GLY n 
4  162  ALA n 
4  163  VAL n 
4  164  ILE n 
4  165  GLN n 
4  166  LEU n 
4  167  LEU n 
4  168  LYS n 
4  169  SER n 
4  170  THR n 
4  171  GLY n 
4  172  LEU n 
4  173  HIS n 
4  174  PRO n 
4  175  PHE n 
4  176  GLU n 
4  177  VAL n 
4  178  ALA n 
4  179  GLN n 
4  180  LEU n 
4  181  GLY n 
4  182  SER n 
4  183  LEU n 
4  184  ALA n 
4  185  CYS n 
4  186  ASP n 
4  187  THR n 
4  188  ALA n 
4  189  ASP n 
4  190  GLU n 
4  191  ALA n 
4  192  LYS n 
4  193  THR n 
4  194  LEU n 
4  195  ILE n 
4  196  PRO n 
4  197  SER n 
4  198  LEU n 
4  199  ASN n 
4  200  ASN n 
4  201  LYS n 
4  202  ILE n 
4  203  SER n 
4  204  ASP n 
4  205  ASP n 
4  206  GLU n 
4  207  LEU n 
4  208  GLU n 
4  209  ARG n 
4  210  ILE n 
4  211  LEU n 
4  212  LYS n 
4  213  GLU n 
4  214  LEU n 
4  215  SER n 
4  216  ASN n 
4  217  LEU n 
4  218  GLU n 
4  219  THR n 
4  220  LEU n 
4  221  TYR n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    PHE n 
7  3    PHE n 
7  4    ILE n 
7  5    LYS n 
7  6    ASP n 
7  7    LEU n 
7  8    SER n 
7  9    LEU n 
7  10   ASN n 
7  11   ILE n 
7  12   THR n 
7  13   LEU n 
7  14   HIS n 
7  15   PRO n 
7  16   SER n 
7  17   PHE n 
7  18   PHE n 
7  19   GLY n 
7  20   PRO n 
7  21   ARG n 
7  22   MET n 
7  23   LYS n 
7  24   GLN n 
7  25   TYR n 
7  26   LEU n 
7  27   LYS n 
7  28   THR n 
7  29   LYS n 
7  30   LEU n 
7  31   LEU n 
7  32   GLU n 
7  33   GLU n 
7  34   VAL n 
7  35   GLU n 
7  36   GLY n 
7  37   SER n 
7  38   CYS n 
7  39   THR n 
7  40   GLY n 
7  41   LYS n 
7  42   PHE n 
7  43   GLY n 
7  44   TYR n 
7  45   ILE n 
7  46   LEU n 
7  47   CYS n 
7  48   VAL n 
7  49   LEU n 
7  50   ASP n 
7  51   TYR n 
7  52   ASP n 
7  53   ASN n 
7  54   ILE n 
7  55   ASP n 
7  56   ILE n 
7  57   GLN n 
7  58   ARG n 
7  59   GLY n 
7  60   ARG n 
7  61   ILE n 
7  62   LEU n 
7  63   PRO n 
7  64   THR n 
7  65   ASP n 
7  66   GLY n 
7  67   SER n 
7  68   ALA n 
7  69   GLU n 
7  70   PHE n 
7  71   ASN n 
7  72   VAL n 
7  73   LYS n 
7  74   TYR n 
7  75   ARG n 
7  76   ALA n 
7  77   VAL n 
7  78   VAL n 
7  79   PHE n 
7  80   LYS n 
7  81   PRO n 
7  82   PHE n 
7  83   LYS n 
7  84   GLY n 
7  85   GLU n 
7  86   VAL n 
7  87   VAL n 
7  88   ASP n 
7  89   GLY n 
7  90   THR n 
7  91   VAL n 
7  92   VAL n 
7  93   SER n 
7  94   CYS n 
7  95   SER n 
7  96   GLN n 
7  97   HIS n 
7  98   GLY n 
7  99   PHE n 
7  100  GLU n 
7  101  VAL n 
7  102  GLN n 
7  103  VAL n 
7  104  GLY n 
7  105  PRO n 
7  106  MET n 
7  107  LYS n 
7  108  VAL n 
7  109  PHE n 
7  110  VAL n 
7  111  THR n 
7  112  LYS n 
7  113  HIS n 
7  114  LEU n 
7  115  MET n 
7  116  PRO n 
7  117  GLN n 
7  118  ASP n 
7  119  LEU n 
7  120  THR n 
7  121  PHE n 
7  122  ASN n 
7  123  ALA n 
7  124  GLY n 
7  125  SER n 
7  126  ASN n 
7  127  PRO n 
7  128  PRO n 
7  129  SER n 
7  130  TYR n 
7  131  GLN n 
7  132  SER n 
7  133  SER n 
7  134  GLU n 
7  135  ASP n 
7  136  VAL n 
7  137  ILE n 
7  138  THR n 
7  139  ILE n 
7  140  LYS n 
7  141  SER n 
7  142  ARG n 
7  143  ILE n 
7  144  ARG n 
7  145  VAL n 
7  146  LYS n 
7  147  ILE n 
7  148  GLU n 
7  149  GLY n 
7  150  CYS n 
7  151  ILE n 
7  152  SER n 
7  153  GLN n 
7  154  VAL n 
7  155  SER n 
7  156  SER n 
7  157  ILE n 
7  158  HIS n 
7  159  ALA n 
7  160  ILE n 
7  161  GLY n 
7  162  SER n 
7  163  ILE n 
7  164  LYS n 
7  165  GLU n 
7  166  ASP n 
7  167  TYR n 
7  168  LEU n 
7  169  GLY n 
7  170  ALA n 
7  171  ILE n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    THR n 
9  3    THR n 
9  4    PHE n 
9  5    ARG n 
9  6    PHE n 
9  7    CYS n 
9  8    ARG n 
9  9    ASP n 
9  10   CYS n 
9  11   ASN n 
9  12   ASN n 
9  13   MET n 
9  14   LEU n 
9  15   TYR n 
9  16   PRO n 
9  17   ARG n 
9  18   GLU n 
9  19   ASP n 
9  20   LYS n 
9  21   GLU n 
9  22   ASN n 
9  23   ASN n 
9  24   ARG n 
9  25   LEU n 
9  26   LEU n 
9  27   PHE n 
9  28   GLU n 
9  29   CYS n 
9  30   ARG n 
9  31   THR n 
9  32   CYS n 
9  33   SER n 
9  34   TYR n 
9  35   VAL n 
9  36   GLU n 
9  37   GLU n 
9  38   ALA n 
9  39   GLY n 
9  40   SER n 
9  41   PRO n 
9  42   LEU n 
9  43   VAL n 
9  44   TYR n 
9  45   ARG n 
9  46   HIS n 
9  47   GLU n 
9  48   LEU n 
9  49   ILE n 
9  50   THR n 
9  51   ASN n 
9  52   ILE n 
9  53   GLY n 
9  54   GLU n 
9  55   THR n 
9  56   ALA n 
9  57   GLY n 
9  58   VAL n 
9  59   VAL n 
9  60   GLN n 
9  61   ASP n 
9  62   ILE n 
9  63   GLY n 
9  64   SER n 
9  65   ASP n 
9  66   PRO n 
9  67   THR n 
9  68   LEU n 
9  69   PRO n 
9  70   ARG n 
9  71   SER n 
9  72   ASP n 
9  73   ARG n 
9  74   GLU n 
9  75   CYS n 
9  76   PRO n 
9  77   LYS n 
9  78   CYS n 
9  79   HIS n 
9  80   SER n 
9  81   ARG n 
9  82   GLU n 
9  83   ASN n 
9  84   VAL n 
9  85   PHE n 
9  86   PHE n 
9  87   GLN n 
9  88   SER n 
9  89   GLN n 
9  90   GLN n 
9  91   ARG n 
9  92   ARG n 
9  93   LYS n 
9  94   ASP n 
9  95   THR n 
9  96   SER n 
9  97   MET n 
9  98   VAL n 
9  99   LEU n 
9  100  PHE n 
9  101  PHE n 
9  102  VAL n 
9  103  CYS n 
9  104  LEU n 
9  105  SER n 
9  106  CYS n 
9  107  SER n 
9  108  HIS n 
9  109  ILE n 
9  110  PHE n 
9  111  THR n 
9  112  SER n 
9  113  ASP n 
9  114  GLN n 
9  115  LYS n 
9  116  ASN n 
9  117  LYS n 
9  118  ARG n 
9  119  THR n 
9  120  GLN n 
9  121  PHE n 
9  122  SER n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    ASN n 
11 3    ALA n 
11 4    PRO n 
11 5    ASP n 
11 6    ARG n 
11 7    PHE n 
11 8    GLU n 
11 9    LEU n 
11 10   PHE n 
11 11   LEU n 
11 12   LEU n 
11 13   GLY n 
11 14   GLU n 
11 15   GLY n 
11 16   GLU n 
11 17   SER n 
11 18   LYS n 
11 19   LEU n 
11 20   LYS n 
11 21   ILE n 
11 22   ASP n 
11 23   PRO n 
11 24   ASP n 
11 25   THR n 
11 26   LYS n 
11 27   ALA n 
11 28   PRO n 
11 29   ASN n 
11 30   ALA n 
11 31   VAL n 
11 32   VAL n 
11 33   ILE n 
11 34   THR n 
11 35   PHE n 
11 36   GLU n 
11 37   LYS n 
11 38   GLU n 
11 39   ASP n 
11 40   HIS n 
11 41   THR n 
11 42   LEU n 
11 43   GLY n 
11 44   ASN n 
11 45   LEU n 
11 46   ILE n 
11 47   ARG n 
11 48   ALA n 
11 49   GLU n 
11 50   LEU n 
11 51   LEU n 
11 52   ASN n 
11 53   ASP n 
11 54   ARG n 
11 55   LYS n 
11 56   VAL n 
11 57   LEU n 
11 58   PHE n 
11 59   ALA n 
11 60   ALA n 
11 61   TYR n 
11 62   LYS n 
11 63   VAL n 
11 64   GLU n 
11 65   HIS n 
11 66   PRO n 
11 67   PHE n 
11 68   PHE n 
11 69   ALA n 
11 70   ARG n 
11 71   PHE n 
11 72   LYS n 
11 73   LEU n 
11 74   ARG n 
11 75   ILE n 
11 76   GLN n 
11 77   THR n 
11 78   THR n 
11 79   GLU n 
11 80   GLY n 
11 81   TYR n 
11 82   ASP n 
11 83   PRO n 
11 84   LYS n 
11 85   ASP n 
11 86   ALA n 
11 87   LEU n 
11 88   LYS n 
11 89   ASN n 
11 90   ALA n 
11 91   CYS n 
11 92   ASN n 
11 93   SER n 
11 94   ILE n 
11 95   ILE n 
11 96   ASN n 
11 97   LYS n 
11 98   LEU n 
11 99   GLY n 
11 100  ALA n 
11 101  LEU n 
11 102  LYS n 
11 103  THR n 
11 104  ASN n 
11 105  PHE n 
11 106  GLU n 
11 107  THR n 
11 108  GLU n 
11 109  TRP n 
11 110  ASN n 
11 111  LEU n 
11 112  GLN n 
11 113  THR n 
11 114  LEU n 
11 115  ALA n 
11 116  ALA n 
11 117  ASP n 
11 118  ASP n 
11 119  ALA n 
11 120  PHE n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    DA  n 
13 2    DC  n 
13 3    DC  n 
13 4    DT  n 
13 5    DC  n 
13 6    DA  n 
13 7    DA  n 
13 8    DC  n 
13 9    DT  n 
13 10   DA  n 
13 11   DC  n 
13 12   DT  n 
13 13   DT  n 
13 14   DG  n 
13 15   4DU n 
13 16   DC  n 
13 17   DC  n 
13 18   DC  n 
13 19   BRU n 
13 20   DC  n 
13 21   DC  n 
13 22   DT  n 
13 23   DC  n 
13 24   DA  n 
13 25   DT  n 
13 26   DT  n 
14 1    DC  n 
14 2    DA  n 
14 3    DA  n 
14 4    DG  n 
14 5    DT  n 
14 6    DA  n 
14 7    DG  n 
14 8    DT  n 
14 9    DT  n 
14 10   DG  n 
14 11   DA  n 
14 12   DG  n 
14 13   DG  n 
14 14   DT  n 
15 1    U   n 
15 2    U   n 
15 3    C   n 
15 4    G   n 
15 5    A   n 
15 6    G   n 
15 7    G   n 
15 8    A   n 
15 9    G   n 
15 10   G   n 
15 11   G   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 1733 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 1224 
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 318  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 221  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 215  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 155  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 171  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 146  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 122  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 120  
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae (strain ATCC 204508 / S288c)' 559292 ? ? 'ATCC 204508 / S288c' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
13 1 sample 1 26 'synthetic construct' ? 32630 ? 
14 1 sample 1 14 'synthetic construct' ? 32630 ? 
15 1 sample 1 11 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP RPB1_YEAST  P04050 ? 1  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
1 
2  UNP RPB2_YEAST  P08518 ? 2  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
1 
3  UNP RPB3_YEAST  P16370 ? 3  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
1 
4  UNP RPB4_YEAST  P20433 ? 4  
;MNVSTSTFQTRRRRLKKVEEEENAATLQLGQEFQLKQINHQGEEEELIALNLSEARLVIKEALVERRRAFKRSQKKHKKK
HLKHENANDETTAVEDEDDDLDEDDVNADDDDFMHSETREKELESIDVLLEQTTGGNNKDLKNTMQYLTNFSRFRDQETV
GAVIQLLKSTGLHPFEVAQLGSLACDTADEAKTLIPSLNNKISDDELERILKELSNLETLY
;
1 
5  UNP RPAB1_YEAST P20434 ? 5  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 
6  UNP RPAB2_YEAST P20435 ? 6  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 
7  UNP RPB7_YEAST  P34087 ? 7  
;MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFK
PFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAI
GSIKEDYLGAI
;
1 
8  UNP RPAB3_YEAST P20436 ? 8  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 
9  UNP RPB9_YEAST  P27999 ? 9  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
1 
10 UNP RPAB5_YEAST P22139 ? 10 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 
11 UNP RPB11_YEAST P38902 ? 11 
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
1 
12 UNP RPAB4_YEAST P40422 ? 12 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 
13 PDB 5OT2        5OT2   ? 13 ? 1 
14 PDB 5OT2        5OT2   ? 14 ? 1 
15 PDB 5OT2        5OT2   ? 15 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5OT2 A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  5OT2 B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  5OT2 C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  5OT2 D 1 ? 221  ? P20433 1 ? 221  ? 1 221  
5  5  5OT2 E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
6  6  5OT2 F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
7  7  5OT2 G 1 ? 171  ? P34087 1 ? 171  ? 1 171  
8  8  5OT2 H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
9  9  5OT2 I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
10 10 5OT2 J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
11 11 5OT2 K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
12 12 5OT2 L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
13 13 5OT2 T 1 ? 26   ? 5OT2   4 ? 29   ? 4 29   
14 14 5OT2 N 1 ? 14   ? 5OT2   0 ? 13   ? 0 13   
15 15 5OT2 P 1 ? 11   ? 5OT2   0 ? 10   ? 0 10   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4DU 'DNA linking'       . '1-(2-deoxy-5-O-phosphono-beta-D-erythro-pentofuranosyl)-1H-imidazo[4,5-c]pyridin-4-amine' ? 
'C11 H15 N4 O6 P'   330.234 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"                                                               ? 
'C10 H14 N5 O7 P'   347.221 
AHW non-polymer         . 2-ethyl-7-methoxy-naphthalene                                                              ? 'C13 H14 O' 
186.250 
ALA 'L-peptide linking' y ALANINE                                                                                    ? 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                                   ? 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                 ? 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                            ? 
'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE"                                                 ? 
'C9 H12 Br N2 O8 P' 387.078 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                                                                ? 
'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                                                                   ? 
'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                       ? 
'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                        ? 
'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                       ? 
'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                               ? 
'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"                                                               ? 
'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                                                                  ? 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                            ? 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                    ? 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                  ? 
'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                                                                 ? 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                    ? 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                     ? 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                                 ? 
'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                            ? 'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                              ? 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                    ? 
'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                                                                     ? 
'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                                                                  ? 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                 ? 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                   ? 
'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"                                                                 ? 
'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                                                                                     ? 
'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                                                                 ? 'Zn 2' 
65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5OT2 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            5.85 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         78.96 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '4-7% PEG 6000, 200 mM ammonium acetate, 300 mM sodium acetate, 50 mM HEPES pH 7.0, 5 mM TCEP' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-07-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.976 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.976 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'P13 (MX1)' 
_diffrn_source.pdbx_synchrotron_site       'PETRA III, EMBL c/o DESY' 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5OT2 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.2 
_reflns.d_resolution_low                 49.882 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       202994 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.5 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.38 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.2 
_reflns_shell.d_res_low                   3.31 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5OT2 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.200 
_refine.ls_d_res_low                             49.882 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     202994 
_refine.ls_number_reflns_R_free                  3272 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.93 
_refine.ls_percent_reflns_R_free                 0.83 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1789 
_refine.ls_R_factor_R_free                       0.2218 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1785 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.22 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.42 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        30950 
_refine_hist.pdbx_number_atoms_nucleic_acid   761 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               31714 
_refine_hist.d_res_high                       3.200 
_refine_hist.d_res_low                        49.882 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007 ? 32432 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.033 ? 43837 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 6.240 ? 19680 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.058 ? 4934  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007 ? 5552  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.2000 3.2477  . . 144 17083 100.00 . . . 0.3288 . 0.3214 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2477 3.2985  . . 126 17143 100.00 . . . 0.3139 . 0.3179 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2985 3.3526  . . 145 17006 100.00 . . . 0.3990 . 0.3306 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3526 3.4104  . . 148 17020 100.00 . . . 0.3814 . 0.3137 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4104 3.4724  . . 145 17116 100.00 . . . 0.3316 . 0.2874 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4724 3.5391  . . 145 17113 100.00 . . . 0.2817 . 0.2571 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5391 3.6113  . . 138 16987 100.00 . . . 0.2657 . 0.2426 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6113 3.6898  . . 140 17091 100.00 . . . 0.2490 . 0.2290 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6898 3.7756  . . 150 17115 100.00 . . . 0.2803 . 0.2241 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7756 3.8700  . . 142 17055 100.00 . . . 0.2534 . 0.2031 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8700 3.9746  . . 149 17023 100.00 . . . 0.2316 . 0.1884 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9746 4.0915  . . 145 17100 100.00 . . . 0.2423 . 0.1729 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0915 4.2235  . . 136 17044 100.00 . . . 0.2317 . 0.1632 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2235 4.3744  . . 138 17116 100.00 . . . 0.2262 . 0.1518 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3744 4.5494  . . 144 17070 100.00 . . . 0.1729 . 0.1413 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5494 4.7563  . . 150 17061 100.00 . . . 0.2016 . 0.1355 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7563 5.0069  . . 138 17110 100.00 . . . 0.2243 . 0.1412 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0069 5.3202  . . 142 17063 100.00 . . . 0.1799 . 0.1497 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3202 5.7305  . . 141 17083 100.00 . . . 0.2028 . 0.1661 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.7305 6.3061  . . 145 17135 100.00 . . . 0.2126 . 0.1789 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.3061 7.2163  . . 150 17047 100.00 . . . 0.2599 . 0.1824 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.2163 9.0828  . . 127 17117 100.00 . . . 0.1815 . 0.1578 . . . . . . . . . . 
'X-RAY DIFFRACTION' 9.0828 49.8878 . . 144 17022 100.00 . . . 0.1801 . 0.1677 . . . . . . . . . . 
# 
_struct.entry_id                     5OT2 
_struct.title                        'RNA polymerase II elongation complex in the presence of 3d-Napht-A' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase II subunit RPB1, DNA-directed RNA polymerase II subunit RPB2, DNA-directed RNA polymerase II subunit RPB3, DNA-directed RNA polymerase II subunit RPB4, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase II subunit RPB7, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase II subunit RPB9, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerase II subunit RPB11, DNA-directed RNA polymerases I, II, and III subunit RPABC4/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5OT2 
_struct_keywords.text            'Inhibitor, Complex, Polymerase, TRANSCRIPTION' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
P N N 16 ? 
Q N N 16 ? 
R N N 17 ? 
S N N 16 ? 
T N N 16 ? 
U N N 16 ? 
V N N 16 ? 
W N N 16 ? 
X N N 16 ? 
Y N N 18 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   AA2 PHE A 95   ? GLU A 104  ? PHE A 95   GLU A 104  1 ? 10 
HELX_P HELX_P3   AA3 ASN A 119  ? LEU A 126  ? ASN A 119  LEU A 126  1 ? 8  
HELX_P HELX_P4   AA4 SER A 131  ? LYS A 143  ? SER A 131  LYS A 143  1 ? 13 
HELX_P HELX_P5   AA5 SER A 203  ? HIS A 213  ? SER A 203  HIS A 213  1 ? 11 
HELX_P HELX_P6   AA6 SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   AA7 ARG A 230  ? TRP A 233  ? ARG A 230  TRP A 233  5 ? 4  
HELX_P HELX_P8   AA8 PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   AA9 ASP A 260  ? ASN A 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P10  AB1 PRO A 285  ? GLU A 290  ? PRO A 285  GLU A 290  1 ? 6  
HELX_P HELX_P11  AB2 GLU A 291  ? ASP A 305  ? GLU A 291  ASP A 305  1 ? 15 
HELX_P HELX_P12  AB3 SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P13  AB4 GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P14  AB5 LYS A 368  ? LYS A 372  ? LYS A 368  LYS A 372  1 ? 5  
HELX_P HELX_P15  AB6 ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P16  AB7 SER A 418  ? GLY A 422  ? SER A 418  GLY A 422  5 ? 5  
HELX_P HELX_P17  AB8 HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P18  AB9 ASN A 471  ? SER A 473  ? ASN A 471  SER A 473  5 ? 3  
HELX_P HELX_P19  AC1 VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P20  AC2 SER A 494  ? LEU A 504  ? SER A 494  LEU A 504  1 ? 11 
HELX_P HELX_P21  AC3 ALA A 506  ? GLN A 510  ? ALA A 506  GLN A 510  5 ? 5  
HELX_P HELX_P22  AC4 VAL A 524  ? LEU A 536  ? VAL A 524  LEU A 536  1 ? 13 
HELX_P HELX_P23  AC5 GLU A 542  ? VAL A 553  ? GLU A 542  VAL A 553  1 ? 12 
HELX_P HELX_P24  AC6 GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P25  AC7 GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P26  AC8 GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P27  AC9 GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P28  AD1 GLY A 665  ? ILE A 670  ? GLY A 665  ILE A 670  5 ? 6  
HELX_P HELX_P29  AD2 GLY A 673  ? ALA A 699  ? GLY A 673  ALA A 699  1 ? 27 
HELX_P HELX_P30  AD3 THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P31  AD4 ASN A 741  ? ALA A 749  ? ASN A 741  ALA A 749  1 ? 9  
HELX_P HELX_P32  AD5 SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P33  AD6 SER A 793  ? GLY A 798  ? SER A 793  GLY A 798  1 ? 6  
HELX_P HELX_P34  AD7 THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P35  AD8 ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P36  AD9 ASP A 874  ? ILE A 878  ? ASP A 874  ILE A 878  5 ? 5  
HELX_P HELX_P37  AE1 SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P38  AE2 GLY A 916  ? LEU A 920  ? GLY A 916  LEU A 920  5 ? 5  
HELX_P HELX_P39  AE3 ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P40  AE4 ASN A 959  ? PHE A 971  ? ASN A 959  PHE A 971  1 ? 13 
HELX_P HELX_P41  AE5 THR A 982  ? GLU A 995  ? THR A 982  GLU A 995  1 ? 14 
HELX_P HELX_P42  AE6 ASN A 1004 ? LEU A 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P43  AE7 ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P44  AE8 THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P45  AE9 MET A 1063 ? GLN A 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P46  AF1 SER A 1096 ? ASN A 1106 ? SER A 1096 ASN A 1106 1 ? 11 
HELX_P HELX_P47  AF2 GLU A 1121 ? ALA A 1125 ? GLU A 1121 ALA A 1125 5 ? 5  
HELX_P HELX_P48  AF3 ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P49  AF4 THR A 1142 ? SER A 1145 ? THR A 1142 SER A 1145 5 ? 4  
HELX_P HELX_P50  AF5 ILE A 1163 ? GLU A 1167 ? ILE A 1163 GLU A 1167 5 ? 5  
HELX_P HELX_P51  AF6 ASP A 1198 ? LYS A 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P52  AF7 THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P53  AF8 ASP A 1257 ? ASN A 1270 ? ASP A 1257 ASN A 1270 1 ? 14 
HELX_P HELX_P54  AF9 ASN A 1312 ? MET A 1317 ? ASN A 1312 MET A 1317 1 ? 6  
HELX_P HELX_P55  AG1 SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P56  AG2 GLY A 1340 ? SER A 1358 ? GLY A 1340 SER A 1358 1 ? 19 
HELX_P HELX_P57  AG3 ASN A 1364 ? THR A 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P58  AG4 GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P59  AG5 GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P60  AG6 GLU A 1404 ? ALA A 1416 ? GLU A 1404 ALA A 1416 1 ? 13 
HELX_P HELX_P61  AG7 GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P62  AG8 ILE A 1436 ? GLY A 1439 ? ILE A 1436 GLY A 1439 5 ? 4  
HELX_P HELX_P63  AG9 ASP A 1446 ? TYR A 1453 ? ASP A 1446 TYR A 1453 1 ? 8  
HELX_P HELX_P64  AH1 THR B 26   ? GLU B 28   ? THR B 26   GLU B 28   5 ? 3  
HELX_P HELX_P65  AH2 ASP B 29   ? LYS B 41   ? ASP B 29   LYS B 41   1 ? 13 
HELX_P HELX_P66  AH3 VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P67  AH4 TYR B 57   ? ILE B 63   ? TYR B 57   ILE B 63   1 ? 7  
HELX_P HELX_P68  AH5 TYR B 113  ? ARG B 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P69  AH6 THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P70  AH7 ILE B 282  ? LEU B 289  ? ILE B 282  LEU B 289  1 ? 8  
HELX_P HELX_P71  AH8 GLY B 295  ? CYS B 302  ? GLY B 295  CYS B 302  1 ? 8  
HELX_P HELX_P72  AH9 ASP B 307  ? GLY B 321  ? ASP B 307  GLY B 321  1 ? 15 
HELX_P HELX_P73  AI1 ASP B 326  ? ARG B 336  ? ASP B 326  ARG B 336  1 ? 11 
HELX_P HELX_P74  AI2 ARG B 348  ? GLU B 359  ? ARG B 348  GLU B 359  1 ? 12 
HELX_P HELX_P75  AI3 PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P76  AI4 HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P77  AI5 LEU B 408  ? MET B 432  ? LEU B 408  MET B 432  1 ? 25 
HELX_P HELX_P78  AI6 GLN B 433  ? THR B 435  ? GLN B 433  THR B 435  5 ? 3  
HELX_P HELX_P79  AI7 ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P80  AI8 THR B 487  ? LEU B 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P81  AI9 HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P82  AJ1 GLU B 529  ? CYS B 533  ? GLU B 529  CYS B 533  5 ? 5  
HELX_P HELX_P83  AJ2 PRO B 551  ? TRP B 561  ? PRO B 551  TRP B 561  1 ? 11 
HELX_P HELX_P84  AJ3 ASN B 592  ? ARG B 605  ? ASN B 592  ARG B 605  1 ? 14 
HELX_P HELX_P85  AJ4 ARG B 654  ? GLU B 665  ? ARG B 654  GLU B 665  1 ? 12 
HELX_P HELX_P86  AJ5 THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P87  AJ6 GLU B 696  ? ILE B 701  ? GLU B 696  ILE B 701  5 ? 6  
HELX_P HELX_P88  AJ7 HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P89  AJ8 GLY B 750  ? ILE B 755  ? GLY B 750  ILE B 755  1 ? 6  
HELX_P HELX_P90  AJ9 PHE B 758  ? ASN B 762  ? PHE B 758  ASN B 762  5 ? 5  
HELX_P HELX_P91  AK1 GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P92  AK2 LYS B 775  ? ALA B 777  ? LYS B 775  ALA B 777  5 ? 3  
HELX_P HELX_P93  AK3 ASN B 784  ? ARG B 788  ? ASN B 784  ARG B 788  5 ? 5  
HELX_P HELX_P94  AK4 ALA B 808  ? LYS B 813  ? ALA B 808  LYS B 813  1 ? 6  
HELX_P HELX_P95  AK5 GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P96  AK6 THR B 889  ? LEU B 893  ? THR B 889  LEU B 893  5 ? 5  
HELX_P HELX_P97  AK7 PRO B 1014 ? ILE B 1017 ? PRO B 1014 ILE B 1017 5 ? 4  
HELX_P HELX_P98  AK8 THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P99  AK9 THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P100 AL1 MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P101 AL2 GLY B 1121 ? ASP B 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P102 AL3 GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P103 AL4 ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P104 AL5 TYR B 1198 ? MET B 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P105 AL6 ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P106 AL7 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P107 AL8 ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P108 AL9 LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P109 AM1 HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P110 AM2 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P111 AM3 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P112 AM4 PRO C 239  ? GLN C 264  ? PRO C 239  GLN C 264  1 ? 26 
HELX_P HELX_P113 AM5 ASN D 51   ? GLN D 74   ? ASN D 51   GLN D 74   1 ? 24 
HELX_P HELX_P114 AM6 ARG D 119  ? THR D 134  ? ARG D 119  THR D 134  1 ? 16 
HELX_P HELX_P115 AM7 ASN D 138  ? SER D 152  ? ASN D 138  SER D 152  1 ? 15 
HELX_P HELX_P116 AM8 ASP D 156  ? LYS D 168  ? ASP D 156  LYS D 168  1 ? 13 
HELX_P HELX_P117 AM9 HIS D 173  ? LEU D 183  ? HIS D 173  LEU D 183  1 ? 11 
HELX_P HELX_P118 AN1 THR D 187  ? ILE D 195  ? THR D 187  ILE D 195  1 ? 9  
HELX_P HELX_P119 AN2 PRO D 196  ? ASN D 199  ? PRO D 196  ASN D 199  5 ? 4  
HELX_P HELX_P120 AN3 SER D 203  ? GLU D 218  ? SER D 203  GLU D 218  1 ? 16 
HELX_P HELX_P121 AN4 ASN E 5    ? GLY E 27   ? ASN E 5    GLY E 27   1 ? 23 
HELX_P HELX_P122 AN5 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P123 AN6 PRO E 38   ? CYS E 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P124 AN7 ARG E 55   ? SER E 59   ? ARG E 55   SER E 59   5 ? 5  
HELX_P HELX_P125 AN8 THR E 65   ? PHE E 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P126 AN9 GLY E 89   ? LYS E 103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P127 AO1 SER E 119  ? ILE E 127  ? SER E 119  ILE E 127  5 ? 9  
HELX_P HELX_P128 AO2 ALA E 138  ? VAL E 141  ? ALA E 138  VAL E 141  5 ? 4  
HELX_P HELX_P129 AO3 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P130 AO4 SER E 157  ? ARG E 169  ? SER E 157  ARG E 169  1 ? 13 
HELX_P HELX_P131 AO5 LYS E 171  ? LEU E 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P132 AO6 ASP E 182  ? LEU E 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P133 AO7 PRO F 75   ? ARG F 79   ? PRO F 75   ARG F 79   5 ? 5  
HELX_P HELX_P134 AO8 THR F 86   ? MET F 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P135 AO9 ASP F 116  ? GLU F 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P136 AP1 HIS G 14   ? PHE G 18   ? HIS G 14   PHE G 18   5 ? 5  
HELX_P HELX_P137 AP2 ARG G 21   ? GLU G 35   ? ARG G 21   GLU G 35   1 ? 15 
HELX_P HELX_P138 AP3 ASP G 50   ? ILE G 54   ? ASP G 50   ILE G 54   5 ? 5  
HELX_P HELX_P139 AP4 HIS G 113  ? MET G 115  ? HIS G 113  MET G 115  5 ? 3  
HELX_P HELX_P140 AP5 LYS J 17   ? GLU J 27   ? LYS J 17   GLU J 27   1 ? 11 
HELX_P HELX_P141 AP6 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P142 AP7 ARG J 43   ? THR J 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P143 AP8 LEU J 56   ? LEU J 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P144 AP9 ASP K 5    ? PHE K 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P145 AQ1 ASP K 39   ? LEU K 51   ? ASP K 39   LEU K 51   1 ? 13 
HELX_P HELX_P146 AQ2 ASP K 82   ? GLN K 112  ? ASP K 82   GLN K 112  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ?    ? A CYS 70   SG    ? ? ? 1_555 A CYS 77  SG ? ? A CYS 70   A CYS 77   1_555 ? ? ? ? ? ? ?              2.404 
? 
disulf2  disulf ?    ? A CYS 107  SG    ? ? ? 1_555 A CYS 167 SG ? ? A CYS 107  A CYS 167  1_555 ? ? ? ? ? ? ?              2.700 
? 
disulf3  disulf ?    ? A CYS 107  SG    ? ? ? 1_555 A CYS 148 SG ? ? A CYS 107  A CYS 148  1_555 ? ? ? ? ? ? ?              2.574 
? 
metalc1  metalc ?    ? A CYS 67   O     ? ? ? 1_555 Q ZN  .   ZN ? ? A CYS 67   A ZN  1802 1_555 ? ? ? ? ? ? ?              2.432 
? 
metalc2  metalc ?    ? A CYS 67   SG    ? ? ? 1_555 Q ZN  .   ZN ? ? A CYS 67   A ZN  1802 1_555 ? ? ? ? ? ? ?              2.301 
? 
metalc3  metalc ?    ? A CYS 70   N     ? ? ? 1_555 Q ZN  .   ZN ? ? A CYS 70   A ZN  1802 1_555 ? ? ? ? ? ? ?              2.241 
? 
metalc4  metalc ?    ? A CYS 70   SG    ? ? ? 1_555 Q ZN  .   ZN ? ? A CYS 70   A ZN  1802 1_555 ? ? ? ? ? ? ?              2.309 
? 
metalc5  metalc ?    ? A CYS 77   SG    ? ? ? 1_555 Q ZN  .   ZN ? ? A CYS 77   A ZN  1802 1_555 ? ? ? ? ? ? ?              2.291 
? 
metalc6  metalc ?    ? A HIS 80   NE2   ? ? ? 1_555 Q ZN  .   ZN ? ? A HIS 80   A ZN  1802 1_555 ? ? ? ? ? ? ?              2.103 
? 
metalc7  metalc ?    ? A CYS 107  SG    ? ? ? 1_555 P ZN  .   ZN ? ? A CYS 107  A ZN  1801 1_555 ? ? ? ? ? ? ?              2.315 
? 
metalc8  metalc ?    ? A CYS 110  SG    ? ? ? 1_555 P ZN  .   ZN ? ? A CYS 110  A ZN  1801 1_555 ? ? ? ? ? ? ?              2.335 
? 
metalc9  metalc ?    ? A CYS 148  SG    ? ? ? 1_555 P ZN  .   ZN ? ? A CYS 148  A ZN  1801 1_555 ? ? ? ? ? ? ?              2.320 
? 
metalc10 metalc ?    ? A CYS 167  SG    ? ? ? 1_555 P ZN  .   ZN ? ? A CYS 167  A ZN  1801 1_555 ? ? ? ? ? ? ?              2.321 
? 
metalc11 metalc ?    ? A ASP 481  OD1   ? ? ? 1_555 R MG  .   MG ? ? A ASP 481  A MG  1803 1_555 ? ? ? ? ? ? ?              1.940 
? 
metalc12 metalc ?    ? A ASP 481  OD2   ? ? ? 1_555 R MG  .   MG ? ? A ASP 481  A MG  1803 1_555 ? ? ? ? ? ? ?              2.416 
? 
metalc13 metalc ?    ? A ASP 483  OD1   ? ? ? 1_555 R MG  .   MG ? ? A ASP 483  A MG  1803 1_555 ? ? ? ? ? ? ?              1.863 
? 
metalc14 metalc ?    ? A ASP 483  OD2   ? ? ? 1_555 R MG  .   MG ? ? A ASP 483  A MG  1803 1_555 ? ? ? ? ? ? ?              2.091 
? 
metalc15 metalc ?    ? A ASP 485  OD1   ? ? ? 1_555 R MG  .   MG ? ? A ASP 485  A MG  1803 1_555 ? ? ? ? ? ? ?              2.907 
? 
metalc16 metalc ?    ? B CYS 1163 SG    ? ? ? 1_555 S ZN  .   ZN ? ? B CYS 1163 B ZN  1301 1_555 ? ? ? ? ? ? ?              2.321 
? 
metalc17 metalc ?    ? B CYS 1166 SG    ? ? ? 1_555 S ZN  .   ZN ? ? B CYS 1166 B ZN  1301 1_555 ? ? ? ? ? ? ?              2.315 
? 
metalc18 metalc ?    ? B CYS 1182 SG    ? ? ? 1_555 S ZN  .   ZN ? ? B CYS 1182 B ZN  1301 1_555 ? ? ? ? ? ? ?              2.312 
? 
metalc19 metalc ?    ? B CYS 1185 SG    ? ? ? 1_555 S ZN  .   ZN ? ? B CYS 1185 B ZN  1301 1_555 ? ? ? ? ? ? ?              2.262 
? 
metalc20 metalc ?    ? C CYS 86   SG    ? ? ? 1_555 T ZN  .   ZN ? ? C CYS 86   C ZN  401  1_555 ? ? ? ? ? ? ?              2.314 
? 
metalc21 metalc ?    ? C CYS 88   SG    ? ? ? 1_555 T ZN  .   ZN ? ? C CYS 88   C ZN  401  1_555 ? ? ? ? ? ? ?              2.287 
? 
metalc22 metalc ?    ? C CYS 92   SG    ? ? ? 1_555 T ZN  .   ZN ? ? C CYS 92   C ZN  401  1_555 ? ? ? ? ? ? ?              2.330 
? 
metalc23 metalc ?    ? C CYS 95   SG    ? ? ? 1_555 T ZN  .   ZN ? ? C CYS 95   C ZN  401  1_555 ? ? ? ? ? ? ?              2.307 
? 
metalc24 metalc ?    ? I CYS 7    SG    ? ? ? 1_555 U ZN  .   ZN ? ? I CYS 7    I ZN  201  1_555 ? ? ? ? ? ? ?              2.298 
? 
metalc25 metalc ?    ? I CYS 10   SG    ? ? ? 1_555 U ZN  .   ZN ? ? I CYS 10   I ZN  201  1_555 ? ? ? ? ? ? ?              2.320 
? 
metalc26 metalc ?    ? I CYS 29   SG    ? ? ? 1_555 U ZN  .   ZN ? ? I CYS 29   I ZN  201  1_555 ? ? ? ? ? ? ?              2.290 
? 
metalc27 metalc ?    ? I CYS 32   SG    ? ? ? 1_555 U ZN  .   ZN ? ? I CYS 32   I ZN  201  1_555 ? ? ? ? ? ? ?              2.323 
? 
metalc28 metalc ?    ? I CYS 75   SG    ? ? ? 1_555 V ZN  .   ZN ? ? I CYS 75   I ZN  202  1_555 ? ? ? ? ? ? ?              2.313 
? 
metalc29 metalc ?    ? I CYS 78   SG    ? ? ? 1_555 V ZN  .   ZN ? ? I CYS 78   I ZN  202  1_555 ? ? ? ? ? ? ?              2.306 
? 
metalc30 metalc ?    ? I CYS 103  SG    ? ? ? 1_555 V ZN  .   ZN ? ? I CYS 103  I ZN  202  1_555 ? ? ? ? ? ? ?              2.318 
? 
metalc31 metalc ?    ? I CYS 106  SG    ? ? ? 1_555 V ZN  .   ZN ? ? I CYS 106  I ZN  202  1_555 ? ? ? ? ? ? ?              2.311 
? 
metalc32 metalc ?    ? J CYS 7    SG    ? ? ? 1_555 W ZN  .   ZN ? ? J CYS 7    J ZN  101  1_555 ? ? ? ? ? ? ?              2.360 
? 
metalc33 metalc ?    ? J CYS 10   SG    ? ? ? 1_555 W ZN  .   ZN ? ? J CYS 10   J ZN  101  1_555 ? ? ? ? ? ? ?              2.348 
? 
metalc34 metalc ?    ? J CYS 45   SG    ? ? ? 1_555 W ZN  .   ZN ? ? J CYS 45   J ZN  101  1_555 ? ? ? ? ? ? ?              2.365 
? 
metalc35 metalc ?    ? J CYS 46   SG    ? ? ? 1_555 W ZN  .   ZN ? ? J CYS 46   J ZN  101  1_555 ? ? ? ? ? ? ?              2.383 
? 
metalc36 metalc ?    ? L CYS 31   SG    ? ? ? 1_555 X ZN  .   ZN ? ? L CYS 31   L ZN  101  1_555 ? ? ? ? ? ? ?              2.373 
? 
metalc37 metalc ?    ? L CYS 34   SG    ? ? ? 1_555 X ZN  .   ZN ? ? L CYS 34   L ZN  101  1_555 ? ? ? ? ? ? ?              2.285 
? 
metalc38 metalc ?    ? L CYS 48   SG    ? ? ? 1_555 X ZN  .   ZN ? ? L CYS 48   L ZN  101  1_555 ? ? ? ? ? ? ?              2.345 
? 
metalc39 metalc ?    ? L CYS 51   SG    ? ? ? 1_555 X ZN  .   ZN ? ? L CYS 51   L ZN  101  1_555 ? ? ? ? ? ? ?              2.364 
? 
covale1  covale both ? M DG  14   "O3'" ? ? ? 1_555 M 4DU 15  P  ? ? T DG  17   T 4DU 18   1_555 ? ? ? ? ? ? ?              1.589 
? 
covale2  covale one  ? M 4DU 15   "O3'" ? ? ? 1_555 M DC  16  P  ? ? T 4DU 18   T DC  19   1_555 ? ? ? ? ? ? ?              1.610 
? 
covale3  covale none ? M 4DU 15   C3    ? ? ? 1_555 Y AHW .   C1 ? ? T 4DU 18   T AHW 101  1_555 ? ? ? ? ? ? ?              1.592 
? 
covale4  covale both ? M DC  18   "O3'" ? ? ? 1_555 M BRU 19  P  ? ? T DC  21   T BRU 22   1_555 ? ? ? ? ? ? ?              1.591 
? 
covale5  covale both ? M BRU 19   "O3'" ? ? ? 1_555 M DC  20  P  ? ? T BRU 22   T DC  23   1_555 ? ? ? ? ? ? ?              1.604 
? 
metalc40 metalc ?    ? O G   11   "O3'" ? ? ? 1_555 R MG  .   MG ? ? P G   10   A MG  1803 1_555 ? ? ? ? ? ? ?              1.862 
? 
hydrog1  hydrog ?    ? M DA  7    N1    ? ? ? 1_555 N DT  8   N3 ? ? T DA  10   N DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog2  hydrog ?    ? M DA  7    N6    ? ? ? 1_555 N DT  8   O4 ? ? T DA  10   N DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog3  hydrog ?    ? M DC  8    N3    ? ? ? 1_555 N DG  7   N1 ? ? T DC  11   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog4  hydrog ?    ? M DC  8    N4    ? ? ? 1_555 N DG  7   O6 ? ? T DC  11   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog5  hydrog ?    ? M DC  8    O2    ? ? ? 1_555 N DG  7   N2 ? ? T DC  11   N DG  6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog6  hydrog ?    ? M DT  9    N3    ? ? ? 1_555 N DA  6   N1 ? ? T DT  12   N DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog7  hydrog ?    ? M DT  9    O4    ? ? ? 1_555 N DA  6   N6 ? ? T DT  12   N DA  5    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog8  hydrog ?    ? M DA  10   N1    ? ? ? 1_555 N DT  5   N3 ? ? T DA  13   N DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog9  hydrog ?    ? M DA  10   N6    ? ? ? 1_555 N DT  5   O4 ? ? T DA  13   N DT  4    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog10 hydrog ?    ? M DC  11   N3    ? ? ? 1_555 N DG  4   N1 ? ? T DC  14   N DG  3    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog11 hydrog ?    ? M DC  11   N4    ? ? ? 1_555 N DG  4   O6 ? ? T DC  14   N DG  3    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog12 hydrog ?    ? M DC  11   O2    ? ? ? 1_555 N DG  4   N2 ? ? T DC  14   N DG  3    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog13 hydrog ?    ? M DT  12   N3    ? ? ? 1_555 N DA  3   N1 ? ? T DT  15   N DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog14 hydrog ?    ? M DT  12   O4    ? ? ? 1_555 N DA  3   N6 ? ? T DT  15   N DA  2    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog15 hydrog ?    ? M DT  13   N3    ? ? ? 1_555 N DA  2   N1 ? ? T DT  16   N DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog16 hydrog ?    ? M DT  13   O4    ? ? ? 1_555 N DA  2   N6 ? ? T DT  16   N DA  1    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog17 hydrog ?    ? M DC  16   N3    ? ? ? 1_555 O G   11  N1 ? ? T DC  19   P G   10   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog18 hydrog ?    ? M DC  16   N4    ? ? ? 1_555 O G   11  O6 ? ? T DC  19   P G   10   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog19 hydrog ?    ? M DC  16   O2    ? ? ? 1_555 O G   11  N2 ? ? T DC  19   P G   10   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog20 hydrog ?    ? M DC  17   N3    ? ? ? 1_555 O G   10  N1 ? ? T DC  20   P G   9    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog21 hydrog ?    ? M DC  17   N4    ? ? ? 1_555 O G   10  O6 ? ? T DC  20   P G   9    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog22 hydrog ?    ? M DC  17   O2    ? ? ? 1_555 O G   10  N2 ? ? T DC  20   P G   9    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog23 hydrog ?    ? M DC  17   N3    ? ? ? 1_555 O G   11  N1 ? ? T DC  20   P G   10   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog24 hydrog ?    ? M DC  17   N4    ? ? ? 1_555 O G   11  O6 ? ? T DC  20   P G   10   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog25 hydrog ?    ? M DC  17   O2    ? ? ? 1_555 O G   11  N2 ? ? T DC  20   P G   10   1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog26 hydrog ?    ? M DC  18   N3    ? ? ? 1_555 O G   9   N1 ? ? T DC  21   P G   8    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog27 hydrog ?    ? M DC  18   N4    ? ? ? 1_555 O G   9   O6 ? ? T DC  21   P G   8    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog28 hydrog ?    ? M DC  18   O2    ? ? ? 1_555 O G   9   N2 ? ? T DC  21   P G   8    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog29 hydrog ?    ? M BRU 19   N3    ? ? ? 1_555 O A   8   N1 ? ? T BRU 22   P A   7    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog30 hydrog ?    ? M BRU 19   O4    ? ? ? 1_555 O A   8   N6 ? ? T BRU 22   P A   7    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog31 hydrog ?    ? M DC  20   N3    ? ? ? 1_555 O G   7   N1 ? ? T DC  23   P G   6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog32 hydrog ?    ? M DC  20   N4    ? ? ? 1_555 O G   7   O6 ? ? T DC  23   P G   6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog33 hydrog ?    ? M DC  20   O2    ? ? ? 1_555 O G   7   N2 ? ? T DC  23   P G   6    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog34 hydrog ?    ? M DC  21   N3    ? ? ? 1_555 O G   6   N1 ? ? T DC  24   P G   5    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog35 hydrog ?    ? M DC  21   N4    ? ? ? 1_555 O G   6   O6 ? ? T DC  24   P G   5    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog36 hydrog ?    ? M DC  21   O2    ? ? ? 1_555 O G   6   N2 ? ? T DC  24   P G   5    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog37 hydrog ?    ? M DT  22   N3    ? ? ? 1_555 O A   5   N1 ? ? T DT  25   P A   4    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog38 hydrog ?    ? M DT  22   O4    ? ? ? 1_555 O A   5   N6 ? ? T DT  25   P A   4    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog39 hydrog ?    ? M DC  23   N3    ? ? ? 1_555 O G   4   N1 ? ? T DC  26   P G   3    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog40 hydrog ?    ? M DC  23   N4    ? ? ? 1_555 O G   4   O6 ? ? T DC  26   P G   3    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog41 hydrog ?    ? M DC  23   O2    ? ? ? 1_555 O G   4   N2 ? ? T DC  26   P G   3    1_555 ? ? ? ? ? ? WATSON-CRICK   ?     
? 
hydrog42 hydrog ?    ? M DA  24   N1    ? ? ? 1_555 O C   3   N4 ? ? T DA  27   P C   2    1_555 ? ? ? ? ? ? 'DA-C MISPAIR' ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLN 447  A . ? GLN 447  A PRO 448  A ? PRO 448  A 1 4.15  
2 LEU 1081 A . ? LEU 1081 A ASN 1082 A ? ASN 1082 A 1 12.65 
3 PRO 128  E . ? PRO 128  E PRO 129  E ? PRO 129  E 1 2.64  
4 ASN 126  G . ? ASN 126  G PRO 127  G ? PRO 127  G 1 -6.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 8 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 7 ? 
AB9 ? 5 ? 
AC1 ? 3 ? 
AC2 ? 2 ? 
AC3 ? 3 ? 
AC4 ? 4 ? 
AC5 ? 5 ? 
AC6 ? 3 ? 
AC7 ? 4 ? 
AC8 ? 5 ? 
AC9 ? 5 ? 
AD1 ? 7 ? 
AD2 ? 2 ? 
AD3 ? 8 ? 
AD4 ? 2 ? 
AD5 ? 2 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 2 ? 
AD9 ? 4 ? 
AE1 ? 5 ? 
AE2 ? 2 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 4 ? 
AE6 ? 2 ? 
AE7 ? 4 ? 
AE8 ? 7 ? 
AE9 ? 3 ? 
AF1 ? 9 ? 
AF2 ? 3 ? 
AF3 ? 3 ? 
AF4 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA6 4 5 ? anti-parallel 
AA6 5 6 ? parallel      
AA6 6 7 ? anti-parallel 
AA6 7 8 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB8 5 6 ? anti-parallel 
AB8 6 7 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AB9 4 5 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? parallel      
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? parallel      
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? parallel      
AC8 4 5 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AC9 4 5 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? anti-parallel 
AD1 6 7 ? anti-parallel 
AD2 1 2 ? parallel      
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD3 4 5 ? parallel      
AD3 5 6 ? anti-parallel 
AD3 6 7 ? parallel      
AD3 7 8 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE1 4 5 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? parallel      
AE5 3 4 ? parallel      
AE6 1 2 ? parallel      
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? parallel      
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? parallel      
AE8 4 5 ? anti-parallel 
AE8 5 6 ? anti-parallel 
AE8 6 7 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF1 4 5 ? anti-parallel 
AF1 5 6 ? anti-parallel 
AF1 6 7 ? anti-parallel 
AF1 7 8 ? anti-parallel 
AF1 8 9 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF4 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
AA1 2 GLU A 16   ? LEU A 21   ? GLU A 16   LEU A 21   
AA1 3 ILE B 1212 ? TYR B 1217 ? ILE B 1212 TYR B 1217 
AA2 1 GLY A 82   ? PHE A 91   ? GLY A 82   PHE A 91   
AA2 2 ILE A 235  ? VAL A 241  ? ILE A 235  VAL A 241  
AA3 1 ASP A 151  ? VAL A 152  ? ASP A 151  VAL A 152  
AA3 2 VAL A 162  ? SER A 163  ? VAL A 162  SER A 163  
AA4 1 THR A 173  ? ASP A 177  ? THR A 173  ASP A 177  
AA4 2 LYS A 180  ? SER A 184  ? LYS A 180  SER A 184  
AA4 3 LEU A 199  ? VAL A 201  ? LEU A 199  VAL A 201  
AA5 1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
AA5 2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
AA6 1 HIS B 1104 ? ALA B 1105 ? HIS B 1104 ALA B 1105 
AA6 2 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AA6 3 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
AA6 4 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
AA6 5 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
AA6 6 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
AA6 7 PHE A 468  ? LEU A 470  ? PHE A 468  LEU A 470  
AA6 8 SER A 348  ? GLY A 355  ? SER A 348  GLY A 355  
AA7 1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
AA7 2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
AA7 3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
AA7 4 ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
AA8 1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
AA8 2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
AA9 1 PHE A 540  ? ILE A 541  ? PHE A 540  ILE A 541  
AA9 2 TRP A 572  ? SER A 573  ? TRP A 572  SER A 573  
AB1 1 LEU A 588  ? ARG A 590  ? LEU A 588  ARG A 590  
AB1 2 MET A 605  ? ILE A 608  ? MET A 605  ILE A 608  
AB1 3 GLN A 611  ? PHE A 614  ? GLN A 611  PHE A 614  
AB2 1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
AB2 2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
AB3 1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
AB3 2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
AB3 3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
AB4 1 GLU A 879  ? SER A 882  ? GLU A 879  SER A 882  
AB4 2 ASN A 953  ? LEU A 956  ? ASN A 953  LEU A 956  
AB5 1 VAL A 1282 ? TYR A 1287 ? VAL A 1282 TYR A 1287 
AB5 2 GLU A 1303 ? THR A 1308 ? GLU A 1303 THR A 1308 
AB5 3 LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
AB5 4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
AB6 1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
AB6 2 ILE A 1237 ? VAL A 1242 ? ILE A 1237 VAL A 1242 
AB6 3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
AB6 4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
AB6 5 LEU I 42   ? GLU I 47   ? LEU I 42   GLU I 47   
AB7 1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
AB7 2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
AB8 1 ILE D 48   ? LEU D 50   ? ILE D 48   LEU D 50   
AB8 2 PHE G 2    ? LEU G 13   ? PHE G 2    LEU G 13   
AB8 3 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
AB8 4 GLY G 59   ? ILE G 61   ? GLY G 59   ILE G 61   
AB8 5 PHE A 1441 ? ILE A 1445 ? PHE A 1441 ILE A 1445 
AB8 6 LEU F 132  ? TYR F 137  ? LEU F 132  TYR F 137  
AB8 7 PHE F 143  ? SER F 147  ? PHE F 143  SER F 147  
AB9 1 ILE D 48   ? LEU D 50   ? ILE D 48   LEU D 50   
AB9 2 PHE G 2    ? LEU G 13   ? PHE G 2    LEU G 13   
AB9 3 ALA G 68   ? PHE G 79   ? ALA G 68   PHE G 79   
AB9 4 GLY G 43   ? VAL G 48   ? GLY G 43   VAL G 48   
AB9 5 CYS G 38   ? THR G 39   ? CYS G 38   THR G 39   
AC1 1 TYR B 96   ? VAL B 97   ? TYR B 96   VAL B 97   
AC1 2 SER B 125  ? VAL B 130  ? SER B 125  VAL B 130  
AC1 3 VAL B 165  ? PRO B 171  ? VAL B 165  PRO B 171  
AC2 1 MET B 101  ? ASN B 103  ? MET B 101  ASN B 103  
AC2 2 THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
AC3 1 PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
AC3 2 SER B 208  ? VAL B 211  ? SER B 208  VAL B 211  
AC3 3 GLN B 481  ? VAL B 482  ? GLN B 481  VAL B 482  
AC4 1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
AC4 2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
AC4 3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
AC4 4 LYS B 537  ? ASN B 538  ? LYS B 537  ASN B 538  
AC5 1 VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
AC5 2 ILE B 234  ? SER B 242  ? ILE B 234  SER B 242  
AC5 3 SER B 252  ? TYR B 259  ? SER B 252  TYR B 259  
AC5 4 ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
AC5 5 ASP B 279  ? PRO B 281  ? ASP B 279  PRO B 281  
AC6 1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
AC6 2 VAL B 633  ? ILE B 639  ? VAL B 633  ILE B 639  
AC6 3 VAL B 690  ? ILE B 693  ? VAL B 690  ILE B 693  
AC7 1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
AC7 2 VAL B 633  ? ILE B 639  ? VAL B 633  ILE B 639  
AC7 3 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
AC7 4 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
AC8 1 GLU B 564  ? PRO B 565  ? GLU B 564  PRO B 565  
AC8 2 VAL B 585  ? HIS B 590  ? VAL B 585  HIS B 590  
AC8 3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
AC8 4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
AC8 5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
AC9 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
AC9 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
AC9 3 PHE B 963  ? LYS B 972  ? PHE B 963  LYS B 972  
AC9 4 GLY B 947  ? THR B 955  ? GLY B 947  THR B 955  
AC9 5 ARG B 904  ? VAL B 905  ? ARG B 904  VAL B 905  
AD1 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
AD1 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
AD1 3 PHE B 963  ? LYS B 972  ? PHE B 963  LYS B 972  
AD1 4 GLY B 947  ? THR B 955  ? GLY B 947  THR B 955  
AD1 5 LEU L 56   ? LYS L 58   ? LEU L 56   LYS L 58   
AD1 6 TYR L 29   ? CYS L 31   ? TYR L 29   CYS L 31   
AD1 7 LYS L 37   ? LEU L 38   ? LYS L 37   LEU L 38   
AD2 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
AD2 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
AD3 1 PHE B 1069 ? GLU B 1070 ? PHE B 1069 GLU B 1070 
AD3 2 ILE B 1085 ? ARG B 1094 ? ILE B 1085 ARG B 1094 
AD3 3 LYS B 979  ? ALA B 981  ? LYS B 979  ALA B 981  
AD3 4 LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
AD3 5 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
AD3 6 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
AD3 7 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
AD3 8 ILE B 1085 ? ARG B 1094 ? ILE B 1085 ARG B 1094 
AD4 1 THR B 873  ? PHE B 874  ? THR B 873  PHE B 874  
AD4 2 LYS B 914  ? THR B 915  ? LYS B 914  THR B 915  
AD5 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
AD5 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
AD6 1 PHE B 1001 ? THR B 1002 ? PHE B 1001 THR B 1002 
AD6 2 MET B 1072 ? TYR B 1073 ? MET B 1072 TYR B 1073 
AD7 1 ALA B 1157 ? CYS B 1163 ? ALA B 1157 CYS B 1163 
AD7 2 ILE B 1191 ? PRO B 1197 ? ILE B 1191 PRO B 1197 
AD8 1 ILE B 1172 ? LYS B 1174 ? ILE B 1172 LYS B 1174 
AD8 2 GLN B 1179 ? GLU B 1181 ? GLN B 1179 GLU B 1181 
AD9 1 GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
AD9 2 ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
AD9 3 THR C 227  ? SER C 234  ? THR C 227  SER C 234  
AD9 4 ALA C 173  ? GLU C 179  ? ALA C 173  GLU C 179  
AE1 1 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
AE1 2 VAL C 97   ? PHE C 104  ? VAL C 97   PHE C 104  
AE1 3 GLU C 152  ? ILE C 163  ? GLU C 152  ILE C 163  
AE1 4 PRO C 42   ? ASN C 54   ? PRO C 42   ASN C 54   
AE1 5 VAL L 65   ? GLU L 68   ? VAL L 65   GLU L 68   
AE2 1 LEU C 72   ? SER C 74   ? LEU C 72   SER C 74   
AE2 2 ILE C 129  ? PRO C 132  ? ILE C 129  PRO C 132  
AE3 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
AE3 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
AE4 1 LYS D 36   ? ILE D 38   ? LYS D 36   ILE D 38   
AE4 2 GLU D 44   ? GLU D 46   ? GLU D 44   GLU D 46   
AE5 1 PHE E 60   ? ALA E 62   ? PHE E 60   ALA E 62   
AE5 2 LEU E 78   ? PHE E 82   ? LEU E 78   PHE E 82   
AE5 3 THR E 107  ? TYR E 112  ? THR E 107  TYR E 112  
AE5 4 THR E 131  ? ASN E 136  ? THR E 131  ASN E 136  
AE6 1 SER E 87   ? VAL E 88   ? SER E 87   VAL E 88   
AE6 2 ASN E 115  ? ILE E 116  ? ASN E 115  ILE E 116  
AE7 1 LYS E 152  ? ARG E 155  ? LYS E 152  ARG E 155  
AE7 2 VAL E 195  ? LYS E 201  ? VAL E 195  LYS E 201  
AE7 3 ARG E 207  ? CYS E 214  ? ARG E 207  CYS E 214  
AE7 4 ARG E 177  ? ILE E 178  ? ARG E 177  ILE E 178  
AE8 1 GLY G 169  ? ALA G 170  ? GLY G 169  ALA G 170  
AE8 2 ARG G 142  ? SER G 152  ? ARG G 142  SER G 152  
AE8 3 ILE G 157  ? SER G 162  ? ILE G 157  SER G 162  
AE8 4 MET G 106  ? THR G 111  ? MET G 106  THR G 111  
AE8 5 GLY G 98   ? VAL G 103  ? GLY G 98   VAL G 103  
AE8 6 VAL G 86   ? SER G 95   ? VAL G 86   SER G 95   
AE8 7 ARG G 142  ? SER G 152  ? ARG G 142  SER G 152  
AE9 1 THR G 120  ? ASN G 122  ? THR G 120  ASN G 122  
AE9 2 SER G 129  ? GLN G 131  ? SER G 129  GLN G 131  
AE9 3 VAL G 136  ? ILE G 137  ? VAL G 136  ILE G 137  
AF1 1 TYR H 95   ? TYR H 98   ? TYR H 95   TYR H 98   
AF1 2 TYR H 141  ? ARG H 145  ? TYR H 141  ARG H 145  
AF1 3 LEU H 55   ? ALA H 60   ? LEU H 55   ALA H 60   
AF1 4 THR H 4    ? ASP H 16   ? THR H 4    ASP H 16   
AF1 5 VAL H 23   ? SER H 30   ? VAL H 23   SER H 30   
AF1 6 LYS H 37   ? ASN H 43   ? LYS H 37   ASN H 43   
AF1 7 LEU H 121  ? GLY H 127  ? LEU H 121  GLY H 127  
AF1 8 LEU H 111  ? PHE H 118  ? LEU H 111  PHE H 118  
AF1 9 THR H 100  ? SER H 108  ? THR H 100  SER H 108  
AF2 1 TYR I 15   ? ASP I 19   ? TYR I 15   ASP I 19   
AF2 2 ARG I 24   ? GLU I 28   ? ARG I 24   GLU I 28   
AF2 3 VAL I 35   ? GLU I 37   ? VAL I 35   GLU I 37   
AF3 1 ASN I 83   ? GLN I 87   ? ASN I 83   GLN I 87   
AF3 2 LEU I 99   ? CYS I 103  ? LEU I 99   CYS I 103  
AF3 3 ILE I 109  ? THR I 111  ? ILE I 109  THR I 111  
AF4 1 LEU K 19   ? PRO K 23   ? LEU K 19   PRO K 23   
AF4 2 ALA K 30   ? GLU K 36   ? ALA K 30   GLU K 36   
AF4 3 ARG K 70   ? THR K 77   ? ARG K 70   THR K 77   
AF4 4 VAL K 56   ? LYS K 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ASP A 1419 ? O ASP A 1419 N VAL A 17   ? N VAL A 17   
AA1 2 3 N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
AA2 1 2 N GLY A 82   ? N GLY A 82   O VAL A 241  ? O VAL A 241  
AA3 1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
AA4 1 2 N ARG A 175  ? N ARG A 175  O VAL A 182  ? O VAL A 182  
AA4 2 3 N GLY A 183  ? N GLY A 183  O ARG A 200  ? O ARG A 200  
AA5 1 2 N LYS A 343  ? N LYS A 343  O PHE B 1130 ? O PHE B 1130 
AA6 1 2 O HIS B 1104 ? O HIS B 1104 N ARG A 350  ? N ARG A 350  
AA6 2 3 N ALA A 349  ? N ALA A 349  O LEU A 489  ? O LEU A 489  
AA6 3 4 O ASN A 488  ? O ASN A 488  N ASN A 445  ? N ASN A 445  
AA6 4 5 N VAL A 442  ? N VAL A 442  O HIS A 458  ? O HIS A 458  
AA6 5 6 O ILE A 463  ? O ILE A 463  N VAL A 366  ? N VAL A 366  
AA6 6 7 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
AA6 7 8 O PHE A 468  ? O PHE A 468  N SER A 354  ? N SER A 354  
AA7 1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
AA7 2 3 O GLU A 433  ? O GLU A 433  N TYR A 404  ? N TYR A 404  
AA7 3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
AA8 1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
AA9 1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
AB1 1 2 N LEU A 588  ? N LEU A 588  O ILE A 607  ? O ILE A 607  
AB1 2 3 N LEU A 606  ? N LEU A 606  O ILE A 613  ? O ILE A 613  
AB2 1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
AB3 1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
AB3 2 3 N THR A 856  ? N THR A 856  O ILE A 864  ? O ILE A 864  
AB4 1 2 N GLU A 879  ? N GLU A 879  O LEU A 956  ? O LEU A 956  
AB5 1 2 N MET A 1285 ? N MET A 1285 O VAL A 1305 ? O VAL A 1305 
AB5 2 3 O LEU A 1306 ? O LEU A 1306 N VAL A 1118 ? N VAL A 1118 
AB5 3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
AB6 1 2 N PHE A 1225 ? N PHE A 1225 O ARG A 1241 ? O ARG A 1241 
AB6 2 3 O ILE A 1238 ? O ILE A 1238 N LEU A 1195 ? N LEU A 1195 
AB6 3 4 O GLU A 1196 ? O GLU A 1196 N ILE A 1148 ? N ILE A 1148 
AB6 4 5 N ILE A 1152 ? N ILE A 1152 O VAL I 43   ? O VAL I 43   
AB7 1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
AB8 1 2 N LEU D 50   ? N LEU D 50   O PHE G 2    ? O PHE G 2    
AB8 2 3 N LEU G 7    ? N LEU G 7    O TYR G 74   ? O TYR G 74   
AB8 3 4 O GLU G 69   ? O GLU G 69   N ARG G 60   ? N ARG G 60   
AB8 4 5 O ILE G 61   ? O ILE G 61   N VAL A 1443 ? N VAL A 1443 
AB8 5 6 N MET A 1444 ? N MET A 1444 O VAL F 133  ? O VAL F 133  
AB8 6 7 N ILE F 134  ? N ILE F 134  O TRP F 146  ? O TRP F 146  
AB9 1 2 N LEU D 50   ? N LEU D 50   O PHE G 2    ? O PHE G 2    
AB9 2 3 N LEU G 7    ? N LEU G 7    O TYR G 74   ? O TYR G 74   
AB9 3 4 O PHE G 79   ? O PHE G 79   N TYR G 44   ? N TYR G 44   
AB9 4 5 O GLY G 43   ? O GLY G 43   N THR G 39   ? N THR G 39   
AC1 1 2 N TYR B 96   ? N TYR B 96   O PHE B 129  ? O PHE B 129  
AC1 2 3 N VAL B 130  ? N VAL B 130  O VAL B 165  ? O VAL B 165  
AC2 1 2 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
AC3 1 2 N PHE B 203  ? N PHE B 203  O LYS B 210  ? O LYS B 210  
AC3 2 3 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
AC4 1 2 O ASP B 407  ? O ASP B 407  N GLN B 215  ? N GLN B 215  
AC4 2 3 N ALA B 214  ? N ALA B 214  O ASN B 499  ? O ASN B 499  
AC4 3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
AC5 1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
AC5 2 3 N ILE B 240  ? N ILE B 240  O LEU B 254  ? O LEU B 254  
AC5 3 4 N GLN B 255  ? N GLN B 255  O THR B 272  ? O THR B 272  
AC5 4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
AC6 1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
AC6 2 3 N ARG B 635  ? N ARG B 635  O ILE B 693  ? O ILE B 693  
AC7 1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
AC7 2 3 N PHE B 638  ? N PHE B 638  O CYS B 741  ? O CYS B 741  
AC7 3 4 O HIS B 740  ? O HIS B 740  N ALA B 704  ? N ALA B 704  
AC8 1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
AC8 2 3 O VAL B 585  ? O VAL B 585  N VAL B 582  ? N VAL B 582  
AC8 3 4 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
AC8 4 5 O LYS B 625  ? O LYS B 625  N ILE B 616  ? N ILE B 616  
AC9 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AC9 2 3 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
AC9 3 4 O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
AC9 4 5 O GLY B 947  ? O GLY B 947  N VAL B 905  ? N VAL B 905  
AD1 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
AD1 2 3 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
AD1 3 4 O ARG B 969  ? O ARG B 969  N ILE B 948  ? N ILE B 948  
AD1 4 5 N VAL B 954  ? N VAL B 954  O LEU L 56   ? O LEU L 56   
AD1 5 6 O LEU L 57   ? O LEU L 57   N ILE L 30   ? N ILE L 30   
AD1 6 7 N TYR L 29   ? N TYR L 29   O LEU L 38   ? O LEU L 38   
AD2 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
AD3 1 2 N GLU B 1070 ? N GLU B 1070 O ILE B 1085 ? O ILE B 1085 
AD3 2 3 O GLN B 1093 ? O GLN B 1093 N ALA B 981  ? N ALA B 981  
AD3 3 4 N PHE B 980  ? N PHE B 980  O GLY B 988  ? O GLY B 988  
AD3 4 5 O GLY B 991  ? O GLY B 991  N MET B 839  ? N MET B 839  
AD3 5 6 N ILE B 840  ? N ILE B 840  O ILE B 1011 ? O ILE B 1011 
AD3 6 7 O LEU B 1010 ? O LEU B 1010 N ILE B 824  ? N ILE B 824  
AD3 7 8 N GLN B 821  ? N GLN B 821  O TYR B 1092 ? O TYR B 1092 
AD4 1 2 N THR B 873  ? N THR B 873  O THR B 915  ? O THR B 915  
AD5 1 2 N ILE B 912  ? N ILE B 912  O THR B 939  ? O THR B 939  
AD6 1 2 N PHE B 1001 ? N PHE B 1001 O TYR B 1073 ? O TYR B 1073 
AD7 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
AD8 1 2 N ILE B 1172 ? N ILE B 1172 O GLU B 1181 ? O GLU B 1181 
AD9 1 2 N GLN C 7    ? N GLN C 7    O SER C 23   ? O SER C 23   
AD9 2 3 N LEU C 22   ? N LEU C 22   O PHE C 228  ? O PHE C 228  
AD9 3 4 O TYR C 229  ? O TYR C 229  N GLU C 179  ? N GLU C 179  
AE1 1 2 O VAL C 119  ? O VAL C 119  N THR C 100  ? N THR C 100  
AE1 2 3 N VAL C 97   ? N VAL C 97   O ALA C 159  ? O ALA C 159  
AE1 3 4 O THR C 156  ? O THR C 156  N GLU C 50   ? N GLU C 50   
AE1 4 5 N VAL C 49   ? N VAL C 49   O PHE L 67   ? O PHE L 67   
AE2 1 2 N GLN C 73   ? N GLN C 73   O GLY C 130  ? O GLY C 130  
AE3 1 2 N THR C 111  ? N THR C 111  O LEU C 147  ? O LEU C 147  
AE4 1 2 N GLN D 37   ? N GLN D 37   O GLU D 45   ? O GLU D 45   
AE5 1 2 N ALA E 62   ? N ALA E 62   O LEU E 78   ? O LEU E 78   
AE5 2 3 N TRP E 79   ? N TRP E 79   O ILE E 109  ? O ILE E 109  
AE5 3 4 N PHE E 110  ? N PHE E 110  O GLU E 133  ? O GLU E 133  
AE6 1 2 N VAL E 88   ? N VAL E 88   O ASN E 115  ? O ASN E 115  
AE7 1 2 N ILE E 154  ? N ILE E 154  O LYS E 197  ? O LYS E 197  
AE7 2 3 N ILE E 198  ? N ILE E 198  O SER E 210  ? O SER E 210  
AE7 3 4 O ILE E 213  ? O ILE E 213  N ILE E 178  ? N ILE E 178  
AE8 1 2 O GLY G 169  ? O GLY G 169  N ARG G 144  ? N ARG G 144  
AE8 2 3 N GLU G 148  ? N GLU G 148  O ILE G 160  ? O ILE G 160  
AE8 3 4 O ALA G 159  ? O ALA G 159  N PHE G 109  ? N PHE G 109  
AE8 4 5 O MET G 106  ? O MET G 106  N VAL G 103  ? N VAL G 103  
AE8 5 6 O GLN G 102  ? O GLN G 102  N THR G 90   ? N THR G 90   
AE8 6 7 N VAL G 87   ? N VAL G 87   O VAL G 145  ? O VAL G 145  
AE9 1 2 N THR G 120  ? N THR G 120  O GLN G 131  ? O GLN G 131  
AE9 2 3 N TYR G 130  ? N TYR G 130  O ILE G 137  ? O ILE G 137  
AF1 1 2 N TYR H 95   ? N TYR H 95   O ILE H 144  ? O ILE H 144  
AF1 2 3 O TYR H 141  ? O TYR H 141  N ALA H 60   ? N ALA H 60   
AF1 3 4 O VAL H 57   ? O VAL H 57   N ASP H 8    ? N ASP H 8    
AF1 4 5 N GLN H 11   ? N GLN H 11   O ALA H 29   ? O ALA H 29   
AF1 5 6 N ILE H 26   ? N ILE H 26   O LEU H 40   ? O LEU H 40   
AF1 6 7 N THR H 39   ? N THR H 39   O ARG H 124  ? O ARG H 124  
AF1 7 8 O LEU H 121  ? O LEU H 121  N PHE H 118  ? N PHE H 118  
AF1 8 9 O SER H 117  ? O SER H 117  N THR H 100  ? N THR H 100  
AF2 1 2 N TYR I 15   ? N TYR I 15   O GLU I 28   ? O GLU I 28   
AF2 2 3 N PHE I 27   ? N PHE I 27   O GLU I 36   ? O GLU I 36   
AF3 1 2 N VAL I 84   ? N VAL I 84   O VAL I 102  ? O VAL I 102  
AF3 2 3 N PHE I 101  ? N PHE I 101  O PHE I 110  ? O PHE I 110  
AF4 1 2 N ASP K 22   ? N ASP K 22   O VAL K 32   ? O VAL K 32   
AF4 2 3 N PHE K 35   ? N PHE K 35   O PHE K 71   ? O PHE K 71   
AF4 3 4 O GLN K 76   ? O GLN K 76   N LEU K 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  1801 ? 4 'binding site for residue ZN A 1801'               
AC2 Software A ZN  1802 ? 5 'binding site for residue ZN A 1802'               
AC3 Software A MG  1803 ? 4 'binding site for residue MG A 1803'               
AC4 Software B ZN  1301 ? 4 'binding site for residue ZN B 1301'               
AC5 Software C ZN  401  ? 4 'binding site for residue ZN C 401'                
AC6 Software I ZN  201  ? 4 'binding site for residue ZN I 201'                
AC7 Software I ZN  202  ? 5 'binding site for residue ZN I 202'                
AC8 Software J ZN  101  ? 5 'binding site for residue ZN J 101'                
AC9 Software L ZN  101  ? 6 'binding site for residue ZN L 101'                
AD1 Software T AHW 101  ? 8 'binding site for residues AHW T 101 and 4DU T 18' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4 CYS A 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4 CYS A 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4 CYS A 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 5 CYS A 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 5 THR A 69   ? THR A 69   . ? 1_555 ? 
7  AC2 5 CYS A 70   ? CYS A 70   . ? 1_555 ? 
8  AC2 5 CYS A 77   ? CYS A 77   . ? 1_555 ? 
9  AC2 5 HIS A 80   ? HIS A 80   . ? 1_555 ? 
10 AC3 4 ASP A 481  ? ASP A 481  . ? 1_555 ? 
11 AC3 4 ASP A 483  ? ASP A 483  . ? 1_555 ? 
12 AC3 4 ASP A 485  ? ASP A 485  . ? 1_555 ? 
13 AC3 4 G   O 11   ? G   P 10   . ? 1_555 ? 
14 AC4 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
15 AC4 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
16 AC4 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
17 AC4 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
18 AC5 4 CYS C 86   ? CYS C 86   . ? 1_555 ? 
19 AC5 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
20 AC5 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
21 AC5 4 CYS C 95   ? CYS C 95   . ? 1_555 ? 
22 AC6 4 CYS I 7    ? CYS I 7    . ? 1_555 ? 
23 AC6 4 CYS I 10   ? CYS I 10   . ? 1_555 ? 
24 AC6 4 CYS I 29   ? CYS I 29   . ? 1_555 ? 
25 AC6 4 CYS I 32   ? CYS I 32   . ? 1_555 ? 
26 AC7 5 CYS I 75   ? CYS I 75   . ? 1_555 ? 
27 AC7 5 CYS I 78   ? CYS I 78   . ? 1_555 ? 
28 AC7 5 CYS I 103  ? CYS I 103  . ? 1_555 ? 
29 AC7 5 SER I 105  ? SER I 105  . ? 1_555 ? 
30 AC7 5 CYS I 106  ? CYS I 106  . ? 1_555 ? 
31 AC8 5 CYS J 7    ? CYS J 7    . ? 1_555 ? 
32 AC8 5 CYS J 10   ? CYS J 10   . ? 1_555 ? 
33 AC8 5 ARG J 43   ? ARG J 43   . ? 1_555 ? 
34 AC8 5 CYS J 45   ? CYS J 45   . ? 1_555 ? 
35 AC8 5 CYS J 46   ? CYS J 46   . ? 1_555 ? 
36 AC9 6 CYS L 31   ? CYS L 31   . ? 1_555 ? 
37 AC9 6 GLU L 33   ? GLU L 33   . ? 1_555 ? 
38 AC9 6 CYS L 34   ? CYS L 34   . ? 1_555 ? 
39 AC9 6 CYS L 48   ? CYS L 48   . ? 1_555 ? 
40 AC9 6 CYS L 51   ? CYS L 51   . ? 1_555 ? 
41 AC9 6 HIS L 53   ? HIS L 53   . ? 1_555 ? 
42 AD1 8 LYS A 332  ? LYS A 332  . ? 1_555 ? 
43 AD1 8 LYS A 830  ? LYS A 830  . ? 1_555 ? 
44 AD1 8 THR A 831  ? THR A 831  . ? 1_555 ? 
45 AD1 8 THR A 834  ? THR A 834  . ? 1_555 ? 
46 AD1 8 GLY A 835  ? GLY A 835  . ? 1_555 ? 
47 AD1 8 THR A 1077 ? THR A 1077 . ? 1_555 ? 
48 AD1 8 DG  M 14   ? DG  T 17   . ? 1_555 ? 
49 AD1 8 DC  M 16   ? DC  T 19   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5OT2 
_atom_sites.fract_transf_matrix[1][1]   0.004518 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.002532 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003525 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLN A 1  4    ? -0.227  -25.472  29.359  1.00 93.06  ? 4    GLN A N     1 
ATOM   2     C  CA    . GLN A 1  4    ? 0.674   -24.566  28.634  1.00 89.91  ? 4    GLN A CA    1 
ATOM   3     C  C     . GLN A 1  4    ? 1.456   -23.583  29.513  1.00 102.88 ? 4    GLN A C     1 
ATOM   4     O  O     . GLN A 1  4    ? 2.586   -23.221  29.191  1.00 124.27 ? 4    GLN A O     1 
ATOM   5     C  CB    . GLN A 1  4    ? -0.115  -23.774  27.608  1.00 79.58  ? 4    GLN A CB    1 
ATOM   6     C  CG    . GLN A 1  4    ? 0.714   -22.915  26.692  1.00 98.63  ? 4    GLN A CG    1 
ATOM   7     C  CD    . GLN A 1  4    ? -0.169  -22.111  25.769  1.00 147.37 ? 4    GLN A CD    1 
ATOM   8     O  OE1   . GLN A 1  4    ? -1.398  -22.182  25.863  1.00 132.17 ? 4    GLN A OE1   1 
ATOM   9     N  NE2   . GLN A 1  4    ? 0.443   -21.330  24.880  1.00 162.02 ? 4    GLN A NE2   1 
ATOM   10    N  N     . GLN A 1  5    ? 0.850   -23.158  30.615  1.00 93.43  ? 5    GLN A N     1 
ATOM   11    C  CA    . GLN A 1  5    ? 1.480   -22.219  31.534  1.00 105.95 ? 5    GLN A CA    1 
ATOM   12    C  C     . GLN A 1  5    ? 2.562   -22.922  32.355  1.00 94.93  ? 5    GLN A C     1 
ATOM   13    O  O     . GLN A 1  5    ? 2.535   -24.138  32.538  1.00 131.24 ? 5    GLN A O     1 
ATOM   14    C  CB    . GLN A 1  5    ? 0.405   -21.606  32.433  1.00 146.49 ? 5    GLN A CB    1 
ATOM   15    C  CG    . GLN A 1  5    ? 0.845   -20.497  33.369  1.00 168.91 ? 5    GLN A CG    1 
ATOM   16    C  CD    . GLN A 1  5    ? -0.222  -20.197  34.415  1.00 175.89 ? 5    GLN A CD    1 
ATOM   17    O  OE1   . GLN A 1  5    ? -1.376  -20.612  34.273  1.00 158.44 ? 5    GLN A OE1   1 
ATOM   18    N  NE2   . GLN A 1  5    ? 0.158   -19.485  35.472  1.00 180.97 ? 5    GLN A NE2   1 
ATOM   19    N  N     . TYR A 1  6    ? 3.540   -22.148  32.828  1.00 94.01  ? 6    TYR A N     1 
ATOM   20    C  CA    . TYR A 1  6    ? 4.677   -22.716  33.549  1.00 84.88  ? 6    TYR A CA    1 
ATOM   21    C  C     . TYR A 1  6    ? 4.271   -23.299  34.900  1.00 90.50  ? 6    TYR A C     1 
ATOM   22    O  O     . TYR A 1  6    ? 3.477   -22.707  35.634  1.00 119.92 ? 6    TYR A O     1 
ATOM   23    C  CB    . TYR A 1  6    ? 5.763   -21.649  33.765  1.00 97.80  ? 6    TYR A CB    1 
ATOM   24    C  CG    . TYR A 1  6    ? 6.787   -22.058  34.814  1.00 100.37 ? 6    TYR A CG    1 
ATOM   25    C  CD1   . TYR A 1  6    ? 7.881   -22.844  34.480  1.00 115.16 ? 6    TYR A CD1   1 
ATOM   26    C  CD2   . TYR A 1  6    ? 6.648   -21.684  36.142  1.00 92.34  ? 6    TYR A CD2   1 
ATOM   27    C  CE1   . TYR A 1  6    ? 8.810   -23.246  35.445  1.00 104.60 ? 6    TYR A CE1   1 
ATOM   28    C  CE2   . TYR A 1  6    ? 7.571   -22.080  37.108  1.00 92.13  ? 6    TYR A CE2   1 
ATOM   29    C  CZ    . TYR A 1  6    ? 8.647   -22.860  36.756  1.00 108.35 ? 6    TYR A CZ    1 
ATOM   30    O  OH    . TYR A 1  6    ? 9.565   -23.252  37.711  1.00 110.53 ? 6    TYR A OH    1 
ATOM   31    N  N     . SER A 1  7    ? 4.871   -24.440  35.254  1.00 84.18  ? 7    SER A N     1 
ATOM   32    C  CA    . SER A 1  7    ? 4.631   -25.097  36.535  1.00 104.42 ? 7    SER A CA    1 
ATOM   33    C  C     . SER A 1  7    ? 5.948   -25.460  37.187  1.00 102.45 ? 7    SER A C     1 
ATOM   34    O  O     . SER A 1  7    ? 6.870   -25.951  36.529  1.00 125.38 ? 7    SER A O     1 
ATOM   35    C  CB    . SER A 1  7    ? 3.794   -26.372  36.413  1.00 117.65 ? 7    SER A CB    1 
ATOM   36    O  OG    . SER A 1  7    ? 3.682   -27.037  37.672  1.00 92.73  ? 7    SER A OG    1 
ATOM   37    N  N     . SER A 1  8    ? 6.010   -25.264  38.494  1.00 96.26  ? 8    SER A N     1 
ATOM   38    C  CA    . SER A 1  8    ? 7.228   -25.549  39.230  1.00 102.46 ? 8    SER A CA    1 
ATOM   39    C  C     . SER A 1  8    ? 7.367   -27.015  39.610  1.00 109.93 ? 8    SER A C     1 
ATOM   40    O  O     . SER A 1  8    ? 8.340   -27.373  40.279  1.00 118.76 ? 8    SER A O     1 
ATOM   41    C  CB    . SER A 1  8    ? 7.278   -24.697  40.495  1.00 104.10 ? 8    SER A CB    1 
ATOM   42    O  OG    . SER A 1  8    ? 6.311   -25.141  41.434  1.00 103.50 ? 8    SER A OG    1 
ATOM   43    N  N     . ALA A 1  9    ? 6.432   -27.866  39.214  1.00 106.15 ? 9    ALA A N     1 
ATOM   44    C  CA    . ALA A 1  9    ? 6.548   -29.270  39.552  1.00 92.81  ? 9    ALA A CA    1 
ATOM   45    C  C     . ALA A 1  9    ? 7.638   -29.918  38.706  1.00 95.99  ? 9    ALA A C     1 
ATOM   46    O  O     . ALA A 1  9    ? 7.787   -29.597  37.522  1.00 114.65 ? 9    ALA A O     1 
ATOM   47    C  CB    . ALA A 1  9    ? 5.225   -29.993  39.324  1.00 114.62 ? 9    ALA A CB    1 
ATOM   48    N  N     . PRO A 1  10   ? 8.407   -30.832  39.279  1.00 86.65  ? 10   PRO A N     1 
ATOM   49    C  CA    . PRO A 1  10   ? 9.446   -31.517  38.505  1.00 91.44  ? 10   PRO A CA    1 
ATOM   50    C  C     . PRO A 1  10   ? 8.842   -32.356  37.385  1.00 104.84 ? 10   PRO A C     1 
ATOM   51    O  O     . PRO A 1  10   ? 7.895   -33.117  37.591  1.00 104.22 ? 10   PRO A O     1 
ATOM   52    C  CB    . PRO A 1  10   ? 10.147  -32.381  39.556  1.00 110.92 ? 10   PRO A CB    1 
ATOM   53    C  CG    . PRO A 1  10   ? 9.141   -32.528  40.648  1.00 94.68  ? 10   PRO A CG    1 
ATOM   54    C  CD    . PRO A 1  10   ? 8.381   -31.258  40.683  1.00 102.30 ? 10   PRO A CD    1 
ATOM   55    N  N     . LEU A 1  11   ? 9.408   -32.223  36.192  1.00 114.32 ? 11   LEU A N     1 
ATOM   56    C  CA    . LEU A 1  11   ? 8.903   -32.918  35.013  1.00 92.43  ? 11   LEU A CA    1 
ATOM   57    C  C     . LEU A 1  11   ? 9.607   -34.262  34.872  1.00 103.17 ? 11   LEU A C     1 
ATOM   58    O  O     . LEU A 1  11   ? 10.836  -34.314  34.748  1.00 114.07 ? 11   LEU A O     1 
ATOM   59    C  CB    . LEU A 1  11   ? 9.111   -32.075  33.758  1.00 83.04  ? 11   LEU A CB    1 
ATOM   60    C  CG    . LEU A 1  11   ? 8.958   -32.827  32.444  1.00 82.18  ? 11   LEU A CG    1 
ATOM   61    C  CD1   . LEU A 1  11   ? 7.520   -33.148  32.270  1.00 88.14  ? 11   LEU A CD1   1 
ATOM   62    C  CD2   . LEU A 1  11   ? 9.473   -32.069  31.216  1.00 81.69  ? 11   LEU A CD2   1 
ATOM   63    N  N     . ARG A 1  12   ? 8.827   -35.342  34.856  1.00 86.53  ? 12   ARG A N     1 
ATOM   64    C  CA    . ARG A 1  12   ? 9.360   -36.688  34.689  1.00 89.14  ? 12   ARG A CA    1 
ATOM   65    C  C     . ARG A 1  12   ? 8.600   -37.414  33.589  1.00 82.86  ? 12   ARG A C     1 
ATOM   66    O  O     . ARG A 1  12   ? 7.623   -36.904  33.033  1.00 94.51  ? 12   ARG A O     1 
ATOM   67    C  CB    . ARG A 1  12   ? 9.301   -37.498  35.991  1.00 95.71  ? 12   ARG A CB    1 
ATOM   68    C  CG    . ARG A 1  12   ? 10.580  -37.421  36.799  1.00 104.68 ? 12   ARG A CG    1 
ATOM   69    C  CD    . ARG A 1  12   ? 10.468  -38.071  38.160  1.00 108.72 ? 12   ARG A CD    1 
ATOM   70    N  NE    . ARG A 1  12   ? 11.278  -37.372  39.149  1.00 141.63 ? 12   ARG A NE    1 
ATOM   71    C  CZ    . ARG A 1  12   ? 11.543  -37.857  40.358  1.00 152.25 ? 12   ARG A CZ    1 
ATOM   72    N  NH1   . ARG A 1  12   ? 11.067  -39.045  40.716  1.00 134.56 ? 12   ARG A NH1   1 
ATOM   73    N  NH2   . ARG A 1  12   ? 12.287  -37.161  41.207  1.00 155.84 ? 12   ARG A NH2   1 
ATOM   74    N  N     . THR A 1  13   ? 9.068   -38.617  33.266  1.00 91.01  ? 13   THR A N     1 
ATOM   75    C  CA    . THR A 1  13   ? 8.402   -39.466  32.293  1.00 87.49  ? 13   THR A CA    1 
ATOM   76    C  C     . THR A 1  13   ? 7.813   -40.673  33.017  1.00 106.45 ? 13   THR A C     1 
ATOM   77    O  O     . THR A 1  13   ? 8.259   -41.046  34.108  1.00 117.22 ? 13   THR A O     1 
ATOM   78    C  CB    . THR A 1  13   ? 9.370   -39.933  31.180  1.00 82.01  ? 13   THR A CB    1 
ATOM   79    O  OG1   . THR A 1  13   ? 10.258  -40.935  31.679  1.00 100.75 ? 13   THR A OG1   1 
ATOM   80    C  CG2   . THR A 1  13   ? 10.221  -38.786  30.683  1.00 113.60 ? 13   THR A CG2   1 
ATOM   81    N  N     . VAL A 1  14   ? 6.772   -41.259  32.416  1.00 88.46  ? 14   VAL A N     1 
ATOM   82    C  CA    . VAL A 1  14   ? 6.100   -42.420  32.993  1.00 86.15  ? 14   VAL A CA    1 
ATOM   83    C  C     . VAL A 1  14   ? 7.028   -43.624  32.845  1.00 97.15  ? 14   VAL A C     1 
ATOM   84    O  O     . VAL A 1  14   ? 7.452   -43.966  31.735  1.00 90.41  ? 14   VAL A O     1 
ATOM   85    C  CB    . VAL A 1  14   ? 4.750   -42.672  32.298  1.00 82.15  ? 14   VAL A CB    1 
ATOM   86    C  CG1   . VAL A 1  14   ? 4.344   -44.094  32.465  1.00 105.63 ? 14   VAL A CG1   1 
ATOM   87    C  CG2   . VAL A 1  14   ? 3.647   -41.781  32.854  1.00 82.11  ? 14   VAL A CG2   1 
ATOM   88    N  N     . LYS A 1  15   ? 7.378   -44.256  33.965  1.00 96.79  ? 15   LYS A N     1 
ATOM   89    C  CA    . LYS A 1  15   ? 8.205   -45.459  33.946  1.00 96.42  ? 15   LYS A CA    1 
ATOM   90    C  C     . LYS A 1  15   ? 7.372   -46.723  33.999  1.00 98.56  ? 15   LYS A C     1 
ATOM   91    O  O     . LYS A 1  15   ? 7.651   -47.682  33.277  1.00 106.21 ? 15   LYS A O     1 
ATOM   92    C  CB    . LYS A 1  15   ? 9.193   -45.474  35.121  1.00 100.45 ? 15   LYS A CB    1 
ATOM   93    C  CG    . LYS A 1  15   ? 10.254  -44.399  35.105  1.00 104.45 ? 15   LYS A CG    1 
ATOM   94    C  CD    . LYS A 1  15   ? 11.133  -44.457  33.862  1.00 106.35 ? 15   LYS A CD    1 
ATOM   95    C  CE    . LYS A 1  15   ? 12.120  -43.319  33.891  1.00 112.70 ? 15   LYS A CE    1 
ATOM   96    N  NZ    . LYS A 1  15   ? 11.410  -42.101  34.375  1.00 116.73 ? 15   LYS A NZ    1 
ATOM   97    N  N     . GLU A 1  16   ? 6.355   -46.734  34.853  1.00 92.48  ? 16   GLU A N     1 
ATOM   98    C  CA    . GLU A 1  16   ? 5.534   -47.908  35.091  1.00 97.45  ? 16   GLU A CA    1 
ATOM   99    C  C     . GLU A 1  16   ? 4.081   -47.482  35.184  1.00 101.60 ? 16   GLU A C     1 
ATOM   100   O  O     . GLU A 1  16   ? 3.771   -46.397  35.682  1.00 110.32 ? 16   GLU A O     1 
ATOM   101   C  CB    . GLU A 1  16   ? 5.922   -48.622  36.400  1.00 88.99  ? 16   GLU A CB    1 
ATOM   102   C  CG    . GLU A 1  16   ? 7.352   -49.111  36.483  1.00 100.23 ? 16   GLU A CG    1 
ATOM   103   C  CD    . GLU A 1  16   ? 7.643   -49.737  37.830  1.00 118.13 ? 16   GLU A CD    1 
ATOM   104   O  OE1   . GLU A 1  16   ? 6.898   -49.429  38.795  1.00 100.04 ? 16   GLU A OE1   1 
ATOM   105   O  OE2   . GLU A 1  16   ? 8.615   -50.523  37.926  1.00 116.04 ? 16   GLU A OE2   1 
ATOM   106   N  N     . VAL A 1  17   ? 3.192   -48.338  34.697  1.00 98.63  ? 17   VAL A N     1 
ATOM   107   C  CA    . VAL A 1  17   ? 1.758   -48.166  34.897  1.00 96.99  ? 17   VAL A CA    1 
ATOM   108   C  C     . VAL A 1  17   ? 1.273   -49.290  35.804  1.00 104.87 ? 17   VAL A C     1 
ATOM   109   O  O     . VAL A 1  17   ? 1.312   -50.464  35.416  1.00 113.11 ? 17   VAL A O     1 
ATOM   110   C  CB    . VAL A 1  17   ? 0.969   -48.139  33.583  1.00 96.90  ? 17   VAL A CB    1 
ATOM   111   C  CG1   . VAL A 1  17   ? -0.449  -47.736  33.878  1.00 84.33  ? 17   VAL A CG1   1 
ATOM   112   C  CG2   . VAL A 1  17   ? 1.583   -47.163  32.588  1.00 83.39  ? 17   VAL A CG2   1 
ATOM   113   N  N     . GLN A 1  18   ? 0.865   -48.950  37.027  1.00 95.04  ? 18   GLN A N     1 
ATOM   114   C  CA    . GLN A 1  18   ? 0.369   -49.925  37.993  1.00 87.97  ? 18   GLN A CA    1 
ATOM   115   C  C     . GLN A 1  18   ? -1.151  -49.952  37.932  1.00 108.14 ? 18   GLN A C     1 
ATOM   116   O  O     . GLN A 1  18   ? -1.816  -49.019  38.399  1.00 99.01  ? 18   GLN A O     1 
ATOM   117   C  CB    . GLN A 1  18   ? 0.830   -49.628  39.415  1.00 89.47  ? 18   GLN A CB    1 
ATOM   118   C  CG    . GLN A 1  18   ? 0.232   -50.625  40.400  1.00 101.22 ? 18   GLN A CG    1 
ATOM   119   C  CD    . GLN A 1  18   ? 0.795   -52.009  40.257  1.00 105.33 ? 18   GLN A CD    1 
ATOM   120   O  OE1   . GLN A 1  18   ? 1.921   -52.291  40.676  1.00 105.31 ? 18   GLN A OE1   1 
ATOM   121   N  NE2   . GLN A 1  18   ? 0.024   -52.883  39.620  1.00 96.84  ? 18   GLN A NE2   1 
ATOM   122   N  N     . PHE A 1  19   ? -1.690  -51.018  37.344  1.00 108.21 ? 19   PHE A N     1 
ATOM   123   C  CA    . PHE A 1  19   ? -3.124  -51.173  37.230  1.00 91.74  ? 19   PHE A CA    1 
ATOM   124   C  C     . PHE A 1  19   ? -3.692  -51.694  38.538  1.00 114.30 ? 19   PHE A C     1 
ATOM   125   O  O     . PHE A 1  19   ? -2.986  -52.269  39.373  1.00 133.28 ? 19   PHE A O     1 
ATOM   126   C  CB    . PHE A 1  19   ? -3.493  -52.123  36.085  1.00 87.93  ? 19   PHE A CB    1 
ATOM   127   C  CG    . PHE A 1  19   ? -3.314  -51.523  34.718  1.00 96.04  ? 19   PHE A CG    1 
ATOM   128   C  CD1   . PHE A 1  19   ? -4.171  -50.534  34.252  1.00 108.19 ? 19   PHE A CD1   1 
ATOM   129   C  CD2   . PHE A 1  19   ? -2.274  -51.911  33.911  1.00 100.99 ? 19   PHE A CD2   1 
ATOM   130   C  CE1   . PHE A 1  19   ? -3.999  -49.970  32.998  1.00 89.68  ? 19   PHE A CE1   1 
ATOM   131   C  CE2   . PHE A 1  19   ? -2.098  -51.336  32.656  1.00 108.86 ? 19   PHE A CE2   1 
ATOM   132   C  CZ    . PHE A 1  19   ? -2.956  -50.374  32.205  1.00 101.46 ? 19   PHE A CZ    1 
ATOM   133   N  N     . GLY A 1  20   ? -4.987  -51.463  38.713  1.00 106.14 ? 20   GLY A N     1 
ATOM   134   C  CA    . GLY A 1  20   ? -5.665  -51.881  39.920  1.00 98.18  ? 20   GLY A CA    1 
ATOM   135   C  C     . GLY A 1  20   ? -7.122  -51.500  39.847  1.00 98.86  ? 20   GLY A C     1 
ATOM   136   O  O     . GLY A 1  20   ? -7.618  -51.077  38.799  1.00 109.32 ? 20   GLY A O     1 
ATOM   137   N  N     . LEU A 1  21   ? -7.797  -51.652  40.989  1.00 117.08 ? 21   LEU A N     1 
ATOM   138   C  CA    . LEU A 1  21   ? -9.208  -51.323  41.148  1.00 103.56 ? 21   LEU A CA    1 
ATOM   139   C  C     . LEU A 1  21   ? -9.403  -50.270  42.231  1.00 92.60  ? 21   LEU A C     1 
ATOM   140   O  O     . LEU A 1  21   ? -8.609  -50.151  43.173  1.00 123.67 ? 21   LEU A O     1 
ATOM   141   C  CB    . LEU A 1  21   ? -10.057 -52.561  41.472  1.00 93.38  ? 21   LEU A CB    1 
ATOM   142   C  CG    . LEU A 1  21   ? -9.949  -53.706  40.463  1.00 93.22  ? 21   LEU A CG    1 
ATOM   143   C  CD1   . LEU A 1  21   ? -10.752 -54.916  40.871  1.00 94.51  ? 21   LEU A CD1   1 
ATOM   144   C  CD2   . LEU A 1  21   ? -10.423 -53.214  39.117  1.00 94.94  ? 21   LEU A CD2   1 
ATOM   145   N  N     . PHE A 1  22   ? -10.481 -49.506  42.086  1.00 102.49 ? 22   PHE A N     1 
ATOM   146   C  CA    . PHE A 1  22   ? -10.821 -48.464  43.043  1.00 103.15 ? 22   PHE A CA    1 
ATOM   147   C  C     . PHE A 1  22   ? -11.499 -49.059  44.272  1.00 123.46 ? 22   PHE A C     1 
ATOM   148   O  O     . PHE A 1  22   ? -12.537 -49.721  44.164  1.00 107.94 ? 22   PHE A O     1 
ATOM   149   C  CB    . PHE A 1  22   ? -11.744 -47.429  42.408  1.00 92.18  ? 22   PHE A CB    1 
ATOM   150   C  CG    . PHE A 1  22   ? -11.030 -46.218  41.895  1.00 108.68 ? 22   PHE A CG    1 
ATOM   151   C  CD1   . PHE A 1  22   ? -10.563 -45.253  42.764  1.00 107.09 ? 22   PHE A CD1   1 
ATOM   152   C  CD2   . PHE A 1  22   ? -10.899 -45.996  40.538  1.00 114.38 ? 22   PHE A CD2   1 
ATOM   153   C  CE1   . PHE A 1  22   ? -9.927  -44.131  42.294  1.00 94.30  ? 22   PHE A CE1   1 
ATOM   154   C  CE2   . PHE A 1  22   ? -10.259 -44.861  40.071  1.00 102.82 ? 22   PHE A CE2   1 
ATOM   155   C  CZ    . PHE A 1  22   ? -9.780  -43.937  40.950  1.00 96.58  ? 22   PHE A CZ    1 
ATOM   156   N  N     . SER A 1  23   ? -10.910 -48.837  45.440  1.00 136.66 ? 23   SER A N     1 
ATOM   157   C  CA    . SER A 1  23   ? -11.679 -49.012  46.651  1.00 116.15 ? 23   SER A CA    1 
ATOM   158   C  C     . SER A 1  23   ? -12.727 -47.905  46.708  1.00 117.95 ? 23   SER A C     1 
ATOM   159   O  O     . SER A 1  23   ? -12.504 -46.801  46.197  1.00 114.97 ? 23   SER A O     1 
ATOM   160   C  CB    . SER A 1  23   ? -10.778 -48.950  47.883  1.00 124.10 ? 23   SER A CB    1 
ATOM   161   O  OG    . SER A 1  23   ? -10.437 -47.614  48.227  1.00 124.64 ? 23   SER A OG    1 
ATOM   162   N  N     . PRO A 1  24   ? -13.905 -48.186  47.256  1.00 114.10 ? 24   PRO A N     1 
ATOM   163   C  CA    . PRO A 1  24   ? -14.879 -47.100  47.427  1.00 101.92 ? 24   PRO A CA    1 
ATOM   164   C  C     . PRO A 1  24   ? -14.350 -45.980  48.291  1.00 112.59 ? 24   PRO A C     1 
ATOM   165   O  O     . PRO A 1  24   ? -14.659 -44.804  48.046  1.00 117.48 ? 24   PRO A O     1 
ATOM   166   C  CB    . PRO A 1  24   ? -16.091 -47.801  48.052  1.00 98.97  ? 24   PRO A CB    1 
ATOM   167   C  CG    . PRO A 1  24   ? -15.602 -49.122  48.502  1.00 99.77  ? 24   PRO A CG    1 
ATOM   168   C  CD    . PRO A 1  24   ? -14.465 -49.494  47.625  1.00 110.90 ? 24   PRO A CD    1 
ATOM   169   N  N     . GLU A 1  25   ? -13.475 -46.316  49.236  1.00 119.84 ? 25   GLU A N     1 
ATOM   170   C  CA    . GLU A 1  25   ? -12.922 -45.317  50.139  1.00 122.18 ? 25   GLU A CA    1 
ATOM   171   C  C     . GLU A 1  25   ? -12.037 -44.331  49.389  1.00 118.30 ? 25   GLU A C     1 
ATOM   172   O  O     . GLU A 1  25   ? -12.067 -43.125  49.670  1.00 112.08 ? 25   GLU A O     1 
ATOM   173   C  CB    . GLU A 1  25   ? -12.126 -46.024  51.243  1.00 105.48 ? 25   GLU A CB    1 
ATOM   174   C  CG    . GLU A 1  25   ? -12.949 -46.947  52.159  1.00 109.57 ? 25   GLU A CG    1 
ATOM   175   C  CD    . GLU A 1  25   ? -13.137 -48.336  51.567  1.00 134.44 ? 25   GLU A CD    1 
ATOM   176   O  OE1   . GLU A 1  25   ? -13.090 -48.461  50.326  1.00 145.80 ? 25   GLU A OE1   1 
ATOM   177   O  OE2   . GLU A 1  25   ? -13.360 -49.297  52.334  1.00 138.34 ? 25   GLU A OE2   1 
ATOM   178   N  N     . GLU A 1  26   ? -11.256 -44.821  48.419  1.00 110.31 ? 26   GLU A N     1 
ATOM   179   C  CA    . GLU A 1  26   ? -10.366 -43.936  47.676  1.00 95.03  ? 26   GLU A CA    1 
ATOM   180   C  C     . GLU A 1  26   ? -11.169 -43.019  46.759  1.00 111.65 ? 26   GLU A C     1 
ATOM   181   O  O     . GLU A 1  26   ? -10.802 -41.851  46.562  1.00 93.55  ? 26   GLU A O     1 
ATOM   182   C  CB    . GLU A 1  26   ? -9.346  -44.763  46.883  1.00 94.29  ? 26   GLU A CB    1 
ATOM   183   C  CG    . GLU A 1  26   ? -8.689  -44.017  45.726  1.00 135.07 ? 26   GLU A CG    1 
ATOM   184   C  CD    . GLU A 1  26   ? -7.291  -44.508  45.415  1.00 137.58 ? 26   GLU A CD    1 
ATOM   185   O  OE1   . GLU A 1  26   ? -7.104  -45.740  45.370  1.00 139.58 ? 26   GLU A OE1   1 
ATOM   186   O  OE2   . GLU A 1  26   ? -6.379  -43.665  45.255  1.00 126.94 ? 26   GLU A OE2   1 
ATOM   187   N  N     . VAL A 1  27   ? -12.275 -43.527  46.205  1.00 107.92 ? 27   VAL A N     1 
ATOM   188   C  CA    . VAL A 1  27   ? -13.158 -42.691  45.395  1.00 109.17 ? 27   VAL A CA    1 
ATOM   189   C  C     . VAL A 1  27   ? -13.742 -41.580  46.254  1.00 114.18 ? 27   VAL A C     1 
ATOM   190   O  O     . VAL A 1  27   ? -13.695 -40.397  45.899  1.00 100.11 ? 27   VAL A O     1 
ATOM   191   C  CB    . VAL A 1  27   ? -14.265 -43.534  44.737  1.00 97.19  ? 27   VAL A CB    1 
ATOM   192   C  CG1   . VAL A 1  27   ? -15.001 -42.735  43.655  1.00 92.80  ? 27   VAL A CG1   1 
ATOM   193   C  CG2   . VAL A 1  27   ? -13.703 -44.819  44.174  1.00 103.89 ? 27   VAL A CG2   1 
ATOM   194   N  N     . ARG A 1  28   ? -14.307 -41.950  47.405  1.00 95.57  ? 28   ARG A N     1 
ATOM   195   C  CA    . ARG A 1  28   ? -14.820 -40.944  48.328  1.00 111.90 ? 28   ARG A CA    1 
ATOM   196   C  C     . ARG A 1  28   ? -13.712 -39.983  48.764  1.00 117.07 ? 28   ARG A C     1 
ATOM   197   O  O     . ARG A 1  28   ? -13.987 -38.823  49.088  1.00 122.77 ? 28   ARG A O     1 
ATOM   198   C  CB    . ARG A 1  28   ? -15.481 -41.643  49.530  1.00 128.98 ? 28   ARG A CB    1 
ATOM   199   C  CG    . ARG A 1  28   ? -16.559 -40.836  50.267  1.00 98.98  ? 28   ARG A CG    1 
ATOM   200   C  CD    . ARG A 1  28   ? -16.030 -40.286  51.583  1.00 131.98 ? 28   ARG A CD    1 
ATOM   201   N  NE    . ARG A 1  28   ? -17.007 -39.448  52.270  1.00 151.66 ? 28   ARG A NE    1 
ATOM   202   C  CZ    . ARG A 1  28   ? -16.716 -38.606  53.263  1.00 138.66 ? 28   ARG A CZ    1 
ATOM   203   N  NH1   . ARG A 1  28   ? -15.468 -38.468  53.707  1.00 137.15 ? 28   ARG A NH1   1 
ATOM   204   N  NH2   . ARG A 1  28   ? -17.681 -37.883  53.810  1.00 117.02 ? 28   ARG A NH2   1 
ATOM   205   N  N     . ALA A 1  29   ? -12.455 -40.436  48.733  1.00 116.79 ? 29   ALA A N     1 
ATOM   206   C  CA    . ALA A 1  29   ? -11.326 -39.603  49.143  1.00 116.99 ? 29   ALA A CA    1 
ATOM   207   C  C     . ALA A 1  29   ? -11.000 -38.542  48.102  1.00 114.44 ? 29   ALA A C     1 
ATOM   208   O  O     . ALA A 1  29   ? -10.891 -37.349  48.419  1.00 123.48 ? 29   ALA A O     1 
ATOM   209   C  CB    . ALA A 1  29   ? -10.100 -40.469  49.396  1.00 95.67  ? 29   ALA A CB    1 
ATOM   210   N  N     . ILE A 1  30   ? -10.821 -38.960  46.854  1.00 105.32 ? 30   ILE A N     1 
ATOM   211   C  CA    . ILE A 1  30   ? -10.421 -38.037  45.803  1.00 104.16 ? 30   ILE A CA    1 
ATOM   212   C  C     . ILE A 1  30   ? -11.649 -37.387  45.189  1.00 100.96 ? 30   ILE A C     1 
ATOM   213   O  O     . ILE A 1  30   ? -11.539 -36.681  44.184  1.00 99.65  ? 30   ILE A O     1 
ATOM   214   C  CB    . ILE A 1  30   ? -9.623  -38.760  44.702  1.00 102.13 ? 30   ILE A CB    1 
ATOM   215   C  CG1   . ILE A 1  30   ? -10.541 -39.719  43.947  1.00 90.73  ? 30   ILE A CG1   1 
ATOM   216   C  CG2   . ILE A 1  30   ? -8.457  -39.531  45.279  1.00 116.13 ? 30   ILE A CG2   1 
ATOM   217   C  CD1   . ILE A 1  30   ? -10.071 -40.038  42.554  1.00 91.79  ? 30   ILE A CD1   1 
ATOM   218   N  N     . SER A 1  31   ? -12.823 -37.607  45.777  1.00 117.42 ? 31   SER A N     1 
ATOM   219   C  CA    . SER A 1  31   ? -14.041 -36.999  45.256  1.00 114.65 ? 31   SER A CA    1 
ATOM   220   C  C     . SER A 1  31   ? -14.132 -35.552  45.714  1.00 107.75 ? 31   SER A C     1 
ATOM   221   O  O     . SER A 1  31   ? -14.064 -35.268  46.916  1.00 151.22 ? 31   SER A O     1 
ATOM   222   C  CB    . SER A 1  31   ? -15.279 -37.766  45.704  1.00 126.82 ? 31   SER A CB    1 
ATOM   223   O  OG    . SER A 1  31   ? -16.462 -37.062  45.367  1.00 125.61 ? 31   SER A OG    1 
ATOM   224   N  N     . VAL A 1  32   ? -14.319 -34.642  44.754  1.00 92.05  ? 32   VAL A N     1 
ATOM   225   C  CA    . VAL A 1  32   ? -14.420 -33.213  45.040  1.00 97.61  ? 32   VAL A CA    1 
ATOM   226   C  C     . VAL A 1  32   ? -15.868 -32.735  45.134  1.00 110.43 ? 32   VAL A C     1 
ATOM   227   O  O     . VAL A 1  32   ? -16.101 -31.547  45.395  1.00 93.29  ? 32   VAL A O     1 
ATOM   228   C  CB    . VAL A 1  32   ? -13.654 -32.360  44.007  1.00 91.11  ? 32   VAL A CB    1 
ATOM   229   C  CG1   . VAL A 1  32   ? -14.436 -32.203  42.718  1.00 90.35  ? 32   VAL A CG1   1 
ATOM   230   C  CG2   . VAL A 1  32   ? -13.294 -31.018  44.611  1.00 116.54 ? 32   VAL A CG2   1 
ATOM   231   N  N     . ALA A 1  33   ? -16.845 -33.614  44.905  1.00 107.43 ? 33   ALA A N     1 
ATOM   232   C  CA    . ALA A 1  33   ? -18.251 -33.253  45.018  1.00 93.97  ? 33   ALA A CA    1 
ATOM   233   C  C     . ALA A 1  33   ? -19.057 -34.507  45.296  1.00 115.77 ? 33   ALA A C     1 
ATOM   234   O  O     . ALA A 1  33   ? -18.677 -35.606  44.891  1.00 118.50 ? 33   ALA A O     1 
ATOM   235   C  CB    . ALA A 1  33   ? -18.764 -32.586  43.751  1.00 93.15  ? 33   ALA A CB    1 
ATOM   236   N  N     . LYS A 1  34   ? -20.256 -34.300  45.848  1.00 112.61 ? 34   LYS A N     1 
ATOM   237   C  CA    . LYS A 1  34   ? -21.114 -35.391  46.293  1.00 96.77  ? 34   LYS A CA    1 
ATOM   238   C  C     . LYS A 1  34   ? -22.038 -35.880  45.197  1.00 130.43 ? 34   LYS A C     1 
ATOM   239   O  O     . LYS A 1  34   ? -22.404 -37.061  45.185  1.00 182.22 ? 34   LYS A O     1 
ATOM   240   C  CB    . LYS A 1  34   ? -21.931 -34.961  47.515  1.00 123.38 ? 34   LYS A CB    1 
ATOM   241   C  CG    . LYS A 1  34   ? -22.975 -35.987  47.967  1.00 138.88 ? 34   LYS A CG    1 
ATOM   242   C  CD    . LYS A 1  34   ? -22.373 -37.126  48.780  1.00 127.54 ? 34   LYS A CD    1 
ATOM   243   C  CE    . LYS A 1  34   ? -23.386 -38.245  48.961  1.00 102.16 ? 34   LYS A CE    1 
ATOM   244   N  NZ    . LYS A 1  34   ? -24.683 -37.691  49.365  1.00 118.87 ? 34   LYS A NZ    1 
ATOM   245   N  N     . ILE A 1  35   ? -22.431 -34.992  44.291  1.00 95.82  ? 35   ILE A N     1 
ATOM   246   C  CA    . ILE A 1  35   ? -23.265 -35.320  43.135  1.00 123.29 ? 35   ILE A CA    1 
ATOM   247   C  C     . ILE A 1  35   ? -24.572 -35.969  43.584  1.00 110.29 ? 35   ILE A C     1 
ATOM   248   O  O     . ILE A 1  35   ? -24.642 -37.195  43.757  1.00 97.11  ? 35   ILE A O     1 
ATOM   249   C  CB    . ILE A 1  35   ? -22.520 -36.236  42.144  1.00 98.68  ? 35   ILE A CB    1 
ATOM   250   C  CG1   . ILE A 1  35   ? -21.235 -35.574  41.640  1.00 107.81 ? 35   ILE A CG1   1 
ATOM   251   C  CG2   . ILE A 1  35   ? -23.386 -36.520  40.944  1.00 93.93  ? 35   ILE A CG2   1 
ATOM   252   C  CD1   . ILE A 1  35   ? -21.367 -34.143  41.188  1.00 92.62  ? 35   ILE A CD1   1 
ATOM   253   N  N     . ARG A 1  36   ? -25.602 -35.153  43.822  1.00 112.67 ? 36   ARG A N     1 
ATOM   254   C  CA    . ARG A 1  36   ? -26.870 -35.666  44.314  1.00 115.67 ? 36   ARG A CA    1 
ATOM   255   C  C     . ARG A 1  36   ? -28.055 -35.415  43.390  1.00 121.18 ? 36   ARG A C     1 
ATOM   256   O  O     . ARG A 1  36   ? -29.057 -36.134  43.513  1.00 100.14 ? 36   ARG A O     1 
ATOM   257   C  CB    . ARG A 1  36   ? -27.185 -35.085  45.702  1.00 106.42 ? 36   ARG A CB    1 
ATOM   258   C  CG    . ARG A 1  36   ? -25.954 -34.708  46.492  1.00 121.70 ? 36   ARG A CG    1 
ATOM   259   C  CD    . ARG A 1  36   ? -26.296 -33.940  47.748  1.00 139.13 ? 36   ARG A CD    1 
ATOM   260   N  NE    . ARG A 1  36   ? -25.138 -33.758  48.617  1.00 122.44 ? 36   ARG A NE    1 
ATOM   261   C  CZ    . ARG A 1  36   ? -24.325 -32.706  48.591  1.00 123.93 ? 36   ARG A CZ    1 
ATOM   262   N  NH1   . ARG A 1  36   ? -24.532 -31.719  47.735  1.00 117.79 ? 36   ARG A NH1   1 
ATOM   263   N  NH2   . ARG A 1  36   ? -23.312 -32.637  49.437  1.00 162.29 ? 36   ARG A NH2   1 
ATOM   264   N  N     . PHE A 1  37   ? -27.954 -34.484  42.439  1.00 112.44 ? 37   PHE A N     1 
ATOM   265   C  CA    . PHE A 1  37   ? -29.125 -34.141  41.648  1.00 107.92 ? 37   PHE A CA    1 
ATOM   266   C  C     . PHE A 1  37   ? -28.894 -34.396  40.162  1.00 119.48 ? 37   PHE A C     1 
ATOM   267   O  O     . PHE A 1  37   ? -27.838 -34.041  39.629  1.00 128.26 ? 37   PHE A O     1 
ATOM   268   C  CB    . PHE A 1  37   ? -29.480 -32.661  41.862  1.00 114.68 ? 37   PHE A CB    1 
ATOM   269   C  CG    . PHE A 1  37   ? -29.392 -32.222  43.299  1.00 121.45 ? 37   PHE A CG    1 
ATOM   270   C  CD1   . PHE A 1  37   ? -29.972 -32.966  44.304  1.00 101.29 ? 37   PHE A CD1   1 
ATOM   271   C  CD2   . PHE A 1  37   ? -28.686 -31.084  43.649  1.00 138.61 ? 37   PHE A CD2   1 
ATOM   272   C  CE1   . PHE A 1  37   ? -29.876 -32.569  45.619  1.00 109.81 ? 37   PHE A CE1   1 
ATOM   273   C  CE2   . PHE A 1  37   ? -28.581 -30.692  44.969  1.00 133.77 ? 37   PHE A CE2   1 
ATOM   274   C  CZ    . PHE A 1  37   ? -29.178 -31.435  45.950  1.00 123.84 ? 37   PHE A CZ    1 
ATOM   275   N  N     . PRO A 1  38   ? -29.859 -35.006  39.466  1.00 115.89 ? 38   PRO A N     1 
ATOM   276   C  CA    . PRO A 1  38   ? -29.695 -35.204  38.015  1.00 110.24 ? 38   PRO A CA    1 
ATOM   277   C  C     . PRO A 1  38   ? -29.786 -33.913  37.230  1.00 117.91 ? 38   PRO A C     1 
ATOM   278   O  O     . PRO A 1  38   ? -29.315 -33.866  36.087  1.00 137.29 ? 38   PRO A O     1 
ATOM   279   C  CB    . PRO A 1  38   ? -30.840 -36.157  37.653  1.00 108.43 ? 38   PRO A CB    1 
ATOM   280   C  CG    . PRO A 1  38   ? -31.347 -36.700  38.982  1.00 104.49 ? 38   PRO A CG    1 
ATOM   281   C  CD    . PRO A 1  38   ? -31.090 -35.628  39.976  1.00 106.48 ? 38   PRO A CD    1 
ATOM   282   N  N     . GLU A 1  39   ? -30.367 -32.869  37.811  1.00 116.07 ? 39   GLU A N     1 
ATOM   283   C  CA    . GLU A 1  39   ? -30.393 -31.570  37.163  1.00 122.22 ? 39   GLU A CA    1 
ATOM   284   C  C     . GLU A 1  39   ? -28.971 -31.122  36.858  1.00 115.82 ? 39   GLU A C     1 
ATOM   285   O  O     . GLU A 1  39   ? -28.147 -30.970  37.762  1.00 143.67 ? 39   GLU A O     1 
ATOM   286   C  CB    . GLU A 1  39   ? -31.103 -30.557  38.067  1.00 142.73 ? 39   GLU A CB    1 
ATOM   287   C  CG    . GLU A 1  39   ? -32.603 -30.807  38.205  1.00 157.35 ? 39   GLU A CG    1 
ATOM   288   C  CD    . GLU A 1  39   ? -32.913 -31.842  39.272  1.00 163.81 ? 39   GLU A CD    1 
ATOM   289   O  OE1   . GLU A 1  39   ? -33.168 -31.463  40.435  1.00 171.02 ? 39   GLU A OE1   1 
ATOM   290   O  OE2   . GLU A 1  39   ? -32.845 -33.044  38.953  1.00 160.03 ? 39   GLU A OE2   1 
ATOM   291   N  N     . THR A 1  40   ? -28.664 -30.980  35.574  1.00 123.34 ? 40   THR A N     1 
ATOM   292   C  CA    . THR A 1  40   ? -27.355 -30.479  35.183  1.00 122.08 ? 40   THR A CA    1 
ATOM   293   C  C     . THR A 1  40   ? -27.256 -28.972  35.372  1.00 132.89 ? 40   THR A C     1 
ATOM   294   O  O     . THR A 1  40   ? -26.200 -28.465  35.776  1.00 113.54 ? 40   THR A O     1 
ATOM   295   C  CB    . THR A 1  40   ? -27.064 -30.833  33.718  1.00 124.06 ? 40   THR A CB    1 
ATOM   296   O  OG1   . THR A 1  40   ? -25.898 -30.132  33.273  1.00 133.52 ? 40   THR A OG1   1 
ATOM   297   C  CG2   . THR A 1  40   ? -28.247 -30.467  32.805  1.00 122.93 ? 40   THR A CG2   1 
ATOM   298   N  N     . MET A 1  41   ? -28.368 -28.268  35.179  1.00 145.42 ? 41   MET A N     1 
ATOM   299   C  CA    . MET A 1  41   ? -28.393 -26.818  35.136  1.00 131.27 ? 41   MET A CA    1 
ATOM   300   C  C     . MET A 1  41   ? -28.955 -26.219  36.424  1.00 142.44 ? 41   MET A C     1 
ATOM   301   O  O     . MET A 1  41   ? -29.485 -26.916  37.291  1.00 155.58 ? 41   MET A O     1 
ATOM   302   C  CB    . MET A 1  41   ? -29.187 -26.358  33.925  1.00 138.59 ? 41   MET A CB    1 
ATOM   303   C  CG    . MET A 1  41   ? -28.239 -26.046  32.800  1.00 140.83 ? 41   MET A CG    1 
ATOM   304   S  SD    . MET A 1  41   ? -26.821 -25.079  33.340  1.00 132.24 ? 41   MET A SD    1 
ATOM   305   C  CE    . MET A 1  41   ? -25.541 -25.685  32.250  1.00 128.74 ? 41   MET A CE    1 
ATOM   306   N  N     . ASP A 1  42   ? -28.894 -24.887  36.503  1.00 162.15 ? 42   ASP A N     1 
ATOM   307   C  CA    . ASP A 1  42   ? -29.229 -24.165  37.726  1.00 187.64 ? 42   ASP A CA    1 
ATOM   308   C  C     . ASP A 1  42   ? -30.691 -24.325  38.119  1.00 201.48 ? 42   ASP A C     1 
ATOM   309   O  O     . ASP A 1  42   ? -31.061 -23.918  39.225  1.00 206.73 ? 42   ASP A O     1 
ATOM   310   C  CB    . ASP A 1  42   ? -28.915 -22.675  37.506  1.00 206.10 ? 42   ASP A CB    1 
ATOM   311   C  CG    . ASP A 1  42   ? -28.865 -21.868  38.797  1.00 227.78 ? 42   ASP A CG    1 
ATOM   312   O  OD1   . ASP A 1  42   ? -29.001 -22.444  39.894  1.00 240.24 ? 42   ASP A OD1   1 
ATOM   313   O  OD2   . ASP A 1  42   ? -28.697 -20.633  38.710  1.00 229.24 ? 42   ASP A OD2   1 
ATOM   314   N  N     . GLU A 1  43   ? -31.514 -24.880  37.227  1.00 216.96 ? 43   GLU A N     1 
ATOM   315   C  CA    . GLU A 1  43   ? -32.925 -25.239  37.382  1.00 235.47 ? 43   GLU A CA    1 
ATOM   316   C  C     . GLU A 1  43   ? -33.737 -23.971  37.188  1.00 221.25 ? 43   GLU A C     1 
ATOM   317   O  O     . GLU A 1  43   ? -34.929 -24.018  36.864  1.00 217.80 ? 43   GLU A O     1 
ATOM   318   C  CB    . GLU A 1  43   ? -33.253 -25.869  38.743  1.00 241.61 ? 43   GLU A CB    1 
ATOM   319   C  CG    . GLU A 1  43   ? -33.726 -24.860  39.790  1.00 237.98 ? 43   GLU A CG    1 
ATOM   320   C  CD    . GLU A 1  43   ? -34.428 -25.502  40.961  1.00 231.35 ? 43   GLU A CD    1 
ATOM   321   O  OE1   . GLU A 1  43   ? -34.404 -26.746  41.063  1.00 230.61 ? 43   GLU A OE1   1 
ATOM   322   O  OE2   . GLU A 1  43   ? -35.010 -24.759  41.778  1.00 226.69 ? 43   GLU A OE2   1 
ATOM   323   N  N     . THR A 1  44   ? -33.085 -22.830  37.372  1.00 205.08 ? 44   THR A N     1 
ATOM   324   C  CA    . THR A 1  44   ? -33.615 -21.571  36.903  1.00 193.21 ? 44   THR A CA    1 
ATOM   325   C  C     . THR A 1  44   ? -33.067 -21.244  35.521  1.00 194.02 ? 44   THR A C     1 
ATOM   326   O  O     . THR A 1  44   ? -33.364 -20.167  34.991  1.00 201.51 ? 44   THR A O     1 
ATOM   327   C  CB    . THR A 1  44   ? -33.274 -20.465  37.916  1.00 191.89 ? 44   THR A CB    1 
ATOM   328   O  OG1   . THR A 1  44   ? -33.490 -20.968  39.238  1.00 188.55 ? 44   THR A OG1   1 
ATOM   329   C  CG2   . THR A 1  44   ? -34.205 -19.264  37.753  1.00 201.55 ? 44   THR A CG2   1 
ATOM   330   N  N     . GLN A 1  45   ? -32.266 -22.149  34.933  1.00 195.76 ? 45   GLN A N     1 
ATOM   331   C  CA    . GLN A 1  45   ? -31.682 -21.930  33.608  1.00 208.13 ? 45   GLN A CA    1 
ATOM   332   C  C     . GLN A 1  45   ? -30.965 -20.585  33.581  1.00 218.20 ? 45   GLN A C     1 
ATOM   333   O  O     . GLN A 1  45   ? -30.826 -19.943  32.539  1.00 236.05 ? 45   GLN A O     1 
ATOM   334   C  CB    . GLN A 1  45   ? -32.762 -22.049  32.521  1.00 231.89 ? 45   GLN A CB    1 
ATOM   335   C  CG    . GLN A 1  45   ? -32.312 -21.968  31.059  1.00 239.19 ? 45   GLN A CG    1 
ATOM   336   C  CD    . GLN A 1  45   ? -32.716 -20.654  30.403  1.00 239.20 ? 45   GLN A CD    1 
ATOM   337   O  OE1   . GLN A 1  45   ? -33.377 -19.817  31.020  1.00 241.24 ? 45   GLN A OE1   1 
ATOM   338   N  NE2   . GLN A 1  45   ? -32.319 -20.468  29.148  1.00 225.92 ? 45   GLN A NE2   1 
ATOM   339   N  N     . THR A 1  46   ? -30.440 -20.175  34.732  1.00 213.19 ? 46   THR A N     1 
ATOM   340   C  CA    . THR A 1  46   ? -29.731 -18.904  34.827  1.00 218.89 ? 46   THR A CA    1 
ATOM   341   C  C     . THR A 1  46   ? -28.274 -19.005  34.423  1.00 210.37 ? 46   THR A C     1 
ATOM   342   O  O     . THR A 1  46   ? -27.441 -18.211  34.876  1.00 216.33 ? 46   THR A O     1 
ATOM   343   C  CB    . THR A 1  46   ? -29.826 -18.355  36.252  1.00 213.95 ? 46   THR A CB    1 
ATOM   344   O  OG1   . THR A 1  46   ? -29.427 -19.368  37.181  1.00 221.65 ? 46   THR A OG1   1 
ATOM   345   C  CG2   . THR A 1  46   ? -31.239 -17.895  36.565  1.00 201.63 ? 46   THR A CG2   1 
ATOM   346   N  N     . ARG A 1  47   ? -27.955 -19.990  33.588  1.00 189.50 ? 47   ARG A N     1 
ATOM   347   C  CA    . ARG A 1  47   ? -26.608 -20.183  33.073  1.00 186.07 ? 47   ARG A CA    1 
ATOM   348   C  C     . ARG A 1  47   ? -25.608 -20.417  34.199  1.00 183.05 ? 47   ARG A C     1 
ATOM   349   O  O     . ARG A 1  47   ? -24.401 -20.264  34.005  1.00 190.08 ? 47   ARG A O     1 
ATOM   350   C  CB    . ARG A 1  47   ? -26.199 -18.993  32.192  1.00 190.44 ? 47   ARG A CB    1 
ATOM   351   C  CG    . ARG A 1  47   ? -26.398 -19.204  30.699  1.00 190.08 ? 47   ARG A CG    1 
ATOM   352   C  CD    . ARG A 1  47   ? -25.130 -19.683  30.056  1.00 196.52 ? 47   ARG A CD    1 
ATOM   353   N  NE    . ARG A 1  47   ? -24.156 -18.607  29.972  1.00 207.61 ? 47   ARG A NE    1 
ATOM   354   C  CZ    . ARG A 1  47   ? -24.298 -17.529  29.209  1.00 209.08 ? 47   ARG A CZ    1 
ATOM   355   N  NH1   . ARG A 1  47   ? -23.347 -16.600  29.210  1.00 206.55 ? 47   ARG A NH1   1 
ATOM   356   N  NH2   . ARG A 1  47   ? -25.370 -17.371  28.435  1.00 211.04 ? 47   ARG A NH2   1 
ATOM   357   N  N     . ALA A 1  48   ? -26.098 -20.788  35.377  1.00 167.29 ? 48   ALA A N     1 
ATOM   358   C  CA    . ALA A 1  48   ? -25.271 -21.371  36.417  1.00 151.70 ? 48   ALA A CA    1 
ATOM   359   C  C     . ALA A 1  48   ? -25.465 -22.879  36.360  1.00 141.72 ? 48   ALA A C     1 
ATOM   360   O  O     . ALA A 1  48   ? -26.419 -23.374  35.759  1.00 155.18 ? 48   ALA A O     1 
ATOM   361   C  CB    . ALA A 1  48   ? -25.664 -20.831  37.796  1.00 135.08 ? 48   ALA A CB    1 
ATOM   362   N  N     . LYS A 1  49   ? -24.573 -23.616  36.999  1.00 120.52 ? 49   LYS A N     1 
ATOM   363   C  CA    . LYS A 1  49   ? -24.703 -25.061  37.085  1.00 117.65 ? 49   LYS A CA    1 
ATOM   364   C  C     . LYS A 1  49   ? -25.028 -25.422  38.525  1.00 120.15 ? 49   LYS A C     1 
ATOM   365   O  O     . LYS A 1  49   ? -24.420 -24.869  39.446  1.00 133.30 ? 49   LYS A O     1 
ATOM   366   C  CB    . LYS A 1  49   ? -23.420 -25.731  36.608  1.00 152.14 ? 49   LYS A CB    1 
ATOM   367   C  CG    . LYS A 1  49   ? -22.885 -25.129  35.308  1.00 179.57 ? 49   LYS A CG    1 
ATOM   368   C  CD    . LYS A 1  49   ? -22.243 -26.195  34.429  1.00 194.72 ? 49   LYS A CD    1 
ATOM   369   C  CE    . LYS A 1  49   ? -21.362 -25.580  33.358  1.00 175.05 ? 49   LYS A CE    1 
ATOM   370   N  NZ    . LYS A 1  49   ? -19.938 -25.657  33.748  1.00 156.92 ? 49   LYS A NZ    1 
ATOM   371   N  N     . ILE A 1  50   ? -26.029 -26.288  38.723  1.00 107.43 ? 50   ILE A N     1 
ATOM   372   C  CA    . ILE A 1  50   ? -26.509 -26.546  40.080  1.00 126.13 ? 50   ILE A CA    1 
ATOM   373   C  C     . ILE A 1  50   ? -25.395 -27.191  40.911  1.00 120.67 ? 50   ILE A C     1 
ATOM   374   O  O     . ILE A 1  50   ? -24.511 -27.878  40.381  1.00 114.72 ? 50   ILE A O     1 
ATOM   375   C  CB    . ILE A 1  50   ? -27.782 -27.416  40.042  1.00 143.39 ? 50   ILE A CB    1 
ATOM   376   C  CG1   . ILE A 1  50   ? -28.705 -27.139  41.241  1.00 135.60 ? 50   ILE A CG1   1 
ATOM   377   C  CG2   . ILE A 1  50   ? -27.435 -28.889  39.974  1.00 163.60 ? 50   ILE A CG2   1 
ATOM   378   C  CD1   . ILE A 1  50   ? -30.009 -27.976  41.238  1.00 120.54 ? 50   ILE A CD1   1 
ATOM   379   N  N     . GLY A 1  51   ? -25.453 -26.992  42.233  1.00 119.29 ? 51   GLY A N     1 
ATOM   380   C  CA    . GLY A 1  51   ? -24.470 -27.569  43.132  1.00 96.34  ? 51   GLY A CA    1 
ATOM   381   C  C     . GLY A 1  51   ? -24.643 -29.071  43.246  1.00 100.83 ? 51   GLY A C     1 
ATOM   382   O  O     . GLY A 1  51   ? -24.289 -29.662  44.261  1.00 104.09 ? 51   GLY A O     1 
ATOM   383   N  N     . GLY A 1  52   ? -25.194 -29.701  42.212  1.00 124.93 ? 52   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  52   ? -25.599 -31.089  42.271  1.00 96.19  ? 52   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  52   ? -25.009 -32.048  41.261  1.00 101.22 ? 52   GLY A C     1 
ATOM   386   O  O     . GLY A 1  52   ? -24.845 -33.214  41.619  1.00 117.17 ? 52   GLY A O     1 
ATOM   387   N  N     . LEU A 1  53   ? -24.751 -31.643  40.002  1.00 107.07 ? 53   LEU A N     1 
ATOM   388   C  CA    . LEU A 1  53   ? -24.143 -32.593  39.059  1.00 118.46 ? 53   LEU A CA    1 
ATOM   389   C  C     . LEU A 1  53   ? -23.000 -32.008  38.236  1.00 126.76 ? 53   LEU A C     1 
ATOM   390   O  O     . LEU A 1  53   ? -21.893 -32.544  38.259  1.00 156.00 ? 53   LEU A O     1 
ATOM   391   C  CB    . LEU A 1  53   ? -25.149 -33.200  38.077  1.00 112.73 ? 53   LEU A CB    1 
ATOM   392   C  CG    . LEU A 1  53   ? -24.451 -34.253  37.181  1.00 103.25 ? 53   LEU A CG    1 
ATOM   393   C  CD1   . LEU A 1  53   ? -25.266 -35.531  36.989  1.00 92.32  ? 53   LEU A CD1   1 
ATOM   394   C  CD2   . LEU A 1  53   ? -24.050 -33.694  35.819  1.00 121.04 ? 53   LEU A CD2   1 
ATOM   395   N  N     . ASN A 1  54   ? -23.254 -30.986  37.433  1.00 126.18 ? 54   ASN A N     1 
ATOM   396   C  CA    . ASN A 1  54   ? -22.201 -30.430  36.596  1.00 89.86  ? 54   ASN A CA    1 
ATOM   397   C  C     . ASN A 1  54   ? -21.626 -29.230  37.333  1.00 105.62 ? 54   ASN A C     1 
ATOM   398   O  O     . ASN A 1  54   ? -22.365 -28.491  37.985  1.00 163.00 ? 54   ASN A O     1 
ATOM   399   C  CB    . ASN A 1  54   ? -22.764 -30.022  35.239  1.00 97.15  ? 54   ASN A CB    1 
ATOM   400   C  CG    . ASN A 1  54   ? -22.315 -30.930  34.158  1.00 94.65  ? 54   ASN A CG    1 
ATOM   401   O  OD1   . ASN A 1  54   ? -21.826 -32.019  34.443  1.00 113.39 ? 54   ASN A OD1   1 
ATOM   402   N  ND2   . ASN A 1  54   ? -22.509 -30.530  32.913  1.00 87.80  ? 54   ASN A ND2   1 
ATOM   403   N  N     . ASP A 1  55   ? -20.315 -29.038  37.222  1.00 115.50 ? 55   ASP A N     1 
ATOM   404   C  CA    . ASP A 1  55   ? -19.514 -28.159  38.081  1.00 135.75 ? 55   ASP A CA    1 
ATOM   405   C  C     . ASP A 1  55   ? -20.104 -27.879  39.453  1.00 116.30 ? 55   ASP A C     1 
ATOM   406   O  O     . ASP A 1  55   ? -20.485 -26.738  39.758  1.00 107.83 ? 55   ASP A O     1 
ATOM   407   C  CB    . ASP A 1  55   ? -19.141 -26.797  37.506  1.00 170.92 ? 55   ASP A CB    1 
ATOM   408   C  CG    . ASP A 1  55   ? -18.305 -25.970  38.530  1.00 165.10 ? 55   ASP A CG    1 
ATOM   409   O  OD1   . ASP A 1  55   ? -17.190 -26.409  38.920  1.00 136.98 ? 55   ASP A OD1   1 
ATOM   410   O  OD2   . ASP A 1  55   ? -18.784 -24.903  38.973  1.00 157.49 ? 55   ASP A OD2   1 
ATOM   411   N  N     . PRO A 1  56   ? -20.204 -28.851  40.280  1.00 107.22 ? 56   PRO A N     1 
ATOM   412   C  CA    . PRO A 1  56   ? -20.149 -28.518  41.693  1.00 147.12 ? 56   PRO A CA    1 
ATOM   413   C  C     . PRO A 1  56   ? -18.718 -28.831  42.049  1.00 192.38 ? 56   PRO A C     1 
ATOM   414   O  O     . PRO A 1  56   ? -18.413 -29.914  42.548  1.00 222.58 ? 56   PRO A O     1 
ATOM   415   C  CB    . PRO A 1  56   ? -21.169 -29.458  42.341  1.00 104.67 ? 56   PRO A CB    1 
ATOM   416   C  CG    . PRO A 1  56   ? -21.310 -30.611  41.340  1.00 116.41 ? 56   PRO A CG    1 
ATOM   417   C  CD    . PRO A 1  56   ? -20.506 -30.276  40.098  1.00 91.29  ? 56   PRO A CD    1 
ATOM   418   N  N     . ARG A 1  57   ? -17.832 -27.855  41.791  1.00 177.17 ? 57   ARG A N     1 
ATOM   419   C  CA    . ARG A 1  57   ? -16.393 -27.981  41.995  1.00 133.43 ? 57   ARG A CA    1 
ATOM   420   C  C     . ARG A 1  57   ? -15.708 -28.961  41.021  1.00 124.04 ? 57   ARG A C     1 
ATOM   421   O  O     . ARG A 1  57   ? -14.550 -29.343  41.239  1.00 95.82  ? 57   ARG A O     1 
ATOM   422   C  CB    . ARG A 1  57   ? -16.118 -28.352  43.471  1.00 136.84 ? 57   ARG A CB    1 
ATOM   423   C  CG    . ARG A 1  57   ? -16.872 -27.448  44.526  1.00 126.85 ? 57   ARG A CG    1 
ATOM   424   C  CD    . ARG A 1  57   ? -18.226 -28.028  45.068  1.00 94.25  ? 57   ARG A CD    1 
ATOM   425   N  NE    . ARG A 1  57   ? -18.137 -28.978  46.182  1.00 126.29 ? 57   ARG A NE    1 
ATOM   426   C  CZ    . ARG A 1  57   ? -19.209 -29.533  46.754  1.00 147.71 ? 57   ARG A CZ    1 
ATOM   427   N  NH1   . ARG A 1  57   ? -20.403 -29.212  46.283  1.00 152.03 ? 57   ARG A NH1   1 
ATOM   428   N  NH2   . ARG A 1  57   ? -19.116 -30.399  47.782  1.00 116.95 ? 57   ARG A NH2   1 
ATOM   429   N  N     . LEU A 1  58   ? -16.345 -29.331  39.898  1.00 123.94 ? 58   LEU A N     1 
ATOM   430   C  CA    . LEU A 1  58   ? -15.840 -30.409  39.033  1.00 115.78 ? 58   LEU A CA    1 
ATOM   431   C  C     . LEU A 1  58   ? -15.084 -29.936  37.800  1.00 105.89 ? 58   LEU A C     1 
ATOM   432   O  O     . LEU A 1  58   ? -14.511 -30.772  37.098  1.00 86.28  ? 58   LEU A O     1 
ATOM   433   C  CB    . LEU A 1  58   ? -16.962 -31.326  38.509  1.00 101.21 ? 58   LEU A CB    1 
ATOM   434   C  CG    . LEU A 1  58   ? -17.690 -32.343  39.383  1.00 99.78  ? 58   LEU A CG    1 
ATOM   435   C  CD1   . LEU A 1  58   ? -18.724 -33.091  38.569  1.00 89.18  ? 58   LEU A CD1   1 
ATOM   436   C  CD2   . LEU A 1  58   ? -16.722 -33.296  40.012  1.00 97.00  ? 58   LEU A CD2   1 
ATOM   437   N  N     . GLY A 1  59   ? -15.117 -28.653  37.479  1.00 117.47 ? 59   GLY A N     1 
ATOM   438   C  CA    . GLY A 1  59   ? -14.504 -28.132  36.277  1.00 85.97  ? 59   GLY A CA    1 
ATOM   439   C  C     . GLY A 1  59   ? -15.465 -27.248  35.520  1.00 107.20 ? 59   GLY A C     1 
ATOM   440   O  O     . GLY A 1  59   ? -16.610 -27.043  35.913  1.00 140.29 ? 59   GLY A O     1 
ATOM   441   N  N     . SER A 1  60   ? -15.001 -26.751  34.386  1.00 117.52 ? 60   SER A N     1 
ATOM   442   C  CA    . SER A 1  60   ? -15.683 -25.665  33.704  1.00 126.07 ? 60   SER A CA    1 
ATOM   443   C  C     . SER A 1  60   ? -16.416 -26.175  32.483  1.00 152.15 ? 60   SER A C     1 
ATOM   444   O  O     . SER A 1  60   ? -15.921 -27.054  31.773  1.00 181.52 ? 60   SER A O     1 
ATOM   445   C  CB    . SER A 1  60   ? -14.699 -24.594  33.243  1.00 155.15 ? 60   SER A CB    1 
ATOM   446   O  OG    . SER A 1  60   ? -15.380 -23.383  32.959  1.00 163.83 ? 60   SER A OG    1 
ATOM   447   N  N     . ILE A 1  61   ? -17.576 -25.585  32.225  1.00 160.97 ? 61   ILE A N     1 
ATOM   448   C  CA    . ILE A 1  61   ? -18.081 -25.489  30.862  1.00 174.28 ? 61   ILE A CA    1 
ATOM   449   C  C     . ILE A 1  61   ? -18.568 -24.062  30.666  1.00 160.77 ? 61   ILE A C     1 
ATOM   450   O  O     . ILE A 1  61   ? -19.769 -23.783  30.754  1.00 144.37 ? 61   ILE A O     1 
ATOM   451   C  CB    . ILE A 1  61   ? -19.193 -26.507  30.550  1.00 182.22 ? 61   ILE A CB    1 
ATOM   452   C  CG1   . ILE A 1  61   ? -18.675 -27.938  30.680  1.00 181.09 ? 61   ILE A CG1   1 
ATOM   453   C  CG2   . ILE A 1  61   ? -19.652 -26.342  29.117  1.00 192.83 ? 61   ILE A CG2   1 
ATOM   454   C  CD1   . ILE A 1  61   ? -17.915 -28.431  29.441  1.00 158.13 ? 61   ILE A CD1   1 
ATOM   455   N  N     . ASP A 1  62   ? -17.611 -23.157  30.432  1.00 167.25 ? 62   ASP A N     1 
ATOM   456   C  CA    . ASP A 1  62   ? -17.821 -21.751  30.103  1.00 149.49 ? 62   ASP A CA    1 
ATOM   457   C  C     . ASP A 1  62   ? -16.442 -21.108  29.969  1.00 151.00 ? 62   ASP A C     1 
ATOM   458   O  O     . ASP A 1  62   ? -15.426 -21.809  30.003  1.00 151.28 ? 62   ASP A O     1 
ATOM   459   C  CB    . ASP A 1  62   ? -18.665 -21.045  31.170  1.00 146.85 ? 62   ASP A CB    1 
ATOM   460   C  CG    . ASP A 1  62   ? -19.352 -19.791  30.646  1.00 165.77 ? 62   ASP A CG    1 
ATOM   461   O  OD1   . ASP A 1  62   ? -19.128 -19.426  29.470  1.00 178.16 ? 62   ASP A OD1   1 
ATOM   462   O  OD2   . ASP A 1  62   ? -20.126 -19.172  31.405  1.00 159.63 ? 62   ASP A OD2   1 
ATOM   463   N  N     . ARG A 1  63   ? -16.384 -19.795  29.767  1.00 155.76 ? 63   ARG A N     1 
ATOM   464   C  CA    . ARG A 1  63   ? -15.125 -19.052  29.714  1.00 133.25 ? 63   ARG A CA    1 
ATOM   465   C  C     . ARG A 1  63   ? -15.104 -18.091  30.901  1.00 133.57 ? 63   ARG A C     1 
ATOM   466   O  O     . ARG A 1  63   ? -15.355 -16.891  30.760  1.00 148.41 ? 63   ARG A O     1 
ATOM   467   C  CB    . ARG A 1  63   ? -14.974 -18.359  28.416  1.00 153.46 ? 63   ARG A CB    1 
ATOM   468   C  CG    . ARG A 1  63   ? -15.198 -19.298  27.244  1.00 178.99 ? 63   ARG A CG    1 
ATOM   469   C  CD    . ARG A 1  63   ? -14.386 -20.572  27.410  1.00 158.82 ? 63   ARG A CD    1 
ATOM   470   N  NE    . ARG A 1  63   ? -12.957 -20.301  27.413  1.00 174.89 ? 63   ARG A NE    1 
ATOM   471   C  CZ    . ARG A 1  63   ? -12.091 -20.866  26.578  1.00 178.17 ? 63   ARG A CZ    1 
ATOM   472   N  NH1   . ARG A 1  63   ? -10.804 -20.553  26.658  1.00 179.23 ? 63   ARG A NH1   1 
ATOM   473   N  NH2   . ARG A 1  63   ? -12.503 -21.751  25.673  1.00 160.32 ? 63   ARG A NH2   1 
ATOM   474   N  N     . ASN A 1  64   ? -14.845 -18.649  32.080  1.00 142.48 ? 64   ASN A N     1 
ATOM   475   C  CA    . ASN A 1  64   ? -14.676 -17.921  33.330  1.00 143.78 ? 64   ASN A CA    1 
ATOM   476   C  C     . ASN A 1  64   ? -13.785 -18.774  34.224  1.00 173.18 ? 64   ASN A C     1 
ATOM   477   O  O     . ASN A 1  64   ? -13.950 -20.004  34.273  1.00 114.45 ? 64   ASN A O     1 
ATOM   478   C  CB    . ASN A 1  64   ? -16.033 -17.655  33.990  1.00 127.19 ? 64   ASN A CB    1 
ATOM   479   C  CG    . ASN A 1  64   ? -16.908 -18.901  34.028  1.00 131.25 ? 64   ASN A CG    1 
ATOM   480   O  OD1   . ASN A 1  64   ? -16.680 -19.841  33.266  1.00 134.41 ? 64   ASN A OD1   1 
ATOM   481   N  ND2   . ASN A 1  64   ? -17.905 -18.916  34.914  1.00 104.40 ? 64   ASN A ND2   1 
ATOM   482   N  N     . LEU A 1  65   ? -12.847 -18.118  34.938  1.00 207.87 ? 65   LEU A N     1 
ATOM   483   C  CA    . LEU A 1  65   ? -11.920 -18.855  35.796  1.00 205.60 ? 65   LEU A CA    1 
ATOM   484   C  C     . LEU A 1  65   ? -12.732 -19.806  36.652  1.00 194.82 ? 65   LEU A C     1 
ATOM   485   O  O     . LEU A 1  65   ? -13.134 -19.489  37.774  1.00 214.85 ? 65   LEU A O     1 
ATOM   486   C  CB    . LEU A 1  65   ? -11.088 -17.901  36.658  1.00 204.47 ? 65   LEU A CB    1 
ATOM   487   C  CG    . LEU A 1  65   ? -9.710  -17.460  36.156  1.00 183.56 ? 65   LEU A CG    1 
ATOM   488   C  CD1   . LEU A 1  65   ? -9.814  -16.588  34.906  1.00 177.82 ? 65   LEU A CD1   1 
ATOM   489   C  CD2   . LEU A 1  65   ? -8.994  -16.702  37.268  1.00 162.14 ? 65   LEU A CD2   1 
ATOM   490   N  N     . LYS A 1  66   ? -12.922 -21.001  36.126  1.00 123.69 ? 66   LYS A N     1 
ATOM   491   C  CA    . LYS A 1  66   ? -13.729 -22.018  36.776  1.00 156.09 ? 66   LYS A CA    1 
ATOM   492   C  C     . LYS A 1  66   ? -12.865 -23.103  37.357  1.00 141.46 ? 66   LYS A C     1 
ATOM   493   O  O     . LYS A 1  66   ? -11.807 -22.824  37.925  1.00 109.79 ? 66   LYS A O     1 
ATOM   494   C  CB    . LYS A 1  66   ? -14.775 -22.615  35.852  1.00 188.13 ? 66   LYS A CB    1 
ATOM   495   C  CG    . LYS A 1  66   ? -16.123 -21.948  35.899  1.00 187.13 ? 66   LYS A CG    1 
ATOM   496   C  CD    . LYS A 1  66   ? -16.595 -21.845  37.352  1.00 181.00 ? 66   LYS A CD    1 
ATOM   497   C  CE    . LYS A 1  66   ? -18.071 -21.495  37.445  1.00 157.88 ? 66   LYS A CE    1 
ATOM   498   N  NZ    . LYS A 1  66   ? -18.502 -21.259  38.848  1.00 139.66 ? 66   LYS A NZ    1 
ATOM   499   N  N     . CYS A 1  67   ? -13.328 -24.344  37.238  1.00 162.35 ? 67   CYS A N     1 
ATOM   500   C  CA    . CYS A 1  67   ? -12.665 -25.446  37.894  1.00 140.62 ? 67   CYS A CA    1 
ATOM   501   C  C     . CYS A 1  67   ? -12.504 -25.102  39.358  1.00 135.30 ? 67   CYS A C     1 
ATOM   502   O  O     . CYS A 1  67   ? -11.450 -25.312  39.944  1.00 168.96 ? 67   CYS A O     1 
ATOM   503   C  CB    . CYS A 1  67   ? -11.309 -25.732  37.255  1.00 141.93 ? 67   CYS A CB    1 
ATOM   504   S  SG    . CYS A 1  67   ? -10.714 -27.466  37.198  1.00 111.51 ? 67   CYS A SG    1 
ATOM   505   N  N     . GLN A 1  68   ? -13.582 -24.576  39.947  1.00 130.70 ? 68   GLN A N     1 
ATOM   506   C  CA    . GLN A 1  68   ? -13.566 -23.797  41.181  1.00 110.91 ? 68   GLN A CA    1 
ATOM   507   C  C     . GLN A 1  68   ? -12.560 -24.296  42.208  1.00 133.53 ? 68   GLN A C     1 
ATOM   508   O  O     . GLN A 1  68   ? -12.192 -23.559  43.129  1.00 175.15 ? 68   GLN A O     1 
ATOM   509   C  CB    . GLN A 1  68   ? -14.948 -23.800  41.809  1.00 109.22 ? 68   GLN A CB    1 
ATOM   510   C  CG    . GLN A 1  68   ? -15.867 -22.753  41.238  1.00 130.23 ? 68   GLN A CG    1 
ATOM   511   C  CD    . GLN A 1  68   ? -17.064 -22.515  42.126  1.00 146.35 ? 68   GLN A CD    1 
ATOM   512   O  OE1   . GLN A 1  68   ? -17.225 -23.160  43.166  1.00 132.63 ? 68   GLN A OE1   1 
ATOM   513   N  NE2   . GLN A 1  68   ? -17.934 -21.613  41.705  1.00 154.43 ? 68   GLN A NE2   1 
ATOM   514   N  N     . THR A 1  69   ? -12.149 -25.563  42.080  1.00 110.37 ? 69   THR A N     1 
ATOM   515   C  CA    . THR A 1  69   ? -11.039 -26.097  42.862  1.00 130.40 ? 69   THR A CA    1 
ATOM   516   C  C     . THR A 1  69   ? -9.668  -25.672  42.293  1.00 125.16 ? 69   THR A C     1 
ATOM   517   O  O     . THR A 1  69   ? -8.751  -25.388  43.069  1.00 106.79 ? 69   THR A O     1 
ATOM   518   C  CB    . THR A 1  69   ? -11.202 -27.620  42.944  1.00 121.76 ? 69   THR A CB    1 
ATOM   519   O  OG1   . THR A 1  69   ? -11.208 -28.182  41.631  1.00 156.54 ? 69   THR A OG1   1 
ATOM   520   C  CG2   . THR A 1  69   ? -12.541 -27.936  43.541  1.00 90.66  ? 69   THR A CG2   1 
ATOM   521   N  N     . CYS A 1  70   ? -9.511  -25.601  40.948  1.00 147.79 ? 70   CYS A N     1 
ATOM   522   C  CA    . CYS A 1  70   ? -8.253  -25.246  40.270  1.00 95.71  ? 70   CYS A CA    1 
ATOM   523   C  C     . CYS A 1  70   ? -8.028  -23.757  40.096  1.00 115.01 ? 70   CYS A C     1 
ATOM   524   O  O     . CYS A 1  70   ? -6.881  -23.296  40.116  1.00 135.71 ? 70   CYS A O     1 
ATOM   525   C  CB    . CYS A 1  70   ? -8.222  -25.793  38.841  1.00 184.49 ? 70   CYS A CB    1 
ATOM   526   S  SG    . CYS A 1  70   ? -7.747  -27.461  38.606  1.00 185.46 ? 70   CYS A SG    1 
ATOM   527   N  N     . GLN A 1  71   ? -9.111  -23.006  39.913  1.00 120.57 ? 71   GLN A N     1 
ATOM   528   C  CA    . GLN A 1  71   ? -9.060  -21.597  39.526  1.00 99.97  ? 71   GLN A CA    1 
ATOM   529   C  C     . GLN A 1  71   ? -8.243  -21.413  38.247  1.00 87.03  ? 71   GLN A C     1 
ATOM   530   O  O     . GLN A 1  71   ? -7.568  -20.401  38.052  1.00 119.15 ? 71   GLN A O     1 
ATOM   531   C  CB    . GLN A 1  71   ? -8.545  -20.713  40.664  1.00 126.75 ? 71   GLN A CB    1 
ATOM   532   C  CG    . GLN A 1  71   ? -8.769  -21.270  42.066  1.00 129.56 ? 71   GLN A CG    1 
ATOM   533   C  CD    . GLN A 1  71   ? -10.244 -21.258  42.461  1.00 172.15 ? 71   GLN A CD    1 
ATOM   534   O  OE1   . GLN A 1  71   ? -11.125 -20.940  41.653  1.00 170.74 ? 71   GLN A OE1   1 
ATOM   535   N  NE2   . GLN A 1  71   ? -10.518 -21.606  43.714  1.00 198.94 ? 71   GLN A NE2   1 
ATOM   536   N  N     . GLU A 1  72   ? -8.318  -22.390  37.352  1.00 86.12  ? 72   GLU A N     1 
ATOM   537   C  CA    . GLU A 1  72   ? -7.462  -22.430  36.178  1.00 94.93  ? 72   GLU A CA    1 
ATOM   538   C  C     . GLU A 1  72   ? -8.190  -22.181  34.867  1.00 99.74  ? 72   GLU A C     1 
ATOM   539   O  O     . GLU A 1  72   ? -7.608  -21.605  33.947  1.00 113.09 ? 72   GLU A O     1 
ATOM   540   C  CB    . GLU A 1  72   ? -6.697  -23.755  36.116  1.00 107.41 ? 72   GLU A CB    1 
ATOM   541   C  CG    . GLU A 1  72   ? -5.415  -23.772  36.982  1.00 126.60 ? 72   GLU A CG    1 
ATOM   542   C  CD    . GLU A 1  72   ? -4.391  -22.692  36.630  1.00 118.92 ? 72   GLU A CD    1 
ATOM   543   O  OE1   . GLU A 1  72   ? -4.299  -22.298  35.448  1.00 112.28 ? 72   GLU A OE1   1 
ATOM   544   O  OE2   . GLU A 1  72   ? -3.666  -22.240  37.542  1.00 108.44 ? 72   GLU A OE2   1 
ATOM   545   N  N     . GLY A 1  73   ? -9.407  -22.674  34.709  1.00 84.55  ? 73   GLY A N     1 
ATOM   546   C  CA    . GLY A 1  73   ? -10.095 -22.544  33.444  1.00 114.62 ? 73   GLY A CA    1 
ATOM   547   C  C     . GLY A 1  73   ? -9.536  -23.539  32.444  1.00 119.43 ? 73   GLY A C     1 
ATOM   548   O  O     . GLY A 1  73   ? -8.403  -23.999  32.552  1.00 102.87 ? 73   GLY A O     1 
ATOM   549   N  N     . MET A 1  74   ? -10.322 -23.806  31.404  1.00 112.05 ? 74   MET A N     1 
ATOM   550   C  CA    . MET A 1  74   ? -9.988  -24.867  30.460  1.00 99.96  ? 74   MET A CA    1 
ATOM   551   C  C     . MET A 1  74   ? -8.660  -24.581  29.754  1.00 120.93 ? 74   MET A C     1 
ATOM   552   O  O     . MET A 1  74   ? -8.096  -23.487  29.875  1.00 149.03 ? 74   MET A O     1 
ATOM   553   C  CB    . MET A 1  74   ? -11.121 -25.040  29.454  1.00 110.40 ? 74   MET A CB    1 
ATOM   554   C  CG    . MET A 1  74   ? -12.480 -24.617  29.994  1.00 132.03 ? 74   MET A CG    1 
ATOM   555   S  SD    . MET A 1  74   ? -13.843 -25.197  28.963  1.00 140.23 ? 74   MET A SD    1 
ATOM   556   C  CE    . MET A 1  74   ? -13.216 -24.752  27.342  1.00 145.34 ? 74   MET A CE    1 
ATOM   557   N  N     . ASN A 1  75   ? -8.164  -25.580  29.004  1.00 92.86  ? 75   ASN A N     1 
ATOM   558   C  CA    . ASN A 1  75   ? -6.768  -25.720  28.575  1.00 112.48 ? 75   ASN A CA    1 
ATOM   559   C  C     . ASN A 1  75   ? -5.866  -26.030  29.766  1.00 116.85 ? 75   ASN A C     1 
ATOM   560   O  O     . ASN A 1  75   ? -4.663  -26.157  29.624  1.00 162.42 ? 75   ASN A O     1 
ATOM   561   C  CB    . ASN A 1  75   ? -6.258  -24.471  27.833  1.00 132.28 ? 75   ASN A CB    1 
ATOM   562   C  CG    . ASN A 1  75   ? -4.820  -24.587  27.360  1.00 156.57 ? 75   ASN A CG    1 
ATOM   563   O  OD1   . ASN A 1  75   ? -4.501  -25.373  26.465  1.00 161.06 ? 75   ASN A OD1   1 
ATOM   564   N  ND2   . ASN A 1  75   ? -3.937  -23.806  27.976  1.00 156.61 ? 75   ASN A ND2   1 
ATOM   565   N  N     . GLU A 1  76   ? -6.444  -26.119  30.948  1.00 124.39 ? 76   GLU A N     1 
ATOM   566   C  CA    . GLU A 1  76   ? -5.849  -26.577  32.182  1.00 81.50  ? 76   GLU A CA    1 
ATOM   567   C  C     . GLU A 1  76   ? -7.005  -27.151  32.994  1.00 137.90 ? 76   GLU A C     1 
ATOM   568   O  O     . GLU A 1  76   ? -8.147  -27.187  32.524  1.00 158.86 ? 76   GLU A O     1 
ATOM   569   C  CB    . GLU A 1  76   ? -5.139  -25.446  32.940  1.00 82.08  ? 76   GLU A CB    1 
ATOM   570   C  CG    . GLU A 1  76   ? -3.835  -25.845  33.626  1.00 123.50 ? 76   GLU A CG    1 
ATOM   571   C  CD    . GLU A 1  76   ? -2.612  -25.763  32.728  1.00 136.11 ? 76   GLU A CD    1 
ATOM   572   O  OE1   . GLU A 1  76   ? -2.292  -24.664  32.224  1.00 134.64 ? 76   GLU A OE1   1 
ATOM   573   O  OE2   . GLU A 1  76   ? -1.969  -26.811  32.501  1.00 147.31 ? 76   GLU A OE2   1 
ATOM   574   N  N     . CYS A 1  77   ? -6.726  -27.537  34.230  1.00 141.37 ? 77   CYS A N     1 
ATOM   575   C  CA    . CYS A 1  77   ? -7.725  -28.218  35.044  1.00 140.54 ? 77   CYS A CA    1 
ATOM   576   C  C     . CYS A 1  77   ? -8.272  -29.376  34.237  1.00 105.39 ? 77   CYS A C     1 
ATOM   577   O  O     . CYS A 1  77   ? -9.326  -29.265  33.605  1.00 82.56  ? 77   CYS A O     1 
ATOM   578   C  CB    . CYS A 1  77   ? -8.866  -27.296  35.485  1.00 111.70 ? 77   CYS A CB    1 
ATOM   579   S  SG    . CYS A 1  77   ? -9.633  -27.738  37.142  1.00 85.07  ? 77   CYS A SG    1 
ATOM   580   N  N     . PRO A 1  78   ? -7.529  -30.477  34.206  1.00 96.83  ? 78   PRO A N     1 
ATOM   581   C  CA    . PRO A 1  78   ? -7.844  -31.572  33.281  1.00 107.82 ? 78   PRO A CA    1 
ATOM   582   C  C     . PRO A 1  78   ? -9.213  -32.136  33.495  1.00 110.54 ? 78   PRO A C     1 
ATOM   583   O  O     . PRO A 1  78   ? -9.744  -32.823  32.617  1.00 118.25 ? 78   PRO A O     1 
ATOM   584   C  CB    . PRO A 1  78   ? -6.802  -32.632  33.649  1.00 120.17 ? 78   PRO A CB    1 
ATOM   585   C  CG    . PRO A 1  78   ? -6.496  -32.326  35.104  1.00 88.10  ? 78   PRO A CG    1 
ATOM   586   C  CD    . PRO A 1  78   ? -6.536  -30.858  35.221  1.00 82.87  ? 78   PRO A CD    1 
ATOM   587   N  N     . GLY A 1  79   ? -9.797  -31.851  34.645  1.00 98.54  ? 79   GLY A N     1 
ATOM   588   C  CA    . GLY A 1  79   ? -11.075 -32.356  35.060  1.00 83.73  ? 79   GLY A CA    1 
ATOM   589   C  C     . GLY A 1  79   ? -10.900 -32.889  36.459  1.00 101.30 ? 79   GLY A C     1 
ATOM   590   O  O     . GLY A 1  79   ? -9.872  -33.500  36.760  1.00 108.05 ? 79   GLY A O     1 
ATOM   591   N  N     . HIS A 1  80   ? -11.881 -32.677  37.320  1.00 108.65 ? 80   HIS A N     1 
ATOM   592   C  CA    . HIS A 1  80   ? -11.804 -33.088  38.710  1.00 90.51  ? 80   HIS A CA    1 
ATOM   593   C  C     . HIS A 1  80   ? -12.995 -34.007  38.953  1.00 120.15 ? 80   HIS A C     1 
ATOM   594   O  O     . HIS A 1  80   ? -14.084 -33.763  38.424  1.00 133.19 ? 80   HIS A O     1 
ATOM   595   C  CB    . HIS A 1  80   ? -11.858 -31.882  39.634  1.00 121.99 ? 80   HIS A CB    1 
ATOM   596   C  CG    . HIS A 1  80   ? -10.967 -30.759  39.209  1.00 137.93 ? 80   HIS A CG    1 
ATOM   597   N  ND1   . HIS A 1  80   ? -9.665  -30.626  39.630  1.00 160.74 ? 80   HIS A ND1   1 
ATOM   598   C  CD2   . HIS A 1  80   ? -11.213 -29.700  38.399  1.00 165.83 ? 80   HIS A CD2   1 
ATOM   599   C  CE1   . HIS A 1  80   ? -9.146  -29.536  39.094  1.00 139.68 ? 80   HIS A CE1   1 
ATOM   600   N  NE2   . HIS A 1  80   ? -10.067 -28.949  38.352  1.00 157.40 ? 80   HIS A NE2   1 
ATOM   601   N  N     . PHE A 1  81   ? -12.782 -35.069  39.726  1.00 99.74  ? 81   PHE A N     1 
ATOM   602   C  CA    . PHE A 1  81   ? -13.766 -36.131  39.931  1.00 91.55  ? 81   PHE A CA    1 
ATOM   603   C  C     . PHE A 1  81   ? -14.718 -35.875  41.096  1.00 106.59 ? 81   PHE A C     1 
ATOM   604   O  O     . PHE A 1  81   ? -14.335 -35.331  42.138  1.00 123.53 ? 81   PHE A O     1 
ATOM   605   C  CB    . PHE A 1  81   ? -13.077 -37.473  40.170  1.00 100.34 ? 81   PHE A CB    1 
ATOM   606   C  CG    . PHE A 1  81   ? -12.821 -38.260  38.921  1.00 103.39 ? 81   PHE A CG    1 
ATOM   607   C  CD1   . PHE A 1  81   ? -11.744 -37.990  38.098  1.00 115.55 ? 81   PHE A CD1   1 
ATOM   608   C  CD2   . PHE A 1  81   ? -13.680 -39.278  38.558  1.00 106.90 ? 81   PHE A CD2   1 
ATOM   609   C  CE1   . PHE A 1  81   ? -11.531 -38.746  36.942  1.00 111.64 ? 81   PHE A CE1   1 
ATOM   610   C  CE2   . PHE A 1  81   ? -13.465 -40.021  37.401  1.00 86.80  ? 81   PHE A CE2   1 
ATOM   611   C  CZ    . PHE A 1  81   ? -12.397 -39.751  36.600  1.00 85.82  ? 81   PHE A CZ    1 
ATOM   612   N  N     . GLY A 1  82   ? -15.968 -36.322  40.922  1.00 120.34 ? 82   GLY A N     1 
ATOM   613   C  CA    . GLY A 1  82   ? -16.914 -36.420  42.017  1.00 109.83 ? 82   GLY A CA    1 
ATOM   614   C  C     . GLY A 1  82   ? -17.299 -37.876  42.246  1.00 105.70 ? 82   GLY A C     1 
ATOM   615   O  O     . GLY A 1  82   ? -16.784 -38.771  41.580  1.00 110.02 ? 82   GLY A O     1 
ATOM   616   N  N     . HIS A 1  83   ? -18.080 -38.120  43.299  1.00 110.95 ? 83   HIS A N     1 
ATOM   617   C  CA    . HIS A 1  83   ? -18.523 -39.479  43.614  1.00 101.09 ? 83   HIS A CA    1 
ATOM   618   C  C     . HIS A 1  83   ? -20.049 -39.527  43.695  1.00 101.47 ? 83   HIS A C     1 
ATOM   619   O  O     . HIS A 1  83   ? -20.722 -38.496  43.720  1.00 98.79  ? 83   HIS A O     1 
ATOM   620   C  CB    . HIS A 1  83   ? -17.925 -40.006  44.926  1.00 94.54  ? 83   HIS A CB    1 
ATOM   621   C  CG    . HIS A 1  83   ? -18.511 -39.399  46.160  1.00 95.79  ? 83   HIS A CG    1 
ATOM   622   N  ND1   . HIS A 1  83   ? -18.420 -38.057  46.456  1.00 118.13 ? 83   HIS A ND1   1 
ATOM   623   C  CD2   . HIS A 1  83   ? -19.209 -39.960  47.176  1.00 115.71 ? 83   HIS A CD2   1 
ATOM   624   C  CE1   . HIS A 1  83   ? -19.022 -37.819  47.609  1.00 116.97 ? 83   HIS A CE1   1 
ATOM   625   N  NE2   . HIS A 1  83   ? -19.513 -38.956  48.065  1.00 122.47 ? 83   HIS A NE2   1 
ATOM   626   N  N     . ILE A 1  84   ? -20.601 -40.743  43.697  1.00 100.76 ? 84   ILE A N     1 
ATOM   627   C  CA    . ILE A 1  84   ? -22.008 -40.998  44.020  1.00 99.32  ? 84   ILE A CA    1 
ATOM   628   C  C     . ILE A 1  84   ? -22.058 -42.195  44.960  1.00 104.45 ? 84   ILE A C     1 
ATOM   629   O  O     . ILE A 1  84   ? -21.627 -43.291  44.583  1.00 98.76  ? 84   ILE A O     1 
ATOM   630   C  CB    . ILE A 1  84   ? -22.882 -41.287  42.784  1.00 97.30  ? 84   ILE A CB    1 
ATOM   631   C  CG1   . ILE A 1  84   ? -23.095 -40.051  41.929  1.00 97.76  ? 84   ILE A CG1   1 
ATOM   632   C  CG2   . ILE A 1  84   ? -24.230 -41.818  43.182  1.00 97.34  ? 84   ILE A CG2   1 
ATOM   633   C  CD1   . ILE A 1  84   ? -23.685 -40.400  40.586  1.00 94.57  ? 84   ILE A CD1   1 
ATOM   634   N  N     . ASP A 1  85   ? -22.590 -42.003  46.169  1.00 109.34 ? 85   ASP A N     1 
ATOM   635   C  CA    . ASP A 1  85   ? -22.763 -43.114  47.101  1.00 109.12 ? 85   ASP A CA    1 
ATOM   636   C  C     . ASP A 1  85   ? -23.984 -43.917  46.656  1.00 100.77 ? 85   ASP A C     1 
ATOM   637   O  O     . ASP A 1  85   ? -25.104 -43.399  46.649  1.00 127.76 ? 85   ASP A O     1 
ATOM   638   C  CB    . ASP A 1  85   ? -22.904 -42.602  48.538  1.00 135.51 ? 85   ASP A CB    1 
ATOM   639   C  CG    . ASP A 1  85   ? -21.565 -42.144  49.158  1.00 143.06 ? 85   ASP A CG    1 
ATOM   640   O  OD1   . ASP A 1  85   ? -20.615 -42.958  49.216  1.00 147.55 ? 85   ASP A OD1   1 
ATOM   641   O  OD2   . ASP A 1  85   ? -21.449 -40.972  49.589  1.00 118.01 ? 85   ASP A OD2   1 
ATOM   642   N  N     . LEU A 1  86   ? -23.768 -45.158  46.223  1.00 107.71 ? 86   LEU A N     1 
ATOM   643   C  CA    . LEU A 1  86   ? -24.865 -46.005  45.773  1.00 101.39 ? 86   LEU A CA    1 
ATOM   644   C  C     . LEU A 1  86   ? -25.650 -46.523  46.966  1.00 132.50 ? 86   LEU A C     1 
ATOM   645   O  O     . LEU A 1  86   ? -25.073 -46.888  47.997  1.00 127.63 ? 86   LEU A O     1 
ATOM   646   C  CB    . LEU A 1  86   ? -24.347 -47.189  44.955  1.00 100.80 ? 86   LEU A CB    1 
ATOM   647   C  CG    . LEU A 1  86   ? -23.581 -46.874  43.675  1.00 115.01 ? 86   LEU A CG    1 
ATOM   648   C  CD1   . LEU A 1  86   ? -23.159 -48.151  42.964  1.00 114.67 ? 86   LEU A CD1   1 
ATOM   649   C  CD2   . LEU A 1  86   ? -24.429 -46.012  42.769  1.00 98.57  ? 86   LEU A CD2   1 
ATOM   650   N  N     . ALA A 1  87   ? -26.972 -46.571  46.812  1.00 125.94 ? 87   ALA A N     1 
ATOM   651   C  CA    . ALA A 1  87   ? -27.827 -47.037  47.891  1.00 126.58 ? 87   ALA A CA    1 
ATOM   652   C  C     . ALA A 1  87   ? -27.684 -48.534  48.143  1.00 129.46 ? 87   ALA A C     1 
ATOM   653   O  O     . ALA A 1  87   ? -28.058 -49.004  49.224  1.00 136.94 ? 87   ALA A O     1 
ATOM   654   C  CB    . ALA A 1  87   ? -29.284 -46.681  47.600  1.00 133.23 ? 87   ALA A CB    1 
ATOM   655   N  N     . LYS A 1  88   ? -27.142 -49.289  47.185  1.00 124.01 ? 88   LYS A N     1 
ATOM   656   C  CA    . LYS A 1  88   ? -26.956 -50.720  47.379  1.00 118.48 ? 88   LYS A CA    1 
ATOM   657   C  C     . LYS A 1  88   ? -25.880 -51.223  46.432  1.00 118.19 ? 88   LYS A C     1 
ATOM   658   O  O     . LYS A 1  88   ? -25.741 -50.697  45.320  1.00 122.85 ? 88   LYS A O     1 
ATOM   659   C  CB    . LYS A 1  88   ? -28.271 -51.475  47.166  1.00 107.90 ? 88   LYS A CB    1 
ATOM   660   C  CG    . LYS A 1  88   ? -28.703 -52.178  48.431  1.00 143.10 ? 88   LYS A CG    1 
ATOM   661   C  CD    . LYS A 1  88   ? -30.165 -52.574  48.403  1.00 149.40 ? 88   LYS A CD    1 
ATOM   662   C  CE    . LYS A 1  88   ? -30.465 -53.686  49.403  1.00 139.32 ? 88   LYS A CE    1 
ATOM   663   N  NZ    . LYS A 1  88   ? -29.917 -53.383  50.749  1.00 140.44 ? 88   LYS A NZ    1 
ATOM   664   N  N     . PRO A 1  89   ? -25.079 -52.201  46.856  1.00 105.52 ? 89   PRO A N     1 
ATOM   665   C  CA    . PRO A 1  89   ? -24.015 -52.706  45.982  1.00 117.26 ? 89   PRO A CA    1 
ATOM   666   C  C     . PRO A 1  89   ? -24.568 -53.318  44.701  1.00 124.80 ? 89   PRO A C     1 
ATOM   667   O  O     . PRO A 1  89   ? -25.590 -54.009  44.706  1.00 137.04 ? 89   PRO A O     1 
ATOM   668   C  CB    . PRO A 1  89   ? -23.301 -53.751  46.850  1.00 117.40 ? 89   PRO A CB    1 
ATOM   669   C  CG    . PRO A 1  89   ? -24.200 -53.996  48.012  1.00 107.27 ? 89   PRO A CG    1 
ATOM   670   C  CD    . PRO A 1  89   ? -24.979 -52.744  48.219  1.00 107.00 ? 89   PRO A CD    1 
ATOM   671   N  N     . VAL A 1  90   ? -23.872 -53.050  43.593  1.00 113.24 ? 90   VAL A N     1 
ATOM   672   C  CA    . VAL A 1  90   ? -24.202 -53.591  42.285  1.00 107.95 ? 90   VAL A CA    1 
ATOM   673   C  C     . VAL A 1  90   ? -22.934 -54.185  41.687  1.00 103.15 ? 90   VAL A C     1 
ATOM   674   O  O     . VAL A 1  90   ? -21.817 -53.839  42.073  1.00 119.18 ? 90   VAL A O     1 
ATOM   675   C  CB    . VAL A 1  90   ? -24.806 -52.526  41.346  1.00 120.37 ? 90   VAL A CB    1 
ATOM   676   C  CG1   . VAL A 1  90   ? -25.881 -51.720  42.069  1.00 115.66 ? 90   VAL A CG1   1 
ATOM   677   C  CG2   . VAL A 1  90   ? -23.717 -51.605  40.825  1.00 111.69 ? 90   VAL A CG2   1 
ATOM   678   N  N     . PHE A 1  91   ? -23.113 -55.097  40.736  1.00 104.26 ? 91   PHE A N     1 
ATOM   679   C  CA    . PHE A 1  91   ? -21.965 -55.699  40.071  1.00 105.67 ? 91   PHE A CA    1 
ATOM   680   C  C     . PHE A 1  91   ? -21.331 -54.714  39.101  1.00 110.05 ? 91   PHE A C     1 
ATOM   681   O  O     . PHE A 1  91   ? -21.985 -53.818  38.569  1.00 122.12 ? 91   PHE A O     1 
ATOM   682   C  CB    . PHE A 1  91   ? -22.360 -56.958  39.293  1.00 100.50 ? 91   PHE A CB    1 
ATOM   683   C  CG    . PHE A 1  91   ? -22.694 -58.138  40.159  1.00 112.17 ? 91   PHE A CG    1 
ATOM   684   C  CD1   . PHE A 1  91   ? -22.076 -58.321  41.378  1.00 116.78 ? 91   PHE A CD1   1 
ATOM   685   C  CD2   . PHE A 1  91   ? -23.632 -59.071  39.746  1.00 113.51 ? 91   PHE A CD2   1 
ATOM   686   C  CE1   . PHE A 1  91   ? -22.391 -59.410  42.177  1.00 104.54 ? 91   PHE A CE1   1 
ATOM   687   C  CE2   . PHE A 1  91   ? -23.944 -60.158  40.546  1.00 128.85 ? 91   PHE A CE2   1 
ATOM   688   C  CZ    . PHE A 1  91   ? -23.318 -60.322  41.761  1.00 122.31 ? 91   PHE A CZ    1 
ATOM   689   N  N     . HIS A 1  92   ? -20.036 -54.880  38.891  1.00 110.61 ? 92   HIS A N     1 
ATOM   690   C  CA    . HIS A 1  92   ? -19.348 -54.245  37.780  1.00 101.04 ? 92   HIS A CA    1 
ATOM   691   C  C     . HIS A 1  92   ? -19.457 -55.209  36.610  1.00 99.62  ? 92   HIS A C     1 
ATOM   692   O  O     . HIS A 1  92   ? -18.920 -56.319  36.669  1.00 126.98 ? 92   HIS A O     1 
ATOM   693   C  CB    . HIS A 1  92   ? -17.895 -53.945  38.132  1.00 105.16 ? 92   HIS A CB    1 
ATOM   694   C  CG    . HIS A 1  92   ? -17.146 -53.233  37.052  1.00 106.54 ? 92   HIS A CG    1 
ATOM   695   N  ND1   . HIS A 1  92   ? -16.932 -53.791  35.810  1.00 108.26 ? 92   HIS A ND1   1 
ATOM   696   C  CD2   . HIS A 1  92   ? -16.552 -52.017  37.027  1.00 100.85 ? 92   HIS A CD2   1 
ATOM   697   C  CE1   . HIS A 1  92   ? -16.242 -52.947  35.064  1.00 101.40 ? 92   HIS A CE1   1 
ATOM   698   N  NE2   . HIS A 1  92   ? -16.000 -51.862  35.778  1.00 91.26  ? 92   HIS A NE2   1 
ATOM   699   N  N     . VAL A 1  93   ? -20.160 -54.790  35.560  1.00 95.11  ? 93   VAL A N     1 
ATOM   700   C  CA    . VAL A 1  93   ? -20.540 -55.704  34.486  1.00 100.16 ? 93   VAL A CA    1 
ATOM   701   C  C     . VAL A 1  93   ? -19.349 -56.472  33.938  1.00 112.21 ? 93   VAL A C     1 
ATOM   702   O  O     . VAL A 1  93   ? -19.469 -57.653  33.585  1.00 135.36 ? 93   VAL A O     1 
ATOM   703   C  CB    . VAL A 1  93   ? -21.281 -54.932  33.372  1.00 99.53  ? 93   VAL A CB    1 
ATOM   704   C  CG1   . VAL A 1  93   ? -20.465 -53.761  32.917  1.00 93.07  ? 93   VAL A CG1   1 
ATOM   705   C  CG2   . VAL A 1  93   ? -21.607 -55.839  32.197  1.00 102.24 ? 93   VAL A CG2   1 
ATOM   706   N  N     . GLY A 1  94   ? -18.175 -55.852  33.917  1.00 101.58 ? 94   GLY A N     1 
ATOM   707   C  CA    . GLY A 1  94   ? -16.994 -56.537  33.421  1.00 108.24 ? 94   GLY A CA    1 
ATOM   708   C  C     . GLY A 1  94   ? -16.455 -57.647  34.303  1.00 115.49 ? 94   GLY A C     1 
ATOM   709   O  O     . GLY A 1  94   ? -15.523 -58.338  33.875  1.00 112.93 ? 94   GLY A O     1 
ATOM   710   N  N     . PHE A 1  95   ? -17.001 -57.846  35.503  1.00 105.61 ? 95   PHE A N     1 
ATOM   711   C  CA    . PHE A 1  95   ? -16.457 -58.850  36.408  1.00 121.27 ? 95   PHE A CA    1 
ATOM   712   C  C     . PHE A 1  95   ? -17.482 -59.879  36.874  1.00 127.33 ? 95   PHE A C     1 
ATOM   713   O  O     . PHE A 1  95   ? -17.136 -60.744  37.689  1.00 138.71 ? 95   PHE A O     1 
ATOM   714   C  CB    . PHE A 1  95   ? -15.842 -58.159  37.633  1.00 125.09 ? 95   PHE A CB    1 
ATOM   715   C  CG    . PHE A 1  95   ? -14.704 -57.240  37.299  1.00 101.34 ? 95   PHE A CG    1 
ATOM   716   C  CD1   . PHE A 1  95   ? -13.527 -57.727  36.777  1.00 100.98 ? 95   PHE A CD1   1 
ATOM   717   C  CD2   . PHE A 1  95   ? -14.808 -55.885  37.537  1.00 108.24 ? 95   PHE A CD2   1 
ATOM   718   C  CE1   . PHE A 1  95   ? -12.489 -56.873  36.463  1.00 103.17 ? 95   PHE A CE1   1 
ATOM   719   C  CE2   . PHE A 1  95   ? -13.771 -55.032  37.233  1.00 104.50 ? 95   PHE A CE2   1 
ATOM   720   C  CZ    . PHE A 1  95   ? -12.614 -55.525  36.697  1.00 108.04 ? 95   PHE A CZ    1 
ATOM   721   N  N     . ILE A 1  96   ? -18.716 -59.848  36.359  1.00 126.99 ? 96   ILE A N     1 
ATOM   722   C  CA    . ILE A 1  96   ? -19.685 -60.876  36.740  1.00 129.65 ? 96   ILE A CA    1 
ATOM   723   C  C     . ILE A 1  96   ? -19.152 -62.253  36.382  1.00 133.37 ? 96   ILE A C     1 
ATOM   724   O  O     . ILE A 1  96   ? -19.351 -63.220  37.128  1.00 137.15 ? 96   ILE A O     1 
ATOM   725   C  CB    . ILE A 1  96   ? -21.063 -60.615  36.086  1.00 127.33 ? 96   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1  96   ? -20.918 -60.470  34.570  1.00 151.14 ? 96   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1  96   ? -21.761 -59.374  36.679  1.00 100.47 ? 96   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1  96   ? -22.203 -60.084  33.849  1.00 150.55 ? 96   ILE A CD1   1 
ATOM   729   N  N     . ALA A 1  97   ? -18.375 -62.342  35.304  1.00 130.73 ? 97   ALA A N     1 
ATOM   730   C  CA    . ALA A 1  97   ? -17.759 -63.606  34.931  1.00 128.36 ? 97   ALA A CA    1 
ATOM   731   C  C     . ALA A 1  97   ? -16.737 -64.017  35.973  1.00 123.21 ? 97   ALA A C     1 
ATOM   732   O  O     . ALA A 1  97   ? -16.707 -65.175  36.411  1.00 111.89 ? 97   ALA A O     1 
ATOM   733   C  CB    . ALA A 1  97   ? -17.113 -63.486  33.549  1.00 135.75 ? 97   ALA A CB    1 
ATOM   734   N  N     . LYS A 1  98   ? -15.906 -63.066  36.400  1.00 131.26 ? 98   LYS A N     1 
ATOM   735   C  CA    . LYS A 1  98   ? -14.857 -63.381  37.358  1.00 123.19 ? 98   LYS A CA    1 
ATOM   736   C  C     . LYS A 1  98   ? -15.416 -63.497  38.772  1.00 121.04 ? 98   LYS A C     1 
ATOM   737   O  O     . LYS A 1  98   ? -14.990 -64.374  39.532  1.00 125.47 ? 98   LYS A O     1 
ATOM   738   C  CB    . LYS A 1  98   ? -13.767 -62.309  37.301  1.00 109.38 ? 98   LYS A CB    1 
ATOM   739   C  CG    . LYS A 1  98   ? -12.681 -62.477  38.347  1.00 109.44 ? 98   LYS A CG    1 
ATOM   740   C  CD    . LYS A 1  98   ? -11.452 -61.673  37.992  1.00 120.59 ? 98   LYS A CD    1 
ATOM   741   C  CE    . LYS A 1  98   ? -10.295 -62.593  37.640  1.00 132.28 ? 98   LYS A CE    1 
ATOM   742   N  NZ    . LYS A 1  98   ? -10.617 -63.400  36.422  1.00 132.60 ? 98   LYS A NZ    1 
ATOM   743   N  N     . ILE A 1  99   ? -16.401 -62.661  39.115  1.00 114.14 ? 99   ILE A N     1 
ATOM   744   C  CA    . ILE A 1  99   ? -17.055 -62.756  40.422  1.00 115.41 ? 99   ILE A CA    1 
ATOM   745   C  C     . ILE A 1  99   ? -17.657 -64.143  40.596  1.00 125.78 ? 99   ILE A C     1 
ATOM   746   O  O     . ILE A 1  99   ? -17.384 -64.848  41.579  1.00 121.72 ? 99   ILE A O     1 
ATOM   747   C  CB    . ILE A 1  99   ? -18.133 -61.663  40.568  1.00 117.55 ? 99   ILE A CB    1 
ATOM   748   C  CG1   . ILE A 1  99   ? -17.504 -60.285  40.789  1.00 122.34 ? 99   ILE A CG1   1 
ATOM   749   C  CG2   . ILE A 1  99   ? -19.064 -61.988  41.728  1.00 114.24 ? 99   ILE A CG2   1 
ATOM   750   C  CD1   . ILE A 1  99   ? -18.485 -59.199  41.249  1.00 101.19 ? 99   ILE A CD1   1 
ATOM   751   N  N     . LYS A 1  100  ? -18.375 -64.605  39.570  1.00 122.41 ? 100  LYS A N     1 
ATOM   752   C  CA    . LYS A 1  100  ? -18.924 -65.954  39.599  1.00 116.35 ? 100  LYS A CA    1 
ATOM   753   C  C     . LYS A 1  100  ? -17.809 -66.965  39.731  1.00 118.64 ? 100  LYS A C     1 
ATOM   754   O  O     . LYS A 1  100  ? -17.884 -67.884  40.559  1.00 118.33 ? 100  LYS A O     1 
ATOM   755   C  CB    . LYS A 1  100  ? -19.713 -66.218  38.313  1.00 109.84 ? 100  LYS A CB    1 
ATOM   756   C  CG    . LYS A 1  100  ? -20.094 -67.676  38.096  1.00 123.09 ? 100  LYS A CG    1 
ATOM   757   C  CD    . LYS A 1  100  ? -21.116 -67.886  36.980  1.00 130.19 ? 100  LYS A CD    1 
ATOM   758   C  CE    . LYS A 1  100  ? -21.554 -69.343  36.943  1.00 150.99 ? 100  LYS A CE    1 
ATOM   759   N  NZ    . LYS A 1  100  ? -20.416 -70.210  36.495  1.00 160.26 ? 100  LYS A NZ    1 
ATOM   760   N  N     . LYS A 1  101  ? -16.710 -66.738  39.010  1.00 121.13 ? 101  LYS A N     1 
ATOM   761   C  CA    . LYS A 1  101  ? -15.598 -67.676  39.064  1.00 117.82 ? 101  LYS A CA    1 
ATOM   762   C  C     . LYS A 1  101  ? -14.983 -67.680  40.453  1.00 126.60 ? 101  LYS A C     1 
ATOM   763   O  O     . LYS A 1  101  ? -14.580 -68.733  40.958  1.00 127.64 ? 101  LYS A O     1 
ATOM   764   C  CB    . LYS A 1  101  ? -14.578 -67.315  37.986  1.00 103.83 ? 101  LYS A CB    1 
ATOM   765   C  CG    . LYS A 1  101  ? -14.200 -68.476  37.077  1.00 104.18 ? 101  LYS A CG    1 
ATOM   766   C  CD    . LYS A 1  101  ? -13.879 -67.998  35.675  1.00 109.31 ? 101  LYS A CD    1 
ATOM   767   C  CE    . LYS A 1  101  ? -13.688 -69.178  34.741  1.00 126.24 ? 101  LYS A CE    1 
ATOM   768   N  NZ    . LYS A 1  101  ? -13.619 -68.718  33.331  1.00 143.39 ? 101  LYS A NZ    1 
ATOM   769   N  N     . VAL A 1  102  ? -14.905 -66.504  41.085  1.00 127.96 ? 102  VAL A N     1 
ATOM   770   C  CA    . VAL A 1  102  ? -14.405 -66.456  42.453  1.00 125.88 ? 102  VAL A CA    1 
ATOM   771   C  C     . VAL A 1  102  ? -15.442 -67.041  43.402  1.00 129.83 ? 102  VAL A C     1 
ATOM   772   O  O     . VAL A 1  102  ? -15.095 -67.717  44.378  1.00 129.68 ? 102  VAL A O     1 
ATOM   773   C  CB    . VAL A 1  102  ? -13.999 -65.018  42.841  1.00 124.12 ? 102  VAL A CB    1 
ATOM   774   C  CG1   . VAL A 1  102  ? -13.680 -64.913  44.334  1.00 106.06 ? 102  VAL A CG1   1 
ATOM   775   C  CG2   . VAL A 1  102  ? -12.805 -64.533  42.007  1.00 113.07 ? 102  VAL A CG2   1 
ATOM   776   N  N     . CYS A 1  103  ? -16.732 -66.826  43.112  1.00 135.63 ? 103  CYS A N     1 
ATOM   777   C  CA    . CYS A 1  103  ? -17.771 -67.403  43.964  1.00 133.64 ? 103  CYS A CA    1 
ATOM   778   C  C     . CYS A 1  103  ? -17.684 -68.917  44.028  1.00 116.81 ? 103  CYS A C     1 
ATOM   779   O  O     . CYS A 1  103  ? -17.998 -69.511  45.064  1.00 126.17 ? 103  CYS A O     1 
ATOM   780   C  CB    . CYS A 1  103  ? -19.160 -66.971  43.503  1.00 133.14 ? 103  CYS A CB    1 
ATOM   781   S  SG    . CYS A 1  103  ? -19.733 -65.466  44.318  1.00 135.92 ? 103  CYS A SG    1 
ATOM   782   N  N     . GLU A 1  104  ? -17.218 -69.550  42.959  1.00 120.83 ? 104  GLU A N     1 
ATOM   783   C  CA    . GLU A 1  104  ? -17.100 -70.998  42.911  1.00 129.78 ? 104  GLU A CA    1 
ATOM   784   C  C     . GLU A 1  104  ? -15.837 -71.523  43.579  1.00 130.84 ? 104  GLU A C     1 
ATOM   785   O  O     . GLU A 1  104  ? -15.750 -72.732  43.826  1.00 153.02 ? 104  GLU A O     1 
ATOM   786   C  CB    . GLU A 1  104  ? -17.159 -71.456  41.453  1.00 111.99 ? 104  GLU A CB    1 
ATOM   787   C  CG    . GLU A 1  104  ? -18.521 -71.214  40.797  1.00 114.24 ? 104  GLU A CG    1 
ATOM   788   C  CD    . GLU A 1  104  ? -18.422 -71.054  39.300  1.00 137.42 ? 104  GLU A CD    1 
ATOM   789   O  OE1   . GLU A 1  104  ? -17.306 -71.189  38.758  1.00 159.42 ? 104  GLU A OE1   1 
ATOM   790   O  OE2   . GLU A 1  104  ? -19.458 -70.805  38.659  1.00 136.76 ? 104  GLU A OE2   1 
ATOM   791   N  N     . CYS A 1  105  ? -14.883 -70.653  43.919  1.00 123.90 ? 105  CYS A N     1 
ATOM   792   C  CA    . CYS A 1  105  ? -13.670 -71.083  44.606  1.00 128.18 ? 105  CYS A CA    1 
ATOM   793   C  C     . CYS A 1  105  ? -13.737 -70.952  46.126  1.00 136.39 ? 105  CYS A C     1 
ATOM   794   O  O     . CYS A 1  105  ? -13.004 -71.663  46.823  1.00 124.42 ? 105  CYS A O     1 
ATOM   795   C  CB    . CYS A 1  105  ? -12.466 -70.269  44.105  1.00 125.18 ? 105  CYS A CB    1 
ATOM   796   S  SG    . CYS A 1  105  ? -12.042 -70.456  42.352  1.00 129.83 ? 105  CYS A SG    1 
ATOM   797   N  N     . VAL A 1  106  ? -14.574 -70.061  46.656  1.00 151.13 ? 106  VAL A N     1 
ATOM   798   C  CA    . VAL A 1  106  ? -14.649 -69.791  48.091  1.00 163.66 ? 106  VAL A CA    1 
ATOM   799   C  C     . VAL A 1  106  ? -15.958 -70.331  48.659  1.00 164.24 ? 106  VAL A C     1 
ATOM   800   O  O     . VAL A 1  106  ? -16.980 -70.413  47.967  1.00 170.34 ? 106  VAL A O     1 
ATOM   801   C  CB    . VAL A 1  106  ? -14.480 -68.283  48.396  1.00 167.03 ? 106  VAL A CB    1 
ATOM   802   C  CG1   . VAL A 1  106  ? -14.492 -68.006  49.908  1.00 168.24 ? 106  VAL A CG1   1 
ATOM   803   C  CG2   . VAL A 1  106  ? -13.181 -67.777  47.796  1.00 171.67 ? 106  VAL A CG2   1 
ATOM   804   N  N     . CYS A 1  107  ? -15.916 -70.727  49.927  1.00 152.03 ? 107  CYS A N     1 
ATOM   805   C  CA    . CYS A 1  107  ? -17.122 -71.144  50.622  1.00 167.75 ? 107  CYS A CA    1 
ATOM   806   C  C     . CYS A 1  107  ? -17.913 -69.894  50.992  1.00 160.98 ? 107  CYS A C     1 
ATOM   807   O  O     . CYS A 1  107  ? -17.340 -68.821  51.205  1.00 148.94 ? 107  CYS A O     1 
ATOM   808   C  CB    . CYS A 1  107  ? -16.767 -71.960  51.873  1.00 178.81 ? 107  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1  107  ? -17.975 -72.036  53.227  1.00 169.72 ? 107  CYS A SG    1 
ATOM   810   N  N     . MET A 1  108  ? -19.237 -70.007  50.955  1.00 152.34 ? 108  MET A N     1 
ATOM   811   C  CA    . MET A 1  108  ? -20.129 -68.938  51.383  1.00 141.17 ? 108  MET A CA    1 
ATOM   812   C  C     . MET A 1  108  ? -20.455 -69.115  52.863  1.00 153.97 ? 108  MET A C     1 
ATOM   813   O  O     . MET A 1  108  ? -20.539 -70.250  53.348  1.00 171.26 ? 108  MET A O     1 
ATOM   814   C  CB    . MET A 1  108  ? -21.398 -68.952  50.543  1.00 122.58 ? 108  MET A CB    1 
ATOM   815   C  CG    . MET A 1  108  ? -21.100 -69.078  49.055  1.00 135.99 ? 108  MET A CG    1 
ATOM   816   S  SD    . MET A 1  108  ? -20.447 -67.532  48.398  1.00 147.24 ? 108  MET A SD    1 
ATOM   817   C  CE    . MET A 1  108  ? -20.172 -67.944  46.691  1.00 120.79 ? 108  MET A CE    1 
ATOM   818   N  N     . HIS A 1  109  ? -20.599 -67.989  53.582  1.00 146.28 ? 109  HIS A N     1 
ATOM   819   C  CA    . HIS A 1  109  ? -20.859 -67.980  55.025  1.00 173.47 ? 109  HIS A CA    1 
ATOM   820   C  C     . HIS A 1  109  ? -19.577 -68.298  55.794  1.00 176.01 ? 109  HIS A C     1 
ATOM   821   O  O     . HIS A 1  109  ? -19.470 -68.019  56.994  1.00 193.02 ? 109  HIS A O     1 
ATOM   822   C  CB    . HIS A 1  109  ? -21.996 -68.957  55.393  1.00 172.67 ? 109  HIS A CB    1 
ATOM   823   C  CG    . HIS A 1  109  ? -22.041 -69.330  56.843  1.00 160.99 ? 109  HIS A CG    1 
ATOM   824   N  ND1   . HIS A 1  109  ? -21.456 -70.481  57.329  1.00 161.63 ? 109  HIS A ND1   1 
ATOM   825   C  CD2   . HIS A 1  109  ? -22.592 -68.708  57.913  1.00 161.11 ? 109  HIS A CD2   1 
ATOM   826   C  CE1   . HIS A 1  109  ? -21.642 -70.550  58.635  1.00 167.69 ? 109  HIS A CE1   1 
ATOM   827   N  NE2   . HIS A 1  109  ? -22.329 -69.488  59.015  1.00 164.64 ? 109  HIS A NE2   1 
ATOM   828   N  N     . CYS A 1  110  ? -18.592 -68.858  55.094  1.00 164.31 ? 110  CYS A N     1 
ATOM   829   C  CA    . CYS A 1  110  ? -17.214 -68.965  55.557  1.00 157.60 ? 110  CYS A CA    1 
ATOM   830   C  C     . CYS A 1  110  ? -16.284 -68.505  54.446  1.00 157.25 ? 110  CYS A C     1 
ATOM   831   O  O     . CYS A 1  110  ? -16.049 -69.244  53.485  1.00 178.71 ? 110  CYS A O     1 
ATOM   832   C  CB    . CYS A 1  110  ? -16.956 -70.418  55.928  1.00 189.01 ? 110  CYS A CB    1 
ATOM   833   S  SG    . CYS A 1  110  ? -15.303 -71.023  56.226  1.00 161.67 ? 110  CYS A SG    1 
ATOM   834   N  N     . GLY A 1  111  ? -15.716 -67.313  54.592  1.00 125.08 ? 111  GLY A N     1 
ATOM   835   C  CA    . GLY A 1  111  ? -14.830 -66.801  53.566  1.00 144.16 ? 111  GLY A CA    1 
ATOM   836   C  C     . GLY A 1  111  ? -13.533 -67.577  53.523  1.00 168.46 ? 111  GLY A C     1 
ATOM   837   O  O     . GLY A 1  111  ? -12.479 -67.038  53.875  1.00 190.10 ? 111  GLY A O     1 
ATOM   838   N  N     . LYS A 1  112  ? -13.575 -68.825  53.069  1.00 157.28 ? 112  LYS A N     1 
ATOM   839   C  CA    . LYS A 1  112  ? -12.373 -69.637  53.052  1.00 151.83 ? 112  LYS A CA    1 
ATOM   840   C  C     . LYS A 1  112  ? -12.265 -70.351  51.719  1.00 149.30 ? 112  LYS A C     1 
ATOM   841   O  O     . LYS A 1  112  ? -13.271 -70.704  51.101  1.00 132.61 ? 112  LYS A O     1 
ATOM   842   C  CB    . LYS A 1  112  ? -12.376 -70.671  54.200  1.00 132.98 ? 112  LYS A CB    1 
ATOM   843   C  CG    . LYS A 1  112  ? -11.135 -71.559  54.230  1.00 140.45 ? 112  LYS A CG    1 
ATOM   844   C  CD    . LYS A 1  112  ? -11.270 -72.764  55.151  1.00 135.04 ? 112  LYS A CD    1 
ATOM   845   C  CE    . LYS A 1  112  ? -9.887  -73.267  55.568  1.00 140.17 ? 112  LYS A CE    1 
ATOM   846   N  NZ    . LYS A 1  112  ? -9.178  -72.280  56.428  1.00 139.08 ? 112  LYS A NZ    1 
ATOM   847   N  N     . LEU A 1  113  ? -11.024 -70.539  51.279  1.00 158.49 ? 113  LEU A N     1 
ATOM   848   C  CA    . LEU A 1  113  ? -10.782 -71.263  50.045  1.00 155.82 ? 113  LEU A CA    1 
ATOM   849   C  C     . LEU A 1  113  ? -11.271 -72.701  50.202  1.00 167.18 ? 113  LEU A C     1 
ATOM   850   O  O     . LEU A 1  113  ? -11.108 -73.320  51.259  1.00 173.44 ? 113  LEU A O     1 
ATOM   851   C  CB    . LEU A 1  113  ? -9.295  -71.218  49.693  1.00 142.17 ? 113  LEU A CB    1 
ATOM   852   C  CG    . LEU A 1  113  ? -8.940  -71.390  48.218  1.00 126.16 ? 113  LEU A CG    1 
ATOM   853   C  CD1   . LEU A 1  113  ? -9.892  -70.580  47.358  1.00 127.78 ? 113  LEU A CD1   1 
ATOM   854   C  CD2   . LEU A 1  113  ? -7.515  -70.972  47.955  1.00 113.16 ? 113  LEU A CD2   1 
ATOM   855   N  N     . LEU A 1  114  ? -11.886 -73.228  49.145  1.00 166.04 ? 114  LEU A N     1 
ATOM   856   C  CA    . LEU A 1  114  ? -12.504 -74.548  49.227  1.00 160.59 ? 114  LEU A CA    1 
ATOM   857   C  C     . LEU A 1  114  ? -11.457 -75.644  49.344  1.00 169.25 ? 114  LEU A C     1 
ATOM   858   O  O     . LEU A 1  114  ? -11.624 -76.592  50.123  1.00 177.34 ? 114  LEU A O     1 
ATOM   859   C  CB    . LEU A 1  114  ? -13.403 -74.783  48.015  1.00 144.11 ? 114  LEU A CB    1 
ATOM   860   C  CG    . LEU A 1  114  ? -14.709 -74.002  48.111  1.00 135.97 ? 114  LEU A CG    1 
ATOM   861   C  CD1   . LEU A 1  114  ? -15.746 -74.573  47.175  1.00 140.81 ? 114  LEU A CD1   1 
ATOM   862   C  CD2   . LEU A 1  114  ? -15.197 -74.053  49.540  1.00 120.99 ? 114  LEU A CD2   1 
ATOM   863   N  N     . LEU A 1  115  ? -10.380 -75.535  48.576  1.00 161.71 ? 115  LEU A N     1 
ATOM   864   C  CA    . LEU A 1  115  ? -9.327  -76.534  48.538  1.00 157.22 ? 115  LEU A CA    1 
ATOM   865   C  C     . LEU A 1  115  ? -8.077  -76.001  49.220  1.00 147.89 ? 115  LEU A C     1 
ATOM   866   O  O     . LEU A 1  115  ? -7.701  -74.840  49.043  1.00 137.05 ? 115  LEU A O     1 
ATOM   867   C  CB    . LEU A 1  115  ? -9.035  -76.947  47.098  1.00 152.77 ? 115  LEU A CB    1 
ATOM   868   C  CG    . LEU A 1  115  ? -9.598  -78.335  46.803  1.00 135.46 ? 115  LEU A CG    1 
ATOM   869   C  CD1   . LEU A 1  115  ? -11.030 -78.427  47.271  1.00 135.69 ? 115  LEU A CD1   1 
ATOM   870   C  CD2   . LEU A 1  115  ? -9.519  -78.632  45.317  1.00 135.38 ? 115  LEU A CD2   1 
ATOM   871   N  N     . ASP A 1  116  ? -7.436  -76.869  49.982  1.00 159.81 ? 116  ASP A N     1 
ATOM   872   C  CA    . ASP A 1  116  ? -6.382  -76.499  50.901  1.00 157.62 ? 116  ASP A CA    1 
ATOM   873   C  C     . ASP A 1  116  ? -5.028  -76.875  50.306  1.00 164.73 ? 116  ASP A C     1 
ATOM   874   O  O     . ASP A 1  116  ? -4.930  -77.393  49.191  1.00 149.65 ? 116  ASP A O     1 
ATOM   875   C  CB    . ASP A 1  116  ? -6.645  -77.173  52.253  1.00 157.66 ? 116  ASP A CB    1 
ATOM   876   C  CG    . ASP A 1  116  ? -6.377  -76.256  53.431  1.00 181.86 ? 116  ASP A CG    1 
ATOM   877   O  OD1   . ASP A 1  116  ? -5.252  -75.732  53.537  1.00 199.09 ? 116  ASP A OD1   1 
ATOM   878   O  OD2   . ASP A 1  116  ? -7.300  -76.040  54.248  1.00 176.13 ? 116  ASP A OD2   1 
ATOM   879   N  N     . GLU A 1  117  ? -3.965  -76.537  51.036  1.00 188.10 ? 117  GLU A N     1 
ATOM   880   C  CA    . GLU A 1  117  ? -2.668  -77.156  50.803  1.00 196.04 ? 117  GLU A CA    1 
ATOM   881   C  C     . GLU A 1  117  ? -2.651  -78.622  51.217  1.00 188.56 ? 117  GLU A C     1 
ATOM   882   O  O     . GLU A 1  117  ? -1.720  -79.343  50.844  1.00 186.14 ? 117  GLU A O     1 
ATOM   883   C  CB    . GLU A 1  117  ? -1.561  -76.399  51.545  1.00 204.69 ? 117  GLU A CB    1 
ATOM   884   C  CG    . GLU A 1  117  ? -1.910  -75.984  52.969  1.00 209.15 ? 117  GLU A CG    1 
ATOM   885   C  CD    . GLU A 1  117  ? -2.552  -74.608  53.049  1.00 211.78 ? 117  GLU A CD    1 
ATOM   886   O  OE1   . GLU A 1  117  ? -2.732  -73.959  51.995  1.00 208.57 ? 117  GLU A OE1   1 
ATOM   887   O  OE2   . GLU A 1  117  ? -2.908  -74.189  54.171  1.00 209.57 ? 117  GLU A OE2   1 
ATOM   888   N  N     . HIS A 1  118  ? -3.654  -79.070  51.977  1.00 174.27 ? 118  HIS A N     1 
ATOM   889   C  CA    . HIS A 1  118  ? -3.830  -80.483  52.285  1.00 168.82 ? 118  HIS A CA    1 
ATOM   890   C  C     . HIS A 1  118  ? -4.210  -81.317  51.065  1.00 176.16 ? 118  HIS A C     1 
ATOM   891   O  O     . HIS A 1  118  ? -4.247  -82.547  51.174  1.00 189.80 ? 118  HIS A O     1 
ATOM   892   C  CB    . HIS A 1  118  ? -4.882  -80.662  53.385  1.00 168.15 ? 118  HIS A CB    1 
ATOM   893   C  CG    . HIS A 1  118  ? -4.481  -80.084  54.709  1.00 166.37 ? 118  HIS A CG    1 
ATOM   894   N  ND1   . HIS A 1  118  ? -4.694  -78.763  55.041  1.00 166.72 ? 118  HIS A ND1   1 
ATOM   895   C  CD2   . HIS A 1  118  ? -3.874  -80.647  55.783  1.00 165.82 ? 118  HIS A CD2   1 
ATOM   896   C  CE1   . HIS A 1  118  ? -4.241  -78.537  56.262  1.00 167.53 ? 118  HIS A CE1   1 
ATOM   897   N  NE2   . HIS A 1  118  ? -3.737  -79.664  56.734  1.00 163.21 ? 118  HIS A NE2   1 
ATOM   898   N  N     . ASN A 1  119  ? -4.509  -80.695  49.924  1.00 160.04 ? 119  ASN A N     1 
ATOM   899   C  CA    . ASN A 1  119  ? -4.741  -81.419  48.682  1.00 161.48 ? 119  ASN A CA    1 
ATOM   900   C  C     . ASN A 1  119  ? -3.512  -81.311  47.787  1.00 175.42 ? 119  ASN A C     1 
ATOM   901   O  O     . ASN A 1  119  ? -2.811  -80.297  47.780  1.00 193.26 ? 119  ASN A O     1 
ATOM   902   C  CB    . ASN A 1  119  ? -5.972  -80.890  47.937  1.00 155.41 ? 119  ASN A CB    1 
ATOM   903   C  CG    . ASN A 1  119  ? -6.239  -81.641  46.633  1.00 157.58 ? 119  ASN A CG    1 
ATOM   904   O  OD1   . ASN A 1  119  ? -5.525  -81.468  45.641  1.00 171.21 ? 119  ASN A OD1   1 
ATOM   905   N  ND2   . ASN A 1  119  ? -7.258  -82.487  46.635  1.00 142.11 ? 119  ASN A ND2   1 
ATOM   906   N  N     . GLU A 1  120  ? -3.275  -82.372  47.011  1.00 178.30 ? 120  GLU A N     1 
ATOM   907   C  CA    . GLU A 1  120  ? -2.034  -82.507  46.253  1.00 180.39 ? 120  GLU A CA    1 
ATOM   908   C  C     . GLU A 1  120  ? -2.081  -81.690  44.960  1.00 182.03 ? 120  GLU A C     1 
ATOM   909   O  O     . GLU A 1  120  ? -1.218  -80.830  44.716  1.00 195.76 ? 120  GLU A O     1 
ATOM   910   C  CB    . GLU A 1  120  ? -1.762  -83.994  45.977  1.00 176.56 ? 120  GLU A CB    1 
ATOM   911   C  CG    . GLU A 1  120  ? -0.292  -84.345  45.769  1.00 178.39 ? 120  GLU A CG    1 
ATOM   912   C  CD    . GLU A 1  120  ? 0.626   -83.591  46.722  1.00 182.80 ? 120  GLU A CD    1 
ATOM   913   O  OE1   . GLU A 1  120  ? 0.546   -83.821  47.947  1.00 174.17 ? 120  GLU A OE1   1 
ATOM   914   O  OE2   . GLU A 1  120  ? 1.424   -82.757  46.246  1.00 188.21 ? 120  GLU A OE2   1 
ATOM   915   N  N     . LEU A 1  121  ? -3.089  -81.947  44.115  1.00 170.30 ? 121  LEU A N     1 
ATOM   916   C  CA    . LEU A 1  121  ? -3.207  -81.194  42.872  1.00 169.90 ? 121  LEU A CA    1 
ATOM   917   C  C     . LEU A 1  121  ? -3.351  -79.706  43.151  1.00 167.07 ? 121  LEU A C     1 
ATOM   918   O  O     . LEU A 1  121  ? -2.996  -78.871  42.303  1.00 149.34 ? 121  LEU A O     1 
ATOM   919   C  CB    . LEU A 1  121  ? -4.413  -81.682  42.066  1.00 158.38 ? 121  LEU A CB    1 
ATOM   920   C  CG    . LEU A 1  121  ? -4.586  -83.171  41.760  1.00 157.42 ? 121  LEU A CG    1 
ATOM   921   C  CD1   . LEU A 1  121  ? -5.233  -83.932  42.931  1.00 154.90 ? 121  LEU A CD1   1 
ATOM   922   C  CD2   . LEU A 1  121  ? -5.383  -83.349  40.468  1.00 149.53 ? 121  LEU A CD2   1 
ATOM   923   N  N     . MET A 1  122  ? -3.835  -79.363  44.346  1.00 160.78 ? 122  MET A N     1 
ATOM   924   C  CA    . MET A 1  122  ? -3.985  -77.964  44.703  1.00 152.93 ? 122  MET A CA    1 
ATOM   925   C  C     . MET A 1  122  ? -2.617  -77.373  45.005  1.00 157.13 ? 122  MET A C     1 
ATOM   926   O  O     . MET A 1  122  ? -2.218  -76.362  44.415  1.00 158.93 ? 122  MET A O     1 
ATOM   927   C  CB    . MET A 1  122  ? -4.926  -77.835  45.907  1.00 146.61 ? 122  MET A CB    1 
ATOM   928   C  CG    . MET A 1  122  ? -5.341  -76.415  46.247  1.00 153.45 ? 122  MET A CG    1 
ATOM   929   S  SD    . MET A 1  122  ? -6.271  -75.635  44.917  1.00 172.87 ? 122  MET A SD    1 
ATOM   930   C  CE    . MET A 1  122  ? -6.459  -73.970  45.552  1.00 162.74 ? 122  MET A CE    1 
ATOM   931   N  N     . ARG A 1  123  ? -1.859  -78.036  45.885  1.00 161.03 ? 123  ARG A N     1 
ATOM   932   C  CA    . ARG A 1  123  ? -0.566  -77.517  46.312  1.00 170.12 ? 123  ARG A CA    1 
ATOM   933   C  C     . ARG A 1  123  ? 0.429   -77.479  45.161  1.00 168.24 ? 123  ARG A C     1 
ATOM   934   O  O     . ARG A 1  123  ? 1.445   -76.781  45.262  1.00 163.37 ? 123  ARG A O     1 
ATOM   935   C  CB    . ARG A 1  123  ? -0.025  -78.334  47.491  1.00 161.86 ? 123  ARG A CB    1 
ATOM   936   C  CG    . ARG A 1  123  ? 0.301   -79.777  47.183  1.00 162.43 ? 123  ARG A CG    1 
ATOM   937   C  CD    . ARG A 1  123  ? 1.169   -80.374  48.269  1.00 177.56 ? 123  ARG A CD    1 
ATOM   938   N  NE    . ARG A 1  123  ? 0.511   -80.252  49.566  1.00 191.45 ? 123  ARG A NE    1 
ATOM   939   C  CZ    . ARG A 1  123  ? 0.978   -80.763  50.701  1.00 199.32 ? 123  ARG A CZ    1 
ATOM   940   N  NH1   . ARG A 1  123  ? 2.114   -81.446  50.713  1.00 194.20 ? 123  ARG A NH1   1 
ATOM   941   N  NH2   . ARG A 1  123  ? 0.300   -80.590  51.827  1.00 205.59 ? 123  ARG A NH2   1 
ATOM   942   N  N     . GLN A 1  124  ? 0.146   -78.194  44.063  1.00 163.40 ? 124  GLN A N     1 
ATOM   943   C  CA    . GLN A 1  124  ? 0.979   -78.045  42.875  1.00 172.38 ? 124  GLN A CA    1 
ATOM   944   C  C     . GLN A 1  124  ? 0.431   -76.972  41.944  1.00 161.14 ? 124  GLN A C     1 
ATOM   945   O  O     . GLN A 1  124  ? 1.208   -76.266  41.287  1.00 156.63 ? 124  GLN A O     1 
ATOM   946   C  CB    . GLN A 1  124  ? 1.119   -79.373  42.114  1.00 183.31 ? 124  GLN A CB    1 
ATOM   947   C  CG    . GLN A 1  124  ? -0.140  -79.877  41.431  1.00 190.12 ? 124  GLN A CG    1 
ATOM   948   C  CD    . GLN A 1  124  ? 0.153   -80.829  40.280  1.00 194.84 ? 124  GLN A CD    1 
ATOM   949   O  OE1   . GLN A 1  124  ? 0.884   -81.811  40.434  1.00 195.45 ? 124  GLN A OE1   1 
ATOM   950   N  NE2   . GLN A 1  124  ? -0.377  -80.509  39.104  1.00 189.62 ? 124  GLN A NE2   1 
ATOM   951   N  N     . ALA A 1  125  ? -0.892  -76.818  41.884  1.00 156.70 ? 125  ALA A N     1 
ATOM   952   C  CA    . ALA A 1  125  ? -1.452  -75.661  41.196  1.00 153.68 ? 125  ALA A CA    1 
ATOM   953   C  C     . ALA A 1  125  ? -1.179  -74.375  41.973  1.00 151.87 ? 125  ALA A C     1 
ATOM   954   O  O     . ALA A 1  125  ? -1.005  -73.305  41.373  1.00 135.99 ? 125  ALA A O     1 
ATOM   955   C  CB    . ALA A 1  125  ? -2.954  -75.856  40.972  1.00 129.80 ? 125  ALA A CB    1 
ATOM   956   N  N     . LEU A 1  126  ? -1.116  -74.468  43.304  1.00 148.61 ? 126  LEU A N     1 
ATOM   957   C  CA    . LEU A 1  126  ? -0.745  -73.324  44.132  1.00 139.45 ? 126  LEU A CA    1 
ATOM   958   C  C     . LEU A 1  126  ? 0.663   -72.823  43.845  1.00 153.05 ? 126  LEU A C     1 
ATOM   959   O  O     . LEU A 1  126  ? 0.931   -71.627  44.001  1.00 161.10 ? 126  LEU A O     1 
ATOM   960   C  CB    . LEU A 1  126  ? -0.868  -73.700  45.608  1.00 145.60 ? 126  LEU A CB    1 
ATOM   961   C  CG    . LEU A 1  126  ? -2.260  -73.509  46.205  1.00 140.27 ? 126  LEU A CG    1 
ATOM   962   C  CD1   . LEU A 1  126  ? -2.316  -73.901  47.686  1.00 128.43 ? 126  LEU A CD1   1 
ATOM   963   C  CD2   . LEU A 1  126  ? -2.644  -72.050  46.005  1.00 149.12 ? 126  LEU A CD2   1 
ATOM   964   N  N     . ALA A 1  127  ? 1.564   -73.693  43.405  1.00 152.17 ? 127  ALA A N     1 
ATOM   965   C  CA    . ALA A 1  127  ? 2.938   -73.280  43.167  1.00 136.14 ? 127  ALA A CA    1 
ATOM   966   C  C     . ALA A 1  127  ? 3.152   -72.695  41.778  1.00 135.71 ? 127  ALA A C     1 
ATOM   967   O  O     . ALA A 1  127  ? 4.287   -72.320  41.455  1.00 144.43 ? 127  ALA A O     1 
ATOM   968   C  CB    . ALA A 1  127  ? 3.887   -74.461  43.375  1.00 136.59 ? 127  ALA A CB    1 
ATOM   969   N  N     . ILE A 1  128  ? 2.099   -72.580  40.963  1.00 137.12 ? 128  ILE A N     1 
ATOM   970   C  CA    . ILE A 1  128  ? 2.250   -71.963  39.647  1.00 134.88 ? 128  ILE A CA    1 
ATOM   971   C  C     . ILE A 1  128  ? 2.664   -70.511  39.827  1.00 148.07 ? 128  ILE A C     1 
ATOM   972   O  O     . ILE A 1  128  ? 1.964   -69.730  40.481  1.00 141.32 ? 128  ILE A O     1 
ATOM   973   C  CB    . ILE A 1  128  ? 0.952   -72.069  38.833  1.00 130.28 ? 128  ILE A CB    1 
ATOM   974   C  CG1   . ILE A 1  128  ? 0.631   -73.516  38.490  1.00 128.12 ? 128  ILE A CG1   1 
ATOM   975   C  CG2   . ILE A 1  128  ? 1.052   -71.267  37.544  1.00 127.51 ? 128  ILE A CG2   1 
ATOM   976   C  CD1   . ILE A 1  128  ? -0.555  -73.641  37.540  1.00 106.47 ? 128  ILE A CD1   1 
ATOM   977   N  N     . LYS A 1  129  ? 3.796   -70.140  39.228  1.00 147.76 ? 129  LYS A N     1 
ATOM   978   C  CA    . LYS A 1  129  ? 4.350   -68.806  39.428  1.00 142.72 ? 129  LYS A CA    1 
ATOM   979   C  C     . LYS A 1  129  ? 3.499   -67.747  38.738  1.00 130.35 ? 129  LYS A C     1 
ATOM   980   O  O     . LYS A 1  129  ? 3.293   -66.658  39.285  1.00 121.94 ? 129  LYS A O     1 
ATOM   981   C  CB    . LYS A 1  129  ? 5.796   -68.773  38.947  1.00 140.28 ? 129  LYS A CB    1 
ATOM   982   C  CG    . LYS A 1  129  ? 6.716   -69.650  39.805  1.00 148.14 ? 129  LYS A CG    1 
ATOM   983   C  CD    . LYS A 1  129  ? 7.718   -70.401  38.959  1.00 164.04 ? 129  LYS A CD    1 
ATOM   984   C  CE    . LYS A 1  129  ? 9.059   -69.703  38.971  1.00 171.33 ? 129  LYS A CE    1 
ATOM   985   N  NZ    . LYS A 1  129  ? 9.862   -70.075  40.165  1.00 170.46 ? 129  LYS A NZ    1 
ATOM   986   N  N     . ASP A 1  130  ? 2.969   -68.057  37.550  1.00 133.57 ? 130  ASP A N     1 
ATOM   987   C  CA    . ASP A 1  130  ? 2.023   -67.169  36.883  1.00 124.60 ? 130  ASP A CA    1 
ATOM   988   C  C     . ASP A 1  130  ? 0.800   -66.963  37.765  1.00 139.01 ? 130  ASP A C     1 
ATOM   989   O  O     . ASP A 1  130  ? 0.414   -67.836  38.543  1.00 175.26 ? 130  ASP A O     1 
ATOM   990   C  CB    . ASP A 1  130  ? 1.603   -67.758  35.527  1.00 129.64 ? 130  ASP A CB    1 
ATOM   991   C  CG    . ASP A 1  130  ? 0.862   -66.758  34.638  1.00 149.36 ? 130  ASP A CG    1 
ATOM   992   O  OD1   . ASP A 1  130  ? 0.044   -65.976  35.157  1.00 169.49 ? 130  ASP A OD1   1 
ATOM   993   O  OD2   . ASP A 1  130  ? 1.074   -66.771  33.405  1.00 146.61 ? 130  ASP A OD2   1 
ATOM   994   N  N     . SER A 1  131  ? 0.187   -65.789  37.641  1.00 122.82 ? 131  SER A N     1 
ATOM   995   C  CA    . SER A 1  131  ? -1.031  -65.467  38.375  1.00 122.29 ? 131  SER A CA    1 
ATOM   996   C  C     . SER A 1  131  ? -2.302  -65.934  37.661  1.00 128.92 ? 131  SER A C     1 
ATOM   997   O  O     . SER A 1  131  ? -3.097  -66.681  38.236  1.00 140.21 ? 131  SER A O     1 
ATOM   998   C  CB    . SER A 1  131  ? -1.093  -63.955  38.624  1.00 135.67 ? 131  SER A CB    1 
ATOM   999   O  OG    . SER A 1  131  ? -2.430  -63.533  38.848  1.00 157.06 ? 131  SER A OG    1 
ATOM   1000  N  N     . LYS A 1  132  ? -2.484  -65.542  36.400  1.00 126.49 ? 132  LYS A N     1 
ATOM   1001  C  CA    . LYS A 1  132  ? -3.697  -65.898  35.669  1.00 124.88 ? 132  LYS A CA    1 
ATOM   1002  C  C     . LYS A 1  132  ? -3.811  -67.399  35.432  1.00 131.93 ? 132  LYS A C     1 
ATOM   1003  O  O     . LYS A 1  132  ? -4.904  -67.973  35.549  1.00 151.26 ? 132  LYS A O     1 
ATOM   1004  C  CB    . LYS A 1  132  ? -3.714  -65.155  34.337  1.00 134.05 ? 132  LYS A CB    1 
ATOM   1005  C  CG    . LYS A 1  132  ? -3.795  -63.645  34.474  1.00 139.44 ? 132  LYS A CG    1 
ATOM   1006  C  CD    . LYS A 1  132  ? -3.877  -62.967  33.119  1.00 121.07 ? 132  LYS A CD    1 
ATOM   1007  C  CE    . LYS A 1  132  ? -3.115  -61.653  33.129  1.00 111.04 ? 132  LYS A CE    1 
ATOM   1008  N  NZ    . LYS A 1  132  ? -3.374  -60.851  34.358  1.00 107.33 ? 132  LYS A NZ    1 
ATOM   1009  N  N     . LYS A 1  133  ? -2.696  -68.060  35.117  1.00 126.65 ? 133  LYS A N     1 
ATOM   1010  C  CA    . LYS A 1  133  ? -2.765  -69.497  34.876  1.00 128.28 ? 133  LYS A CA    1 
ATOM   1011  C  C     . LYS A 1  133  ? -3.005  -70.257  36.168  1.00 127.76 ? 133  LYS A C     1 
ATOM   1012  O  O     . LYS A 1  133  ? -3.716  -71.276  36.176  1.00 133.68 ? 133  LYS A O     1 
ATOM   1013  C  CB    . LYS A 1  133  ? -1.482  -69.978  34.208  1.00 126.96 ? 133  LYS A CB    1 
ATOM   1014  C  CG    . LYS A 1  133  ? -1.596  -70.169  32.715  1.00 125.52 ? 133  LYS A CG    1 
ATOM   1015  C  CD    . LYS A 1  133  ? -0.230  -70.131  32.082  1.00 132.46 ? 133  LYS A CD    1 
ATOM   1016  C  CE    . LYS A 1  133  ? -0.326  -69.911  30.598  1.00 143.65 ? 133  LYS A CE    1 
ATOM   1017  N  NZ    . LYS A 1  133  ? 1.000   -69.575  30.033  1.00 133.45 ? 133  LYS A NZ    1 
ATOM   1018  N  N     . ARG A 1  134  ? -2.489  -69.727  37.278  1.00 120.04 ? 134  ARG A N     1 
ATOM   1019  C  CA    . ARG A 1  134  ? -2.751  -70.331  38.577  1.00 132.74 ? 134  ARG A CA    1 
ATOM   1020  C  C     . ARG A 1  134  ? -4.214  -70.189  38.942  1.00 136.15 ? 134  ARG A C     1 
ATOM   1021  O  O     . ARG A 1  134  ? -4.817  -71.116  39.493  1.00 149.25 ? 134  ARG A O     1 
ATOM   1022  C  CB    . ARG A 1  134  ? -1.875  -69.680  39.644  1.00 127.28 ? 134  ARG A CB    1 
ATOM   1023  C  CG    . ARG A 1  134  ? -2.310  -69.939  41.077  1.00 117.05 ? 134  ARG A CG    1 
ATOM   1024  C  CD    . ARG A 1  134  ? -1.418  -69.166  42.018  1.00 127.90 ? 134  ARG A CD    1 
ATOM   1025  N  NE    . ARG A 1  134  ? -1.091  -67.851  41.480  1.00 133.29 ? 134  ARG A NE    1 
ATOM   1026  C  CZ    . ARG A 1  134  ? -0.512  -66.886  42.185  1.00 141.26 ? 134  ARG A CZ    1 
ATOM   1027  N  NH1   . ARG A 1  134  ? -0.202  -67.097  43.456  1.00 142.85 ? 134  ARG A NH1   1 
ATOM   1028  N  NH2   . ARG A 1  134  ? -0.235  -65.714  41.624  1.00 131.38 ? 134  ARG A NH2   1 
ATOM   1029  N  N     . PHE A 1  135  ? -4.796  -69.023  38.664  1.00 122.05 ? 135  PHE A N     1 
ATOM   1030  C  CA    . PHE A 1  135  ? -6.216  -68.847  38.927  1.00 125.38 ? 135  PHE A CA    1 
ATOM   1031  C  C     . PHE A 1  135  ? -7.062  -69.773  38.064  1.00 127.45 ? 135  PHE A C     1 
ATOM   1032  O  O     . PHE A 1  135  ? -8.114  -70.242  38.511  1.00 132.86 ? 135  PHE A O     1 
ATOM   1033  C  CB    . PHE A 1  135  ? -6.637  -67.398  38.684  1.00 122.84 ? 135  PHE A CB    1 
ATOM   1034  C  CG    . PHE A 1  135  ? -8.116  -67.173  38.841  1.00 119.21 ? 135  PHE A CG    1 
ATOM   1035  C  CD1   . PHE A 1  135  ? -8.693  -67.130  40.097  1.00 124.76 ? 135  PHE A CD1   1 
ATOM   1036  C  CD2   . PHE A 1  135  ? -8.937  -67.058  37.732  1.00 113.10 ? 135  PHE A CD2   1 
ATOM   1037  C  CE1   . PHE A 1  135  ? -10.058 -66.942  40.243  1.00 122.76 ? 135  PHE A CE1   1 
ATOM   1038  C  CE2   . PHE A 1  135  ? -10.298 -66.875  37.876  1.00 118.70 ? 135  PHE A CE2   1 
ATOM   1039  C  CZ    . PHE A 1  135  ? -10.858 -66.818  39.130  1.00 115.53 ? 135  PHE A CZ    1 
ATOM   1040  N  N     . ALA A 1  136  ? -6.605  -70.079  36.845  1.00 122.94 ? 136  ALA A N     1 
ATOM   1041  C  CA    . ALA A 1  136  ? -7.335  -71.034  36.011  1.00 117.89 ? 136  ALA A CA    1 
ATOM   1042  C  C     . ALA A 1  136  ? -7.266  -72.443  36.583  1.00 131.33 ? 136  ALA A C     1 
ATOM   1043  O  O     . ALA A 1  136  ? -8.268  -73.174  36.583  1.00 144.32 ? 136  ALA A O     1 
ATOM   1044  C  CB    . ALA A 1  136  ? -6.797  -71.006  34.581  1.00 123.80 ? 136  ALA A CB    1 
ATOM   1045  N  N     . ALA A 1  137  ? -6.118  -72.817  37.149  1.00 135.22 ? 137  ALA A N     1 
ATOM   1046  C  CA    . ALA A 1  137  ? -6.018  -74.154  37.723  1.00 143.87 ? 137  ALA A CA    1 
ATOM   1047  C  C     . ALA A 1  137  ? -6.771  -74.257  39.047  1.00 143.74 ? 137  ALA A C     1 
ATOM   1048  O  O     . ALA A 1  137  ? -7.346  -75.315  39.349  1.00 148.79 ? 137  ALA A O     1 
ATOM   1049  C  CB    . ALA A 1  137  ? -4.548  -74.538  37.902  1.00 145.12 ? 137  ALA A CB    1 
ATOM   1050  N  N     . ILE A 1  138  ? -6.811  -73.172  39.829  1.00 123.27 ? 138  ILE A N     1 
ATOM   1051  C  CA    . ILE A 1  138  ? -7.542  -73.205  41.092  1.00 125.08 ? 138  ILE A CA    1 
ATOM   1052  C  C     . ILE A 1  138  ? -9.036  -73.248  40.823  1.00 141.09 ? 138  ILE A C     1 
ATOM   1053  O  O     . ILE A 1  138  ? -9.785  -73.984  41.483  1.00 149.06 ? 138  ILE A O     1 
ATOM   1054  C  CB    . ILE A 1  138  ? -7.181  -71.984  41.963  1.00 121.15 ? 138  ILE A CB    1 
ATOM   1055  C  CG1   . ILE A 1  138  ? -5.753  -72.082  42.491  1.00 123.11 ? 138  ILE A CG1   1 
ATOM   1056  C  CG2   . ILE A 1  138  ? -8.146  -71.850  43.144  1.00 130.55 ? 138  ILE A CG2   1 
ATOM   1057  C  CD1   . ILE A 1  138  ? -5.290  -70.864  43.296  1.00 111.94 ? 138  ILE A CD1   1 
ATOM   1058  N  N     . TRP A 1  139  ? -9.496  -72.473  39.838  1.00 136.78 ? 139  TRP A N     1 
ATOM   1059  C  CA    . TRP A 1  139  ? -10.921 -72.490  39.539  1.00 134.80 ? 139  TRP A CA    1 
ATOM   1060  C  C     . TRP A 1  139  ? -11.328 -73.836  38.970  1.00 147.08 ? 139  TRP A C     1 
ATOM   1061  O  O     . TRP A 1  139  ? -12.458 -74.286  39.190  1.00 164.33 ? 139  TRP A O     1 
ATOM   1062  C  CB    . TRP A 1  139  ? -11.305 -71.378  38.570  1.00 124.59 ? 139  TRP A CB    1 
ATOM   1063  C  CG    . TRP A 1  139  ? -12.744 -71.456  38.199  1.00 128.78 ? 139  TRP A CG    1 
ATOM   1064  C  CD1   . TRP A 1  139  ? -13.800 -71.142  38.993  1.00 139.68 ? 139  TRP A CD1   1 
ATOM   1065  C  CD2   . TRP A 1  139  ? -13.296 -71.918  36.958  1.00 128.51 ? 139  TRP A CD2   1 
ATOM   1066  N  NE1   . TRP A 1  139  ? -14.977 -71.356  38.320  1.00 145.84 ? 139  TRP A NE1   1 
ATOM   1067  C  CE2   . TRP A 1  139  ? -14.694 -71.834  37.069  1.00 140.11 ? 139  TRP A CE2   1 
ATOM   1068  C  CE3   . TRP A 1  139  ? -12.744 -72.385  35.764  1.00 136.42 ? 139  TRP A CE3   1 
ATOM   1069  C  CZ2   . TRP A 1  139  ? -15.547 -72.198  36.033  1.00 149.35 ? 139  TRP A CZ2   1 
ATOM   1070  C  CZ3   . TRP A 1  139  ? -13.596 -72.741  34.736  1.00 141.03 ? 139  TRP A CZ3   1 
ATOM   1071  C  CH2   . TRP A 1  139  ? -14.979 -72.648  34.878  1.00 149.16 ? 139  TRP A CH2   1 
ATOM   1072  N  N     . THR A 1  140  ? -10.423 -74.493  38.236  1.00 132.21 ? 140  THR A N     1 
ATOM   1073  C  CA    . THR A 1  140  ? -10.757 -75.806  37.698  1.00 137.32 ? 140  THR A CA    1 
ATOM   1074  C  C     . THR A 1  140  ? -10.856 -76.845  38.815  1.00 146.61 ? 140  THR A C     1 
ATOM   1075  O  O     . THR A 1  140  ? -11.777 -77.671  38.820  1.00 145.23 ? 140  THR A O     1 
ATOM   1076  C  CB    . THR A 1  140  ? -9.734  -76.217  36.636  1.00 129.72 ? 140  THR A CB    1 
ATOM   1077  O  OG1   . THR A 1  140  ? -9.820  -75.319  35.523  1.00 132.26 ? 140  THR A OG1   1 
ATOM   1078  C  CG2   . THR A 1  140  ? -9.987  -77.634  36.141  1.00 126.09 ? 140  THR A CG2   1 
ATOM   1079  N  N     . LEU A 1  141  ? -9.932  -76.806  39.785  1.00 155.71 ? 141  LEU A N     1 
ATOM   1080  C  CA    . LEU A 1  141  ? -9.977  -77.767  40.890  1.00 150.02 ? 141  LEU A CA    1 
ATOM   1081  C  C     . LEU A 1  141  ? -11.094 -77.497  41.891  1.00 152.20 ? 141  LEU A C     1 
ATOM   1082  O  O     . LEU A 1  141  ? -11.492 -78.417  42.615  1.00 159.49 ? 141  LEU A O     1 
ATOM   1083  C  CB    . LEU A 1  141  ? -8.650  -77.804  41.653  1.00 130.92 ? 141  LEU A CB    1 
ATOM   1084  C  CG    . LEU A 1  141  ? -7.427  -78.260  40.873  1.00 138.01 ? 141  LEU A CG    1 
ATOM   1085  C  CD1   . LEU A 1  141  ? -6.200  -78.249  41.774  1.00 152.31 ? 141  LEU A CD1   1 
ATOM   1086  C  CD2   . LEU A 1  141  ? -7.678  -79.640  40.291  1.00 121.49 ? 141  LEU A CD2   1 
ATOM   1087  N  N     . CYS A 1  142  ? -11.607 -76.269  41.958  1.00 144.89 ? 142  CYS A N     1 
ATOM   1088  C  CA    . CYS A 1  142  ? -12.534 -75.887  43.016  1.00 151.44 ? 142  CYS A CA    1 
ATOM   1089  C  C     . CYS A 1  142  ? -13.972 -75.710  42.550  1.00 158.72 ? 142  CYS A C     1 
ATOM   1090  O  O     . CYS A 1  142  ? -14.880 -75.678  43.392  1.00 161.95 ? 142  CYS A O     1 
ATOM   1091  C  CB    . CYS A 1  142  ? -12.046 -74.600  43.701  1.00 159.78 ? 142  CYS A CB    1 
ATOM   1092  S  SG    . CYS A 1  142  ? -10.598 -74.825  44.770  1.00 164.02 ? 142  CYS A SG    1 
ATOM   1093  N  N     . LYS A 1  143  ? -14.214 -75.656  41.239  1.00 156.47 ? 143  LYS A N     1 
ATOM   1094  C  CA    . LYS A 1  143  ? -15.561 -75.457  40.711  1.00 155.71 ? 143  LYS A CA    1 
ATOM   1095  C  C     . LYS A 1  143  ? -16.487 -76.628  41.000  1.00 157.26 ? 143  LYS A C     1 
ATOM   1096  O  O     . LYS A 1  143  ? -17.692 -76.527  40.748  1.00 152.12 ? 143  LYS A O     1 
ATOM   1097  C  CB    . LYS A 1  143  ? -15.485 -75.216  39.196  1.00 150.37 ? 143  LYS A CB    1 
ATOM   1098  C  CG    . LYS A 1  143  ? -14.933 -76.398  38.402  1.00 158.73 ? 143  LYS A CG    1 
ATOM   1099  C  CD    . LYS A 1  143  ? -14.261 -75.965  37.102  1.00 148.52 ? 143  LYS A CD    1 
ATOM   1100  C  CE    . LYS A 1  143  ? -14.721 -76.800  35.925  1.00 137.78 ? 143  LYS A CE    1 
ATOM   1101  N  NZ    . LYS A 1  143  ? -16.038 -76.338  35.414  1.00 142.24 ? 143  LYS A NZ    1 
ATOM   1102  N  N     . THR A 1  144  ? -15.960 -77.732  41.538  1.00 158.81 ? 144  THR A N     1 
ATOM   1103  C  CA    . THR A 1  144  ? -16.747 -78.928  41.744  1.00 153.03 ? 144  THR A CA    1 
ATOM   1104  C  C     . THR A 1  144  ? -16.683 -79.472  43.164  1.00 157.00 ? 144  THR A C     1 
ATOM   1105  O  O     . THR A 1  144  ? -17.462 -80.375  43.486  1.00 183.49 ? 144  THR A O     1 
ATOM   1106  C  CB    . THR A 1  144  ? -16.280 -80.033  40.785  1.00 149.42 ? 144  THR A CB    1 
ATOM   1107  O  OG1   . THR A 1  144  ? -14.870 -80.237  40.952  1.00 142.05 ? 144  THR A OG1   1 
ATOM   1108  C  CG2   . THR A 1  144  ? -16.556 -79.636  39.334  1.00 132.12 ? 144  THR A CG2   1 
ATOM   1109  N  N     . LYS A 1  145  ? -15.815 -78.952  44.024  1.00 150.64 ? 145  LYS A N     1 
ATOM   1110  C  CA    . LYS A 1  145  ? -15.881 -79.273  45.443  1.00 169.73 ? 145  LYS A CA    1 
ATOM   1111  C  C     . LYS A 1  145  ? -16.970 -78.425  46.083  1.00 183.07 ? 145  LYS A C     1 
ATOM   1112  O  O     . LYS A 1  145  ? -16.884 -77.194  46.081  1.00 180.95 ? 145  LYS A O     1 
ATOM   1113  C  CB    . LYS A 1  145  ? -14.535 -79.064  46.131  1.00 151.85 ? 145  LYS A CB    1 
ATOM   1114  C  CG    . LYS A 1  145  ? -13.858 -80.372  46.538  1.00 146.31 ? 145  LYS A CG    1 
ATOM   1115  C  CD    . LYS A 1  145  ? -14.656 -81.106  47.603  1.00 151.87 ? 145  LYS A CD    1 
ATOM   1116  C  CE    . LYS A 1  145  ? -13.773 -82.038  48.421  1.00 158.87 ? 145  LYS A CE    1 
ATOM   1117  N  NZ    . LYS A 1  145  ? -14.499 -82.632  49.583  1.00 166.63 ? 145  LYS A NZ    1 
ATOM   1118  N  N     . MET A 1  146  ? -18.018 -79.075  46.587  1.00 177.48 ? 146  MET A N     1 
ATOM   1119  C  CA    . MET A 1  146  ? -19.270 -78.397  46.894  1.00 157.56 ? 146  MET A CA    1 
ATOM   1120  C  C     . MET A 1  146  ? -19.625 -78.497  48.370  1.00 154.88 ? 146  MET A C     1 
ATOM   1121  O  O     . MET A 1  146  ? -20.807 -78.534  48.722  1.00 151.87 ? 146  MET A O     1 
ATOM   1122  C  CB    . MET A 1  146  ? -20.412 -78.973  46.057  1.00 135.16 ? 146  MET A CB    1 
ATOM   1123  C  CG    . MET A 1  146  ? -20.133 -79.060  44.573  1.00 139.29 ? 146  MET A CG    1 
ATOM   1124  S  SD    . MET A 1  146  ? -20.842 -77.670  43.672  1.00 158.64 ? 146  MET A SD    1 
ATOM   1125  C  CE    . MET A 1  146  ? -20.533 -78.140  41.967  1.00 152.90 ? 146  MET A CE    1 
ATOM   1126  N  N     . VAL A 1  147  ? -18.632 -78.563  49.253  1.00 152.51 ? 147  VAL A N     1 
ATOM   1127  C  CA    . VAL A 1  147  ? -19.010 -78.885  50.619  1.00 163.53 ? 147  VAL A CA    1 
ATOM   1128  C  C     . VAL A 1  147  ? -18.080 -78.278  51.666  1.00 175.23 ? 147  VAL A C     1 
ATOM   1129  O  O     . VAL A 1  147  ? -18.254 -78.523  52.866  1.00 192.06 ? 147  VAL A O     1 
ATOM   1130  C  CB    . VAL A 1  147  ? -19.093 -80.414  50.767  1.00 158.09 ? 147  VAL A CB    1 
ATOM   1131  C  CG1   . VAL A 1  147  ? -17.695 -81.015  50.822  1.00 163.08 ? 147  VAL A CG1   1 
ATOM   1132  C  CG2   . VAL A 1  147  ? -19.961 -80.803  51.957  1.00 171.70 ? 147  VAL A CG2   1 
ATOM   1133  N  N     . CYS A 1  148  ? -17.116 -77.450  51.249  1.00 154.83 ? 148  CYS A N     1 
ATOM   1134  C  CA    . CYS A 1  148  ? -16.405 -76.577  52.194  1.00 175.05 ? 148  CYS A CA    1 
ATOM   1135  C  C     . CYS A 1  148  ? -15.682 -77.368  53.279  1.00 188.57 ? 148  CYS A C     1 
ATOM   1136  O  O     . CYS A 1  148  ? -15.531 -76.873  54.396  1.00 204.95 ? 148  CYS A O     1 
ATOM   1137  C  CB    . CYS A 1  148  ? -17.322 -75.535  52.845  1.00 176.46 ? 148  CYS A CB    1 
ATOM   1138  S  SG    . CYS A 1  148  ? -16.421 -74.072  53.486  1.00 166.25 ? 148  CYS A SG    1 
ATOM   1139  N  N     . GLU A 1  149  ? -15.229 -78.586  52.960  1.00 175.51 ? 149  GLU A N     1 
ATOM   1140  C  CA    . GLU A 1  149  ? -14.953 -79.625  53.953  1.00 165.78 ? 149  GLU A CA    1 
ATOM   1141  C  C     . GLU A 1  149  ? -14.218 -79.100  55.184  1.00 178.58 ? 149  GLU A C     1 
ATOM   1142  O  O     . GLU A 1  149  ? -13.331 -78.245  55.092  1.00 187.68 ? 149  GLU A O     1 
ATOM   1143  C  CB    . GLU A 1  149  ? -14.151 -80.755  53.300  1.00 166.29 ? 149  GLU A CB    1 
ATOM   1144  C  CG    . GLU A 1  149  ? -15.000 -81.970  52.925  1.00 173.60 ? 149  GLU A CG    1 
ATOM   1145  C  CD    . GLU A 1  149  ? -15.779 -82.532  54.112  1.00 204.14 ? 149  GLU A CD    1 
ATOM   1146  O  OE1   . GLU A 1  149  ? -16.951 -82.938  53.929  1.00 209.87 ? 149  GLU A OE1   1 
ATOM   1147  O  OE2   . GLU A 1  149  ? -15.228 -82.562  55.231  1.00 210.71 ? 149  GLU A OE2   1 
ATOM   1148  N  N     . THR A 1  150  ? -14.569 -79.672  56.338  1.00 191.16 ? 150  THR A N     1 
ATOM   1149  C  CA    . THR A 1  150  ? -14.074 -79.245  57.644  1.00 186.97 ? 150  THR A CA    1 
ATOM   1150  C  C     . THR A 1  150  ? -12.913 -80.080  58.176  1.00 183.66 ? 150  THR A C     1 
ATOM   1151  O  O     . THR A 1  150  ? -12.111 -79.563  58.962  1.00 168.93 ? 150  THR A O     1 
ATOM   1152  C  CB    . THR A 1  150  ? -15.216 -79.266  58.674  1.00 172.18 ? 150  THR A CB    1 
ATOM   1153  O  OG1   . THR A 1  150  ? -14.679 -79.105  59.996  1.00 172.68 ? 150  THR A OG1   1 
ATOM   1154  C  CG2   . THR A 1  150  ? -16.018 -80.575  58.595  1.00 145.78 ? 150  THR A CG2   1 
ATOM   1155  N  N     . ASP A 1  151  ? -12.793 -81.349  57.775  1.00 187.87 ? 151  ASP A N     1 
ATOM   1156  C  CA    . ASP A 1  151  ? -11.637 -82.158  58.145  1.00 184.15 ? 151  ASP A CA    1 
ATOM   1157  C  C     . ASP A 1  151  ? -11.199 -82.962  56.924  1.00 182.27 ? 151  ASP A C     1 
ATOM   1158  O  O     . ASP A 1  151  ? -12.007 -83.265  56.042  1.00 171.78 ? 151  ASP A O     1 
ATOM   1159  C  CB    . ASP A 1  151  ? -11.939 -83.091  59.337  1.00 190.31 ? 151  ASP A CB    1 
ATOM   1160  C  CG    . ASP A 1  151  ? -12.731 -82.399  60.460  1.00 197.24 ? 151  ASP A CG    1 
ATOM   1161  O  OD1   . ASP A 1  151  ? -13.947 -82.174  60.301  1.00 197.61 ? 151  ASP A OD1   1 
ATOM   1162  O  OD2   . ASP A 1  151  ? -12.136 -82.060  61.502  1.00 200.59 ? 151  ASP A OD2   1 
ATOM   1163  N  N     . VAL A 1  152  ? -9.919  -83.333  56.893  1.00 195.34 ? 152  VAL A N     1 
ATOM   1164  C  CA    . VAL A 1  152  ? -9.314  -83.889  55.682  1.00 205.33 ? 152  VAL A CA    1 
ATOM   1165  C  C     . VAL A 1  152  ? -8.327  -85.012  55.993  1.00 214.24 ? 152  VAL A C     1 
ATOM   1166  O  O     . VAL A 1  152  ? -7.589  -84.940  56.988  1.00 223.22 ? 152  VAL A O     1 
ATOM   1167  C  CB    . VAL A 1  152  ? -8.642  -82.762  54.871  1.00 201.96 ? 152  VAL A CB    1 
ATOM   1168  C  CG1   . VAL A 1  152  ? -7.487  -83.273  54.008  1.00 198.80 ? 152  VAL A CG1   1 
ATOM   1169  C  CG2   . VAL A 1  152  ? -9.677  -82.054  54.001  1.00 195.63 ? 152  VAL A CG2   1 
ATOM   1170  N  N     . PRO A 1  153  ? -8.291  -86.070  55.177  1.00 208.58 ? 153  PRO A N     1 
ATOM   1171  C  CA    . PRO A 1  153  ? -7.276  -87.122  55.352  1.00 216.55 ? 153  PRO A CA    1 
ATOM   1172  C  C     . PRO A 1  153  ? -5.871  -86.543  55.283  1.00 234.81 ? 153  PRO A C     1 
ATOM   1173  O  O     . PRO A 1  153  ? -5.479  -85.932  54.285  1.00 234.71 ? 153  PRO A O     1 
ATOM   1174  C  CB    . PRO A 1  153  ? -7.558  -88.079  54.186  1.00 201.26 ? 153  PRO A CB    1 
ATOM   1175  C  CG    . PRO A 1  153  ? -8.328  -87.249  53.187  1.00 178.67 ? 153  PRO A CG    1 
ATOM   1176  C  CD    . PRO A 1  153  ? -9.164  -86.336  54.022  1.00 188.06 ? 153  PRO A CD    1 
ATOM   1177  N  N     . SER A 1  154  ? -5.116  -86.726  56.363  1.00 242.72 ? 154  SER A N     1 
ATOM   1178  C  CA    . SER A 1  154  ? -3.822  -86.075  56.500  1.00 243.25 ? 154  SER A CA    1 
ATOM   1179  C  C     . SER A 1  154  ? -2.800  -86.707  55.556  1.00 241.97 ? 154  SER A C     1 
ATOM   1180  O  O     . SER A 1  154  ? -3.086  -87.649  54.812  1.00 251.25 ? 154  SER A O     1 
ATOM   1181  C  CB    . SER A 1  154  ? -3.336  -86.161  57.945  1.00 243.08 ? 154  SER A CB    1 
ATOM   1182  O  OG    . SER A 1  154  ? -3.389  -87.495  58.423  1.00 244.86 ? 154  SER A OG    1 
ATOM   1183  N  N     . GLU A 1  155  ? -1.583  -86.165  55.596  1.00 231.00 ? 155  GLU A N     1 
ATOM   1184  C  CA    . GLU A 1  155  ? -0.502  -86.607  54.724  1.00 222.59 ? 155  GLU A CA    1 
ATOM   1185  C  C     . GLU A 1  155  ? 0.213   -87.821  55.293  1.00 239.54 ? 155  GLU A C     1 
ATOM   1186  O  O     . GLU A 1  155  ? 0.859   -88.566  54.545  1.00 242.68 ? 155  GLU A O     1 
ATOM   1187  C  CB    . GLU A 1  155  ? 0.503   -85.477  54.500  1.00 204.83 ? 155  GLU A CB    1 
ATOM   1188  C  CG    . GLU A 1  155  ? 1.535   -85.778  53.431  1.00 204.26 ? 155  GLU A CG    1 
ATOM   1189  C  CD    . GLU A 1  155  ? 2.243   -84.537  52.947  1.00 223.02 ? 155  GLU A CD    1 
ATOM   1190  O  OE1   . GLU A 1  155  ? 1.955   -83.445  53.481  1.00 229.60 ? 155  GLU A OE1   1 
ATOM   1191  O  OE2   . GLU A 1  155  ? 3.090   -84.654  52.037  1.00 228.05 ? 155  GLU A OE2   1 
ATOM   1192  N  N     . ASP A 1  156  ? 0.087   -88.037  56.601  1.00 245.54 ? 156  ASP A N     1 
ATOM   1193  C  CA    . ASP A 1  156  ? 0.722   -89.121  57.335  1.00 248.04 ? 156  ASP A CA    1 
ATOM   1194  C  C     . ASP A 1  156  ? -0.125  -90.387  57.355  1.00 250.13 ? 156  ASP A C     1 
ATOM   1195  O  O     . ASP A 1  156  ? 0.424   -91.493  57.309  1.00 255.20 ? 156  ASP A O     1 
ATOM   1196  C  CB    . ASP A 1  156  ? 1.000   -88.655  58.768  1.00 257.18 ? 156  ASP A CB    1 
ATOM   1197  C  CG    . ASP A 1  156  ? -0.217  -87.990  59.416  1.00 267.62 ? 156  ASP A CG    1 
ATOM   1198  O  OD1   . ASP A 1  156  ? -1.342  -88.518  59.282  1.00 274.66 ? 156  ASP A OD1   1 
ATOM   1199  O  OD2   . ASP A 1  156  ? -0.055  -86.914  60.031  1.00 267.28 ? 156  ASP A OD2   1 
ATOM   1200  N  N     . ASP A 1  157  ? -1.449  -90.253  57.419  1.00 246.22 ? 157  ASP A N     1 
ATOM   1201  C  CA    . ASP A 1  157  ? -2.309  -91.426  57.495  1.00 239.70 ? 157  ASP A CA    1 
ATOM   1202  C  C     . ASP A 1  157  ? -3.740  -91.079  57.101  1.00 250.82 ? 157  ASP A C     1 
ATOM   1203  O  O     . ASP A 1  157  ? -4.378  -90.241  57.753  1.00 262.11 ? 157  ASP A O     1 
ATOM   1204  C  CB    . ASP A 1  157  ? -2.277  -92.005  58.910  1.00 222.28 ? 157  ASP A CB    1 
ATOM   1205  C  CG    . ASP A 1  157  ? -3.220  -93.173  59.081  1.00 216.93 ? 157  ASP A CG    1 
ATOM   1206  O  OD1   . ASP A 1  157  ? -3.555  -93.824  58.069  1.00 211.81 ? 157  ASP A OD1   1 
ATOM   1207  O  OD2   . ASP A 1  157  ? -3.632  -93.436  60.229  1.00 220.22 ? 157  ASP A OD2   1 
ATOM   1208  N  N     . PRO A 1  158  ? -4.281  -91.695  56.043  1.00 246.60 ? 158  PRO A N     1 
ATOM   1209  C  CA    . PRO A 1  158  ? -5.673  -91.406  55.660  1.00 241.68 ? 158  PRO A CA    1 
ATOM   1210  C  C     . PRO A 1  158  ? -6.700  -91.939  56.655  1.00 246.11 ? 158  PRO A C     1 
ATOM   1211  O  O     . PRO A 1  158  ? -7.869  -91.531  56.588  1.00 244.76 ? 158  PRO A O     1 
ATOM   1212  C  CB    . PRO A 1  158  ? -5.809  -92.096  54.295  1.00 227.37 ? 158  PRO A CB    1 
ATOM   1213  C  CG    . PRO A 1  158  ? -4.401  -92.190  53.773  1.00 214.86 ? 158  PRO A CG    1 
ATOM   1214  C  CD    . PRO A 1  158  ? -3.558  -92.433  54.992  1.00 229.49 ? 158  PRO A CD    1 
ATOM   1215  N  N     . THR A 1  159  ? -6.301  -92.832  57.567  1.00 245.47 ? 159  THR A N     1 
ATOM   1216  C  CA    . THR A 1  159  ? -7.200  -93.414  58.561  1.00 247.32 ? 159  THR A CA    1 
ATOM   1217  C  C     . THR A 1  159  ? -7.668  -92.342  59.544  1.00 251.60 ? 159  THR A C     1 
ATOM   1218  O  O     . THR A 1  159  ? -8.796  -91.848  59.447  1.00 246.03 ? 159  THR A O     1 
ATOM   1219  C  CB    . THR A 1  159  ? -6.518  -94.571  59.305  1.00 242.40 ? 159  THR A CB    1 
ATOM   1220  O  OG1   . THR A 1  159  ? -5.990  -95.508  58.358  1.00 243.57 ? 159  THR A OG1   1 
ATOM   1221  C  CG2   . THR A 1  159  ? -7.515  -95.304  60.202  1.00 230.29 ? 159  THR A CG2   1 
ATOM   1222  N  N     . GLN A 1  160  ? -6.792  -91.967  60.478  1.00 251.26 ? 160  GLN A N     1 
ATOM   1223  C  CA    . GLN A 1  160  ? -7.033  -90.862  61.405  1.00 236.99 ? 160  GLN A CA    1 
ATOM   1224  C  C     . GLN A 1  160  ? -6.677  -89.555  60.709  1.00 245.70 ? 160  GLN A C     1 
ATOM   1225  O  O     . GLN A 1  160  ? -5.498  -89.255  60.501  1.00 249.80 ? 160  GLN A O     1 
ATOM   1226  C  CB    . GLN A 1  160  ? -6.222  -91.044  62.686  1.00 220.54 ? 160  GLN A CB    1 
ATOM   1227  C  CG    . GLN A 1  160  ? -6.899  -91.913  63.748  1.00 225.65 ? 160  GLN A CG    1 
ATOM   1228  C  CD    . GLN A 1  160  ? -6.506  -93.378  63.653  1.00 222.28 ? 160  GLN A CD    1 
ATOM   1229  O  OE1   . GLN A 1  160  ? -5.935  -93.811  62.654  1.00 237.34 ? 160  GLN A OE1   1 
ATOM   1230  N  NE2   . GLN A 1  160  ? -6.817  -94.149  64.691  1.00 194.25 ? 160  GLN A NE2   1 
ATOM   1231  N  N     . LEU A 1  161  ? -7.695  -88.768  60.364  1.00 245.51 ? 161  LEU A N     1 
ATOM   1232  C  CA    . LEU A 1  161  ? -7.525  -87.607  59.506  1.00 222.71 ? 161  LEU A CA    1 
ATOM   1233  C  C     . LEU A 1  161  ? -7.449  -86.326  60.337  1.00 214.74 ? 161  LEU A C     1 
ATOM   1234  O  O     . LEU A 1  161  ? -7.579  -86.338  61.563  1.00 207.41 ? 161  LEU A O     1 
ATOM   1235  C  CB    . LEU A 1  161  ? -8.672  -87.550  58.491  1.00 204.87 ? 161  LEU A CB    1 
ATOM   1236  C  CG    . LEU A 1  161  ? -10.096 -87.913  58.942  1.00 189.82 ? 161  LEU A CG    1 
ATOM   1237  C  CD1   . LEU A 1  161  ? -10.663 -86.938  59.965  1.00 178.75 ? 161  LEU A CD1   1 
ATOM   1238  C  CD2   . LEU A 1  161  ? -11.021 -88.018  57.736  1.00 173.53 ? 161  LEU A CD2   1 
ATOM   1239  N  N     . VAL A 1  162  ? -7.255  -85.202  59.648  1.00 211.45 ? 162  VAL A N     1 
ATOM   1240  C  CA    . VAL A 1  162  ? -6.871  -83.942  60.272  1.00 202.02 ? 162  VAL A CA    1 
ATOM   1241  C  C     . VAL A 1  162  ? -7.922  -82.874  59.990  1.00 190.82 ? 162  VAL A C     1 
ATOM   1242  O  O     . VAL A 1  162  ? -8.513  -82.836  58.906  1.00 181.02 ? 162  VAL A O     1 
ATOM   1243  C  CB    . VAL A 1  162  ? -5.469  -83.512  59.782  1.00 188.25 ? 162  VAL A CB    1 
ATOM   1244  C  CG1   . VAL A 1  162  ? -5.281  -82.010  59.830  1.00 185.35 ? 162  VAL A CG1   1 
ATOM   1245  C  CG2   . VAL A 1  162  ? -4.404  -84.182  60.634  1.00 190.40 ? 162  VAL A CG2   1 
ATOM   1246  N  N     . SER A 1  163  ? -8.140  -81.998  60.969  1.00 191.16 ? 163  SER A N     1 
ATOM   1247  C  CA    . SER A 1  163  ? -9.102  -80.914  60.852  1.00 192.04 ? 163  SER A CA    1 
ATOM   1248  C  C     . SER A 1  163  ? -8.471  -79.752  60.101  1.00 195.30 ? 163  SER A C     1 
ATOM   1249  O  O     . SER A 1  163  ? -7.245  -79.634  59.998  1.00 194.91 ? 163  SER A O     1 
ATOM   1250  C  CB    . SER A 1  163  ? -9.572  -80.439  62.225  1.00 192.52 ? 163  SER A CB    1 
ATOM   1251  O  OG    . SER A 1  163  ? -10.332 -79.245  62.115  1.00 191.83 ? 163  SER A OG    1 
ATOM   1252  N  N     . ARG A 1  164  ? -9.317  -78.864  59.581  1.00 198.02 ? 164  ARG A N     1 
ATOM   1253  C  CA    . ARG A 1  164  ? -8.784  -77.710  58.865  1.00 186.24 ? 164  ARG A CA    1 
ATOM   1254  C  C     . ARG A 1  164  ? -9.565  -76.432  59.110  1.00 188.73 ? 164  ARG A C     1 
ATOM   1255  O  O     . ARG A 1  164  ? -9.395  -75.464  58.357  1.00 181.04 ? 164  ARG A O     1 
ATOM   1256  C  CB    . ARG A 1  164  ? -8.741  -77.967  57.359  1.00 166.02 ? 164  ARG A CB    1 
ATOM   1257  C  CG    . ARG A 1  164  ? -10.095 -78.297  56.766  1.00 157.93 ? 164  ARG A CG    1 
ATOM   1258  C  CD    . ARG A 1  164  ? -10.015 -78.413  55.266  1.00 157.87 ? 164  ARG A CD    1 
ATOM   1259  N  NE    . ARG A 1  164  ? -10.378 -77.146  54.652  1.00 170.33 ? 164  ARG A NE    1 
ATOM   1260  C  CZ    . ARG A 1  164  ? -10.659 -76.991  53.358  1.00 169.60 ? 164  ARG A CZ    1 
ATOM   1261  N  NH1   . ARG A 1  164  ? -10.616 -78.036  52.546  1.00 166.50 ? 164  ARG A NH1   1 
ATOM   1262  N  NH2   . ARG A 1  164  ? -10.979 -75.796  52.888  1.00 168.75 ? 164  ARG A NH2   1 
ATOM   1263  N  N     . GLY A 1  165  ? -10.394 -76.378  60.159  1.00 194.02 ? 165  GLY A N     1 
ATOM   1264  C  CA    . GLY A 1  165  ? -11.161 -75.176  60.419  1.00 186.90 ? 165  GLY A CA    1 
ATOM   1265  C  C     . GLY A 1  165  ? -12.020 -74.868  59.215  1.00 173.65 ? 165  GLY A C     1 
ATOM   1266  O  O     . GLY A 1  165  ? -11.853 -73.839  58.556  1.00 164.08 ? 165  GLY A O     1 
ATOM   1267  N  N     . GLY A 1  166  ? -12.955 -75.764  58.923  1.00 181.56 ? 166  GLY A N     1 
ATOM   1268  C  CA    . GLY A 1  166  ? -13.705 -75.735  57.685  1.00 175.90 ? 166  GLY A CA    1 
ATOM   1269  C  C     . GLY A 1  166  ? -15.142 -75.331  57.931  1.00 193.62 ? 166  GLY A C     1 
ATOM   1270  O  O     . GLY A 1  166  ? -15.717 -75.616  58.984  1.00 170.86 ? 166  GLY A O     1 
ATOM   1271  N  N     . CYS A 1  167  ? -15.714 -74.669  56.940  1.00 228.42 ? 167  CYS A N     1 
ATOM   1272  C  CA    . CYS A 1  167  ? -17.144 -74.444  56.917  1.00 246.57 ? 167  CYS A CA    1 
ATOM   1273  C  C     . CYS A 1  167  ? -17.884 -75.771  56.827  1.00 207.24 ? 167  CYS A C     1 
ATOM   1274  O  O     . CYS A 1  167  ? -17.404 -76.740  56.237  1.00 212.11 ? 167  CYS A O     1 
ATOM   1275  C  CB    . CYS A 1  167  ? -17.462 -73.583  55.706  1.00 299.49 ? 167  CYS A CB    1 
ATOM   1276  S  SG    . CYS A 1  167  ? -19.024 -72.770  55.604  1.00 298.16 ? 167  CYS A SG    1 
ATOM   1277  N  N     . GLY A 1  168  ? -19.056 -75.831  57.453  1.00 167.92 ? 168  GLY A N     1 
ATOM   1278  C  CA    . GLY A 1  168  ? -19.874 -77.013  57.287  1.00 148.71 ? 168  GLY A CA    1 
ATOM   1279  C  C     . GLY A 1  168  ? -20.730 -76.983  56.040  1.00 165.90 ? 168  GLY A C     1 
ATOM   1280  O  O     . GLY A 1  168  ? -20.911 -78.017  55.392  1.00 159.35 ? 168  GLY A O     1 
ATOM   1281  N  N     . ASN A 1  169  ? -21.200 -75.799  55.642  1.00 173.53 ? 169  ASN A N     1 
ATOM   1282  C  CA    . ASN A 1  169  ? -22.301 -75.697  54.688  1.00 175.70 ? 169  ASN A CA    1 
ATOM   1283  C  C     . ASN A 1  169  ? -21.935 -76.233  53.306  1.00 159.63 ? 169  ASN A C     1 
ATOM   1284  O  O     . ASN A 1  169  ? -20.773 -76.225  52.893  1.00 151.92 ? 169  ASN A O     1 
ATOM   1285  C  CB    . ASN A 1  169  ? -22.780 -74.246  54.568  1.00 197.84 ? 169  ASN A CB    1 
ATOM   1286  C  CG    . ASN A 1  169  ? -22.837 -73.534  55.906  1.00 220.74 ? 169  ASN A CG    1 
ATOM   1287  O  OD1   . ASN A 1  169  ? -21.809 -73.258  56.519  1.00 238.78 ? 169  ASN A OD1   1 
ATOM   1288  N  ND2   . ASN A 1  169  ? -24.049 -73.257  56.378  1.00 215.20 ? 169  ASN A ND2   1 
ATOM   1289  N  N     . THR A 1  170  ? -22.958 -76.688  52.583  1.00 161.45 ? 170  THR A N     1 
ATOM   1290  C  CA    . THR A 1  170  ? -22.788 -77.193  51.227  1.00 162.11 ? 170  THR A CA    1 
ATOM   1291  C  C     . THR A 1  170  ? -22.593 -76.024  50.264  1.00 163.71 ? 170  THR A C     1 
ATOM   1292  O  O     . THR A 1  170  ? -23.187 -74.955  50.423  1.00 160.77 ? 170  THR A O     1 
ATOM   1293  C  CB    . THR A 1  170  ? -24.010 -78.037  50.825  1.00 165.93 ? 170  THR A CB    1 
ATOM   1294  O  OG1   . THR A 1  170  ? -24.030 -79.245  51.598  1.00 169.96 ? 170  THR A OG1   1 
ATOM   1295  C  CG2   . THR A 1  170  ? -24.014 -78.387  49.333  1.00 155.81 ? 170  THR A CG2   1 
ATOM   1296  N  N     . GLN A 1  171  ? -21.766 -76.240  49.244  1.00 170.63 ? 171  GLN A N     1 
ATOM   1297  C  CA    . GLN A 1  171  ? -21.559 -75.114  48.338  1.00 150.33 ? 171  GLN A CA    1 
ATOM   1298  C  C     . GLN A 1  171  ? -22.529 -75.186  47.162  1.00 136.72 ? 171  GLN A C     1 
ATOM   1299  O  O     . GLN A 1  171  ? -22.705 -76.249  46.563  1.00 138.49 ? 171  GLN A O     1 
ATOM   1300  C  CB    . GLN A 1  171  ? -20.122 -75.078  47.828  1.00 135.25 ? 171  GLN A CB    1 
ATOM   1301  C  CG    . GLN A 1  171  ? -19.110 -74.714  48.899  1.00 133.96 ? 171  GLN A CG    1 
ATOM   1302  C  CD    . GLN A 1  171  ? -19.466 -73.426  49.614  1.00 160.27 ? 171  GLN A CD    1 
ATOM   1303  O  OE1   . GLN A 1  171  ? -19.619 -72.368  48.991  1.00 177.22 ? 171  GLN A OE1   1 
ATOM   1304  N  NE2   . GLN A 1  171  ? -19.614 -73.509  50.929  1.00 150.35 ? 171  GLN A NE2   1 
ATOM   1305  N  N     . PRO A 1  172  ? -23.145 -74.066  46.808  1.00 147.18 ? 172  PRO A N     1 
ATOM   1306  C  CA    . PRO A 1  172  ? -24.152 -74.078  45.744  1.00 152.70 ? 172  PRO A CA    1 
ATOM   1307  C  C     . PRO A 1  172  ? -23.562 -74.136  44.346  1.00 123.24 ? 172  PRO A C     1 
ATOM   1308  O  O     . PRO A 1  172  ? -22.493 -73.593  44.063  1.00 128.48 ? 172  PRO A O     1 
ATOM   1309  C  CB    . PRO A 1  172  ? -24.878 -72.744  45.945  1.00 158.10 ? 172  PRO A CB    1 
ATOM   1310  C  CG    . PRO A 1  172  ? -23.853 -71.859  46.561  1.00 159.44 ? 172  PRO A CG    1 
ATOM   1311  C  CD    . PRO A 1  172  ? -23.028 -72.747  47.452  1.00 160.73 ? 172  PRO A CD    1 
ATOM   1312  N  N     . THR A 1  173  ? -24.324 -74.755  43.448  1.00 126.82 ? 173  THR A N     1 
ATOM   1313  C  CA    . THR A 1  173  ? -24.033 -74.705  42.021  1.00 138.22 ? 173  THR A CA    1 
ATOM   1314  C  C     . THR A 1  173  ? -24.663 -73.447  41.444  1.00 148.71 ? 173  THR A C     1 
ATOM   1315  O  O     . THR A 1  173  ? -25.883 -73.249  41.553  1.00 149.05 ? 173  THR A O     1 
ATOM   1316  C  CB    . THR A 1  173  ? -24.540 -75.955  41.292  1.00 145.37 ? 173  THR A CB    1 
ATOM   1317  O  OG1   . THR A 1  173  ? -23.669 -77.060  41.564  1.00 152.87 ? 173  THR A OG1   1 
ATOM   1318  C  CG2   . THR A 1  173  ? -24.627 -75.728  39.781  1.00 129.62 ? 173  THR A CG2   1 
ATOM   1319  N  N     . ILE A 1  174  ? -23.801 -72.555  40.914  1.00 161.42 ? 174  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1  174  ? -24.169 -71.202  40.511  1.00 155.26 ? 174  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1  174  ? -24.307 -71.137  38.999  1.00 148.45 ? 174  ILE A C     1 
ATOM   1322  O  O     . ILE A 1  174  ? -23.561 -71.779  38.250  1.00 153.29 ? 174  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1  174  ? -23.134 -70.161  40.987  1.00 139.90 ? 174  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1  174  ? -22.633 -70.499  42.386  1.00 148.30 ? 174  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1  174  ? -23.731 -68.762  40.955  1.00 128.33 ? 174  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1  174  ? -21.753 -69.428  42.992  1.00 132.18 ? 174  ILE A CD1   1 
ATOM   1327  N  N     . ARG A 1  175  ? -25.234 -70.297  38.549  1.00 125.58 ? 175  ARG A N     1 
ATOM   1328  C  CA    . ARG A 1  175  ? -25.469 -70.052  37.137  1.00 126.59 ? 175  ARG A CA    1 
ATOM   1329  C  C     . ARG A 1  175  ? -25.834 -68.588  36.950  1.00 135.85 ? 175  ARG A C     1 
ATOM   1330  O  O     . ARG A 1  175  ? -26.445 -67.955  37.822  1.00 135.21 ? 175  ARG A O     1 
ATOM   1331  C  CB    . ARG A 1  175  ? -26.556 -70.980  36.564  1.00 152.39 ? 175  ARG A CB    1 
ATOM   1332  C  CG    . ARG A 1  175  ? -26.574 -71.084  35.029  1.00 158.12 ? 175  ARG A CG    1 
ATOM   1333  C  CD    . ARG A 1  175  ? -27.390 -72.286  34.504  1.00 161.03 ? 175  ARG A CD    1 
ATOM   1334  N  NE    . ARG A 1  175  ? -26.942 -73.542  35.107  1.00 170.74 ? 175  ARG A NE    1 
ATOM   1335  C  CZ    . ARG A 1  175  ? -27.639 -74.250  35.993  1.00 169.60 ? 175  ARG A CZ    1 
ATOM   1336  N  NH1   . ARG A 1  175  ? -28.835 -73.834  36.387  1.00 173.73 ? 175  ARG A NH1   1 
ATOM   1337  N  NH2   . ARG A 1  175  ? -27.134 -75.369  36.497  1.00 148.83 ? 175  ARG A NH2   1 
ATOM   1338  N  N     . LYS A 1  176  ? -25.386 -68.049  35.821  1.00 141.40 ? 176  LYS A N     1 
ATOM   1339  C  CA    . LYS A 1  176  ? -25.622 -66.664  35.440  1.00 130.66 ? 176  LYS A CA    1 
ATOM   1340  C  C     . LYS A 1  176  ? -26.977 -66.531  34.754  1.00 131.97 ? 176  LYS A C     1 
ATOM   1341  O  O     . LYS A 1  176  ? -27.228 -67.202  33.748  1.00 145.09 ? 176  LYS A O     1 
ATOM   1342  C  CB    . LYS A 1  176  ? -24.502 -66.196  34.518  1.00 128.41 ? 176  LYS A CB    1 
ATOM   1343  C  CG    . LYS A 1  176  ? -24.724 -64.835  33.906  1.00 121.91 ? 176  LYS A CG    1 
ATOM   1344  C  CD    . LYS A 1  176  ? -23.538 -64.442  33.043  1.00 110.90 ? 176  LYS A CD    1 
ATOM   1345  C  CE    . LYS A 1  176  ? -23.994 -63.643  31.846  1.00 128.19 ? 176  LYS A CE    1 
ATOM   1346  N  NZ    . LYS A 1  176  ? -23.083 -62.499  31.575  1.00 137.13 ? 176  LYS A NZ    1 
ATOM   1347  N  N     . ASP A 1  177  ? -27.840 -65.652  35.272  1.00 137.70 ? 177  ASP A N     1 
ATOM   1348  C  CA    . ASP A 1  177  ? -29.111 -65.310  34.626  1.00 147.03 ? 177  ASP A CA    1 
ATOM   1349  C  C     . ASP A 1  177  ? -29.155 -63.802  34.439  1.00 143.71 ? 177  ASP A C     1 
ATOM   1350  O  O     . ASP A 1  177  ? -29.364 -63.061  35.406  1.00 145.65 ? 177  ASP A O     1 
ATOM   1351  C  CB    . ASP A 1  177  ? -30.309 -65.784  35.460  1.00 147.39 ? 177  ASP A CB    1 
ATOM   1352  C  CG    . ASP A 1  177  ? -31.660 -65.496  34.789  1.00 154.44 ? 177  ASP A CG    1 
ATOM   1353  O  OD1   . ASP A 1  177  ? -31.678 -64.973  33.653  1.00 156.06 ? 177  ASP A OD1   1 
ATOM   1354  O  OD2   . ASP A 1  177  ? -32.712 -65.790  35.400  1.00 151.12 ? 177  ASP A OD2   1 
ATOM   1355  N  N     . GLY A 1  178  ? -28.989 -63.350  33.198  1.00 141.82 ? 178  GLY A N     1 
ATOM   1356  C  CA    . GLY A 1  178  ? -28.922 -61.924  32.938  1.00 147.76 ? 178  GLY A CA    1 
ATOM   1357  C  C     . GLY A 1  178  ? -27.736 -61.280  33.624  1.00 134.56 ? 178  GLY A C     1 
ATOM   1358  O  O     . GLY A 1  178  ? -26.587 -61.532  33.243  1.00 121.86 ? 178  GLY A O     1 
ATOM   1359  N  N     . LEU A 1  179  ? -28.004 -60.470  34.656  1.00 127.42 ? 179  LEU A N     1 
ATOM   1360  C  CA    . LEU A 1  179  ? -26.958 -59.863  35.469  1.00 103.54 ? 179  LEU A CA    1 
ATOM   1361  C  C     . LEU A 1  179  ? -27.056 -60.308  36.918  1.00 127.25 ? 179  LEU A C     1 
ATOM   1362  O  O     . LEU A 1  179  ? -26.535 -59.628  37.816  1.00 124.00 ? 179  LEU A O     1 
ATOM   1363  C  CB    . LEU A 1  179  ? -27.015 -58.334  35.388  1.00 102.35 ? 179  LEU A CB    1 
ATOM   1364  C  CG    . LEU A 1  179  ? -27.218 -57.761  33.989  1.00 112.08 ? 179  LEU A CG    1 
ATOM   1365  C  CD1   . LEU A 1  179  ? -27.418 -56.254  34.031  1.00 100.36 ? 179  LEU A CD1   1 
ATOM   1366  C  CD2   . LEU A 1  179  ? -26.049 -58.130  33.101  1.00 100.06 ? 179  LEU A CD2   1 
ATOM   1367  N  N     . LYS A 1  180  ? -27.717 -61.440  37.158  1.00 135.94 ? 180  LYS A N     1 
ATOM   1368  C  CA    . LYS A 1  180  ? -27.910 -61.979  38.491  1.00 122.35 ? 180  LYS A CA    1 
ATOM   1369  C  C     . LYS A 1  180  ? -27.206 -63.325  38.566  1.00 121.01 ? 180  LYS A C     1 
ATOM   1370  O  O     . LYS A 1  180  ? -26.944 -63.976  37.543  1.00 125.96 ? 180  LYS A O     1 
ATOM   1371  C  CB    . LYS A 1  180  ? -29.403 -62.147  38.814  1.00 124.20 ? 180  LYS A CB    1 
ATOM   1372  C  CG    . LYS A 1  180  ? -30.276 -61.015  38.289  1.00 142.03 ? 180  LYS A CG    1 
ATOM   1373  C  CD    . LYS A 1  180  ? -30.283 -59.820  39.237  1.00 153.06 ? 180  LYS A CD    1 
ATOM   1374  C  CE    . LYS A 1  180  ? -31.394 -59.938  40.269  1.00 149.38 ? 180  LYS A CE    1 
ATOM   1375  N  NZ    . LYS A 1  180  ? -31.482 -58.709  41.107  1.00 150.08 ? 180  LYS A NZ    1 
ATOM   1376  N  N     . LEU A 1  181  ? -26.897 -63.734  39.788  1.00 125.94 ? 181  LEU A N     1 
ATOM   1377  C  CA    . LEU A 1  181  ? -26.224 -64.996  40.048  1.00 136.66 ? 181  LEU A CA    1 
ATOM   1378  C  C     . LEU A 1  181  ? -27.149 -65.831  40.916  1.00 152.10 ? 181  LEU A C     1 
ATOM   1379  O  O     . LEU A 1  181  ? -27.498 -65.415  42.022  1.00 165.09 ? 181  LEU A O     1 
ATOM   1380  C  CB    . LEU A 1  181  ? -24.863 -64.759  40.715  1.00 134.60 ? 181  LEU A CB    1 
ATOM   1381  C  CG    . LEU A 1  181  ? -23.813 -64.304  39.697  1.00 107.74 ? 181  LEU A CG    1 
ATOM   1382  C  CD1   . LEU A 1  181  ? -22.397 -64.403  40.241  1.00 107.22 ? 181  LEU A CD1   1 
ATOM   1383  C  CD2   . LEU A 1  181  ? -23.948 -65.121  38.414  1.00 120.50 ? 181  LEU A CD2   1 
ATOM   1384  N  N     . VAL A 1  182  ? -27.537 -67.003  40.428  1.00 147.73 ? 182  VAL A N     1 
ATOM   1385  C  CA    . VAL A 1  182  ? -28.519 -67.814  41.136  1.00 146.93 ? 182  VAL A CA    1 
ATOM   1386  C  C     . VAL A 1  182  ? -27.870 -69.147  41.446  1.00 146.69 ? 182  VAL A C     1 
ATOM   1387  O  O     . VAL A 1  182  ? -27.074 -69.657  40.654  1.00 133.03 ? 182  VAL A O     1 
ATOM   1388  C  CB    . VAL A 1  182  ? -29.810 -68.030  40.309  1.00 128.40 ? 182  VAL A CB    1 
ATOM   1389  C  CG1   . VAL A 1  182  ? -30.943 -68.556  41.188  1.00 152.60 ? 182  VAL A CG1   1 
ATOM   1390  C  CG2   . VAL A 1  182  ? -30.217 -66.757  39.578  1.00 125.81 ? 182  VAL A CG2   1 
ATOM   1391  N  N     . GLY A 1  183  ? -28.209 -69.728  42.595  1.00 140.57 ? 183  GLY A N     1 
ATOM   1392  C  CA    . GLY A 1  183  ? -27.578 -70.974  42.961  1.00 143.38 ? 183  GLY A CA    1 
ATOM   1393  C  C     . GLY A 1  183  ? -28.565 -71.965  43.534  1.00 147.99 ? 183  GLY A C     1 
ATOM   1394  O  O     . GLY A 1  183  ? -29.663 -71.610  43.994  1.00 144.53 ? 183  GLY A O     1 
ATOM   1395  N  N     . SER A 1  184  ? -28.117 -73.228  43.535  1.00 157.04 ? 184  SER A N     1 
ATOM   1396  C  CA    . SER A 1  184  ? -28.899 -74.360  44.010  1.00 163.00 ? 184  SER A CA    1 
ATOM   1397  C  C     . SER A 1  184  ? -28.093 -75.159  45.020  1.00 169.28 ? 184  SER A C     1 
ATOM   1398  O  O     . SER A 1  184  ? -26.857 -75.194  44.969  1.00 185.73 ? 184  SER A O     1 
ATOM   1399  C  CB    . SER A 1  184  ? -29.323 -75.298  42.866  1.00 157.00 ? 184  SER A CB    1 
ATOM   1400  O  OG    . SER A 1  184  ? -28.224 -76.029  42.343  1.00 162.32 ? 184  SER A OG    1 
ATOM   1401  N  N     . TRP A 1  185  ? -28.816 -75.835  45.914  1.00 184.59 ? 185  TRP A N     1 
ATOM   1402  C  CA    . TRP A 1  185  ? -28.213 -76.651  46.959  1.00 203.80 ? 185  TRP A CA    1 
ATOM   1403  C  C     . TRP A 1  185  ? -28.814 -78.056  46.941  1.00 194.49 ? 185  TRP A C     1 
ATOM   1404  O  O     . TRP A 1  185  ? -29.503 -78.437  45.987  1.00 176.78 ? 185  TRP A O     1 
ATOM   1405  C  CB    . TRP A 1  185  ? -28.436 -75.993  48.324  1.00 218.66 ? 185  TRP A CB    1 
ATOM   1406  C  CG    . TRP A 1  185  ? -27.536 -74.804  48.617  1.00 210.32 ? 185  TRP A CG    1 
ATOM   1407  C  CD1   . TRP A 1  185  ? -26.377 -74.800  49.344  1.00 208.14 ? 185  TRP A CD1   1 
ATOM   1408  C  CD2   . TRP A 1  185  ? -27.734 -73.450  48.181  1.00 196.72 ? 185  TRP A CD2   1 
ATOM   1409  N  NE1   . TRP A 1  185  ? -25.850 -73.528  49.389  1.00 191.83 ? 185  TRP A NE1   1 
ATOM   1410  C  CE2   . TRP A 1  185  ? -26.667 -72.682  48.687  1.00 181.55 ? 185  TRP A CE2   1 
ATOM   1411  C  CE3   . TRP A 1  185  ? -28.714 -72.812  47.415  1.00 192.47 ? 185  TRP A CE3   1 
ATOM   1412  C  CZ2   . TRP A 1  185  ? -26.555 -71.312  48.451  1.00 157.12 ? 185  TRP A CZ2   1 
ATOM   1413  C  CZ3   . TRP A 1  185  ? -28.593 -71.454  47.179  1.00 170.87 ? 185  TRP A CZ3   1 
ATOM   1414  C  CH2   . TRP A 1  185  ? -27.523 -70.722  47.692  1.00 151.48 ? 185  TRP A CH2   1 
ATOM   1415  N  N     . LYS A 1  186  ? -28.575 -78.824  47.999  1.00 184.93 ? 186  LYS A N     1 
ATOM   1416  C  CA    . LYS A 1  186  ? -28.996 -80.220  48.057  1.00 185.11 ? 186  LYS A CA    1 
ATOM   1417  C  C     . LYS A 1  186  ? -30.102 -80.441  49.094  1.00 188.69 ? 186  LYS A C     1 
ATOM   1418  O  O     . LYS A 1  186  ? -30.480 -81.579  49.394  1.00 170.58 ? 186  LYS A O     1 
ATOM   1419  C  CB    . LYS A 1  186  ? -27.794 -81.134  48.352  1.00 183.30 ? 186  LYS A CB    1 
ATOM   1420  C  CG    . LYS A 1  186  ? -26.500 -80.874  47.548  1.00 189.42 ? 186  LYS A CG    1 
ATOM   1421  C  CD    . LYS A 1  186  ? -26.696 -80.499  46.072  1.00 184.22 ? 186  LYS A CD    1 
ATOM   1422  C  CE    . LYS A 1  186  ? -27.545 -81.505  45.304  1.00 169.93 ? 186  LYS A CE    1 
ATOM   1423  N  NZ    . LYS A 1  186  ? -27.139 -82.899  45.585  1.00 173.07 ? 186  LYS A NZ    1 
ATOM   1424  N  N     . ASP A 1  195  ? -36.792 -85.367  48.142  1.00 228.66 ? 195  ASP A N     1 
ATOM   1425  C  CA    . ASP A 1  195  ? -35.397 -85.086  47.821  1.00 235.79 ? 195  ASP A CA    1 
ATOM   1426  C  C     . ASP A 1  195  ? -35.282 -84.182  46.596  1.00 236.90 ? 195  ASP A C     1 
ATOM   1427  O  O     . ASP A 1  195  ? -35.179 -84.665  45.469  1.00 231.11 ? 195  ASP A O     1 
ATOM   1428  C  CB    . ASP A 1  195  ? -34.622 -86.392  47.599  1.00 238.18 ? 195  ASP A CB    1 
ATOM   1429  C  CG    . ASP A 1  195  ? -33.251 -86.385  48.265  1.00 233.53 ? 195  ASP A CG    1 
ATOM   1430  O  OD1   . ASP A 1  195  ? -32.880 -85.357  48.870  1.00 233.13 ? 195  ASP A OD1   1 
ATOM   1431  O  OD2   . ASP A 1  195  ? -32.543 -87.409  48.185  1.00 230.84 ? 195  ASP A OD2   1 
ATOM   1432  N  N     . GLU A 1  196  ? -35.300 -82.874  46.819  1.00 243.56 ? 196  GLU A N     1 
ATOM   1433  C  CA    . GLU A 1  196  ? -35.327 -81.893  45.745  1.00 241.82 ? 196  GLU A CA    1 
ATOM   1434  C  C     . GLU A 1  196  ? -34.422 -80.727  46.108  1.00 222.89 ? 196  GLU A C     1 
ATOM   1435  O  O     . GLU A 1  196  ? -34.065 -80.553  47.278  1.00 209.27 ? 196  GLU A O     1 
ATOM   1436  C  CB    . GLU A 1  196  ? -36.759 -81.399  45.485  1.00 241.82 ? 196  GLU A CB    1 
ATOM   1437  C  CG    . GLU A 1  196  ? -37.490 -82.144  44.371  1.00 239.82 ? 196  GLU A CG    1 
ATOM   1438  C  CD    . GLU A 1  196  ? -36.742 -82.088  43.045  1.00 229.82 ? 196  GLU A CD    1 
ATOM   1439  O  OE1   . GLU A 1  196  ? -35.874 -82.959  42.800  1.00 225.16 ? 196  GLU A OE1   1 
ATOM   1440  O  OE2   . GLU A 1  196  ? -36.995 -81.155  42.259  1.00 214.13 ? 196  GLU A OE2   1 
ATOM   1441  N  N     . PRO A 1  197  ? -34.021 -79.906  45.114  1.00 218.86 ? 197  PRO A N     1 
ATOM   1442  C  CA    . PRO A 1  197  ? -33.126 -78.783  45.414  1.00 205.18 ? 197  PRO A CA    1 
ATOM   1443  C  C     . PRO A 1  197  ? -33.872 -77.542  45.862  1.00 207.16 ? 197  PRO A C     1 
ATOM   1444  O  O     . PRO A 1  197  ? -35.091 -77.560  46.064  1.00 220.26 ? 197  PRO A O     1 
ATOM   1445  C  CB    . PRO A 1  197  ? -32.412 -78.543  44.081  1.00 179.40 ? 197  PRO A CB    1 
ATOM   1446  C  CG    . PRO A 1  197  ? -33.439 -78.894  43.073  1.00 179.69 ? 197  PRO A CG    1 
ATOM   1447  C  CD    . PRO A 1  197  ? -34.192 -80.075  43.656  1.00 205.94 ? 197  PRO A CD    1 
ATOM   1448  N  N     . GLU A 1  198  ? -33.123 -76.458  46.019  1.00 187.06 ? 198  GLU A N     1 
ATOM   1449  C  CA    . GLU A 1  198  ? -33.665 -75.161  46.384  1.00 186.69 ? 198  GLU A CA    1 
ATOM   1450  C  C     . GLU A 1  198  ? -32.821 -74.133  45.652  1.00 177.15 ? 198  GLU A C     1 
ATOM   1451  O  O     . GLU A 1  198  ? -31.606 -74.302  45.535  1.00 172.74 ? 198  GLU A O     1 
ATOM   1452  C  CB    . GLU A 1  198  ? -33.642 -74.944  47.901  1.00 192.69 ? 198  GLU A CB    1 
ATOM   1453  C  CG    . GLU A 1  198  ? -32.252 -74.821  48.508  1.00 188.44 ? 198  GLU A CG    1 
ATOM   1454  C  CD    . GLU A 1  198  ? -32.273 -74.959  50.016  1.00 208.64 ? 198  GLU A CD    1 
ATOM   1455  O  OE1   . GLU A 1  198  ? -33.374 -74.901  50.603  1.00 219.50 ? 198  GLU A OE1   1 
ATOM   1456  O  OE2   . GLU A 1  198  ? -31.193 -75.135  50.616  1.00 210.78 ? 198  GLU A OE2   1 
ATOM   1457  N  N     . LEU A 1  199  ? -33.465 -73.076  45.161  1.00 170.35 ? 199  LEU A N     1 
ATOM   1458  C  CA    . LEU A 1  199  ? -32.800 -72.061  44.350  1.00 162.99 ? 199  LEU A CA    1 
ATOM   1459  C  C     . LEU A 1  199  ? -32.987 -70.713  45.020  1.00 162.48 ? 199  LEU A C     1 
ATOM   1460  O  O     . LEU A 1  199  ? -34.122 -70.287  45.258  1.00 165.35 ? 199  LEU A O     1 
ATOM   1461  C  CB    . LEU A 1  199  ? -33.376 -72.021  42.930  1.00 157.05 ? 199  LEU A CB    1 
ATOM   1462  C  CG    . LEU A 1  199  ? -33.831 -73.345  42.310  1.00 151.99 ? 199  LEU A CG    1 
ATOM   1463  C  CD1   . LEU A 1  199  ? -34.409 -73.132  40.916  1.00 136.15 ? 199  LEU A CD1   1 
ATOM   1464  C  CD2   . LEU A 1  199  ? -32.665 -74.316  42.248  1.00 152.37 ? 199  LEU A CD2   1 
ATOM   1465  N  N     . ARG A 1  200  ? -31.877 -70.045  45.322  1.00 163.51 ? 200  ARG A N     1 
ATOM   1466  C  CA    . ARG A 1  200  ? -31.921 -68.682  45.833  1.00 146.56 ? 200  ARG A CA    1 
ATOM   1467  C  C     . ARG A 1  200  ? -30.984 -67.799  45.029  1.00 172.57 ? 200  ARG A C     1 
ATOM   1468  O  O     . ARG A 1  200  ? -29.882 -68.227  44.646  1.00 180.18 ? 200  ARG A O     1 
ATOM   1469  C  CB    . ARG A 1  200  ? -31.588 -68.614  47.342  1.00 127.11 ? 200  ARG A CB    1 
ATOM   1470  C  CG    . ARG A 1  200  ? -30.115 -68.502  47.735  1.00 143.11 ? 200  ARG A CG    1 
ATOM   1471  C  CD    . ARG A 1  200  ? -29.940 -68.520  49.259  1.00 151.05 ? 200  ARG A CD    1 
ATOM   1472  N  NE    . ARG A 1  200  ? -30.517 -69.744  49.828  1.00 193.66 ? 200  ARG A NE    1 
ATOM   1473  C  CZ    . ARG A 1  200  ? -29.885 -70.580  50.650  1.00 187.58 ? 200  ARG A CZ    1 
ATOM   1474  N  NH1   . ARG A 1  200  ? -28.634 -70.339  51.017  1.00 199.50 ? 200  ARG A NH1   1 
ATOM   1475  N  NH2   . ARG A 1  200  ? -30.504 -71.668  51.103  1.00 134.43 ? 200  ARG A NH2   1 
ATOM   1476  N  N     . VAL A 1  201  ? -31.489 -66.622  44.660  1.00 166.97 ? 201  VAL A N     1 
ATOM   1477  C  CA    . VAL A 1  201  ? -30.646 -65.630  44.017  1.00 150.79 ? 201  VAL A CA    1 
ATOM   1478  C  C     . VAL A 1  201  ? -29.672 -65.099  45.059  1.00 157.14 ? 201  VAL A C     1 
ATOM   1479  O  O     . VAL A 1  201  ? -30.024 -64.899  46.230  1.00 185.12 ? 201  VAL A O     1 
ATOM   1480  C  CB    . VAL A 1  201  ? -31.487 -64.494  43.409  1.00 146.46 ? 201  VAL A CB    1 
ATOM   1481  C  CG1   . VAL A 1  201  ? -32.139 -64.942  42.120  1.00 146.53 ? 201  VAL A CG1   1 
ATOM   1482  C  CG2   . VAL A 1  201  ? -32.554 -64.046  44.402  1.00 162.25 ? 201  VAL A CG2   1 
ATOM   1483  N  N     . LEU A 1  202  ? -28.435 -64.898  44.643  1.00 136.88 ? 202  LEU A N     1 
ATOM   1484  C  CA    . LEU A 1  202  ? -27.369 -64.423  45.512  1.00 136.11 ? 202  LEU A CA    1 
ATOM   1485  C  C     . LEU A 1  202  ? -27.395 -62.903  45.527  1.00 133.40 ? 202  LEU A C     1 
ATOM   1486  O  O     . LEU A 1  202  ? -27.166 -62.258  44.497  1.00 141.37 ? 202  LEU A O     1 
ATOM   1487  C  CB    . LEU A 1  202  ? -26.019 -64.960  45.050  1.00 131.17 ? 202  LEU A CB    1 
ATOM   1488  C  CG    . LEU A 1  202  ? -25.973 -66.483  45.087  1.00 123.54 ? 202  LEU A CG    1 
ATOM   1489  C  CD1   . LEU A 1  202  ? -24.646 -67.021  44.574  1.00 114.79 ? 202  LEU A CD1   1 
ATOM   1490  C  CD2   . LEU A 1  202  ? -26.245 -66.934  46.514  1.00 128.99 ? 202  LEU A CD2   1 
ATOM   1491  N  N     . SER A 1  203  ? -27.715 -62.330  46.681  1.00 123.99 ? 203  SER A N     1 
ATOM   1492  C  CA    . SER A 1  203  ? -27.694 -60.885  46.782  1.00 137.04 ? 203  SER A CA    1 
ATOM   1493  C  C     . SER A 1  203  ? -26.254 -60.388  46.702  1.00 149.96 ? 203  SER A C     1 
ATOM   1494  O  O     . SER A 1  203  ? -25.315 -61.036  47.176  1.00 146.01 ? 203  SER A O     1 
ATOM   1495  C  CB    . SER A 1  203  ? -28.350 -60.446  48.096  1.00 148.44 ? 203  SER A CB    1 
ATOM   1496  O  OG    . SER A 1  203  ? -27.678 -60.990  49.224  1.00 152.31 ? 203  SER A OG    1 
ATOM   1497  N  N     . THR A 1  204  ? -26.094 -59.217  46.085  1.00 143.56 ? 204  THR A N     1 
ATOM   1498  C  CA    . THR A 1  204  ? -24.770 -58.632  45.905  1.00 122.60 ? 204  THR A CA    1 
ATOM   1499  C  C     . THR A 1  204  ? -24.069 -58.416  47.237  1.00 133.64 ? 204  THR A C     1 
ATOM   1500  O  O     . THR A 1  204  ? -22.857 -58.618  47.341  1.00 151.71 ? 204  THR A O     1 
ATOM   1501  C  CB    . THR A 1  204  ? -24.869 -57.317  45.135  1.00 119.16 ? 204  THR A CB    1 
ATOM   1502  O  OG1   . THR A 1  204  ? -25.990 -56.570  45.615  1.00 159.78 ? 204  THR A OG1   1 
ATOM   1503  C  CG2   . THR A 1  204  ? -25.015 -57.567  43.645  1.00 111.13 ? 204  THR A CG2   1 
ATOM   1504  N  N     . GLU A 1  205  ? -24.821 -58.015  48.265  1.00 127.68 ? 205  GLU A N     1 
ATOM   1505  C  CA    . GLU A 1  205  ? -24.265 -57.793  49.598  1.00 133.89 ? 205  GLU A CA    1 
ATOM   1506  C  C     . GLU A 1  205  ? -23.780 -59.078  50.242  1.00 131.18 ? 205  GLU A C     1 
ATOM   1507  O  O     . GLU A 1  205  ? -22.816 -59.054  51.014  1.00 141.30 ? 205  GLU A O     1 
ATOM   1508  C  CB    . GLU A 1  205  ? -25.323 -57.148  50.500  1.00 130.86 ? 205  GLU A CB    1 
ATOM   1509  C  CG    . GLU A 1  205  ? -26.730 -57.720  50.304  1.00 166.13 ? 205  GLU A CG    1 
ATOM   1510  C  CD    . GLU A 1  205  ? -27.441 -57.163  49.077  1.00 190.89 ? 205  GLU A CD    1 
ATOM   1511  O  OE1   . GLU A 1  205  ? -27.098 -57.546  47.940  1.00 199.87 ? 205  GLU A OE1   1 
ATOM   1512  O  OE2   . GLU A 1  205  ? -28.366 -56.343  49.266  1.00 198.64 ? 205  GLU A OE2   1 
ATOM   1513  N  N     . GLU A 1  206  ? -24.427 -60.196  49.929  1.00 131.07 ? 206  GLU A N     1 
ATOM   1514  C  CA    . GLU A 1  206  ? -23.974 -61.494  50.417  1.00 140.57 ? 206  GLU A CA    1 
ATOM   1515  C  C     . GLU A 1  206  ? -22.603 -61.835  49.853  1.00 141.59 ? 206  GLU A C     1 
ATOM   1516  O  O     . GLU A 1  206  ? -21.675 -62.208  50.588  1.00 139.48 ? 206  GLU A O     1 
ATOM   1517  C  CB    . GLU A 1  206  ? -25.000 -62.556  50.032  1.00 128.07 ? 206  GLU A CB    1 
ATOM   1518  C  CG    . GLU A 1  206  ? -24.880 -63.873  50.769  1.00 144.58 ? 206  GLU A CG    1 
ATOM   1519  C  CD    . GLU A 1  206  ? -25.898 -64.881  50.276  1.00 159.94 ? 206  GLU A CD    1 
ATOM   1520  O  OE1   . GLU A 1  206  ? -26.349 -64.738  49.118  1.00 147.29 ? 206  GLU A OE1   1 
ATOM   1521  O  OE2   . GLU A 1  206  ? -26.254 -65.800  51.043  1.00 173.99 ? 206  GLU A OE2   1 
ATOM   1522  N  N     . ILE A 1  207  ? -22.457 -61.670  48.539  1.00 133.77 ? 207  ILE A N     1 
ATOM   1523  C  CA    . ILE A 1  207  ? -21.172 -61.872  47.881  1.00 138.73 ? 207  ILE A CA    1 
ATOM   1524  C  C     . ILE A 1  207  ? -20.155 -60.873  48.401  1.00 132.27 ? 207  ILE A C     1 
ATOM   1525  O  O     . ILE A 1  207  ? -18.974 -61.191  48.562  1.00 126.79 ? 207  ILE A O     1 
ATOM   1526  C  CB    . ILE A 1  207  ? -21.341 -61.771  46.352  1.00 122.55 ? 207  ILE A CB    1 
ATOM   1527  C  CG1   . ILE A 1  207  ? -22.240 -62.900  45.834  1.00 112.81 ? 207  ILE A CG1   1 
ATOM   1528  C  CG2   . ILE A 1  207  ? -19.978 -61.759  45.643  1.00 107.71 ? 207  ILE A CG2   1 
ATOM   1529  C  CD1   . ILE A 1  207  ? -23.249 -62.480  44.767  1.00 109.73 ? 207  ILE A CD1   1 
ATOM   1530  N  N     . LEU A 1  208  ? -20.593 -59.647  48.657  1.00 126.10 ? 208  LEU A N     1 
ATOM   1531  C  CA    . LEU A 1  208  ? -19.688 -58.630  49.169  1.00 132.70 ? 208  LEU A CA    1 
ATOM   1532  C  C     . LEU A 1  208  ? -19.132 -59.029  50.530  1.00 142.46 ? 208  LEU A C     1 
ATOM   1533  O  O     . LEU A 1  208  ? -17.924 -58.934  50.766  1.00 146.35 ? 208  LEU A O     1 
ATOM   1534  C  CB    . LEU A 1  208  ? -20.411 -57.285  49.245  1.00 122.28 ? 208  LEU A CB    1 
ATOM   1535  C  CG    . LEU A 1  208  ? -19.496 -56.156  49.696  1.00 115.47 ? 208  LEU A CG    1 
ATOM   1536  C  CD1   . LEU A 1  208  ? -18.271 -56.132  48.812  1.00 126.50 ? 208  LEU A CD1   1 
ATOM   1537  C  CD2   . LEU A 1  208  ? -20.221 -54.823  49.690  1.00 110.52 ? 208  LEU A CD2   1 
ATOM   1538  N  N     . ASN A 1  209  ? -20.005 -59.469  51.443  1.00 123.35 ? 209  ASN A N     1 
ATOM   1539  C  CA    . ASN A 1  209  ? -19.560 -59.854  52.782  1.00 129.35 ? 209  ASN A CA    1 
ATOM   1540  C  C     . ASN A 1  209  ? -18.669 -61.093  52.742  1.00 137.44 ? 209  ASN A C     1 
ATOM   1541  O  O     . ASN A 1  209  ? -17.658 -61.170  53.472  1.00 148.02 ? 209  ASN A O     1 
ATOM   1542  C  CB    . ASN A 1  209  ? -20.775 -60.084  53.690  1.00 114.64 ? 209  ASN A CB    1 
ATOM   1543  C  CG    . ASN A 1  209  ? -20.399 -60.683  55.039  1.00 142.37 ? 209  ASN A CG    1 
ATOM   1544  O  OD1   . ASN A 1  209  ? -20.765 -61.818  55.349  1.00 144.24 ? 209  ASN A OD1   1 
ATOM   1545  N  ND2   . ASN A 1  209  ? -19.672 -59.925  55.845  1.00 149.25 ? 209  ASN A ND2   1 
ATOM   1546  N  N     . ILE A 1  210  ? -18.943 -61.993  51.794  1.00 123.88 ? 210  ILE A N     1 
ATOM   1547  C  CA    . ILE A 1  210  ? -18.115 -63.185  51.678  1.00 131.34 ? 210  ILE A CA    1 
ATOM   1548  C  C     . ILE A 1  210  ? -16.748 -62.827  51.097  1.00 135.54 ? 210  ILE A C     1 
ATOM   1549  O  O     . ILE A 1  210  ? -15.710 -63.323  51.557  1.00 139.34 ? 210  ILE A O     1 
ATOM   1550  C  CB    . ILE A 1  210  ? -18.844 -64.256  50.840  1.00 128.34 ? 210  ILE A CB    1 
ATOM   1551  C  CG1   . ILE A 1  210  ? -19.661 -65.195  51.741  1.00 150.04 ? 210  ILE A CG1   1 
ATOM   1552  C  CG2   . ILE A 1  210  ? -17.875 -65.064  49.985  1.00 136.53 ? 210  ILE A CG2   1 
ATOM   1553  C  CD1   . ILE A 1  210  ? -20.799 -64.528  52.525  1.00 169.00 ? 210  ILE A CD1   1 
ATOM   1554  N  N     . PHE A 1  211  ? -16.718 -61.948  50.095  1.00 123.00 ? 211  PHE A N     1 
ATOM   1555  C  CA    . PHE A 1  211  ? -15.446 -61.500  49.540  1.00 128.23 ? 211  PHE A CA    1 
ATOM   1556  C  C     . PHE A 1  211  ? -14.637 -60.753  50.592  1.00 125.67 ? 211  PHE A C     1 
ATOM   1557  O  O     . PHE A 1  211  ? -13.417 -60.931  50.700  1.00 139.02 ? 211  PHE A O     1 
ATOM   1558  C  CB    . PHE A 1  211  ? -15.688 -60.616  48.316  1.00 128.73 ? 211  PHE A CB    1 
ATOM   1559  C  CG    . PHE A 1  211  ? -16.018 -61.396  47.074  1.00 120.16 ? 211  PHE A CG    1 
ATOM   1560  C  CD1   . PHE A 1  211  ? -16.115 -62.770  47.129  1.00 119.74 ? 211  PHE A CD1   1 
ATOM   1561  C  CD2   . PHE A 1  211  ? -16.251 -60.770  45.866  1.00 110.87 ? 211  PHE A CD2   1 
ATOM   1562  C  CE1   . PHE A 1  211  ? -16.429 -63.502  46.016  1.00 120.34 ? 211  PHE A CE1   1 
ATOM   1563  C  CE2   . PHE A 1  211  ? -16.568 -61.515  44.739  1.00 121.20 ? 211  PHE A CE2   1 
ATOM   1564  C  CZ    . PHE A 1  211  ? -16.655 -62.880  44.822  1.00 120.65 ? 211  PHE A CZ    1 
ATOM   1565  N  N     . LYS A 1  212  ? -15.310 -59.909  51.376  1.00 116.61 ? 212  LYS A N     1 
ATOM   1566  C  CA    . LYS A 1  212  ? -14.641 -59.160  52.426  1.00 127.32 ? 212  LYS A CA    1 
ATOM   1567  C  C     . LYS A 1  212  ? -14.068 -60.086  53.486  1.00 129.76 ? 212  LYS A C     1 
ATOM   1568  O  O     . LYS A 1  212  ? -13.186 -59.671  54.250  1.00 131.02 ? 212  LYS A O     1 
ATOM   1569  C  CB    . LYS A 1  212  ? -15.608 -58.153  53.056  1.00 119.27 ? 212  LYS A CB    1 
ATOM   1570  C  CG    . LYS A 1  212  ? -15.085 -56.723  53.083  1.00 132.06 ? 212  LYS A CG    1 
ATOM   1571  C  CD    . LYS A 1  212  ? -16.124 -55.746  53.607  1.00 137.21 ? 212  LYS A CD    1 
ATOM   1572  C  CE    . LYS A 1  212  ? -17.143 -55.390  52.549  1.00 123.72 ? 212  LYS A CE    1 
ATOM   1573  N  NZ    . LYS A 1  212  ? -18.063 -54.328  53.037  1.00 121.68 ? 212  LYS A NZ    1 
ATOM   1574  N  N     . HIS A 1  213  ? -14.519 -61.335  53.531  1.00 129.21 ? 213  HIS A N     1 
ATOM   1575  C  CA    . HIS A 1  213  ? -13.965 -62.261  54.504  1.00 133.03 ? 213  HIS A CA    1 
ATOM   1576  C  C     . HIS A 1  213  ? -12.970 -63.245  53.889  1.00 126.23 ? 213  HIS A C     1 
ATOM   1577  O  O     . HIS A 1  213  ? -12.406 -64.063  54.618  1.00 148.58 ? 213  HIS A O     1 
ATOM   1578  C  CB    . HIS A 1  213  ? -15.095 -63.021  55.210  1.00 143.26 ? 213  HIS A CB    1 
ATOM   1579  C  CG    . HIS A 1  213  ? -15.768 -62.220  56.280  1.00 146.09 ? 213  HIS A CG    1 
ATOM   1580  N  ND1   . HIS A 1  213  ? -16.833 -62.694  57.018  1.00 153.20 ? 213  HIS A ND1   1 
ATOM   1581  C  CD2   . HIS A 1  213  ? -15.532 -60.963  56.725  1.00 148.01 ? 213  HIS A CD2   1 
ATOM   1582  C  CE1   . HIS A 1  213  ? -17.216 -61.768  57.878  1.00 157.31 ? 213  HIS A CE1   1 
ATOM   1583  N  NE2   . HIS A 1  213  ? -16.443 -60.707  57.720  1.00 152.04 ? 213  HIS A NE2   1 
ATOM   1584  N  N     . ILE A 1  214  ? -12.715 -63.169  52.578  1.00 131.86 ? 214  ILE A N     1 
ATOM   1585  C  CA    . ILE A 1  214  ? -11.682 -64.003  51.963  1.00 142.53 ? 214  ILE A CA    1 
ATOM   1586  C  C     . ILE A 1  214  ? -10.315 -63.641  52.529  1.00 153.73 ? 214  ILE A C     1 
ATOM   1587  O  O     . ILE A 1  214  ? -9.931  -62.464  52.561  1.00 144.63 ? 214  ILE A O     1 
ATOM   1588  C  CB    . ILE A 1  214  ? -11.704 -63.844  50.431  1.00 132.70 ? 214  ILE A CB    1 
ATOM   1589  C  CG1   . ILE A 1  214  ? -13.061 -64.246  49.850  1.00 122.25 ? 214  ILE A CG1   1 
ATOM   1590  C  CG2   . ILE A 1  214  ? -10.605 -64.666  49.778  1.00 113.75 ? 214  ILE A CG2   1 
ATOM   1591  C  CD1   . ILE A 1  214  ? -13.137 -64.131  48.341  1.00 108.72 ? 214  ILE A CD1   1 
ATOM   1592  N  N     . SER A 1  215  ? -9.567  -64.655  52.971  1.00 146.82 ? 215  SER A N     1 
ATOM   1593  C  CA    . SER A 1  215  ? -8.258  -64.424  53.575  1.00 140.96 ? 215  SER A CA    1 
ATOM   1594  C  C     . SER A 1  215  ? -7.299  -63.777  52.579  1.00 136.23 ? 215  SER A C     1 
ATOM   1595  O  O     . SER A 1  215  ? -7.450  -63.910  51.362  1.00 149.53 ? 215  SER A O     1 
ATOM   1596  C  CB    . SER A 1  215  ? -7.656  -65.742  54.060  1.00 150.94 ? 215  SER A CB    1 
ATOM   1597  O  OG    . SER A 1  215  ? -6.781  -66.278  53.082  1.00 144.55 ? 215  SER A OG    1 
ATOM   1598  N  N     . VAL A 1  216  ? -6.314  -63.044  53.104  1.00 138.61 ? 216  VAL A N     1 
ATOM   1599  C  CA    . VAL A 1  216  ? -5.415  -62.294  52.228  1.00 144.86 ? 216  VAL A CA    1 
ATOM   1600  C  C     . VAL A 1  216  ? -4.539  -63.245  51.420  1.00 140.20 ? 216  VAL A C     1 
ATOM   1601  O  O     . VAL A 1  216  ? -4.273  -63.015  50.228  1.00 114.88 ? 216  VAL A O     1 
ATOM   1602  C  CB    . VAL A 1  216  ? -4.567  -61.291  53.031  1.00 132.97 ? 216  VAL A CB    1 
ATOM   1603  C  CG1   . VAL A 1  216  ? -3.626  -60.543  52.102  1.00 106.97 ? 216  VAL A CG1   1 
ATOM   1604  C  CG2   . VAL A 1  216  ? -5.461  -60.317  53.794  1.00 125.99 ? 216  VAL A CG2   1 
ATOM   1605  N  N     . LYS A 1  217  ? -4.123  -64.357  52.041  1.00 135.17 ? 217  LYS A N     1 
ATOM   1606  C  CA    . LYS A 1  217  ? -3.372  -65.376  51.315  1.00 134.92 ? 217  LYS A CA    1 
ATOM   1607  C  C     . LYS A 1  217  ? -4.233  -66.032  50.250  1.00 124.63 ? 217  LYS A C     1 
ATOM   1608  O  O     . LYS A 1  217  ? -3.717  -66.467  49.214  1.00 137.19 ? 217  LYS A O     1 
ATOM   1609  C  CB    . LYS A 1  217  ? -2.826  -66.427  52.279  1.00 140.10 ? 217  LYS A CB    1 
ATOM   1610  C  CG    . LYS A 1  217  ? -2.222  -65.867  53.559  1.00 156.55 ? 217  LYS A CG    1 
ATOM   1611  C  CD    . LYS A 1  217  ? -1.871  -66.996  54.532  1.00 170.68 ? 217  LYS A CD    1 
ATOM   1612  C  CE    . LYS A 1  217  ? -0.765  -67.892  53.980  1.00 162.30 ? 217  LYS A CE    1 
ATOM   1613  N  NZ    . LYS A 1  217  ? 0.576   -67.534  54.531  1.00 150.51 ? 217  LYS A NZ    1 
ATOM   1614  N  N     . ASP A 1  218  ? -5.537  -66.130  50.487  1.00 122.34 ? 218  ASP A N     1 
ATOM   1615  C  CA    . ASP A 1  218  ? -6.369  -66.877  49.559  1.00 148.76 ? 218  ASP A CA    1 
ATOM   1616  C  C     . ASP A 1  218  ? -6.551  -66.091  48.267  1.00 138.46 ? 218  ASP A C     1 
ATOM   1617  O  O     . ASP A 1  218  ? -6.365  -66.631  47.170  1.00 145.59 ? 218  ASP A O     1 
ATOM   1618  C  CB    . ASP A 1  218  ? -7.717  -67.201  50.206  1.00 165.61 ? 218  ASP A CB    1 
ATOM   1619  C  CG    . ASP A 1  218  ? -7.667  -68.446  51.077  1.00 169.46 ? 218  ASP A CG    1 
ATOM   1620  O  OD1   . ASP A 1  218  ? -6.806  -69.313  50.819  1.00 167.16 ? 218  ASP A OD1   1 
ATOM   1621  O  OD2   . ASP A 1  218  ? -8.485  -68.558  52.022  1.00 169.60 ? 218  ASP A OD2   1 
ATOM   1622  N  N     . PHE A 1  219  ? -6.879  -64.792  48.367  1.00 116.42 ? 219  PHE A N     1 
ATOM   1623  C  CA    . PHE A 1  219  ? -7.072  -64.043  47.129  1.00 129.86 ? 219  PHE A CA    1 
ATOM   1624  C  C     . PHE A 1  219  ? -5.755  -63.601  46.516  1.00 126.34 ? 219  PHE A C     1 
ATOM   1625  O  O     . PHE A 1  219  ? -5.730  -63.286  45.324  1.00 130.68 ? 219  PHE A O     1 
ATOM   1626  C  CB    . PHE A 1  219  ? -8.016  -62.837  47.307  1.00 133.30 ? 219  PHE A CB    1 
ATOM   1627  C  CG    . PHE A 1  219  ? -7.538  -61.743  48.244  1.00 119.27 ? 219  PHE A CG    1 
ATOM   1628  C  CD1   . PHE A 1  219  ? -6.516  -60.884  47.892  1.00 114.15 ? 219  PHE A CD1   1 
ATOM   1629  C  CD2   . PHE A 1  219  ? -8.162  -61.537  49.456  1.00 141.21 ? 219  PHE A CD2   1 
ATOM   1630  C  CE1   . PHE A 1  219  ? -6.114  -59.870  48.748  1.00 113.33 ? 219  PHE A CE1   1 
ATOM   1631  C  CE2   . PHE A 1  219  ? -7.748  -60.523  50.312  1.00 141.34 ? 219  PHE A CE2   1 
ATOM   1632  C  CZ    . PHE A 1  219  ? -6.725  -59.694  49.951  1.00 104.66 ? 219  PHE A CZ    1 
ATOM   1633  N  N     . THR A 1  220  ? -4.658  -63.589  47.291  1.00 117.55 ? 220  THR A N     1 
ATOM   1634  C  CA    . THR A 1  220  ? -3.367  -63.416  46.633  1.00 118.86 ? 220  THR A CA    1 
ATOM   1635  C  C     . THR A 1  220  ? -2.996  -64.688  45.880  1.00 127.59 ? 220  THR A C     1 
ATOM   1636  O  O     . THR A 1  220  ? -2.355  -64.619  44.822  1.00 118.90 ? 220  THR A O     1 
ATOM   1637  C  CB    . THR A 1  220  ? -2.270  -63.020  47.636  1.00 119.13 ? 220  THR A CB    1 
ATOM   1638  O  OG1   . THR A 1  220  ? -2.423  -63.768  48.846  1.00 174.43 ? 220  THR A OG1   1 
ATOM   1639  C  CG2   . THR A 1  220  ? -2.301  -61.516  47.960  1.00 103.50 ? 220  THR A CG2   1 
ATOM   1640  N  N     . SER A 1  221  ? -3.447  -65.848  46.384  1.00 124.40 ? 221  SER A N     1 
ATOM   1641  C  CA    . SER A 1  221  ? -3.320  -67.089  45.628  1.00 133.54 ? 221  SER A CA    1 
ATOM   1642  C  C     . SER A 1  221  ? -4.240  -67.070  44.418  1.00 122.94 ? 221  SER A C     1 
ATOM   1643  O  O     . SER A 1  221  ? -3.953  -67.717  43.403  1.00 115.18 ? 221  SER A O     1 
ATOM   1644  C  CB    . SER A 1  221  ? -3.636  -68.299  46.518  1.00 133.66 ? 221  SER A CB    1 
ATOM   1645  O  OG    . SER A 1  221  ? -3.155  -68.137  47.843  1.00 149.71 ? 221  SER A OG    1 
ATOM   1646  N  N     . LEU A 1  222  ? -5.349  -66.338  44.513  1.00 121.75 ? 222  LEU A N     1 
ATOM   1647  C  CA    . LEU A 1  222  ? -6.281  -66.183  43.408  1.00 125.38 ? 222  LEU A CA    1 
ATOM   1648  C  C     . LEU A 1  222  ? -5.870  -65.081  42.441  1.00 129.29 ? 222  LEU A C     1 
ATOM   1649  O  O     . LEU A 1  222  ? -6.684  -64.681  41.602  1.00 126.18 ? 222  LEU A O     1 
ATOM   1650  C  CB    . LEU A 1  222  ? -7.692  -65.912  43.941  1.00 129.26 ? 222  LEU A CB    1 
ATOM   1651  C  CG    . LEU A 1  222  ? -8.423  -67.110  44.558  1.00 119.21 ? 222  LEU A CG    1 
ATOM   1652  C  CD1   . LEU A 1  222  ? -9.713  -66.696  45.243  1.00 107.02 ? 222  LEU A CD1   1 
ATOM   1653  C  CD2   . LEU A 1  222  ? -8.715  -68.145  43.481  1.00 109.81 ? 222  LEU A CD2   1 
ATOM   1654  N  N     . GLY A 1  223  ? -4.650  -64.560  42.551  1.00 143.18 ? 223  GLY A N     1 
ATOM   1655  C  CA    . GLY A 1  223  ? -4.160  -63.595  41.591  1.00 138.19 ? 223  GLY A CA    1 
ATOM   1656  C  C     . GLY A 1  223  ? -4.453  -62.152  41.921  1.00 127.65 ? 223  GLY A C     1 
ATOM   1657  O  O     . GLY A 1  223  ? -4.170  -61.277  41.094  1.00 134.96 ? 223  GLY A O     1 
ATOM   1658  N  N     . PHE A 1  224  ? -5.026  -61.875  43.086  1.00 117.90 ? 224  PHE A N     1 
ATOM   1659  C  CA    . PHE A 1  224  ? -5.366  -60.511  43.455  1.00 104.01 ? 224  PHE A CA    1 
ATOM   1660  C  C     . PHE A 1  224  ? -4.254  -59.869  44.283  1.00 109.77 ? 224  PHE A C     1 
ATOM   1661  O  O     . PHE A 1  224  ? -3.250  -60.492  44.641  1.00 139.30 ? 224  PHE A O     1 
ATOM   1662  C  CB    . PHE A 1  224  ? -6.711  -60.481  44.177  1.00 113.38 ? 224  PHE A CB    1 
ATOM   1663  C  CG    . PHE A 1  224  ? -7.873  -60.834  43.286  1.00 128.18 ? 224  PHE A CG    1 
ATOM   1664  C  CD1   . PHE A 1  224  ? -7.691  -60.994  41.925  1.00 155.11 ? 224  PHE A CD1   1 
ATOM   1665  C  CD2   . PHE A 1  224  ? -9.133  -61.021  43.796  1.00 121.16 ? 224  PHE A CD2   1 
ATOM   1666  C  CE1   . PHE A 1  224  ? -8.743  -61.326  41.098  1.00 151.38 ? 224  PHE A CE1   1 
ATOM   1667  C  CE2   . PHE A 1  224  ? -10.191 -61.355  42.957  1.00 131.89 ? 224  PHE A CE2   1 
ATOM   1668  C  CZ    . PHE A 1  224  ? -9.991  -61.506  41.616  1.00 130.75 ? 224  PHE A CZ    1 
ATOM   1669  N  N     . ASN A 1  225  ? -4.445  -58.595  44.600  1.00 106.51 ? 225  ASN A N     1 
ATOM   1670  C  CA    . ASN A 1  225  ? -3.407  -57.792  45.222  1.00 125.11 ? 225  ASN A CA    1 
ATOM   1671  C  C     . ASN A 1  225  ? -3.970  -57.095  46.442  1.00 124.20 ? 225  ASN A C     1 
ATOM   1672  O  O     . ASN A 1  225  ? -4.922  -56.317  46.332  1.00 126.08 ? 225  ASN A O     1 
ATOM   1673  C  CB    . ASN A 1  225  ? -2.846  -56.783  44.228  1.00 118.93 ? 225  ASN A CB    1 
ATOM   1674  C  CG    . ASN A 1  225  ? -1.571  -56.189  44.690  1.00 105.63 ? 225  ASN A CG    1 
ATOM   1675  O  OD1   . ASN A 1  225  ? -1.542  -55.460  45.680  1.00 100.72 ? 225  ASN A OD1   1 
ATOM   1676  N  ND2   . ASN A 1  225  ? -0.485  -56.537  44.016  1.00 122.16 ? 225  ASN A ND2   1 
ATOM   1677  N  N     . GLU A 1  226  ? -3.332  -57.331  47.589  1.00 116.99 ? 226  GLU A N     1 
ATOM   1678  C  CA    . GLU A 1  226  ? -3.862  -56.867  48.865  1.00 121.41 ? 226  GLU A CA    1 
ATOM   1679  C  C     . GLU A 1  226  ? -4.055  -55.358  48.880  1.00 116.63 ? 226  GLU A C     1 
ATOM   1680  O  O     . GLU A 1  226  ? -4.953  -54.847  49.562  1.00 105.39 ? 226  GLU A O     1 
ATOM   1681  C  CB    . GLU A 1  226  ? -2.904  -57.277  49.986  1.00 115.88 ? 226  GLU A CB    1 
ATOM   1682  C  CG    . GLU A 1  226  ? -3.271  -56.734  51.348  1.00 120.67 ? 226  GLU A CG    1 
ATOM   1683  C  CD    . GLU A 1  226  ? -2.163  -56.938  52.352  1.00 153.51 ? 226  GLU A CD    1 
ATOM   1684  O  OE1   . GLU A 1  226  ? -0.983  -56.945  51.938  1.00 147.10 ? 226  GLU A OE1   1 
ATOM   1685  O  OE2   . GLU A 1  226  ? -2.467  -57.067  53.555  1.00 165.68 ? 226  GLU A OE2   1 
ATOM   1686  N  N     . VAL A 1  227  ? -3.229  -54.632  48.132  1.00 98.96  ? 227  VAL A N     1 
ATOM   1687  C  CA    . VAL A 1  227  ? -3.242  -53.184  48.167  1.00 112.06 ? 227  VAL A CA    1 
ATOM   1688  C  C     . VAL A 1  227  ? -3.835  -52.574  46.905  1.00 101.15 ? 227  VAL A C     1 
ATOM   1689  O  O     . VAL A 1  227  ? -4.403  -51.479  46.980  1.00 115.35 ? 227  VAL A O     1 
ATOM   1690  C  CB    . VAL A 1  227  ? -1.826  -52.615  48.432  1.00 113.39 ? 227  VAL A CB    1 
ATOM   1691  C  CG1   . VAL A 1  227  ? -0.944  -52.780  47.226  1.00 98.06  ? 227  VAL A CG1   1 
ATOM   1692  C  CG2   . VAL A 1  227  ? -1.878  -51.132  48.850  1.00 126.37 ? 227  VAL A CG2   1 
ATOM   1693  N  N     . PHE A 1  228  ? -3.763  -53.256  45.758  1.00 103.00 ? 228  PHE A N     1 
ATOM   1694  C  CA    . PHE A 1  228  ? -4.175  -52.640  44.498  1.00 113.22 ? 228  PHE A CA    1 
ATOM   1695  C  C     . PHE A 1  228  ? -5.506  -53.118  43.942  1.00 110.80 ? 228  PHE A C     1 
ATOM   1696  O  O     . PHE A 1  228  ? -6.126  -52.372  43.177  1.00 107.58 ? 228  PHE A O     1 
ATOM   1697  C  CB    . PHE A 1  228  ? -3.108  -52.847  43.425  1.00 116.88 ? 228  PHE A CB    1 
ATOM   1698  C  CG    . PHE A 1  228  ? -1.909  -51.997  43.632  1.00 104.16 ? 228  PHE A CG    1 
ATOM   1699  C  CD1   . PHE A 1  228  ? -1.991  -50.628  43.524  1.00 123.79 ? 228  PHE A CD1   1 
ATOM   1700  C  CD2   . PHE A 1  228  ? -0.692  -52.563  43.898  1.00 93.85  ? 228  PHE A CD2   1 
ATOM   1701  C  CE1   . PHE A 1  228  ? -0.882  -49.844  43.717  1.00 105.04 ? 228  PHE A CE1   1 
ATOM   1702  C  CE2   . PHE A 1  228  ? 0.411   -51.781  44.082  1.00 109.10 ? 228  PHE A CE2   1 
ATOM   1703  C  CZ    . PHE A 1  228  ? 0.315   -50.425  43.991  1.00 97.65  ? 228  PHE A CZ    1 
ATOM   1704  N  N     . SER A 1  229  ? -5.923  -54.354  44.240  1.00 112.49 ? 229  SER A N     1 
ATOM   1705  C  CA    . SER A 1  229  ? -7.161  -54.904  43.699  1.00 110.98 ? 229  SER A CA    1 
ATOM   1706  C  C     . SER A 1  229  ? -7.659  -56.084  44.527  1.00 120.07 ? 229  SER A C     1 
ATOM   1707  O  O     . SER A 1  229  ? -7.502  -57.248  44.139  1.00 116.87 ? 229  SER A O     1 
ATOM   1708  C  CB    . SER A 1  229  ? -6.966  -55.341  42.248  1.00 109.24 ? 229  SER A CB    1 
ATOM   1709  O  OG    . SER A 1  229  ? -6.060  -56.432  42.181  1.00 124.70 ? 229  SER A OG    1 
ATOM   1710  N  N     . ARG A 1  230  ? -8.278  -55.782  45.664  1.00 115.74 ? 230  ARG A N     1 
ATOM   1711  C  CA    . ARG A 1  230  ? -8.936  -56.797  46.455  1.00 99.84  ? 230  ARG A CA    1 
ATOM   1712  C  C     . ARG A 1  230  ? -10.169 -57.293  45.699  1.00 110.03 ? 230  ARG A C     1 
ATOM   1713  O  O     . ARG A 1  230  ? -10.800 -56.529  44.964  1.00 132.72 ? 230  ARG A O     1 
ATOM   1714  C  CB    . ARG A 1  230  ? -9.341  -56.207  47.800  1.00 102.34 ? 230  ARG A CB    1 
ATOM   1715  C  CG    . ARG A 1  230  ? -8.185  -55.681  48.637  1.00 115.71 ? 230  ARG A CG    1 
ATOM   1716  C  CD    . ARG A 1  230  ? -8.685  -55.093  49.952  1.00 137.38 ? 230  ARG A CD    1 
ATOM   1717  N  NE    . ARG A 1  230  ? -7.713  -55.242  51.027  1.00 138.18 ? 230  ARG A NE    1 
ATOM   1718  C  CZ    . ARG A 1  230  ? -7.647  -56.305  51.818  1.00 140.47 ? 230  ARG A CZ    1 
ATOM   1719  N  NH1   . ARG A 1  230  ? -8.500  -57.300  51.648  1.00 139.44 ? 230  ARG A NH1   1 
ATOM   1720  N  NH2   . ARG A 1  230  ? -6.730  -56.368  52.773  1.00 156.70 ? 230  ARG A NH2   1 
ATOM   1721  N  N     . PRO A 1  231  ? -10.565 -58.553  45.893  1.00 115.50 ? 231  PRO A N     1 
ATOM   1722  C  CA    . PRO A 1  231  ? -11.764 -59.050  45.188  1.00 115.68 ? 231  PRO A CA    1 
ATOM   1723  C  C     . PRO A 1  231  ? -13.038 -58.278  45.500  1.00 126.22 ? 231  PRO A C     1 
ATOM   1724  O  O     . PRO A 1  231  ? -13.860 -58.048  44.594  1.00 112.23 ? 231  PRO A O     1 
ATOM   1725  C  CB    . PRO A 1  231  ? -11.860 -60.502  45.673  1.00 118.54 ? 231  PRO A CB    1 
ATOM   1726  C  CG    . PRO A 1  231  ? -11.100 -60.524  46.974  1.00 107.59 ? 231  PRO A CG    1 
ATOM   1727  C  CD    . PRO A 1  231  ? -9.979  -59.567  46.788  1.00 114.25 ? 231  PRO A CD    1 
ATOM   1728  N  N     . GLU A 1  232  ? -13.153 -57.764  46.730  1.00 126.06 ? 232  GLU A N     1 
ATOM   1729  C  CA    . GLU A 1  232  ? -14.343 -57.046  47.165  1.00 104.42 ? 232  GLU A CA    1 
ATOM   1730  C  C     . GLU A 1  232  ? -14.616 -55.816  46.316  1.00 123.73 ? 232  GLU A C     1 
ATOM   1731  O  O     . GLU A 1  232  ? -15.729 -55.286  46.363  1.00 119.41 ? 232  GLU A O     1 
ATOM   1732  C  CB    . GLU A 1  232  ? -14.183 -56.635  48.635  1.00 103.57 ? 232  GLU A CB    1 
ATOM   1733  C  CG    . GLU A 1  232  ? -12.734 -56.284  49.009  1.00 131.50 ? 232  GLU A CG    1 
ATOM   1734  C  CD    . GLU A 1  232  ? -12.510 -56.031  50.499  1.00 152.12 ? 232  GLU A CD    1 
ATOM   1735  O  OE1   . GLU A 1  232  ? -13.172 -55.124  51.051  1.00 157.31 ? 232  GLU A OE1   1 
ATOM   1736  O  OE2   . GLU A 1  232  ? -11.671 -56.726  51.116  1.00 146.13 ? 232  GLU A OE2   1 
ATOM   1737  N  N     . TRP A 1  233  ? -13.629 -55.340  45.558  1.00 124.15 ? 233  TRP A N     1 
ATOM   1738  C  CA    . TRP A 1  233  ? -13.766 -54.110  44.791  1.00 115.92 ? 233  TRP A CA    1 
ATOM   1739  C  C     . TRP A 1  233  ? -14.278 -54.345  43.385  1.00 115.45 ? 233  TRP A C     1 
ATOM   1740  O  O     . TRP A 1  233  ? -14.446 -53.375  42.637  1.00 119.00 ? 233  TRP A O     1 
ATOM   1741  C  CB    . TRP A 1  233  ? -12.437 -53.358  44.718  1.00 128.69 ? 233  TRP A CB    1 
ATOM   1742  C  CG    . TRP A 1  233  ? -11.948 -52.920  46.042  1.00 128.99 ? 233  TRP A CG    1 
ATOM   1743  C  CD1   . TRP A 1  233  ? -12.705 -52.652  47.129  1.00 143.60 ? 233  TRP A CD1   1 
ATOM   1744  C  CD2   . TRP A 1  233  ? -10.588 -52.718  46.438  1.00 124.97 ? 233  TRP A CD2   1 
ATOM   1745  N  NE1   . TRP A 1  233  ? -11.911 -52.289  48.185  1.00 130.04 ? 233  TRP A NE1   1 
ATOM   1746  C  CE2   . TRP A 1  233  ? -10.604 -52.325  47.785  1.00 114.36 ? 233  TRP A CE2   1 
ATOM   1747  C  CE3   . TRP A 1  233  ? -9.359  -52.829  45.785  1.00 125.63 ? 233  TRP A CE3   1 
ATOM   1748  C  CZ2   . TRP A 1  233  ? -9.447  -52.047  48.491  1.00 111.79 ? 233  TRP A CZ2   1 
ATOM   1749  C  CZ3   . TRP A 1  233  ? -8.211  -52.550  46.490  1.00 117.13 ? 233  TRP A CZ3   1 
ATOM   1750  C  CH2   . TRP A 1  233  ? -8.261  -52.164  47.827  1.00 120.03 ? 233  TRP A CH2   1 
ATOM   1751  N  N     . MET A 1  234  ? -14.483 -55.600  42.986  1.00 115.12 ? 234  MET A N     1 
ATOM   1752  C  CA    . MET A 1  234  ? -15.238 -55.803  41.759  1.00 117.32 ? 234  MET A CA    1 
ATOM   1753  C  C     . MET A 1  234  ? -16.714 -55.469  41.941  1.00 125.91 ? 234  MET A C     1 
ATOM   1754  O  O     . MET A 1  234  ? -17.441 -55.364  40.947  1.00 130.69 ? 234  MET A O     1 
ATOM   1755  C  CB    . MET A 1  234  ? -15.059 -57.240  41.271  1.00 101.12 ? 234  MET A CB    1 
ATOM   1756  C  CG    . MET A 1  234  ? -13.684 -57.522  40.712  1.00 99.42  ? 234  MET A CG    1 
ATOM   1757  S  SD    . MET A 1  234  ? -13.401 -59.267  40.402  1.00 114.06 ? 234  MET A SD    1 
ATOM   1758  C  CE    . MET A 1  234  ? -13.714 -59.946  42.025  1.00 128.55 ? 234  MET A CE    1 
ATOM   1759  N  N     . ILE A 1  235  ? -17.157 -55.275  43.182  1.00 118.14 ? 235  ILE A N     1 
ATOM   1760  C  CA    . ILE A 1  235  ? -18.519 -54.859  43.498  1.00 114.90 ? 235  ILE A CA    1 
ATOM   1761  C  C     . ILE A 1  235  ? -18.508 -53.375  43.835  1.00 106.73 ? 235  ILE A C     1 
ATOM   1762  O  O     . ILE A 1  235  ? -17.731 -52.928  44.686  1.00 131.25 ? 235  ILE A O     1 
ATOM   1763  C  CB    . ILE A 1  235  ? -19.086 -55.691  44.660  1.00 121.89 ? 235  ILE A CB    1 
ATOM   1764  C  CG1   . ILE A 1  235  ? -19.287 -57.139  44.213  1.00 102.54 ? 235  ILE A CG1   1 
ATOM   1765  C  CG2   . ILE A 1  235  ? -20.381 -55.085  45.183  1.00 111.43 ? 235  ILE A CG2   1 
ATOM   1766  C  CD1   . ILE A 1  235  ? -19.458 -58.111  45.359  1.00 108.46 ? 235  ILE A CD1   1 
ATOM   1767  N  N     . LEU A 1  236  ? -19.381 -52.617  43.186  1.00 98.86  ? 236  LEU A N     1 
ATOM   1768  C  CA    . LEU A 1  236  ? -19.380 -51.164  43.268  1.00 106.18 ? 236  LEU A CA    1 
ATOM   1769  C  C     . LEU A 1  236  ? -20.252 -50.697  44.430  1.00 119.68 ? 236  LEU A C     1 
ATOM   1770  O  O     . LEU A 1  236  ? -21.441 -51.026  44.501  1.00 118.49 ? 236  LEU A O     1 
ATOM   1771  C  CB    . LEU A 1  236  ? -19.870 -50.585  41.941  1.00 97.04  ? 236  LEU A CB    1 
ATOM   1772  C  CG    . LEU A 1  236  ? -19.022 -51.044  40.749  1.00 95.87  ? 236  LEU A CG    1 
ATOM   1773  C  CD1   . LEU A 1  236  ? -19.452 -50.380  39.450  1.00 94.81  ? 236  LEU A CD1   1 
ATOM   1774  C  CD2   . LEU A 1  236  ? -17.553 -50.753  41.019  1.00 96.96  ? 236  LEU A CD2   1 
ATOM   1775  N  N     . THR A 1  237  ? -19.649 -49.950  45.347  1.00 122.40 ? 237  THR A N     1 
ATOM   1776  C  CA    . THR A 1  237  ? -20.339 -49.304  46.455  1.00 111.48 ? 237  THR A CA    1 
ATOM   1777  C  C     . THR A 1  237  ? -20.377 -47.792  46.307  1.00 120.62 ? 237  THR A C     1 
ATOM   1778  O  O     . THR A 1  237  ? -21.416 -47.175  46.542  1.00 115.28 ? 237  THR A O     1 
ATOM   1779  C  CB    . THR A 1  237  ? -19.652 -49.681  47.772  1.00 115.34 ? 237  THR A CB    1 
ATOM   1780  O  OG1   . THR A 1  237  ? -20.064 -50.998  48.141  1.00 136.72 ? 237  THR A OG1   1 
ATOM   1781  C  CG2   . THR A 1  237  ? -19.985 -48.706  48.898  1.00 109.61 ? 237  THR A CG2   1 
ATOM   1782  N  N     . CYS A 1  238  ? -19.279 -47.191  45.864  1.00 129.80 ? 238  CYS A N     1 
ATOM   1783  C  CA    . CYS A 1  238  ? -19.191 -45.762  45.610  1.00 107.15 ? 238  CYS A CA    1 
ATOM   1784  C  C     . CYS A 1  238  ? -18.690 -45.608  44.188  1.00 113.33 ? 238  CYS A C     1 
ATOM   1785  O  O     . CYS A 1  238  ? -17.681 -46.216  43.816  1.00 115.97 ? 238  CYS A O     1 
ATOM   1786  C  CB    . CYS A 1  238  ? -18.246 -45.072  46.604  1.00 114.90 ? 238  CYS A CB    1 
ATOM   1787  S  SG    . CYS A 1  238  ? -18.024 -43.294  46.386  1.00 120.02 ? 238  CYS A SG    1 
ATOM   1788  N  N     . LEU A 1  239  ? -19.416 -44.826  43.390  1.00 109.38 ? 239  LEU A N     1 
ATOM   1789  C  CA    . LEU A 1  239  ? -19.198 -44.779  41.953  1.00 101.03 ? 239  LEU A CA    1 
ATOM   1790  C  C     . LEU A 1  239  ? -18.580 -43.452  41.543  1.00 106.19 ? 239  LEU A C     1 
ATOM   1791  O  O     . LEU A 1  239  ? -19.186 -42.393  41.771  1.00 116.96 ? 239  LEU A O     1 
ATOM   1792  C  CB    . LEU A 1  239  ? -20.519 -44.991  41.229  1.00 101.60 ? 239  LEU A CB    1 
ATOM   1793  C  CG    . LEU A 1  239  ? -20.441 -44.938  39.715  1.00 102.93 ? 239  LEU A CG    1 
ATOM   1794  C  CD1   . LEU A 1  239  ? -20.056 -46.300  39.221  1.00 110.88 ? 239  LEU A CD1   1 
ATOM   1795  C  CD2   . LEU A 1  239  ? -21.779 -44.496  39.128  1.00 93.46  ? 239  LEU A CD2   1 
ATOM   1796  N  N     . PRO A 1  240  ? -17.412 -43.449  40.910  1.00 98.44  ? 240  PRO A N     1 
ATOM   1797  C  CA    . PRO A 1  240  ? -16.824 -42.175  40.486  1.00 109.79 ? 240  PRO A CA    1 
ATOM   1798  C  C     . PRO A 1  240  ? -17.604 -41.539  39.343  1.00 113.21 ? 240  PRO A C     1 
ATOM   1799  O  O     . PRO A 1  240  ? -18.085 -42.222  38.435  1.00 115.88 ? 240  PRO A O     1 
ATOM   1800  C  CB    . PRO A 1  240  ? -15.407 -42.565  40.046  1.00 90.09  ? 240  PRO A CB    1 
ATOM   1801  C  CG    . PRO A 1  240  ? -15.474 -44.037  39.776  1.00 92.86  ? 240  PRO A CG    1 
ATOM   1802  C  CD    . PRO A 1  240  ? -16.499 -44.584  40.711  1.00 98.06  ? 240  PRO A CD    1 
ATOM   1803  N  N     . VAL A 1  241  ? -17.720 -40.215  39.408  1.00 95.98  ? 241  VAL A N     1 
ATOM   1804  C  CA    . VAL A 1  241  ? -18.399 -39.373  38.430  1.00 89.60  ? 241  VAL A CA    1 
ATOM   1805  C  C     . VAL A 1  241  ? -17.319 -38.624  37.649  1.00 96.26  ? 241  VAL A C     1 
ATOM   1806  O  O     . VAL A 1  241  ? -16.615 -37.768  38.226  1.00 110.08 ? 241  VAL A O     1 
ATOM   1807  C  CB    . VAL A 1  241  ? -19.375 -38.390  39.096  1.00 101.59 ? 241  VAL A CB    1 
ATOM   1808  C  CG1   . VAL A 1  241  ? -19.882 -37.374  38.091  1.00 89.83  ? 241  VAL A CG1   1 
ATOM   1809  C  CG2   . VAL A 1  241  ? -20.530 -39.108  39.758  1.00 91.68  ? 241  VAL A CG2   1 
ATOM   1810  N  N     . PRO A 1  242  ? -17.130 -38.941  36.361  1.00 92.23  ? 242  PRO A N     1 
ATOM   1811  C  CA    . PRO A 1  242  ? -16.109 -38.252  35.568  1.00 86.37  ? 242  PRO A CA    1 
ATOM   1812  C  C     . PRO A 1  242  ? -16.453 -36.792  35.368  1.00 106.30 ? 242  PRO A C     1 
ATOM   1813  O  O     . PRO A 1  242  ? -17.639 -36.409  35.373  1.00 103.25 ? 242  PRO A O     1 
ATOM   1814  C  CB    . PRO A 1  242  ? -16.116 -39.022  34.234  1.00 85.68  ? 242  PRO A CB    1 
ATOM   1815  C  CG    . PRO A 1  242  ? -17.385 -39.788  34.233  1.00 92.10  ? 242  PRO A CG    1 
ATOM   1816  C  CD    . PRO A 1  242  ? -17.718 -40.084  35.644  1.00 103.80 ? 242  PRO A CD    1 
ATOM   1817  N  N     . PRO A 1  243  ? -15.454 -35.926  35.189  1.00 109.89 ? 243  PRO A N     1 
ATOM   1818  C  CA    . PRO A 1  243  ? -15.720 -34.490  35.063  1.00 109.87 ? 243  PRO A CA    1 
ATOM   1819  C  C     . PRO A 1  243  ? -16.203 -34.152  33.666  1.00 100.77 ? 243  PRO A C     1 
ATOM   1820  O  O     . PRO A 1  243  ? -16.126 -34.991  32.758  1.00 102.81 ? 243  PRO A O     1 
ATOM   1821  C  CB    . PRO A 1  243  ? -14.349 -33.861  35.344  1.00 98.60  ? 243  PRO A CB    1 
ATOM   1822  C  CG    . PRO A 1  243  ? -13.400 -34.894  34.870  1.00 99.24  ? 243  PRO A CG    1 
ATOM   1823  C  CD    . PRO A 1  243  ? -14.011 -36.217  35.202  1.00 102.21 ? 243  PRO A CD    1 
ATOM   1824  N  N     . PRO A 1  244  ? -16.638 -32.915  33.439  1.00 101.56 ? 244  PRO A N     1 
ATOM   1825  C  CA    . PRO A 1  244  ? -17.191 -32.534  32.120  1.00 95.37  ? 244  PRO A CA    1 
ATOM   1826  C  C     . PRO A 1  244  ? -16.303 -32.876  30.930  1.00 89.43  ? 244  PRO A C     1 
ATOM   1827  O  O     . PRO A 1  244  ? -16.827 -33.323  29.900  1.00 126.23 ? 244  PRO A O     1 
ATOM   1828  C  CB    . PRO A 1  244  ? -17.423 -31.025  32.267  1.00 93.43  ? 244  PRO A CB    1 
ATOM   1829  C  CG    . PRO A 1  244  ? -17.789 -30.893  33.736  1.00 85.61  ? 244  PRO A CG    1 
ATOM   1830  C  CD    . PRO A 1  244  ? -16.960 -31.904  34.472  1.00 85.62  ? 244  PRO A CD    1 
ATOM   1831  N  N     . PRO A 1  245  ? -14.982 -32.679  30.986  1.00 93.39  ? 245  PRO A N     1 
ATOM   1832  C  CA    . PRO A 1  245  ? -14.163 -32.968  29.787  1.00 90.47  ? 245  PRO A CA    1 
ATOM   1833  C  C     . PRO A 1  245  ? -14.292 -34.391  29.246  1.00 88.97  ? 245  PRO A C     1 
ATOM   1834  O  O     . PRO A 1  245  ? -13.901 -34.632  28.096  1.00 100.83 ? 245  PRO A O     1 
ATOM   1835  C  CB    . PRO A 1  245  ? -12.737 -32.710  30.273  1.00 81.54  ? 245  PRO A CB    1 
ATOM   1836  C  CG    . PRO A 1  245  ? -12.904 -31.731  31.362  1.00 93.83  ? 245  PRO A CG    1 
ATOM   1837  C  CD    . PRO A 1  245  ? -14.155 -32.114  32.065  1.00 89.70  ? 245  PRO A CD    1 
ATOM   1838  N  N     . VAL A 1  246  ? -14.803 -35.335  30.037  1.00 90.56  ? 246  VAL A N     1 
ATOM   1839  C  CA    . VAL A 1  246  ? -15.067 -36.687  29.551  1.00 92.07  ? 246  VAL A CA    1 
ATOM   1840  C  C     . VAL A 1  246  ? -16.443 -36.768  28.894  1.00 94.05  ? 246  VAL A C     1 
ATOM   1841  O  O     . VAL A 1  246  ? -16.635 -37.547  27.955  1.00 101.91 ? 246  VAL A O     1 
ATOM   1842  C  CB    . VAL A 1  246  ? -14.941 -37.697  30.718  1.00 83.05  ? 246  VAL A CB    1 
ATOM   1843  C  CG1   . VAL A 1  246  ? -15.387 -39.084  30.307  1.00 87.47  ? 246  VAL A CG1   1 
ATOM   1844  C  CG2   . VAL A 1  246  ? -13.521 -37.748  31.229  1.00 84.78  ? 246  VAL A CG2   1 
ATOM   1845  N  N     . ARG A 1  247  ? -17.386 -35.934  29.334  1.00 100.20 ? 247  ARG A N     1 
ATOM   1846  C  CA    . ARG A 1  247  ? -18.768 -35.951  28.851  1.00 110.26 ? 247  ARG A CA    1 
ATOM   1847  C  C     . ARG A 1  247  ? -19.208 -34.511  28.642  1.00 101.93 ? 247  ARG A C     1 
ATOM   1848  O  O     . ARG A 1  247  ? -20.095 -34.003  29.340  1.00 118.44 ? 247  ARG A O     1 
ATOM   1849  C  CB    . ARG A 1  247  ? -19.685 -36.662  29.853  1.00 111.76 ? 247  ARG A CB    1 
ATOM   1850  C  CG    . ARG A 1  247  ? -19.371 -36.301  31.304  1.00 88.38  ? 247  ARG A CG    1 
ATOM   1851  C  CD    . ARG A 1  247  ? -20.304 -36.924  32.321  1.00 86.42  ? 247  ARG A CD    1 
ATOM   1852  N  NE    . ARG A 1  247  ? -20.087 -36.310  33.628  1.00 103.37 ? 247  ARG A NE    1 
ATOM   1853  C  CZ    . ARG A 1  247  ? -20.616 -35.142  33.978  1.00 116.09 ? 247  ARG A CZ    1 
ATOM   1854  N  NH1   . ARG A 1  247  ? -21.383 -34.494  33.117  1.00 124.42 ? 247  ARG A NH1   1 
ATOM   1855  N  NH2   . ARG A 1  247  ? -20.388 -34.625  35.179  1.00 88.70  ? 247  ARG A NH2   1 
ATOM   1856  N  N     . PRO A 1  248  ? -18.613 -33.819  27.672  1.00 90.52  ? 248  PRO A N     1 
ATOM   1857  C  CA    . PRO A 1  248  ? -18.809 -32.369  27.590  1.00 98.82  ? 248  PRO A CA    1 
ATOM   1858  C  C     . PRO A 1  248  ? -20.197 -32.003  27.090  1.00 117.93 ? 248  PRO A C     1 
ATOM   1859  O  O     . PRO A 1  248  ? -20.923 -32.805  26.505  1.00 109.61 ? 248  PRO A O     1 
ATOM   1860  C  CB    . PRO A 1  248  ? -17.714 -31.922  26.618  1.00 84.24  ? 248  PRO A CB    1 
ATOM   1861  C  CG    . PRO A 1  248  ? -17.486 -33.099  25.763  1.00 91.02  ? 248  PRO A CG    1 
ATOM   1862  C  CD    . PRO A 1  248  ? -17.698 -34.309  26.625  1.00 83.28  ? 248  PRO A CD    1 
ATOM   1863  N  N     . SER A 1  249  ? -20.528 -30.729  27.283  1.00 139.07 ? 249  SER A N     1 
ATOM   1864  C  CA    . SER A 1  249  ? -21.810 -30.176  26.880  1.00 131.08 ? 249  SER A CA    1 
ATOM   1865  C  C     . SER A 1  249  ? -21.738 -29.785  25.408  1.00 134.43 ? 249  SER A C     1 
ATOM   1866  O  O     . SER A 1  249  ? -20.719 -29.970  24.736  1.00 143.23 ? 249  SER A O     1 
ATOM   1867  C  CB    . SER A 1  249  ? -22.169 -28.967  27.750  1.00 125.01 ? 249  SER A CB    1 
ATOM   1868  O  OG    . SER A 1  249  ? -22.887 -29.334  28.918  1.00 129.75 ? 249  SER A OG    1 
ATOM   1869  N  N     . ILE A 1  250  ? -22.839 -29.265  24.884  1.00 157.67 ? 250  ILE A N     1 
ATOM   1870  C  CA    . ILE A 1  250  ? -22.885 -28.760  23.519  1.00 178.18 ? 250  ILE A CA    1 
ATOM   1871  C  C     . ILE A 1  250  ? -23.571 -27.406  23.590  1.00 195.44 ? 250  ILE A C     1 
ATOM   1872  O  O     . ILE A 1  250  ? -24.459 -27.184  24.419  1.00 200.11 ? 250  ILE A O     1 
ATOM   1873  C  CB    . ILE A 1  250  ? -23.628 -29.722  22.554  1.00 160.46 ? 250  ILE A CB    1 
ATOM   1874  C  CG1   . ILE A 1  250  ? -22.956 -31.089  22.522  1.00 119.73 ? 250  ILE A CG1   1 
ATOM   1875  C  CG2   . ILE A 1  250  ? -23.675 -29.171  21.137  1.00 165.67 ? 250  ILE A CG2   1 
ATOM   1876  C  CD1   . ILE A 1  250  ? -21.643 -31.059  21.802  1.00 124.97 ? 250  ILE A CD1   1 
ATOM   1877  N  N     . SER A 1  251  ? -23.134 -26.483  22.734  1.00 200.79 ? 251  SER A N     1 
ATOM   1878  C  CA    . SER A 1  251  ? -23.745 -25.159  22.626  1.00 205.16 ? 251  SER A CA    1 
ATOM   1879  C  C     . SER A 1  251  ? -23.990 -24.887  21.145  1.00 219.39 ? 251  SER A C     1 
ATOM   1880  O  O     . SER A 1  251  ? -23.214 -24.185  20.488  1.00 216.86 ? 251  SER A O     1 
ATOM   1881  C  CB    . SER A 1  251  ? -22.851 -24.094  23.277  1.00 189.40 ? 251  SER A CB    1 
ATOM   1882  O  OG    . SER A 1  251  ? -22.615 -24.382  24.649  1.00 165.76 ? 251  SER A OG    1 
ATOM   1883  N  N     . PHE A 1  252  ? -25.084 -25.444  20.624  1.00 224.17 ? 252  PHE A N     1 
ATOM   1884  C  CA    . PHE A 1  252  ? -25.467 -25.225  19.236  1.00 231.25 ? 252  PHE A CA    1 
ATOM   1885  C  C     . PHE A 1  252  ? -26.366 -24.013  19.055  1.00 232.77 ? 252  PHE A C     1 
ATOM   1886  O  O     . PHE A 1  252  ? -26.421 -23.452  17.954  1.00 231.44 ? 252  PHE A O     1 
ATOM   1887  C  CB    . PHE A 1  252  ? -26.132 -26.483  18.667  1.00 228.64 ? 252  PHE A CB    1 
ATOM   1888  C  CG    . PHE A 1  252  ? -27.385 -26.896  19.385  1.00 223.81 ? 252  PHE A CG    1 
ATOM   1889  C  CD1   . PHE A 1  252  ? -27.327 -27.759  20.465  1.00 209.18 ? 252  PHE A CD1   1 
ATOM   1890  C  CD2   . PHE A 1  252  ? -28.626 -26.464  18.951  1.00 229.78 ? 252  PHE A CD2   1 
ATOM   1891  C  CE1   . PHE A 1  252  ? -28.479 -28.154  21.120  1.00 196.20 ? 252  PHE A CE1   1 
ATOM   1892  C  CE2   . PHE A 1  252  ? -29.778 -26.861  19.602  1.00 218.90 ? 252  PHE A CE2   1 
ATOM   1893  C  CZ    . PHE A 1  252  ? -29.703 -27.707  20.688  1.00 199.07 ? 252  PHE A CZ    1 
ATOM   1894  N  N     . ASN A 1  253  ? -27.064 -23.595  20.108  1.00 231.16 ? 253  ASN A N     1 
ATOM   1895  C  CA    . ASN A 1  253  ? -27.675 -22.275  20.133  1.00 213.08 ? 253  ASN A CA    1 
ATOM   1896  C  C     . ASN A 1  253  ? -27.178 -21.541  21.371  1.00 211.22 ? 253  ASN A C     1 
ATOM   1897  O  O     . ASN A 1  253  ? -26.060 -21.795  21.835  1.00 207.09 ? 253  ASN A O     1 
ATOM   1898  C  CB    . ASN A 1  253  ? -29.203 -22.379  20.108  1.00 208.63 ? 253  ASN A CB    1 
ATOM   1899  C  CG    . ASN A 1  253  ? -29.722 -23.106  18.868  1.00 212.43 ? 253  ASN A CG    1 
ATOM   1900  O  OD1   . ASN A 1  253  ? -30.759 -23.775  18.908  1.00 210.20 ? 253  ASN A OD1   1 
ATOM   1901  N  ND2   . ASN A 1  253  ? -28.988 -22.990  17.766  1.00 203.81 ? 253  ASN A ND2   1 
ATOM   1902  N  N     . GLU A 1  254  ? -27.972 -20.618  21.913  1.00 209.76 ? 254  GLU A N     1 
ATOM   1903  C  CA    . GLU A 1  254  ? -27.594 -19.945  23.151  1.00 216.68 ? 254  GLU A CA    1 
ATOM   1904  C  C     . GLU A 1  254  ? -28.382 -20.482  24.340  1.00 222.27 ? 254  GLU A C     1 
ATOM   1905  O  O     . GLU A 1  254  ? -27.801 -21.046  25.273  1.00 214.63 ? 254  GLU A O     1 
ATOM   1906  C  CB    . GLU A 1  254  ? -27.774 -18.425  23.025  1.00 206.28 ? 254  GLU A CB    1 
ATOM   1907  C  CG    . GLU A 1  254  ? -27.245 -17.641  24.223  1.00 199.96 ? 254  GLU A CG    1 
ATOM   1908  C  CD    . GLU A 1  254  ? -25.948 -18.206  24.806  1.00 204.91 ? 254  GLU A CD    1 
ATOM   1909  O  OE1   . GLU A 1  254  ? -25.073 -18.676  24.041  1.00 203.68 ? 254  GLU A OE1   1 
ATOM   1910  O  OE2   . GLU A 1  254  ? -25.814 -18.204  26.046  1.00 204.10 ? 254  GLU A OE2   1 
ATOM   1911  N  N     . SER A 1  255  ? -29.705 -20.324  24.320  1.00 226.65 ? 255  SER A N     1 
ATOM   1912  C  CA    . SER A 1  255  ? -30.545 -20.845  25.390  1.00 224.21 ? 255  SER A CA    1 
ATOM   1913  C  C     . SER A 1  255  ? -30.815 -22.330  25.172  1.00 223.48 ? 255  SER A C     1 
ATOM   1914  O  O     . SER A 1  255  ? -31.869 -22.839  25.564  1.00 237.35 ? 255  SER A O     1 
ATOM   1915  C  CB    . SER A 1  255  ? -31.863 -20.070  25.465  1.00 215.40 ? 255  SER A CB    1 
ATOM   1916  O  OG    . SER A 1  255  ? -32.346 -19.763  24.165  1.00 210.46 ? 255  SER A OG    1 
ATOM   1917  N  N     . GLN A 1  256  ? -29.867 -23.036  24.554  1.00 202.87 ? 256  GLN A N     1 
ATOM   1918  C  CA    . GLN A 1  256  ? -29.959 -24.477  24.366  1.00 180.25 ? 256  GLN A CA    1 
ATOM   1919  C  C     . GLN A 1  256  ? -28.572 -25.066  24.564  1.00 145.31 ? 256  GLN A C     1 
ATOM   1920  O  O     . GLN A 1  256  ? -27.594 -24.546  24.021  1.00 136.78 ? 256  GLN A O     1 
ATOM   1921  C  CB    . GLN A 1  256  ? -30.500 -24.817  22.965  1.00 190.44 ? 256  GLN A CB    1 
ATOM   1922  C  CG    . GLN A 1  256  ? -31.823 -24.122  22.629  1.00 188.27 ? 256  GLN A CG    1 
ATOM   1923  C  CD    . GLN A 1  256  ? -32.642 -24.834  21.568  1.00 194.61 ? 256  GLN A CD    1 
ATOM   1924  O  OE1   . GLN A 1  256  ? -32.219 -25.841  21.007  1.00 204.74 ? 256  GLN A OE1   1 
ATOM   1925  N  NE2   . GLN A 1  256  ? -33.821 -24.297  21.278  1.00 194.14 ? 256  GLN A NE2   1 
ATOM   1926  N  N     . ARG A 1  257  ? -28.492 -26.173  25.304  1.00 152.24 ? 257  ARG A N     1 
ATOM   1927  C  CA    . ARG A 1  257  ? -27.226 -26.864  25.544  1.00 140.56 ? 257  ARG A CA    1 
ATOM   1928  C  C     . ARG A 1  257  ? -27.437 -28.366  25.487  1.00 138.53 ? 257  ARG A C     1 
ATOM   1929  O  O     . ARG A 1  257  ? -28.212 -28.917  26.276  1.00 139.67 ? 257  ARG A O     1 
ATOM   1930  C  CB    . ARG A 1  257  ? -26.630 -26.463  26.895  1.00 119.41 ? 257  ARG A CB    1 
ATOM   1931  C  CG    . ARG A 1  257  ? -26.360 -24.976  27.007  1.00 157.28 ? 257  ARG A CG    1 
ATOM   1932  C  CD    . ARG A 1  257  ? -26.033 -24.579  28.418  1.00 171.52 ? 257  ARG A CD    1 
ATOM   1933  N  NE    . ARG A 1  257  ? -24.830 -25.261  28.864  1.00 179.66 ? 257  ARG A NE    1 
ATOM   1934  C  CZ    . ARG A 1  257  ? -23.599 -24.832  28.624  1.00 169.89 ? 257  ARG A CZ    1 
ATOM   1935  N  NH1   . ARG A 1  257  ? -23.391 -23.715  27.941  1.00 178.07 ? 257  ARG A NH1   1 
ATOM   1936  N  NH2   . ARG A 1  257  ? -22.576 -25.530  29.073  1.00 150.85 ? 257  ARG A NH2   1 
ATOM   1937  N  N     . GLY A 1  258  ? -26.725 -29.028  24.583  1.00 126.17 ? 258  GLY A N     1 
ATOM   1938  C  CA    . GLY A 1  258  ? -26.858 -30.465  24.475  1.00 150.18 ? 258  GLY A CA    1 
ATOM   1939  C  C     . GLY A 1  258  ? -25.905 -31.215  25.383  1.00 144.51 ? 258  GLY A C     1 
ATOM   1940  O  O     . GLY A 1  258  ? -24.682 -31.133  25.220  1.00 136.04 ? 258  GLY A O     1 
ATOM   1941  N  N     . GLU A 1  259  ? -26.450 -31.951  26.345  1.00 124.07 ? 259  GLU A N     1 
ATOM   1942  C  CA    . GLU A 1  259  ? -25.611 -32.713  27.254  1.00 108.91 ? 259  GLU A CA    1 
ATOM   1943  C  C     . GLU A 1  259  ? -25.202 -34.037  26.616  1.00 114.87 ? 259  GLU A C     1 
ATOM   1944  O  O     . GLU A 1  259  ? -25.870 -34.547  25.709  1.00 106.92 ? 259  GLU A O     1 
ATOM   1945  C  CB    . GLU A 1  259  ? -26.337 -32.946  28.582  1.00 101.90 ? 259  GLU A CB    1 
ATOM   1946  C  CG    . GLU A 1  259  ? -26.606 -31.682  29.408  1.00 129.41 ? 259  GLU A CG    1 
ATOM   1947  C  CD    . GLU A 1  259  ? -25.345 -31.085  30.016  1.00 147.39 ? 259  GLU A CD    1 
ATOM   1948  O  OE1   . GLU A 1  259  ? -24.281 -31.733  29.944  1.00 149.67 ? 259  GLU A OE1   1 
ATOM   1949  O  OE2   . GLU A 1  259  ? -25.407 -29.957  30.552  1.00 154.35 ? 259  GLU A OE2   1 
ATOM   1950  N  N     . ASP A 1  260  ? -24.057 -34.563  27.063  1.00 105.30 ? 260  ASP A N     1 
ATOM   1951  C  CA    . ASP A 1  260  ? -23.510 -35.781  26.477  1.00 111.65 ? 260  ASP A CA    1 
ATOM   1952  C  C     . ASP A 1  260  ? -24.356 -37.003  26.849  1.00 115.01 ? 260  ASP A C     1 
ATOM   1953  O  O     . ASP A 1  260  ? -25.069 -37.031  27.861  1.00 106.50 ? 260  ASP A O     1 
ATOM   1954  C  CB    . ASP A 1  260  ? -22.052 -35.997  26.903  1.00 130.63 ? 260  ASP A CB    1 
ATOM   1955  C  CG    . ASP A 1  260  ? -21.356 -37.099  26.092  1.00 141.83 ? 260  ASP A CG    1 
ATOM   1956  O  OD1   . ASP A 1  260  ? -21.550 -38.297  26.390  1.00 144.94 ? 260  ASP A OD1   1 
ATOM   1957  O  OD2   . ASP A 1  260  ? -20.621 -36.765  25.139  1.00 139.82 ? 260  ASP A OD2   1 
ATOM   1958  N  N     . ASP A 1  261  ? -24.195 -38.056  26.045  1.00 125.16 ? 261  ASP A N     1 
ATOM   1959  C  CA    . ASP A 1  261  ? -24.872 -39.324  26.306  1.00 113.67 ? 261  ASP A CA    1 
ATOM   1960  C  C     . ASP A 1  261  ? -24.556 -39.838  27.705  1.00 101.36 ? 261  ASP A C     1 
ATOM   1961  O  O     . ASP A 1  261  ? -25.422 -40.403  28.390  1.00 113.85 ? 261  ASP A O     1 
ATOM   1962  C  CB    . ASP A 1  261  ? -24.428 -40.355  25.266  1.00 111.92 ? 261  ASP A CB    1 
ATOM   1963  C  CG    . ASP A 1  261  ? -25.415 -40.521  24.135  1.00 142.88 ? 261  ASP A CG    1 
ATOM   1964  O  OD1   . ASP A 1  261  ? -26.047 -39.522  23.722  1.00 164.88 ? 261  ASP A OD1   1 
ATOM   1965  O  OD2   . ASP A 1  261  ? -25.555 -41.663  23.649  1.00 147.83 ? 261  ASP A OD2   1 
ATOM   1966  N  N     . LEU A 1  262  ? -23.320 -39.624  28.154  1.00 106.67 ? 262  LEU A N     1 
ATOM   1967  C  CA    . LEU A 1  262  ? -22.893 -40.103  29.461  1.00 101.14 ? 262  LEU A CA    1 
ATOM   1968  C  C     . LEU A 1  262  ? -23.534 -39.305  30.583  1.00 100.58 ? 262  LEU A C     1 
ATOM   1969  O  O     . LEU A 1  262  ? -23.821 -39.855  31.652  1.00 99.73  ? 262  LEU A O     1 
ATOM   1970  C  CB    . LEU A 1  262  ? -21.373 -40.029  29.563  1.00 99.88  ? 262  LEU A CB    1 
ATOM   1971  C  CG    . LEU A 1  262  ? -20.629 -41.230  28.989  1.00 98.10  ? 262  LEU A CG    1 
ATOM   1972  C  CD1   . LEU A 1  262  ? -19.191 -41.172  29.429  1.00 85.09  ? 262  LEU A CD1   1 
ATOM   1973  C  CD2   . LEU A 1  262  ? -21.296 -42.512  29.442  1.00 95.42  ? 262  LEU A CD2   1 
ATOM   1974  N  N     . THR A 1  263  ? -23.718 -37.998  30.379  1.00 103.34 ? 263  THR A N     1 
ATOM   1975  C  CA    . THR A 1  263  ? -24.364 -37.173  31.393  1.00 88.55  ? 263  THR A CA    1 
ATOM   1976  C  C     . THR A 1  263  ? -25.797 -37.634  31.612  1.00 91.12  ? 263  THR A C     1 
ATOM   1977  O  O     . THR A 1  263  ? -26.263 -37.743  32.757  1.00 117.91 ? 263  THR A O     1 
ATOM   1978  C  CB    . THR A 1  263  ? -24.322 -35.691  30.995  1.00 103.30 ? 263  THR A CB    1 
ATOM   1979  O  OG1   . THR A 1  263  ? -22.962 -35.236  30.891  1.00 94.84  ? 263  THR A OG1   1 
ATOM   1980  C  CG2   . THR A 1  263  ? -25.045 -34.831  32.016  1.00 89.10  ? 263  THR A CG2   1 
ATOM   1981  N  N     . PHE A 1  264  ? -26.496 -37.970  30.524  1.00 98.72  ? 264  PHE A N     1 
ATOM   1982  C  CA    . PHE A 1  264  ? -27.854 -38.500  30.640  1.00 104.27 ? 264  PHE A CA    1 
ATOM   1983  C  C     . PHE A 1  264  ? -27.847 -39.856  31.331  1.00 97.51  ? 264  PHE A C     1 
ATOM   1984  O  O     . PHE A 1  264  ? -28.656 -40.098  32.235  1.00 103.15 ? 264  PHE A O     1 
ATOM   1985  C  CB    . PHE A 1  264  ? -28.540 -38.584  29.268  1.00 122.90 ? 264  PHE A CB    1 
ATOM   1986  C  CG    . PHE A 1  264  ? -28.937 -37.232  28.710  1.00 143.11 ? 264  PHE A CG    1 
ATOM   1987  C  CD1   . PHE A 1  264  ? -30.044 -36.558  29.208  1.00 144.80 ? 264  PHE A CD1   1 
ATOM   1988  C  CD2   . PHE A 1  264  ? -28.208 -36.640  27.690  1.00 140.90 ? 264  PHE A CD2   1 
ATOM   1989  C  CE1   . PHE A 1  264  ? -30.397 -35.317  28.716  1.00 143.99 ? 264  PHE A CE1   1 
ATOM   1990  C  CE2   . PHE A 1  264  ? -28.565 -35.398  27.195  1.00 132.79 ? 264  PHE A CE2   1 
ATOM   1991  C  CZ    . PHE A 1  264  ? -29.657 -34.740  27.708  1.00 134.21 ? 264  PHE A CZ    1 
ATOM   1992  N  N     . LYS A 1  265  ? -26.947 -40.761  30.917  1.00 105.97 ? 265  LYS A N     1 
ATOM   1993  C  CA    . LYS A 1  265  ? -26.928 -42.088  31.534  1.00 106.74 ? 265  LYS A CA    1 
ATOM   1994  C  C     . LYS A 1  265  ? -26.599 -42.015  33.022  1.00 104.53 ? 265  LYS A C     1 
ATOM   1995  O  O     . LYS A 1  265  ? -27.114 -42.810  33.829  1.00 110.54 ? 265  LYS A O     1 
ATOM   1996  C  CB    . LYS A 1  265  ? -25.936 -42.996  30.800  1.00 90.74  ? 265  LYS A CB    1 
ATOM   1997  C  CG    . LYS A 1  265  ? -25.936 -44.429  31.327  1.00 91.49  ? 265  LYS A CG    1 
ATOM   1998  C  CD    . LYS A 1  265  ? -26.936 -45.251  30.538  1.00 107.56 ? 265  LYS A CD    1 
ATOM   1999  C  CE    . LYS A 1  265  ? -27.804 -46.108  31.448  1.00 115.91 ? 265  LYS A CE    1 
ATOM   2000  N  NZ    . LYS A 1  265  ? -28.986 -46.638  30.714  1.00 127.86 ? 265  LYS A NZ    1 
ATOM   2001  N  N     . LEU A 1  266  ? -25.810 -41.023  33.417  1.00 104.49 ? 266  LEU A N     1 
ATOM   2002  C  CA    . LEU A 1  266  ? -25.592 -40.799  34.838  1.00 108.30 ? 266  LEU A CA    1 
ATOM   2003  C  C     . LEU A 1  266  ? -26.867 -40.315  35.508  1.00 111.91 ? 266  LEU A C     1 
ATOM   2004  O  O     . LEU A 1  266  ? -27.248 -40.829  36.561  1.00 122.87 ? 266  LEU A O     1 
ATOM   2005  C  CB    . LEU A 1  266  ? -24.455 -39.796  35.039  1.00 112.04 ? 266  LEU A CB    1 
ATOM   2006  C  CG    . LEU A 1  266  ? -23.044 -40.382  34.954  1.00 98.37  ? 266  LEU A CG    1 
ATOM   2007  C  CD1   . LEU A 1  266  ? -22.037 -39.269  34.830  1.00 113.57 ? 266  LEU A CD1   1 
ATOM   2008  C  CD2   . LEU A 1  266  ? -22.747 -41.221  36.170  1.00 91.08  ? 266  LEU A CD2   1 
ATOM   2009  N  N     . ALA A 1  267  ? -27.574 -39.369  34.884  1.00 103.09 ? 267  ALA A N     1 
ATOM   2010  C  CA    . ALA A 1  267  ? -28.839 -38.923  35.458  1.00 109.78 ? 267  ALA A CA    1 
ATOM   2011  C  C     . ALA A 1  267  ? -29.822 -40.078  35.635  1.00 109.35 ? 267  ALA A C     1 
ATOM   2012  O  O     . ALA A 1  267  ? -30.615 -40.084  36.584  1.00 120.61 ? 267  ALA A O     1 
ATOM   2013  C  CB    . ALA A 1  267  ? -29.443 -37.826  34.585  1.00 123.16 ? 267  ALA A CB    1 
ATOM   2014  N  N     . ASP A 1  268  ? -29.775 -41.066  34.742  1.00 100.19 ? 268  ASP A N     1 
ATOM   2015  C  CA    . ASP A 1  268  ? -30.560 -42.283  34.927  1.00 116.22 ? 268  ASP A CA    1 
ATOM   2016  C  C     . ASP A 1  268  ? -30.131 -43.028  36.189  1.00 110.65 ? 268  ASP A C     1 
ATOM   2017  O  O     . ASP A 1  268  ? -30.969 -43.399  37.023  1.00 114.45 ? 268  ASP A O     1 
ATOM   2018  C  CB    . ASP A 1  268  ? -30.429 -43.190  33.694  1.00 119.87 ? 268  ASP A CB    1 
ATOM   2019  C  CG    . ASP A 1  268  ? -31.214 -42.676  32.481  1.00 138.18 ? 268  ASP A CG    1 
ATOM   2020  O  OD1   . ASP A 1  268  ? -32.183 -41.897  32.655  1.00 151.98 ? 268  ASP A OD1   1 
ATOM   2021  O  OD2   . ASP A 1  268  ? -30.848 -43.053  31.341  1.00 125.87 ? 268  ASP A OD2   1 
ATOM   2022  N  N     . ILE A 1  269  ? -28.815 -43.234  36.354  1.00 101.72 ? 269  ILE A N     1 
ATOM   2023  C  CA    . ILE A 1  269  ? -28.290 -43.912  37.548  1.00 100.87 ? 269  ILE A CA    1 
ATOM   2024  C  C     . ILE A 1  269  ? -28.689 -43.181  38.826  1.00 110.86 ? 269  ILE A C     1 
ATOM   2025  O  O     . ILE A 1  269  ? -29.018 -43.799  39.850  1.00 114.62 ? 269  ILE A O     1 
ATOM   2026  C  CB    . ILE A 1  269  ? -26.761 -44.063  37.444  1.00 99.89  ? 269  ILE A CB    1 
ATOM   2027  C  CG1   . ILE A 1  269  ? -26.383 -44.971  36.271  1.00 116.69 ? 269  ILE A CG1   1 
ATOM   2028  C  CG2   . ILE A 1  269  ? -26.179 -44.606  38.729  1.00 96.29  ? 269  ILE A CG2   1 
ATOM   2029  C  CD1   . ILE A 1  269  ? -24.982 -44.754  35.739  1.00 103.63 ? 269  ILE A CD1   1 
ATOM   2030  N  N     . LEU A 1  270  ? -28.637 -41.857  38.792  1.00 99.77  ? 270  LEU A N     1 
ATOM   2031  C  CA    . LEU A 1  270  ? -28.988 -41.056  39.954  1.00 105.32 ? 270  LEU A CA    1 
ATOM   2032  C  C     . LEU A 1  270  ? -30.487 -41.136  40.254  1.00 123.86 ? 270  LEU A C     1 
ATOM   2033  O  O     . LEU A 1  270  ? -30.887 -41.250  41.419  1.00 119.62 ? 270  LEU A O     1 
ATOM   2034  C  CB    . LEU A 1  270  ? -28.521 -39.620  39.717  1.00 101.22 ? 270  LEU A CB    1 
ATOM   2035  C  CG    . LEU A 1  270  ? -28.246 -38.783  40.961  1.00 123.87 ? 270  LEU A CG    1 
ATOM   2036  C  CD1   . LEU A 1  270  ? -27.433 -39.596  41.952  1.00 125.27 ? 270  LEU A CD1   1 
ATOM   2037  C  CD2   . LEU A 1  270  ? -27.512 -37.507  40.586  1.00 104.97 ? 270  LEU A CD2   1 
ATOM   2038  N  N     . LYS A 1  271  ? -31.330 -41.095  39.217  1.00 120.26 ? 271  LYS A N     1 
ATOM   2039  C  CA    . LYS A 1  271  ? -32.771 -41.242  39.414  1.00 124.48 ? 271  LYS A CA    1 
ATOM   2040  C  C     . LYS A 1  271  ? -33.104 -42.591  40.045  1.00 121.49 ? 271  LYS A C     1 
ATOM   2041  O  O     . LYS A 1  271  ? -33.860 -42.670  41.030  1.00 129.37 ? 271  LYS A O     1 
ATOM   2042  C  CB    . LYS A 1  271  ? -33.476 -41.085  38.065  1.00 121.46 ? 271  LYS A CB    1 
ATOM   2043  C  CG    . LYS A 1  271  ? -33.602 -39.649  37.569  1.00 110.07 ? 271  LYS A CG    1 
ATOM   2044  C  CD    . LYS A 1  271  ? -34.032 -39.648  36.119  1.00 110.27 ? 271  LYS A CD    1 
ATOM   2045  C  CE    . LYS A 1  271  ? -34.030 -38.261  35.540  1.00 116.82 ? 271  LYS A CE    1 
ATOM   2046  N  NZ    . LYS A 1  271  ? -34.021 -38.346  34.060  1.00 118.54 ? 271  LYS A NZ    1 
ATOM   2047  N  N     . ALA A 1  272  ? -32.514 -43.667  39.511  1.00 110.20 ? 272  ALA A N     1 
ATOM   2048  C  CA    . ALA A 1  272  ? -32.781 -44.990  40.065  1.00 128.32 ? 272  ALA A CA    1 
ATOM   2049  C  C     . ALA A 1  272  ? -32.239 -45.119  41.477  1.00 129.64 ? 272  ALA A C     1 
ATOM   2050  O  O     . ALA A 1  272  ? -32.844 -45.805  42.319  1.00 116.16 ? 272  ALA A O     1 
ATOM   2051  C  CB    . ALA A 1  272  ? -32.164 -46.068  39.173  1.00 128.11 ? 272  ALA A CB    1 
ATOM   2052  N  N     . ASN A 1  273  ? -31.144 -44.412  41.772  1.00 122.71 ? 273  ASN A N     1 
ATOM   2053  C  CA    . ASN A 1  273  ? -30.563 -44.489  43.106  1.00 127.19 ? 273  ASN A CA    1 
ATOM   2054  C  C     . ASN A 1  273  ? -31.464 -43.790  44.125  1.00 131.12 ? 273  ASN A C     1 
ATOM   2055  O  O     . ASN A 1  273  ? -31.705 -44.321  45.216  1.00 129.75 ? 273  ASN A O     1 
ATOM   2056  C  CB    . ASN A 1  273  ? -29.152 -43.883  43.096  1.00 106.14 ? 273  ASN A CB    1 
ATOM   2057  C  CG    . ASN A 1  273  ? -28.342 -44.225  44.354  1.00 122.35 ? 273  ASN A CG    1 
ATOM   2058  O  OD1   . ASN A 1  273  ? -27.846 -45.347  44.500  1.00 111.30 ? 273  ASN A OD1   1 
ATOM   2059  N  ND2   . ASN A 1  273  ? -28.232 -43.271  45.272  1.00 131.06 ? 273  ASN A ND2   1 
ATOM   2060  N  N     . ILE A 1  274  ? -31.978 -42.598  43.786  1.00 121.49 ? 274  ILE A N     1 
ATOM   2061  C  CA    . ILE A 1  274  ? -32.859 -41.896  44.721  1.00 123.57 ? 274  ILE A CA    1 
ATOM   2062  C  C     . ILE A 1  274  ? -34.160 -42.671  44.913  1.00 135.43 ? 274  ILE A C     1 
ATOM   2063  O  O     . ILE A 1  274  ? -34.725 -42.694  46.019  1.00 151.79 ? 274  ILE A O     1 
ATOM   2064  C  CB    . ILE A 1  274  ? -33.125 -40.452  44.244  1.00 105.22 ? 274  ILE A CB    1 
ATOM   2065  C  CG1   . ILE A 1  274  ? -31.818 -39.755  43.889  1.00 105.50 ? 274  ILE A CG1   1 
ATOM   2066  C  CG2   . ILE A 1  274  ? -33.795 -39.635  45.345  1.00 106.59 ? 274  ILE A CG2   1 
ATOM   2067  C  CD1   . ILE A 1  274  ? -31.983 -38.349  43.349  1.00 118.57 ? 274  ILE A CD1   1 
ATOM   2068  N  N     . SER A 1  275  ? -34.638 -43.347  43.861  1.00 122.49 ? 275  SER A N     1 
ATOM   2069  C  CA    . SER A 1  275  ? -35.817 -44.200  44.002  1.00 140.57 ? 275  SER A CA    1 
ATOM   2070  C  C     . SER A 1  275  ? -35.551 -45.330  44.994  1.00 137.70 ? 275  SER A C     1 
ATOM   2071  O  O     . SER A 1  275  ? -36.351 -45.586  45.910  1.00 116.69 ? 275  SER A O     1 
ATOM   2072  C  CB    . SER A 1  275  ? -36.235 -44.748  42.630  1.00 143.27 ? 275  SER A CB    1 
ATOM   2073  O  OG    . SER A 1  275  ? -36.896 -46.008  42.719  1.00 149.83 ? 275  SER A OG    1 
ATOM   2074  N  N     . LEU A 1  276  ? -34.406 -45.999  44.846  1.00 131.56 ? 276  LEU A N     1 
ATOM   2075  C  CA    . LEU A 1  276  ? -34.065 -47.077  45.764  1.00 131.96 ? 276  LEU A CA    1 
ATOM   2076  C  C     . LEU A 1  276  ? -33.831 -46.570  47.181  1.00 138.69 ? 276  LEU A C     1 
ATOM   2077  O  O     . LEU A 1  276  ? -34.047 -47.318  48.146  1.00 132.26 ? 276  LEU A O     1 
ATOM   2078  C  CB    . LEU A 1  276  ? -32.829 -47.812  45.252  1.00 116.49 ? 276  LEU A CB    1 
ATOM   2079  C  CG    . LEU A 1  276  ? -32.541 -49.124  45.971  1.00 113.82 ? 276  LEU A CG    1 
ATOM   2080  C  CD1   . LEU A 1  276  ? -33.703 -50.061  45.761  1.00 134.24 ? 276  LEU A CD1   1 
ATOM   2081  C  CD2   . LEU A 1  276  ? -31.262 -49.743  45.464  1.00 120.51 ? 276  LEU A CD2   1 
ATOM   2082  N  N     . GLU A 1  277  ? -33.477 -45.293  47.330  1.00 152.53 ? 277  GLU A N     1 
ATOM   2083  C  CA    . GLU A 1  277  ? -33.159 -44.755  48.646  1.00 162.25 ? 277  GLU A CA    1 
ATOM   2084  C  C     . GLU A 1  277  ? -34.433 -44.395  49.392  1.00 165.99 ? 277  GLU A C     1 
ATOM   2085  O  O     . GLU A 1  277  ? -34.536 -44.633  50.602  1.00 169.89 ? 277  GLU A O     1 
ATOM   2086  C  CB    . GLU A 1  277  ? -32.242 -43.536  48.525  1.00 163.88 ? 277  GLU A CB    1 
ATOM   2087  C  CG    . GLU A 1  277  ? -31.210 -43.436  49.634  1.00 169.55 ? 277  GLU A CG    1 
ATOM   2088  C  CD    . GLU A 1  277  ? -31.622 -42.467  50.719  1.00 195.42 ? 277  GLU A CD    1 
ATOM   2089  O  OE1   . GLU A 1  277  ? -32.441 -41.567  50.434  1.00 204.09 ? 277  GLU A OE1   1 
ATOM   2090  O  OE2   . GLU A 1  277  ? -31.140 -42.620  51.862  1.00 201.59 ? 277  GLU A OE2   1 
ATOM   2091  N  N     . THR A 1  278  ? -35.424 -43.838  48.685  1.00 163.57 ? 278  THR A N     1 
ATOM   2092  C  CA    . THR A 1  278  ? -36.686 -43.551  49.354  1.00 149.01 ? 278  THR A CA    1 
ATOM   2093  C  C     . THR A 1  278  ? -37.420 -44.855  49.648  1.00 150.73 ? 278  THR A C     1 
ATOM   2094  O  O     . THR A 1  278  ? -37.991 -45.018  50.733  1.00 166.86 ? 278  THR A O     1 
ATOM   2095  C  CB    . THR A 1  278  ? -37.558 -42.605  48.514  1.00 140.61 ? 278  THR A CB    1 
ATOM   2096  O  OG1   . THR A 1  278  ? -38.047 -43.290  47.358  1.00 159.75 ? 278  THR A OG1   1 
ATOM   2097  C  CG2   . THR A 1  278  ? -36.780 -41.356  48.054  1.00 113.03 ? 278  THR A CG2   1 
ATOM   2098  N  N     . LEU A 1  279  ? -37.410 -45.801  48.697  1.00 149.06 ? 279  LEU A N     1 
ATOM   2099  C  CA    . LEU A 1  279  ? -38.098 -47.069  48.938  1.00 142.95 ? 279  LEU A CA    1 
ATOM   2100  C  C     . LEU A 1  279  ? -37.455 -47.835  50.086  1.00 149.20 ? 279  LEU A C     1 
ATOM   2101  O  O     . LEU A 1  279  ? -38.146 -48.549  50.820  1.00 161.84 ? 279  LEU A O     1 
ATOM   2102  C  CB    . LEU A 1  279  ? -38.126 -47.919  47.670  1.00 121.70 ? 279  LEU A CB    1 
ATOM   2103  C  CG    . LEU A 1  279  ? -38.998 -47.313  46.572  1.00 127.15 ? 279  LEU A CG    1 
ATOM   2104  C  CD1   . LEU A 1  279  ? -39.248 -48.321  45.457  1.00 130.87 ? 279  LEU A CD1   1 
ATOM   2105  C  CD2   . LEU A 1  279  ? -40.313 -46.796  47.167  1.00 124.62 ? 279  LEU A CD2   1 
ATOM   2106  N  N     . GLU A 1  280  ? -36.139 -47.703  50.257  1.00 160.46 ? 280  GLU A N     1 
ATOM   2107  C  CA    . GLU A 1  280  ? -35.497 -48.306  51.418  1.00 170.57 ? 280  GLU A CA    1 
ATOM   2108  C  C     . GLU A 1  280  ? -35.883 -47.581  52.700  1.00 169.12 ? 280  GLU A C     1 
ATOM   2109  O  O     . GLU A 1  280  ? -36.231 -48.214  53.703  1.00 174.26 ? 280  GLU A O     1 
ATOM   2110  C  CB    . GLU A 1  280  ? -33.978 -48.294  51.255  1.00 178.64 ? 280  GLU A CB    1 
ATOM   2111  C  CG    . GLU A 1  280  ? -33.292 -49.307  52.138  1.00 187.09 ? 280  GLU A CG    1 
ATOM   2112  C  CD    . GLU A 1  280  ? -32.905 -50.554  51.391  1.00 188.55 ? 280  GLU A CD    1 
ATOM   2113  O  OE1   . GLU A 1  280  ? -32.617 -50.453  50.182  1.00 182.74 ? 280  GLU A OE1   1 
ATOM   2114  O  OE2   . GLU A 1  280  ? -32.931 -51.642  52.002  1.00 186.81 ? 280  GLU A OE2   1 
ATOM   2115  N  N     . HIS A 1  281  ? -35.848 -46.246  52.680  1.00 175.50 ? 281  HIS A N     1 
ATOM   2116  C  CA    . HIS A 1  281  ? -36.101 -45.490  53.902  1.00 183.29 ? 281  HIS A CA    1 
ATOM   2117  C  C     . HIS A 1  281  ? -37.557 -45.556  54.342  1.00 182.59 ? 281  HIS A C     1 
ATOM   2118  O  O     . HIS A 1  281  ? -37.832 -45.400  55.537  1.00 188.41 ? 281  HIS A O     1 
ATOM   2119  C  CB    . HIS A 1  281  ? -35.674 -44.027  53.714  1.00 186.14 ? 281  HIS A CB    1 
ATOM   2120  C  CG    . HIS A 1  281  ? -35.739 -43.202  54.966  1.00 189.03 ? 281  HIS A CG    1 
ATOM   2121  N  ND1   . HIS A 1  281  ? -36.762 -42.311  55.222  1.00 187.60 ? 281  HIS A ND1   1 
ATOM   2122  C  CD2   . HIS A 1  281  ? -34.917 -43.145  56.041  1.00 186.90 ? 281  HIS A CD2   1 
ATOM   2123  C  CE1   . HIS A 1  281  ? -36.562 -41.735  56.394  1.00 187.94 ? 281  HIS A CE1   1 
ATOM   2124  N  NE2   . HIS A 1  281  ? -35.450 -42.226  56.913  1.00 189.91 ? 281  HIS A NE2   1 
ATOM   2125  N  N     . ASN A 1  282  ? -38.481 -45.827  53.424  1.00 177.37 ? 282  ASN A N     1 
ATOM   2126  C  CA    . ASN A 1  282  ? -39.901 -45.860  53.741  1.00 172.05 ? 282  ASN A CA    1 
ATOM   2127  C  C     . ASN A 1  282  ? -40.335 -47.292  54.051  1.00 179.62 ? 282  ASN A C     1 
ATOM   2128  O  O     . ASN A 1  282  ? -39.516 -48.193  54.259  1.00 159.77 ? 282  ASN A O     1 
ATOM   2129  C  CB    . ASN A 1  282  ? -40.725 -45.263  52.597  1.00 157.93 ? 282  ASN A CB    1 
ATOM   2130  C  CG    . ASN A 1  282  ? -40.406 -43.799  52.340  1.00 166.52 ? 282  ASN A CG    1 
ATOM   2131  O  OD1   . ASN A 1  282  ? -39.598 -43.193  53.044  1.00 173.47 ? 282  ASN A OD1   1 
ATOM   2132  N  ND2   . ASN A 1  282  ? -41.052 -43.223  51.330  1.00 160.00 ? 282  ASN A ND2   1 
ATOM   2133  N  N     . GLY A 1  283  ? -41.645 -47.513  54.070  1.00 194.55 ? 283  GLY A N     1 
ATOM   2134  C  CA    . GLY A 1  283  ? -42.174 -48.856  54.032  1.00 202.77 ? 283  GLY A CA    1 
ATOM   2135  C  C     . GLY A 1  283  ? -41.777 -49.514  52.729  1.00 193.65 ? 283  GLY A C     1 
ATOM   2136  O  O     . GLY A 1  283  ? -42.140 -49.037  51.649  1.00 183.60 ? 283  GLY A O     1 
ATOM   2137  N  N     . ALA A 1  284  ? -40.985 -50.574  52.814  1.00 186.50 ? 284  ALA A N     1 
ATOM   2138  C  CA    . ALA A 1  284  ? -40.376 -51.176  51.637  1.00 184.38 ? 284  ALA A CA    1 
ATOM   2139  C  C     . ALA A 1  284  ? -41.078 -52.489  51.334  1.00 178.52 ? 284  ALA A C     1 
ATOM   2140  O  O     . ALA A 1  284  ? -40.784 -53.508  51.979  1.00 180.05 ? 284  ALA A O     1 
ATOM   2141  C  CB    . ALA A 1  284  ? -38.882 -51.409  51.877  1.00 189.82 ? 284  ALA A CB    1 
ATOM   2142  N  N     . PRO A 1  285  ? -42.009 -52.531  50.382  1.00 174.29 ? 285  PRO A N     1 
ATOM   2143  C  CA    . PRO A 1  285  ? -42.449 -53.833  49.863  1.00 162.72 ? 285  PRO A CA    1 
ATOM   2144  C  C     . PRO A 1  285  ? -41.259 -54.551  49.238  1.00 183.78 ? 285  PRO A C     1 
ATOM   2145  O  O     . PRO A 1  285  ? -40.525 -53.981  48.427  1.00 184.17 ? 285  PRO A O     1 
ATOM   2146  C  CB    . PRO A 1  285  ? -43.520 -53.467  48.826  1.00 132.87 ? 285  PRO A CB    1 
ATOM   2147  C  CG    . PRO A 1  285  ? -43.934 -52.059  49.169  1.00 126.81 ? 285  PRO A CG    1 
ATOM   2148  C  CD    . PRO A 1  285  ? -42.709 -51.407  49.730  1.00 154.66 ? 285  PRO A CD    1 
ATOM   2149  N  N     . HIS A 1  286  ? -41.043 -55.799  49.658  1.00 183.69 ? 286  HIS A N     1 
ATOM   2150  C  CA    . HIS A 1  286  ? -39.819 -56.509  49.291  1.00 178.14 ? 286  HIS A CA    1 
ATOM   2151  C  C     . HIS A 1  286  ? -39.634 -56.566  47.776  1.00 176.21 ? 286  HIS A C     1 
ATOM   2152  O  O     . HIS A 1  286  ? -38.593 -56.154  47.250  1.00 198.57 ? 286  HIS A O     1 
ATOM   2153  C  CB    . HIS A 1  286  ? -39.824 -57.922  49.881  1.00 193.57 ? 286  HIS A CB    1 
ATOM   2154  C  CG    . HIS A 1  286  ? -38.456 -58.455  50.178  1.00 213.13 ? 286  HIS A CG    1 
ATOM   2155  N  ND1   . HIS A 1  286  ? -37.326 -57.989  49.540  1.00 214.96 ? 286  HIS A ND1   1 
ATOM   2156  C  CD2   . HIS A 1  286  ? -38.036 -59.429  51.022  1.00 216.46 ? 286  HIS A CD2   1 
ATOM   2157  C  CE1   . HIS A 1  286  ? -36.266 -58.635  49.992  1.00 209.60 ? 286  HIS A CE1   1 
ATOM   2158  N  NE2   . HIS A 1  286  ? -36.670 -59.518  50.889  1.00 217.34 ? 286  HIS A NE2   1 
ATOM   2159  N  N     . HIS A 1  287  ? -40.653 -57.040  47.052  1.00 173.88 ? 287  HIS A N     1 
ATOM   2160  C  CA    . HIS A 1  287  ? -40.544 -57.140  45.598  1.00 179.54 ? 287  HIS A CA    1 
ATOM   2161  C  C     . HIS A 1  287  ? -40.366 -55.771  44.950  1.00 186.33 ? 287  HIS A C     1 
ATOM   2162  O  O     . HIS A 1  287  ? -39.630 -55.636  43.965  1.00 201.24 ? 287  HIS A O     1 
ATOM   2163  C  CB    . HIS A 1  287  ? -41.766 -57.852  45.013  1.00 183.64 ? 287  HIS A CB    1 
ATOM   2164  C  CG    . HIS A 1  287  ? -42.042 -57.487  43.588  1.00 187.14 ? 287  HIS A CG    1 
ATOM   2165  N  ND1   . HIS A 1  287  ? -42.934 -56.500  43.228  1.00 189.49 ? 287  HIS A ND1   1 
ATOM   2166  C  CD2   . HIS A 1  287  ? -41.522 -57.964  42.432  1.00 186.51 ? 287  HIS A CD2   1 
ATOM   2167  C  CE1   . HIS A 1  287  ? -42.956 -56.388  41.911  1.00 186.81 ? 287  HIS A CE1   1 
ATOM   2168  N  NE2   . HIS A 1  287  ? -42.108 -57.266  41.405  1.00 187.21 ? 287  HIS A NE2   1 
ATOM   2169  N  N     . ALA A 1  288  ? -41.034 -54.745  45.482  1.00 184.95 ? 288  ALA A N     1 
ATOM   2170  C  CA    . ALA A 1  288  ? -41.030 -53.432  44.839  1.00 182.30 ? 288  ALA A CA    1 
ATOM   2171  C  C     . ALA A 1  288  ? -39.651 -52.778  44.864  1.00 172.15 ? 288  ALA A C     1 
ATOM   2172  O  O     . ALA A 1  288  ? -39.344 -51.950  43.996  1.00 158.19 ? 288  ALA A O     1 
ATOM   2173  C  CB    . ALA A 1  288  ? -42.065 -52.522  45.504  1.00 189.84 ? 288  ALA A CB    1 
ATOM   2174  N  N     . ILE A 1  289  ? -38.811 -53.136  45.838  1.00 168.94 ? 289  ILE A N     1 
ATOM   2175  C  CA    . ILE A 1  289  ? -37.487 -52.538  45.979  1.00 159.34 ? 289  ILE A CA    1 
ATOM   2176  C  C     . ILE A 1  289  ? -36.443 -53.481  45.390  1.00 150.28 ? 289  ILE A C     1 
ATOM   2177  O  O     . ILE A 1  289  ? -35.419 -53.031  44.863  1.00 158.12 ? 289  ILE A O     1 
ATOM   2178  C  CB    . ILE A 1  289  ? -37.158 -52.189  47.447  1.00 155.64 ? 289  ILE A CB    1 
ATOM   2179  C  CG1   . ILE A 1  289  ? -36.692 -53.423  48.225  1.00 134.07 ? 289  ILE A CG1   1 
ATOM   2180  C  CG2   . ILE A 1  289  ? -38.364 -51.563  48.135  1.00 172.95 ? 289  ILE A CG2   1 
ATOM   2181  C  CD1   . ILE A 1  289  ? -35.924 -53.104  49.506  1.00 118.30 ? 289  ILE A CD1   1 
ATOM   2182  N  N     . GLU A 1  290  ? -36.700 -54.793  45.435  1.00 147.49 ? 290  GLU A N     1 
ATOM   2183  C  CA    . GLU A 1  290  ? -35.731 -55.735  44.889  1.00 163.30 ? 290  GLU A CA    1 
ATOM   2184  C  C     . GLU A 1  290  ? -35.828 -55.853  43.378  1.00 164.80 ? 290  GLU A C     1 
ATOM   2185  O  O     . GLU A 1  290  ? -35.126 -56.681  42.784  1.00 184.00 ? 290  GLU A O     1 
ATOM   2186  C  CB    . GLU A 1  290  ? -35.884 -57.116  45.545  1.00 181.75 ? 290  GLU A CB    1 
ATOM   2187  C  CG    . GLU A 1  290  ? -37.100 -57.933  45.115  1.00 200.90 ? 290  GLU A CG    1 
ATOM   2188  C  CD    . GLU A 1  290  ? -37.428 -59.046  46.104  1.00 211.47 ? 290  GLU A CD    1 
ATOM   2189  O  OE1   . GLU A 1  290  ? -36.499 -59.494  46.811  1.00 206.68 ? 290  GLU A OE1   1 
ATOM   2190  O  OE2   . GLU A 1  290  ? -38.600 -59.481  46.170  1.00 210.50 ? 290  GLU A OE2   1 
ATOM   2191  N  N     . GLU A 1  291  ? -36.672 -55.034  42.745  1.00 141.95 ? 291  GLU A N     1 
ATOM   2192  C  CA    . GLU A 1  291  ? -36.587 -54.808  41.313  1.00 150.94 ? 291  GLU A CA    1 
ATOM   2193  C  C     . GLU A 1  291  ? -36.236 -53.375  40.932  1.00 149.06 ? 291  GLU A C     1 
ATOM   2194  O  O     . GLU A 1  291  ? -35.841 -53.148  39.784  1.00 161.27 ? 291  GLU A O     1 
ATOM   2195  C  CB    . GLU A 1  291  ? -37.899 -55.196  40.613  1.00 157.95 ? 291  GLU A CB    1 
ATOM   2196  C  CG    . GLU A 1  291  ? -39.053 -54.255  40.863  1.00 162.70 ? 291  GLU A CG    1 
ATOM   2197  C  CD    . GLU A 1  291  ? -40.111 -54.371  39.793  1.00 171.52 ? 291  GLU A CD    1 
ATOM   2198  O  OE1   . GLU A 1  291  ? -39.750 -54.726  38.650  1.00 162.57 ? 291  GLU A OE1   1 
ATOM   2199  O  OE2   . GLU A 1  291  ? -41.292 -54.093  40.084  1.00 185.09 ? 291  GLU A OE2   1 
ATOM   2200  N  N     . ALA A 1  292  ? -36.375 -52.403  41.843  1.00 133.46 ? 292  ALA A N     1 
ATOM   2201  C  CA    . ALA A 1  292  ? -35.692 -51.119  41.666  1.00 136.46 ? 292  ALA A CA    1 
ATOM   2202  C  C     . ALA A 1  292  ? -34.180 -51.251  41.829  1.00 130.92 ? 292  ALA A C     1 
ATOM   2203  O  O     . ALA A 1  292  ? -33.412 -50.508  41.196  1.00 125.96 ? 292  ALA A O     1 
ATOM   2204  C  CB    . ALA A 1  292  ? -36.245 -50.080  42.641  1.00 130.33 ? 292  ALA A CB    1 
ATOM   2205  N  N     . GLU A 1  293  ? -33.737 -52.239  42.608  1.00 129.85 ? 293  GLU A N     1 
ATOM   2206  C  CA    . GLU A 1  293  ? -32.321 -52.584  42.630  1.00 121.79 ? 293  GLU A CA    1 
ATOM   2207  C  C     . GLU A 1  293  ? -31.891 -53.202  41.306  1.00 128.53 ? 293  GLU A C     1 
ATOM   2208  O  O     . GLU A 1  293  ? -30.817 -52.880  40.788  1.00 118.89 ? 293  GLU A O     1 
ATOM   2209  C  CB    . GLU A 1  293  ? -32.041 -53.550  43.785  1.00 122.84 ? 293  GLU A CB    1 
ATOM   2210  C  CG    . GLU A 1  293  ? -30.702 -54.270  43.685  1.00 135.60 ? 293  GLU A CG    1 
ATOM   2211  C  CD    . GLU A 1  293  ? -30.289 -54.921  44.992  1.00 157.24 ? 293  GLU A CD    1 
ATOM   2212  O  OE1   . GLU A 1  293  ? -31.188 -55.276  45.787  1.00 161.43 ? 293  GLU A OE1   1 
ATOM   2213  O  OE2   . GLU A 1  293  ? -29.067 -55.059  45.231  1.00 138.14 ? 293  GLU A OE2   1 
ATOM   2214  N  N     . SER A 1  294  ? -32.706 -54.094  40.743  1.00 145.76 ? 294  SER A N     1 
ATOM   2215  C  CA    . SER A 1  294  ? -32.343 -54.682  39.459  1.00 140.80 ? 294  SER A CA    1 
ATOM   2216  C  C     . SER A 1  294  ? -32.218 -53.606  38.388  1.00 125.20 ? 294  SER A C     1 
ATOM   2217  O  O     . SER A 1  294  ? -31.398 -53.731  37.467  1.00 132.70 ? 294  SER A O     1 
ATOM   2218  C  CB    . SER A 1  294  ? -33.371 -55.743  39.052  1.00 151.38 ? 294  SER A CB    1 
ATOM   2219  O  OG    . SER A 1  294  ? -33.394 -56.846  39.954  1.00 161.17 ? 294  SER A OG    1 
ATOM   2220  N  N     . LEU A 1  295  ? -32.951 -52.499  38.550  1.00 114.41 ? 295  LEU A N     1 
ATOM   2221  C  CA    . LEU A 1  295  ? -32.855 -51.399  37.597  1.00 134.00 ? 295  LEU A CA    1 
ATOM   2222  C  C     . LEU A 1  295  ? -31.605 -50.563  37.846  1.00 138.58 ? 295  LEU A C     1 
ATOM   2223  O  O     . LEU A 1  295  ? -30.966 -50.093  36.894  1.00 117.56 ? 295  LEU A O     1 
ATOM   2224  C  CB    . LEU A 1  295  ? -34.105 -50.518  37.681  1.00 105.29 ? 295  LEU A CB    1 
ATOM   2225  C  CG    . LEU A 1  295  ? -33.955 -49.092  37.134  1.00 104.03 ? 295  LEU A CG    1 
ATOM   2226  C  CD1   . LEU A 1  295  ? -33.804 -49.112  35.620  1.00 102.91 ? 295  LEU A CD1   1 
ATOM   2227  C  CD2   . LEU A 1  295  ? -35.057 -48.162  37.557  1.00 104.98 ? 295  LEU A CD2   1 
ATOM   2228  N  N     . LEU A 1  296  ? -31.237 -50.351  39.114  1.00 140.19 ? 296  LEU A N     1 
ATOM   2229  C  CA    . LEU A 1  296  ? -29.984 -49.642  39.373  1.00 119.37 ? 296  LEU A CA    1 
ATOM   2230  C  C     . LEU A 1  296  ? -28.795 -50.425  38.830  1.00 112.54 ? 296  LEU A C     1 
ATOM   2231  O  O     . LEU A 1  296  ? -27.894 -49.859  38.197  1.00 120.53 ? 296  LEU A O     1 
ATOM   2232  C  CB    . LEU A 1  296  ? -29.810 -49.388  40.867  1.00 114.30 ? 296  LEU A CB    1 
ATOM   2233  C  CG    . LEU A 1  296  ? -28.513 -48.679  41.257  1.00 101.73 ? 296  LEU A CG    1 
ATOM   2234  C  CD1   . LEU A 1  296  ? -28.563 -47.200  40.905  1.00 100.83 ? 296  LEU A CD1   1 
ATOM   2235  C  CD2   . LEU A 1  296  ? -28.246 -48.876  42.730  1.00 102.75 ? 296  LEU A CD2   1 
ATOM   2236  N  N     . GLN A 1  297  ? -28.806 -51.745  39.022  1.00 109.86 ? 297  GLN A N     1 
ATOM   2237  C  CA    . GLN A 1  297  ? -27.752 -52.579  38.465  1.00 104.56 ? 297  GLN A CA    1 
ATOM   2238  C  C     . GLN A 1  297  ? -27.748 -52.480  36.957  1.00 110.25 ? 297  GLN A C     1 
ATOM   2239  O  O     . GLN A 1  297  ? -26.683 -52.433  36.330  1.00 111.98 ? 297  GLN A O     1 
ATOM   2240  C  CB    . GLN A 1  297  ? -27.929 -54.029  38.895  1.00 114.16 ? 297  GLN A CB    1 
ATOM   2241  C  CG    . GLN A 1  297  ? -27.050 -54.976  38.111  1.00 109.68 ? 297  GLN A CG    1 
ATOM   2242  C  CD    . GLN A 1  297  ? -25.677 -55.092  38.694  1.00 101.21 ? 297  GLN A CD    1 
ATOM   2243  O  OE1   . GLN A 1  297  ? -25.359 -56.053  39.389  1.00 122.71 ? 297  GLN A OE1   1 
ATOM   2244  N  NE2   . GLN A 1  297  ? -24.848 -54.106  38.418  1.00 99.76  ? 297  GLN A NE2   1 
ATOM   2245  N  N     . PHE A 1  298  ? -28.937 -52.424  36.358  1.00 100.64 ? 298  PHE A N     1 
ATOM   2246  C  CA    . PHE A 1  298  ? -29.010 -52.319  34.909  1.00 117.47 ? 298  PHE A CA    1 
ATOM   2247  C  C     . PHE A 1  298  ? -28.398 -51.012  34.408  1.00 120.05 ? 298  PHE A C     1 
ATOM   2248  O  O     . PHE A 1  298  ? -27.678 -51.002  33.400  1.00 96.97  ? 298  PHE A O     1 
ATOM   2249  C  CB    . PHE A 1  298  ? -30.470 -52.436  34.456  1.00 116.72 ? 298  PHE A CB    1 
ATOM   2250  C  CG    . PHE A 1  298  ? -30.679 -52.105  33.004  1.00 103.43 ? 298  PHE A CG    1 
ATOM   2251  C  CD1   . PHE A 1  298  ? -30.501 -53.055  32.017  1.00 108.95 ? 298  PHE A CD1   1 
ATOM   2252  C  CD2   . PHE A 1  298  ? -31.039 -50.822  32.627  1.00 104.72 ? 298  PHE A CD2   1 
ATOM   2253  C  CE1   . PHE A 1  298  ? -30.680 -52.722  30.682  1.00 111.38 ? 298  PHE A CE1   1 
ATOM   2254  C  CE2   . PHE A 1  298  ? -31.211 -50.489  31.298  1.00 98.64  ? 298  PHE A CE2   1 
ATOM   2255  C  CZ    . PHE A 1  298  ? -31.034 -51.436  30.328  1.00 98.50  ? 298  PHE A CZ    1 
ATOM   2256  N  N     . HIS A 1  299  ? -28.638 -49.903  35.113  1.00 115.19 ? 299  HIS A N     1 
ATOM   2257  C  CA    . HIS A 1  299  ? -28.136 -48.616  34.633  1.00 114.15 ? 299  HIS A CA    1 
ATOM   2258  C  C     . HIS A 1  299  ? -26.630 -48.494  34.822  1.00 114.62 ? 299  HIS A C     1 
ATOM   2259  O  O     . HIS A 1  299  ? -25.926 -47.992  33.935  1.00 129.96 ? 299  HIS A O     1 
ATOM   2260  C  CB    . HIS A 1  299  ? -28.865 -47.468  35.333  1.00 122.59 ? 299  HIS A CB    1 
ATOM   2261  C  CG    . HIS A 1  299  ? -30.167 -47.101  34.692  1.00 108.10 ? 299  HIS A CG    1 
ATOM   2262  N  ND1   . HIS A 1  299  ? -30.354 -47.134  33.328  1.00 108.66 ? 299  HIS A ND1   1 
ATOM   2263  C  CD2   . HIS A 1  299  ? -31.346 -46.698  35.225  1.00 116.03 ? 299  HIS A CD2   1 
ATOM   2264  C  CE1   . HIS A 1  299  ? -31.589 -46.763  33.046  1.00 120.47 ? 299  HIS A CE1   1 
ATOM   2265  N  NE2   . HIS A 1  299  ? -32.214 -46.497  34.179  1.00 123.76 ? 299  HIS A NE2   1 
ATOM   2266  N  N     . VAL A 1  300  ? -26.119 -48.930  35.976  1.00 113.32 ? 300  VAL A N     1 
ATOM   2267  C  CA    . VAL A 1  300  ? -24.674 -48.906  36.190  1.00 102.55 ? 300  VAL A CA    1 
ATOM   2268  C  C     . VAL A 1  300  ? -23.978 -49.866  35.231  1.00 102.90 ? 300  VAL A C     1 
ATOM   2269  O  O     . VAL A 1  300  ? -22.857 -49.605  34.788  1.00 118.02 ? 300  VAL A O     1 
ATOM   2270  C  CB    . VAL A 1  300  ? -24.338 -49.218  37.666  1.00 98.28  ? 300  VAL A CB    1 
ATOM   2271  C  CG1   . VAL A 1  300  ? -22.840 -49.238  37.888  1.00 95.26  ? 300  VAL A CG1   1 
ATOM   2272  C  CG2   . VAL A 1  300  ? -24.988 -48.203  38.606  1.00 99.19  ? 300  VAL A CG2   1 
ATOM   2273  N  N     . ALA A 1  301  ? -24.640 -50.959  34.851  1.00 115.52 ? 301  ALA A N     1 
ATOM   2274  C  CA    . ALA A 1  301  ? -24.023 -51.901  33.920  1.00 117.80 ? 301  ALA A CA    1 
ATOM   2275  C  C     . ALA A 1  301  ? -23.964 -51.315  32.514  1.00 111.85 ? 301  ALA A C     1 
ATOM   2276  O  O     . ALA A 1  301  ? -22.891 -51.243  31.902  1.00 129.73 ? 301  ALA A O     1 
ATOM   2277  C  CB    . ALA A 1  301  ? -24.774 -53.234  33.928  1.00 96.27  ? 301  ALA A CB    1 
ATOM   2278  N  N     . THR A 1  302  ? -25.106 -50.874  31.991  1.00 98.04  ? 302  THR A N     1 
ATOM   2279  C  CA    . THR A 1  302  ? -25.165 -50.347  30.633  1.00 111.12 ? 302  THR A CA    1 
ATOM   2280  C  C     . THR A 1  302  ? -24.500 -48.982  30.515  1.00 113.46 ? 302  THR A C     1 
ATOM   2281  O  O     . THR A 1  302  ? -24.312 -48.495  29.396  1.00 120.77 ? 302  THR A O     1 
ATOM   2282  C  CB    . THR A 1  302  ? -26.626 -50.248  30.154  1.00 120.48 ? 302  THR A CB    1 
ATOM   2283  O  OG1   . THR A 1  302  ? -27.357 -49.313  30.965  1.00 115.26 ? 302  THR A OG1   1 
ATOM   2284  C  CG2   . THR A 1  302  ? -27.309 -51.605  30.223  1.00 98.20  ? 302  THR A CG2   1 
ATOM   2285  N  N     . TYR A 1  303  ? -24.125 -48.364  31.637  1.00 112.93 ? 303  TYR A N     1 
ATOM   2286  C  CA    . TYR A 1  303  ? -23.352 -47.128  31.575  1.00 98.24  ? 303  TYR A CA    1 
ATOM   2287  C  C     . TYR A 1  303  ? -21.900 -47.408  31.226  1.00 94.16  ? 303  TYR A C     1 
ATOM   2288  O  O     . TYR A 1  303  ? -21.253 -46.594  30.554  1.00 107.13 ? 303  TYR A O     1 
ATOM   2289  C  CB    . TYR A 1  303  ? -23.483 -46.380  32.908  1.00 117.18 ? 303  TYR A CB    1 
ATOM   2290  C  CG    . TYR A 1  303  ? -22.326 -45.480  33.312  1.00 102.75 ? 303  TYR A CG    1 
ATOM   2291  C  CD1   . TYR A 1  303  ? -22.214 -44.194  32.816  1.00 98.70  ? 303  TYR A CD1   1 
ATOM   2292  C  CD2   . TYR A 1  303  ? -21.379 -45.898  34.224  1.00 96.05  ? 303  TYR A CD2   1 
ATOM   2293  C  CE1   . TYR A 1  303  ? -21.167 -43.358  33.197  1.00 101.72 ? 303  TYR A CE1   1 
ATOM   2294  C  CE2   . TYR A 1  303  ? -20.332 -45.066  34.608  1.00 107.49 ? 303  TYR A CE2   1 
ATOM   2295  C  CZ    . TYR A 1  303  ? -20.229 -43.800  34.089  1.00 101.51 ? 303  TYR A CZ    1 
ATOM   2296  O  OH    . TYR A 1  303  ? -19.186 -42.983  34.475  1.00 99.71  ? 303  TYR A OH    1 
ATOM   2297  N  N     . MET A 1  304  ? -21.407 -48.585  31.594  1.00 104.58 ? 304  MET A N     1 
ATOM   2298  C  CA    . MET A 1  304  ? -20.063 -49.020  31.247  1.00 98.20  ? 304  MET A CA    1 
ATOM   2299  C  C     . MET A 1  304  ? -20.034 -49.912  30.011  1.00 105.81 ? 304  MET A C     1 
ATOM   2300  O  O     . MET A 1  304  ? -19.144 -49.759  29.169  1.00 106.04 ? 304  MET A O     1 
ATOM   2301  C  CB    . MET A 1  304  ? -19.417 -49.730  32.440  1.00 89.96  ? 304  MET A CB    1 
ATOM   2302  C  CG    . MET A 1  304  ? -19.201 -48.786  33.608  1.00 109.97 ? 304  MET A CG    1 
ATOM   2303  S  SD    . MET A 1  304  ? -18.387 -49.499  35.035  1.00 100.95 ? 304  MET A SD    1 
ATOM   2304  C  CE    . MET A 1  304  ? -19.619 -50.718  35.530  1.00 129.79 ? 304  MET A CE    1 
ATOM   2305  N  N     . ASP A 1  305  ? -21.008 -50.807  29.855  1.00 114.58 ? 305  ASP A N     1 
ATOM   2306  C  CA    . ASP A 1  305  ? -21.125 -51.625  28.649  1.00 110.17 ? 305  ASP A CA    1 
ATOM   2307  C  C     . ASP A 1  305  ? -22.595 -51.789  28.301  1.00 98.90  ? 305  ASP A C     1 
ATOM   2308  O  O     . ASP A 1  305  ? -23.342 -52.416  29.054  1.00 125.26 ? 305  ASP A O     1 
ATOM   2309  C  CB    . ASP A 1  305  ? -20.462 -52.990  28.825  1.00 107.17 ? 305  ASP A CB    1 
ATOM   2310  C  CG    . ASP A 1  305  ? -20.492 -53.820  27.549  1.00 119.56 ? 305  ASP A CG    1 
ATOM   2311  O  OD1   . ASP A 1  305  ? -20.630 -53.231  26.457  1.00 127.30 ? 305  ASP A OD1   1 
ATOM   2312  O  OD2   . ASP A 1  305  ? -20.362 -55.062  27.628  1.00 112.40 ? 305  ASP A OD2   1 
ATOM   2313  N  N     . ASN A 1  306  ? -23.003 -51.240  27.154  1.00 97.07  ? 306  ASN A N     1 
ATOM   2314  C  CA    . ASN A 1  306  ? -24.377 -51.337  26.680  1.00 116.20 ? 306  ASN A CA    1 
ATOM   2315  C  C     . ASN A 1  306  ? -24.494 -52.278  25.491  1.00 120.00 ? 306  ASN A C     1 
ATOM   2316  O  O     . ASN A 1  306  ? -25.504 -52.267  24.782  1.00 134.67 ? 306  ASN A O     1 
ATOM   2317  C  CB    . ASN A 1  306  ? -24.902 -49.956  26.293  1.00 97.99  ? 306  ASN A CB    1 
ATOM   2318  C  CG    . ASN A 1  306  ? -26.395 -49.940  26.113  1.00 103.22 ? 306  ASN A CG    1 
ATOM   2319  O  OD1   . ASN A 1  306  ? -27.103 -50.739  26.723  1.00 109.66 ? 306  ASN A OD1   1 
ATOM   2320  N  ND2   . ASN A 1  306  ? -26.880 -49.079  25.225  1.00 112.21 ? 306  ASN A ND2   1 
ATOM   2321  N  N     . ASP A 1  307  ? -23.472 -53.093  25.262  1.00 108.85 ? 307  ASP A N     1 
ATOM   2322  C  CA    . ASP A 1  307  ? -23.458 -54.091  24.205  1.00 97.16  ? 307  ASP A CA    1 
ATOM   2323  C  C     . ASP A 1  307  ? -23.459 -55.493  24.813  1.00 110.15 ? 307  ASP A C     1 
ATOM   2324  O  O     . ASP A 1  307  ? -22.779 -56.403  24.336  1.00 96.44  ? 307  ASP A O     1 
ATOM   2325  C  CB    . ASP A 1  307  ? -22.271 -53.865  23.270  1.00 115.62 ? 307  ASP A CB    1 
ATOM   2326  C  CG    . ASP A 1  307  ? -22.267 -52.458  22.646  1.00 154.87 ? 307  ASP A CG    1 
ATOM   2327  O  OD1   . ASP A 1  307  ? -22.951 -51.555  23.171  1.00 168.89 ? 307  ASP A OD1   1 
ATOM   2328  O  OD2   . ASP A 1  307  ? -21.583 -52.248  21.622  1.00 168.62 ? 307  ASP A OD2   1 
ATOM   2329  N  N     . ILE A 1  308  ? -24.222 -55.666  25.897  1.00 129.11 ? 308  ILE A N     1 
ATOM   2330  C  CA    . ILE A 1  308  ? -24.239 -56.931  26.621  1.00 114.46 ? 308  ILE A CA    1 
ATOM   2331  C  C     . ILE A 1  308  ? -24.929 -57.996  25.779  1.00 119.04 ? 308  ILE A C     1 
ATOM   2332  O  O     . ILE A 1  308  ? -25.915 -57.726  25.079  1.00 127.55 ? 308  ILE A O     1 
ATOM   2333  C  CB    . ILE A 1  308  ? -24.913 -56.749  27.994  1.00 108.20 ? 308  ILE A CB    1 
ATOM   2334  C  CG1   . ILE A 1  308  ? -24.464 -55.423  28.624  1.00 113.46 ? 308  ILE A CG1   1 
ATOM   2335  C  CG2   . ILE A 1  308  ? -24.591 -57.896  28.923  1.00 111.93 ? 308  ILE A CG2   1 
ATOM   2336  C  CD1   . ILE A 1  308  ? -24.909 -55.202  30.071  1.00 103.33 ? 308  ILE A CD1   1 
ATOM   2337  N  N     . ALA A 1  309  ? -24.404 -59.218  25.848  1.00 125.00 ? 309  ALA A N     1 
ATOM   2338  C  CA    . ALA A 1  309  ? -24.947 -60.324  25.076  1.00 120.49 ? 309  ALA A CA    1 
ATOM   2339  C  C     . ALA A 1  309  ? -26.268 -60.787  25.660  1.00 129.26 ? 309  ALA A C     1 
ATOM   2340  O  O     . ALA A 1  309  ? -26.432 -60.869  26.881  1.00 127.55 ? 309  ALA A O     1 
ATOM   2341  C  CB    . ALA A 1  309  ? -23.964 -61.490  25.049  1.00 124.17 ? 309  ALA A CB    1 
ATOM   2342  N  N     . GLY A 1  310  ? -27.213 -61.081  24.774  1.00 149.83 ? 310  GLY A N     1 
ATOM   2343  C  CA    . GLY A 1  310  ? -28.485 -61.644  25.190  1.00 158.68 ? 310  GLY A CA    1 
ATOM   2344  C  C     . GLY A 1  310  ? -29.276 -60.725  26.093  1.00 148.68 ? 310  GLY A C     1 
ATOM   2345  O  O     . GLY A 1  310  ? -29.864 -61.182  27.081  1.00 155.22 ? 310  GLY A O     1 
ATOM   2346  N  N     . GLN A 1  311  ? -29.311 -59.437  25.776  1.00 132.31 ? 311  GLN A N     1 
ATOM   2347  C  CA    . GLN A 1  311  ? -30.049 -58.469  26.571  1.00 138.35 ? 311  GLN A CA    1 
ATOM   2348  C  C     . GLN A 1  311  ? -30.534 -57.353  25.666  1.00 144.77 ? 311  GLN A C     1 
ATOM   2349  O  O     . GLN A 1  311  ? -29.948 -57.105  24.606  1.00 165.17 ? 311  GLN A O     1 
ATOM   2350  C  CB    . GLN A 1  311  ? -29.192 -57.895  27.708  1.00 150.85 ? 311  GLN A CB    1 
ATOM   2351  C  CG    . GLN A 1  311  ? -29.133 -58.794  28.921  1.00 165.24 ? 311  GLN A CG    1 
ATOM   2352  C  CD    . GLN A 1  311  ? -29.108 -58.019  30.217  1.00 169.40 ? 311  GLN A CD    1 
ATOM   2353  O  OE1   . GLN A 1  311  ? -28.825 -56.818  30.234  1.00 152.63 ? 311  GLN A OE1   1 
ATOM   2354  N  NE2   . GLN A 1  311  ? -29.446 -58.691  31.310  1.00 174.34 ? 311  GLN A NE2   1 
ATOM   2355  N  N     . PRO A 1  312  ? -31.593 -56.655  26.056  1.00 140.31 ? 312  PRO A N     1 
ATOM   2356  C  CA    . PRO A 1  312  ? -32.000 -55.470  25.301  1.00 141.59 ? 312  PRO A CA    1 
ATOM   2357  C  C     . PRO A 1  312  ? -31.014 -54.345  25.556  1.00 146.08 ? 312  PRO A C     1 
ATOM   2358  O  O     . PRO A 1  312  ? -30.520 -54.171  26.672  1.00 136.70 ? 312  PRO A O     1 
ATOM   2359  C  CB    . PRO A 1  312  ? -33.382 -55.141  25.872  1.00 149.21 ? 312  PRO A CB    1 
ATOM   2360  C  CG    . PRO A 1  312  ? -33.302 -55.637  27.273  1.00 150.41 ? 312  PRO A CG    1 
ATOM   2361  C  CD    . PRO A 1  312  ? -32.469 -56.889  27.217  1.00 143.20 ? 312  PRO A CD    1 
ATOM   2362  N  N     . GLN A 1  313  ? -30.684 -53.615  24.498  1.00 141.38 ? 313  GLN A N     1 
ATOM   2363  C  CA    . GLN A 1  313  ? -29.801 -52.473  24.654  1.00 116.39 ? 313  GLN A CA    1 
ATOM   2364  C  C     . GLN A 1  313  ? -30.544 -51.349  25.367  1.00 121.38 ? 313  GLN A C     1 
ATOM   2365  O  O     . GLN A 1  313  ? -31.768 -51.220  25.270  1.00 149.68 ? 313  GLN A O     1 
ATOM   2366  C  CB    . GLN A 1  313  ? -29.308 -51.984  23.288  1.00 99.32  ? 313  GLN A CB    1 
ATOM   2367  C  CG    . GLN A 1  313  ? -27.962 -52.537  22.843  1.00 93.32  ? 313  GLN A CG    1 
ATOM   2368  C  CD    . GLN A 1  313  ? -27.551 -51.998  21.482  1.00 121.34 ? 313  GLN A CD    1 
ATOM   2369  O  OE1   . GLN A 1  313  ? -28.343 -51.353  20.795  1.00 124.55 ? 313  GLN A OE1   1 
ATOM   2370  N  NE2   . GLN A 1  313  ? -26.311 -52.258  21.089  1.00 120.36 ? 313  GLN A NE2   1 
ATOM   2371  N  N     . ALA A 1  314  ? -29.801 -50.565  26.138  1.00 102.71 ? 314  ALA A N     1 
ATOM   2372  C  CA    . ALA A 1  314  ? -30.352 -49.335  26.685  1.00 109.75 ? 314  ALA A CA    1 
ATOM   2373  C  C     . ALA A 1  314  ? -30.429 -48.316  25.560  1.00 128.55 ? 314  ALA A C     1 
ATOM   2374  O  O     . ALA A 1  314  ? -29.407 -47.966  24.959  1.00 141.56 ? 314  ALA A O     1 
ATOM   2375  C  CB    . ALA A 1  314  ? -29.498 -48.815  27.834  1.00 94.56  ? 314  ALA A CB    1 
ATOM   2376  N  N     . LEU A 1  315  ? -31.636 -47.850  25.271  1.00 132.89 ? 315  LEU A N     1 
ATOM   2377  C  CA    . LEU A 1  315  ? -31.910 -47.050  24.090  1.00 129.60 ? 315  LEU A CA    1 
ATOM   2378  C  C     . LEU A 1  315  ? -32.215 -45.618  24.489  1.00 131.30 ? 315  LEU A C     1 
ATOM   2379  O  O     . LEU A 1  315  ? -32.940 -45.377  25.460  1.00 138.49 ? 315  LEU A O     1 
ATOM   2380  C  CB    . LEU A 1  315  ? -33.082 -47.641  23.304  1.00 121.08 ? 315  LEU A CB    1 
ATOM   2381  C  CG    . LEU A 1  315  ? -33.025 -49.165  23.235  1.00 128.36 ? 315  LEU A CG    1 
ATOM   2382  C  CD1   . LEU A 1  315  ? -34.369 -49.783  22.836  1.00 132.02 ? 315  LEU A CD1   1 
ATOM   2383  C  CD2   . LEU A 1  315  ? -31.904 -49.572  22.291  1.00 119.01 ? 315  LEU A CD2   1 
ATOM   2384  N  N     . GLN A 1  316  ? -31.617 -44.676  23.769  1.00 135.43 ? 316  GLN A N     1 
ATOM   2385  C  CA    . GLN A 1  316  ? -31.926 -43.275  23.955  1.00 144.46 ? 316  GLN A CA    1 
ATOM   2386  C  C     . GLN A 1  316  ? -33.377 -43.008  23.561  1.00 173.99 ? 316  GLN A C     1 
ATOM   2387  O  O     . GLN A 1  316  ? -34.093 -43.882  23.056  1.00 176.59 ? 316  GLN A O     1 
ATOM   2388  C  CB    . GLN A 1  316  ? -30.988 -42.416  23.106  1.00 147.83 ? 316  GLN A CB    1 
ATOM   2389  C  CG    . GLN A 1  316  ? -30.810 -40.988  23.575  1.00 169.18 ? 316  GLN A CG    1 
ATOM   2390  C  CD    . GLN A 1  316  ? -29.835 -40.887  24.728  1.00 190.75 ? 316  GLN A CD    1 
ATOM   2391  O  OE1   . GLN A 1  316  ? -28.668 -40.545  24.537  1.00 200.54 ? 316  GLN A OE1   1 
ATOM   2392  N  NE2   . GLN A 1  316  ? -30.306 -41.188  25.933  1.00 190.03 ? 316  GLN A NE2   1 
ATOM   2393  N  N     . LYS A 1  317  ? -33.809 -41.769  23.801  1.00 181.79 ? 317  LYS A N     1 
ATOM   2394  C  CA    . LYS A 1  317  ? -35.166 -41.381  23.444  1.00 184.89 ? 317  LYS A CA    1 
ATOM   2395  C  C     . LYS A 1  317  ? -35.429 -41.643  21.968  1.00 172.74 ? 317  LYS A C     1 
ATOM   2396  O  O     . LYS A 1  317  ? -36.463 -42.216  21.601  1.00 159.69 ? 317  LYS A O     1 
ATOM   2397  C  CB    . LYS A 1  317  ? -35.379 -39.907  23.782  1.00 188.54 ? 317  LYS A CB    1 
ATOM   2398  C  CG    . LYS A 1  317  ? -36.814 -39.506  24.043  1.00 192.12 ? 317  LYS A CG    1 
ATOM   2399  C  CD    . LYS A 1  317  ? -36.890 -38.013  24.295  1.00 182.06 ? 317  LYS A CD    1 
ATOM   2400  C  CE    . LYS A 1  317  ? -38.286 -37.481  24.057  1.00 172.52 ? 317  LYS A CE    1 
ATOM   2401  N  NZ    . LYS A 1  317  ? -38.263 -36.004  23.881  1.00 167.35 ? 317  LYS A NZ    1 
ATOM   2402  N  N     . SER A 1  318  ? -34.469 -41.286  21.113  1.00 167.35 ? 318  SER A N     1 
ATOM   2403  C  CA    . SER A 1  318  ? -34.565 -41.455  19.668  1.00 163.22 ? 318  SER A CA    1 
ATOM   2404  C  C     . SER A 1  318  ? -34.392 -42.893  19.223  1.00 161.42 ? 318  SER A C     1 
ATOM   2405  O  O     . SER A 1  318  ? -34.281 -43.141  18.014  1.00 155.55 ? 318  SER A O     1 
ATOM   2406  C  CB    . SER A 1  318  ? -33.520 -40.575  18.974  1.00 156.70 ? 318  SER A CB    1 
ATOM   2407  O  OG    . SER A 1  318  ? -32.206 -40.886  19.421  1.00 139.35 ? 318  SER A OG    1 
ATOM   2408  N  N     . GLY A 1  319  ? -34.346 -43.872  20.124  1.00 163.04 ? 319  GLY A N     1 
ATOM   2409  C  CA    . GLY A 1  319  ? -34.214 -45.255  19.739  1.00 166.14 ? 319  GLY A CA    1 
ATOM   2410  C  C     . GLY A 1  319  ? -32.785 -45.748  19.628  1.00 161.26 ? 319  GLY A C     1 
ATOM   2411  O  O     . GLY A 1  319  ? -32.520 -46.920  19.931  1.00 152.94 ? 319  GLY A O     1 
ATOM   2412  N  N     . ARG A 1  320  ? -31.855 -44.882  19.218  1.00 149.88 ? 320  ARG A N     1 
ATOM   2413  C  CA    . ARG A 1  320  ? -30.465 -45.297  19.099  1.00 138.47 ? 320  ARG A CA    1 
ATOM   2414  C  C     . ARG A 1  320  ? -29.909 -45.611  20.484  1.00 138.66 ? 320  ARG A C     1 
ATOM   2415  O  O     . ARG A 1  320  ? -30.255 -44.938  21.459  1.00 154.52 ? 320  ARG A O     1 
ATOM   2416  C  CB    . ARG A 1  320  ? -29.607 -44.201  18.455  1.00 143.70 ? 320  ARG A CB    1 
ATOM   2417  C  CG    . ARG A 1  320  ? -29.643 -42.862  19.194  1.00 173.97 ? 320  ARG A CG    1 
ATOM   2418  C  CD    . ARG A 1  320  ? -28.268 -42.185  19.212  1.00 184.11 ? 320  ARG A CD    1 
ATOM   2419  N  NE    . ARG A 1  320  ? -28.277 -40.946  19.988  1.00 191.36 ? 320  ARG A NE    1 
ATOM   2420  C  CZ    . ARG A 1  320  ? -28.090 -40.896  21.304  1.00 190.58 ? 320  ARG A CZ    1 
ATOM   2421  N  NH1   . ARG A 1  320  ? -27.883 -42.016  21.984  1.00 186.87 ? 320  ARG A NH1   1 
ATOM   2422  N  NH2   . ARG A 1  320  ? -28.111 -39.735  21.943  1.00 195.87 ? 320  ARG A NH2   1 
ATOM   2423  N  N     . PRO A 1  321  ? -29.067 -46.629  20.610  1.00 127.82 ? 321  PRO A N     1 
ATOM   2424  C  CA    . PRO A 1  321  ? -28.571 -47.005  21.940  1.00 132.38 ? 321  PRO A CA    1 
ATOM   2425  C  C     . PRO A 1  321  ? -27.589 -45.974  22.486  1.00 130.35 ? 321  PRO A C     1 
ATOM   2426  O  O     . PRO A 1  321  ? -26.928 -45.256  21.733  1.00 130.11 ? 321  PRO A O     1 
ATOM   2427  C  CB    . PRO A 1  321  ? -27.888 -48.356  21.694  1.00 118.17 ? 321  PRO A CB    1 
ATOM   2428  C  CG    . PRO A 1  321  ? -27.513 -48.329  20.251  1.00 115.78 ? 321  PRO A CG    1 
ATOM   2429  C  CD    . PRO A 1  321  ? -28.589 -47.543  19.556  1.00 122.02 ? 321  PRO A CD    1 
ATOM   2430  N  N     . VAL A 1  322  ? -27.487 -45.914  23.820  1.00 117.43 ? 322  VAL A N     1 
ATOM   2431  C  CA    . VAL A 1  322  ? -26.543 -44.994  24.451  1.00 122.67 ? 322  VAL A CA    1 
ATOM   2432  C  C     . VAL A 1  322  ? -25.136 -45.532  24.258  1.00 121.79 ? 322  VAL A C     1 
ATOM   2433  O  O     . VAL A 1  322  ? -24.875 -46.718  24.489  1.00 116.97 ? 322  VAL A O     1 
ATOM   2434  C  CB    . VAL A 1  322  ? -26.852 -44.797  25.945  1.00 116.33 ? 322  VAL A CB    1 
ATOM   2435  C  CG1   . VAL A 1  322  ? -28.048 -43.880  26.141  1.00 144.75 ? 322  VAL A CG1   1 
ATOM   2436  C  CG2   . VAL A 1  322  ? -27.085 -46.128  26.627  1.00 115.67 ? 322  VAL A CG2   1 
ATOM   2437  N  N     . LYS A 1  323  ? -24.212 -44.659  23.858  1.00 106.38 ? 323  LYS A N     1 
ATOM   2438  C  CA    . LYS A 1  323  ? -22.841 -45.106  23.653  1.00 104.92 ? 323  LYS A CA    1 
ATOM   2439  C  C     . LYS A 1  323  ? -22.235 -45.408  25.012  1.00 113.51 ? 323  LYS A C     1 
ATOM   2440  O  O     . LYS A 1  323  ? -22.070 -44.509  25.838  1.00 117.26 ? 323  LYS A O     1 
ATOM   2441  C  CB    . LYS A 1  323  ? -22.021 -44.048  22.920  1.00 116.32 ? 323  LYS A CB    1 
ATOM   2442  C  CG    . LYS A 1  323  ? -20.623 -44.516  22.517  1.00 127.20 ? 323  LYS A CG    1 
ATOM   2443  C  CD    . LYS A 1  323  ? -19.874 -43.438  21.736  1.00 132.99 ? 323  LYS A CD    1 
ATOM   2444  C  CE    . LYS A 1  323  ? -19.407 -43.946  20.379  1.00 127.89 ? 323  LYS A CE    1 
ATOM   2445  N  NZ    . LYS A 1  323  ? -18.882 -42.835  19.535  1.00 128.51 ? 323  LYS A NZ    1 
ATOM   2446  N  N     . SER A 1  324  ? -21.908 -46.674  25.248  1.00 129.33 ? 324  SER A N     1 
ATOM   2447  C  CA    . SER A 1  324  ? -21.288 -47.052  26.506  1.00 115.11 ? 324  SER A CA    1 
ATOM   2448  C  C     . SER A 1  324  ? -19.840 -46.569  26.538  1.00 111.38 ? 324  SER A C     1 
ATOM   2449  O  O     . SER A 1  324  ? -19.261 -46.196  25.515  1.00 127.30 ? 324  SER A O     1 
ATOM   2450  C  CB    . SER A 1  324  ? -21.398 -48.564  26.700  1.00 121.04 ? 324  SER A CB    1 
ATOM   2451  O  OG    . SER A 1  324  ? -21.254 -49.267  25.467  1.00 128.12 ? 324  SER A OG    1 
ATOM   2452  N  N     . ILE A 1  325  ? -19.235 -46.609  27.728  1.00 115.45 ? 325  ILE A N     1 
ATOM   2453  C  CA    . ILE A 1  325  ? -17.834 -46.195  27.834  1.00 113.09 ? 325  ILE A CA    1 
ATOM   2454  C  C     . ILE A 1  325  ? -16.922 -47.187  27.131  1.00 103.23 ? 325  ILE A C     1 
ATOM   2455  O  O     . ILE A 1  325  ? -15.973 -46.797  26.438  1.00 101.01 ? 325  ILE A O     1 
ATOM   2456  C  CB    . ILE A 1  325  ? -17.410 -46.004  29.306  1.00 93.44  ? 325  ILE A CB    1 
ATOM   2457  C  CG1   . ILE A 1  325  ? -18.127 -44.818  29.938  1.00 87.67  ? 325  ILE A CG1   1 
ATOM   2458  C  CG2   . ILE A 1  325  ? -15.927 -45.762  29.403  1.00 84.83  ? 325  ILE A CG2   1 
ATOM   2459  C  CD1   . ILE A 1  325  ? -17.835 -44.641  31.408  1.00 86.40  ? 325  ILE A CD1   1 
ATOM   2460  N  N     . ARG A 1  326  ? -17.216 -48.480  27.268  1.00 90.09  ? 326  ARG A N     1 
ATOM   2461  C  CA    . ARG A 1  326  ? -16.447 -49.499  26.566  1.00 87.42  ? 326  ARG A CA    1 
ATOM   2462  C  C     . ARG A 1  326  ? -16.453 -49.246  25.061  1.00 102.05 ? 326  ARG A C     1 
ATOM   2463  O  O     . ARG A 1  326  ? -15.430 -49.420  24.386  1.00 105.26 ? 326  ARG A O     1 
ATOM   2464  C  CB    . ARG A 1  326  ? -17.006 -50.887  26.898  1.00 86.49  ? 326  ARG A CB    1 
ATOM   2465  C  CG    . ARG A 1  326  ? -16.538 -51.996  25.977  1.00 103.09 ? 326  ARG A CG    1 
ATOM   2466  C  CD    . ARG A 1  326  ? -16.830 -53.384  26.560  1.00 105.43 ? 326  ARG A CD    1 
ATOM   2467  N  NE    . ARG A 1  326  ? -16.304 -54.439  25.697  1.00 99.99  ? 326  ARG A NE    1 
ATOM   2468  C  CZ    . ARG A 1  326  ? -16.821 -54.790  24.522  1.00 117.23 ? 326  ARG A CZ    1 
ATOM   2469  N  NH1   . ARG A 1  326  ? -17.894 -54.175  24.039  1.00 116.83 ? 326  ARG A NH1   1 
ATOM   2470  N  NH2   . ARG A 1  326  ? -16.254 -55.763  23.825  1.00 121.94 ? 326  ARG A NH2   1 
ATOM   2471  N  N     . ALA A 1  327  ? -17.584 -48.780  24.528  1.00 96.14  ? 327  ALA A N     1 
ATOM   2472  C  CA    . ALA A 1  327  ? -17.681 -48.489  23.104  1.00 84.23  ? 327  ALA A CA    1 
ATOM   2473  C  C     . ALA A 1  327  ? -16.723 -47.397  22.690  1.00 96.62  ? 327  ALA A C     1 
ATOM   2474  O  O     . ALA A 1  327  ? -16.349 -47.331  21.516  1.00 123.28 ? 327  ALA A O     1 
ATOM   2475  C  CB    . ALA A 1  327  ? -19.106 -48.084  22.740  1.00 119.99 ? 327  ALA A CB    1 
ATOM   2476  N  N     . ARG A 1  328  ? -16.306 -46.552  23.637  1.00 102.98 ? 328  ARG A N     1 
ATOM   2477  C  CA    . ARG A 1  328  ? -15.413 -45.451  23.302  1.00 97.85  ? 328  ARG A CA    1 
ATOM   2478  C  C     . ARG A 1  328  ? -14.006 -45.937  22.990  1.00 99.11  ? 328  ARG A C     1 
ATOM   2479  O  O     . ARG A 1  328  ? -13.328 -45.372  22.122  1.00 107.28 ? 328  ARG A O     1 
ATOM   2480  C  CB    . ARG A 1  328  ? -15.372 -44.420  24.429  1.00 98.76  ? 328  ARG A CB    1 
ATOM   2481  C  CG    . ARG A 1  328  ? -16.662 -43.653  24.673  1.00 84.37  ? 328  ARG A CG    1 
ATOM   2482  C  CD    . ARG A 1  328  ? -16.323 -42.368  25.444  1.00 92.73  ? 328  ARG A CD    1 
ATOM   2483  N  NE    . ARG A 1  328  ? -17.485 -41.535  25.712  1.00 115.38 ? 328  ARG A NE    1 
ATOM   2484  C  CZ    . ARG A 1  328  ? -17.442 -40.403  26.407  1.00 112.02 ? 328  ARG A CZ    1 
ATOM   2485  N  NH1   . ARG A 1  328  ? -16.294 -39.965  26.910  1.00 82.17  ? 328  ARG A NH1   1 
ATOM   2486  N  NH2   . ARG A 1  328  ? -18.552 -39.704  26.595  1.00 127.22 ? 328  ARG A NH2   1 
ATOM   2487  N  N     . LEU A 1  329  ? -13.544 -46.969  23.691  1.00 90.75  ? 329  LEU A N     1 
ATOM   2488  C  CA    . LEU A 1  329  ? -12.157 -47.403  23.584  1.00 93.33  ? 329  LEU A CA    1 
ATOM   2489  C  C     . LEU A 1  329  ? -11.954 -48.472  22.524  1.00 97.64  ? 329  LEU A C     1 
ATOM   2490  O  O     . LEU A 1  329  ? -10.872 -48.558  21.929  1.00 110.78 ? 329  LEU A O     1 
ATOM   2491  C  CB    . LEU A 1  329  ? -11.675 -47.938  24.934  1.00 82.70  ? 329  LEU A CB    1 
ATOM   2492  C  CG    . LEU A 1  329  ? -12.274 -47.231  26.149  1.00 82.41  ? 329  LEU A CG    1 
ATOM   2493  C  CD1   . LEU A 1  329  ? -11.862 -47.941  27.412  1.00 83.62  ? 329  LEU A CD1   1 
ATOM   2494  C  CD2   . LEU A 1  329  ? -11.847 -45.781  26.204  1.00 81.72  ? 329  LEU A CD2   1 
ATOM   2495  N  N     . LYS A 1  330  ? -12.981 -49.267  22.261  1.00 82.13  ? 330  LYS A N     1 
ATOM   2496  C  CA    . LYS A 1  330  ? -12.880 -50.418  21.378  1.00 90.13  ? 330  LYS A CA    1 
ATOM   2497  C  C     . LYS A 1  330  ? -13.075 -50.021  19.922  1.00 91.92  ? 330  LYS A C     1 
ATOM   2498  O  O     . LYS A 1  330  ? -13.765 -49.042  19.610  1.00 108.84 ? 330  LYS A O     1 
ATOM   2499  C  CB    . LYS A 1  330  ? -13.917 -51.478  21.782  1.00 113.45 ? 330  LYS A CB    1 
ATOM   2500  C  CG    . LYS A 1  330  ? -14.597 -52.244  20.647  1.00 100.65 ? 330  LYS A CG    1 
ATOM   2501  C  CD    . LYS A 1  330  ? -15.757 -53.096  21.163  1.00 111.30 ? 330  LYS A CD    1 
ATOM   2502  C  CE    . LYS A 1  330  ? -17.025 -52.794  20.406  1.00 145.02 ? 330  LYS A CE    1 
ATOM   2503  N  NZ    . LYS A 1  330  ? -16.839 -53.051  18.955  1.00 171.05 ? 330  LYS A NZ    1 
ATOM   2504  N  N     . GLY A 1  331  ? -12.386 -50.746  19.040  1.00 82.14  ? 331  GLY A N     1 
ATOM   2505  C  CA    . GLY A 1  331  ? -12.606 -50.631  17.614  1.00 109.34 ? 331  GLY A CA    1 
ATOM   2506  C  C     . GLY A 1  331  ? -11.568 -49.767  16.925  1.00 98.18  ? 331  GLY A C     1 
ATOM   2507  O  O     . GLY A 1  331  ? -10.785 -49.050  17.550  1.00 102.34 ? 331  GLY A O     1 
ATOM   2508  N  N     . LYS A 1  332  ? -11.573 -49.865  15.593  1.00 88.75  ? 332  LYS A N     1 
ATOM   2509  C  CA    . LYS A 1  332  ? -10.638 -49.096  14.779  1.00 79.46  ? 332  LYS A CA    1 
ATOM   2510  C  C     . LYS A 1  332  ? -10.762 -47.607  15.043  1.00 93.17  ? 332  LYS A C     1 
ATOM   2511  O  O     . LYS A 1  332  ? -9.766  -46.880  14.971  1.00 112.97 ? 332  LYS A O     1 
ATOM   2512  C  CB    . LYS A 1  332  ? -10.881 -49.355  13.297  1.00 88.39  ? 332  LYS A CB    1 
ATOM   2513  C  CG    . LYS A 1  332  ? -9.914  -48.645  12.335  1.00 97.08  ? 332  LYS A CG    1 
ATOM   2514  C  CD    . LYS A 1  332  ? -10.548 -48.494  10.961  1.00 132.32 ? 332  LYS A CD    1 
ATOM   2515  C  CE    . LYS A 1  332  ? -11.513 -49.626  10.632  1.00 124.91 ? 332  LYS A CE    1 
ATOM   2516  N  NZ    . LYS A 1  332  ? -10.904 -50.980  10.526  1.00 134.70 ? 332  LYS A NZ    1 
ATOM   2517  N  N     . GLU A 1  333  ? -11.981 -47.120  15.260  1.00 96.03  ? 333  GLU A N     1 
ATOM   2518  C  CA    . GLU A 1  333  ? -12.209 -45.696  15.442  1.00 86.67  ? 333  GLU A CA    1 
ATOM   2519  C  C     . GLU A 1  333  ? -12.357 -45.309  16.903  1.00 89.57  ? 333  GLU A C     1 
ATOM   2520  O  O     . GLU A 1  333  ? -12.664 -44.149  17.196  1.00 105.37 ? 333  GLU A O     1 
ATOM   2521  C  CB    . GLU A 1  333  ? -13.441 -45.261  14.650  1.00 98.78  ? 333  GLU A CB    1 
ATOM   2522  C  CG    . GLU A 1  333  ? -13.462 -45.792  13.231  1.00 101.68 ? 333  GLU A CG    1 
ATOM   2523  C  CD    . GLU A 1  333  ? -14.261 -44.922  12.285  1.00 143.13 ? 333  GLU A CD    1 
ATOM   2524  O  OE1   . GLU A 1  333  ? -15.374 -44.477  12.649  1.00 151.69 ? 333  GLU A OE1   1 
ATOM   2525  O  OE2   . GLU A 1  333  ? -13.755 -44.672  11.171  1.00 155.10 ? 333  GLU A OE2   1 
ATOM   2526  N  N     . GLY A 1  334  ? -12.053 -46.228  17.817  1.00 101.72 ? 334  GLY A N     1 
ATOM   2527  C  CA    . GLY A 1  334  ? -12.146 -45.984  19.240  1.00 112.44 ? 334  GLY A CA    1 
ATOM   2528  C  C     . GLY A 1  334  ? -10.990 -45.140  19.746  1.00 99.50  ? 334  GLY A C     1 
ATOM   2529  O  O     . GLY A 1  334  ? -10.203 -44.581  18.982  1.00 90.07  ? 334  GLY A O     1 
ATOM   2530  N  N     . ARG A 1  335  ? -10.857 -45.111  21.076  1.00 100.82 ? 335  ARG A N     1 
ATOM   2531  C  CA    . ARG A 1  335  ? -9.830  -44.293  21.720  1.00 90.48  ? 335  ARG A CA    1 
ATOM   2532  C  C     . ARG A 1  335  ? -8.421  -44.802  21.422  1.00 92.91  ? 335  ARG A C     1 
ATOM   2533  O  O     . ARG A 1  335  ? -7.548  -44.037  20.989  1.00 98.29  ? 335  ARG A O     1 
ATOM   2534  C  CB    . ARG A 1  335  ? -10.039 -44.297  23.238  1.00 92.38  ? 335  ARG A CB    1 
ATOM   2535  C  CG    . ARG A 1  335  ? -9.369  -43.154  24.004  1.00 93.55  ? 335  ARG A CG    1 
ATOM   2536  C  CD    . ARG A 1  335  ? -9.975  -41.820  23.643  1.00 89.34  ? 335  ARG A CD    1 
ATOM   2537  N  NE    . ARG A 1  335  ? -11.308 -41.682  24.214  1.00 79.50  ? 335  ARG A NE    1 
ATOM   2538  C  CZ    . ARG A 1  335  ? -12.302 -41.062  23.600  1.00 104.65 ? 335  ARG A CZ    1 
ATOM   2539  N  NH1   . ARG A 1  335  ? -12.104 -40.536  22.399  1.00 96.24  ? 335  ARG A NH1   1 
ATOM   2540  N  NH2   . ARG A 1  335  ? -13.497 -40.962  24.174  1.00 118.27 ? 335  ARG A NH2   1 
ATOM   2541  N  N     . ILE A 1  336  ? -8.183  -46.095  21.633  1.00 102.17 ? 336  ILE A N     1 
ATOM   2542  C  CA    . ILE A 1  336  ? -6.838  -46.640  21.478  1.00 102.78 ? 336  ILE A CA    1 
ATOM   2543  C  C     . ILE A 1  336  ? -6.419  -46.620  20.015  1.00 107.21 ? 336  ILE A C     1 
ATOM   2544  O  O     . ILE A 1  336  ? -5.383  -46.056  19.650  1.00 97.81  ? 336  ILE A O     1 
ATOM   2545  C  CB    . ILE A 1  336  ? -6.764  -48.061  22.057  1.00 87.71  ? 336  ILE A CB    1 
ATOM   2546  C  CG1   . ILE A 1  336  ? -7.133  -48.058  23.539  1.00 83.33  ? 336  ILE A CG1   1 
ATOM   2547  C  CG2   . ILE A 1  336  ? -5.380  -48.631  21.863  1.00 79.59  ? 336  ILE A CG2   1 
ATOM   2548  C  CD1   . ILE A 1  336  ? -6.203  -47.320  24.410  1.00 91.87  ? 336  ILE A CD1   1 
ATOM   2549  N  N     . ARG A 1  337  ? -7.220  -47.241  19.159  1.00 96.67  ? 337  ARG A N     1 
ATOM   2550  C  CA    . ARG A 1  337  ? -6.828  -47.404  17.767  1.00 82.89  ? 337  ARG A CA    1 
ATOM   2551  C  C     . ARG A 1  337  ? -6.833  -46.074  17.010  1.00 104.80 ? 337  ARG A C     1 
ATOM   2552  O  O     . ARG A 1  337  ? -5.937  -45.811  16.198  1.00 103.05 ? 337  ARG A O     1 
ATOM   2553  C  CB    . ARG A 1  337  ? -7.776  -48.388  17.105  1.00 95.38  ? 337  ARG A CB    1 
ATOM   2554  C  CG    . ARG A 1  337  ? -7.434  -49.812  17.368  1.00 87.47  ? 337  ARG A CG    1 
ATOM   2555  C  CD    . ARG A 1  337  ? -6.373  -50.282  16.416  1.00 110.29 ? 337  ARG A CD    1 
ATOM   2556  N  NE    . ARG A 1  337  ? -6.863  -50.543  15.062  1.00 104.45 ? 337  ARG A NE    1 
ATOM   2557  C  CZ    . ARG A 1  337  ? -7.653  -51.562  14.722  1.00 81.06  ? 337  ARG A CZ    1 
ATOM   2558  N  NH1   . ARG A 1  337  ? -8.067  -52.444  15.632  1.00 85.40  ? 337  ARG A NH1   1 
ATOM   2559  N  NH2   . ARG A 1  337  ? -8.020  -51.712  13.461  1.00 79.80  ? 337  ARG A NH2   1 
ATOM   2560  N  N     . GLY A 1  338  ? -7.840  -45.229  17.243  1.00 81.46  ? 338  GLY A N     1 
ATOM   2561  C  CA    . GLY A 1  338  ? -8.033  -44.072  16.391  1.00 78.79  ? 338  GLY A CA    1 
ATOM   2562  C  C     . GLY A 1  338  ? -7.680  -42.747  17.028  1.00 83.49  ? 338  GLY A C     1 
ATOM   2563  O  O     . GLY A 1  338  ? -7.809  -41.701  16.384  1.00 78.14  ? 338  GLY A O     1 
ATOM   2564  N  N     . ASN A 1  339  ? -7.266  -42.765  18.301  1.00 98.78  ? 339  ASN A N     1 
ATOM   2565  C  CA    . ASN A 1  339  ? -6.856  -41.541  18.976  1.00 76.69  ? 339  ASN A CA    1 
ATOM   2566  C  C     . ASN A 1  339  ? -5.484  -41.613  19.630  1.00 85.76  ? 339  ASN A C     1 
ATOM   2567  O  O     . ASN A 1  339  ? -4.892  -40.551  19.864  1.00 81.44  ? 339  ASN A O     1 
ATOM   2568  C  CB    . ASN A 1  339  ? -7.870  -41.145  20.059  1.00 77.10  ? 339  ASN A CB    1 
ATOM   2569  C  CG    . ASN A 1  339  ? -9.137  -40.593  19.490  1.00 77.68  ? 339  ASN A CG    1 
ATOM   2570  O  OD1   . ASN A 1  339  ? -10.234 -41.064  19.800  1.00 99.03  ? 339  ASN A OD1   1 
ATOM   2571  N  ND2   . ASN A 1  339  ? -9.002  -39.589  18.640  1.00 78.00  ? 339  ASN A ND2   1 
ATOM   2572  N  N     . LEU A 1  340  ? -4.940  -42.803  19.893  1.00 77.16  ? 340  LEU A N     1 
ATOM   2573  C  CA    . LEU A 1  340  ? -3.639  -42.930  20.539  1.00 79.87  ? 340  LEU A CA    1 
ATOM   2574  C  C     . LEU A 1  340  ? -2.595  -43.599  19.661  1.00 83.65  ? 340  LEU A C     1 
ATOM   2575  O  O     . LEU A 1  340  ? -1.492  -43.056  19.500  1.00 95.66  ? 340  LEU A O     1 
ATOM   2576  C  CB    . LEU A 1  340  ? -3.769  -43.682  21.875  1.00 77.59  ? 340  LEU A CB    1 
ATOM   2577  C  CG    . LEU A 1  340  ? -4.420  -42.868  22.991  1.00 82.74  ? 340  LEU A CG    1 
ATOM   2578  C  CD1   . LEU A 1  340  ? -4.316  -43.595  24.313  1.00 78.59  ? 340  LEU A CD1   1 
ATOM   2579  C  CD2   . LEU A 1  340  ? -3.731  -41.522  23.088  1.00 77.43  ? 340  LEU A CD2   1 
ATOM   2580  N  N     . MET A 1  341  ? -2.894  -44.778  19.106  1.00 77.05  ? 341  MET A N     1 
ATOM   2581  C  CA    . MET A 1  341  ? -1.993  -45.411  18.141  1.00 76.95  ? 341  MET A CA    1 
ATOM   2582  C  C     . MET A 1  341  ? -1.971  -44.687  16.805  1.00 76.43  ? 341  MET A C     1 
ATOM   2583  O  O     . MET A 1  341  ? -1.116  -44.994  15.968  1.00 77.90  ? 341  MET A O     1 
ATOM   2584  C  CB    . MET A 1  341  ? -2.377  -46.872  17.901  1.00 77.44  ? 341  MET A CB    1 
ATOM   2585  C  CG    . MET A 1  341  ? -2.533  -47.687  19.147  1.00 91.06  ? 341  MET A CG    1 
ATOM   2586  S  SD    . MET A 1  341  ? -0.986  -47.902  20.003  1.00 93.83  ? 341  MET A SD    1 
ATOM   2587  C  CE    . MET A 1  341  ? -0.049  -48.781  18.752  1.00 98.27  ? 341  MET A CE    1 
ATOM   2588  N  N     . GLY A 1  342  ? -2.913  -43.776  16.578  1.00 80.66  ? 342  GLY A N     1 
ATOM   2589  C  CA    . GLY A 1  342  ? -3.006  -42.970  15.375  1.00 75.75  ? 342  GLY A CA    1 
ATOM   2590  C  C     . GLY A 1  342  ? -3.739  -41.672  15.657  1.00 88.97  ? 342  GLY A C     1 
ATOM   2591  O  O     . GLY A 1  342  ? -4.707  -41.639  16.425  1.00 81.75  ? 342  GLY A O     1 
ATOM   2592  N  N     . LYS A 1  343  ? -3.295  -40.589  15.031  1.00 93.40  ? 343  LYS A N     1 
ATOM   2593  C  CA    . LYS A 1  343  ? -3.835  -39.267  15.299  1.00 75.03  ? 343  LYS A CA    1 
ATOM   2594  C  C     . LYS A 1  343  ? -4.020  -38.516  13.990  1.00 92.71  ? 343  LYS A C     1 
ATOM   2595  O  O     . LYS A 1  343  ? -3.412  -38.838  12.969  1.00 103.07 ? 343  LYS A O     1 
ATOM   2596  C  CB    . LYS A 1  343  ? -2.905  -38.436  16.205  1.00 74.97  ? 343  LYS A CB    1 
ATOM   2597  C  CG    . LYS A 1  343  ? -2.913  -38.809  17.663  1.00 75.32  ? 343  LYS A CG    1 
ATOM   2598  C  CD    . LYS A 1  343  ? -1.650  -38.327  18.373  1.00 75.34  ? 343  LYS A CD    1 
ATOM   2599  C  CE    . LYS A 1  343  ? -1.667  -38.645  19.867  1.00 88.19  ? 343  LYS A CE    1 
ATOM   2600  N  NZ    . LYS A 1  343  ? -0.854  -39.845  20.226  1.00 95.15  ? 343  LYS A NZ    1 
ATOM   2601  N  N     . ARG A 1  344  ? -4.880  -37.511  14.032  1.00 74.72  ? 344  ARG A N     1 
ATOM   2602  C  CA    . ARG A 1  344  ? -4.793  -36.432  13.065  1.00 83.87  ? 344  ARG A CA    1 
ATOM   2603  C  C     . ARG A 1  344  ? -3.727  -35.447  13.547  1.00 96.88  ? 344  ARG A C     1 
ATOM   2604  O  O     . ARG A 1  344  ? -3.558  -35.234  14.754  1.00 84.11  ? 344  ARG A O     1 
ATOM   2605  C  CB    . ARG A 1  344  ? -6.138  -35.732  12.906  1.00 93.20  ? 344  ARG A CB    1 
ATOM   2606  C  CG    . ARG A 1  344  ? -6.944  -36.295  11.768  1.00 79.82  ? 344  ARG A CG    1 
ATOM   2607  C  CD    . ARG A 1  344  ? -8.409  -35.879  11.811  1.00 91.36  ? 344  ARG A CD    1 
ATOM   2608  N  NE    . ARG A 1  344  ? -9.234  -37.044  11.509  1.00 125.67 ? 344  ARG A NE    1 
ATOM   2609  C  CZ    . ARG A 1  344  ? -9.324  -37.617  10.311  1.00 137.38 ? 344  ARG A CZ    1 
ATOM   2610  N  NH1   . ARG A 1  344  ? -8.645  -37.136  9.271   1.00 117.72 ? 344  ARG A NH1   1 
ATOM   2611  N  NH2   . ARG A 1  344  ? -10.085 -38.693  10.154  1.00 145.88 ? 344  ARG A NH2   1 
ATOM   2612  N  N     . VAL A 1  345  ? -2.926  -34.935  12.612  1.00 80.36  ? 345  VAL A N     1 
ATOM   2613  C  CA    . VAL A 1  345  ? -1.723  -34.201  12.974  1.00 86.00  ? 345  VAL A CA    1 
ATOM   2614  C  C     . VAL A 1  345  ? -1.718  -32.837  12.297  1.00 96.68  ? 345  VAL A C     1 
ATOM   2615  O  O     . VAL A 1  345  ? -2.246  -32.664  11.193  1.00 85.86  ? 345  VAL A O     1 
ATOM   2616  C  CB    . VAL A 1  345  ? -0.446  -34.991  12.603  1.00 79.48  ? 345  VAL A CB    1 
ATOM   2617  C  CG1   . VAL A 1  345  ? -0.392  -36.273  13.379  1.00 75.37  ? 345  VAL A CG1   1 
ATOM   2618  C  CG2   . VAL A 1  345  ? -0.367  -35.247  11.093  1.00 74.42  ? 345  VAL A CG2   1 
ATOM   2619  N  N     . ASP A 1  346  ? -1.108  -31.865  12.976  1.00 75.41  ? 346  ASP A N     1 
ATOM   2620  C  CA    . ASP A 1  346  ? -0.828  -30.578  12.360  1.00 80.97  ? 346  ASP A CA    1 
ATOM   2621  C  C     . ASP A 1  346  ? 0.327   -30.729  11.360  1.00 82.97  ? 346  ASP A C     1 
ATOM   2622  O  O     . ASP A 1  346  ? 1.002   -31.762  11.287  1.00 94.73  ? 346  ASP A O     1 
ATOM   2623  C  CB    . ASP A 1  346  ? -0.482  -29.527  13.423  1.00 86.15  ? 346  ASP A CB    1 
ATOM   2624  C  CG    . ASP A 1  346  ? -1.696  -29.047  14.217  1.00 100.01 ? 346  ASP A CG    1 
ATOM   2625  O  OD1   . ASP A 1  346  ? -2.824  -29.028  13.673  1.00 110.73 ? 346  ASP A OD1   1 
ATOM   2626  O  OD2   . ASP A 1  346  ? -1.529  -28.674  15.395  1.00 102.73 ? 346  ASP A OD2   1 
ATOM   2627  N  N     . PHE A 1  347  ? 0.569   -29.668  10.601  1.00 86.02  ? 347  PHE A N     1 
ATOM   2628  C  CA    . PHE A 1  347  ? 1.728   -29.577  9.716   1.00 83.56  ? 347  PHE A CA    1 
ATOM   2629  C  C     . PHE A 1  347  ? 1.742   -30.715  8.704   1.00 100.67 ? 347  PHE A C     1 
ATOM   2630  O  O     . PHE A 1  347  ? 2.753   -31.387  8.480   1.00 100.63 ? 347  PHE A O     1 
ATOM   2631  C  CB    . PHE A 1  347  ? 3.008   -29.551  10.531  1.00 74.35  ? 347  PHE A CB    1 
ATOM   2632  C  CG    . PHE A 1  347  ? 3.086   -28.368  11.433  1.00 74.58  ? 347  PHE A CG    1 
ATOM   2633  C  CD1   . PHE A 1  347  ? 3.484   -27.133  10.956  1.00 74.81  ? 347  PHE A CD1   1 
ATOM   2634  C  CD2   . PHE A 1  347  ? 2.784   -28.492  12.774  1.00 84.10  ? 347  PHE A CD2   1 
ATOM   2635  C  CE1   . PHE A 1  347  ? 3.533   -26.042  11.791  1.00 75.10  ? 347  PHE A CE1   1 
ATOM   2636  C  CE2   . PHE A 1  347  ? 2.851   -27.399  13.615  1.00 104.19 ? 347  PHE A CE2   1 
ATOM   2637  C  CZ    . PHE A 1  347  ? 3.223   -26.180  13.123  1.00 97.05  ? 347  PHE A CZ    1 
ATOM   2638  N  N     . SER A 1  348  ? 0.600   -30.901  8.063   1.00 111.23 ? 348  SER A N     1 
ATOM   2639  C  CA    . SER A 1  348  ? 0.432   -31.936  7.071   1.00 73.92  ? 348  SER A CA    1 
ATOM   2640  C  C     . SER A 1  348  ? -0.191  -31.296  5.841   1.00 81.00  ? 348  SER A C     1 
ATOM   2641  O  O     . SER A 1  348  ? -0.745  -30.197  5.903   1.00 99.00  ? 348  SER A O     1 
ATOM   2642  C  CB    . SER A 1  348  ? -0.433  -33.099  7.639   1.00 100.06 ? 348  SER A CB    1 
ATOM   2643  O  OG    . SER A 1  348  ? -1.705  -32.678  8.141   1.00 89.04  ? 348  SER A OG    1 
ATOM   2644  N  N     . ALA A 1  349  ? -0.043  -31.969  4.707   1.00 74.05  ? 349  ALA A N     1 
ATOM   2645  C  CA    . ALA A 1  349  ? -0.541  -31.458  3.441   1.00 74.21  ? 349  ALA A CA    1 
ATOM   2646  C  C     . ALA A 1  349  ? -0.756  -32.632  2.507   1.00 84.48  ? 349  ALA A C     1 
ATOM   2647  O  O     . ALA A 1  349  ? -0.086  -33.652  2.620   1.00 91.16  ? 349  ALA A O     1 
ATOM   2648  C  CB    . ALA A 1  349  ? 0.433   -30.462  2.811   1.00 96.99  ? 349  ALA A CB    1 
ATOM   2649  N  N     . ARG A 1  350  ? -1.648  -32.456  1.548   1.00 74.45  ? 350  ARG A N     1 
ATOM   2650  C  CA    . ARG A 1  350  ? -1.997  -33.541  0.654   1.00 74.60  ? 350  ARG A CA    1 
ATOM   2651  C  C     . ARG A 1  350  ? -2.516  -32.943  -0.636  1.00 74.90  ? 350  ARG A C     1 
ATOM   2652  O  O     . ARG A 1  350  ? -3.281  -31.984  -0.604  1.00 74.98  ? 350  ARG A O     1 
ATOM   2653  C  CB    . ARG A 1  350  ? -3.048  -34.442  1.299   1.00 74.57  ? 350  ARG A CB    1 
ATOM   2654  C  CG    . ARG A 1  350  ? -3.626  -35.487  0.380   1.00 81.32  ? 350  ARG A CG    1 
ATOM   2655  C  CD    . ARG A 1  350  ? -4.549  -36.414  1.137   1.00 74.87  ? 350  ARG A CD    1 
ATOM   2656  N  NE    . ARG A 1  350  ? -5.248  -37.296  0.218   1.00 84.22  ? 350  ARG A NE    1 
ATOM   2657  C  CZ    . ARG A 1  350  ? -5.124  -38.618  0.202   1.00 88.50  ? 350  ARG A CZ    1 
ATOM   2658  N  NH1   . ARG A 1  350  ? -4.308  -39.236  1.057   1.00 77.17  ? 350  ARG A NH1   1 
ATOM   2659  N  NH2   . ARG A 1  350  ? -5.821  -39.328  -0.678  1.00 89.11  ? 350  ARG A NH2   1 
ATOM   2660  N  N     . THR A 1  351  ? -2.073  -33.493  -1.760  1.00 86.93  ? 351  THR A N     1 
ATOM   2661  C  CA    . THR A 1  351  ? -2.559  -33.055  -3.056  1.00 77.73  ? 351  THR A CA    1 
ATOM   2662  C  C     . THR A 1  351  ? -2.220  -34.130  -4.080  1.00 75.77  ? 351  THR A C     1 
ATOM   2663  O  O     . THR A 1  351  ? -1.566  -35.131  -3.764  1.00 99.62  ? 351  THR A O     1 
ATOM   2664  C  CB    . THR A 1  351  ? -1.951  -31.713  -3.454  1.00 89.16  ? 351  THR A CB    1 
ATOM   2665  O  OG1   . THR A 1  351  ? -2.588  -31.255  -4.648  1.00 94.20  ? 351  THR A OG1   1 
ATOM   2666  C  CG2   . THR A 1  351  ? -0.465  -31.866  -3.711  1.00 98.92  ? 351  THR A CG2   1 
ATOM   2667  N  N     . VAL A 1  352  ? -2.707  -33.917  -5.312  1.00 80.50  ? 352  VAL A N     1 
ATOM   2668  C  CA    . VAL A 1  352  ? -2.465  -34.830  -6.429  1.00 77.50  ? 352  VAL A CA    1 
ATOM   2669  C  C     . VAL A 1  352  ? -0.977  -34.832  -6.769  1.00 84.76  ? 352  VAL A C     1 
ATOM   2670  O  O     . VAL A 1  352  ? -0.283  -33.814  -6.619  1.00 88.68  ? 352  VAL A O     1 
ATOM   2671  C  CB    . VAL A 1  352  ? -3.307  -34.408  -7.649  1.00 77.08  ? 352  VAL A CB    1 
ATOM   2672  C  CG1   . VAL A 1  352  ? -3.078  -35.332  -8.845  1.00 77.57  ? 352  VAL A CG1   1 
ATOM   2673  C  CG2   . VAL A 1  352  ? -4.758  -34.352  -7.283  1.00 77.11  ? 352  VAL A CG2   1 
ATOM   2674  N  N     . ILE A 1  353  ? -0.481  -35.966  -7.264  1.00 76.84  ? 353  ILE A N     1 
ATOM   2675  C  CA    . ILE A 1  353  ? 0.931   -36.092  -7.593  1.00 76.98  ? 353  ILE A CA    1 
ATOM   2676  C  C     . ILE A 1  353  ? 1.094   -36.111  -9.106  1.00 90.21  ? 353  ILE A C     1 
ATOM   2677  O  O     . ILE A 1  353  ? 0.187   -36.508  -9.846  1.00 90.10  ? 353  ILE A O     1 
ATOM   2678  C  CB    . ILE A 1  353  ? 1.565   -37.353  -6.975  1.00 76.87  ? 353  ILE A CB    1 
ATOM   2679  C  CG1   . ILE A 1  353  ? 0.700   -38.582  -7.254  1.00 77.09  ? 353  ILE A CG1   1 
ATOM   2680  C  CG2   . ILE A 1  353  ? 1.797   -37.158  -5.492  1.00 88.93  ? 353  ILE A CG2   1 
ATOM   2681  C  CD1   . ILE A 1  353  ? 1.336   -39.882  -6.793  1.00 78.27  ? 353  ILE A CD1   1 
ATOM   2682  N  N     . SER A 1  354  ? 2.279   -35.696  -9.563  1.00 81.54  ? 354  SER A N     1 
ATOM   2683  C  CA    . SER A 1  354  ? 2.624   -35.701  -10.976 1.00 83.09  ? 354  SER A CA    1 
ATOM   2684  C  C     . SER A 1  354  ? 4.094   -36.093  -11.090 1.00 84.84  ? 354  SER A C     1 
ATOM   2685  O  O     . SER A 1  354  ? 4.834   -36.089  -10.106 1.00 97.28  ? 354  SER A O     1 
ATOM   2686  C  CB    . SER A 1  354  ? 2.362   -34.334  -11.636 1.00 89.64  ? 354  SER A CB    1 
ATOM   2687  O  OG    . SER A 1  354  ? 1.034   -34.219  -12.120 1.00 91.01  ? 354  SER A OG    1 
ATOM   2688  N  N     . GLY A 1  355  ? 4.527   -36.435  -12.296 1.00 82.45  ? 355  GLY A N     1 
ATOM   2689  C  CA    . GLY A 1  355  ? 5.898   -36.825  -12.527 1.00 81.07  ? 355  GLY A CA    1 
ATOM   2690  C  C     . GLY A 1  355  ? 6.723   -35.683  -13.074 1.00 98.29  ? 355  GLY A C     1 
ATOM   2691  O  O     . GLY A 1  355  ? 6.191   -34.719  -13.618 1.00 111.74 ? 355  GLY A O     1 
ATOM   2692  N  N     . ASP A 1  356  ? 8.035   -35.800  -12.939 1.00 91.45  ? 356  ASP A N     1 
ATOM   2693  C  CA    . ASP A 1  356  ? 8.894   -34.743  -13.453 1.00 84.36  ? 356  ASP A CA    1 
ATOM   2694  C  C     . ASP A 1  356  ? 10.247  -35.314  -13.831 1.00 85.25  ? 356  ASP A C     1 
ATOM   2695  O  O     . ASP A 1  356  ? 11.002  -35.762  -12.964 1.00 90.42  ? 356  ASP A O     1 
ATOM   2696  C  CB    . ASP A 1  356  ? 9.066   -33.615  -12.447 1.00 80.23  ? 356  ASP A CB    1 
ATOM   2697  C  CG    . ASP A 1  356  ? 9.353   -32.299  -13.127 1.00 82.82  ? 356  ASP A CG    1 
ATOM   2698  O  OD1   . ASP A 1  356  ? 10.072  -32.307  -14.142 1.00 94.23  ? 356  ASP A OD1   1 
ATOM   2699  O  OD2   . ASP A 1  356  ? 8.847   -31.257  -12.681 1.00 80.43  ? 356  ASP A OD2   1 
ATOM   2700  N  N     . PRO A 1  357  ? 10.590  -35.300  -15.120 1.00 84.86  ? 357  PRO A N     1 
ATOM   2701  C  CA    . PRO A 1  357  ? 11.916  -35.763  -15.535 1.00 109.36 ? 357  PRO A CA    1 
ATOM   2702  C  C     . PRO A 1  357  ? 13.046  -34.874  -15.062 1.00 102.76 ? 357  PRO A C     1 
ATOM   2703  O  O     . PRO A 1  357  ? 14.212  -35.227  -15.268 1.00 118.97 ? 357  PRO A O     1 
ATOM   2704  C  CB    . PRO A 1  357  ? 11.824  -35.726  -17.067 1.00 129.79 ? 357  PRO A CB    1 
ATOM   2705  C  CG    . PRO A 1  357  ? 10.342  -35.784  -17.374 1.00 83.30  ? 357  PRO A CG    1 
ATOM   2706  C  CD    . PRO A 1  357  ? 9.709   -35.026  -16.269 1.00 82.45  ? 357  PRO A CD    1 
ATOM   2707  N  N     . ASN A 1  358  ? 12.744  -33.755  -14.402 1.00 82.42  ? 358  ASN A N     1 
ATOM   2708  C  CA    . ASN A 1  358  ? 13.742  -32.732  -14.115 1.00 98.27  ? 358  ASN A CA    1 
ATOM   2709  C  C     . ASN A 1  358  ? 13.848  -32.431  -12.624 1.00 89.36  ? 358  ASN A C     1 
ATOM   2710  O  O     . ASN A 1  358  ? 14.396  -31.395  -12.242 1.00 124.19 ? 358  ASN A O     1 
ATOM   2711  C  CB    . ASN A 1  358  ? 13.434  -31.452  -14.900 1.00 83.09  ? 358  ASN A CB    1 
ATOM   2712  C  CG    . ASN A 1  358  ? 13.703  -31.593  -16.396 1.00 94.78  ? 358  ASN A CG    1 
ATOM   2713  O  OD1   . ASN A 1  358  ? 14.765  -32.046  -16.816 1.00 85.96  ? 358  ASN A OD1   1 
ATOM   2714  N  ND2   . ASN A 1  358  ? 12.737  -31.175  -17.208 1.00 98.05  ? 358  ASN A ND2   1 
ATOM   2715  N  N     . LEU A 1  359  ? 13.322  -33.303  -11.775 1.00 81.34  ? 359  LEU A N     1 
ATOM   2716  C  CA    . LEU A 1  359  ? 13.605  -33.245  -10.350 1.00 91.72  ? 359  LEU A CA    1 
ATOM   2717  C  C     . LEU A 1  359  ? 14.608  -34.330  -9.987  1.00 114.27 ? 359  LEU A C     1 
ATOM   2718  O  O     . LEU A 1  359  ? 14.636  -35.410  -10.586 1.00 93.78  ? 359  LEU A O     1 
ATOM   2719  C  CB    . LEU A 1  359  ? 12.348  -33.400  -9.493  1.00 90.74  ? 359  LEU A CB    1 
ATOM   2720  C  CG    . LEU A 1  359  ? 11.356  -32.244  -9.504  1.00 101.52 ? 359  LEU A CG    1 
ATOM   2721  C  CD1   . LEU A 1  359  ? 10.287  -32.463  -8.430  1.00 78.86  ? 359  LEU A CD1   1 
ATOM   2722  C  CD2   . LEU A 1  359  ? 12.117  -30.942  -9.293  1.00 94.53  ? 359  LEU A CD2   1 
ATOM   2723  N  N     . GLU A 1  360  ? 15.452  -34.021  -9.010  1.00 113.11 ? 360  GLU A N     1 
ATOM   2724  C  CA    . GLU A 1  360  ? 16.390  -35.016  -8.536  1.00 106.86 ? 360  GLU A CA    1 
ATOM   2725  C  C     . GLU A 1  360  ? 15.623  -36.128  -7.820  1.00 99.17  ? 360  GLU A C     1 
ATOM   2726  O  O     . GLU A 1  360  ? 14.470  -35.961  -7.418  1.00 113.07 ? 360  GLU A O     1 
ATOM   2727  C  CB    . GLU A 1  360  ? 17.440  -34.339  -7.653  1.00 102.25 ? 360  GLU A CB    1 
ATOM   2728  C  CG    . GLU A 1  360  ? 18.450  -33.526  -8.460  1.00 100.52 ? 360  GLU A CG    1 
ATOM   2729  C  CD    . GLU A 1  360  ? 19.096  -34.339  -9.568  1.00 136.92 ? 360  GLU A CD    1 
ATOM   2730  O  OE1   . GLU A 1  360  ? 19.395  -35.526  -9.332  1.00 152.23 ? 360  GLU A OE1   1 
ATOM   2731  O  OE2   . GLU A 1  360  ? 19.279  -33.812  -10.686 1.00 135.47 ? 360  GLU A OE2   1 
ATOM   2732  N  N     . LEU A 1  361  ? 16.269  -37.286  -7.684  1.00 96.17  ? 361  LEU A N     1 
ATOM   2733  C  CA    . LEU A 1  361  ? 15.579  -38.451  -7.131  1.00 80.52  ? 361  LEU A CA    1 
ATOM   2734  C  C     . LEU A 1  361  ? 14.986  -38.163  -5.758  1.00 90.18  ? 361  LEU A C     1 
ATOM   2735  O  O     . LEU A 1  361  ? 13.876  -38.613  -5.446  1.00 122.29 ? 361  LEU A O     1 
ATOM   2736  C  CB    . LEU A 1  361  ? 16.530  -39.644  -7.043  1.00 81.08  ? 361  LEU A CB    1 
ATOM   2737  C  CG    . LEU A 1  361  ? 15.962  -40.959  -6.496  1.00 80.81  ? 361  LEU A CG    1 
ATOM   2738  C  CD1   . LEU A 1  361  ? 15.449  -41.833  -7.604  1.00 81.13  ? 361  LEU A CD1   1 
ATOM   2739  C  CD2   . LEU A 1  361  ? 16.996  -41.712  -5.698  1.00 86.89  ? 361  LEU A CD2   1 
ATOM   2740  N  N     . ASP A 1  362  ? 15.698  -37.393  -4.936  1.00 79.76  ? 362  ASP A N     1 
ATOM   2741  C  CA    . ASP A 1  362  ? 15.326  -37.142  -3.551  1.00 88.01  ? 362  ASP A CA    1 
ATOM   2742  C  C     . ASP A 1  362  ? 14.664  -35.789  -3.349  1.00 89.22  ? 362  ASP A C     1 
ATOM   2743  O  O     . ASP A 1  362  ? 14.477  -35.368  -2.201  1.00 91.08  ? 362  ASP A O     1 
ATOM   2744  C  CB    . ASP A 1  362  ? 16.544  -37.275  -2.618  1.00 92.77  ? 362  ASP A CB    1 
ATOM   2745  C  CG    . ASP A 1  362  ? 17.646  -36.256  -2.910  1.00 86.73  ? 362  ASP A CG    1 
ATOM   2746  O  OD1   . ASP A 1  362  ? 17.563  -35.516  -3.901  1.00 101.81 ? 362  ASP A OD1   1 
ATOM   2747  O  OD2   . ASP A 1  362  ? 18.584  -36.147  -2.105  1.00 103.12 ? 362  ASP A OD2   1 
ATOM   2748  N  N     . GLN A 1  363  ? 14.239  -35.135  -4.424  1.00 83.82  ? 363  GLN A N     1 
ATOM   2749  C  CA    . GLN A 1  363  ? 13.467  -33.911  -4.298  1.00 78.52  ? 363  GLN A CA    1 
ATOM   2750  C  C     . GLN A 1  363  ? 11.985  -34.258  -4.333  1.00 85.49  ? 363  GLN A C     1 
ATOM   2751  O  O     . GLN A 1  363  ? 11.581  -35.315  -4.832  1.00 103.17 ? 363  GLN A O     1 
ATOM   2752  C  CB    . GLN A 1  363  ? 13.788  -32.916  -5.427  1.00 85.78  ? 363  GLN A CB    1 
ATOM   2753  C  CG    . GLN A 1  363  ? 15.238  -32.455  -5.551  1.00 79.74  ? 363  GLN A CG    1 
ATOM   2754  C  CD    . GLN A 1  363  ? 15.368  -31.170  -6.351  1.00 89.62  ? 363  GLN A CD    1 
ATOM   2755  O  OE1   . GLN A 1  363  ? 15.257  -31.161  -7.582  1.00 95.53  ? 363  GLN A OE1   1 
ATOM   2756  N  NE2   . GLN A 1  363  ? 15.572  -30.065  -5.644  1.00 93.98  ? 363  GLN A NE2   1 
ATOM   2757  N  N     . VAL A 1  364  ? 11.179  -33.353  -3.771  1.00 90.75  ? 364  VAL A N     1 
ATOM   2758  C  CA    . VAL A 1  364  ? 9.725   -33.377  -3.877  1.00 84.51  ? 364  VAL A CA    1 
ATOM   2759  C  C     . VAL A 1  364  ? 9.278   -31.996  -4.328  1.00 77.18  ? 364  VAL A C     1 
ATOM   2760  O  O     . VAL A 1  364  ? 9.671   -30.980  -3.740  1.00 106.84 ? 364  VAL A O     1 
ATOM   2761  C  CB    . VAL A 1  364  ? 9.037   -33.765  -2.549  1.00 76.54  ? 364  VAL A CB    1 
ATOM   2762  C  CG1   . VAL A 1  364  ? 9.300   -32.747  -1.455  1.00 76.38  ? 364  VAL A CG1   1 
ATOM   2763  C  CG2   . VAL A 1  364  ? 7.549   -33.961  -2.746  1.00 76.21  ? 364  VAL A CG2   1 
ATOM   2764  N  N     . GLY A 1  365  ? 8.465   -31.960  -5.372  1.00 77.28  ? 365  GLY A N     1 
ATOM   2765  C  CA    . GLY A 1  365  ? 7.939   -30.692  -5.826  1.00 77.72  ? 365  GLY A CA    1 
ATOM   2766  C  C     . GLY A 1  365  ? 6.791   -30.245  -4.949  1.00 79.11  ? 365  GLY A C     1 
ATOM   2767  O  O     . GLY A 1  365  ? 5.804   -30.972  -4.816  1.00 114.63 ? 365  GLY A O     1 
ATOM   2768  N  N     . VAL A 1  366  ? 6.901   -29.081  -4.330  1.00 76.89  ? 366  VAL A N     1 
ATOM   2769  C  CA    . VAL A 1  366  ? 5.877   -28.585  -3.417  1.00 76.50  ? 366  VAL A CA    1 
ATOM   2770  C  C     . VAL A 1  366  ? 5.247   -27.357  -4.064  1.00 85.70  ? 366  VAL A C     1 
ATOM   2771  O  O     . VAL A 1  366  ? 5.957   -26.393  -4.372  1.00 78.22  ? 366  VAL A O     1 
ATOM   2772  C  CB    . VAL A 1  366  ? 6.460   -28.253  -2.034  1.00 76.31  ? 366  VAL A CB    1 
ATOM   2773  C  CG1   . VAL A 1  366  ? 5.424   -27.580  -1.166  1.00 76.02  ? 366  VAL A CG1   1 
ATOM   2774  C  CG2   . VAL A 1  366  ? 7.016   -29.510  -1.371  1.00 80.56  ? 366  VAL A CG2   1 
ATOM   2775  N  N     . PRO A 1  367  ? 3.940   -27.344  -4.293  1.00 78.24  ? 367  PRO A N     1 
ATOM   2776  C  CA    . PRO A 1  367  ? 3.298   -26.126  -4.801  1.00 79.20  ? 367  PRO A CA    1 
ATOM   2777  C  C     . PRO A 1  367  ? 3.438   -24.950  -3.839  1.00 91.82  ? 367  PRO A C     1 
ATOM   2778  O  O     . PRO A 1  367  ? 3.398   -25.095  -2.615  1.00 85.60  ? 367  PRO A O     1 
ATOM   2779  C  CB    . PRO A 1  367  ? 1.836   -26.545  -4.974  1.00 76.80  ? 367  PRO A CB    1 
ATOM   2780  C  CG    . PRO A 1  367  ? 1.707   -27.860  -4.230  1.00 78.58  ? 367  PRO A CG    1 
ATOM   2781  C  CD    . PRO A 1  367  ? 3.035   -28.499  -4.268  1.00 76.34  ? 367  PRO A CD    1 
ATOM   2782  N  N     . LYS A 1  368  ? 3.493   -23.753  -4.425  1.00 77.49  ? 368  LYS A N     1 
ATOM   2783  C  CA    . LYS A 1  368  ? 3.786   -22.555  -3.648  1.00 77.67  ? 368  LYS A CA    1 
ATOM   2784  C  C     . LYS A 1  368  ? 2.738   -22.325  -2.576  1.00 92.74  ? 368  LYS A C     1 
ATOM   2785  O  O     . LYS A 1  368  ? 3.066   -21.903  -1.459  1.00 92.79  ? 368  LYS A O     1 
ATOM   2786  C  CB    . LYS A 1  368  ? 3.875   -21.332  -4.563  1.00 78.37  ? 368  LYS A CB    1 
ATOM   2787  C  CG    . LYS A 1  368  ? 4.487   -20.133  -3.890  1.00 84.26  ? 368  LYS A CG    1 
ATOM   2788  C  CD    . LYS A 1  368  ? 4.544   -18.946  -4.827  1.00 108.59 ? 368  LYS A CD    1 
ATOM   2789  C  CE    . LYS A 1  368  ? 5.745   -18.982  -5.736  1.00 112.71 ? 368  LYS A CE    1 
ATOM   2790  N  NZ    . LYS A 1  368  ? 5.779   -17.749  -6.568  1.00 117.30 ? 368  LYS A NZ    1 
ATOM   2791  N  N     . SER A 1  369  ? 1.470   -22.610  -2.893  1.00 77.20  ? 369  SER A N     1 
ATOM   2792  C  CA    . SER A 1  369  ? 0.395   -22.341  -1.946  1.00 76.98  ? 369  SER A CA    1 
ATOM   2793  C  C     . SER A 1  369  ? 0.552   -23.160  -0.684  1.00 92.00  ? 369  SER A C     1 
ATOM   2794  O  O     . SER A 1  369  ? 0.130   -22.719  0.392   1.00 87.45  ? 369  SER A O     1 
ATOM   2795  C  CB    . SER A 1  369  ? -0.972  -22.614  -2.581  1.00 78.41  ? 369  SER A CB    1 
ATOM   2796  O  OG    . SER A 1  369  ? -1.355  -23.982  -2.509  1.00 83.60  ? 369  SER A OG    1 
ATOM   2797  N  N     . ILE A 1  370  ? 1.143   -24.352  -0.799  1.00 77.13  ? 370  ILE A N     1 
ATOM   2798  C  CA    . ILE A 1  370  ? 1.370   -25.193  0.369   1.00 75.72  ? 370  ILE A CA    1 
ATOM   2799  C  C     . ILE A 1  370  ? 2.607   -24.736  1.120   1.00 91.23  ? 370  ILE A C     1 
ATOM   2800  O  O     . ILE A 1  370  ? 2.653   -24.783  2.354   1.00 94.29  ? 370  ILE A O     1 
ATOM   2801  C  CB    . ILE A 1  370  ? 1.456   -26.675  -0.041  1.00 90.88  ? 370  ILE A CB    1 
ATOM   2802  C  CG1   . ILE A 1  370  ? 0.152   -27.114  -0.712  1.00 75.47  ? 370  ILE A CG1   1 
ATOM   2803  C  CG2   . ILE A 1  370  ? 1.696   -27.552  1.169   1.00 75.09  ? 370  ILE A CG2   1 
ATOM   2804  C  CD1   . ILE A 1  370  ? 0.075   -28.583  -1.041  1.00 75.29  ? 370  ILE A CD1   1 
ATOM   2805  N  N     . ALA A 1  371  ? 3.644   -24.315  0.393   1.00 95.65  ? 371  ALA A N     1 
ATOM   2806  C  CA    . ALA A 1  371  ? 4.835   -23.798  1.059   1.00 76.37  ? 371  ALA A CA    1 
ATOM   2807  C  C     . ALA A 1  371  ? 4.549   -22.499  1.793   1.00 87.93  ? 371  ALA A C     1 
ATOM   2808  O  O     . ALA A 1  371  ? 5.190   -22.214  2.810   1.00 89.30  ? 371  ALA A O     1 
ATOM   2809  C  CB    . ALA A 1  371  ? 5.962   -23.614  0.044   1.00 88.63  ? 371  ALA A CB    1 
ATOM   2810  N  N     . LYS A 1  372  ? 3.588   -21.706  1.302   1.00 88.22  ? 372  LYS A N     1 
ATOM   2811  C  CA    . LYS A 1  372  ? 3.168   -20.499  2.009   1.00 82.26  ? 372  LYS A CA    1 
ATOM   2812  C  C     . LYS A 1  372  ? 2.371   -20.807  3.272   1.00 76.69  ? 372  LYS A C     1 
ATOM   2813  O  O     . LYS A 1  372  ? 2.243   -19.930  4.132   1.00 90.25  ? 372  LYS A O     1 
ATOM   2814  C  CB    . LYS A 1  372  ? 2.311   -19.610  1.087   1.00 81.46  ? 372  LYS A CB    1 
ATOM   2815  C  CG    . LYS A 1  372  ? 3.045   -18.674  0.103   1.00 78.13  ? 372  LYS A CG    1 
ATOM   2816  C  CD    . LYS A 1  372  ? 2.347   -17.301  -0.072  1.00 84.57  ? 372  LYS A CD    1 
ATOM   2817  C  CE    . LYS A 1  372  ? 0.987   -17.350  -0.787  1.00 103.71 ? 372  LYS A CE    1 
ATOM   2818  N  NZ    . LYS A 1  372  ? 0.984   -17.885  -2.188  1.00 114.63 ? 372  LYS A NZ    1 
ATOM   2819  N  N     . THR A 1  373  ? 1.864   -22.030  3.411   1.00 76.20  ? 373  THR A N     1 
ATOM   2820  C  CA    . THR A 1  373  ? 0.997   -22.464  4.508   1.00 75.87  ? 373  THR A CA    1 
ATOM   2821  C  C     . THR A 1  373  ? 1.742   -23.245  5.581   1.00 88.69  ? 373  THR A C     1 
ATOM   2822  O  O     . THR A 1  373  ? 1.555   -22.983  6.768   1.00 87.33  ? 373  THR A O     1 
ATOM   2823  C  CB    . THR A 1  373  ? -0.134  -23.349  3.977   1.00 75.60  ? 373  THR A CB    1 
ATOM   2824  O  OG1   . THR A 1  373  ? -0.897  -22.655  2.988   1.00 81.13  ? 373  THR A OG1   1 
ATOM   2825  C  CG2   . THR A 1  373  ? -1.028  -23.785  5.098   1.00 75.36  ? 373  THR A CG2   1 
ATOM   2826  N  N     . LEU A 1  374  ? 2.488   -24.274  5.182   1.00 75.40  ? 374  LEU A N     1 
ATOM   2827  C  CA    . LEU A 1  374  ? 3.313   -25.034  6.107   1.00 75.24  ? 374  LEU A CA    1 
ATOM   2828  C  C     . LEU A 1  374  ? 4.478   -24.191  6.616   1.00 86.53  ? 374  LEU A C     1 
ATOM   2829  O  O     . LEU A 1  374  ? 5.080   -23.413  5.875   1.00 113.37 ? 374  LEU A O     1 
ATOM   2830  C  CB    . LEU A 1  374  ? 3.835   -26.297  5.426   1.00 76.55  ? 374  LEU A CB    1 
ATOM   2831  C  CG    . LEU A 1  374  ? 2.758   -27.239  4.902   1.00 74.77  ? 374  LEU A CG    1 
ATOM   2832  C  CD1   . LEU A 1  374  ? 3.352   -28.398  4.134   1.00 74.70  ? 374  LEU A CD1   1 
ATOM   2833  C  CD2   . LEU A 1  374  ? 1.932   -27.744  6.085   1.00 109.61 ? 374  LEU A CD2   1 
ATOM   2834  N  N     . THR A 1  375  ? 4.833   -24.372  7.878   1.00 77.95  ? 375  THR A N     1 
ATOM   2835  C  CA    . THR A 1  375  ? 5.814   -23.471  8.447   1.00 77.77  ? 375  THR A CA    1 
ATOM   2836  C  C     . THR A 1  375  ? 6.701   -24.183  9.466   1.00 78.64  ? 375  THR A C     1 
ATOM   2837  O  O     . THR A 1  375  ? 6.220   -24.934  10.313  1.00 82.15  ? 375  THR A O     1 
ATOM   2838  C  CB    . THR A 1  375  ? 5.084   -22.259  9.058   1.00 84.45  ? 375  THR A CB    1 
ATOM   2839  O  OG1   . THR A 1  375  ? 6.041   -21.269  9.431   1.00 150.70 ? 375  THR A OG1   1 
ATOM   2840  C  CG2   . THR A 1  375  ? 4.223   -22.627  10.266  1.00 76.04  ? 375  THR A CG2   1 
ATOM   2841  N  N     . TYR A 1  376  ? 8.001   -23.938  9.376   1.00 94.94  ? 376  TYR A N     1 
ATOM   2842  C  CA    . TYR A 1  376  ? 9.015   -24.464  10.278  1.00 89.96  ? 376  TYR A CA    1 
ATOM   2843  C  C     . TYR A 1  376  ? 9.435   -23.397  11.285  1.00 90.58  ? 376  TYR A C     1 
ATOM   2844  O  O     . TYR A 1  376  ? 9.607   -22.222  10.909  1.00 83.68  ? 376  TYR A O     1 
ATOM   2845  C  CB    . TYR A 1  376  ? 10.249  -24.935  9.500   1.00 76.83  ? 376  TYR A CB    1 
ATOM   2846  C  CG    . TYR A 1  376  ? 11.383  -25.379  10.391  1.00 77.15  ? 376  TYR A CG    1 
ATOM   2847  C  CD1   . TYR A 1  376  ? 11.423  -26.665  10.884  1.00 86.31  ? 376  TYR A CD1   1 
ATOM   2848  C  CD2   . TYR A 1  376  ? 12.420  -24.524  10.736  1.00 77.81  ? 376  TYR A CD2   1 
ATOM   2849  C  CE1   . TYR A 1  376  ? 12.438  -27.091  11.713  1.00 77.25  ? 376  TYR A CE1   1 
ATOM   2850  C  CE2   . TYR A 1  376  ? 13.455  -24.955  11.572  1.00 91.94  ? 376  TYR A CE2   1 
ATOM   2851  C  CZ    . TYR A 1  376  ? 13.450  -26.251  12.049  1.00 86.86  ? 376  TYR A CZ    1 
ATOM   2852  O  OH    . TYR A 1  376  ? 14.428  -26.751  12.877  1.00 82.83  ? 376  TYR A OH    1 
ATOM   2853  N  N     . PRO A 1  377  ? 9.569   -23.787  12.578  1.00 81.61  ? 377  PRO A N     1 
ATOM   2854  C  CA    . PRO A 1  377  ? 9.974   -22.830  13.616  1.00 77.70  ? 377  PRO A CA    1 
ATOM   2855  C  C     . PRO A 1  377  ? 11.479  -22.773  13.772  1.00 88.77  ? 377  PRO A C     1 
ATOM   2856  O  O     . PRO A 1  377  ? 12.089  -23.680  14.337  1.00 101.40 ? 377  PRO A O     1 
ATOM   2857  C  CB    . PRO A 1  377  ? 9.319   -23.396  14.877  1.00 88.27  ? 377  PRO A CB    1 
ATOM   2858  C  CG    . PRO A 1  377  ? 9.314   -24.853  14.650  1.00 96.96  ? 377  PRO A CG    1 
ATOM   2859  C  CD    . PRO A 1  377  ? 9.181   -25.080  13.161  1.00 76.73  ? 377  PRO A CD    1 
ATOM   2860  N  N     . GLU A 1  378  ? 12.073  -21.662  13.368  1.00 95.76  ? 378  GLU A N     1 
ATOM   2861  C  CA    . GLU A 1  378  ? 13.513  -21.477  13.381  1.00 82.28  ? 378  GLU A CA    1 
ATOM   2862  C  C     . GLU A 1  378  ? 13.850  -20.546  14.537  1.00 88.61  ? 378  GLU A C     1 
ATOM   2863  O  O     . GLU A 1  378  ? 13.294  -19.451  14.648  1.00 84.34  ? 378  GLU A O     1 
ATOM   2864  C  CB    . GLU A 1  378  ? 13.994  -20.918  12.033  1.00 79.80  ? 378  GLU A CB    1 
ATOM   2865  C  CG    . GLU A 1  378  ? 15.502  -20.984  11.834  1.00 98.31  ? 378  GLU A CG    1 
ATOM   2866  C  CD    . GLU A 1  378  ? 15.925  -20.738  10.400  1.00 97.08  ? 378  GLU A CD    1 
ATOM   2867  O  OE1   . GLU A 1  378  ? 15.041  -20.643  9.532   1.00 93.21  ? 378  GLU A OE1   1 
ATOM   2868  O  OE2   . GLU A 1  378  ? 17.138  -20.586  10.144  1.00 96.65  ? 378  GLU A OE2   1 
ATOM   2869  N  N     . VAL A 1  379  ? 14.740  -20.998  15.412  1.00 97.19  ? 379  VAL A N     1 
ATOM   2870  C  CA    . VAL A 1  379  ? 15.145  -20.180  16.542  1.00 81.31  ? 379  VAL A CA    1 
ATOM   2871  C  C     . VAL A 1  379  ? 16.065  -19.068  16.051  1.00 89.01  ? 379  VAL A C     1 
ATOM   2872  O  O     . VAL A 1  379  ? 16.889  -19.265  15.146  1.00 93.89  ? 379  VAL A O     1 
ATOM   2873  C  CB    . VAL A 1  379  ? 15.812  -21.058  17.612  1.00 81.52  ? 379  VAL A CB    1 
ATOM   2874  C  CG1   . VAL A 1  379  ? 16.213  -20.221  18.787  1.00 85.89  ? 379  VAL A CG1   1 
ATOM   2875  C  CG2   . VAL A 1  379  ? 14.865  -22.168  18.039  1.00 104.60 ? 379  VAL A CG2   1 
ATOM   2876  N  N     . VAL A 1  380  ? 15.913  -17.876  16.621  1.00 92.04  ? 380  VAL A N     1 
ATOM   2877  C  CA    . VAL A 1  380  ? 16.712  -16.730  16.195  1.00 97.16  ? 380  VAL A CA    1 
ATOM   2878  C  C     . VAL A 1  380  ? 18.108  -16.885  16.791  1.00 106.18 ? 380  VAL A C     1 
ATOM   2879  O  O     . VAL A 1  380  ? 18.285  -16.873  18.011  1.00 105.80 ? 380  VAL A O     1 
ATOM   2880  C  CB    . VAL A 1  380  ? 16.075  -15.397  16.606  1.00 92.50  ? 380  VAL A CB    1 
ATOM   2881  C  CG1   . VAL A 1  380  ? 17.109  -14.293  16.542  1.00 88.94  ? 380  VAL A CG1   1 
ATOM   2882  C  CG2   . VAL A 1  380  ? 14.877  -15.067  15.718  1.00 86.09  ? 380  VAL A CG2   1 
ATOM   2883  N  N     . THR A 1  381  ? 19.086  -17.102  15.925  1.00 110.42 ? 381  THR A N     1 
ATOM   2884  C  CA    . THR A 1  381  ? 20.497  -17.166  16.248  1.00 85.73  ? 381  THR A CA    1 
ATOM   2885  C  C     . THR A 1  381  ? 21.236  -16.149  15.382  1.00 95.53  ? 381  THR A C     1 
ATOM   2886  O  O     . THR A 1  381  ? 20.749  -15.767  14.311  1.00 100.96 ? 381  THR A O     1 
ATOM   2887  C  CB    . THR A 1  381  ? 21.033  -18.585  16.004  1.00 90.85  ? 381  THR A CB    1 
ATOM   2888  O  OG1   . THR A 1  381  ? 22.431  -18.616  16.273  1.00 149.66 ? 381  THR A OG1   1 
ATOM   2889  C  CG2   . THR A 1  381  ? 20.817  -19.037  14.559  1.00 96.81  ? 381  THR A CG2   1 
ATOM   2890  N  N     . PRO A 1  382  ? 22.400  -15.662  15.819  1.00 100.55 ? 382  PRO A N     1 
ATOM   2891  C  CA    . PRO A 1  382  ? 23.147  -14.717  14.973  1.00 92.22  ? 382  PRO A CA    1 
ATOM   2892  C  C     . PRO A 1  382  ? 23.453  -15.232  13.571  1.00 102.38 ? 382  PRO A C     1 
ATOM   2893  O  O     . PRO A 1  382  ? 23.758  -14.419  12.689  1.00 117.52 ? 382  PRO A O     1 
ATOM   2894  C  CB    . PRO A 1  382  ? 24.417  -14.446  15.786  1.00 89.96  ? 382  PRO A CB    1 
ATOM   2895  C  CG    . PRO A 1  382  ? 24.423  -15.470  16.891  1.00 89.60  ? 382  PRO A CG    1 
ATOM   2896  C  CD    . PRO A 1  382  ? 22.998  -15.770  17.160  1.00 100.14 ? 382  PRO A CD    1 
ATOM   2897  N  N     . TYR A 1  383  ? 23.378  -16.545  13.328  1.00 89.94  ? 383  TYR A N     1 
ATOM   2898  C  CA    . TYR A 1  383  ? 23.606  -17.063  11.981  1.00 106.81 ? 383  TYR A CA    1 
ATOM   2899  C  C     . TYR A 1  383  ? 22.442  -16.785  11.034  1.00 113.60 ? 383  TYR A C     1 
ATOM   2900  O  O     . TYR A 1  383  ? 22.623  -16.870  9.814   1.00 125.73 ? 383  TYR A O     1 
ATOM   2901  C  CB    . TYR A 1  383  ? 23.880  -18.574  11.990  1.00 121.38 ? 383  TYR A CB    1 
ATOM   2902  C  CG    . TYR A 1  383  ? 24.658  -19.062  13.188  1.00 122.69 ? 383  TYR A CG    1 
ATOM   2903  C  CD1   . TYR A 1  383  ? 25.982  -18.715  13.369  1.00 127.73 ? 383  TYR A CD1   1 
ATOM   2904  C  CD2   . TYR A 1  383  ? 24.090  -19.938  14.095  1.00 125.20 ? 383  TYR A CD2   1 
ATOM   2905  C  CE1   . TYR A 1  383  ? 26.701  -19.170  14.468  1.00 118.35 ? 383  TYR A CE1   1 
ATOM   2906  C  CE2   . TYR A 1  383  ? 24.806  -20.403  15.192  1.00 116.17 ? 383  TYR A CE2   1 
ATOM   2907  C  CZ    . TYR A 1  383  ? 26.107  -20.018  15.371  1.00 105.84 ? 383  TYR A CZ    1 
ATOM   2908  O  OH    . TYR A 1  383  ? 26.799  -20.483  16.464  1.00 114.49 ? 383  TYR A OH    1 
ATOM   2909  N  N     . ASN A 1  384  ? 21.243  -16.508  11.558  1.00 105.52 ? 384  ASN A N     1 
ATOM   2910  C  CA    . ASN A 1  384  ? 20.072  -16.363  10.707  1.00 111.21 ? 384  ASN A CA    1 
ATOM   2911  C  C     . ASN A 1  384  ? 19.234  -15.131  11.004  1.00 112.90 ? 384  ASN A C     1 
ATOM   2912  O  O     . ASN A 1  384  ? 18.208  -14.932  10.346  1.00 102.01 ? 384  ASN A O     1 
ATOM   2913  C  CB    . ASN A 1  384  ? 19.168  -17.602  10.837  1.00 102.41 ? 384  ASN A CB    1 
ATOM   2914  C  CG    . ASN A 1  384  ? 18.589  -17.769  12.242  1.00 97.29  ? 384  ASN A CG    1 
ATOM   2915  O  OD1   . ASN A 1  384  ? 18.661  -16.865  13.066  1.00 84.21  ? 384  ASN A OD1   1 
ATOM   2916  N  ND2   . ASN A 1  384  ? 18.015  -18.939  12.515  1.00 108.38 ? 384  ASN A ND2   1 
ATOM   2917  N  N     . ILE A 1  385  ? 19.651  -14.279  11.940  1.00 118.27 ? 385  ILE A N     1 
ATOM   2918  C  CA    . ILE A 1  385  ? 18.806  -13.146  12.291  1.00 107.68 ? 385  ILE A CA    1 
ATOM   2919  C  C     . ILE A 1  385  ? 18.605  -12.228  11.095  1.00 109.71 ? 385  ILE A C     1 
ATOM   2920  O  O     . ILE A 1  385  ? 17.528  -11.645  10.926  1.00 119.09 ? 385  ILE A O     1 
ATOM   2921  C  CB    . ILE A 1  385  ? 19.396  -12.414  13.513  1.00 87.28  ? 385  ILE A CB    1 
ATOM   2922  C  CG1   . ILE A 1  385  ? 18.457  -11.306  13.976  1.00 87.48  ? 385  ILE A CG1   1 
ATOM   2923  C  CG2   . ILE A 1  385  ? 20.736  -11.843  13.179  1.00 88.49  ? 385  ILE A CG2   1 
ATOM   2924  C  CD1   . ILE A 1  385  ? 18.463  -11.084  15.470  1.00 87.88  ? 385  ILE A CD1   1 
ATOM   2925  N  N     . ASP A 1  386  ? 19.595  -12.145  10.209  1.00 103.12 ? 386  ASP A N     1 
ATOM   2926  C  CA    . ASP A 1  386  ? 19.449  -11.314  9.021   1.00 106.36 ? 386  ASP A CA    1 
ATOM   2927  C  C     . ASP A 1  386  ? 18.416  -11.910  8.070   1.00 91.93  ? 386  ASP A C     1 
ATOM   2928  O  O     . ASP A 1  386  ? 17.461  -11.233  7.655   1.00 103.39 ? 386  ASP A O     1 
ATOM   2929  C  CB    . ASP A 1  386  ? 20.810  -11.171  8.338   1.00 137.24 ? 386  ASP A CB    1 
ATOM   2930  C  CG    . ASP A 1  386  ? 21.727  -10.198  9.064   1.00 132.56 ? 386  ASP A CG    1 
ATOM   2931  O  OD1   . ASP A 1  386  ? 21.394  -9.802   10.201  1.00 133.74 ? 386  ASP A OD1   1 
ATOM   2932  O  OD2   . ASP A 1  386  ? 22.785  -9.835   8.506   1.00 125.36 ? 386  ASP A OD2   1 
ATOM   2933  N  N     . ARG A 1  387  ? 18.535  -13.212  7.795   1.00 105.51 ? 387  ARG A N     1 
ATOM   2934  C  CA    . ARG A 1  387  ? 17.597  -13.845  6.875   1.00 93.86  ? 387  ARG A CA    1 
ATOM   2935  C  C     . ARG A 1  387  ? 16.203  -13.857  7.469   1.00 93.39  ? 387  ARG A C     1 
ATOM   2936  O  O     . ARG A 1  387  ? 15.228  -13.532  6.782   1.00 106.46 ? 387  ARG A O     1 
ATOM   2937  C  CB    . ARG A 1  387  ? 18.049  -15.270  6.543   1.00 86.72  ? 387  ARG A CB    1 
ATOM   2938  C  CG    . ARG A 1  387  ? 17.455  -15.838  5.255   1.00 109.95 ? 387  ARG A CG    1 
ATOM   2939  C  CD    . ARG A 1  387  ? 17.860  -17.294  5.012   1.00 134.35 ? 387  ARG A CD    1 
ATOM   2940  N  NE    . ARG A 1  387  ? 17.199  -18.228  5.924   1.00 125.89 ? 387  ARG A NE    1 
ATOM   2941  C  CZ    . ARG A 1  387  ? 17.777  -18.792  6.982   1.00 120.51 ? 387  ARG A CZ    1 
ATOM   2942  N  NH1   . ARG A 1  387  ? 19.052  -18.535  7.288   1.00 122.33 ? 387  ARG A NH1   1 
ATOM   2943  N  NH2   . ARG A 1  387  ? 17.072  -19.620  7.738   1.00 81.69  ? 387  ARG A NH2   1 
ATOM   2944  N  N     . LEU A 1  388  ? 16.091  -14.200  8.752   1.00 97.55  ? 388  LEU A N     1 
ATOM   2945  C  CA    . LEU A 1  388  ? 14.774  -14.275  9.361   1.00 90.27  ? 388  LEU A CA    1 
ATOM   2946  C  C     . LEU A 1  388  ? 14.122  -12.896  9.404   1.00 102.49 ? 388  LEU A C     1 
ATOM   2947  O  O     . LEU A 1  388  ? 12.918  -12.769  9.159   1.00 107.72 ? 388  LEU A O     1 
ATOM   2948  C  CB    . LEU A 1  388  ? 14.879  -14.872  10.763  1.00 82.99  ? 388  LEU A CB    1 
ATOM   2949  C  CG    . LEU A 1  388  ? 15.340  -16.324  10.861  1.00 82.44  ? 388  LEU A CG    1 
ATOM   2950  C  CD1   . LEU A 1  388  ? 15.308  -16.785  12.295  1.00 86.67  ? 388  LEU A CD1   1 
ATOM   2951  C  CD2   . LEU A 1  388  ? 14.495  -17.202  10.009  1.00 81.53  ? 388  LEU A CD2   1 
ATOM   2952  N  N     . THR A 1  389  ? 14.902  -11.848  9.708   1.00 107.43 ? 389  THR A N     1 
ATOM   2953  C  CA    . THR A 1  389  ? 14.345  -10.495  9.717   1.00 96.70  ? 389  THR A CA    1 
ATOM   2954  C  C     . THR A 1  389  ? 13.806  -10.128  8.344   1.00 95.54  ? 389  THR A C     1 
ATOM   2955  O  O     . THR A 1  389  ? 12.766  -9.458   8.239   1.00 103.17 ? 389  THR A O     1 
ATOM   2956  C  CB    . THR A 1  389  ? 15.379  -9.455   10.163  1.00 86.66  ? 389  THR A CB    1 
ATOM   2957  O  OG1   . THR A 1  389  ? 16.022  -9.869   11.371  1.00 104.55 ? 389  THR A OG1   1 
ATOM   2958  C  CG2   . THR A 1  389  ? 14.699  -8.152   10.445  1.00 87.28  ? 389  THR A CG2   1 
ATOM   2959  N  N     . GLN A 1  390  ? 14.453  -10.627  7.279   1.00 97.27  ? 390  GLN A N     1 
ATOM   2960  C  CA    . GLN A 1  390  ? 13.945  -10.338  5.940   1.00 100.33 ? 390  GLN A CA    1 
ATOM   2961  C  C     . GLN A 1  390  ? 12.668  -11.127  5.655   1.00 92.40  ? 390  GLN A C     1 
ATOM   2962  O  O     . GLN A 1  390  ? 11.745  -10.620  4.999   1.00 97.58  ? 390  GLN A O     1 
ATOM   2963  C  CB    . GLN A 1  390  ? 15.017  -10.648  4.891   1.00 105.34 ? 390  GLN A CB    1 
ATOM   2964  C  CG    . GLN A 1  390  ? 14.667  -10.157  3.489   1.00 130.04 ? 390  GLN A CG    1 
ATOM   2965  C  CD    . GLN A 1  390  ? 14.413  -8.662   3.466   1.00 139.70 ? 390  GLN A CD    1 
ATOM   2966  O  OE1   . GLN A 1  390  ? 15.115  -7.903   4.129   1.00 156.42 ? 390  GLN A OE1   1 
ATOM   2967  N  NE2   . GLN A 1  390  ? 13.392  -8.236   2.731   1.00 136.63 ? 390  GLN A NE2   1 
ATOM   2968  N  N     . LEU A 1  391  ? 12.605  -12.380  6.114   1.00 96.75  ? 391  LEU A N     1 
ATOM   2969  C  CA    . LEU A 1  391  ? 11.396  -13.175  5.918   1.00 82.41  ? 391  LEU A CA    1 
ATOM   2970  C  C     . LEU A 1  391  ? 10.219  -12.581  6.673   1.00 98.34  ? 391  LEU A C     1 
ATOM   2971  O  O     . LEU A 1  391  ? 9.083   -12.608  6.188   1.00 116.98 ? 391  LEU A O     1 
ATOM   2972  C  CB    . LEU A 1  391  ? 11.632  -14.609  6.378   1.00 81.65  ? 391  LEU A CB    1 
ATOM   2973  C  CG    . LEU A 1  391  ? 12.744  -15.360  5.653   1.00 81.73  ? 391  LEU A CG    1 
ATOM   2974  C  CD1   . LEU A 1  391  ? 13.078  -16.653  6.358   1.00 81.15  ? 391  LEU A CD1   1 
ATOM   2975  C  CD2   . LEU A 1  391  ? 12.348  -15.614  4.222   1.00 81.53  ? 391  LEU A CD2   1 
ATOM   2976  N  N     . VAL A 1  392  ? 10.470  -12.025  7.861   1.00 85.04  ? 392  VAL A N     1 
ATOM   2977  C  CA    . VAL A 1  392  ? 9.395   -11.356  8.579   1.00 86.65  ? 392  VAL A CA    1 
ATOM   2978  C  C     . VAL A 1  392  ? 8.955   -10.123  7.797   1.00 107.17 ? 392  VAL A C     1 
ATOM   2979  O  O     . VAL A 1  392  ? 7.757   -9.830   7.706   1.00 112.30 ? 392  VAL A O     1 
ATOM   2980  C  CB    . VAL A 1  392  ? 9.821   -11.039  10.029  1.00 83.15  ? 392  VAL A CB    1 
ATOM   2981  C  CG1   . VAL A 1  392  ? 8.700   -10.359  10.800  1.00 83.26  ? 392  VAL A CG1   1 
ATOM   2982  C  CG2   . VAL A 1  392  ? 10.241  -12.310  10.760  1.00 82.52  ? 392  VAL A CG2   1 
ATOM   2983  N  N     . ARG A 1  393  ? 9.898   -9.427   7.139   1.00 104.11 ? 393  ARG A N     1 
ATOM   2984  C  CA    . ARG A 1  393  ? 9.475   -8.265   6.351   1.00 101.58 ? 393  ARG A CA    1 
ATOM   2985  C  C     . ARG A 1  393  ? 8.609   -8.687   5.173   1.00 100.85 ? 393  ARG A C     1 
ATOM   2986  O  O     . ARG A 1  393  ? 7.619   -8.014   4.855   1.00 111.67 ? 393  ARG A O     1 
ATOM   2987  C  CB    . ARG A 1  393  ? 10.669  -7.443   5.855   1.00 121.77 ? 393  ARG A CB    1 
ATOM   2988  C  CG    . ARG A 1  393  ? 11.574  -6.903   6.939   1.00 143.73 ? 393  ARG A CG    1 
ATOM   2989  C  CD    . ARG A 1  393  ? 11.792  -5.398   6.773   1.00 146.70 ? 393  ARG A CD    1 
ATOM   2990  N  NE    . ARG A 1  393  ? 12.780  -4.878   7.714   1.00 152.34 ? 393  ARG A NE    1 
ATOM   2991  C  CZ    . ARG A 1  393  ? 12.565  -4.754   9.021   1.00 166.60 ? 393  ARG A CZ    1 
ATOM   2992  N  NH1   . ARG A 1  393  ? 11.398  -5.114   9.548   1.00 174.69 ? 393  ARG A NH1   1 
ATOM   2993  N  NH2   . ARG A 1  393  ? 13.513  -4.267   9.807   1.00 158.86 ? 393  ARG A NH2   1 
ATOM   2994  N  N     . ASN A 1  394  ? 8.957   -9.799   4.517   1.00 83.82  ? 394  ASN A N     1 
ATOM   2995  C  CA    . ASN A 1  394  ? 8.111   -10.273  3.421   1.00 105.02 ? 394  ASN A CA    1 
ATOM   2996  C  C     . ASN A 1  394  ? 6.741   -10.722  3.915   1.00 98.53  ? 394  ASN A C     1 
ATOM   2997  O  O     . ASN A 1  394  ? 5.773   -10.724  3.143   1.00 110.45 ? 394  ASN A O     1 
ATOM   2998  C  CB    . ASN A 1  394  ? 8.785   -11.420  2.665   1.00 109.16 ? 394  ASN A CB    1 
ATOM   2999  C  CG    . ASN A 1  394  ? 10.178  -11.085  2.201   1.00 111.97 ? 394  ASN A CG    1 
ATOM   3000  O  OD1   . ASN A 1  394  ? 10.699  -10.002  2.472   1.00 135.33 ? 394  ASN A OD1   1 
ATOM   3001  N  ND2   . ASN A 1  394  ? 10.786  -12.009  1.469   1.00 112.11 ? 394  ASN A ND2   1 
ATOM   3002  N  N     . GLY A 1  395  ? 6.648   -11.167  5.158   1.00 82.19  ? 395  GLY A N     1 
ATOM   3003  C  CA    . GLY A 1  395  ? 5.370   -11.515  5.719   1.00 111.60 ? 395  GLY A CA    1 
ATOM   3004  C  C     . GLY A 1  395  ? 4.780   -12.745  5.062   1.00 90.54  ? 395  GLY A C     1 
ATOM   3005  O  O     . GLY A 1  395  ? 5.436   -13.445  4.285   1.00 97.24  ? 395  GLY A O     1 
ATOM   3006  N  N     . PRO A 1  396  ? 3.500   -13.006  5.333   1.00 84.08  ? 396  PRO A N     1 
ATOM   3007  C  CA    . PRO A 1  396  ? 2.878   -14.266  4.906   1.00 91.56  ? 396  PRO A CA    1 
ATOM   3008  C  C     . PRO A 1  396  ? 2.356   -14.304  3.480   1.00 93.29  ? 396  PRO A C     1 
ATOM   3009  O  O     . PRO A 1  396  ? 1.816   -15.338  3.074   1.00 101.99 ? 396  PRO A O     1 
ATOM   3010  C  CB    . PRO A 1  396  ? 1.728   -14.409  5.894   1.00 94.28  ? 396  PRO A CB    1 
ATOM   3011  C  CG    . PRO A 1  396  ? 1.351   -12.997  6.206   1.00 80.07  ? 396  PRO A CG    1 
ATOM   3012  C  CD    . PRO A 1  396  ? 2.615   -12.217  6.204   1.00 80.68  ? 396  PRO A CD    1 
ATOM   3013  N  N     . ASN A 1  397  ? 2.487   -13.240  2.702   1.00 107.00 ? 397  ASN A N     1 
ATOM   3014  C  CA    . ASN A 1  397  ? 1.859   -13.205  1.389   1.00 113.31 ? 397  ASN A CA    1 
ATOM   3015  C  C     . ASN A 1  397  ? 2.810   -13.558  0.250   1.00 107.17 ? 397  ASN A C     1 
ATOM   3016  O  O     . ASN A 1  397  ? 2.394   -14.207  -0.714  1.00 122.47 ? 397  ASN A O     1 
ATOM   3017  C  CB    . ASN A 1  397  ? 1.233   -11.832  1.164   1.00 142.97 ? 397  ASN A CB    1 
ATOM   3018  C  CG    . ASN A 1  397  ? 0.098   -11.570  2.126   1.00 137.80 ? 397  ASN A CG    1 
ATOM   3019  O  OD1   . ASN A 1  397  ? -0.454  -12.508  2.704   1.00 114.53 ? 397  ASN A OD1   1 
ATOM   3020  N  ND2   . ASN A 1  397  ? -0.257  -10.302  2.308   1.00 148.18 ? 397  ASN A ND2   1 
ATOM   3021  N  N     . GLU A 1  398  ? 4.077   -13.160  0.339   1.00 93.34  ? 398  GLU A N     1 
ATOM   3022  C  CA    . GLU A 1  398  ? 5.076   -13.558  -0.639  1.00 107.52 ? 398  GLU A CA    1 
ATOM   3023  C  C     . GLU A 1  398  ? 5.669   -14.881  -0.181  1.00 112.49 ? 398  GLU A C     1 
ATOM   3024  O  O     . GLU A 1  398  ? 5.633   -15.203  1.007   1.00 108.23 ? 398  GLU A O     1 
ATOM   3025  C  CB    . GLU A 1  398  ? 6.179   -12.511  -0.774  1.00 144.87 ? 398  GLU A CB    1 
ATOM   3026  C  CG    . GLU A 1  398  ? 5.756   -11.079  -0.539  1.00 147.79 ? 398  GLU A CG    1 
ATOM   3027  C  CD    . GLU A 1  398  ? 6.928   -10.130  -0.662  1.00 173.10 ? 398  GLU A CD    1 
ATOM   3028  O  OE1   . GLU A 1  398  ? 7.989   -10.565  -1.161  1.00 176.22 ? 398  GLU A OE1   1 
ATOM   3029  O  OE2   . GLU A 1  398  ? 6.793   -8.957   -0.254  1.00 187.99 ? 398  GLU A OE2   1 
ATOM   3030  N  N     . HIS A 1  399  ? 6.250   -15.652  -1.128  1.00 101.84 ? 399  HIS A N     1 
ATOM   3031  C  CA    . HIS A 1  399  ? 6.677   -17.002  -0.757  1.00 103.37 ? 399  HIS A CA    1 
ATOM   3032  C  C     . HIS A 1  399  ? 7.803   -17.063  0.259   1.00 150.47 ? 399  HIS A C     1 
ATOM   3033  O  O     . HIS A 1  399  ? 7.595   -17.632  1.344   1.00 211.55 ? 399  HIS A O     1 
ATOM   3034  C  CB    . HIS A 1  399  ? 7.055   -17.820  -1.985  1.00 114.65 ? 399  HIS A CB    1 
ATOM   3035  C  CG    . HIS A 1  399  ? 7.908   -18.994  -1.620  1.00 116.78 ? 399  HIS A CG    1 
ATOM   3036  N  ND1   . HIS A 1  399  ? 7.626   -19.795  -0.527  1.00 81.35  ? 399  HIS A ND1   1 
ATOM   3037  C  CD2   . HIS A 1  399  ? 9.074   -19.453  -2.134  1.00 133.70 ? 399  HIS A CD2   1 
ATOM   3038  C  CE1   . HIS A 1  399  ? 8.560   -20.719  -0.408  1.00 81.80  ? 399  HIS A CE1   1 
ATOM   3039  N  NE2   . HIS A 1  399  ? 9.447   -20.538  -1.373  1.00 124.19 ? 399  HIS A NE2   1 
ATOM   3040  N  N     . PRO A 1  400  ? 9.002   -16.565  -0.013  1.00 115.08 ? 400  PRO A N     1 
ATOM   3041  C  CA    . PRO A 1  400  ? 10.030  -16.618  1.033   1.00 86.75  ? 400  PRO A CA    1 
ATOM   3042  C  C     . PRO A 1  400  ? 9.664   -15.653  2.155   1.00 110.68 ? 400  PRO A C     1 
ATOM   3043  O  O     . PRO A 1  400  ? 10.139  -14.515  2.202   1.00 137.63 ? 400  PRO A O     1 
ATOM   3044  C  CB    . PRO A 1  400  ? 11.318  -16.274  0.287   1.00 88.87  ? 400  PRO A CB    1 
ATOM   3045  C  CG    . PRO A 1  400  ? 10.963  -16.464  -1.193  1.00 103.99 ? 400  PRO A CG    1 
ATOM   3046  C  CD    . PRO A 1  400  ? 9.547   -16.045  -1.277  1.00 87.61  ? 400  PRO A CD    1 
ATOM   3047  N  N     . GLY A 1  401  ? 8.716   -16.074  3.000   1.00 80.12  ? 401  GLY A N     1 
ATOM   3048  C  CA    . GLY A 1  401  ? 8.197   -15.248  4.072   1.00 88.04  ? 401  GLY A CA    1 
ATOM   3049  C  C     . GLY A 1  401  ? 7.892   -16.030  5.329   1.00 79.67  ? 401  GLY A C     1 
ATOM   3050  O  O     . GLY A 1  401  ? 8.407   -17.134  5.500   1.00 81.33  ? 401  GLY A O     1 
ATOM   3051  N  N     . ALA A 1  402  ? 7.127   -15.447  6.249   1.00 86.38  ? 402  ALA A N     1 
ATOM   3052  C  CA    . ALA A 1  402  ? 6.839   -16.086  7.527   1.00 89.53  ? 402  ALA A CA    1 
ATOM   3053  C  C     . ALA A 1  402  ? 5.429   -15.720  7.967   1.00 91.22  ? 402  ALA A C     1 
ATOM   3054  O  O     . ALA A 1  402  ? 4.858   -14.725  7.515   1.00 90.37  ? 402  ALA A O     1 
ATOM   3055  C  CB    . ALA A 1  402  ? 7.861   -15.693  8.598   1.00 79.74  ? 402  ALA A CB    1 
ATOM   3056  N  N     . LYS A 1  403  ? 4.879   -16.537  8.868   1.00 78.60  ? 403  LYS A N     1 
ATOM   3057  C  CA    . LYS A 1  403  ? 3.531   -16.367  9.401   1.00 78.46  ? 403  LYS A CA    1 
ATOM   3058  C  C     . LYS A 1  403  ? 3.489   -15.828  10.824  1.00 85.43  ? 403  LYS A C     1 
ATOM   3059  O  O     . LYS A 1  403  ? 2.658   -14.960  11.116  1.00 104.53 ? 403  LYS A O     1 
ATOM   3060  C  CB    . LYS A 1  403  ? 2.777   -17.706  9.369   1.00 77.72  ? 403  LYS A CB    1 
ATOM   3061  C  CG    . LYS A 1  403  ? 2.342   -18.163  7.996   1.00 78.55  ? 403  LYS A CG    1 
ATOM   3062  C  CD    . LYS A 1  403  ? 1.747   -19.555  8.069   1.00 76.80  ? 403  LYS A CD    1 
ATOM   3063  C  CE    . LYS A 1  403  ? 0.281   -19.557  7.706   1.00 101.31 ? 403  LYS A CE    1 
ATOM   3064  N  NZ    . LYS A 1  403  ? -0.259  -20.942  7.559   1.00 93.40  ? 403  LYS A NZ    1 
ATOM   3065  N  N     . TYR A 1  404  ? 4.363   -16.287  11.719  1.00 78.76  ? 404  TYR A N     1 
ATOM   3066  C  CA    . TYR A 1  404  ? 4.252   -15.964  13.137  1.00 79.04  ? 404  TYR A CA    1 
ATOM   3067  C  C     . TYR A 1  404  ? 5.627   -15.705  13.726  1.00 79.52  ? 404  TYR A C     1 
ATOM   3068  O  O     . TYR A 1  404  ? 6.633   -16.208  13.224  1.00 95.18  ? 404  TYR A O     1 
ATOM   3069  C  CB    . TYR A 1  404  ? 3.576   -17.098  13.926  1.00 78.46  ? 404  TYR A CB    1 
ATOM   3070  C  CG    . TYR A 1  404  ? 2.092   -17.298  13.661  1.00 92.09  ? 404  TYR A CG    1 
ATOM   3071  C  CD1   . TYR A 1  404  ? 1.138   -16.584  14.372  1.00 78.48  ? 404  TYR A CD1   1 
ATOM   3072  C  CD2   . TYR A 1  404  ? 1.645   -18.175  12.696  1.00 86.68  ? 404  TYR A CD2   1 
ATOM   3073  C  CE1   . TYR A 1  404  ? -0.212  -16.757  14.141  1.00 97.41  ? 404  TYR A CE1   1 
ATOM   3074  C  CE2   . TYR A 1  404  ? 0.281   -18.346  12.461  1.00 119.09 ? 404  TYR A CE2   1 
ATOM   3075  C  CZ    . TYR A 1  404  ? -0.637  -17.636  13.185  1.00 100.36 ? 404  TYR A CZ    1 
ATOM   3076  O  OH    . TYR A 1  404  ? -1.983  -17.811  12.950  1.00 117.01 ? 404  TYR A OH    1 
ATOM   3077  N  N     . VAL A 1  405  ? 5.653   -14.940  14.826  1.00 80.08  ? 405  VAL A N     1 
ATOM   3078  C  CA    . VAL A 1  405  ? 6.864   -14.700  15.619  1.00 80.63  ? 405  VAL A CA    1 
ATOM   3079  C  C     . VAL A 1  405  ? 6.520   -14.973  17.074  1.00 87.13  ? 405  VAL A C     1 
ATOM   3080  O  O     . VAL A 1  405  ? 5.570   -14.388  17.602  1.00 106.40 ? 405  VAL A O     1 
ATOM   3081  C  CB    . VAL A 1  405  ? 7.407   -13.258  15.464  1.00 81.58  ? 405  VAL A CB    1 
ATOM   3082  C  CG1   . VAL A 1  405  ? 8.585   -13.026  16.390  1.00 82.23  ? 405  VAL A CG1   1 
ATOM   3083  C  CG2   . VAL A 1  405  ? 7.859   -12.973  14.034  1.00 81.66  ? 405  VAL A CG2   1 
ATOM   3084  N  N     . ILE A 1  406  ? 7.316   -15.812  17.736  1.00 88.56  ? 406  ILE A N     1 
ATOM   3085  C  CA    . ILE A 1  406  ? 7.102   -16.182  19.130  1.00 80.67  ? 406  ILE A CA    1 
ATOM   3086  C  C     . ILE A 1  406  ? 8.201   -15.533  19.937  1.00 84.35  ? 406  ILE A C     1 
ATOM   3087  O  O     . ILE A 1  406  ? 9.387   -15.785  19.693  1.00 101.17 ? 406  ILE A O     1 
ATOM   3088  C  CB    . ILE A 1  406  ? 7.132   -17.707  19.348  1.00 79.99  ? 406  ILE A CB    1 
ATOM   3089  C  CG1   . ILE A 1  406  ? 5.912   -18.405  18.747  1.00 83.92  ? 406  ILE A CG1   1 
ATOM   3090  C  CG2   . ILE A 1  406  ? 7.208   -18.028  20.827  1.00 132.84 ? 406  ILE A CG2   1 
ATOM   3091  C  CD1   . ILE A 1  406  ? 6.096   -18.877  17.328  1.00 78.73  ? 406  ILE A CD1   1 
ATOM   3092  N  N     . ARG A 1  407  ? 7.814   -14.695  20.885  1.00 100.09 ? 407  ARG A N     1 
ATOM   3093  C  CA    . ARG A 1  407  ? 8.763   -14.103  21.808  1.00 101.29 ? 407  ARG A CA    1 
ATOM   3094  C  C     . ARG A 1  407  ? 8.952   -15.038  23.004  1.00 108.92 ? 407  ARG A C     1 
ATOM   3095  O  O     . ARG A 1  407  ? 8.211   -16.005  23.197  1.00 117.06 ? 407  ARG A O     1 
ATOM   3096  C  CB    . ARG A 1  407  ? 8.286   -12.717  22.248  1.00 100.06 ? 407  ARG A CB    1 
ATOM   3097  C  CG    . ARG A 1  407  ? 7.713   -11.853  21.123  1.00 93.03  ? 407  ARG A CG    1 
ATOM   3098  C  CD    . ARG A 1  407  ? 7.605   -10.377  21.528  1.00 122.76 ? 407  ARG A CD    1 
ATOM   3099  N  NE    . ARG A 1  407  ? 6.302   -10.027  22.088  1.00 120.55 ? 407  ARG A NE    1 
ATOM   3100  C  CZ    . ARG A 1  407  ? 6.058   -9.910   23.389  1.00 130.11 ? 407  ARG A CZ    1 
ATOM   3101  N  NH1   . ARG A 1  407  ? 7.028   -10.111  24.275  1.00 143.92 ? 407  ARG A NH1   1 
ATOM   3102  N  NH2   . ARG A 1  407  ? 4.845   -9.594   23.805  1.00 134.65 ? 407  ARG A NH2   1 
ATOM   3103  N  N     . ASP A 1  408  ? 9.983   -14.760  23.802  1.00 125.25 ? 408  ASP A N     1 
ATOM   3104  C  CA    . ASP A 1  408  ? 10.263  -15.603  24.962  1.00 151.33 ? 408  ASP A CA    1 
ATOM   3105  C  C     . ASP A 1  408  ? 9.106   -15.600  25.956  1.00 165.67 ? 408  ASP A C     1 
ATOM   3106  O  O     . ASP A 1  408  ? 8.890   -16.594  26.662  1.00 159.01 ? 408  ASP A O     1 
ATOM   3107  C  CB    . ASP A 1  408  ? 11.552  -15.136  25.641  1.00 148.09 ? 408  ASP A CB    1 
ATOM   3108  C  CG    . ASP A 1  408  ? 11.638  -13.624  25.740  1.00 167.08 ? 408  ASP A CG    1 
ATOM   3109  O  OD1   . ASP A 1  408  ? 10.578  -12.963  25.773  1.00 178.89 ? 408  ASP A OD1   1 
ATOM   3110  O  OD2   . ASP A 1  408  ? 12.766  -13.089  25.779  1.00 175.41 ? 408  ASP A OD2   1 
ATOM   3111  N  N     . SER A 1  409  ? 8.340   -14.504  26.000  1.00 171.42 ? 409  SER A N     1 
ATOM   3112  C  CA    . SER A 1  409  ? 7.182   -14.432  26.885  1.00 155.83 ? 409  SER A CA    1 
ATOM   3113  C  C     . SER A 1  409  ? 6.169   -15.515  26.562  1.00 154.54 ? 409  SER A C     1 
ATOM   3114  O  O     . SER A 1  409  ? 5.582   -16.121  27.467  1.00 161.43 ? 409  SER A O     1 
ATOM   3115  C  CB    . SER A 1  409  ? 6.526   -13.055  26.767  1.00 140.81 ? 409  SER A CB    1 
ATOM   3116  O  OG    . SER A 1  409  ? 5.605   -13.022  25.682  1.00 145.65 ? 409  SER A OG    1 
ATOM   3117  N  N     . GLY A 1  410  ? 5.951   -15.775  25.282  1.00 154.56 ? 410  GLY A N     1 
ATOM   3118  C  CA    . GLY A 1  410  ? 5.019   -16.805  24.897  1.00 172.52 ? 410  GLY A CA    1 
ATOM   3119  C  C     . GLY A 1  410  ? 3.933   -16.320  23.967  1.00 185.57 ? 410  GLY A C     1 
ATOM   3120  O  O     . GLY A 1  410  ? 3.615   -17.004  22.991  1.00 195.06 ? 410  GLY A O     1 
ATOM   3121  N  N     . ASP A 1  411  ? 3.356   -15.151  24.242  1.00 170.55 ? 411  ASP A N     1 
ATOM   3122  C  CA    . ASP A 1  411  ? 2.277   -14.677  23.389  1.00 174.00 ? 411  ASP A CA    1 
ATOM   3123  C  C     . ASP A 1  411  ? 2.787   -14.462  21.971  1.00 157.04 ? 411  ASP A C     1 
ATOM   3124  O  O     . ASP A 1  411  ? 3.901   -13.971  21.759  1.00 153.64 ? 411  ASP A O     1 
ATOM   3125  C  CB    . ASP A 1  411  ? 1.653   -13.395  23.931  1.00 186.95 ? 411  ASP A CB    1 
ATOM   3126  C  CG    . ASP A 1  411  ? 0.161   -13.320  23.627  1.00 192.94 ? 411  ASP A CG    1 
ATOM   3127  O  OD1   . ASP A 1  411  ? -0.306  -14.089  22.757  1.00 181.60 ? 411  ASP A OD1   1 
ATOM   3128  O  OD2   . ASP A 1  411  ? -0.549  -12.506  24.252  1.00 197.45 ? 411  ASP A OD2   1 
ATOM   3129  N  N     . ARG A 1  412  ? 1.965   -14.840  20.998  1.00 120.24 ? 412  ARG A N     1 
ATOM   3130  C  CA    . ARG A 1  412  ? 2.424   -15.137  19.650  1.00 88.13  ? 412  ARG A CA    1 
ATOM   3131  C  C     . ARG A 1  412  ? 1.944   -14.076  18.670  1.00 96.30  ? 412  ARG A C     1 
ATOM   3132  O  O     . ARG A 1  412  ? 0.740   -13.834  18.550  1.00 124.77 ? 412  ARG A O     1 
ATOM   3133  C  CB    . ARG A 1  412  ? 1.948   -16.536  19.256  1.00 90.67  ? 412  ARG A CB    1 
ATOM   3134  C  CG    . ARG A 1  412  ? 2.561   -17.101  18.003  1.00 115.15 ? 412  ARG A CG    1 
ATOM   3135  C  CD    . ARG A 1  412  ? 1.648   -18.172  17.427  1.00 126.71 ? 412  ARG A CD    1 
ATOM   3136  N  NE    . ARG A 1  412  ? 2.006   -19.460  18.015  1.00 126.35 ? 412  ARG A NE    1 
ATOM   3137  C  CZ    . ARG A 1  412  ? 1.201   -20.509  18.114  1.00 129.51 ? 412  ARG A CZ    1 
ATOM   3138  N  NH1   . ARG A 1  412  ? -0.048  -20.447  17.670  1.00 150.15 ? 412  ARG A NH1   1 
ATOM   3139  N  NH2   . ARG A 1  412  ? 1.657   -21.629  18.655  1.00 109.59 ? 412  ARG A NH2   1 
ATOM   3140  N  N     . ILE A 1  413  ? 2.896   -13.493  17.930  1.00 90.02  ? 413  ILE A N     1 
ATOM   3141  C  CA    . ILE A 1  413  ? 2.650   -12.382  17.013  1.00 81.39  ? 413  ILE A CA    1 
ATOM   3142  C  C     . ILE A 1  413  ? 2.233   -12.908  15.653  1.00 90.94  ? 413  ILE A C     1 
ATOM   3143  O  O     . ILE A 1  413  ? 2.954   -13.707  15.041  1.00 98.28  ? 413  ILE A O     1 
ATOM   3144  C  CB    . ILE A 1  413  ? 3.911   -11.520  16.876  1.00 82.10  ? 413  ILE A CB    1 
ATOM   3145  C  CG1   . ILE A 1  413  ? 4.392   -11.068  18.240  1.00 82.77  ? 413  ILE A CG1   1 
ATOM   3146  C  CG2   . ILE A 1  413  ? 3.653   -10.333  15.992  1.00 85.49  ? 413  ILE A CG2   1 
ATOM   3147  C  CD1   . ILE A 1  413  ? 5.716   -10.395  18.209  1.00 83.50  ? 413  ILE A CD1   1 
ATOM   3148  N  N     . ASP A 1  414  ? 1.143   -12.352  15.120  1.00 82.00  ? 414  ASP A N     1 
ATOM   3149  C  CA    . ASP A 1  414  ? 0.570   -12.776  13.847  1.00 85.02  ? 414  ASP A CA    1 
ATOM   3150  C  C     . ASP A 1  414  ? 0.869   -11.695  12.820  1.00 93.20  ? 414  ASP A C     1 
ATOM   3151  O  O     . ASP A 1  414  ? 0.250   -10.628  12.838  1.00 99.08  ? 414  ASP A O     1 
ATOM   3152  C  CB    . ASP A 1  414  ? -0.932  -13.019  13.987  1.00 89.44  ? 414  ASP A CB    1 
ATOM   3153  C  CG    . ASP A 1  414  ? -1.557  -13.593  12.730  1.00 98.88  ? 414  ASP A CG    1 
ATOM   3154  O  OD1   . ASP A 1  414  ? -0.874  -13.655  11.685  1.00 102.49 ? 414  ASP A OD1   1 
ATOM   3155  O  OD2   . ASP A 1  414  ? -2.751  -13.962  12.780  1.00 103.44 ? 414  ASP A OD2   1 
ATOM   3156  N  N     . LEU A 1  415  ? 1.807   -11.979  11.916  1.00 118.16 ? 415  LEU A N     1 
ATOM   3157  C  CA    . LEU A 1  415  ? 2.240   -11.000  10.925  1.00 98.35  ? 415  LEU A CA    1 
ATOM   3158  C  C     . LEU A 1  415  ? 1.141   -10.626  9.943   1.00 81.48  ? 415  LEU A C     1 
ATOM   3159  O  O     . LEU A 1  415  ? 1.333   -9.698   9.155   1.00 114.29 ? 415  LEU A O     1 
ATOM   3160  C  CB    . LEU A 1  415  ? 3.462   -11.530  10.180  1.00 97.55  ? 415  LEU A CB    1 
ATOM   3161  C  CG    . LEU A 1  415  ? 4.533   -12.170  11.065  1.00 93.14  ? 415  LEU A CG    1 
ATOM   3162  C  CD1   . LEU A 1  415  ? 5.662   -12.710  10.214  1.00 101.02 ? 415  LEU A CD1   1 
ATOM   3163  C  CD2   . LEU A 1  415  ? 5.049   -11.156  12.054  1.00 81.86  ? 415  LEU A CD2   1 
ATOM   3164  N  N     . ARG A 1  416  ? 0.025   -11.355  9.933   1.00 97.03  ? 416  ARG A N     1 
ATOM   3165  C  CA    . ARG A 1  416  ? -1.103  -10.988  9.081   1.00 93.92  ? 416  ARG A CA    1 
ATOM   3166  C  C     . ARG A 1  416  ? -1.797  -9.724   9.569   1.00 91.63  ? 416  ARG A C     1 
ATOM   3167  O  O     . ARG A 1  416  ? -2.419  -9.016   8.767   1.00 87.46  ? 416  ARG A O     1 
ATOM   3168  C  CB    . ARG A 1  416  ? -2.125  -12.122  9.029   1.00 88.23  ? 416  ARG A CB    1 
ATOM   3169  C  CG    . ARG A 1  416  ? -2.007  -13.074  7.860   1.00 107.83 ? 416  ARG A CG    1 
ATOM   3170  C  CD    . ARG A 1  416  ? -3.033  -14.174  8.030   1.00 108.13 ? 416  ARG A CD    1 
ATOM   3171  N  NE    . ARG A 1  416  ? -3.150  -14.517  9.446   1.00 112.25 ? 416  ARG A NE    1 
ATOM   3172  C  CZ    . ARG A 1  416  ? -3.936  -15.475  9.922   1.00 106.82 ? 416  ARG A CZ    1 
ATOM   3173  N  NH1   . ARG A 1  416  ? -4.688  -16.190  9.098   1.00 101.62 ? 416  ARG A NH1   1 
ATOM   3174  N  NH2   . ARG A 1  416  ? -3.968  -15.722  11.222  1.00 111.20 ? 416  ARG A NH2   1 
ATOM   3175  N  N     . TYR A 1  417  ? -1.743  -9.448   10.876  1.00 82.16  ? 417  TYR A N     1 
ATOM   3176  C  CA    . TYR A 1  417  ? -2.617  -8.458   11.499  1.00 82.88  ? 417  TYR A CA    1 
ATOM   3177  C  C     . TYR A 1  417  ? -1.867  -7.483   12.395  1.00 83.65  ? 417  TYR A C     1 
ATOM   3178  O  O     . TYR A 1  417  ? -2.226  -6.305   12.459  1.00 133.82 ? 417  TYR A O     1 
ATOM   3179  C  CB    . TYR A 1  417  ? -3.677  -9.182   12.337  1.00 92.32  ? 417  TYR A CB    1 
ATOM   3180  C  CG    . TYR A 1  417  ? -4.595  -10.104  11.556  1.00 101.55 ? 417  TYR A CG    1 
ATOM   3181  C  CD1   . TYR A 1  417  ? -4.786  -9.932   10.202  1.00 109.32 ? 417  TYR A CD1   1 
ATOM   3182  C  CD2   . TYR A 1  417  ? -5.186  -11.208  12.153  1.00 90.67  ? 417  TYR A CD2   1 
ATOM   3183  C  CE1   . TYR A 1  417  ? -5.587  -10.774  9.469   1.00 108.22 ? 417  TYR A CE1   1 
ATOM   3184  C  CE2   . TYR A 1  417  ? -5.995  -12.074  11.416  1.00 100.26 ? 417  TYR A CE2   1 
ATOM   3185  C  CZ    . TYR A 1  417  ? -6.188  -11.846  10.068  1.00 109.45 ? 417  TYR A CZ    1 
ATOM   3186  O  OH    . TYR A 1  417  ? -6.984  -12.666  9.294   1.00 103.90 ? 417  TYR A OH    1 
ATOM   3187  N  N     . SER A 1  418  ? -0.814  -7.954   13.065  1.00 96.17  ? 418  SER A N     1 
ATOM   3188  C  CA    . SER A 1  418  ? -0.107  -7.141   14.050  1.00 86.00  ? 418  SER A CA    1 
ATOM   3189  C  C     . SER A 1  418  ? 0.295   -5.814   13.436  1.00 88.77  ? 418  SER A C     1 
ATOM   3190  O  O     . SER A 1  418  ? 0.908   -5.765   12.367  1.00 108.13 ? 418  SER A O     1 
ATOM   3191  C  CB    . SER A 1  418  ? 1.122   -7.884   14.571  1.00 91.79  ? 418  SER A CB    1 
ATOM   3192  O  OG    . SER A 1  418  ? 1.710   -7.222   15.674  1.00 84.52  ? 418  SER A OG    1 
ATOM   3193  N  N     . LYS A 1  419  ? -0.036  -4.737   14.131  1.00 86.06  ? 419  LYS A N     1 
ATOM   3194  C  CA    . LYS A 1  419  ? 0.313   -3.424   13.619  1.00 98.33  ? 419  LYS A CA    1 
ATOM   3195  C  C     . LYS A 1  419  ? 1.813   -3.278   13.471  1.00 98.22  ? 419  LYS A C     1 
ATOM   3196  O  O     . LYS A 1  419  ? 2.282   -2.512   12.623  1.00 135.74 ? 419  LYS A O     1 
ATOM   3197  C  CB    . LYS A 1  419  ? -0.225  -2.331   14.532  1.00 91.84  ? 419  LYS A CB    1 
ATOM   3198  C  CG    . LYS A 1  419  ? 0.516   -2.263   15.821  1.00 88.47  ? 419  LYS A CG    1 
ATOM   3199  C  CD    . LYS A 1  419  ? 0.087   -1.088   16.615  1.00 94.55  ? 419  LYS A CD    1 
ATOM   3200  C  CE    . LYS A 1  419  ? -1.241  -1.338   17.218  1.00 89.43  ? 419  LYS A CE    1 
ATOM   3201  N  NZ    . LYS A 1  419  ? -1.027  -1.578   18.645  1.00 89.54  ? 419  LYS A NZ    1 
ATOM   3202  N  N     . ARG A 1  420  ? 2.579   -4.005   14.269  1.00 97.88  ? 420  ARG A N     1 
ATOM   3203  C  CA    . ARG A 1  420  ? 4.023   -3.909   14.223  1.00 98.31  ? 420  ARG A CA    1 
ATOM   3204  C  C     . ARG A 1  420  ? 4.675   -4.893   13.266  1.00 91.04  ? 420  ARG A C     1 
ATOM   3205  O  O     . ARG A 1  420  ? 5.896   -5.040   13.307  1.00 97.38  ? 420  ARG A O     1 
ATOM   3206  C  CB    . ARG A 1  420  ? 4.617   -4.075   15.617  1.00 87.50  ? 420  ARG A CB    1 
ATOM   3207  C  CG    . ARG A 1  420  ? 4.323   -2.903   16.506  1.00 88.61  ? 420  ARG A CG    1 
ATOM   3208  C  CD    . ARG A 1  420  ? 5.139   -2.963   17.746  1.00 88.99  ? 420  ARG A CD    1 
ATOM   3209  N  NE    . ARG A 1  420  ? 6.555   -2.855   17.436  1.00 89.38  ? 420  ARG A NE    1 
ATOM   3210  C  CZ    . ARG A 1  420  ? 7.504   -2.867   18.359  1.00 115.82 ? 420  ARG A CZ    1 
ATOM   3211  N  NH1   . ARG A 1  420  ? 7.176   -2.981   19.638  1.00 89.98  ? 420  ARG A NH1   1 
ATOM   3212  N  NH2   . ARG A 1  420  ? 8.774   -2.759   18.010  1.00 146.54 ? 420  ARG A NH2   1 
ATOM   3213  N  N     . ALA A 1  421  ? 3.903   -5.600   12.441  1.00 85.68  ? 421  ALA A N     1 
ATOM   3214  C  CA    . ALA A 1  421  ? 4.507   -6.533   11.495  1.00 84.99  ? 421  ALA A CA    1 
ATOM   3215  C  C     . ALA A 1  421  ? 5.540   -5.872   10.587  1.00 109.11 ? 421  ALA A C     1 
ATOM   3216  O  O     . ALA A 1  421  ? 6.431   -6.561   10.079  1.00 114.17 ? 421  ALA A O     1 
ATOM   3217  C  CB    . ALA A 1  421  ? 3.427   -7.207   10.656  1.00 84.22  ? 421  ALA A CB    1 
ATOM   3218  N  N     . GLY A 1  422  ? 5.469   -4.553   10.398  1.00 103.23 ? 422  GLY A N     1 
ATOM   3219  C  CA    . GLY A 1  422  ? 6.493   -3.880   9.613   1.00 88.93  ? 422  GLY A CA    1 
ATOM   3220  C  C     . GLY A 1  422  ? 7.816   -3.751   10.345  1.00 105.04 ? 422  GLY A C     1 
ATOM   3221  O  O     . GLY A 1  422  ? 8.856   -4.175   9.833   1.00 148.74 ? 422  GLY A O     1 
ATOM   3222  N  N     . ASP A 1  423  ? 7.787   -3.232   11.579  1.00 98.99  ? 423  ASP A N     1 
ATOM   3223  C  CA    . ASP A 1  423  ? 9.000   -2.907   12.327  1.00 111.93 ? 423  ASP A CA    1 
ATOM   3224  C  C     . ASP A 1  423  ? 9.260   -3.849   13.505  1.00 129.86 ? 423  ASP A C     1 
ATOM   3225  O  O     . ASP A 1  423  ? 9.531   -3.382   14.616  1.00 137.40 ? 423  ASP A O     1 
ATOM   3226  C  CB    . ASP A 1  423  ? 8.956   -1.451   12.840  1.00 128.82 ? 423  ASP A CB    1 
ATOM   3227  C  CG    . ASP A 1  423  ? 7.901   -1.219   13.945  1.00 152.47 ? 423  ASP A CG    1 
ATOM   3228  O  OD1   . ASP A 1  423  ? 7.091   -2.129   14.225  1.00 153.11 ? 423  ASP A OD1   1 
ATOM   3229  O  OD2   . ASP A 1  423  ? 7.897   -0.124   14.554  1.00 158.51 ? 423  ASP A OD2   1 
ATOM   3230  N  N     . ILE A 1  424  ? 9.174   -5.162   13.298  1.00 111.40 ? 424  ILE A N     1 
ATOM   3231  C  CA    . ILE A 1  424  ? 9.630   -6.112   14.313  1.00 103.04 ? 424  ILE A CA    1 
ATOM   3232  C  C     . ILE A 1  424  ? 11.148  -6.172   14.278  1.00 110.15 ? 424  ILE A C     1 
ATOM   3233  O  O     . ILE A 1  424  ? 11.737  -6.554   13.263  1.00 128.55 ? 424  ILE A O     1 
ATOM   3234  C  CB    . ILE A 1  424  ? 9.041   -7.511   14.103  1.00 107.13 ? 424  ILE A CB    1 
ATOM   3235  C  CG1   . ILE A 1  424  ? 7.560   -7.429   13.799  1.00 107.12 ? 424  ILE A CG1   1 
ATOM   3236  C  CG2   . ILE A 1  424  ? 9.270   -8.361   15.350  1.00 112.81 ? 424  ILE A CG2   1 
ATOM   3237  C  CD1   . ILE A 1  424  ? 6.854   -8.746   13.857  1.00 124.15 ? 424  ILE A CD1   1 
ATOM   3238  N  N     . GLN A 1  425  ? 11.787  -5.817   15.385  1.00 100.18 ? 425  GLN A N     1 
ATOM   3239  C  CA    . GLN A 1  425  ? 13.224  -6.000   15.526  1.00 125.32 ? 425  GLN A CA    1 
ATOM   3240  C  C     . GLN A 1  425  ? 13.427  -7.263   16.353  1.00 120.28 ? 425  GLN A C     1 
ATOM   3241  O  O     . GLN A 1  425  ? 13.125  -7.287   17.552  1.00 116.74 ? 425  GLN A O     1 
ATOM   3242  C  CB    . GLN A 1  425  ? 13.879  -4.780   16.173  1.00 138.78 ? 425  GLN A CB    1 
ATOM   3243  C  CG    . GLN A 1  425  ? 13.657  -3.484   15.386  1.00 154.83 ? 425  GLN A CG    1 
ATOM   3244  C  CD    . GLN A 1  425  ? 12.482  -2.667   15.905  1.00 179.74 ? 425  GLN A CD    1 
ATOM   3245  O  OE1   . GLN A 1  425  ? 12.207  -2.646   17.107  1.00 187.87 ? 425  GLN A OE1   1 
ATOM   3246  N  NE2   . GLN A 1  425  ? 11.757  -2.021   14.993  1.00 180.98 ? 425  GLN A NE2   1 
ATOM   3247  N  N     . LEU A 1  426  ? 13.912  -8.316   15.698  1.00 112.07 ? 426  LEU A N     1 
ATOM   3248  C  CA    . LEU A 1  426  ? 14.004  -9.626   16.318  1.00 110.17 ? 426  LEU A CA    1 
ATOM   3249  C  C     . LEU A 1  426  ? 15.017  -9.629   17.458  1.00 110.90 ? 426  LEU A C     1 
ATOM   3250  O  O     . LEU A 1  426  ? 15.858  -8.736   17.595  1.00 143.36 ? 426  LEU A O     1 
ATOM   3251  C  CB    . LEU A 1  426  ? 14.388  -10.695  15.290  1.00 85.86  ? 426  LEU A CB    1 
ATOM   3252  C  CG    . LEU A 1  426  ? 13.287  -11.063  14.303  1.00 84.93  ? 426  LEU A CG    1 
ATOM   3253  C  CD1   . LEU A 1  426  ? 13.728  -12.075  13.250  1.00 84.34  ? 426  LEU A CD1   1 
ATOM   3254  C  CD2   . LEU A 1  426  ? 12.128  -11.597  15.097  1.00 84.20  ? 426  LEU A CD2   1 
ATOM   3255  N  N     . GLN A 1  427  ? 14.889  -10.637  18.311  1.00 86.77  ? 427  GLN A N     1 
ATOM   3256  C  CA    . GLN A 1  427  ? 15.772  -10.829  19.444  1.00 103.02 ? 427  GLN A CA    1 
ATOM   3257  C  C     . GLN A 1  427  ? 16.206  -12.283  19.466  1.00 116.31 ? 427  GLN A C     1 
ATOM   3258  O  O     . GLN A 1  427  ? 15.450  -13.180  19.079  1.00 106.99 ? 427  GLN A O     1 
ATOM   3259  C  CB    . GLN A 1  427  ? 15.106  -10.463  20.773  1.00 94.85  ? 427  GLN A CB    1 
ATOM   3260  C  CG    . GLN A 1  427  ? 15.394  -9.042   21.230  1.00 119.36 ? 427  GLN A CG    1 
ATOM   3261  C  CD    . GLN A 1  427  ? 14.304  -8.495   22.137  1.00 149.90 ? 427  GLN A CD    1 
ATOM   3262  O  OE1   . GLN A 1  427  ? 13.999  -9.074   23.183  1.00 157.84 ? 427  GLN A OE1   1 
ATOM   3263  N  NE2   . GLN A 1  427  ? 13.696  -7.386   21.730  1.00 150.90 ? 427  GLN A NE2   1 
ATOM   3264  N  N     . TYR A 1  428  ? 17.425  -12.505  19.941  1.00 113.93 ? 428  TYR A N     1 
ATOM   3265  C  CA    . TYR A 1  428  ? 17.964  -13.850  20.034  1.00 86.88  ? 428  TYR A CA    1 
ATOM   3266  C  C     . TYR A 1  428  ? 17.112  -14.704  20.956  1.00 102.45 ? 428  TYR A C     1 
ATOM   3267  O  O     . TYR A 1  428  ? 16.636  -14.243  21.998  1.00 125.15 ? 428  TYR A O     1 
ATOM   3268  C  CB    . TYR A 1  428  ? 19.383  -13.802  20.571  1.00 94.54  ? 428  TYR A CB    1 
ATOM   3269  C  CG    . TYR A 1  428  ? 20.397  -13.249  19.617  1.00 106.36 ? 428  TYR A CG    1 
ATOM   3270  C  CD1   . TYR A 1  428  ? 20.169  -13.242  18.259  1.00 105.95 ? 428  TYR A CD1   1 
ATOM   3271  C  CD2   . TYR A 1  428  ? 21.592  -12.732  20.078  1.00 122.95 ? 428  TYR A CD2   1 
ATOM   3272  C  CE1   . TYR A 1  428  ? 21.112  -12.738  17.388  1.00 115.43 ? 428  TYR A CE1   1 
ATOM   3273  C  CE2   . TYR A 1  428  ? 22.533  -12.229  19.212  1.00 108.74 ? 428  TYR A CE2   1 
ATOM   3274  C  CZ    . TYR A 1  428  ? 22.290  -12.232  17.875  1.00 100.05 ? 428  TYR A CZ    1 
ATOM   3275  O  OH    . TYR A 1  428  ? 23.241  -11.725  17.024  1.00 120.36 ? 428  TYR A OH    1 
ATOM   3276  N  N     . GLY A 1  429  ? 16.925  -15.960  20.569  1.00 98.11  ? 429  GLY A N     1 
ATOM   3277  C  CA    . GLY A 1  429  ? 16.072  -16.862  21.301  1.00 107.91 ? 429  GLY A CA    1 
ATOM   3278  C  C     . GLY A 1  429  ? 14.631  -16.873  20.854  1.00 94.60  ? 429  GLY A C     1 
ATOM   3279  O  O     . GLY A 1  429  ? 13.939  -17.871  21.066  1.00 101.23 ? 429  GLY A O     1 
ATOM   3280  N  N     . TRP A 1  430  ? 14.157  -15.795  20.250  1.00 83.80  ? 430  TRP A N     1 
ATOM   3281  C  CA    . TRP A 1  430  ? 12.814  -15.788  19.703  1.00 83.04  ? 430  TRP A CA    1 
ATOM   3282  C  C     . TRP A 1  430  ? 12.691  -16.846  18.606  1.00 93.50  ? 430  TRP A C     1 
ATOM   3283  O  O     . TRP A 1  430  ? 13.663  -17.206  17.938  1.00 101.40 ? 430  TRP A O     1 
ATOM   3284  C  CB    . TRP A 1  430  ? 12.488  -14.407  19.144  1.00 86.64  ? 430  TRP A CB    1 
ATOM   3285  C  CG    . TRP A 1  430  ? 12.303  -13.374  20.183  1.00 84.31  ? 430  TRP A CG    1 
ATOM   3286  C  CD1   . TRP A 1  430  ? 12.648  -13.467  21.485  1.00 111.33 ? 430  TRP A CD1   1 
ATOM   3287  C  CD2   . TRP A 1  430  ? 11.718  -12.077  20.011  1.00 84.81  ? 430  TRP A CD2   1 
ATOM   3288  N  NE1   . TRP A 1  430  ? 12.321  -12.307  22.148  1.00 120.74 ? 430  TRP A NE1   1 
ATOM   3289  C  CE2   . TRP A 1  430  ? 11.746  -11.440  21.260  1.00 95.70  ? 430  TRP A CE2   1 
ATOM   3290  C  CE3   . TRP A 1  430  ? 11.174  -11.394  18.921  1.00 84.74  ? 430  TRP A CE3   1 
ATOM   3291  C  CZ2   . TRP A 1  430  ? 11.254  -10.161  21.451  1.00 105.00 ? 430  TRP A CZ2   1 
ATOM   3292  C  CZ3   . TRP A 1  430  ? 10.687  -10.124  19.116  1.00 85.45  ? 430  TRP A CZ3   1 
ATOM   3293  C  CH2   . TRP A 1  430  ? 10.731  -9.520   20.368  1.00 110.00 ? 430  TRP A CH2   1 
ATOM   3294  N  N     . LYS A 1  431  ? 11.488  -17.367  18.440  1.00 90.29  ? 431  LYS A N     1 
ATOM   3295  C  CA    . LYS A 1  431  ? 11.186  -18.276  17.344  1.00 88.67  ? 431  LYS A CA    1 
ATOM   3296  C  C     . LYS A 1  431  ? 10.522  -17.505  16.213  1.00 80.44  ? 431  LYS A C     1 
ATOM   3297  O  O     . LYS A 1  431  ? 9.729   -16.597  16.453  1.00 90.07  ? 431  LYS A O     1 
ATOM   3298  C  CB    . LYS A 1  431  ? 10.266  -19.423  17.793  1.00 86.34  ? 431  LYS A CB    1 
ATOM   3299  C  CG    . LYS A 1  431  ? 10.970  -20.665  18.317  1.00 79.69  ? 431  LYS A CG    1 
ATOM   3300  C  CD    . LYS A 1  431  ? 10.323  -21.195  19.595  1.00 94.40  ? 431  LYS A CD    1 
ATOM   3301  C  CE    . LYS A 1  431  ? 10.806  -22.599  19.925  1.00 113.94 ? 431  LYS A CE    1 
ATOM   3302  N  NZ    . LYS A 1  431  ? 10.118  -23.635  19.105  1.00 109.13 ? 431  LYS A NZ    1 
ATOM   3303  N  N     . VAL A 1  432  ? 10.901  -17.826  14.983  1.00 81.07  ? 432  VAL A N     1 
ATOM   3304  C  CA    . VAL A 1  432  ? 10.249  -17.298  13.791  1.00 80.05  ? 432  VAL A CA    1 
ATOM   3305  C  C     . VAL A 1  432  ? 9.674   -18.480  13.036  1.00 90.98  ? 432  VAL A C     1 
ATOM   3306  O  O     . VAL A 1  432  ? 10.387  -19.437  12.731  1.00 95.24  ? 432  VAL A O     1 
ATOM   3307  C  CB    . VAL A 1  432  ? 11.210  -16.506  12.890  1.00 80.69  ? 432  VAL A CB    1 
ATOM   3308  C  CG1   . VAL A 1  432  ? 10.658  -16.421  11.467  1.00 80.39  ? 432  VAL A CG1   1 
ATOM   3309  C  CG2   . VAL A 1  432  ? 11.446  -15.140  13.474  1.00 84.58  ? 432  VAL A CG2   1 
ATOM   3310  N  N     . GLU A 1  433  ? 8.401   -18.410  12.713  1.00 87.94  ? 433  GLU A N     1 
ATOM   3311  C  CA    . GLU A 1  433  ? 7.753   -19.510  12.027  1.00 78.08  ? 433  GLU A CA    1 
ATOM   3312  C  C     . GLU A 1  433  ? 7.776   -19.136  10.553  1.00 79.39  ? 433  GLU A C     1 
ATOM   3313  O  O     . GLU A 1  433  ? 6.876   -18.473  10.043  1.00 78.17  ? 433  GLU A O     1 
ATOM   3314  C  CB    . GLU A 1  433  ? 6.349   -19.743  12.555  1.00 77.68  ? 433  GLU A CB    1 
ATOM   3315  C  CG    . GLU A 1  433  ? 6.319   -20.520  13.851  1.00 83.84  ? 433  GLU A CG    1 
ATOM   3316  C  CD    . GLU A 1  433  ? 4.975   -21.140  14.090  1.00 108.27 ? 433  GLU A CD    1 
ATOM   3317  O  OE1   . GLU A 1  433  ? 4.218   -20.637  14.940  1.00 113.36 ? 433  GLU A OE1   1 
ATOM   3318  O  OE2   . GLU A 1  433  ? 4.657   -22.129  13.392  1.00 115.45 ? 433  GLU A OE2   1 
ATOM   3319  N  N     . ARG A 1  434  ? 8.852   -19.534  9.876   1.00 81.67  ? 434  ARG A N     1 
ATOM   3320  C  CA    . ARG A 1  434  ? 9.031   -19.222  8.464   1.00 93.40  ? 434  ARG A CA    1 
ATOM   3321  C  C     . ARG A 1  434  ? 8.353   -20.271  7.589   1.00 88.95  ? 434  ARG A C     1 
ATOM   3322  O  O     . ARG A 1  434  ? 8.103   -21.398  8.015   1.00 88.57  ? 434  ARG A O     1 
ATOM   3323  C  CB    . ARG A 1  434  ? 10.513  -19.177  8.092   1.00 92.61  ? 434  ARG A CB    1 
ATOM   3324  C  CG    . ARG A 1  434  ? 11.193  -20.537  8.211   1.00 81.81  ? 434  ARG A CG    1 
ATOM   3325  C  CD    . ARG A 1  434  ? 12.550  -20.579  7.518   1.00 79.12  ? 434  ARG A CD    1 
ATOM   3326  N  NE    . ARG A 1  434  ? 13.235  -21.842  7.780   1.00 87.37  ? 434  ARG A NE    1 
ATOM   3327  C  CZ    . ARG A 1  434  ? 13.126  -22.926  7.021   1.00 98.17  ? 434  ARG A CZ    1 
ATOM   3328  N  NH1   . ARG A 1  434  ? 12.365  -22.907  5.941   1.00 105.73 ? 434  ARG A NH1   1 
ATOM   3329  N  NH2   . ARG A 1  434  ? 13.783  -24.031  7.341   1.00 99.69  ? 434  ARG A NH2   1 
ATOM   3330  N  N     . HIS A 1  435  ? 8.148   -19.920  6.322   1.00 82.81  ? 435  HIS A N     1 
ATOM   3331  C  CA    . HIS A 1  435  ? 7.574   -20.856  5.366   1.00 78.01  ? 435  HIS A CA    1 
ATOM   3332  C  C     . HIS A 1  435  ? 8.545   -22.008  5.087   1.00 79.39  ? 435  HIS A C     1 
ATOM   3333  O  O     . HIS A 1  435  ? 9.755   -21.904  5.290   1.00 102.79 ? 435  HIS A O     1 
ATOM   3334  C  CB    . HIS A 1  435  ? 7.265   -20.169  4.026   1.00 94.40  ? 435  HIS A CB    1 
ATOM   3335  C  CG    . HIS A 1  435  ? 6.152   -19.172  4.072   1.00 84.66  ? 435  HIS A CG    1 
ATOM   3336  N  ND1   . HIS A 1  435  ? 6.189   -17.997  3.356   1.00 91.91  ? 435  HIS A ND1   1 
ATOM   3337  C  CD2   . HIS A 1  435  ? 4.987   -19.160  4.755   1.00 95.31  ? 435  HIS A CD2   1 
ATOM   3338  C  CE1   . HIS A 1  435  ? 5.084   -17.314  3.579   1.00 87.81  ? 435  HIS A CE1   1 
ATOM   3339  N  NE2   . HIS A 1  435  ? 4.338   -17.995  4.428   1.00 104.50 ? 435  HIS A NE2   1 
ATOM   3340  N  N     . ILE A 1  436  ? 7.989   -23.130  4.626   1.00 91.30  ? 436  ILE A N     1 
ATOM   3341  C  CA    . ILE A 1  436  ? 8.811   -24.210  4.089   1.00 76.82  ? 436  ILE A CA    1 
ATOM   3342  C  C     . ILE A 1  436  ? 9.596   -23.652  2.905   1.00 86.77  ? 436  ILE A C     1 
ATOM   3343  O  O     . ILE A 1  436  ? 9.046   -22.949  2.047   1.00 85.77  ? 436  ILE A O     1 
ATOM   3344  C  CB    . ILE A 1  436  ? 7.910   -25.401  3.701   1.00 81.48  ? 436  ILE A CB    1 
ATOM   3345  C  CG1   . ILE A 1  436  ? 7.817   -26.413  4.832   1.00 75.86  ? 436  ILE A CG1   1 
ATOM   3346  C  CG2   . ILE A 1  436  ? 8.345   -26.097  2.418   1.00 105.09 ? 436  ILE A CG2   1 
ATOM   3347  C  CD1   . ILE A 1  436  ? 7.444   -25.835  6.182   1.00 126.12 ? 436  ILE A CD1   1 
ATOM   3348  N  N     . MET A 1  437  ? 10.904  -23.870  2.896   1.00 77.67  ? 437  MET A N     1 
ATOM   3349  C  CA    . MET A 1  437  ? 11.742  -23.336  1.830   1.00 83.44  ? 437  MET A CA    1 
ATOM   3350  C  C     . MET A 1  437  ? 12.522  -24.484  1.203   1.00 86.22  ? 437  MET A C     1 
ATOM   3351  O  O     . MET A 1  437  ? 12.584  -25.590  1.746   1.00 89.46  ? 437  MET A O     1 
ATOM   3352  C  CB    . MET A 1  437  ? 12.689  -22.240  2.354   1.00 93.25  ? 437  MET A CB    1 
ATOM   3353  C  CG    . MET A 1  437  ? 11.965  -21.022  2.893   1.00 116.42 ? 437  MET A CG    1 
ATOM   3354  S  SD    . MET A 1  437  ? 13.072  -19.797  3.606   1.00 121.02 ? 437  MET A SD    1 
ATOM   3355  C  CE    . MET A 1  437  ? 14.030  -19.346  2.176   1.00 137.91 ? 437  MET A CE    1 
ATOM   3356  N  N     . ASP A 1  438  ? 13.160  -24.192  0.068   1.00 99.29  ? 438  ASP A N     1 
ATOM   3357  C  CA    . ASP A 1  438  ? 13.881  -25.207  -0.691  1.00 79.06  ? 438  ASP A CA    1 
ATOM   3358  C  C     . ASP A 1  438  ? 14.890  -25.927  0.193   1.00 80.87  ? 438  ASP A C     1 
ATOM   3359  O  O     . ASP A 1  438  ? 15.532  -25.322  1.053   1.00 108.78 ? 438  ASP A O     1 
ATOM   3360  C  CB    . ASP A 1  438  ? 14.578  -24.572  -1.893  1.00 79.82  ? 438  ASP A CB    1 
ATOM   3361  C  CG    . ASP A 1  438  ? 13.606  -24.127  -2.963  1.00 101.51 ? 438  ASP A CG    1 
ATOM   3362  O  OD1   . ASP A 1  438  ? 12.458  -23.797  -2.622  1.00 128.32 ? 438  ASP A OD1   1 
ATOM   3363  O  OD2   . ASP A 1  438  ? 13.976  -24.114  -4.154  1.00 107.59 ? 438  ASP A OD2   1 
ATOM   3364  N  N     . ASN A 1  439  ? 14.960  -27.246  0.024   1.00 93.73  ? 439  ASN A N     1 
ATOM   3365  C  CA    . ASN A 1  439  ? 15.871  -28.155  0.718   1.00 79.04  ? 439  ASN A CA    1 
ATOM   3366  C  C     . ASN A 1  439  ? 15.504  -28.377  2.178   1.00 97.10  ? 439  ASN A C     1 
ATOM   3367  O  O     . ASN A 1  439  ? 16.287  -28.979  2.918   1.00 109.29 ? 439  ASN A O     1 
ATOM   3368  C  CB    . ASN A 1  439  ? 17.322  -27.684  0.618   1.00 79.90  ? 439  ASN A CB    1 
ATOM   3369  C  CG    . ASN A 1  439  ? 17.863  -27.800  -0.772  1.00 88.51  ? 439  ASN A CG    1 
ATOM   3370  O  OD1   . ASN A 1  439  ? 17.457  -28.667  -1.539  1.00 87.59  ? 439  ASN A OD1   1 
ATOM   3371  N  ND2   . ASN A 1  439  ? 18.746  -26.885  -1.132  1.00 109.88 ? 439  ASN A ND2   1 
ATOM   3372  N  N     . ASP A 1  440  ? 14.327  -27.963  2.607   1.00 102.13 ? 440  ASP A N     1 
ATOM   3373  C  CA    . ASP A 1  440  ? 13.829  -28.428  3.886   1.00 86.64  ? 440  ASP A CA    1 
ATOM   3374  C  C     . ASP A 1  440  ? 13.535  -29.917  3.771   1.00 88.61  ? 440  ASP A C     1 
ATOM   3375  O  O     . ASP A 1  440  ? 12.875  -30.343  2.818   1.00 113.07 ? 440  ASP A O     1 
ATOM   3376  C  CB    . ASP A 1  440  ? 12.562  -27.680  4.309   1.00 81.88  ? 440  ASP A CB    1 
ATOM   3377  C  CG    . ASP A 1  440  ? 12.848  -26.310  4.917   1.00 91.21  ? 440  ASP A CG    1 
ATOM   3378  O  OD1   . ASP A 1  440  ? 13.926  -26.128  5.517   1.00 100.99 ? 440  ASP A OD1   1 
ATOM   3379  O  OD2   . ASP A 1  440  ? 11.966  -25.423  4.846   1.00 93.36  ? 440  ASP A OD2   1 
ATOM   3380  N  N     . PRO A 1  441  ? 14.025  -30.740  4.688   1.00 89.61  ? 441  PRO A N     1 
ATOM   3381  C  CA    . PRO A 1  441  ? 13.640  -32.153  4.672   1.00 77.00  ? 441  PRO A CA    1 
ATOM   3382  C  C     . PRO A 1  441  ? 12.184  -32.294  5.086   1.00 82.91  ? 441  PRO A C     1 
ATOM   3383  O  O     . PRO A 1  441  ? 11.754  -31.731  6.097   1.00 82.78  ? 441  PRO A O     1 
ATOM   3384  C  CB    . PRO A 1  441  ? 14.588  -32.789  5.690   1.00 77.30  ? 441  PRO A CB    1 
ATOM   3385  C  CG    . PRO A 1  441  ? 14.915  -31.686  6.616   1.00 78.69  ? 441  PRO A CG    1 
ATOM   3386  C  CD    . PRO A 1  441  ? 14.951  -30.433  5.787   1.00 83.39  ? 441  PRO A CD    1 
ATOM   3387  N  N     . VAL A 1  442  ? 11.405  -32.979  4.247   1.00 87.23  ? 442  VAL A N     1 
ATOM   3388  C  CA    . VAL A 1  442  ? 10.008  -33.253  4.553   1.00 75.63  ? 442  VAL A CA    1 
ATOM   3389  C  C     . VAL A 1  442  ? 9.746   -34.730  4.323   1.00 79.88  ? 442  VAL A C     1 
ATOM   3390  O  O     . VAL A 1  442  ? 10.415  -35.389  3.524   1.00 77.14  ? 442  VAL A O     1 
ATOM   3391  C  CB    . VAL A 1  442  ? 9.030   -32.404  3.719   1.00 75.46  ? 442  VAL A CB    1 
ATOM   3392  C  CG1   . VAL A 1  442  ? 9.148   -30.950  4.101   1.00 81.67  ? 442  VAL A CG1   1 
ATOM   3393  C  CG2   . VAL A 1  442  ? 9.268   -32.624  2.229   1.00 75.70  ? 442  VAL A CG2   1 
ATOM   3394  N  N     . LEU A 1  443  ? 8.760   -35.251  5.036   1.00 86.93  ? 443  LEU A N     1 
ATOM   3395  C  CA    . LEU A 1  443  ? 8.399   -36.658  4.963   1.00 81.96  ? 443  LEU A CA    1 
ATOM   3396  C  C     . LEU A 1  443  ? 7.248   -36.826  3.981   1.00 80.10  ? 443  LEU A C     1 
ATOM   3397  O  O     . LEU A 1  443  ? 6.246   -36.110  4.054   1.00 82.10  ? 443  LEU A O     1 
ATOM   3398  C  CB    . LEU A 1  443  ? 8.035   -37.205  6.342   1.00 75.06  ? 443  LEU A CB    1 
ATOM   3399  C  CG    . LEU A 1  443  ? 7.683   -38.687  6.377   1.00 81.61  ? 443  LEU A CG    1 
ATOM   3400  C  CD1   . LEU A 1  443  ? 8.659   -39.529  5.588   1.00 82.39  ? 443  LEU A CD1   1 
ATOM   3401  C  CD2   . LEU A 1  443  ? 7.672   -39.129  7.812   1.00 81.91  ? 443  LEU A CD2   1 
ATOM   3402  N  N     . PHE A 1  444  ? 7.417   -37.752  3.046   1.00 80.79  ? 444  PHE A N     1 
ATOM   3403  C  CA    . PHE A 1  444  ? 6.527   -37.930  1.909   1.00 75.23  ? 444  PHE A CA    1 
ATOM   3404  C  C     . PHE A 1  444  ? 5.983   -39.347  1.954   1.00 81.95  ? 444  PHE A C     1 
ATOM   3405  O  O     . PHE A 1  444  ? 6.751   -40.301  2.124   1.00 91.47  ? 444  PHE A O     1 
ATOM   3406  C  CB    . PHE A 1  444  ? 7.281   -37.675  0.608   1.00 75.57  ? 444  PHE A CB    1 
ATOM   3407  C  CG    . PHE A 1  444  ? 6.400   -37.375  -0.563  1.00 82.10  ? 444  PHE A CG    1 
ATOM   3408  C  CD1   . PHE A 1  444  ? 5.305   -36.562  -0.415  1.00 82.05  ? 444  PHE A CD1   1 
ATOM   3409  C  CD2   . PHE A 1  444  ? 6.709   -37.832  -1.832  1.00 89.58  ? 444  PHE A CD2   1 
ATOM   3410  C  CE1   . PHE A 1  444  ? 4.507   -36.263  -1.490  1.00 75.41  ? 444  PHE A CE1   1 
ATOM   3411  C  CE2   . PHE A 1  444  ? 5.899   -37.517  -2.909  1.00 81.10  ? 444  PHE A CE2   1 
ATOM   3412  C  CZ    . PHE A 1  444  ? 4.803   -36.741  -2.728  1.00 75.78  ? 444  PHE A CZ    1 
ATOM   3413  N  N     . ASN A 1  445  ? 4.669   -39.496  1.790   1.00 88.03  ? 445  ASN A N     1 
ATOM   3414  C  CA    . ASN A 1  445  ? 4.058   -40.798  2.021   1.00 92.47  ? 445  ASN A CA    1 
ATOM   3415  C  C     . ASN A 1  445  ? 2.900   -41.012  1.053   1.00 75.33  ? 445  ASN A C     1 
ATOM   3416  O  O     . ASN A 1  445  ? 2.158   -40.079  0.757   1.00 100.98 ? 445  ASN A O     1 
ATOM   3417  C  CB    . ASN A 1  445  ? 3.556   -40.839  3.475   1.00 95.54  ? 445  ASN A CB    1 
ATOM   3418  C  CG    . ASN A 1  445  ? 2.550   -41.934  3.750   1.00 105.69 ? 445  ASN A CG    1 
ATOM   3419  O  OD1   . ASN A 1  445  ? 2.384   -42.874  2.980   1.00 126.76 ? 445  ASN A OD1   1 
ATOM   3420  N  ND2   . ASN A 1  445  ? 1.789   -41.750  4.817   1.00 107.39 ? 445  ASN A ND2   1 
ATOM   3421  N  N     . ARG A 1  446  ? 2.772   -42.230  0.528   1.00 85.09  ? 446  ARG A N     1 
ATOM   3422  C  CA    . ARG A 1  446  ? 1.576   -42.636  -0.204  1.00 94.96  ? 446  ARG A CA    1 
ATOM   3423  C  C     . ARG A 1  446  ? 0.941   -43.835  0.484   1.00 90.75  ? 446  ARG A C     1 
ATOM   3424  O  O     . ARG A 1  446  ? 1.644   -44.693  1.021   1.00 90.91  ? 446  ARG A O     1 
ATOM   3425  C  CB    . ARG A 1  446  ? 1.866   -42.999  -1.645  1.00 79.11  ? 446  ARG A CB    1 
ATOM   3426  C  CG    . ARG A 1  446  ? 0.617   -43.224  -2.469  1.00 76.50  ? 446  ARG A CG    1 
ATOM   3427  C  CD    . ARG A 1  446  ? 0.911   -44.131  -3.641  1.00 98.12  ? 446  ARG A CD    1 
ATOM   3428  N  NE    . ARG A 1  446  ? -0.286  -44.652  -4.288  1.00 89.41  ? 446  ARG A NE    1 
ATOM   3429  C  CZ    . ARG A 1  446  ? -0.806  -45.850  -4.039  1.00 110.86 ? 446  ARG A CZ    1 
ATOM   3430  N  NH1   . ARG A 1  446  ? -0.240  -46.666  -3.159  1.00 103.58 ? 446  ARG A NH1   1 
ATOM   3431  N  NH2   . ARG A 1  446  ? -1.894  -46.241  -4.683  1.00 145.32 ? 446  ARG A NH2   1 
ATOM   3432  N  N     . GLN A 1  447  ? -0.389  -43.925  0.419   1.00 85.49  ? 447  GLN A N     1 
ATOM   3433  C  CA    . GLN A 1  447  ? -1.081  -44.938  1.208   1.00 76.25  ? 447  GLN A CA    1 
ATOM   3434  C  C     . GLN A 1  447  ? -1.772  -45.948  0.299   1.00 76.79  ? 447  GLN A C     1 
ATOM   3435  O  O     . GLN A 1  447  ? -2.228  -45.596  -0.791  1.00 105.04 ? 447  GLN A O     1 
ATOM   3436  C  CB    . GLN A 1  447  ? -2.098  -44.289  2.165   1.00 78.78  ? 447  GLN A CB    1 
ATOM   3437  C  CG    . GLN A 1  447  ? -1.428  -43.381  3.187   1.00 80.35  ? 447  GLN A CG    1 
ATOM   3438  C  CD    . GLN A 1  447  ? -2.317  -42.285  3.683   1.00 101.45 ? 447  GLN A CD    1 
ATOM   3439  O  OE1   . GLN A 1  447  ? -2.484  -42.121  4.884   1.00 95.42  ? 447  GLN A OE1   1 
ATOM   3440  N  NE2   . GLN A 1  447  ? -2.917  -41.542  2.761   1.00 120.57 ? 447  GLN A NE2   1 
ATOM   3441  N  N     . PRO A 1  448  ? -1.892  -47.210  0.729   1.00 77.17  ? 448  PRO A N     1 
ATOM   3442  C  CA    . PRO A 1  448  ? -1.495  -47.717  2.044   1.00 78.76  ? 448  PRO A CA    1 
ATOM   3443  C  C     . PRO A 1  448  ? 0.011   -47.817  2.236   1.00 95.13  ? 448  PRO A C     1 
ATOM   3444  O  O     . PRO A 1  448  ? 0.730   -48.073  1.275   1.00 90.07  ? 448  PRO A O     1 
ATOM   3445  C  CB    . PRO A 1  448  ? -2.109  -49.112  2.060   1.00 79.36  ? 448  PRO A CB    1 
ATOM   3446  C  CG    . PRO A 1  448  ? -2.100  -49.522  0.619   1.00 82.21  ? 448  PRO A CG    1 
ATOM   3447  C  CD    . PRO A 1  448  ? -2.381  -48.283  -0.154  1.00 83.81  ? 448  PRO A CD    1 
ATOM   3448  N  N     . SER A 1  449  ? 0.466   -47.630  3.476   1.00 96.19  ? 449  SER A N     1 
ATOM   3449  C  CA    . SER A 1  449  ? 1.892   -47.638  3.804   1.00 85.81  ? 449  SER A CA    1 
ATOM   3450  C  C     . SER A 1  449  ? 2.295   -49.048  4.213   1.00 95.26  ? 449  SER A C     1 
ATOM   3451  O  O     . SER A 1  449  ? 2.337   -49.381  5.403   1.00 97.35  ? 449  SER A O     1 
ATOM   3452  C  CB    . SER A 1  449  ? 2.138   -46.652  4.931   1.00 76.36  ? 449  SER A CB    1 
ATOM   3453  O  OG    . SER A 1  449  ? 1.462   -45.440  4.636   1.00 89.75  ? 449  SER A OG    1 
ATOM   3454  N  N     . LEU A 1  450  ? 2.729   -49.845  3.233   1.00 77.85  ? 450  LEU A N     1 
ATOM   3455  C  CA    . LEU A 1  450  ? 2.938   -51.266  3.482   1.00 95.83  ? 450  LEU A CA    1 
ATOM   3456  C  C     . LEU A 1  450  ? 4.332   -51.562  4.030   1.00 110.97 ? 450  LEU A C     1 
ATOM   3457  O  O     . LEU A 1  450  ? 4.470   -52.281  5.025   1.00 98.92  ? 450  LEU A O     1 
ATOM   3458  C  CB    . LEU A 1  450  ? 2.695   -52.061  2.194   1.00 81.87  ? 450  LEU A CB    1 
ATOM   3459  C  CG    . LEU A 1  450  ? 1.318   -51.840  1.575   1.00 84.59  ? 450  LEU A CG    1 
ATOM   3460  C  CD1   . LEU A 1  450  ? 1.161   -52.572  0.233   1.00 107.32 ? 450  LEU A CD1   1 
ATOM   3461  C  CD2   . LEU A 1  450  ? 0.248   -52.237  2.580   1.00 79.04  ? 450  LEU A CD2   1 
ATOM   3462  N  N     . HIS A 1  451  ? 5.369   -51.013  3.411   1.00 88.03  ? 451  HIS A N     1 
ATOM   3463  C  CA    . HIS A 1  451  ? 6.707   -51.127  3.955   1.00 93.11  ? 451  HIS A CA    1 
ATOM   3464  C  C     . HIS A 1  451  ? 7.275   -49.740  4.216   1.00 91.12  ? 451  HIS A C     1 
ATOM   3465  O  O     . HIS A 1  451  ? 6.709   -48.724  3.800   1.00 89.13  ? 451  HIS A O     1 
ATOM   3466  C  CB    . HIS A 1  451  ? 7.625   -51.928  3.028   1.00 111.87 ? 451  HIS A CB    1 
ATOM   3467  C  CG    . HIS A 1  451  ? 7.573   -51.501  1.594   1.00 96.29  ? 451  HIS A CG    1 
ATOM   3468  N  ND1   . HIS A 1  451  ? 7.463   -52.407  0.562   1.00 103.31 ? 451  HIS A ND1   1 
ATOM   3469  C  CD2   . HIS A 1  451  ? 7.549   -50.275  1.021   1.00 98.69  ? 451  HIS A CD2   1 
ATOM   3470  C  CE1   . HIS A 1  451  ? 7.449   -51.760  -0.590  1.00 114.84 ? 451  HIS A CE1   1 
ATOM   3471  N  NE2   . HIS A 1  451  ? 7.485   -50.464  -0.339  1.00 100.84 ? 451  HIS A NE2   1 
ATOM   3472  N  N     . LYS A 1  452  ? 8.432   -49.701  4.894   1.00 104.51 ? 452  LYS A N     1 
ATOM   3473  C  CA    . LYS A 1  452  ? 8.980   -48.416  5.332   1.00 103.58 ? 452  LYS A CA    1 
ATOM   3474  C  C     . LYS A 1  452  ? 9.315   -47.495  4.171   1.00 84.41  ? 452  LYS A C     1 
ATOM   3475  O  O     . LYS A 1  452  ? 9.287   -46.271  4.347   1.00 85.78  ? 452  LYS A O     1 
ATOM   3476  C  CB    . LYS A 1  452  ? 10.224  -48.610  6.221   1.00 85.27  ? 452  LYS A CB    1 
ATOM   3477  C  CG    . LYS A 1  452  ? 11.433  -49.266  5.530   1.00 85.47  ? 452  LYS A CG    1 
ATOM   3478  C  CD    . LYS A 1  452  ? 12.772  -48.781  6.120   1.00 91.15  ? 452  LYS A CD    1 
ATOM   3479  C  CE    . LYS A 1  452  ? 13.945  -49.757  6.078   1.00 80.12  ? 452  LYS A CE    1 
ATOM   3480  N  NZ    . LYS A 1  452  ? 14.052  -50.503  7.361   1.00 90.17  ? 452  LYS A NZ    1 
ATOM   3481  N  N     . MET A 1  453  ? 9.563   -48.049  2.985   1.00 88.06  ? 453  MET A N     1 
ATOM   3482  C  CA    . MET A 1  453  ? 9.842   -47.251  1.796   1.00 92.50  ? 453  MET A CA    1 
ATOM   3483  C  C     . MET A 1  453  ? 8.612   -46.514  1.280   1.00 77.69  ? 453  MET A C     1 
ATOM   3484  O  O     . MET A 1  453  ? 8.725   -45.775  0.300   1.00 84.95  ? 453  MET A O     1 
ATOM   3485  C  CB    . MET A 1  453  ? 10.428  -48.147  0.706   1.00 78.86  ? 453  MET A CB    1 
ATOM   3486  C  CG    . MET A 1  453  ? 11.738  -48.796  1.095   1.00 117.16 ? 453  MET A CG    1 
ATOM   3487  S  SD    . MET A 1  453  ? 11.476  -50.489  1.609   1.00 123.44 ? 453  MET A SD    1 
ATOM   3488  C  CE    . MET A 1  453  ? 11.212  -51.312  0.040   1.00 121.84 ? 453  MET A CE    1 
ATOM   3489  N  N     . SER A 1  454  ? 7.437   -46.754  1.873   1.00 83.85  ? 454  SER A N     1 
ATOM   3490  C  CA    . SER A 1  454  ? 6.239   -45.988  1.550   1.00 94.28  ? 454  SER A CA    1 
ATOM   3491  C  C     . SER A 1  454  ? 6.277   -44.607  2.186   1.00 92.49  ? 454  SER A C     1 
ATOM   3492  O  O     . SER A 1  454  ? 5.487   -43.741  1.803   1.00 77.32  ? 454  SER A O     1 
ATOM   3493  C  CB    . SER A 1  454  ? 4.963   -46.716  1.996   1.00 76.97  ? 454  SER A CB    1 
ATOM   3494  O  OG    . SER A 1  454  ? 4.534   -47.658  1.028   1.00 105.99 ? 454  SER A OG    1 
ATOM   3495  N  N     . MET A 1  455  ? 7.164   -44.391  3.154   1.00 81.40  ? 455  MET A N     1 
ATOM   3496  C  CA    . MET A 1  455  ? 7.371   -43.077  3.750   1.00 80.06  ? 455  MET A CA    1 
ATOM   3497  C  C     . MET A 1  455  ? 8.850   -42.748  3.671   1.00 82.49  ? 455  MET A C     1 
ATOM   3498  O  O     . MET A 1  455  ? 9.674   -43.425  4.284   1.00 77.77  ? 455  MET A O     1 
ATOM   3499  C  CB    . MET A 1  455  ? 6.880   -43.013  5.197   1.00 77.78  ? 455  MET A CB    1 
ATOM   3500  C  CG    . MET A 1  455  ? 5.454   -43.428  5.366   1.00 92.05  ? 455  MET A CG    1 
ATOM   3501  S  SD    . MET A 1  455  ? 4.735   -42.893  6.944   1.00 100.38 ? 455  MET A SD    1 
ATOM   3502  C  CE    . MET A 1  455  ? 5.209   -41.197  7.036   1.00 96.73  ? 455  MET A CE    1 
ATOM   3503  N  N     . MET A 1  456  ? 9.191   -41.705  2.928   1.00 106.32 ? 456  MET A N     1 
ATOM   3504  C  CA    . MET A 1  456  ? 10.593  -41.403  2.731   1.00 90.93  ? 456  MET A CA    1 
ATOM   3505  C  C     . MET A 1  456  ? 10.792  -39.893  2.793   1.00 97.04  ? 456  MET A C     1 
ATOM   3506  O  O     . MET A 1  456  ? 9.891   -39.111  2.478   1.00 94.72  ? 456  MET A O     1 
ATOM   3507  C  CB    . MET A 1  456  ? 11.077  -41.979  1.405   1.00 82.92  ? 456  MET A CB    1 
ATOM   3508  C  CG    . MET A 1  456  ? 11.276  -43.484  1.423   1.00 77.52  ? 456  MET A CG    1 
ATOM   3509  S  SD    . MET A 1  456  ? 11.986  -44.014  -0.146  1.00 87.34  ? 456  MET A SD    1 
ATOM   3510  C  CE    . MET A 1  456  ? 10.686  -43.557  -1.282  1.00 77.87  ? 456  MET A CE    1 
ATOM   3511  N  N     . ALA A 1  457  ? 11.993  -39.483  3.170   1.00 100.45 ? 457  ALA A N     1 
ATOM   3512  C  CA    . ALA A 1  457  ? 12.276  -38.073  3.361   1.00 86.44  ? 457  ALA A CA    1 
ATOM   3513  C  C     . ALA A 1  457  ? 12.841  -37.485  2.079   1.00 90.90  ? 457  ALA A C     1 
ATOM   3514  O  O     . ALA A 1  457  ? 13.825  -38.001  1.541   1.00 85.55  ? 457  ALA A O     1 
ATOM   3515  C  CB    . ALA A 1  457  ? 13.259  -37.894  4.517   1.00 79.10  ? 457  ALA A CB    1 
ATOM   3516  N  N     . HIS A 1  458  ? 12.221  -36.406  1.599   1.00 76.75  ? 458  HIS A N     1 
ATOM   3517  C  CA    . HIS A 1  458  ? 12.628  -35.726  0.377   1.00 77.08  ? 458  HIS A CA    1 
ATOM   3518  C  C     . HIS A 1  458  ? 13.121  -34.321  0.707   1.00 92.31  ? 458  HIS A C     1 
ATOM   3519  O  O     . HIS A 1  458  ? 12.925  -33.799  1.814   1.00 92.49  ? 458  HIS A O     1 
ATOM   3520  C  CB    . HIS A 1  458  ? 11.463  -35.624  -0.622  1.00 76.85  ? 458  HIS A CB    1 
ATOM   3521  C  CG    . HIS A 1  458  ? 10.981  -36.940  -1.151  1.00 84.44  ? 458  HIS A CG    1 
ATOM   3522  N  ND1   . HIS A 1  458  ? 11.029  -37.263  -2.490  1.00 83.59  ? 458  HIS A ND1   1 
ATOM   3523  C  CD2   . HIS A 1  458  ? 10.423  -38.004  -0.527  1.00 82.82  ? 458  HIS A CD2   1 
ATOM   3524  C  CE1   . HIS A 1  458  ? 10.526  -38.471  -2.669  1.00 85.96  ? 458  HIS A CE1   1 
ATOM   3525  N  NE2   . HIS A 1  458  ? 10.148  -38.942  -1.494  1.00 82.15  ? 458  HIS A NE2   1 
ATOM   3526  N  N     . ARG A 1  459  ? 13.703  -33.691  -0.307  1.00 84.54  ? 459  ARG A N     1 
ATOM   3527  C  CA    . ARG A 1  459  ? 14.139  -32.305  -0.255  1.00 77.88  ? 459  ARG A CA    1 
ATOM   3528  C  C     . ARG A 1  459  ? 13.093  -31.446  -0.950  1.00 77.66  ? 459  ARG A C     1 
ATOM   3529  O  O     . ARG A 1  459  ? 12.781  -31.683  -2.120  1.00 102.45 ? 459  ARG A O     1 
ATOM   3530  C  CB    . ARG A 1  459  ? 15.502  -32.154  -0.931  1.00 78.65  ? 459  ARG A CB    1 
ATOM   3531  C  CG    . ARG A 1  459  ? 16.682  -32.307  0.015   1.00 79.02  ? 459  ARG A CG    1 
ATOM   3532  C  CD    . ARG A 1  459  ? 17.953  -32.626  -0.721  1.00 79.81  ? 459  ARG A CD    1 
ATOM   3533  N  NE    . ARG A 1  459  ? 18.233  -31.693  -1.800  1.00 109.41 ? 459  ARG A NE    1 
ATOM   3534  C  CZ    . ARG A 1  459  ? 18.315  -32.076  -3.065  1.00 106.57 ? 459  ARG A CZ    1 
ATOM   3535  N  NH1   . ARG A 1  459  ? 18.134  -33.354  -3.353  1.00 80.49  ? 459  ARG A NH1   1 
ATOM   3536  N  NH2   . ARG A 1  459  ? 18.587  -31.203  -4.028  1.00 95.70  ? 459  ARG A NH2   1 
ATOM   3537  N  N     . VAL A 1  460  ? 12.580  -30.432  -0.255  1.00 77.42  ? 460  VAL A N     1 
ATOM   3538  C  CA    . VAL A 1  460  ? 11.575  -29.559  -0.846  1.00 77.28  ? 460  VAL A CA    1 
ATOM   3539  C  C     . VAL A 1  460  ? 12.192  -28.786  -2.007  1.00 104.84 ? 460  VAL A C     1 
ATOM   3540  O  O     . VAL A 1  460  ? 13.359  -28.361  -1.956  1.00 78.71  ? 460  VAL A O     1 
ATOM   3541  C  CB    . VAL A 1  460  ? 10.999  -28.590  0.205   1.00 77.02  ? 460  VAL A CB    1 
ATOM   3542  C  CG1   . VAL A 1  460  ? 10.195  -27.489  -0.464  1.00 77.08  ? 460  VAL A CG1   1 
ATOM   3543  C  CG2   . VAL A 1  460  ? 10.148  -29.299  1.206   1.00 76.45  ? 460  VAL A CG2   1 
ATOM   3544  N  N     . LYS A 1  461  ? 11.431  -28.678  -3.101  1.00 92.63  ? 461  LYS A N     1 
ATOM   3545  C  CA    . LYS A 1  461  ? 11.675  -27.681  -4.138  1.00 90.12  ? 461  LYS A CA    1 
ATOM   3546  C  C     . LYS A 1  461  ? 10.347  -26.995  -4.391  1.00 96.64  ? 461  LYS A C     1 
ATOM   3547  O  O     . LYS A 1  461  ? 9.435   -27.601  -4.964  1.00 110.02 ? 461  LYS A O     1 
ATOM   3548  C  CB    . LYS A 1  461  ? 12.210  -28.283  -5.437  1.00 78.95  ? 461  LYS A CB    1 
ATOM   3549  C  CG    . LYS A 1  461  ? 12.858  -27.232  -6.319  1.00 79.70  ? 461  LYS A CG    1 
ATOM   3550  C  CD    . LYS A 1  461  ? 12.875  -27.602  -7.792  1.00 100.80 ? 461  LYS A CD    1 
ATOM   3551  C  CE    . LYS A 1  461  ? 13.303  -26.404  -8.616  1.00 102.34 ? 461  LYS A CE    1 
ATOM   3552  N  NZ    . LYS A 1  461  ? 14.343  -25.631  -7.889  1.00 115.40 ? 461  LYS A NZ    1 
ATOM   3553  N  N     . VAL A 1  462  ? 10.216  -25.758  -3.912  1.00 97.23  ? 462  VAL A N     1 
ATOM   3554  C  CA    . VAL A 1  462  ? 8.979   -25.011  -4.096  1.00 78.19  ? 462  VAL A CA    1 
ATOM   3555  C  C     . VAL A 1  462  ? 8.827   -24.680  -5.574  1.00 78.69  ? 462  VAL A C     1 
ATOM   3556  O  O     . VAL A 1  462  ? 9.772   -24.211  -6.219  1.00 101.43 ? 462  VAL A O     1 
ATOM   3557  C  CB    . VAL A 1  462  ? 8.944   -23.754  -3.214  1.00 78.29  ? 462  VAL A CB    1 
ATOM   3558  C  CG1   . VAL A 1  462  ? 7.581   -23.145  -3.260  1.00 78.12  ? 462  VAL A CG1   1 
ATOM   3559  C  CG2   . VAL A 1  462  ? 9.297   -24.085  -1.778  1.00 101.66 ? 462  VAL A CG2   1 
ATOM   3560  N  N     . ILE A 1  463  ? 7.663   -24.996  -6.131  1.00 78.49  ? 463  ILE A N     1 
ATOM   3561  C  CA    . ILE A 1  463  ? 7.329   -24.881  -7.550  1.00 86.39  ? 463  ILE A CA    1 
ATOM   3562  C  C     . ILE A 1  463  ? 5.901   -24.362  -7.659  1.00 93.86  ? 463  ILE A C     1 
ATOM   3563  O  O     . ILE A 1  463  ? 5.242   -24.172  -6.627  1.00 85.16  ? 463  ILE A O     1 
ATOM   3564  C  CB    . ILE A 1  463  ? 7.409   -26.247  -8.232  1.00 78.89  ? 463  ILE A CB    1 
ATOM   3565  C  CG1   . ILE A 1  463  ? 6.338   -27.126  -7.593  1.00 78.22  ? 463  ILE A CG1   1 
ATOM   3566  C  CG2   . ILE A 1  463  ? 8.786   -26.851  -8.111  1.00 102.54 ? 463  ILE A CG2   1 
ATOM   3567  C  CD1   . ILE A 1  463  ? 6.404   -28.543  -7.992  1.00 121.69 ? 463  ILE A CD1   1 
ATOM   3568  N  N     . PRO A 1  464  ? 5.381   -24.102  -8.878  1.00 104.54 ? 464  PRO A N     1 
ATOM   3569  C  CA    . PRO A 1  464  ? 3.952   -23.785  -9.014  1.00 89.06  ? 464  PRO A CA    1 
ATOM   3570  C  C     . PRO A 1  464  ? 3.081   -25.005  -9.303  1.00 97.78  ? 464  PRO A C     1 
ATOM   3571  O  O     . PRO A 1  464  ? 3.587   -26.130  -9.355  1.00 144.19 ? 464  PRO A O     1 
ATOM   3572  C  CB    . PRO A 1  464  ? 3.945   -22.798  -10.182 1.00 88.50  ? 464  PRO A CB    1 
ATOM   3573  C  CG    . PRO A 1  464  ? 5.083   -23.215  -11.011 1.00 80.41  ? 464  PRO A CG    1 
ATOM   3574  C  CD    . PRO A 1  464  ? 6.141   -23.678  -10.070 1.00 80.04  ? 464  PRO A CD    1 
ATOM   3575  N  N     . TYR A 1  465  ? 1.767   -24.779  -9.408  1.00 78.85  ? 465  TYR A N     1 
ATOM   3576  C  CA    . TYR A 1  465  ? 0.787   -25.610  -10.113 1.00 106.47 ? 465  TYR A CA    1 
ATOM   3577  C  C     . TYR A 1  465  ? 0.062   -26.682  -9.305  1.00 117.60 ? 465  TYR A C     1 
ATOM   3578  O  O     . TYR A 1  465  ? -0.599  -27.547  -9.892  1.00 145.66 ? 465  TYR A O     1 
ATOM   3579  C  CB    . TYR A 1  465  ? 1.428   -26.291  -11.319 1.00 103.23 ? 465  TYR A CB    1 
ATOM   3580  C  CG    . TYR A 1  465  ? 1.706   -25.349  -12.451 1.00 87.95  ? 465  TYR A CG    1 
ATOM   3581  C  CD1   . TYR A 1  465  ? 0.684   -24.725  -13.128 1.00 91.08  ? 465  TYR A CD1   1 
ATOM   3582  C  CD2   . TYR A 1  465  ? 2.999   -25.135  -12.887 1.00 97.51  ? 465  TYR A CD2   1 
ATOM   3583  C  CE1   . TYR A 1  465  ? 0.945   -23.864  -14.181 1.00 103.71 ? 465  TYR A CE1   1 
ATOM   3584  C  CE2   . TYR A 1  465  ? 3.262   -24.287  -13.940 1.00 125.34 ? 465  TYR A CE2   1 
ATOM   3585  C  CZ    . TYR A 1  465  ? 2.233   -23.654  -14.586 1.00 112.55 ? 465  TYR A CZ    1 
ATOM   3586  O  OH    . TYR A 1  465  ? 2.498   -22.802  -15.636 1.00 124.57 ? 465  TYR A OH    1 
ATOM   3587  N  N     . SER A 1  466  ? 0.135   -26.634  -7.983  1.00 84.74  ? 466  SER A N     1 
ATOM   3588  C  CA    . SER A 1  466  ? -0.809  -27.343  -7.121  1.00 101.27 ? 466  SER A CA    1 
ATOM   3589  C  C     . SER A 1  466  ? -0.608  -28.855  -7.081  1.00 89.69  ? 466  SER A C     1 
ATOM   3590  O  O     . SER A 1  466  ? -1.415  -29.539  -6.437  1.00 90.35  ? 466  SER A O     1 
ATOM   3591  C  CB    . SER A 1  466  ? -2.277  -27.108  -7.534  1.00 88.37  ? 466  SER A CB    1 
ATOM   3592  O  OG    . SER A 1  466  ? -2.585  -25.738  -7.740  1.00 106.03 ? 466  SER A OG    1 
ATOM   3593  N  N     . THR A 1  467  ? 0.457   -29.405  -7.680  1.00 97.85  ? 467  THR A N     1 
ATOM   3594  C  CA    . THR A 1  467  ? 0.717   -30.844  -7.619  1.00 89.82  ? 467  THR A CA    1 
ATOM   3595  C  C     . THR A 1  467  ? 2.079   -31.119  -7.008  1.00 89.00  ? 467  THR A C     1 
ATOM   3596  O  O     . THR A 1  467  ? 3.059   -30.432  -7.316  1.00 108.96 ? 467  THR A O     1 
ATOM   3597  C  CB    . THR A 1  467  ? 0.709   -31.574  -9.006  1.00 77.54  ? 467  THR A CB    1 
ATOM   3598  O  OG1   . THR A 1  467  ? 1.410   -30.806  -9.995  1.00 109.12 ? 467  THR A OG1   1 
ATOM   3599  C  CG2   . THR A 1  467  ? -0.676  -31.938  -9.465  1.00 77.70  ? 467  THR A CG2   1 
ATOM   3600  N  N     . PHE A 1  468  ? 2.119   -32.110  -6.119  1.00 88.82  ? 468  PHE A N     1 
ATOM   3601  C  CA    . PHE A 1  468  ? 3.382   -32.728  -5.732  1.00 89.98  ? 468  PHE A CA    1 
ATOM   3602  C  C     . PHE A 1  468  ? 4.051   -33.359  -6.943  1.00 90.21  ? 468  PHE A C     1 
ATOM   3603  O  O     . PHE A 1  468  ? 3.414   -34.042  -7.749  1.00 95.16  ? 468  PHE A O     1 
ATOM   3604  C  CB    . PHE A 1  468  ? 3.133   -33.781  -4.659  1.00 76.91  ? 468  PHE A CB    1 
ATOM   3605  C  CG    . PHE A 1  468  ? 2.778   -33.221  -3.327  1.00 75.62  ? 468  PHE A CG    1 
ATOM   3606  C  CD1   . PHE A 1  468  ? 3.186   -31.963  -2.968  1.00 91.61  ? 468  PHE A CD1   1 
ATOM   3607  C  CD2   . PHE A 1  468  ? 1.989   -33.924  -2.451  1.00 75.32  ? 468  PHE A CD2   1 
ATOM   3608  C  CE1   . PHE A 1  468  ? 2.883   -31.453  -1.720  1.00 83.71  ? 468  PHE A CE1   1 
ATOM   3609  C  CE2   . PHE A 1  468  ? 1.658   -33.395  -1.220  1.00 75.00  ? 468  PHE A CE2   1 
ATOM   3610  C  CZ    . PHE A 1  468  ? 2.110   -32.165  -0.860  1.00 79.10  ? 468  PHE A CZ    1 
ATOM   3611  N  N     . ARG A 1  469  ? 5.343   -33.150  -7.077  1.00 77.15  ? 469  ARG A N     1 
ATOM   3612  C  CA    . ARG A 1  469  ? 6.037   -33.684  -8.228  1.00 78.16  ? 469  ARG A CA    1 
ATOM   3613  C  C     . ARG A 1  469  ? 7.115   -34.647  -7.748  1.00 77.72  ? 469  ARG A C     1 
ATOM   3614  O  O     . ARG A 1  469  ? 7.905   -34.310  -6.855  1.00 77.56  ? 469  ARG A O     1 
ATOM   3615  C  CB    . ARG A 1  469  ? 6.581   -32.533  -9.085  1.00 78.18  ? 469  ARG A CB    1 
ATOM   3616  C  CG    . ARG A 1  469  ? 5.524   -31.480  -9.474  1.00 78.21  ? 469  ARG A CG    1 
ATOM   3617  C  CD    . ARG A 1  469  ? 5.953   -30.655  -10.695 1.00 78.89  ? 469  ARG A CD    1 
ATOM   3618  N  NE    . ARG A 1  469  ? 5.811   -31.360  -11.957 1.00 79.39  ? 469  ARG A NE    1 
ATOM   3619  C  CZ    . ARG A 1  469  ? 4.662   -31.516  -12.618 1.00 109.53 ? 469  ARG A CZ    1 
ATOM   3620  N  NH1   . ARG A 1  469  ? 3.524   -31.021  -12.156 1.00 118.56 ? 469  ARG A NH1   1 
ATOM   3621  N  NH2   . ARG A 1  469  ? 4.659   -32.180  -13.766 1.00 95.16  ? 469  ARG A NH2   1 
ATOM   3622  N  N     . LEU A 1  470  ? 7.103   -35.855  -8.307  1.00 77.96  ? 470  LEU A N     1 
ATOM   3623  C  CA    . LEU A 1  470  ? 8.000   -36.934  -7.938  1.00 78.08  ? 470  LEU A CA    1 
ATOM   3624  C  C     . LEU A 1  470  ? 8.947   -37.237  -9.085  1.00 81.49  ? 470  LEU A C     1 
ATOM   3625  O  O     . LEU A 1  470  ? 8.591   -37.091  -10.258 1.00 98.27  ? 470  LEU A O     1 
ATOM   3626  C  CB    . LEU A 1  470  ? 7.218   -38.205  -7.618  1.00 78.17  ? 470  LEU A CB    1 
ATOM   3627  C  CG    . LEU A 1  470  ? 6.334   -38.329  -6.390  1.00 88.66  ? 470  LEU A CG    1 
ATOM   3628  C  CD1   . LEU A 1  470  ? 5.280   -37.264  -6.320  1.00 121.16 ? 470  LEU A CD1   1 
ATOM   3629  C  CD2   . LEU A 1  470  ? 5.675   -39.686  -6.423  1.00 106.51 ? 470  LEU A CD2   1 
ATOM   3630  N  N     . ASN A 1  471  ? 10.137  -37.711  -8.744  1.00 79.02  ? 471  ASN A N     1 
ATOM   3631  C  CA    . ASN A 1  471  ? 10.998  -38.331  -9.736  1.00 90.39  ? 471  ASN A CA    1 
ATOM   3632  C  C     . ASN A 1  471  ? 10.488  -39.728  -10.038 1.00 98.97  ? 471  ASN A C     1 
ATOM   3633  O  O     . ASN A 1  471  ? 10.025  -40.436  -9.144  1.00 121.15 ? 471  ASN A O     1 
ATOM   3634  C  CB    . ASN A 1  471  ? 12.449  -38.381  -9.261  1.00 95.00  ? 471  ASN A CB    1 
ATOM   3635  C  CG    . ASN A 1  471  ? 13.356  -38.983  -10.289 1.00 87.09  ? 471  ASN A CG    1 
ATOM   3636  O  OD1   . ASN A 1  471  ? 14.104  -39.910  -10.013 1.00 92.39  ? 471  ASN A OD1   1 
ATOM   3637  N  ND2   . ASN A 1  471  ? 13.247  -38.496  -11.507 1.00 108.21 ? 471  ASN A ND2   1 
ATOM   3638  N  N     . LEU A 1  472  ? 10.499  -40.100  -11.307 1.00 80.52  ? 472  LEU A N     1 
ATOM   3639  C  CA    . LEU A 1  472  ? 9.774   -41.309  -11.668 1.00 80.69  ? 472  LEU A CA    1 
ATOM   3640  C  C     . LEU A 1  472  ? 10.423  -42.578  -11.124 1.00 101.32 ? 472  LEU A C     1 
ATOM   3641  O  O     . LEU A 1  472  ? 9.703   -43.553  -10.855 1.00 91.80  ? 472  LEU A O     1 
ATOM   3642  C  CB    . LEU A 1  472  ? 9.625   -41.376  -13.180 1.00 81.40  ? 472  LEU A CB    1 
ATOM   3643  C  CG    . LEU A 1  472  ? 8.389   -40.620  -13.629 1.00 93.24  ? 472  LEU A CG    1 
ATOM   3644  C  CD1   . LEU A 1  472  ? 8.603   -40.032  -14.962 1.00 115.20 ? 472  LEU A CD1   1 
ATOM   3645  C  CD2   . LEU A 1  472  ? 7.264   -41.607  -13.693 1.00 81.16  ? 472  LEU A CD2   1 
ATOM   3646  N  N     . SER A 1  473  ? 11.720  -42.540  -10.790 1.00 82.47  ? 473  SER A N     1 
ATOM   3647  C  CA    . SER A 1  473  ? 12.337  -43.750  -10.262 1.00 100.56 ? 473  SER A CA    1 
ATOM   3648  C  C     . SER A 1  473  ? 11.867  -44.071  -8.856  1.00 100.26 ? 473  SER A C     1 
ATOM   3649  O  O     . SER A 1  473  ? 12.068  -45.205  -8.398  1.00 96.34  ? 473  SER A O     1 
ATOM   3650  C  CB    . SER A 1  473  ? 13.864  -43.618  -10.325 1.00 99.43  ? 473  SER A CB    1 
ATOM   3651  O  OG    . SER A 1  473  ? 14.360  -43.993  -11.610 1.00 107.64 ? 473  SER A OG    1 
ATOM   3652  N  N     . VAL A 1  474  ? 11.182  -43.130  -8.201  1.00 80.02  ? 474  VAL A N     1 
ATOM   3653  C  CA    . VAL A 1  474  ? 10.678  -43.334  -6.853  1.00 86.67  ? 474  VAL A CA    1 
ATOM   3654  C  C     . VAL A 1  474  ? 9.202   -43.760  -6.867  1.00 99.54  ? 474  VAL A C     1 
ATOM   3655  O  O     . VAL A 1  474  ? 8.585   -43.898  -5.799  1.00 78.63  ? 474  VAL A O     1 
ATOM   3656  C  CB    . VAL A 1  474  ? 10.895  -42.067  -5.990  1.00 78.89  ? 474  VAL A CB    1 
ATOM   3657  C  CG1   . VAL A 1  474  ? 9.777   -41.045  -6.175  1.00 92.50  ? 474  VAL A CG1   1 
ATOM   3658  C  CG2   . VAL A 1  474  ? 11.122  -42.405  -4.525  1.00 96.35  ? 474  VAL A CG2   1 
ATOM   3659  N  N     . THR A 1  475  ? 8.617   -43.977  -8.057  1.00 100.51 ? 475  THR A N     1 
ATOM   3660  C  CA    . THR A 1  475  ? 7.237   -44.456  -8.108  1.00 88.69  ? 475  THR A CA    1 
ATOM   3661  C  C     . THR A 1  475  ? 7.121   -45.875  -7.548  1.00 100.42 ? 475  THR A C     1 
ATOM   3662  O  O     . THR A 1  475  ? 6.231   -46.160  -6.737  1.00 92.08  ? 475  THR A O     1 
ATOM   3663  C  CB    . THR A 1  475  ? 6.705   -44.424  -9.550  1.00 97.24  ? 475  THR A CB    1 
ATOM   3664  O  OG1   . THR A 1  475  ? 7.554   -45.211  -10.399 1.00 115.97 ? 475  THR A OG1   1 
ATOM   3665  C  CG2   . THR A 1  475  ? 6.595   -43.006  -10.098 1.00 79.63  ? 475  THR A CG2   1 
ATOM   3666  N  N     . SER A 1  476  ? 8.042   -46.761  -7.934  1.00 102.06 ? 476  SER A N     1 
ATOM   3667  C  CA    . SER A 1  476  ? 7.967   -48.174  -7.564  1.00 91.01  ? 476  SER A CA    1 
ATOM   3668  C  C     . SER A 1  476  ? 7.835   -48.414  -6.066  1.00 98.81  ? 476  SER A C     1 
ATOM   3669  O  O     . SER A 1  476  ? 6.934   -49.168  -5.665  1.00 137.75 ? 476  SER A O     1 
ATOM   3670  C  CB    . SER A 1  476  ? 9.191   -48.909  -8.130  1.00 110.17 ? 476  SER A CB    1 
ATOM   3671  O  OG    . SER A 1  476  ? 9.548   -48.422  -9.419  1.00 145.66 ? 476  SER A OG    1 
ATOM   3672  N  N     . PRO A 1  477  ? 8.632   -47.790  -5.194  1.00 99.61  ? 477  PRO A N     1 
ATOM   3673  C  CA    . PRO A 1  477  ? 8.463   -48.046  -3.756  1.00 87.07  ? 477  PRO A CA    1 
ATOM   3674  C  C     . PRO A 1  477  ? 7.177   -47.494  -3.187  1.00 84.60  ? 477  PRO A C     1 
ATOM   3675  O  O     . PRO A 1  477  ? 6.709   -48.004  -2.160  1.00 93.44  ? 477  PRO A O     1 
ATOM   3676  C  CB    . PRO A 1  477  ? 9.689   -47.370  -3.131  1.00 79.21  ? 477  PRO A CB    1 
ATOM   3677  C  CG    . PRO A 1  477  ? 10.083  -46.328  -4.111  1.00 79.35  ? 477  PRO A CG    1 
ATOM   3678  C  CD    . PRO A 1  477  ? 9.795   -46.920  -5.451  1.00 104.67 ? 477  PRO A CD    1 
ATOM   3679  N  N     . TYR A 1  478  ? 6.629   -46.423  -3.767  1.00 90.01  ? 478  TYR A N     1 
ATOM   3680  C  CA    . TYR A 1  478  ? 5.390   -45.871  -3.236  1.00 87.93  ? 478  TYR A CA    1 
ATOM   3681  C  C     . TYR A 1  478  ? 4.181   -46.605  -3.768  1.00 100.02 ? 478  TYR A C     1 
ATOM   3682  O  O     . TYR A 1  478  ? 3.099   -46.474  -3.184  1.00 92.43  ? 478  TYR A O     1 
ATOM   3683  C  CB    . TYR A 1  478  ? 5.211   -44.388  -3.591  1.00 83.34  ? 478  TYR A CB    1 
ATOM   3684  C  CG    . TYR A 1  478  ? 6.115   -43.471  -2.819  1.00 78.02  ? 478  TYR A CG    1 
ATOM   3685  C  CD1   . TYR A 1  478  ? 5.937   -43.269  -1.467  1.00 81.65  ? 478  TYR A CD1   1 
ATOM   3686  C  CD2   . TYR A 1  478  ? 7.104   -42.757  -3.452  1.00 78.55  ? 478  TYR A CD2   1 
ATOM   3687  C  CE1   . TYR A 1  478  ? 6.772   -42.431  -0.751  1.00 76.51  ? 478  TYR A CE1   1 
ATOM   3688  C  CE2   . TYR A 1  478  ? 7.940   -41.907  -2.745  1.00 89.24  ? 478  TYR A CE2   1 
ATOM   3689  C  CZ    . TYR A 1  478  ? 7.770   -41.746  -1.399  1.00 83.17  ? 478  TYR A CZ    1 
ATOM   3690  O  OH    . TYR A 1  478  ? 8.616   -40.903  -0.716  1.00 76.59  ? 478  TYR A OH    1 
ATOM   3691  N  N     . ASN A 1  479  ? 4.354   -47.353  -4.864  1.00 101.04 ? 479  ASN A N     1 
ATOM   3692  C  CA    . ASN A 1  479  ? 3.249   -47.912  -5.631  1.00 95.53  ? 479  ASN A CA    1 
ATOM   3693  C  C     . ASN A 1  479  ? 2.351   -46.787  -6.127  1.00 100.00 ? 479  ASN A C     1 
ATOM   3694  O  O     . ASN A 1  479  ? 1.124   -46.854  -6.047  1.00 119.41 ? 479  ASN A O     1 
ATOM   3695  C  CB    . ASN A 1  479  ? 2.448   -48.947  -4.845  1.00 89.54  ? 479  ASN A CB    1 
ATOM   3696  C  CG    . ASN A 1  479  ? 1.759   -49.946  -5.756  1.00 99.14  ? 479  ASN A CG    1 
ATOM   3697  O  OD1   . ASN A 1  479  ? 2.177   -50.156  -6.896  1.00 101.02 ? 479  ASN A OD1   1 
ATOM   3698  N  ND2   . ASN A 1  479  ? 0.688   -50.554  -5.264  1.00 115.47 ? 479  ASN A ND2   1 
ATOM   3699  N  N     . ALA A 1  480  ? 2.981   -45.752  -6.671  1.00 78.63  ? 480  ALA A N     1 
ATOM   3700  C  CA    . ALA A 1  480  ? 2.293   -44.548  -7.110  1.00 78.37  ? 480  ALA A CA    1 
ATOM   3701  C  C     . ALA A 1  480  ? 2.246   -44.524  -8.628  1.00 78.94  ? 480  ALA A C     1 
ATOM   3702  O  O     . ALA A 1  480  ? 3.276   -44.677  -9.288  1.00 106.34 ? 480  ALA A O     1 
ATOM   3703  C  CB    . ALA A 1  480  ? 2.996   -43.292  -6.602  1.00 77.88  ? 480  ALA A CB    1 
ATOM   3704  N  N     . ASP A 1  481  ? 1.050   -44.350  -9.169  1.00 85.21  ? 481  ASP A N     1 
ATOM   3705  C  CA    . ASP A 1  481  ? 0.792   -43.929  -10.537 1.00 93.23  ? 481  ASP A CA    1 
ATOM   3706  C  C     . ASP A 1  481  ? 0.233   -42.508  -10.505 1.00 106.70 ? 481  ASP A C     1 
ATOM   3707  O  O     . ASP A 1  481  ? 0.097   -41.893  -9.441  1.00 108.16 ? 481  ASP A O     1 
ATOM   3708  C  CB    . ASP A 1  481  ? -0.180  -44.912  -11.224 1.00 104.76 ? 481  ASP A CB    1 
ATOM   3709  C  CG    . ASP A 1  481  ? -1.364  -45.323  -10.313 1.00 152.03 ? 481  ASP A CG    1 
ATOM   3710  O  OD1   . ASP A 1  481  ? -1.726  -44.555  -9.402  1.00 176.71 ? 481  ASP A OD1   1 
ATOM   3711  O  OD2   . ASP A 1  481  ? -1.962  -46.399  -10.522 1.00 168.98 ? 481  ASP A OD2   1 
ATOM   3712  N  N     . PHE A 1  482  ? -0.036  -41.953  -11.686 1.00 101.49 ? 482  PHE A N     1 
ATOM   3713  C  CA    . PHE A 1  482  ? -0.551  -40.592  -11.782 1.00 79.35  ? 482  PHE A CA    1 
ATOM   3714  C  C     . PHE A 1  482  ? -1.970  -40.576  -12.342 1.00 80.23  ? 482  PHE A C     1 
ATOM   3715  O  O     . PHE A 1  482  ? -2.373  -39.606  -12.980 1.00 92.12  ? 482  PHE A O     1 
ATOM   3716  C  CB    . PHE A 1  482  ? 0.374   -39.714  -12.617 1.00 94.25  ? 482  PHE A CB    1 
ATOM   3717  C  CG    . PHE A 1  482  ? 1.782   -39.697  -12.098 1.00 92.41  ? 482  PHE A CG    1 
ATOM   3718  C  CD1   . PHE A 1  482  ? 2.084   -39.144  -10.871 1.00 94.95  ? 482  PHE A CD1   1 
ATOM   3719  C  CD2   . PHE A 1  482  ? 2.817   -40.186  -12.868 1.00 85.65  ? 482  PHE A CD2   1 
ATOM   3720  C  CE1   . PHE A 1  482  ? 3.379   -39.156  -10.392 1.00 97.96  ? 482  PHE A CE1   1 
ATOM   3721  C  CE2   . PHE A 1  482  ? 4.110   -40.176  -12.396 1.00 79.75  ? 482  PHE A CE2   1 
ATOM   3722  C  CZ    . PHE A 1  482  ? 4.391   -39.663  -11.163 1.00 81.20  ? 482  PHE A CZ    1 
ATOM   3723  N  N     . ASP A 1  483  ? -2.740  -41.656  -12.127 1.00 121.15 ? 483  ASP A N     1 
ATOM   3724  C  CA    . ASP A 1  483  ? -4.146  -41.714  -12.521 1.00 90.67  ? 483  ASP A CA    1 
ATOM   3725  C  C     . ASP A 1  483  ? -5.054  -40.948  -11.566 1.00 91.10  ? 483  ASP A C     1 
ATOM   3726  O  O     . ASP A 1  483  ? -6.278  -41.131  -11.584 1.00 106.79 ? 483  ASP A O     1 
ATOM   3727  C  CB    . ASP A 1  483  ? -4.593  -43.186  -12.632 1.00 80.75  ? 483  ASP A CB    1 
ATOM   3728  C  CG    . ASP A 1  483  ? -4.349  -43.982  -11.355 1.00 131.17 ? 483  ASP A CG    1 
ATOM   3729  O  OD1   . ASP A 1  483  ? -3.910  -43.374  -10.374 1.00 136.36 ? 483  ASP A OD1   1 
ATOM   3730  O  OD2   . ASP A 1  483  ? -4.587  -45.209  -11.317 1.00 153.59 ? 483  ASP A OD2   1 
ATOM   3731  N  N     . GLY A 1  484  ? -4.470  -40.091  -10.737 1.00 79.11  ? 484  GLY A N     1 
ATOM   3732  C  CA    . GLY A 1  484  ? -5.225  -39.244  -9.855  1.00 78.69  ? 484  GLY A CA    1 
ATOM   3733  C  C     . GLY A 1  484  ? -4.891  -39.468  -8.397  1.00 78.06  ? 484  GLY A C     1 
ATOM   3734  O  O     . GLY A 1  484  ? -5.720  -39.140  -7.542  1.00 104.10 ? 484  GLY A O     1 
ATOM   3735  N  N     . ASP A 1  485  ? -3.687  -39.961  -8.079  1.00 88.11  ? 485  ASP A N     1 
ATOM   3736  C  CA    . ASP A 1  485  ? -3.401  -40.255  -6.677  1.00 82.47  ? 485  ASP A CA    1 
ATOM   3737  C  C     . ASP A 1  485  ? -3.127  -38.980  -5.919  1.00 96.46  ? 485  ASP A C     1 
ATOM   3738  O  O     . ASP A 1  485  ? -2.723  -37.954  -6.474  1.00 99.24  ? 485  ASP A O     1 
ATOM   3739  C  CB    . ASP A 1  485  ? -2.176  -41.141  -6.433  1.00 97.83  ? 485  ASP A CB    1 
ATOM   3740  C  CG    . ASP A 1  485  ? -2.174  -42.372  -7.251  1.00 124.83 ? 485  ASP A CG    1 
ATOM   3741  O  OD1   . ASP A 1  485  ? -3.138  -42.522  -8.004  1.00 157.24 ? 485  ASP A OD1   1 
ATOM   3742  O  OD2   . ASP A 1  485  ? -1.271  -43.224  -7.091  1.00 115.32 ? 485  ASP A OD2   1 
ATOM   3743  N  N     . GLU A 1  486  ? -3.262  -39.094  -4.617  1.00 83.20  ? 486  GLU A N     1 
ATOM   3744  C  CA    . GLU A 1  486  ? -2.875  -38.050  -3.697  1.00 98.46  ? 486  GLU A CA    1 
ATOM   3745  C  C     . GLU A 1  486  ? -1.770  -38.597  -2.806  1.00 90.23  ? 486  GLU A C     1 
ATOM   3746  O  O     . GLU A 1  486  ? -1.677  -39.807  -2.586  1.00 83.32  ? 486  GLU A O     1 
ATOM   3747  C  CB    . GLU A 1  486  ? -4.106  -37.610  -2.861  1.00 87.39  ? 486  GLU A CB    1 
ATOM   3748  C  CG    . GLU A 1  486  ? -4.924  -36.447  -3.439  1.00 95.80  ? 486  GLU A CG    1 
ATOM   3749  C  CD    . GLU A 1  486  ? -6.400  -36.494  -3.051  1.00 113.45 ? 486  GLU A CD    1 
ATOM   3750  O  OE1   . GLU A 1  486  ? -7.066  -37.485  -3.406  1.00 136.19 ? 486  GLU A OE1   1 
ATOM   3751  O  OE2   . GLU A 1  486  ? -6.902  -35.550  -2.399  1.00 113.88 ? 486  GLU A OE2   1 
ATOM   3752  N  N     . MET A 1  487  ? -0.862  -37.733  -2.376  1.00 85.60  ? 487  MET A N     1 
ATOM   3753  C  CA    . MET A 1  487  ? 0.149   -38.180  -1.429  1.00 91.82  ? 487  MET A CA    1 
ATOM   3754  C  C     . MET A 1  487  ? 0.244   -37.162  -0.301  1.00 97.24  ? 487  MET A C     1 
ATOM   3755  O  O     . MET A 1  487  ? -0.191  -36.014  -0.427  1.00 85.19  ? 487  MET A O     1 
ATOM   3756  C  CB    . MET A 1  487  ? 1.500   -38.447  -2.106  1.00 75.49  ? 487  MET A CB    1 
ATOM   3757  C  CG    . MET A 1  487  ? 1.469   -39.638  -3.050  1.00 93.68  ? 487  MET A CG    1 
ATOM   3758  S  SD    . MET A 1  487  ? 3.080   -40.087  -3.736  1.00 81.04  ? 487  MET A SD    1 
ATOM   3759  C  CE    . MET A 1  487  ? 4.042   -40.442  -2.279  1.00 76.04  ? 487  MET A CE    1 
ATOM   3760  N  N     . ASN A 1  488  ? 0.740   -37.634  0.836   1.00 74.74  ? 488  ASN A N     1 
ATOM   3761  C  CA    . ASN A 1  488  ? 0.788   -36.877  2.073   1.00 74.47  ? 488  ASN A CA    1 
ATOM   3762  C  C     . ASN A 1  488  ? 2.191   -36.346  2.331   1.00 77.75  ? 488  ASN A C     1 
ATOM   3763  O  O     . ASN A 1  488  ? 3.197   -36.971  1.977   1.00 87.25  ? 488  ASN A O     1 
ATOM   3764  C  CB    . ASN A 1  488  ? 0.339   -37.752  3.245   1.00 98.04  ? 488  ASN A CB    1 
ATOM   3765  C  CG    . ASN A 1  488  ? -1.141  -38.075  3.200   1.00 110.51 ? 488  ASN A CG    1 
ATOM   3766  O  OD1   . ASN A 1  488  ? -1.854  -37.653  2.291   1.00 81.46  ? 488  ASN A OD1   1 
ATOM   3767  N  ND2   . ASN A 1  488  ? -1.611  -38.834  4.184   1.00 140.32 ? 488  ASN A ND2   1 
ATOM   3768  N  N     . LEU A 1  489  ? 2.240   -35.218  3.032   1.00 75.62  ? 489  LEU A N     1 
ATOM   3769  C  CA    . LEU A 1  489  ? 3.475   -34.526  3.371   1.00 74.36  ? 489  LEU A CA    1 
ATOM   3770  C  C     . LEU A 1  489  ? 3.426   -34.074  4.817   1.00 74.21  ? 489  LEU A C     1 
ATOM   3771  O  O     . LEU A 1  489  ? 2.462   -33.419  5.225   1.00 97.73  ? 489  LEU A O     1 
ATOM   3772  C  CB    . LEU A 1  489  ? 3.683   -33.317  2.463   1.00 79.06  ? 489  LEU A CB    1 
ATOM   3773  C  CG    . LEU A 1  489  ? 5.101   -32.803  2.451   1.00 74.72  ? 489  LEU A CG    1 
ATOM   3774  C  CD1   . LEU A 1  489  ? 5.926   -33.863  1.788   1.00 106.46 ? 489  LEU A CD1   1 
ATOM   3775  C  CD2   . LEU A 1  489  ? 5.165   -31.517  1.692   1.00 74.92  ? 489  LEU A CD2   1 
ATOM   3776  N  N     . HIS A 1  490  ? 4.425   -34.461  5.599   1.00 74.78  ? 490  HIS A N     1 
ATOM   3777  C  CA    . HIS A 1  490  ? 4.548   -34.035  6.986   1.00 90.86  ? 490  HIS A CA    1 
ATOM   3778  C  C     . HIS A 1  490  ? 5.871   -33.303  7.160   1.00 83.72  ? 490  HIS A C     1 
ATOM   3779  O  O     . HIS A 1  490  ? 6.910   -33.778  6.693   1.00 91.64  ? 490  HIS A O     1 
ATOM   3780  C  CB    . HIS A 1  490  ? 4.471   -35.224  7.944   1.00 79.29  ? 490  HIS A CB    1 
ATOM   3781  C  CG    . HIS A 1  490  ? 3.244   -36.062  7.769   1.00 78.69  ? 490  HIS A CG    1 
ATOM   3782  N  ND1   . HIS A 1  490  ? 2.155   -35.954  8.605   1.00 74.00  ? 490  HIS A ND1   1 
ATOM   3783  C  CD2   . HIS A 1  490  ? 2.941   -37.033  6.873   1.00 81.66  ? 490  HIS A CD2   1 
ATOM   3784  C  CE1   . HIS A 1  490  ? 1.226   -36.813  8.224   1.00 99.16  ? 490  HIS A CE1   1 
ATOM   3785  N  NE2   . HIS A 1  490  ? 1.677   -37.481  7.176   1.00 89.17  ? 490  HIS A NE2   1 
ATOM   3786  N  N     . VAL A 1  491  ? 5.833   -32.156  7.824   1.00 80.28  ? 491  VAL A N     1 
ATOM   3787  C  CA    . VAL A 1  491  ? 6.988   -31.277  7.961   1.00 74.78  ? 491  VAL A CA    1 
ATOM   3788  C  C     . VAL A 1  491  ? 7.507   -31.383  9.389   1.00 84.28  ? 491  VAL A C     1 
ATOM   3789  O  O     . VAL A 1  491  ? 6.849   -30.904  10.322  1.00 86.73  ? 491  VAL A O     1 
ATOM   3790  C  CB    . VAL A 1  491  ? 6.629   -29.833  7.613   1.00 80.23  ? 491  VAL A CB    1 
ATOM   3791  C  CG1   . VAL A 1  491  ? 7.830   -28.925  7.841   1.00 75.26  ? 491  VAL A CG1   1 
ATOM   3792  C  CG2   . VAL A 1  491  ? 6.071   -29.787  6.193   1.00 74.79  ? 491  VAL A CG2   1 
ATOM   3793  N  N     . PRO A 1  492  ? 8.720   -31.879  9.589   1.00 85.35  ? 492  PRO A N     1 
ATOM   3794  C  CA    . PRO A 1  492  ? 9.271   -31.972  10.940  1.00 80.37  ? 492  PRO A CA    1 
ATOM   3795  C  C     . PRO A 1  492  ? 9.477   -30.591  11.528  1.00 77.48  ? 492  PRO A C     1 
ATOM   3796  O  O     . PRO A 1  492  ? 9.740   -29.625  10.815  1.00 88.70  ? 492  PRO A O     1 
ATOM   3797  C  CB    . PRO A 1  492  ? 10.608  -32.674  10.711  1.00 75.77  ? 492  PRO A CB    1 
ATOM   3798  C  CG    . PRO A 1  492  ? 10.984  -32.249  9.322   1.00 80.89  ? 492  PRO A CG    1 
ATOM   3799  C  CD    . PRO A 1  492  ? 9.712   -32.226  8.561   1.00 88.74  ? 492  PRO A CD    1 
ATOM   3800  N  N     . GLN A 1  493  ? 9.375   -30.503  12.851  1.00 81.46  ? 493  GLN A N     1 
ATOM   3801  C  CA    . GLN A 1  493  ? 9.386   -29.207  13.519  1.00 75.99  ? 493  GLN A CA    1 
ATOM   3802  C  C     . GLN A 1  493  ? 10.611  -28.963  14.390  1.00 91.11  ? 493  GLN A C     1 
ATOM   3803  O  O     . GLN A 1  493  ? 10.857  -27.815  14.770  1.00 98.22  ? 493  GLN A O     1 
ATOM   3804  C  CB    . GLN A 1  493  ? 8.115   -29.040  14.362  1.00 75.77  ? 493  GLN A CB    1 
ATOM   3805  C  CG    . GLN A 1  493  ? 6.870   -29.119  13.521  1.00 75.33  ? 493  GLN A CG    1 
ATOM   3806  C  CD    . GLN A 1  493  ? 6.596   -27.850  12.801  1.00 78.76  ? 493  GLN A CD    1 
ATOM   3807  O  OE1   . GLN A 1  493  ? 6.276   -26.830  13.408  1.00 98.38  ? 493  GLN A OE1   1 
ATOM   3808  N  NE2   . GLN A 1  493  ? 6.774   -27.882  11.489  1.00 75.30  ? 493  GLN A NE2   1 
ATOM   3809  N  N     . SER A 1  494  ? 11.395  -29.991  14.689  1.00 104.44 ? 494  SER A N     1 
ATOM   3810  C  CA    . SER A 1  494  ? 12.594  -29.880  15.503  1.00 93.67  ? 494  SER A CA    1 
ATOM   3811  C  C     . SER A 1  494  ? 13.835  -29.994  14.635  1.00 90.52  ? 494  SER A C     1 
ATOM   3812  O  O     . SER A 1  494  ? 13.828  -30.638  13.585  1.00 103.41 ? 494  SER A O     1 
ATOM   3813  C  CB    . SER A 1  494  ? 12.627  -30.979  16.578  1.00 113.57 ? 494  SER A CB    1 
ATOM   3814  O  OG    . SER A 1  494  ? 13.671  -30.788  17.516  1.00 117.64 ? 494  SER A OG    1 
ATOM   3815  N  N     . GLU A 1  495  ? 14.902  -29.340  15.082  1.00 112.51 ? 495  GLU A N     1 
ATOM   3816  C  CA    . GLU A 1  495  ? 16.187  -29.483  14.412  1.00 109.78 ? 495  GLU A CA    1 
ATOM   3817  C  C     . GLU A 1  495  ? 16.674  -30.936  14.414  1.00 94.60  ? 495  GLU A C     1 
ATOM   3818  O  O     . GLU A 1  495  ? 17.488  -31.304  13.562  1.00 106.52 ? 495  GLU A O     1 
ATOM   3819  C  CB    . GLU A 1  495  ? 17.229  -28.580  15.096  1.00 79.64  ? 495  GLU A CB    1 
ATOM   3820  C  CG    . GLU A 1  495  ? 18.426  -28.178  14.243  1.00 80.25  ? 495  GLU A CG    1 
ATOM   3821  C  CD    . GLU A 1  495  ? 18.060  -27.341  13.016  1.00 106.14 ? 495  GLU A CD    1 
ATOM   3822  O  OE1   . GLU A 1  495  ? 17.304  -26.357  13.162  1.00 113.64 ? 495  GLU A OE1   1 
ATOM   3823  O  OE2   . GLU A 1  495  ? 18.506  -27.671  11.897  1.00 118.20 ? 495  GLU A OE2   1 
ATOM   3824  N  N     . GLU A 1  496  ? 16.181  -31.771  15.340  1.00 78.71  ? 496  GLU A N     1 
ATOM   3825  C  CA    . GLU A 1  496  ? 16.601  -33.165  15.435  1.00 91.60  ? 496  GLU A CA    1 
ATOM   3826  C  C     . GLU A 1  496  ? 15.624  -34.167  14.816  1.00 84.28  ? 496  GLU A C     1 
ATOM   3827  O  O     . GLU A 1  496  ? 16.029  -35.305  14.525  1.00 108.04 ? 496  GLU A O     1 
ATOM   3828  C  CB    . GLU A 1  496  ? 16.826  -33.536  16.905  1.00 79.23  ? 496  GLU A CB    1 
ATOM   3829  C  CG    . GLU A 1  496  ? 15.582  -33.672  17.718  1.00 87.42  ? 496  GLU A CG    1 
ATOM   3830  C  CD    . GLU A 1  496  ? 15.880  -34.165  19.119  1.00 120.95 ? 496  GLU A CD    1 
ATOM   3831  O  OE1   . GLU A 1  496  ? 16.085  -33.308  19.992  1.00 124.13 ? 496  GLU A OE1   1 
ATOM   3832  O  OE2   . GLU A 1  496  ? 15.989  -35.394  19.337  1.00 129.55 ? 496  GLU A OE2   1 
ATOM   3833  N  N     . THR A 1  497  ? 14.388  -33.766  14.518  1.00 81.53  ? 497  THR A N     1 
ATOM   3834  C  CA    . THR A 1  497  ? 13.548  -34.641  13.712  1.00 88.63  ? 497  THR A CA    1 
ATOM   3835  C  C     . THR A 1  497  ? 13.846  -34.440  12.233  1.00 86.21  ? 497  THR A C     1 
ATOM   3836  O  O     . THR A 1  497  ? 13.735  -35.385  11.435  1.00 98.26  ? 497  THR A O     1 
ATOM   3837  C  CB    . THR A 1  497  ? 12.043  -34.419  14.004  1.00 80.90  ? 497  THR A CB    1 
ATOM   3838  O  OG1   . THR A 1  497  ? 11.630  -33.101  13.645  1.00 76.39  ? 497  THR A OG1   1 
ATOM   3839  C  CG2   . THR A 1  497  ? 11.746  -34.571  15.463  1.00 76.69  ? 497  THR A CG2   1 
ATOM   3840  N  N     . ARG A 1  498  ? 14.326  -33.255  11.861  1.00 77.27  ? 498  ARG A N     1 
ATOM   3841  C  CA    . ARG A 1  498  ? 14.855  -33.107  10.517  1.00 84.87  ? 498  ARG A CA    1 
ATOM   3842  C  C     . ARG A 1  498  ? 16.069  -34.004  10.352  1.00 101.29 ? 498  ARG A C     1 
ATOM   3843  O  O     . ARG A 1  498  ? 16.248  -34.641  9.311   1.00 100.99 ? 498  ARG A O     1 
ATOM   3844  C  CB    . ARG A 1  498  ? 15.238  -31.657  10.238  1.00 91.15  ? 498  ARG A CB    1 
ATOM   3845  C  CG    . ARG A 1  498  ? 14.228  -30.636  10.655  1.00 86.49  ? 498  ARG A CG    1 
ATOM   3846  C  CD    . ARG A 1  498  ? 14.842  -29.251  10.622  1.00 91.99  ? 498  ARG A CD    1 
ATOM   3847  N  NE    . ARG A 1  498  ? 14.507  -28.608  9.356   1.00 98.75  ? 498  ARG A NE    1 
ATOM   3848  C  CZ    . ARG A 1  498  ? 15.390  -28.201  8.459   1.00 78.17  ? 498  ARG A CZ    1 
ATOM   3849  N  NH1   . ARG A 1  498  ? 16.690  -28.365  8.676   1.00 85.49  ? 498  ARG A NH1   1 
ATOM   3850  N  NH2   . ARG A 1  498  ? 14.968  -27.622  7.348   1.00 79.76  ? 498  ARG A NH2   1 
ATOM   3851  N  N     . ALA A 1  499  ? 16.928  -34.050  11.371  1.00 84.10  ? 499  ALA A N     1 
ATOM   3852  C  CA    . ALA A 1  499  ? 18.106  -34.900  11.281  1.00 79.07  ? 499  ALA A CA    1 
ATOM   3853  C  C     . ALA A 1  499  ? 17.702  -36.361  11.181  1.00 96.86  ? 499  ALA A C     1 
ATOM   3854  O  O     . ALA A 1  499  ? 18.297  -37.123  10.413  1.00 108.86 ? 499  ALA A O     1 
ATOM   3855  C  CB    . ALA A 1  499  ? 19.029  -34.652  12.469  1.00 79.70  ? 499  ALA A CB    1 
ATOM   3856  N  N     . GLU A 1  500  ? 16.667  -36.764  11.931  1.00 89.86  ? 500  GLU A N     1 
ATOM   3857  C  CA    . GLU A 1  500  ? 16.167  -38.135  11.806  1.00 78.25  ? 500  GLU A CA    1 
ATOM   3858  C  C     . GLU A 1  500  ? 15.687  -38.444  10.388  1.00 77.94  ? 500  GLU A C     1 
ATOM   3859  O  O     . GLU A 1  500  ? 15.916  -39.551  9.873   1.00 97.02  ? 500  GLU A O     1 
ATOM   3860  C  CB    . GLU A 1  500  ? 15.038  -38.368  12.811  1.00 77.84  ? 500  GLU A CB    1 
ATOM   3861  C  CG    . GLU A 1  500  ? 15.235  -39.575  13.699  1.00 85.92  ? 500  GLU A CG    1 
ATOM   3862  C  CD    . GLU A 1  500  ? 14.484  -39.489  15.015  1.00 101.20 ? 500  GLU A CD    1 
ATOM   3863  O  OE1   . GLU A 1  500  ? 13.245  -39.351  15.015  1.00 86.96  ? 500  GLU A OE1   1 
ATOM   3864  O  OE2   . GLU A 1  500  ? 15.153  -39.556  16.067  1.00 108.65 ? 500  GLU A OE2   1 
ATOM   3865  N  N     . LEU A 1  501  ? 15.114  -37.453  9.711   1.00 79.34  ? 501  LEU A N     1 
ATOM   3866  C  CA    . LEU A 1  501  ? 14.669  -37.648  8.335   1.00 77.34  ? 501  LEU A CA    1 
ATOM   3867  C  C     . LEU A 1  501  ? 15.845  -37.711  7.363   1.00 90.67  ? 501  LEU A C     1 
ATOM   3868  O  O     . LEU A 1  501  ? 15.939  -38.636  6.545   1.00 91.30  ? 501  LEU A O     1 
ATOM   3869  C  CB    . LEU A 1  501  ? 13.686  -36.533  7.951   1.00 76.84  ? 501  LEU A CB    1 
ATOM   3870  C  CG    . LEU A 1  501  ? 12.326  -36.529  8.663   1.00 86.67  ? 501  LEU A CG    1 
ATOM   3871  C  CD1   . LEU A 1  501  ? 11.310  -35.679  7.924   1.00 75.90  ? 501  LEU A CD1   1 
ATOM   3872  C  CD2   . LEU A 1  501  ? 11.831  -37.947  8.764   1.00 85.48  ? 501  LEU A CD2   1 
ATOM   3873  N  N     . SER A 1  502  ? 16.750  -36.734  7.430   1.00 82.55  ? 502  SER A N     1 
ATOM   3874  C  CA    . SER A 1  502  ? 17.811  -36.622  6.439   1.00 78.83  ? 502  SER A CA    1 
ATOM   3875  C  C     . SER A 1  502  ? 18.888  -37.670  6.643   1.00 96.03  ? 502  SER A C     1 
ATOM   3876  O  O     . SER A 1  502  ? 19.637  -37.974  5.707   1.00 85.32  ? 502  SER A O     1 
ATOM   3877  C  CB    . SER A 1  502  ? 18.455  -35.240  6.509   1.00 86.37  ? 502  SER A CB    1 
ATOM   3878  O  OG    . SER A 1  502  ? 19.110  -35.059  7.758   1.00 96.74  ? 502  SER A OG    1 
ATOM   3879  N  N     . GLN A 1  503  ? 18.974  -38.236  7.839   1.00 95.60  ? 503  GLN A N     1 
ATOM   3880  C  CA    . GLN A 1  503  ? 20.021  -39.186  8.152   1.00 82.27  ? 503  GLN A CA    1 
ATOM   3881  C  C     . GLN A 1  503  ? 19.503  -40.611  8.320   1.00 80.15  ? 503  GLN A C     1 
ATOM   3882  O  O     . GLN A 1  503  ? 20.316  -41.523  8.465   1.00 99.74  ? 503  GLN A O     1 
ATOM   3883  C  CB    . GLN A 1  503  ? 20.776  -38.709  9.397   1.00 87.09  ? 503  GLN A CB    1 
ATOM   3884  C  CG    . GLN A 1  503  ? 21.312  -37.296  9.235   1.00 80.92  ? 503  GLN A CG    1 
ATOM   3885  C  CD    . GLN A 1  503  ? 22.288  -37.150  8.090   1.00 87.69  ? 503  GLN A CD    1 
ATOM   3886  O  OE1   . GLN A 1  503  ? 23.182  -37.971  7.899   1.00 107.07 ? 503  GLN A OE1   1 
ATOM   3887  N  NE2   . GLN A 1  503  ? 22.082  -36.122  7.279   1.00 105.41 ? 503  GLN A NE2   1 
ATOM   3888  N  N     . LEU A 1  504  ? 18.183  -40.841  8.263   1.00 99.85  ? 504  LEU A N     1 
ATOM   3889  C  CA    . LEU A 1  504  ? 17.679  -42.211  8.350   1.00 79.43  ? 504  LEU A CA    1 
ATOM   3890  C  C     . LEU A 1  504  ? 16.679  -42.512  7.235   1.00 95.04  ? 504  LEU A C     1 
ATOM   3891  O  O     . LEU A 1  504  ? 16.827  -43.513  6.526   1.00 97.74  ? 504  LEU A O     1 
ATOM   3892  C  CB    . LEU A 1  504  ? 17.026  -42.468  9.709   1.00 79.19  ? 504  LEU A CB    1 
ATOM   3893  C  CG    . LEU A 1  504  ? 17.915  -42.261  10.924  1.00 79.68  ? 504  LEU A CG    1 
ATOM   3894  C  CD1   . LEU A 1  504  ? 17.124  -42.219  12.202  1.00 87.52  ? 504  LEU A CD1   1 
ATOM   3895  C  CD2   . LEU A 1  504  ? 18.873  -43.400  10.970  1.00 80.45  ? 504  LEU A CD2   1 
ATOM   3896  N  N     . CYS A 1  505  ? 15.704  -41.626  7.021   1.00 100.25 ? 505  CYS A N     1 
ATOM   3897  C  CA    . CYS A 1  505  ? 14.613  -41.889  6.095   1.00 77.95  ? 505  CYS A CA    1 
ATOM   3898  C  C     . CYS A 1  505  ? 14.834  -41.266  4.726   1.00 79.28  ? 505  CYS A C     1 
ATOM   3899  O  O     . CYS A 1  505  ? 13.953  -41.358  3.866   1.00 79.53  ? 505  CYS A O     1 
ATOM   3900  C  CB    . CYS A 1  505  ? 13.292  -41.368  6.656   1.00 77.28  ? 505  CYS A CB    1 
ATOM   3901  S  SG    . CYS A 1  505  ? 13.051  -41.501  8.414   1.00 96.97  ? 505  CYS A SG    1 
ATOM   3902  N  N     . ALA A 1  506  ? 15.991  -40.661  4.486   1.00 90.62  ? 506  ALA A N     1 
ATOM   3903  C  CA    . ALA A 1  506  ? 16.231  -40.002  3.208   1.00 78.58  ? 506  ALA A CA    1 
ATOM   3904  C  C     . ALA A 1  506  ? 16.168  -41.006  2.058   1.00 78.86  ? 506  ALA A C     1 
ATOM   3905  O  O     . ALA A 1  506  ? 16.595  -42.154  2.192   1.00 112.55 ? 506  ALA A O     1 
ATOM   3906  C  CB    . ALA A 1  506  ? 17.586  -39.313  3.251   1.00 94.62  ? 506  ALA A CB    1 
ATOM   3907  N  N     . VAL A 1  507  ? 15.641  -40.560  0.911   1.00 83.37  ? 507  VAL A N     1 
ATOM   3908  C  CA    . VAL A 1  507  ? 15.409  -41.476  -0.216  1.00 82.46  ? 507  VAL A CA    1 
ATOM   3909  C  C     . VAL A 1  507  ? 16.667  -42.223  -0.656  1.00 82.59  ? 507  VAL A C     1 
ATOM   3910  O  O     . VAL A 1  507  ? 16.597  -43.449  -0.834  1.00 103.73 ? 507  VAL A O     1 
ATOM   3911  C  CB    . VAL A 1  507  ? 14.719  -40.737  -1.372  1.00 78.77  ? 507  VAL A CB    1 
ATOM   3912  C  CG1   . VAL A 1  507  ? 14.483  -41.657  -2.578  1.00 79.12  ? 507  VAL A CG1   1 
ATOM   3913  C  CG2   . VAL A 1  507  ? 13.410  -40.074  -0.917  1.00 86.54  ? 507  VAL A CG2   1 
ATOM   3914  N  N     . PRO A 1  508  ? 17.823  -41.580  -0.845  1.00 86.29  ? 508  PRO A N     1 
ATOM   3915  C  CA    . PRO A 1  508  ? 18.982  -42.355  -1.319  1.00 94.83  ? 508  PRO A CA    1 
ATOM   3916  C  C     . PRO A 1  508  ? 19.397  -43.465  -0.372  1.00 108.19 ? 508  PRO A C     1 
ATOM   3917  O  O     . PRO A 1  508  ? 19.979  -44.465  -0.816  1.00 110.59 ? 508  PRO A O     1 
ATOM   3918  C  CB    . PRO A 1  508  ? 20.070  -41.290  -1.485  1.00 81.62  ? 508  PRO A CB    1 
ATOM   3919  C  CG    . PRO A 1  508  ? 19.318  -40.036  -1.683  1.00 81.03  ? 508  PRO A CG    1 
ATOM   3920  C  CD    . PRO A 1  508  ? 18.128  -40.141  -0.809  1.00 80.20  ? 508  PRO A CD    1 
ATOM   3921  N  N     . LEU A 1  509  ? 19.096  -43.331  0.922   1.00 81.01  ? 509  LEU A N     1 
ATOM   3922  C  CA    . LEU A 1  509  ? 19.448  -44.386  1.862   1.00 81.32  ? 509  LEU A CA    1 
ATOM   3923  C  C     . LEU A 1  509  ? 18.607  -45.639  1.637   1.00 100.40 ? 509  LEU A C     1 
ATOM   3924  O  O     . LEU A 1  509  ? 19.092  -46.754  1.854   1.00 100.80 ? 509  LEU A O     1 
ATOM   3925  C  CB    . LEU A 1  509  ? 19.279  -43.872  3.293   1.00 80.92  ? 509  LEU A CB    1 
ATOM   3926  C  CG    . LEU A 1  509  ? 20.050  -42.599  3.599   1.00 81.04  ? 509  LEU A CG    1 
ATOM   3927  C  CD1   . LEU A 1  509  ? 19.973  -42.191  5.065   1.00 80.79  ? 509  LEU A CD1   1 
ATOM   3928  C  CD2   . LEU A 1  509  ? 21.461  -42.844  3.170   1.00 94.89  ? 509  LEU A CD2   1 
ATOM   3929  N  N     . GLN A 1  510  ? 17.378  -45.482  1.146   1.00 80.63  ? 510  GLN A N     1 
ATOM   3930  C  CA    . GLN A 1  510  ? 16.431  -46.580  1.026   1.00 84.01  ? 510  GLN A CA    1 
ATOM   3931  C  C     . GLN A 1  510  ? 16.452  -47.242  -0.349  1.00 95.17  ? 510  GLN A C     1 
ATOM   3932  O  O     . GLN A 1  510  ? 15.566  -48.050  -0.642  1.00 117.00 ? 510  GLN A O     1 
ATOM   3933  C  CB    . GLN A 1  510  ? 15.020  -46.071  1.349   1.00 79.68  ? 510  GLN A CB    1 
ATOM   3934  C  CG    . GLN A 1  510  ? 14.892  -45.365  2.685   1.00 79.22  ? 510  GLN A CG    1 
ATOM   3935  C  CD    . GLN A 1  510  ? 14.738  -46.331  3.823   1.00 111.11 ? 510  GLN A CD    1 
ATOM   3936  O  OE1   . GLN A 1  510  ? 14.279  -47.457  3.635   1.00 145.39 ? 510  GLN A OE1   1 
ATOM   3937  N  NE2   . GLN A 1  510  ? 15.179  -45.927  5.002   1.00 85.93  ? 510  GLN A NE2   1 
ATOM   3938  N  N     . ILE A 1  511  ? 17.484  -46.974  -1.157  1.00 81.58  ? 511  ILE A N     1 
ATOM   3939  C  CA    . ILE A 1  511  ? 17.565  -47.493  -2.526  1.00 82.12  ? 511  ILE A CA    1 
ATOM   3940  C  C     . ILE A 1  511  ? 17.692  -49.015  -2.527  1.00 106.32 ? 511  ILE A C     1 
ATOM   3941  O  O     . ILE A 1  511  ? 16.909  -49.720  -3.175  1.00 109.83 ? 511  ILE A O     1 
ATOM   3942  C  CB    . ILE A 1  511  ? 18.734  -46.838  -3.290  1.00 82.69  ? 511  ILE A CB    1 
ATOM   3943  C  CG1   . ILE A 1  511  ? 18.469  -45.354  -3.525  1.00 103.19 ? 511  ILE A CG1   1 
ATOM   3944  C  CG2   . ILE A 1  511  ? 18.996  -47.535  -4.612  1.00 83.44  ? 511  ILE A CG2   1 
ATOM   3945  C  CD1   . ILE A 1  511  ? 19.560  -44.640  -4.294  1.00 86.75  ? 511  ILE A CD1   1 
ATOM   3946  N  N     . VAL A 1  512  ? 18.703  -49.544  -1.840  1.00 83.32  ? 512  VAL A N     1 
ATOM   3947  C  CA    . VAL A 1  512  ? 18.876  -50.988  -1.714  1.00 92.15  ? 512  VAL A CA    1 
ATOM   3948  C  C     . VAL A 1  512  ? 18.139  -51.425  -0.450  1.00 108.77 ? 512  VAL A C     1 
ATOM   3949  O  O     . VAL A 1  512  ? 18.507  -51.029  0.658   1.00 93.34  ? 512  VAL A O     1 
ATOM   3950  C  CB    . VAL A 1  512  ? 20.363  -51.377  -1.682  1.00 87.49  ? 512  VAL A CB    1 
ATOM   3951  C  CG1   . VAL A 1  512  ? 21.137  -50.517  -0.688  1.00 127.88 ? 512  VAL A CG1   1 
ATOM   3952  C  CG2   . VAL A 1  512  ? 20.550  -52.837  -1.373  1.00 85.72  ? 512  VAL A CG2   1 
ATOM   3953  N  N     . SER A 1  513  ? 17.055  -52.217  -0.619  1.00 115.04 ? 513  SER A N     1 
ATOM   3954  C  CA    . SER A 1  513  ? 16.123  -52.529  0.465   1.00 99.89  ? 513  SER A CA    1 
ATOM   3955  C  C     . SER A 1  513  ? 16.461  -53.855  1.126   1.00 87.31  ? 513  SER A C     1 
ATOM   3956  O  O     . SER A 1  513  ? 16.868  -54.804  0.452   1.00 106.83 ? 513  SER A O     1 
ATOM   3957  C  CB    . SER A 1  513  ? 14.678  -52.590  -0.034  1.00 112.96 ? 513  SER A CB    1 
ATOM   3958  O  OG    . SER A 1  513  ? 13.878  -53.415  0.809   1.00 110.98 ? 513  SER A OG    1 
ATOM   3959  N  N     . PRO A 1  514  ? 16.267  -53.916  2.443   1.00 83.41  ? 514  PRO A N     1 
ATOM   3960  C  CA    . PRO A 1  514  ? 16.541  -55.146  3.188   1.00 92.23  ? 514  PRO A CA    1 
ATOM   3961  C  C     . PRO A 1  514  ? 15.455  -56.194  3.051   1.00 106.17 ? 514  PRO A C     1 
ATOM   3962  O  O     . PRO A 1  514  ? 15.609  -57.313  3.561   1.00 94.35  ? 514  PRO A O     1 
ATOM   3963  C  CB    . PRO A 1  514  ? 16.632  -54.648  4.627   1.00 83.75  ? 514  PRO A CB    1 
ATOM   3964  C  CG    . PRO A 1  514  ? 15.721  -53.510  4.655   1.00 82.72  ? 514  PRO A CG    1 
ATOM   3965  C  CD    . PRO A 1  514  ? 15.828  -52.835  3.329   1.00 82.55  ? 514  PRO A CD    1 
ATOM   3966  N  N     . GLN A 1  515  ? 14.348  -55.852  2.407   1.00 92.11  ? 515  GLN A N     1 
ATOM   3967  C  CA    . GLN A 1  515  ? 13.265  -56.805  2.259   1.00 100.41 ? 515  GLN A CA    1 
ATOM   3968  C  C     . GLN A 1  515  ? 13.654  -57.912  1.298   1.00 108.68 ? 515  GLN A C     1 
ATOM   3969  O  O     . GLN A 1  515  ? 13.404  -59.092  1.565   1.00 130.24 ? 515  GLN A O     1 
ATOM   3970  C  CB    . GLN A 1  515  ? 12.023  -56.072  1.764   1.00 129.49 ? 515  GLN A CB    1 
ATOM   3971  C  CG    . GLN A 1  515  ? 10.940  -56.961  1.225   1.00 133.83 ? 515  GLN A CG    1 
ATOM   3972  C  CD    . GLN A 1  515  ? 9.929   -56.165  0.451   1.00 147.43 ? 515  GLN A CD    1 
ATOM   3973  O  OE1   . GLN A 1  515  ? 9.552   -55.054  0.849   1.00 119.78 ? 515  GLN A OE1   1 
ATOM   3974  N  NE2   . GLN A 1  515  ? 9.492   -56.712  -0.672  1.00 169.62 ? 515  GLN A NE2   1 
ATOM   3975  N  N     . SER A 1  516  ? 14.325  -57.548  0.205   1.00 91.95  ? 516  SER A N     1 
ATOM   3976  C  CA    . SER A 1  516  ? 14.707  -58.480  -0.851  1.00 90.40  ? 516  SER A CA    1 
ATOM   3977  C  C     . SER A 1  516  ? 16.208  -58.453  -1.138  1.00 102.54 ? 516  SER A C     1 
ATOM   3978  O  O     . SER A 1  516  ? 16.647  -58.992  -2.169  1.00 96.23  ? 516  SER A O     1 
ATOM   3979  C  CB    . SER A 1  516  ? 13.914  -58.167  -2.120  1.00 126.91 ? 516  SER A CB    1 
ATOM   3980  O  OG    . SER A 1  516  ? 13.856  -56.763  -2.331  1.00 152.14 ? 516  SER A OG    1 
ATOM   3981  N  N     . ASN A 1  517  ? 16.996  -57.868  -0.224  1.00 100.66 ? 517  ASN A N     1 
ATOM   3982  C  CA    . ASN A 1  517  ? 18.424  -57.580  -0.393  1.00 87.04  ? 517  ASN A CA    1 
ATOM   3983  C  C     . ASN A 1  517  ? 18.782  -57.172  -1.819  1.00 87.27  ? 517  ASN A C     1 
ATOM   3984  O  O     . ASN A 1  517  ? 19.827  -57.565  -2.345  1.00 126.20 ? 517  ASN A O     1 
ATOM   3985  C  CB    . ASN A 1  517  ? 19.326  -58.749  0.048   1.00 90.43  ? 517  ASN A CB    1 
ATOM   3986  C  CG    . ASN A 1  517  ? 18.989  -60.070  -0.597  1.00 97.68  ? 517  ASN A CG    1 
ATOM   3987  O  OD1   . ASN A 1  517  ? 18.412  -60.951  0.035   1.00 108.93 ? 517  ASN A OD1   1 
ATOM   3988  N  ND2   . ASN A 1  517  ? 19.340  -60.216  -1.861  1.00 93.57  ? 517  ASN A ND2   1 
ATOM   3989  N  N     . LYS A 1  518  ? 17.949  -56.335  -2.435  1.00 92.58  ? 518  LYS A N     1 
ATOM   3990  C  CA    . LYS A 1  518  ? 18.186  -55.808  -3.773  1.00 86.64  ? 518  LYS A CA    1 
ATOM   3991  C  C     . LYS A 1  518  ? 17.713  -54.358  -3.801  1.00 93.59  ? 518  LYS A C     1 
ATOM   3992  O  O     . LYS A 1  518  ? 17.087  -53.892  -2.836  1.00 93.83  ? 518  LYS A O     1 
ATOM   3993  C  CB    . LYS A 1  518  ? 17.464  -56.652  -4.843  1.00 123.85 ? 518  LYS A CB    1 
ATOM   3994  C  CG    . LYS A 1  518  ? 15.927  -56.628  -4.817  1.00 118.45 ? 518  LYS A CG    1 
ATOM   3995  C  CD    . LYS A 1  518  ? 15.352  -56.927  -6.221  1.00 86.76  ? 518  LYS A CD    1 
ATOM   3996  C  CE    . LYS A 1  518  ? 13.833  -56.707  -6.317  1.00 132.46 ? 518  LYS A CE    1 
ATOM   3997  N  NZ    . LYS A 1  518  ? 13.379  -55.376  -5.805  1.00 128.22 ? 518  LYS A NZ    1 
ATOM   3998  N  N     . PRO A 1  519  ? 17.999  -53.609  -4.863  1.00 86.21  ? 519  PRO A N     1 
ATOM   3999  C  CA    . PRO A 1  519  ? 17.428  -52.264  -4.975  1.00 88.02  ? 519  PRO A CA    1 
ATOM   4000  C  C     . PRO A 1  519  ? 15.911  -52.322  -5.055  1.00 90.27  ? 519  PRO A C     1 
ATOM   4001  O  O     . PRO A 1  519  ? 15.328  -53.301  -5.520  1.00 112.89 ? 519  PRO A O     1 
ATOM   4002  C  CB    . PRO A 1  519  ? 18.011  -51.743  -6.289  1.00 85.18  ? 519  PRO A CB    1 
ATOM   4003  C  CG    . PRO A 1  519  ? 19.252  -52.558  -6.498  1.00 93.24  ? 519  PRO A CG    1 
ATOM   4004  C  CD    . PRO A 1  519  ? 18.952  -53.899  -5.948  1.00 89.78  ? 519  PRO A CD    1 
ATOM   4005  N  N     . CYS A 1  520  ? 15.270  -51.236  -4.628  1.00 83.15  ? 520  CYS A N     1 
ATOM   4006  C  CA    . CYS A 1  520  ? 13.829  -51.092  -4.770  1.00 82.54  ? 520  CYS A CA    1 
ATOM   4007  C  C     . CYS A 1  520  ? 13.471  -49.915  -5.660  1.00 82.17  ? 520  CYS A C     1 
ATOM   4008  O  O     . CYS A 1  520  ? 12.299  -49.511  -5.708  1.00 106.91 ? 520  CYS A O     1 
ATOM   4009  C  CB    . CYS A 1  520  ? 13.140  -51.000  -3.407  1.00 81.94  ? 520  CYS A CB    1 
ATOM   4010  S  SG    . CYS A 1  520  ? 13.330  -49.456  -2.543  1.00 89.37  ? 520  CYS A SG    1 
ATOM   4011  N  N     . MET A 1  521  ? 14.457  -49.324  -6.320  1.00 82.52  ? 521  MET A N     1 
ATOM   4012  C  CA    . MET A 1  521  ? 14.232  -48.253  -7.273  1.00 94.82  ? 521  MET A CA    1 
ATOM   4013  C  C     . MET A 1  521  ? 15.043  -48.505  -8.527  1.00 92.36  ? 521  MET A C     1 
ATOM   4014  O  O     . MET A 1  521  ? 16.185  -48.961  -8.450  1.00 98.51  ? 521  MET A O     1 
ATOM   4015  C  CB    . MET A 1  521  ? 14.611  -46.908  -6.685  1.00 85.58  ? 521  MET A CB    1 
ATOM   4016  C  CG    . MET A 1  521  ? 13.811  -46.542  -5.478  1.00 89.86  ? 521  MET A CG    1 
ATOM   4017  S  SD    . MET A 1  521  ? 14.473  -45.062  -4.762  1.00 86.75  ? 521  MET A SD    1 
ATOM   4018  C  CE    . MET A 1  521  ? 14.132  -45.318  -3.010  1.00 84.72  ? 521  MET A CE    1 
ATOM   4019  N  N     . GLY A 1  522  ? 14.461  -48.188  -9.682  1.00 93.43  ? 522  GLY A N     1 
ATOM   4020  C  CA    . GLY A 1  522  ? 15.181  -48.420  -10.918 1.00 84.27  ? 522  GLY A CA    1 
ATOM   4021  C  C     . GLY A 1  522  ? 14.828  -47.454  -12.018 1.00 84.27  ? 522  GLY A C     1 
ATOM   4022  O  O     . GLY A 1  522  ? 14.111  -46.480  -11.797 1.00 102.64 ? 522  GLY A O     1 
ATOM   4023  N  N     . ILE A 1  523  ? 15.326  -47.718  -13.215 1.00 89.81  ? 523  ILE A N     1 
ATOM   4024  C  CA    . ILE A 1  523  ? 15.029  -46.894  -14.378 1.00 95.29  ? 523  ILE A CA    1 
ATOM   4025  C  C     . ILE A 1  523  ? 13.753  -47.428  -15.017 1.00 92.10  ? 523  ILE A C     1 
ATOM   4026  O  O     . ILE A 1  523  ? 13.663  -48.615  -15.350 1.00 96.09  ? 523  ILE A O     1 
ATOM   4027  C  CB    . ILE A 1  523  ? 16.202  -46.903  -15.366 1.00 86.86  ? 523  ILE A CB    1 
ATOM   4028  C  CG1   . ILE A 1  523  ? 17.457  -46.387  -14.675 1.00 86.44  ? 523  ILE A CG1   1 
ATOM   4029  C  CG2   . ILE A 1  523  ? 15.895  -46.050  -16.554 1.00 96.52  ? 523  ILE A CG2   1 
ATOM   4030  C  CD1   . ILE A 1  523  ? 17.417  -44.898  -14.379 1.00 96.48  ? 523  ILE A CD1   1 
ATOM   4031  N  N     . VAL A 1  524  ? 12.759  -46.558  -15.183 1.00 97.68  ? 524  VAL A N     1 
ATOM   4032  C  CA    . VAL A 1  524  ? 11.410  -47.005  -15.492 1.00 87.98  ? 524  VAL A CA    1 
ATOM   4033  C  C     . VAL A 1  524  ? 10.864  -46.222  -16.680 1.00 100.98 ? 524  VAL A C     1 
ATOM   4034  O  O     . VAL A 1  524  ? 11.309  -45.107  -16.972 1.00 125.26 ? 524  VAL A O     1 
ATOM   4035  C  CB    . VAL A 1  524  ? 10.493  -46.837  -14.256 1.00 86.78  ? 524  VAL A CB    1 
ATOM   4036  C  CG1   . VAL A 1  524  ? 9.161   -47.544  -14.461 1.00 132.39 ? 524  VAL A CG1   1 
ATOM   4037  C  CG2   . VAL A 1  524  ? 11.193  -47.309  -12.982 1.00 92.25  ? 524  VAL A CG2   1 
ATOM   4038  N  N     . GLN A 1  525  ? 9.927   -46.845  -17.397 1.00 88.72  ? 525  GLN A N     1 
ATOM   4039  C  CA    . GLN A 1  525  ? 9.026   -46.182  -18.368 1.00 96.30  ? 525  GLN A CA    1 
ATOM   4040  C  C     . GLN A 1  525  ? 9.844   -45.567  -19.501 1.00 105.90 ? 525  GLN A C     1 
ATOM   4041  O  O     . GLN A 1  525  ? 10.628  -46.289  -20.139 1.00 106.15 ? 525  GLN A O     1 
ATOM   4042  C  CB    . GLN A 1  525  ? 8.142   -45.191  -17.609 1.00 95.22  ? 525  GLN A CB    1 
ATOM   4043  C  CG    . GLN A 1  525  ? 7.067   -45.807  -16.726 1.00 115.90 ? 525  GLN A CG    1 
ATOM   4044  C  CD    . GLN A 1  525  ? 5.777   -46.081  -17.455 1.00 115.66 ? 525  GLN A CD    1 
ATOM   4045  O  OE1   . GLN A 1  525  ? 5.415   -45.374  -18.393 1.00 99.88  ? 525  GLN A OE1   1 
ATOM   4046  N  NE2   . GLN A 1  525  ? 5.068   -47.115  -17.023 1.00 132.39 ? 525  GLN A NE2   1 
ATOM   4047  N  N     . ASP A 1  526  ? 9.693   -44.266  -19.776 1.00 101.88 ? 526  ASP A N     1 
ATOM   4048  C  CA    . ASP A 1  526  ? 10.331  -43.616  -20.918 1.00 98.13  ? 526  ASP A CA    1 
ATOM   4049  C  C     . ASP A 1  526  ? 11.829  -43.852  -20.915 1.00 95.78  ? 526  ASP A C     1 
ATOM   4050  O  O     . ASP A 1  526  ? 12.414  -44.217  -21.937 1.00 105.75 ? 526  ASP A O     1 
ATOM   4051  C  CB    . ASP A 1  526  ? 10.051  -42.111  -20.890 1.00 105.07 ? 526  ASP A CB    1 
ATOM   4052  C  CG    . ASP A 1  526  ? 8.777   -41.740  -21.603 1.00 122.84 ? 526  ASP A CG    1 
ATOM   4053  O  OD1   . ASP A 1  526  ? 7.835   -42.557  -21.578 1.00 142.68 ? 526  ASP A OD1   1 
ATOM   4054  O  OD2   . ASP A 1  526  ? 8.695   -40.626  -22.158 1.00 130.61 ? 526  ASP A OD2   1 
ATOM   4055  N  N     . THR A 1  527  ? 12.474  -43.596  -19.775 1.00 103.02 ? 527  THR A N     1 
ATOM   4056  C  CA    . THR A 1  527  ? 13.929  -43.656  -19.708 1.00 102.25 ? 527  THR A CA    1 
ATOM   4057  C  C     . THR A 1  527  ? 14.425  -45.077  -19.932 1.00 97.68  ? 527  THR A C     1 
ATOM   4058  O  O     . THR A 1  527  ? 15.464  -45.284  -20.570 1.00 101.16 ? 527  THR A O     1 
ATOM   4059  C  CB    . THR A 1  527  ? 14.410  -43.113  -18.355 1.00 92.77  ? 527  THR A CB    1 
ATOM   4060  O  OG1   . THR A 1  527  ? 13.910  -41.786  -18.164 1.00 96.07  ? 527  THR A OG1   1 
ATOM   4061  C  CG2   . THR A 1  527  ? 15.924  -43.049  -18.281 1.00 96.85  ? 527  THR A CG2   1 
ATOM   4062  N  N     . LEU A 1  528  ? 13.661  -46.071  -19.488 1.00 101.00 ? 528  LEU A N     1 
ATOM   4063  C  CA    . LEU A 1  528  ? 14.062  -47.449  -19.739 1.00 106.83 ? 528  LEU A CA    1 
ATOM   4064  C  C     . LEU A 1  528  ? 13.848  -47.836  -21.199 1.00 100.65 ? 528  LEU A C     1 
ATOM   4065  O  O     . LEU A 1  528  ? 14.694  -48.505  -21.798 1.00 101.53 ? 528  LEU A O     1 
ATOM   4066  C  CB    . LEU A 1  528  ? 13.309  -48.395  -18.804 1.00 93.57  ? 528  LEU A CB    1 
ATOM   4067  C  CG    . LEU A 1  528  ? 13.607  -49.875  -19.039 1.00 88.65  ? 528  LEU A CG    1 
ATOM   4068  C  CD1   . LEU A 1  528  ? 15.100  -50.133  -18.980 1.00 89.30  ? 528  LEU A CD1   1 
ATOM   4069  C  CD2   . LEU A 1  528  ? 12.864  -50.742  -18.041 1.00 91.80  ? 528  LEU A CD2   1 
ATOM   4070  N  N     . CYS A 1  529  ? 12.736  -47.413  -21.797 1.00 113.97 ? 529  CYS A N     1 
ATOM   4071  C  CA    . CYS A 1  529  ? 12.496  -47.725  -23.203 1.00 117.78 ? 529  CYS A CA    1 
ATOM   4072  C  C     . CYS A 1  529  ? 13.521  -47.039  -24.100 1.00 125.24 ? 529  CYS A C     1 
ATOM   4073  O  O     . CYS A 1  529  ? 14.002  -47.626  -25.076 1.00 126.38 ? 529  CYS A O     1 
ATOM   4074  C  CB    . CYS A 1  529  ? 11.075  -47.309  -23.587 1.00 100.78 ? 529  CYS A CB    1 
ATOM   4075  S  SG    . CYS A 1  529  ? 10.612  -47.589  -25.301 1.00 118.35 ? 529  CYS A SG    1 
ATOM   4076  N  N     . GLY A 1  530  ? 13.897  -45.810  -23.756 1.00 107.40 ? 530  GLY A N     1 
ATOM   4077  C  CA    . GLY A 1  530  ? 14.843  -45.069  -24.562 1.00 105.52 ? 530  GLY A CA    1 
ATOM   4078  C  C     . GLY A 1  530  ? 16.278  -45.487  -24.368 1.00 113.75 ? 530  GLY A C     1 
ATOM   4079  O  O     . GLY A 1  530  ? 17.089  -45.340  -25.284 1.00 114.54 ? 530  GLY A O     1 
ATOM   4080  N  N     . ILE A 1  531  ? 16.627  -45.992  -23.181 1.00 108.58 ? 531  ILE A N     1 
ATOM   4081  C  CA    . ILE A 1  531  ? 18.024  -46.356  -22.953 1.00 106.60 ? 531  ILE A CA    1 
ATOM   4082  C  C     . ILE A 1  531  ? 18.418  -47.594  -23.751 1.00 120.28 ? 531  ILE A C     1 
ATOM   4083  O  O     . ILE A 1  531  ? 19.599  -47.759  -24.091 1.00 153.42 ? 531  ILE A O     1 
ATOM   4084  C  CB    . ILE A 1  531  ? 18.276  -46.547  -21.446 1.00 91.07  ? 531  ILE A CB    1 
ATOM   4085  C  CG1   . ILE A 1  531  ? 19.766  -46.440  -21.127 1.00 94.59  ? 531  ILE A CG1   1 
ATOM   4086  C  CG2   . ILE A 1  531  ? 17.724  -47.861  -20.953 1.00 90.90  ? 531  ILE A CG2   1 
ATOM   4087  C  CD1   . ILE A 1  531  ? 20.092  -46.449  -19.650 1.00 97.89  ? 531  ILE A CD1   1 
ATOM   4088  N  N     . ARG A 1  532  ? 17.440  -48.387  -24.197 1.00 109.59 ? 532  ARG A N     1 
ATOM   4089  C  CA    . ARG A 1  532  ? 17.737  -49.478  -25.117 1.00 102.47 ? 532  ARG A CA    1 
ATOM   4090  C  C     . ARG A 1  532  ? 17.904  -48.974  -26.543 1.00 102.27 ? 532  ARG A C     1 
ATOM   4091  O  O     . ARG A 1  532  ? 18.840  -49.374  -27.242 1.00 117.29 ? 532  ARG A O     1 
ATOM   4092  C  CB    . ARG A 1  532  ? 16.656  -50.557  -25.056 1.00 95.95  ? 532  ARG A CB    1 
ATOM   4093  C  CG    . ARG A 1  532  ? 16.879  -51.685  -26.043 1.00 101.16 ? 532  ARG A CG    1 
ATOM   4094  C  CD    . ARG A 1  532  ? 15.626  -52.464  -26.340 1.00 114.99 ? 532  ARG A CD    1 
ATOM   4095  N  NE    . ARG A 1  532  ? 15.554  -52.791  -27.751 1.00 130.02 ? 532  ARG A NE    1 
ATOM   4096  C  CZ    . ARG A 1  532  ? 14.932  -52.016  -28.639 1.00 145.09 ? 532  ARG A CZ    1 
ATOM   4097  N  NH1   . ARG A 1  532  ? 14.340  -50.906  -28.227 1.00 121.14 ? 532  ARG A NH1   1 
ATOM   4098  N  NH2   . ARG A 1  532  ? 14.911  -52.351  -29.923 1.00 149.61 ? 532  ARG A NH2   1 
ATOM   4099  N  N     . LYS A 1  533  ? 16.986  -48.123  -27.011 1.00 106.52 ? 533  LYS A N     1 
ATOM   4100  C  CA    . LYS A 1  533  ? 17.134  -47.569  -28.351 1.00 115.67 ? 533  LYS A CA    1 
ATOM   4101  C  C     . LYS A 1  533  ? 18.435  -46.785  -28.461 1.00 114.16 ? 533  LYS A C     1 
ATOM   4102  O  O     . LYS A 1  533  ? 19.148  -46.874  -29.468 1.00 131.36 ? 533  LYS A O     1 
ATOM   4103  C  CB    . LYS A 1  533  ? 15.928  -46.678  -28.686 1.00 117.90 ? 533  LYS A CB    1 
ATOM   4104  C  CG    . LYS A 1  533  ? 14.598  -47.433  -28.840 1.00 111.77 ? 533  LYS A CG    1 
ATOM   4105  C  CD    . LYS A 1  533  ? 13.449  -46.545  -29.293 1.00 95.17  ? 533  LYS A CD    1 
ATOM   4106  C  CE    . LYS A 1  533  ? 13.643  -46.115  -30.738 1.00 107.55 ? 533  LYS A CE    1 
ATOM   4107  N  NZ    . LYS A 1  533  ? 13.227  -47.145  -31.739 1.00 112.48 ? 533  LYS A NZ    1 
ATOM   4108  N  N     . LEU A 1  534  ? 18.776  -46.040  -27.413 1.00 101.56 ? 534  LEU A N     1 
ATOM   4109  C  CA    . LEU A 1  534  ? 20.014  -45.273  -27.397 1.00 109.76 ? 534  LEU A CA    1 
ATOM   4110  C  C     . LEU A 1  534  ? 21.218  -46.203  -27.396 1.00 112.45 ? 534  LEU A C     1 
ATOM   4111  O  O     . LEU A 1  534  ? 22.225  -45.929  -28.060 1.00 102.01 ? 534  LEU A O     1 
ATOM   4112  C  CB    . LEU A 1  534  ? 20.048  -44.353  -26.176 1.00 111.28 ? 534  LEU A CB    1 
ATOM   4113  C  CG    . LEU A 1  534  ? 21.402  -43.671  -25.976 1.00 98.17  ? 534  LEU A CG    1 
ATOM   4114  C  CD1   . LEU A 1  534  ? 21.654  -42.683  -27.106 1.00 103.59 ? 534  LEU A CD1   1 
ATOM   4115  C  CD2   . LEU A 1  534  ? 21.522  -43.023  -24.604 1.00 94.26  ? 534  LEU A CD2   1 
ATOM   4116  N  N     . THR A 1  535  ? 21.129  -47.317  -26.661 1.00 114.58 ? 535  THR A N     1 
ATOM   4117  C  CA    . THR A 1  535  ? 22.272  -48.203  -26.493 1.00 101.61 ? 535  THR A CA    1 
ATOM   4118  C  C     . THR A 1  535  ? 22.493  -49.101  -27.712 1.00 125.96 ? 535  THR A C     1 
ATOM   4119  O  O     . THR A 1  535  ? 23.571  -49.688  -27.841 1.00 134.71 ? 535  THR A O     1 
ATOM   4120  C  CB    . THR A 1  535  ? 22.057  -49.048  -25.230 1.00 113.27 ? 535  THR A CB    1 
ATOM   4121  O  OG1   . THR A 1  535  ? 21.877  -48.179  -24.112 1.00 126.91 ? 535  THR A OG1   1 
ATOM   4122  C  CG2   . THR A 1  535  ? 23.235  -49.942  -24.929 1.00 147.53 ? 535  THR A CG2   1 
ATOM   4123  N  N     . LEU A 1  536  ? 21.514  -49.197  -28.619 1.00 129.82 ? 536  LEU A N     1 
ATOM   4124  C  CA    . LEU A 1  536  ? 21.631  -50.040  -29.810 1.00 121.25 ? 536  LEU A CA    1 
ATOM   4125  C  C     . LEU A 1  536  ? 22.953  -49.818  -30.535 1.00 128.78 ? 536  LEU A C     1 
ATOM   4126  O  O     . LEU A 1  536  ? 23.505  -48.714  -30.556 1.00 139.44 ? 536  LEU A O     1 
ATOM   4127  C  CB    . LEU A 1  536  ? 20.467  -49.799  -30.776 1.00 112.67 ? 536  LEU A CB    1 
ATOM   4128  C  CG    . LEU A 1  536  ? 19.110  -50.329  -30.322 1.00 118.50 ? 536  LEU A CG    1 
ATOM   4129  C  CD1   . LEU A 1  536  ? 18.127  -50.383  -31.482 1.00 136.72 ? 536  LEU A CD1   1 
ATOM   4130  C  CD2   . LEU A 1  536  ? 19.280  -51.703  -29.716 1.00 111.30 ? 536  LEU A CD2   1 
ATOM   4131  N  N     . ARG A 1  537  ? 23.471  -50.900  -31.114 1.00 134.16 ? 537  ARG A N     1 
ATOM   4132  C  CA    . ARG A 1  537  ? 24.796  -50.861  -31.722 1.00 134.67 ? 537  ARG A CA    1 
ATOM   4133  C  C     . ARG A 1  537  ? 24.856  -49.864  -32.870 1.00 125.64 ? 537  ARG A C     1 
ATOM   4134  O  O     . ARG A 1  537  ? 25.876  -49.190  -33.065 1.00 131.09 ? 537  ARG A O     1 
ATOM   4135  C  CB    . ARG A 1  537  ? 25.179  -52.251  -32.210 1.00 146.02 ? 537  ARG A CB    1 
ATOM   4136  C  CG    . ARG A 1  537  ? 26.659  -52.472  -32.315 1.00 141.55 ? 537  ARG A CG    1 
ATOM   4137  C  CD    . ARG A 1  537  ? 26.919  -53.774  -33.033 1.00 145.54 ? 537  ARG A CD    1 
ATOM   4138  N  NE    . ARG A 1  537  ? 26.837  -54.928  -32.142 1.00 153.76 ? 537  ARG A NE    1 
ATOM   4139  C  CZ    . ARG A 1  537  ? 27.811  -55.296  -31.314 1.00 160.50 ? 537  ARG A CZ    1 
ATOM   4140  N  NH1   . ARG A 1  537  ? 28.934  -54.595  -31.261 1.00 183.40 ? 537  ARG A NH1   1 
ATOM   4141  N  NH2   . ARG A 1  537  ? 27.669  -56.364  -30.542 1.00 134.36 ? 537  ARG A NH2   1 
ATOM   4142  N  N     . ASP A 1  538  ? 23.774  -49.757  -33.640 1.00 118.59 ? 538  ASP A N     1 
ATOM   4143  C  CA    . ASP A 1  538  ? 23.712  -48.868  -34.791 1.00 132.62 ? 538  ASP A CA    1 
ATOM   4144  C  C     . ASP A 1  538  ? 23.028  -47.548  -34.458 1.00 139.63 ? 538  ASP A C     1 
ATOM   4145  O  O     . ASP A 1  538  ? 22.500  -46.873  -35.350 1.00 140.08 ? 538  ASP A O     1 
ATOM   4146  C  CB    . ASP A 1  538  ? 23.014  -49.560  -35.966 1.00 140.17 ? 538  ASP A CB    1 
ATOM   4147  C  CG    . ASP A 1  538  ? 21.567  -49.909  -35.670 1.00 148.39 ? 538  ASP A CG    1 
ATOM   4148  O  OD1   . ASP A 1  538  ? 21.172  -49.897  -34.484 1.00 162.18 ? 538  ASP A OD1   1 
ATOM   4149  O  OD2   . ASP A 1  538  ? 20.820  -50.196  -36.629 1.00 141.41 ? 538  ASP A OD2   1 
ATOM   4150  N  N     . THR A 1  539  ? 23.061  -47.151  -33.188 1.00 131.92 ? 539  THR A N     1 
ATOM   4151  C  CA    . THR A 1  539  ? 22.581  -45.846  -32.751 1.00 114.95 ? 539  THR A CA    1 
ATOM   4152  C  C     . THR A 1  539  ? 23.795  -44.933  -32.627 1.00 119.26 ? 539  THR A C     1 
ATOM   4153  O  O     . THR A 1  539  ? 24.654  -45.145  -31.763 1.00 124.35 ? 539  THR A O     1 
ATOM   4154  C  CB    . THR A 1  539  ? 21.822  -45.951  -31.431 1.00 106.18 ? 539  THR A CB    1 
ATOM   4155  O  OG1   . THR A 1  539  ? 20.540  -46.538  -31.676 1.00 138.49 ? 539  THR A OG1   1 
ATOM   4156  C  CG2   . THR A 1  539  ? 21.630  -44.582  -30.798 1.00 99.91  ? 539  THR A CG2   1 
ATOM   4157  N  N     . PHE A 1  540  ? 23.882  -43.950  -33.520 1.00 119.10 ? 540  PHE A N     1 
ATOM   4158  C  CA    . PHE A 1  540  ? 25.004  -43.030  -33.576 1.00 106.69 ? 540  PHE A CA    1 
ATOM   4159  C  C     . PHE A 1  540  ? 24.498  -41.604  -33.429 1.00 113.27 ? 540  PHE A C     1 
ATOM   4160  O  O     . PHE A 1  540  ? 23.467  -41.235  -34.002 1.00 117.77 ? 540  PHE A O     1 
ATOM   4161  C  CB    . PHE A 1  540  ? 25.777  -43.177  -34.887 1.00 113.13 ? 540  PHE A CB    1 
ATOM   4162  C  CG    . PHE A 1  540  ? 26.496  -44.493  -35.024 1.00 122.39 ? 540  PHE A CG    1 
ATOM   4163  C  CD1   . PHE A 1  540  ? 25.802  -45.687  -35.035 1.00 133.94 ? 540  PHE A CD1   1 
ATOM   4164  C  CD2   . PHE A 1  540  ? 27.874  -44.535  -35.134 1.00 126.26 ? 540  PHE A CD2   1 
ATOM   4165  C  CE1   . PHE A 1  540  ? 26.465  -46.891  -35.151 1.00 133.26 ? 540  PHE A CE1   1 
ATOM   4166  C  CE2   . PHE A 1  540  ? 28.542  -45.750  -35.254 1.00 127.98 ? 540  PHE A CE2   1 
ATOM   4167  C  CZ    . PHE A 1  540  ? 27.832  -46.924  -35.261 1.00 133.31 ? 540  PHE A CZ    1 
ATOM   4168  N  N     . ILE A 1  541  ? 25.236  -40.793  -32.679 1.00 117.84 ? 541  ILE A N     1 
ATOM   4169  C  CA    . ILE A 1  541  ? 24.829  -39.427  -32.387 1.00 120.73 ? 541  ILE A CA    1 
ATOM   4170  C  C     . ILE A 1  541  ? 25.821  -38.470  -33.024 1.00 132.48 ? 541  ILE A C     1 
ATOM   4171  O  O     . ILE A 1  541  ? 27.038  -38.688  -32.972 1.00 125.98 ? 541  ILE A O     1 
ATOM   4172  C  CB    . ILE A 1  541  ? 24.723  -39.174  -30.869 1.00 107.85 ? 541  ILE A CB    1 
ATOM   4173  C  CG1   . ILE A 1  541  ? 23.637  -40.058  -30.261 1.00 107.59 ? 541  ILE A CG1   1 
ATOM   4174  C  CG2   . ILE A 1  541  ? 24.358  -37.737  -30.600 1.00 131.49 ? 541  ILE A CG2   1 
ATOM   4175  C  CD1   . ILE A 1  541  ? 24.153  -41.287  -29.556 1.00 125.98 ? 541  ILE A CD1   1 
ATOM   4176  N  N     . GLU A 1  542  ? 25.291  -37.413  -33.632 1.00 124.32 ? 542  GLU A N     1 
ATOM   4177  C  CA    . GLU A 1  542  ? 26.097  -36.411  -34.302 1.00 119.13 ? 542  GLU A CA    1 
ATOM   4178  C  C     . GLU A 1  542  ? 26.644  -35.425  -33.268 1.00 134.37 ? 542  GLU A C     1 
ATOM   4179  O  O     . GLU A 1  542  ? 26.244  -35.416  -32.096 1.00 148.09 ? 542  GLU A O     1 
ATOM   4180  C  CB    . GLU A 1  542  ? 25.257  -35.698  -35.352 1.00 120.88 ? 542  GLU A CB    1 
ATOM   4181  C  CG    . GLU A 1  542  ? 25.956  -35.449  -36.650 1.00 141.03 ? 542  GLU A CG    1 
ATOM   4182  C  CD    . GLU A 1  542  ? 24.973  -35.371  -37.788 1.00 160.02 ? 542  GLU A CD    1 
ATOM   4183  O  OE1   . GLU A 1  542  ? 23.765  -35.164  -37.511 1.00 160.26 ? 542  GLU A OE1   1 
ATOM   4184  O  OE2   . GLU A 1  542  ? 25.396  -35.477  -38.948 1.00 170.68 ? 542  GLU A OE2   1 
ATOM   4185  N  N     . LEU A 1  543  ? 27.571  -34.575  -33.709 1.00 125.45 ? 543  LEU A N     1 
ATOM   4186  C  CA    . LEU A 1  543  ? 28.253  -33.662  -32.784 1.00 118.55 ? 543  LEU A CA    1 
ATOM   4187  C  C     . LEU A 1  543  ? 27.302  -32.633  -32.182 1.00 117.61 ? 543  LEU A C     1 
ATOM   4188  O  O     . LEU A 1  543  ? 27.326  -32.385  -30.963 1.00 118.42 ? 543  LEU A O     1 
ATOM   4189  C  CB    . LEU A 1  543  ? 29.405  -32.957  -33.506 1.00 134.14 ? 543  LEU A CB    1 
ATOM   4190  C  CG    . LEU A 1  543  ? 29.964  -31.751  -32.737 1.00 107.04 ? 543  LEU A CG    1 
ATOM   4191  C  CD1   . LEU A 1  543  ? 30.642  -32.187  -31.460 1.00 106.39 ? 543  LEU A CD1   1 
ATOM   4192  C  CD2   . LEU A 1  543  ? 30.900  -30.925  -33.584 1.00 108.81 ? 543  LEU A CD2   1 
ATOM   4193  N  N     . ASP A 1  544  ? 26.449  -32.040  -33.028 1.00 126.27 ? 544  ASP A N     1 
ATOM   4194  C  CA    . ASP A 1  544  ? 25.512  -31.010  -32.582 1.00 136.31 ? 544  ASP A CA    1 
ATOM   4195  C  C     . ASP A 1  544  ? 24.673  -31.476  -31.410 1.00 121.49 ? 544  ASP A C     1 
ATOM   4196  O  O     . ASP A 1  544  ? 24.381  -30.690  -30.501 1.00 127.11 ? 544  ASP A O     1 
ATOM   4197  C  CB    . ASP A 1  544  ? 24.597  -30.598  -33.749 1.00 147.55 ? 544  ASP A CB    1 
ATOM   4198  C  CG    . ASP A 1  544  ? 23.757  -31.763  -34.287 1.00 154.12 ? 544  ASP A CG    1 
ATOM   4199  O  OD1   . ASP A 1  544  ? 24.093  -32.929  -33.998 1.00 160.12 ? 544  ASP A OD1   1 
ATOM   4200  O  OD2   . ASP A 1  544  ? 22.745  -31.517  -34.980 1.00 156.16 ? 544  ASP A OD2   1 
ATOM   4201  N  N     . GLN A 1  545  ? 24.323  -32.757  -31.392 1.00 114.37 ? 545  GLN A N     1 
ATOM   4202  C  CA    . GLN A 1  545  ? 23.477  -33.326  -30.360 1.00 113.71 ? 545  GLN A CA    1 
ATOM   4203  C  C     . GLN A 1  545  ? 24.301  -33.883  -29.202 1.00 131.44 ? 545  GLN A C     1 
ATOM   4204  O  O     . GLN A 1  545  ? 23.856  -33.840  -28.044 1.00 142.27 ? 545  GLN A O     1 
ATOM   4205  C  CB    . GLN A 1  545  ? 22.611  -34.422  -30.996 1.00 119.02 ? 545  GLN A CB    1 
ATOM   4206  C  CG    . GLN A 1  545  ? 21.703  -35.163  -30.046 1.00 147.88 ? 545  GLN A CG    1 
ATOM   4207  C  CD    . GLN A 1  545  ? 20.385  -35.538  -30.691 1.00 156.69 ? 545  GLN A CD    1 
ATOM   4208  O  OE1   . GLN A 1  545  ? 20.135  -36.705  -31.009 1.00 128.47 ? 545  GLN A OE1   1 
ATOM   4209  N  NE2   . GLN A 1  545  ? 19.547  -34.535  -30.926 1.00 169.52 ? 545  GLN A NE2   1 
ATOM   4210  N  N     . VAL A 1  546  ? 25.520  -34.355  -29.487 1.00 125.61 ? 546  VAL A N     1 
ATOM   4211  C  CA    . VAL A 1  546  ? 26.403  -34.831  -28.427 1.00 116.37 ? 546  VAL A CA    1 
ATOM   4212  C  C     . VAL A 1  546  ? 26.668  -33.708  -27.437 1.00 116.67 ? 546  VAL A C     1 
ATOM   4213  O  O     . VAL A 1  546  ? 26.617  -33.901  -26.217 1.00 110.84 ? 546  VAL A O     1 
ATOM   4214  C  CB    . VAL A 1  546  ? 27.721  -35.387  -29.005 1.00 109.28 ? 546  VAL A CB    1 
ATOM   4215  C  CG1   . VAL A 1  546  ? 28.790  -35.456  -27.918 1.00 115.10 ? 546  VAL A CG1   1 
ATOM   4216  C  CG2   . VAL A 1  546  ? 27.528  -36.777  -29.601 1.00 109.37 ? 546  VAL A CG2   1 
ATOM   4217  N  N     . LEU A 1  547  ? 26.965  -32.511  -27.948 1.00 110.56 ? 547  LEU A N     1 
ATOM   4218  C  CA    . LEU A 1  547  ? 27.304  -31.427  -27.035 1.00 115.07 ? 547  LEU A CA    1 
ATOM   4219  C  C     . LEU A 1  547  ? 26.137  -31.062  -26.117 1.00 121.13 ? 547  LEU A C     1 
ATOM   4220  O  O     . LEU A 1  547  ? 26.349  -30.732  -24.940 1.00 122.43 ? 547  LEU A O     1 
ATOM   4221  C  CB    . LEU A 1  547  ? 27.770  -30.211  -27.837 1.00 115.23 ? 547  LEU A CB    1 
ATOM   4222  C  CG    . LEU A 1  547  ? 28.892  -30.504  -28.838 1.00 107.72 ? 547  LEU A CG    1 
ATOM   4223  C  CD1   . LEU A 1  547  ? 29.307  -29.238  -29.563 1.00 116.39 ? 547  LEU A CD1   1 
ATOM   4224  C  CD2   . LEU A 1  547  ? 30.086  -31.163  -28.156 1.00 103.09 ? 547  LEU A CD2   1 
ATOM   4225  N  N     . ASN A 1  548  ? 24.901  -31.202  -26.601 1.00 116.80 ? 548  ASN A N     1 
ATOM   4226  C  CA    . ASN A 1  548  ? 23.736  -30.955  -25.753 1.00 103.35 ? 548  ASN A CA    1 
ATOM   4227  C  C     . ASN A 1  548  ? 23.570  -32.048  -24.708 1.00 114.92 ? 548  ASN A C     1 
ATOM   4228  O  O     . ASN A 1  548  ? 23.327  -31.755  -23.528 1.00 123.09 ? 548  ASN A O     1 
ATOM   4229  C  CB    . ASN A 1  548  ? 22.477  -30.810  -26.612 1.00 95.96  ? 548  ASN A CB    1 
ATOM   4230  C  CG    . ASN A 1  548  ? 22.366  -29.436  -27.257 1.00 110.05 ? 548  ASN A CG    1 
ATOM   4231  O  OD1   . ASN A 1  548  ? 22.743  -28.433  -26.651 1.00 109.88 ? 548  ASN A OD1   1 
ATOM   4232  N  ND2   . ASN A 1  548  ? 21.861  -29.384  -28.488 1.00 118.89 ? 548  ASN A ND2   1 
ATOM   4233  N  N     . MET A 1  549  ? 23.765  -33.308  -25.104 1.00 124.71 ? 549  MET A N     1 
ATOM   4234  C  CA    . MET A 1  549  ? 23.663  -34.382  -24.124 1.00 107.75 ? 549  MET A CA    1 
ATOM   4235  C  C     . MET A 1  549  ? 24.742  -34.249  -23.054 1.00 112.59 ? 549  MET A C     1 
ATOM   4236  O  O     . MET A 1  549  ? 24.525  -34.615  -21.893 1.00 119.49 ? 549  MET A O     1 
ATOM   4237  C  CB    . MET A 1  549  ? 23.777  -35.734  -24.823 1.00 95.10  ? 549  MET A CB    1 
ATOM   4238  C  CG    . MET A 1  549  ? 22.797  -35.988  -25.949 1.00 95.33  ? 549  MET A CG    1 
ATOM   4239  S  SD    . MET A 1  549  ? 22.688  -37.775  -26.156 1.00 124.74 ? 549  MET A SD    1 
ATOM   4240  C  CE    . MET A 1  549  ? 22.076  -37.867  -27.808 1.00 126.02 ? 549  MET A CE    1 
ATOM   4241  N  N     . LEU A 1  550  ? 25.911  -33.737  -23.423 1.00 106.55 ? 550  LEU A N     1 
ATOM   4242  C  CA    . LEU A 1  550  ? 26.968  -33.589  -22.437 1.00 103.18 ? 550  LEU A CA    1 
ATOM   4243  C  C     . LEU A 1  550  ? 26.626  -32.465  -21.477 1.00 111.83 ? 550  LEU A C     1 
ATOM   4244  O  O     . LEU A 1  550  ? 26.572  -32.670  -20.259 1.00 114.80 ? 550  LEU A O     1 
ATOM   4245  C  CB    . LEU A 1  550  ? 28.313  -33.345  -23.124 1.00 108.00 ? 550  LEU A CB    1 
ATOM   4246  C  CG    . LEU A 1  550  ? 28.820  -34.542  -23.929 1.00 99.17  ? 550  LEU A CG    1 
ATOM   4247  C  CD1   . LEU A 1  550  ? 30.048  -34.187  -24.738 1.00 115.89 ? 550  LEU A CD1   1 
ATOM   4248  C  CD2   . LEU A 1  550  ? 29.113  -35.686  -22.976 1.00 97.84  ? 550  LEU A CD2   1 
ATOM   4249  N  N     . TYR A 1  551  ? 26.306  -31.285  -22.016 1.00 97.61  ? 551  TYR A N     1 
ATOM   4250  C  CA    . TYR A 1  551  ? 25.965  -30.167  -21.147 1.00 94.44  ? 551  TYR A CA    1 
ATOM   4251  C  C     . TYR A 1  551  ? 24.733  -30.445  -20.302 1.00 104.80 ? 551  TYR A C     1 
ATOM   4252  O  O     . TYR A 1  551  ? 24.533  -29.765  -19.285 1.00 92.20  ? 551  TYR A O     1 
ATOM   4253  C  CB    . TYR A 1  551  ? 25.751  -28.892  -21.972 1.00 100.10 ? 551  TYR A CB    1 
ATOM   4254  C  CG    . TYR A 1  551  ? 25.570  -27.650  -21.115 1.00 103.15 ? 551  TYR A CG    1 
ATOM   4255  C  CD1   . TYR A 1  551  ? 26.405  -27.405  -20.039 1.00 103.40 ? 551  TYR A CD1   1 
ATOM   4256  C  CD2   . TYR A 1  551  ? 24.565  -26.731  -21.373 1.00 97.93  ? 551  TYR A CD2   1 
ATOM   4257  C  CE1   . TYR A 1  551  ? 26.244  -26.283  -19.234 1.00 116.54 ? 551  TYR A CE1   1 
ATOM   4258  C  CE2   . TYR A 1  551  ? 24.401  -25.598  -20.566 1.00 118.13 ? 551  TYR A CE2   1 
ATOM   4259  C  CZ    . TYR A 1  551  ? 25.244  -25.381  -19.501 1.00 122.94 ? 551  TYR A CZ    1 
ATOM   4260  O  OH    . TYR A 1  551  ? 25.081  -24.262  -18.705 1.00 105.64 ? 551  TYR A OH    1 
ATOM   4261  N  N     . TRP A 1  552  ? 23.958  -31.483  -20.641 1.00 107.14 ? 552  TRP A N     1 
ATOM   4262  C  CA    . TRP A 1  552  ? 22.777  -31.815  -19.852 1.00 102.22 ? 552  TRP A CA    1 
ATOM   4263  C  C     . TRP A 1  552  ? 23.126  -32.548  -18.561 1.00 108.88 ? 552  TRP A C     1 
ATOM   4264  O  O     . TRP A 1  552  ? 22.373  -32.461  -17.584 1.00 113.47 ? 552  TRP A O     1 
ATOM   4265  C  CB    . TRP A 1  552  ? 21.833  -32.660  -20.712 1.00 90.93  ? 552  TRP A CB    1 
ATOM   4266  C  CG    . TRP A 1  552  ? 20.582  -31.922  -21.099 1.00 107.58 ? 552  TRP A CG    1 
ATOM   4267  C  CD1   . TRP A 1  552  ? 20.278  -31.446  -22.336 1.00 117.33 ? 552  TRP A CD1   1 
ATOM   4268  C  CD2   . TRP A 1  552  ? 19.487  -31.572  -20.257 1.00 90.13  ? 552  TRP A CD2   1 
ATOM   4269  N  NE1   . TRP A 1  552  ? 19.067  -30.812  -22.313 1.00 111.56 ? 552  TRP A NE1   1 
ATOM   4270  C  CE2   . TRP A 1  552  ? 18.561  -30.881  -21.045 1.00 89.38  ? 552  TRP A CE2   1 
ATOM   4271  C  CE3   . TRP A 1  552  ? 19.204  -31.773  -18.912 1.00 113.16 ? 552  TRP A CE3   1 
ATOM   4272  C  CZ2   . TRP A 1  552  ? 17.378  -30.390  -20.535 1.00 106.01 ? 552  TRP A CZ2   1 
ATOM   4273  C  CZ3   . TRP A 1  552  ? 18.028  -31.286  -18.411 1.00 115.26 ? 552  TRP A CZ3   1 
ATOM   4274  C  CH2   . TRP A 1  552  ? 17.131  -30.602  -19.215 1.00 104.62 ? 552  TRP A CH2   1 
ATOM   4275  N  N     . VAL A 1  553  ? 24.255  -33.248  -18.527 1.00 109.93 ? 553  VAL A N     1 
ATOM   4276  C  CA    . VAL A 1  553  ? 24.759  -33.897  -17.319 1.00 91.87  ? 553  VAL A CA    1 
ATOM   4277  C  C     . VAL A 1  553  ? 25.455  -32.856  -16.454 1.00 120.45 ? 553  VAL A C     1 
ATOM   4278  O  O     . VAL A 1  553  ? 26.482  -32.298  -16.865 1.00 120.48 ? 553  VAL A O     1 
ATOM   4279  C  CB    . VAL A 1  553  ? 25.706  -35.054  -17.648 1.00 99.17  ? 553  VAL A CB    1 
ATOM   4280  C  CG1   . VAL A 1  553  ? 25.790  -35.981  -16.476 1.00 100.39 ? 553  VAL A CG1   1 
ATOM   4281  C  CG2   . VAL A 1  553  ? 25.244  -35.788  -18.894 1.00 93.92  ? 553  VAL A CG2   1 
ATOM   4282  N  N     . PRO A 1  554  ? 24.941  -32.573  -15.257 1.00 113.84 ? 554  PRO A N     1 
ATOM   4283  C  CA    . PRO A 1  554  ? 25.516  -31.482  -14.449 1.00 117.26 ? 554  PRO A CA    1 
ATOM   4284  C  C     . PRO A 1  554  ? 26.927  -31.742  -13.954 1.00 121.33 ? 554  PRO A C     1 
ATOM   4285  O  O     . PRO A 1  554  ? 27.751  -30.818  -13.947 1.00 142.28 ? 554  PRO A O     1 
ATOM   4286  C  CB    . PRO A 1  554  ? 24.526  -31.362  -13.284 1.00 95.76  ? 554  PRO A CB    1 
ATOM   4287  C  CG    . PRO A 1  554  ? 23.789  -32.646  -13.276 1.00 99.18  ? 554  PRO A CG    1 
ATOM   4288  C  CD    . PRO A 1  554  ? 23.718  -33.126  -14.671 1.00 93.64  ? 554  PRO A CD    1 
ATOM   4289  N  N     . ASP A 1  555  ? 27.233  -32.965  -13.535 1.00 109.08 ? 555  ASP A N     1 
ATOM   4290  C  CA    . ASP A 1  555  ? 28.560  -33.290  -13.040 1.00 123.21 ? 555  ASP A CA    1 
ATOM   4291  C  C     . ASP A 1  555  ? 29.553  -33.555  -14.155 1.00 138.18 ? 555  ASP A C     1 
ATOM   4292  O  O     . ASP A 1  555  ? 30.561  -34.240  -13.936 1.00 168.15 ? 555  ASP A O     1 
ATOM   4293  C  CB    . ASP A 1  555  ? 28.491  -34.498  -12.107 1.00 139.77 ? 555  ASP A CB    1 
ATOM   4294  C  CG    . ASP A 1  555  ? 27.400  -34.368  -11.076 1.00 155.25 ? 555  ASP A CG    1 
ATOM   4295  O  OD1   . ASP A 1  555  ? 27.562  -33.553  -10.144 1.00 162.88 ? 555  ASP A OD1   1 
ATOM   4296  O  OD2   . ASP A 1  555  ? 26.381  -35.075  -11.198 1.00 162.74 ? 555  ASP A OD2   1 
ATOM   4297  N  N     . TRP A 1  556  ? 29.300  -33.030  -15.346 1.00 117.26 ? 556  TRP A N     1 
ATOM   4298  C  CA    . TRP A 1  556  ? 30.203  -33.262  -16.459 1.00 106.63 ? 556  TRP A CA    1 
ATOM   4299  C  C     . TRP A 1  556  ? 31.505  -32.498  -16.251 1.00 117.93 ? 556  TRP A C     1 
ATOM   4300  O  O     . TRP A 1  556  ? 31.508  -31.364  -15.759 1.00 124.94 ? 556  TRP A O     1 
ATOM   4301  C  CB    . TRP A 1  556  ? 29.536  -32.850  -17.768 1.00 111.14 ? 556  TRP A CB    1 
ATOM   4302  C  CG    . TRP A 1  556  ? 30.377  -33.112  -18.949 1.00 96.33  ? 556  TRP A CG    1 
ATOM   4303  C  CD1   . TRP A 1  556  ? 30.994  -34.273  -19.250 1.00 125.35 ? 556  TRP A CD1   1 
ATOM   4304  C  CD2   . TRP A 1  556  ? 30.701  -32.195  -20.007 1.00 98.40  ? 556  TRP A CD2   1 
ATOM   4305  N  NE1   . TRP A 1  556  ? 31.695  -34.149  -20.425 1.00 134.60 ? 556  TRP A NE1   1 
ATOM   4306  C  CE2   . TRP A 1  556  ? 31.527  -32.882  -20.910 1.00 116.12 ? 556  TRP A CE2   1 
ATOM   4307  C  CE3   . TRP A 1  556  ? 30.373  -30.864  -20.278 1.00 108.52 ? 556  TRP A CE3   1 
ATOM   4308  C  CZ2   . TRP A 1  556  ? 32.033  -32.287  -22.060 1.00 142.77 ? 556  TRP A CZ2   1 
ATOM   4309  C  CZ3   . TRP A 1  556  ? 30.880  -30.274  -21.427 1.00 117.03 ? 556  TRP A CZ3   1 
ATOM   4310  C  CH2   . TRP A 1  556  ? 31.698  -30.984  -22.300 1.00 142.00 ? 556  TRP A CH2   1 
ATOM   4311  N  N     . ASP A 1  557  ? 32.616  -33.131  -16.650 1.00 129.14 ? 557  ASP A N     1 
ATOM   4312  C  CA    . ASP A 1  557  ? 33.965  -32.598  -16.471 1.00 100.81 ? 557  ASP A CA    1 
ATOM   4313  C  C     . ASP A 1  557  ? 34.386  -31.639  -17.571 1.00 118.62 ? 557  ASP A C     1 
ATOM   4314  O  O     . ASP A 1  557  ? 35.498  -31.101  -17.513 1.00 134.20 ? 557  ASP A O     1 
ATOM   4315  C  CB    . ASP A 1  557  ? 34.990  -33.743  -16.369 1.00 99.21  ? 557  ASP A CB    1 
ATOM   4316  C  CG    . ASP A 1  557  ? 34.770  -34.845  -17.411 1.00 129.49 ? 557  ASP A CG    1 
ATOM   4317  O  OD1   . ASP A 1  557  ? 33.670  -34.926  -17.992 1.00 144.17 ? 557  ASP A OD1   1 
ATOM   4318  O  OD2   . ASP A 1  557  ? 35.705  -35.641  -17.655 1.00 131.02 ? 557  ASP A OD2   1 
ATOM   4319  N  N     . GLY A 1  558  ? 33.521  -31.386  -18.546 1.00 135.47 ? 558  GLY A N     1 
ATOM   4320  C  CA    . GLY A 1  558  ? 33.878  -30.497  -19.629 1.00 143.45 ? 558  GLY A CA    1 
ATOM   4321  C  C     . GLY A 1  558  ? 34.853  -31.079  -20.622 1.00 138.16 ? 558  GLY A C     1 
ATOM   4322  O  O     . GLY A 1  558  ? 35.430  -30.331  -21.413 1.00 143.50 ? 558  GLY A O     1 
ATOM   4323  N  N     . VAL A 1  559  ? 35.049  -32.394  -20.616 1.00 130.94 ? 559  VAL A N     1 
ATOM   4324  C  CA    . VAL A 1  559  ? 35.972  -33.047  -21.533 1.00 136.43 ? 559  VAL A CA    1 
ATOM   4325  C  C     . VAL A 1  559  ? 35.137  -33.799  -22.556 1.00 138.07 ? 559  VAL A C     1 
ATOM   4326  O  O     . VAL A 1  559  ? 34.540  -34.835  -22.238 1.00 144.94 ? 559  VAL A O     1 
ATOM   4327  C  CB    . VAL A 1  559  ? 36.935  -33.996  -20.806 1.00 134.38 ? 559  VAL A CB    1 
ATOM   4328  C  CG1   . VAL A 1  559  ? 38.135  -34.311  -21.694 1.00 142.47 ? 559  VAL A CG1   1 
ATOM   4329  C  CG2   . VAL A 1  559  ? 37.365  -33.413  -19.460 1.00 146.09 ? 559  VAL A CG2   1 
ATOM   4330  N  N     . ILE A 1  560  ? 35.095  -33.288  -23.782 1.00 119.19 ? 560  ILE A N     1 
ATOM   4331  C  CA    . ILE A 1  560  ? 34.417  -33.963  -24.884 1.00 104.28 ? 560  ILE A CA    1 
ATOM   4332  C  C     . ILE A 1  560  ? 35.159  -35.265  -25.160 1.00 126.42 ? 560  ILE A C     1 
ATOM   4333  O  O     . ILE A 1  560  ? 36.353  -35.250  -25.496 1.00 138.07 ? 560  ILE A O     1 
ATOM   4334  C  CB    . ILE A 1  560  ? 34.357  -33.081  -26.141 1.00 116.74 ? 560  ILE A CB    1 
ATOM   4335  C  CG1   . ILE A 1  560  ? 33.910  -31.664  -25.786 1.00 117.02 ? 560  ILE A CG1   1 
ATOM   4336  C  CG2   . ILE A 1  560  ? 33.440  -33.697  -27.176 1.00 122.04 ? 560  ILE A CG2   1 
ATOM   4337  C  CD1   . ILE A 1  560  ? 34.184  -30.633  -26.878 1.00 123.74 ? 560  ILE A CD1   1 
ATOM   4338  N  N     . PRO A 1  561  ? 34.494  -36.406  -25.047 1.00 128.42 ? 561  PRO A N     1 
ATOM   4339  C  CA    . PRO A 1  561  ? 35.175  -37.683  -25.283 1.00 118.02 ? 561  PRO A CA    1 
ATOM   4340  C  C     . PRO A 1  561  ? 35.456  -37.888  -26.765 1.00 128.00 ? 561  PRO A C     1 
ATOM   4341  O  O     . PRO A 1  561  ? 34.680  -37.465  -27.623 1.00 119.54 ? 561  PRO A O     1 
ATOM   4342  C  CB    . PRO A 1  561  ? 34.175  -38.711  -24.744 1.00 103.93 ? 561  PRO A CB    1 
ATOM   4343  C  CG    . PRO A 1  561  ? 32.851  -38.044  -24.917 1.00 120.25 ? 561  PRO A CG    1 
ATOM   4344  C  CD    . PRO A 1  561  ? 33.075  -36.580  -24.698 1.00 131.60 ? 561  PRO A CD    1 
ATOM   4345  N  N     . THR A 1  562  ? 36.604  -38.499  -27.057 1.00 145.08 ? 562  THR A N     1 
ATOM   4346  C  CA    . THR A 1  562  ? 36.988  -38.765  -28.439 1.00 140.76 ? 562  THR A CA    1 
ATOM   4347  C  C     . THR A 1  562  ? 35.927  -39.630  -29.117 1.00 126.90 ? 562  THR A C     1 
ATOM   4348  O  O     . THR A 1  562  ? 35.589  -40.707  -28.605 1.00 119.52 ? 562  THR A O     1 
ATOM   4349  C  CB    . THR A 1  562  ? 38.354  -39.449  -28.484 1.00 143.82 ? 562  THR A CB    1 
ATOM   4350  O  OG1   . THR A 1  562  ? 39.264  -38.737  -27.636 1.00 154.52 ? 562  THR A OG1   1 
ATOM   4351  C  CG2   . THR A 1  562  ? 38.911  -39.482  -29.907 1.00 133.11 ? 562  THR A CG2   1 
ATOM   4352  N  N     . PRO A 1  563  ? 35.376  -39.200  -30.250 1.00 122.61 ? 563  PRO A N     1 
ATOM   4353  C  CA    . PRO A 1  563  ? 34.313  -39.984  -30.884 1.00 116.56 ? 563  PRO A CA    1 
ATOM   4354  C  C     . PRO A 1  563  ? 34.834  -41.334  -31.345 1.00 126.04 ? 563  PRO A C     1 
ATOM   4355  O  O     . PRO A 1  563  ? 35.953  -41.450  -31.849 1.00 142.50 ? 563  PRO A O     1 
ATOM   4356  C  CB    . PRO A 1  563  ? 33.894  -39.112  -32.070 1.00 124.68 ? 563  PRO A CB    1 
ATOM   4357  C  CG    . PRO A 1  563  ? 35.140  -38.329  -32.398 1.00 133.96 ? 563  PRO A CG    1 
ATOM   4358  C  CD    . PRO A 1  563  ? 35.778  -38.043  -31.068 1.00 133.76 ? 563  PRO A CD    1 
ATOM   4359  N  N     . ALA A 1  564  ? 34.007  -42.365  -31.154 1.00 125.53 ? 564  ALA A N     1 
ATOM   4360  C  CA    . ALA A 1  564  ? 34.387  -43.710  -31.584 1.00 127.58 ? 564  ALA A CA    1 
ATOM   4361  C  C     . ALA A 1  564  ? 34.698  -43.741  -33.073 1.00 143.95 ? 564  ALA A C     1 
ATOM   4362  O  O     . ALA A 1  564  ? 35.627  -44.429  -33.510 1.00 161.73 ? 564  ALA A O     1 
ATOM   4363  C  CB    . ALA A 1  564  ? 33.291  -44.720  -31.236 1.00 112.79 ? 564  ALA A CB    1 
ATOM   4364  N  N     . ILE A 1  565  ? 33.934  -43.001  -33.865 1.00 132.61 ? 565  ILE A N     1 
ATOM   4365  C  CA    . ILE A 1  565  ? 34.146  -42.876  -35.301 1.00 135.15 ? 565  ILE A CA    1 
ATOM   4366  C  C     . ILE A 1  565  ? 34.692  -41.482  -35.591 1.00 151.55 ? 565  ILE A C     1 
ATOM   4367  O  O     . ILE A 1  565  ? 34.042  -40.480  -35.272 1.00 176.36 ? 565  ILE A O     1 
ATOM   4368  C  CB    . ILE A 1  565  ? 32.847  -43.158  -36.073 1.00 121.76 ? 565  ILE A CB    1 
ATOM   4369  C  CG1   . ILE A 1  565  ? 32.586  -44.663  -36.122 1.00 121.41 ? 565  ILE A CG1   1 
ATOM   4370  C  CG2   . ILE A 1  565  ? 32.871  -42.560  -37.459 1.00 114.78 ? 565  ILE A CG2   1 
ATOM   4371  C  CD1   . ILE A 1  565  ? 31.472  -45.065  -37.064 1.00 135.55 ? 565  ILE A CD1   1 
ATOM   4372  N  N     . ILE A 1  566  ? 35.906  -41.417  -36.148 1.00 137.80 ? 566  ILE A N     1 
ATOM   4373  C  CA    . ILE A 1  566  ? 36.444  -40.175  -36.705 1.00 148.24 ? 566  ILE A CA    1 
ATOM   4374  C  C     . ILE A 1  566  ? 36.128  -40.171  -38.200 1.00 169.28 ? 566  ILE A C     1 
ATOM   4375  O  O     . ILE A 1  566  ? 35.074  -39.669  -38.608 1.00 192.14 ? 566  ILE A O     1 
ATOM   4376  C  CB    . ILE A 1  566  ? 37.949  -40.018  -36.422 1.00 130.72 ? 566  ILE A CB    1 
ATOM   4377  C  CG1   . ILE A 1  566  ? 38.255  -40.536  -35.014 1.00 117.47 ? 566  ILE A CG1   1 
ATOM   4378  C  CG2   . ILE A 1  566  ? 38.366  -38.548  -36.559 1.00 127.33 ? 566  ILE A CG2   1 
ATOM   4379  C  CD1   . ILE A 1  566  ? 39.651  -40.246  -34.513 1.00 132.92 ? 566  ILE A CD1   1 
ATOM   4380  N  N     . LYS A 1  567  ? 37.046  -40.704  -39.036 1.00 151.51 ? 567  LYS A N     1 
ATOM   4381  C  CA    . LYS A 1  567  ? 36.727  -41.139  -40.401 1.00 152.61 ? 567  LYS A CA    1 
ATOM   4382  C  C     . LYS A 1  567  ? 36.119  -39.997  -41.234 1.00 183.77 ? 567  LYS A C     1 
ATOM   4383  O  O     . LYS A 1  567  ? 36.631  -38.875  -41.115 1.00 209.86 ? 567  LYS A O     1 
ATOM   4384  C  CB    . LYS A 1  567  ? 35.765  -42.308  -40.310 1.00 158.53 ? 567  LYS A CB    1 
ATOM   4385  C  CG    . LYS A 1  567  ? 35.804  -43.240  -39.197 1.00 205.56 ? 567  LYS A CG    1 
ATOM   4386  C  CD    . LYS A 1  567  ? 35.869  -44.529  -39.873 1.00 229.53 ? 567  LYS A CD    1 
ATOM   4387  C  CE    . LYS A 1  567  ? 36.034  -45.670  -38.981 1.00 236.93 ? 567  LYS A CE    1 
ATOM   4388  N  NZ    . LYS A 1  567  ? 34.635  -46.067  -38.608 1.00 233.13 ? 567  LYS A NZ    1 
ATOM   4389  N  N     . PRO A 1  568  ? 35.055  -40.168  -42.067 1.00 173.52 ? 568  PRO A N     1 
ATOM   4390  C  CA    . PRO A 1  568  ? 34.615  -38.994  -42.837 1.00 187.32 ? 568  PRO A CA    1 
ATOM   4391  C  C     . PRO A 1  568  ? 33.948  -37.953  -41.961 1.00 185.60 ? 568  PRO A C     1 
ATOM   4392  O  O     . PRO A 1  568  ? 34.029  -36.755  -42.259 1.00 195.60 ? 568  PRO A O     1 
ATOM   4393  C  CB    . PRO A 1  568  ? 33.644  -39.578  -43.877 1.00 177.51 ? 568  PRO A CB    1 
ATOM   4394  C  CG    . PRO A 1  568  ? 33.858  -41.040  -43.835 1.00 157.33 ? 568  PRO A CG    1 
ATOM   4395  C  CD    . PRO A 1  568  ? 34.141  -41.283  -42.430 1.00 130.04 ? 568  PRO A CD    1 
ATOM   4396  N  N     . LYS A 1  569  ? 33.315  -38.379  -40.863 1.00 162.65 ? 569  LYS A N     1 
ATOM   4397  C  CA    . LYS A 1  569  ? 32.648  -37.467  -39.967 1.00 163.55 ? 569  LYS A CA    1 
ATOM   4398  C  C     . LYS A 1  569  ? 32.605  -38.034  -38.558 1.00 149.49 ? 569  LYS A C     1 
ATOM   4399  O  O     . LYS A 1  569  ? 32.377  -39.241  -38.382 1.00 135.98 ? 569  LYS A O     1 
ATOM   4400  C  CB    . LYS A 1  569  ? 31.221  -37.188  -40.468 1.00 167.29 ? 569  LYS A CB    1 
ATOM   4401  C  CG    . LYS A 1  569  ? 30.255  -38.371  -40.357 1.00 149.73 ? 569  LYS A CG    1 
ATOM   4402  C  CD    . LYS A 1  569  ? 28.835  -37.986  -40.749 1.00 130.00 ? 569  LYS A CD    1 
ATOM   4403  C  CE    . LYS A 1  569  ? 28.377  -36.753  -40.018 1.00 128.40 ? 569  LYS A CE    1 
ATOM   4404  N  NZ    . LYS A 1  569  ? 26.936  -36.509  -40.252 1.00 139.26 ? 569  LYS A NZ    1 
ATOM   4405  N  N     . PRO A 1  570  ? 32.829  -37.194  -37.545 1.00 139.35 ? 570  PRO A N     1 
ATOM   4406  C  CA    . PRO A 1  570  ? 32.903  -37.692  -36.163 1.00 138.76 ? 570  PRO A CA    1 
ATOM   4407  C  C     . PRO A 1  570  ? 31.537  -38.134  -35.655 1.00 135.62 ? 570  PRO A C     1 
ATOM   4408  O  O     . PRO A 1  570  ? 30.578  -37.357  -35.653 1.00 139.91 ? 570  PRO A O     1 
ATOM   4409  C  CB    . PRO A 1  570  ? 33.451  -36.490  -35.385 1.00 141.91 ? 570  PRO A CB    1 
ATOM   4410  C  CG    . PRO A 1  570  ? 33.062  -35.302  -36.211 1.00 138.19 ? 570  PRO A CG    1 
ATOM   4411  C  CD    . PRO A 1  570  ? 33.128  -35.752  -37.636 1.00 124.78 ? 570  PRO A CD    1 
ATOM   4412  N  N     . LEU A 1  571  ? 31.459  -39.386  -35.204 1.00 128.46 ? 571  LEU A N     1 
ATOM   4413  C  CA    . LEU A 1  571  ? 30.238  -39.971  -34.661 1.00 127.98 ? 571  LEU A CA    1 
ATOM   4414  C  C     . LEU A 1  571  ? 30.523  -40.595  -33.303 1.00 139.95 ? 571  LEU A C     1 
ATOM   4415  O  O     . LEU A 1  571  ? 31.521  -41.304  -33.133 1.00 134.31 ? 571  LEU A O     1 
ATOM   4416  C  CB    . LEU A 1  571  ? 29.664  -41.021  -35.620 1.00 124.95 ? 571  LEU A CB    1 
ATOM   4417  C  CG    . LEU A 1  571  ? 28.512  -40.620  -36.543 1.00 122.67 ? 571  LEU A CG    1 
ATOM   4418  C  CD1   . LEU A 1  571  ? 28.811  -39.363  -37.303 1.00 143.11 ? 571  LEU A CD1   1 
ATOM   4419  C  CD2   . LEU A 1  571  ? 28.197  -41.753  -37.520 1.00 111.04 ? 571  LEU A CD2   1 
ATOM   4420  N  N     . TRP A 1  572  ? 29.641  -40.331  -32.345 1.00 131.44 ? 572  TRP A N     1 
ATOM   4421  C  CA    . TRP A 1  572  ? 29.681  -40.973  -31.045 1.00 127.29 ? 572  TRP A CA    1 
ATOM   4422  C  C     . TRP A 1  572  ? 28.604  -42.050  -30.992 1.00 124.13 ? 572  TRP A C     1 
ATOM   4423  O  O     . TRP A 1  572  ? 27.601  -41.987  -31.712 1.00 116.70 ? 572  TRP A O     1 
ATOM   4424  C  CB    . TRP A 1  572  ? 29.469  -39.950  -29.923 1.00 128.05 ? 572  TRP A CB    1 
ATOM   4425  C  CG    . TRP A 1  572  ? 30.589  -38.949  -29.806 1.00 130.06 ? 572  TRP A CG    1 
ATOM   4426  C  CD1   . TRP A 1  572  ? 31.547  -38.884  -28.837 1.00 129.39 ? 572  TRP A CD1   1 
ATOM   4427  C  CD2   . TRP A 1  572  ? 30.840  -37.847  -30.688 1.00 125.46 ? 572  TRP A CD2   1 
ATOM   4428  N  NE1   . TRP A 1  572  ? 32.390  -37.821  -29.073 1.00 119.18 ? 572  TRP A NE1   1 
ATOM   4429  C  CE2   . TRP A 1  572  ? 31.971  -37.167  -30.201 1.00 120.47 ? 572  TRP A CE2   1 
ATOM   4430  C  CE3   . TRP A 1  572  ? 30.219  -37.373  -31.846 1.00 122.20 ? 572  TRP A CE3   1 
ATOM   4431  C  CZ2   . TRP A 1  572  ? 32.497  -36.043  -30.837 1.00 128.93 ? 572  TRP A CZ2   1 
ATOM   4432  C  CZ3   . TRP A 1  572  ? 30.742  -36.255  -32.471 1.00 128.82 ? 572  TRP A CZ3   1 
ATOM   4433  C  CH2   . TRP A 1  572  ? 31.866  -35.603  -31.967 1.00 120.75 ? 572  TRP A CH2   1 
ATOM   4434  N  N     . SER A 1  573  ? 28.845  -43.066  -30.177 1.00 124.05 ? 573  SER A N     1 
ATOM   4435  C  CA    . SER A 1  573  ? 27.882  -44.140  -30.027 1.00 117.16 ? 573  SER A CA    1 
ATOM   4436  C  C     . SER A 1  573  ? 26.947  -43.820  -28.870 1.00 125.35 ? 573  SER A C     1 
ATOM   4437  O  O     . SER A 1  573  ? 27.265  -43.023  -27.985 1.00 139.13 ? 573  SER A O     1 
ATOM   4438  C  CB    . SER A 1  573  ? 28.579  -45.473  -29.786 1.00 124.06 ? 573  SER A CB    1 
ATOM   4439  O  OG    . SER A 1  573  ? 28.719  -45.724  -28.403 1.00 139.90 ? 573  SER A OG    1 
ATOM   4440  N  N     . GLY A 1  574  ? 25.772  -44.442  -28.893 1.00 120.63 ? 574  GLY A N     1 
ATOM   4441  C  CA    . GLY A 1  574  ? 24.845  -44.253  -27.793 1.00 111.26 ? 574  GLY A CA    1 
ATOM   4442  C  C     . GLY A 1  574  ? 25.420  -44.749  -26.487 1.00 123.32 ? 574  GLY A C     1 
ATOM   4443  O  O     . GLY A 1  574  ? 25.337  -44.068  -25.459 1.00 124.17 ? 574  GLY A O     1 
ATOM   4444  N  N     . LYS A 1  575  ? 26.051  -45.924  -26.524 1.00 120.61 ? 575  LYS A N     1 
ATOM   4445  C  CA    . LYS A 1  575  ? 26.748  -46.429  -25.349 1.00 123.90 ? 575  LYS A CA    1 
ATOM   4446  C  C     . LYS A 1  575  ? 27.803  -45.438  -24.896 1.00 118.21 ? 575  LYS A C     1 
ATOM   4447  O  O     . LYS A 1  575  ? 27.997  -45.220  -23.692 1.00 111.52 ? 575  LYS A O     1 
ATOM   4448  C  CB    . LYS A 1  575  ? 27.405  -47.773  -25.671 1.00 119.44 ? 575  LYS A CB    1 
ATOM   4449  C  CG    . LYS A 1  575  ? 26.474  -48.826  -26.258 1.00 116.18 ? 575  LYS A CG    1 
ATOM   4450  C  CD    . LYS A 1  575  ? 27.251  -50.052  -26.728 1.00 104.61 ? 575  LYS A CD    1 
ATOM   4451  C  CE    . LYS A 1  575  ? 26.420  -50.880  -27.683 1.00 122.03 ? 575  LYS A CE    1 
ATOM   4452  N  NZ    . LYS A 1  575  ? 25.229  -51.455  -26.994 1.00 121.26 ? 575  LYS A NZ    1 
ATOM   4453  N  N     . GLN A 1  576  ? 28.450  -44.780  -25.858 1.00 127.41 ? 576  GLN A N     1 
ATOM   4454  C  CA    . GLN A 1  576  ? 29.557  -43.890  -25.538 1.00 119.90 ? 576  GLN A CA    1 
ATOM   4455  C  C     . GLN A 1  576  ? 29.067  -42.726  -24.700 1.00 115.47 ? 576  GLN A C     1 
ATOM   4456  O  O     . GLN A 1  576  ? 29.626  -42.430  -23.639 1.00 102.27 ? 576  GLN A O     1 
ATOM   4457  C  CB    . GLN A 1  576  ? 30.187  -43.386  -26.836 1.00 109.17 ? 576  GLN A CB    1 
ATOM   4458  C  CG    . GLN A 1  576  ? 31.673  -43.114  -26.796 1.00 103.75 ? 576  GLN A CG    1 
ATOM   4459  C  CD    . GLN A 1  576  ? 32.188  -42.703  -28.154 1.00 113.74 ? 576  GLN A CD    1 
ATOM   4460  O  OE1   . GLN A 1  576  ? 31.506  -42.882  -29.163 1.00 118.07 ? 576  GLN A OE1   1 
ATOM   4461  N  NE2   . GLN A 1  576  ? 33.371  -42.101  -28.186 1.00 123.80 ? 576  GLN A NE2   1 
ATOM   4462  N  N     . ILE A 1  577  ? 28.009  -42.056  -25.166 1.00 127.78 ? 577  ILE A N     1 
ATOM   4463  C  CA    . ILE A 1  577  ? 27.522  -40.870  -24.471 1.00 118.75 ? 577  ILE A CA    1 
ATOM   4464  C  C     . ILE A 1  577  ? 26.860  -41.264  -23.165 1.00 108.07 ? 577  ILE A C     1 
ATOM   4465  O  O     . ILE A 1  577  ? 26.988  -40.570  -22.151 1.00 110.39 ? 577  ILE A O     1 
ATOM   4466  C  CB    . ILE A 1  577  ? 26.564  -40.062  -25.366 1.00 97.83  ? 577  ILE A CB    1 
ATOM   4467  C  CG1   . ILE A 1  577  ? 27.311  -39.474  -26.553 1.00 110.68 ? 577  ILE A CG1   1 
ATOM   4468  C  CG2   . ILE A 1  577  ? 25.930  -38.924  -24.590 1.00 96.63  ? 577  ILE A CG2   1 
ATOM   4469  C  CD1   . ILE A 1  577  ? 28.515  -38.662  -26.154 1.00 115.74 ? 577  ILE A CD1   1 
ATOM   4470  N  N     . LEU A 1  578  ? 26.145  -42.387  -23.161 1.00 105.99 ? 578  LEU A N     1 
ATOM   4471  C  CA    . LEU A 1  578  ? 25.526  -42.824  -21.917 1.00 107.66 ? 578  LEU A CA    1 
ATOM   4472  C  C     . LEU A 1  578  ? 26.583  -43.110  -20.854 1.00 111.59 ? 578  LEU A C     1 
ATOM   4473  O  O     . LEU A 1  578  ? 26.334  -42.916  -19.659 1.00 103.28 ? 578  LEU A O     1 
ATOM   4474  C  CB    . LEU A 1  578  ? 24.637  -44.043  -22.182 1.00 94.75  ? 578  LEU A CB    1 
ATOM   4475  C  CG    . LEU A 1  578  ? 24.037  -44.707  -20.945 1.00 95.69  ? 578  LEU A CG    1 
ATOM   4476  C  CD1   . LEU A 1  578  ? 23.141  -43.732  -20.236 1.00 92.32  ? 578  LEU A CD1   1 
ATOM   4477  C  CD2   . LEU A 1  578  ? 23.295  -45.994  -21.274 1.00 112.36 ? 578  LEU A CD2   1 
ATOM   4478  N  N     . SER A 1  579  ? 27.794  -43.490  -21.275 1.00 114.13 ? 579  SER A N     1 
ATOM   4479  C  CA    . SER A 1  579  ? 28.843  -43.821  -20.315 1.00 118.40 ? 579  SER A CA    1 
ATOM   4480  C  C     . SER A 1  579  ? 29.323  -42.591  -19.545 1.00 116.80 ? 579  SER A C     1 
ATOM   4481  O  O     . SER A 1  579  ? 29.958  -42.741  -18.492 1.00 134.28 ? 579  SER A O     1 
ATOM   4482  C  CB    . SER A 1  579  ? 30.016  -44.513  -21.031 1.00 121.33 ? 579  SER A CB    1 
ATOM   4483  O  OG    . SER A 1  579  ? 29.661  -45.802  -21.532 1.00 111.87 ? 579  SER A OG    1 
ATOM   4484  N  N     . VAL A 1  580  ? 29.041  -41.384  -20.051 1.00 96.18  ? 580  VAL A N     1 
ATOM   4485  C  CA    . VAL A 1  580  ? 29.404  -40.154  -19.344 1.00 95.86  ? 580  VAL A CA    1 
ATOM   4486  C  C     . VAL A 1  580  ? 28.662  -40.051  -18.017 1.00 112.46 ? 580  VAL A C     1 
ATOM   4487  O  O     . VAL A 1  580  ? 29.145  -39.407  -17.077 1.00 120.49 ? 580  VAL A O     1 
ATOM   4488  C  CB    . VAL A 1  580  ? 29.143  -38.906  -20.226 1.00 96.09  ? 580  VAL A CB    1 
ATOM   4489  C  CG1   . VAL A 1  580  ? 29.723  -37.657  -19.590 1.00 96.09  ? 580  VAL A CG1   1 
ATOM   4490  C  CG2   . VAL A 1  580  ? 29.730  -39.074  -21.626 1.00 97.55  ? 580  VAL A CG2   1 
ATOM   4491  N  N     . ALA A 1  581  ? 27.497  -40.699  -17.901 1.00 111.30 ? 581  ALA A N     1 
ATOM   4492  C  CA    . ALA A 1  581  ? 26.767  -40.691  -16.636 1.00 105.18 ? 581  ALA A CA    1 
ATOM   4493  C  C     . ALA A 1  581  ? 27.260  -41.742  -15.661 1.00 111.36 ? 581  ALA A C     1 
ATOM   4494  O  O     . ALA A 1  581  ? 27.014  -41.606  -14.458 1.00 122.44 ? 581  ALA A O     1 
ATOM   4495  C  CB    . ALA A 1  581  ? 25.269  -40.907  -16.849 1.00 91.16  ? 581  ALA A CB    1 
ATOM   4496  N  N     . ILE A 1  582  ? 27.899  -42.799  -16.147 1.00 93.11  ? 582  ILE A N     1 
ATOM   4497  C  CA    . ILE A 1  582  ? 28.423  -43.839  -15.267 1.00 93.27  ? 582  ILE A CA    1 
ATOM   4498  C  C     . ILE A 1  582  ? 29.742  -43.378  -14.655 1.00 108.76 ? 582  ILE A C     1 
ATOM   4499  O  O     . ILE A 1  582  ? 30.733  -43.174  -15.376 1.00 130.42 ? 582  ILE A O     1 
ATOM   4500  C  CB    . ILE A 1  582  ? 28.585  -45.174  -16.006 1.00 107.48 ? 582  ILE A CB    1 
ATOM   4501  C  CG1   . ILE A 1  582  ? 27.333  -45.462  -16.842 1.00 100.05 ? 582  ILE A CG1   1 
ATOM   4502  C  CG2   . ILE A 1  582  ? 28.840  -46.286  -15.008 1.00 114.22 ? 582  ILE A CG2   1 
ATOM   4503  C  CD1   . ILE A 1  582  ? 27.215  -46.880  -17.380 1.00 94.36  ? 582  ILE A CD1   1 
ATOM   4504  N  N     . PRO A 1  583  ? 29.800  -43.231  -13.336 1.00 93.30  ? 583  PRO A N     1 
ATOM   4505  C  CA    . PRO A 1  583  ? 31.008  -42.722  -12.684 1.00 100.29 ? 583  PRO A CA    1 
ATOM   4506  C  C     . PRO A 1  583  ? 32.151  -43.713  -12.809 1.00 115.51 ? 583  PRO A C     1 
ATOM   4507  O  O     . PRO A 1  583  ? 31.967  -44.885  -13.133 1.00 124.76 ? 583  PRO A O     1 
ATOM   4508  C  CB    . PRO A 1  583  ? 30.568  -42.544  -11.229 1.00 100.38 ? 583  PRO A CB    1 
ATOM   4509  C  CG    . PRO A 1  583  ? 29.498  -43.536  -11.055 1.00 92.03  ? 583  PRO A CG    1 
ATOM   4510  C  CD    . PRO A 1  583  ? 28.764  -43.596  -12.359 1.00 95.76  ? 583  PRO A CD    1 
ATOM   4511  N  N     . ASN A 1  584  ? 33.353  -43.224  -12.517 1.00 116.13 ? 584  ASN A N     1 
ATOM   4512  C  CA    . ASN A 1  584  ? 34.545  -44.037  -12.667 1.00 114.61 ? 584  ASN A CA    1 
ATOM   4513  C  C     . ASN A 1  584  ? 34.681  -44.997  -11.487 1.00 129.69 ? 584  ASN A C     1 
ATOM   4514  O  O     . ASN A 1  584  ? 34.089  -44.808  -10.416 1.00 124.31 ? 584  ASN A O     1 
ATOM   4515  C  CB    . ASN A 1  584  ? 35.773  -43.138  -12.777 1.00 113.43 ? 584  ASN A CB    1 
ATOM   4516  C  CG    . ASN A 1  584  ? 35.657  -42.140  -13.918 1.00 141.97 ? 584  ASN A CG    1 
ATOM   4517  O  OD1   . ASN A 1  584  ? 35.061  -42.434  -14.957 1.00 146.09 ? 584  ASN A OD1   1 
ATOM   4518  N  ND2   . ASN A 1  584  ? 36.227  -40.956  -13.730 1.00 157.28 ? 584  ASN A ND2   1 
ATOM   4519  N  N     . GLY A 1  585  ? 35.419  -46.079  -11.722 1.00 111.57 ? 585  GLY A N     1 
ATOM   4520  C  CA    . GLY A 1  585  ? 35.531  -47.109  -10.714 1.00 124.53 ? 585  GLY A CA    1 
ATOM   4521  C  C     . GLY A 1  585  ? 34.391  -48.098  -10.692 1.00 125.22 ? 585  GLY A C     1 
ATOM   4522  O  O     . GLY A 1  585  ? 34.186  -48.776  -9.677  1.00 125.69 ? 585  GLY A O     1 
ATOM   4523  N  N     . ILE A 1  586  ? 33.630  -48.204  -11.776 1.00 104.34 ? 586  ILE A N     1 
ATOM   4524  C  CA    . ILE A 1  586  ? 32.477  -49.098  -11.842 1.00 122.59 ? 586  ILE A CA    1 
ATOM   4525  C  C     . ILE A 1  586  ? 32.786  -50.220  -12.824 1.00 134.19 ? 586  ILE A C     1 
ATOM   4526  O  O     . ILE A 1  586  ? 33.229  -49.963  -13.951 1.00 140.95 ? 586  ILE A O     1 
ATOM   4527  C  CB    . ILE A 1  586  ? 31.193  -48.348  -12.242 1.00 118.69 ? 586  ILE A CB    1 
ATOM   4528  C  CG1   . ILE A 1  586  ? 30.826  -47.294  -11.193 1.00 106.46 ? 586  ILE A CG1   1 
ATOM   4529  C  CG2   . ILE A 1  586  ? 30.033  -49.309  -12.426 1.00 118.43 ? 586  ILE A CG2   1 
ATOM   4530  C  CD1   . ILE A 1  586  ? 30.376  -47.865  -9.844  1.00 93.47  ? 586  ILE A CD1   1 
ATOM   4531  N  N     . HIS A 1  587  ? 32.546  -51.461  -12.397 1.00 115.31 ? 587  HIS A N     1 
ATOM   4532  C  CA    . HIS A 1  587  ? 32.866  -52.641  -13.190 1.00 121.32 ? 587  HIS A CA    1 
ATOM   4533  C  C     . HIS A 1  587  ? 31.675  -53.586  -13.130 1.00 105.90 ? 587  HIS A C     1 
ATOM   4534  O  O     . HIS A 1  587  ? 31.245  -53.974  -12.040 1.00 109.74 ? 587  HIS A O     1 
ATOM   4535  C  CB    . HIS A 1  587  ? 34.141  -53.318  -12.667 1.00 139.84 ? 587  HIS A CB    1 
ATOM   4536  C  CG    . HIS A 1  587  ? 34.644  -54.434  -13.531 1.00 144.98 ? 587  HIS A CG    1 
ATOM   4537  N  ND1   . HIS A 1  587  ? 34.390  -55.761  -13.258 1.00 147.93 ? 587  HIS A ND1   1 
ATOM   4538  C  CD2   . HIS A 1  587  ? 35.405  -54.421  -14.652 1.00 148.09 ? 587  HIS A CD2   1 
ATOM   4539  C  CE1   . HIS A 1  587  ? 34.961  -56.516  -14.179 1.00 155.67 ? 587  HIS A CE1   1 
ATOM   4540  N  NE2   . HIS A 1  587  ? 35.584  -55.728  -15.037 1.00 155.18 ? 587  HIS A NE2   1 
ATOM   4541  N  N     . LEU A 1  588  ? 31.113  -53.918  -14.289 1.00 109.28 ? 588  LEU A N     1 
ATOM   4542  C  CA    . LEU A 1  588  ? 29.962  -54.807  -14.371 1.00 120.64 ? 588  LEU A CA    1 
ATOM   4543  C  C     . LEU A 1  588  ? 30.203  -55.864  -15.442 1.00 131.35 ? 588  LEU A C     1 
ATOM   4544  O  O     . LEU A 1  588  ? 30.622  -55.539  -16.557 1.00 123.54 ? 588  LEU A O     1 
ATOM   4545  C  CB    . LEU A 1  588  ? 28.678  -54.024  -14.666 1.00 112.47 ? 588  LEU A CB    1 
ATOM   4546  C  CG    . LEU A 1  588  ? 27.370  -54.763  -14.384 1.00 96.11  ? 588  LEU A CG    1 
ATOM   4547  C  CD1   . LEU A 1  588  ? 27.479  -55.475  -13.068 1.00 123.80 ? 588  LEU A CD1   1 
ATOM   4548  C  CD2   . LEU A 1  588  ? 26.200  -53.814  -14.353 1.00 94.72  ? 588  LEU A CD2   1 
ATOM   4549  N  N     . GLN A 1  589  ? 29.963  -57.127  -15.093 1.00 116.29 ? 589  GLN A N     1 
ATOM   4550  C  CA    . GLN A 1  589  ? 30.024  -58.240  -16.032 1.00 112.86 ? 589  GLN A CA    1 
ATOM   4551  C  C     . GLN A 1  589  ? 28.749  -59.056  -15.926 1.00 118.64 ? 589  GLN A C     1 
ATOM   4552  O  O     . GLN A 1  589  ? 28.335  -59.415  -14.820 1.00 137.62 ? 589  GLN A O     1 
ATOM   4553  C  CB    . GLN A 1  589  ? 31.221  -59.161  -15.780 1.00 126.36 ? 589  GLN A CB    1 
ATOM   4554  C  CG    . GLN A 1  589  ? 32.493  -58.807  -16.528 1.00 141.68 ? 589  GLN A CG    1 
ATOM   4555  C  CD    . GLN A 1  589  ? 33.472  -59.972  -16.574 1.00 162.92 ? 589  GLN A CD    1 
ATOM   4556  O  OE1   . GLN A 1  589  ? 33.109  -61.084  -16.965 1.00 156.15 ? 589  GLN A OE1   1 
ATOM   4557  N  NE2   . GLN A 1  589  ? 34.716  -59.724  -16.174 1.00 165.48 ? 589  GLN A NE2   1 
ATOM   4558  N  N     . ARG A 1  590  ? 28.120  -59.335  -17.062 1.00 105.47 ? 590  ARG A N     1 
ATOM   4559  C  CA    . ARG A 1  590  ? 26.925  -60.170  -17.062 1.00 110.96 ? 590  ARG A CA    1 
ATOM   4560  C  C     . ARG A 1  590  ? 26.792  -60.821  -18.425 1.00 131.03 ? 590  ARG A C     1 
ATOM   4561  O  O     . ARG A 1  590  ? 26.648  -60.118  -19.431 1.00 136.13 ? 590  ARG A O     1 
ATOM   4562  C  CB    . ARG A 1  590  ? 25.668  -59.366  -16.730 1.00 116.36 ? 590  ARG A CB    1 
ATOM   4563  C  CG    . ARG A 1  590  ? 24.469  -60.247  -16.372 1.00 127.51 ? 590  ARG A CG    1 
ATOM   4564  C  CD    . ARG A 1  590  ? 23.223  -59.863  -17.162 1.00 113.16 ? 590  ARG A CD    1 
ATOM   4565  N  NE    . ARG A 1  590  ? 23.081  -58.420  -17.304 1.00 109.58 ? 590  ARG A NE    1 
ATOM   4566  C  CZ    . ARG A 1  590  ? 22.355  -57.848  -18.254 1.00 122.61 ? 590  ARG A CZ    1 
ATOM   4567  N  NH1   . ARG A 1  590  ? 21.716  -58.604  -19.132 1.00 125.86 ? 590  ARG A NH1   1 
ATOM   4568  N  NH2   . ARG A 1  590  ? 22.260  -56.529  -18.331 1.00 131.61 ? 590  ARG A NH2   1 
ATOM   4569  N  N     . PHE A 1  591  ? 26.826  -62.156  -18.456 1.00 118.60 ? 591  PHE A N     1 
ATOM   4570  C  CA    . PHE A 1  591  ? 26.618  -62.916  -19.684 1.00 126.55 ? 591  PHE A CA    1 
ATOM   4571  C  C     . PHE A 1  591  ? 25.165  -63.362  -19.753 1.00 135.33 ? 591  PHE A C     1 
ATOM   4572  O  O     . PHE A 1  591  ? 24.739  -64.233  -18.991 1.00 122.42 ? 591  PHE A O     1 
ATOM   4573  C  CB    . PHE A 1  591  ? 27.560  -64.113  -19.729 1.00 147.22 ? 591  PHE A CB    1 
ATOM   4574  C  CG    . PHE A 1  591  ? 28.997  -63.732  -19.698 1.00 153.83 ? 591  PHE A CG    1 
ATOM   4575  C  CD1   . PHE A 1  591  ? 29.628  -63.300  -20.848 1.00 134.12 ? 591  PHE A CD1   1 
ATOM   4576  C  CD2   . PHE A 1  591  ? 29.716  -63.783  -18.518 1.00 168.18 ? 591  PHE A CD2   1 
ATOM   4577  C  CE1   . PHE A 1  591  ? 30.950  -62.940  -20.825 1.00 140.40 ? 591  PHE A CE1   1 
ATOM   4578  C  CE2   . PHE A 1  591  ? 31.040  -63.421  -18.490 1.00 167.46 ? 591  PHE A CE2   1 
ATOM   4579  C  CZ    . PHE A 1  591  ? 31.657  -62.998  -19.645 1.00 158.71 ? 591  PHE A CZ    1 
ATOM   4580  N  N     . ASP A 1  592  ? 24.408  -62.768  -20.676 1.00 164.50 ? 592  ASP A N     1 
ATOM   4581  C  CA    . ASP A 1  592  ? 22.974  -63.032  -20.732 1.00 179.19 ? 592  ASP A CA    1 
ATOM   4582  C  C     . ASP A 1  592  ? 22.679  -64.468  -21.139 1.00 177.52 ? 592  ASP A C     1 
ATOM   4583  O  O     . ASP A 1  592  ? 21.901  -65.163  -20.474 1.00 211.27 ? 592  ASP A O     1 
ATOM   4584  C  CB    . ASP A 1  592  ? 22.290  -62.061  -21.694 1.00 181.51 ? 592  ASP A CB    1 
ATOM   4585  C  CG    . ASP A 1  592  ? 21.665  -60.890  -20.977 1.00 174.94 ? 592  ASP A CG    1 
ATOM   4586  O  OD1   . ASP A 1  592  ? 21.306  -61.057  -19.795 1.00 173.71 ? 592  ASP A OD1   1 
ATOM   4587  O  OD2   . ASP A 1  592  ? 21.520  -59.806  -21.582 1.00 172.26 ? 592  ASP A OD2   1 
ATOM   4588  N  N     . GLU A 1  593  ? 23.299  -64.936  -22.220 1.00 125.90 ? 593  GLU A N     1 
ATOM   4589  C  CA    . GLU A 1  593  ? 22.966  -66.261  -22.725 1.00 126.21 ? 593  GLU A CA    1 
ATOM   4590  C  C     . GLU A 1  593  ? 24.073  -66.853  -23.580 1.00 161.68 ? 593  GLU A C     1 
ATOM   4591  O  O     . GLU A 1  593  ? 24.976  -67.534  -23.077 1.00 175.17 ? 593  GLU A O     1 
ATOM   4592  C  CB    . GLU A 1  593  ? 21.679  -66.200  -23.537 1.00 131.62 ? 593  GLU A CB    1 
ATOM   4593  C  CG    . GLU A 1  593  ? 21.126  -67.556  -23.884 1.00 158.92 ? 593  GLU A CG    1 
ATOM   4594  C  CD    . GLU A 1  593  ? 20.065  -67.475  -24.951 1.00 183.21 ? 593  GLU A CD    1 
ATOM   4595  O  OE1   . GLU A 1  593  ? 20.011  -66.441  -25.652 1.00 187.75 ? 593  GLU A OE1   1 
ATOM   4596  O  OE2   . GLU A 1  593  ? 19.282  -68.439  -25.084 1.00 181.21 ? 593  GLU A OE2   1 
ATOM   4597  N  N     . GLY A 1  594  ? 23.992  -66.597  -24.883 1.00 157.32 ? 594  GLY A N     1 
ATOM   4598  C  CA    . GLY A 1  594  ? 24.978  -67.084  -25.823 1.00 164.86 ? 594  GLY A CA    1 
ATOM   4599  C  C     . GLY A 1  594  ? 26.077  -66.056  -25.947 1.00 154.37 ? 594  GLY A C     1 
ATOM   4600  O  O     . GLY A 1  594  ? 26.763  -65.954  -26.969 1.00 163.77 ? 594  GLY A O     1 
ATOM   4601  N  N     . THR A 1  595  ? 26.205  -65.255  -24.893 1.00 153.65 ? 595  THR A N     1 
ATOM   4602  C  CA    . THR A 1  595  ? 27.169  -64.172  -24.870 1.00 146.78 ? 595  THR A CA    1 
ATOM   4603  C  C     . THR A 1  595  ? 28.573  -64.756  -24.887 1.00 150.23 ? 595  THR A C     1 
ATOM   4604  O  O     . THR A 1  595  ? 28.925  -65.569  -24.027 1.00 152.96 ? 595  THR A O     1 
ATOM   4605  C  CB    . THR A 1  595  ? 26.981  -63.345  -23.599 1.00 140.48 ? 595  THR A CB    1 
ATOM   4606  O  OG1   . THR A 1  595  ? 26.669  -64.225  -22.521 1.00 160.26 ? 595  THR A OG1   1 
ATOM   4607  C  CG2   . THR A 1  595  ? 25.840  -62.420  -23.732 1.00 113.47 ? 595  THR A CG2   1 
ATOM   4608  N  N     . THR A 1  596  ? 29.382  -64.309  -25.837 1.00 147.78 ? 596  THR A N     1 
ATOM   4609  C  CA    . THR A 1  596  ? 30.826  -64.451  -25.796 1.00 143.21 ? 596  THR A CA    1 
ATOM   4610  C  C     . THR A 1  596  ? 31.421  -63.097  -25.426 1.00 140.68 ? 596  THR A C     1 
ATOM   4611  O  O     . THR A 1  596  ? 30.704  -62.104  -25.283 1.00 162.45 ? 596  THR A O     1 
ATOM   4612  C  CB    . THR A 1  596  ? 31.352  -64.933  -27.155 1.00 151.79 ? 596  THR A CB    1 
ATOM   4613  O  OG1   . THR A 1  596  ? 31.172  -63.898  -28.127 1.00 175.63 ? 596  THR A OG1   1 
ATOM   4614  C  CG2   . THR A 1  596  ? 30.558  -66.147  -27.626 1.00 129.14 ? 596  THR A CG2   1 
ATOM   4615  N  N     . LEU A 1  597  ? 32.734  -63.068  -25.199 1.00 133.67 ? 597  LEU A N     1 
ATOM   4616  C  CA    . LEU A 1  597  ? 33.374  -61.770  -25.004 1.00 125.31 ? 597  LEU A CA    1 
ATOM   4617  C  C     . LEU A 1  597  ? 33.275  -60.919  -26.266 1.00 134.56 ? 597  LEU A C     1 
ATOM   4618  O  O     . LEU A 1  597  ? 33.505  -59.705  -26.213 1.00 137.16 ? 597  LEU A O     1 
ATOM   4619  C  CB    . LEU A 1  597  ? 34.832  -61.932  -24.582 1.00 131.49 ? 597  LEU A CB    1 
ATOM   4620  C  CG    . LEU A 1  597  ? 35.084  -62.379  -23.142 1.00 143.48 ? 597  LEU A CG    1 
ATOM   4621  C  CD1   . LEU A 1  597  ? 34.780  -63.872  -22.933 1.00 153.23 ? 597  LEU A CD1   1 
ATOM   4622  C  CD2   . LEU A 1  597  ? 36.509  -62.030  -22.742 1.00 149.77 ? 597  LEU A CD2   1 
ATOM   4623  N  N     . LEU A 1  598  ? 32.992  -61.548  -27.408 1.00 137.62 ? 598  LEU A N     1 
ATOM   4624  C  CA    . LEU A 1  598  ? 32.671  -60.837  -28.636 1.00 144.45 ? 598  LEU A CA    1 
ATOM   4625  C  C     . LEU A 1  598  ? 31.232  -60.344  -28.672 1.00 139.88 ? 598  LEU A C     1 
ATOM   4626  O  O     . LEU A 1  598  ? 30.909  -59.503  -29.516 1.00 137.45 ? 598  LEU A O     1 
ATOM   4627  C  CB    . LEU A 1  598  ? 32.945  -61.719  -29.852 1.00 161.59 ? 598  LEU A CB    1 
ATOM   4628  C  CG    . LEU A 1  598  ? 33.308  -60.901  -31.091 1.00 160.18 ? 598  LEU A CG    1 
ATOM   4629  C  CD1   . LEU A 1  598  ? 34.350  -59.849  -30.739 1.00 142.72 ? 598  LEU A CD1   1 
ATOM   4630  C  CD2   . LEU A 1  598  ? 33.785  -61.795  -32.225 1.00 153.92 ? 598  LEU A CD2   1 
ATOM   4631  N  N     . SER A 1  599  ? 30.361  -60.890  -27.816 1.00 154.46 ? 599  SER A N     1 
ATOM   4632  C  CA    . SER A 1  599  ? 28.952  -60.529  -27.669 1.00 153.32 ? 599  SER A CA    1 
ATOM   4633  C  C     . SER A 1  599  ? 28.311  -60.261  -29.023 1.00 143.77 ? 599  SER A C     1 
ATOM   4634  O  O     . SER A 1  599  ? 27.950  -59.115  -29.328 1.00 135.81 ? 599  SER A O     1 
ATOM   4635  C  CB    . SER A 1  599  ? 28.788  -59.313  -26.757 1.00 136.32 ? 599  SER A CB    1 
ATOM   4636  O  OG    . SER A 1  599  ? 27.438  -59.171  -26.340 1.00 140.81 ? 599  SER A OG    1 
ATOM   4637  N  N     . PRO A 1  600  ? 28.157  -61.285  -29.861 1.00 132.50 ? 600  PRO A N     1 
ATOM   4638  C  CA    . PRO A 1  600  ? 27.694  -61.027  -31.228 1.00 126.68 ? 600  PRO A CA    1 
ATOM   4639  C  C     . PRO A 1  600  ? 26.301  -60.445  -31.269 1.00 136.45 ? 600  PRO A C     1 
ATOM   4640  O  O     . PRO A 1  600  ? 25.998  -59.654  -32.172 1.00 151.69 ? 600  PRO A O     1 
ATOM   4641  C  CB    . PRO A 1  600  ? 27.745  -62.414  -31.876 1.00 140.79 ? 600  PRO A CB    1 
ATOM   4642  C  CG    . PRO A 1  600  ? 27.608  -63.365  -30.728 1.00 126.81 ? 600  PRO A CG    1 
ATOM   4643  C  CD    . PRO A 1  600  ? 28.323  -62.723  -29.588 1.00 121.74 ? 600  PRO A CD    1 
ATOM   4644  N  N     . LYS A 1  601  ? 25.447  -60.799  -30.310 1.00 124.72 ? 601  LYS A N     1 
ATOM   4645  C  CA    . LYS A 1  601  ? 24.082  -60.309  -30.285 1.00 139.71 ? 601  LYS A CA    1 
ATOM   4646  C  C     . LYS A 1  601  ? 23.950  -59.017  -29.481 1.00 146.18 ? 601  LYS A C     1 
ATOM   4647  O  O     . LYS A 1  601  ? 22.832  -58.637  -29.109 1.00 151.96 ? 601  LYS A O     1 
ATOM   4648  C  CB    . LYS A 1  601  ? 23.170  -61.394  -29.705 1.00 138.41 ? 601  LYS A CB    1 
ATOM   4649  C  CG    . LYS A 1  601  ? 22.920  -62.548  -30.661 1.00 144.09 ? 601  LYS A CG    1 
ATOM   4650  C  CD    . LYS A 1  601  ? 22.473  -62.030  -32.018 1.00 166.93 ? 601  LYS A CD    1 
ATOM   4651  C  CE    . LYS A 1  601  ? 22.254  -63.151  -33.027 1.00 165.11 ? 601  LYS A CE    1 
ATOM   4652  N  NZ    . LYS A 1  601  ? 21.945  -62.619  -34.391 1.00 159.61 ? 601  LYS A NZ    1 
ATOM   4653  N  N     . ASP A 1  602  ? 25.069  -58.319  -29.246 1.00 140.20 ? 602  ASP A N     1 
ATOM   4654  C  CA    . ASP A 1  602  ? 25.139  -57.224  -28.272 1.00 129.36 ? 602  ASP A CA    1 
ATOM   4655  C  C     . ASP A 1  602  ? 24.476  -57.632  -26.960 1.00 125.31 ? 602  ASP A C     1 
ATOM   4656  O  O     . ASP A 1  602  ? 23.885  -56.814  -26.257 1.00 135.83 ? 602  ASP A O     1 
ATOM   4657  C  CB    . ASP A 1  602  ? 24.547  -55.926  -28.820 1.00 129.02 ? 602  ASP A CB    1 
ATOM   4658  C  CG    . ASP A 1  602  ? 25.325  -54.685  -28.360 1.00 139.33 ? 602  ASP A CG    1 
ATOM   4659  O  OD1   . ASP A 1  602  ? 26.469  -54.818  -27.865 1.00 125.89 ? 602  ASP A OD1   1 
ATOM   4660  O  OD2   . ASP A 1  602  ? 24.794  -53.564  -28.514 1.00 149.44 ? 602  ASP A OD2   1 
ATOM   4661  N  N     . ASN A 1  603  ? 24.569  -58.913  -26.633 1.00 139.54 ? 603  ASN A N     1 
ATOM   4662  C  CA    . ASN A 1  603  ? 23.917  -59.480  -25.467 1.00 124.48 ? 603  ASN A CA    1 
ATOM   4663  C  C     . ASN A 1  603  ? 24.817  -59.286  -24.258 1.00 120.94 ? 603  ASN A C     1 
ATOM   4664  O  O     . ASN A 1  603  ? 26.042  -59.224  -24.379 1.00 151.46 ? 603  ASN A O     1 
ATOM   4665  C  CB    . ASN A 1  603  ? 23.617  -60.967  -25.680 1.00 131.09 ? 603  ASN A CB    1 
ATOM   4666  C  CG    . ASN A 1  603  ? 22.159  -61.233  -25.946 1.00 172.98 ? 603  ASN A CG    1 
ATOM   4667  O  OD1   . ASN A 1  603  ? 21.316  -60.348  -25.785 1.00 197.17 ? 603  ASN A OD1   1 
ATOM   4668  N  ND2   . ASN A 1  603  ? 21.844  -62.459  -26.351 1.00 181.23 ? 603  ASN A ND2   1 
ATOM   4669  N  N     . GLY A 1  604  ? 24.205  -59.146  -23.096 1.00 116.13 ? 604  GLY A N     1 
ATOM   4670  C  CA    . GLY A 1  604  ? 24.966  -59.106  -21.876 1.00 101.53 ? 604  GLY A CA    1 
ATOM   4671  C  C     . GLY A 1  604  ? 25.258  -57.680  -21.470 1.00 131.64 ? 604  GLY A C     1 
ATOM   4672  O  O     . GLY A 1  604  ? 24.581  -56.733  -21.873 1.00 159.22 ? 604  GLY A O     1 
ATOM   4673  N  N     . MET A 1  605  ? 26.299  -57.531  -20.656 1.00 123.08 ? 605  MET A N     1 
ATOM   4674  C  CA    . MET A 1  605  ? 26.705  -56.225  -20.139 1.00 135.01 ? 605  MET A CA    1 
ATOM   4675  C  C     . MET A 1  605  ? 28.161  -56.290  -19.724 1.00 128.20 ? 605  MET A C     1 
ATOM   4676  O  O     . MET A 1  605  ? 28.538  -57.175  -18.946 1.00 106.89 ? 605  MET A O     1 
ATOM   4677  C  CB    . MET A 1  605  ? 25.838  -55.795  -18.948 1.00 127.88 ? 605  MET A CB    1 
ATOM   4678  C  CG    . MET A 1  605  ? 25.844  -54.298  -18.671 1.00 102.77 ? 605  MET A CG    1 
ATOM   4679  S  SD    . MET A 1  605  ? 25.232  -53.328  -20.039 1.00 130.26 ? 605  MET A SD    1 
ATOM   4680  C  CE    . MET A 1  605  ? 26.747  -52.576  -20.603 1.00 117.10 ? 605  MET A CE    1 
ATOM   4681  N  N     . LEU A 1  606  ? 28.997  -55.420  -20.290 1.00 116.31 ? 606  LEU A N     1 
ATOM   4682  C  CA    . LEU A 1  606  ? 30.374  -55.327  -19.807 1.00 104.21 ? 606  LEU A CA    1 
ATOM   4683  C  C     . LEU A 1  606  ? 30.747  -53.853  -19.673 1.00 127.71 ? 606  LEU A C     1 
ATOM   4684  O  O     . LEU A 1  606  ? 30.965  -53.168  -20.678 1.00 126.31 ? 606  LEU A O     1 
ATOM   4685  C  CB    . LEU A 1  606  ? 31.347  -56.068  -20.717 1.00 113.10 ? 606  LEU A CB    1 
ATOM   4686  C  CG    . LEU A 1  606  ? 32.810  -55.786  -20.364 1.00 114.94 ? 606  LEU A CG    1 
ATOM   4687  C  CD1   . LEU A 1  606  ? 33.126  -56.343  -18.982 1.00 104.52 ? 606  LEU A CD1   1 
ATOM   4688  C  CD2   . LEU A 1  606  ? 33.762  -56.342  -21.420 1.00 106.71 ? 606  LEU A CD2   1 
ATOM   4689  N  N     . ILE A 1  607  ? 30.797  -53.368  -18.430 1.00 127.88 ? 607  ILE A N     1 
ATOM   4690  C  CA    . ILE A 1  607  ? 31.200  -52.006  -18.090 1.00 126.81 ? 607  ILE A CA    1 
ATOM   4691  C  C     . ILE A 1  607  ? 32.547  -52.072  -17.385 1.00 129.53 ? 607  ILE A C     1 
ATOM   4692  O  O     . ILE A 1  607  ? 32.711  -52.843  -16.433 1.00 134.01 ? 607  ILE A O     1 
ATOM   4693  C  CB    . ILE A 1  607  ? 30.154  -51.320  -17.191 1.00 123.58 ? 607  ILE A CB    1 
ATOM   4694  C  CG1   . ILE A 1  607  ? 28.739  -51.547  -17.735 1.00 122.85 ? 607  ILE A CG1   1 
ATOM   4695  C  CG2   . ILE A 1  607  ? 30.441  -49.825  -17.072 1.00 128.57 ? 607  ILE A CG2   1 
ATOM   4696  C  CD1   . ILE A 1  607  ? 27.661  -50.720  -17.062 1.00 119.53 ? 607  ILE A CD1   1 
ATOM   4697  N  N     . ILE A 1  608  ? 33.514  -51.281  -17.850 1.00 131.40 ? 608  ILE A N     1 
ATOM   4698  C  CA    . ILE A 1  608  ? 34.864  -51.260  -17.290 1.00 123.47 ? 608  ILE A CA    1 
ATOM   4699  C  C     . ILE A 1  608  ? 35.227  -49.818  -16.970 1.00 133.74 ? 608  ILE A C     1 
ATOM   4700  O  O     . ILE A 1  608  ? 35.200  -48.959  -17.860 1.00 136.89 ? 608  ILE A O     1 
ATOM   4701  C  CB    . ILE A 1  608  ? 35.907  -51.876  -18.238 1.00 123.64 ? 608  ILE A CB    1 
ATOM   4702  C  CG1   . ILE A 1  608  ? 35.481  -53.292  -18.654 1.00 119.44 ? 608  ILE A CG1   1 
ATOM   4703  C  CG2   . ILE A 1  608  ? 37.279  -51.888  -17.562 1.00 124.29 ? 608  ILE A CG2   1 
ATOM   4704  C  CD1   . ILE A 1  608  ? 36.292  -53.916  -19.784 1.00 106.85 ? 608  ILE A CD1   1 
ATOM   4705  N  N     . ASP A 1  609  ? 35.544  -49.548  -15.700 1.00 140.68 ? 609  ASP A N     1 
ATOM   4706  C  CA    . ASP A 1  609  ? 35.878  -48.201  -15.223 1.00 138.55 ? 609  ASP A CA    1 
ATOM   4707  C  C     . ASP A 1  609  ? 34.765  -47.203  -15.526 1.00 137.97 ? 609  ASP A C     1 
ATOM   4708  O  O     . ASP A 1  609  ? 35.020  -46.016  -15.731 1.00 150.03 ? 609  ASP A O     1 
ATOM   4709  C  CB    . ASP A 1  609  ? 37.198  -47.703  -15.818 1.00 125.81 ? 609  ASP A CB    1 
ATOM   4710  C  CG    . ASP A 1  609  ? 37.839  -46.600  -14.983 1.00 129.81 ? 609  ASP A CG    1 
ATOM   4711  O  OD1   . ASP A 1  609  ? 37.531  -46.514  -13.778 1.00 126.31 ? 609  ASP A OD1   1 
ATOM   4712  O  OD2   . ASP A 1  609  ? 38.636  -45.803  -15.528 1.00 138.73 ? 609  ASP A OD2   1 
ATOM   4713  N  N     . GLY A 1  610  ? 33.526  -47.674  -15.588 1.00 143.36 ? 610  GLY A N     1 
ATOM   4714  C  CA    . GLY A 1  610  ? 32.429  -46.768  -15.842 1.00 142.23 ? 610  GLY A CA    1 
ATOM   4715  C  C     . GLY A 1  610  ? 32.207  -46.440  -17.296 1.00 127.06 ? 610  GLY A C     1 
ATOM   4716  O  O     . GLY A 1  610  ? 31.537  -45.446  -17.600 1.00 131.24 ? 610  GLY A O     1 
ATOM   4717  N  N     . GLN A 1  611  ? 32.767  -47.234  -18.207 1.00 108.33 ? 611  GLN A N     1 
ATOM   4718  C  CA    . GLN A 1  611  ? 32.520  -47.085  -19.631 1.00 122.76 ? 611  GLN A CA    1 
ATOM   4719  C  C     . GLN A 1  611  ? 31.898  -48.379  -20.145 1.00 130.61 ? 611  GLN A C     1 
ATOM   4720  O  O     . GLN A 1  611  ? 32.342  -49.476  -19.789 1.00 135.06 ? 611  GLN A O     1 
ATOM   4721  C  CB    . GLN A 1  611  ? 33.819  -46.743  -20.387 1.00 110.47 ? 611  GLN A CB    1 
ATOM   4722  C  CG    . GLN A 1  611  ? 34.582  -45.535  -19.828 1.00 123.36 ? 611  GLN A CG    1 
ATOM   4723  C  CD    . GLN A 1  611  ? 33.774  -44.244  -19.879 1.00 134.60 ? 611  GLN A CD    1 
ATOM   4724  O  OE1   . GLN A 1  611  ? 33.278  -43.769  -18.852 1.00 142.05 ? 611  GLN A OE1   1 
ATOM   4725  N  NE2   . GLN A 1  611  ? 33.643  -43.668  -21.071 1.00 128.66 ? 611  GLN A NE2   1 
ATOM   4726  N  N     . ILE A 1  612  ? 30.849  -48.254  -20.957 1.00 115.03 ? 612  ILE A N     1 
ATOM   4727  C  CA    . ILE A 1  612  ? 30.165  -49.422  -21.505 1.00 108.77 ? 612  ILE A CA    1 
ATOM   4728  C  C     . ILE A 1  612  ? 31.030  -49.997  -22.618 1.00 119.08 ? 612  ILE A C     1 
ATOM   4729  O  O     . ILE A 1  612  ? 31.357  -49.293  -23.582 1.00 123.69 ? 612  ILE A O     1 
ATOM   4730  C  CB    . ILE A 1  612  ? 28.763  -49.062  -22.022 1.00 112.50 ? 612  ILE A CB    1 
ATOM   4731  C  CG1   . ILE A 1  612  ? 27.834  -48.695  -20.857 1.00 110.85 ? 612  ILE A CG1   1 
ATOM   4732  C  CG2   . ILE A 1  612  ? 28.175  -50.223  -22.809 1.00 105.88 ? 612  ILE A CG2   1 
ATOM   4733  C  CD1   . ILE A 1  612  ? 26.481  -48.077  -21.263 1.00 104.80 ? 612  ILE A CD1   1 
ATOM   4734  N  N     . ILE A 1  613  ? 31.388  -51.273  -22.497 1.00 114.93 ? 613  ILE A N     1 
ATOM   4735  C  CA    . ILE A 1  613  ? 32.238  -51.935  -23.480 1.00 113.78 ? 613  ILE A CA    1 
ATOM   4736  C  C     . ILE A 1  613  ? 31.410  -52.708  -24.493 1.00 113.24 ? 613  ILE A C     1 
ATOM   4737  O  O     . ILE A 1  613  ? 31.745  -52.725  -25.679 1.00 118.90 ? 613  ILE A O     1 
ATOM   4738  C  CB    . ILE A 1  613  ? 33.265  -52.852  -22.786 1.00 122.62 ? 613  ILE A CB    1 
ATOM   4739  C  CG1   . ILE A 1  613  ? 34.041  -52.059  -21.740 1.00 110.43 ? 613  ILE A CG1   1 
ATOM   4740  C  CG2   . ILE A 1  613  ? 34.181  -53.509  -23.788 1.00 123.89 ? 613  ILE A CG2   1 
ATOM   4741  C  CD1   . ILE A 1  613  ? 35.242  -51.361  -22.294 1.00 106.30 ? 613  ILE A CD1   1 
ATOM   4742  N  N     . PHE A 1  614  ? 30.352  -53.380  -24.037 1.00 111.25 ? 614  PHE A N     1 
ATOM   4743  C  CA    . PHE A 1  614  ? 29.358  -53.931  -24.949 1.00 127.73 ? 614  PHE A CA    1 
ATOM   4744  C  C     . PHE A 1  614  ? 28.085  -54.213  -24.171 1.00 133.10 ? 614  PHE A C     1 
ATOM   4745  O  O     . PHE A 1  614  ? 28.072  -54.221  -22.930 1.00 138.41 ? 614  PHE A O     1 
ATOM   4746  C  CB    . PHE A 1  614  ? 29.855  -55.195  -25.665 1.00 143.43 ? 614  PHE A CB    1 
ATOM   4747  C  CG    . PHE A 1  614  ? 30.098  -56.387  -24.765 1.00 143.99 ? 614  PHE A CG    1 
ATOM   4748  C  CD1   . PHE A 1  614  ? 29.044  -57.095  -24.203 1.00 129.87 ? 614  PHE A CD1   1 
ATOM   4749  C  CD2   . PHE A 1  614  ? 31.384  -56.818  -24.504 1.00 140.69 ? 614  PHE A CD2   1 
ATOM   4750  C  CE1   . PHE A 1  614  ? 29.279  -58.189  -23.399 1.00 127.49 ? 614  PHE A CE1   1 
ATOM   4751  C  CE2   . PHE A 1  614  ? 31.615  -57.913  -23.693 1.00 113.25 ? 614  PHE A CE2   1 
ATOM   4752  C  CZ    . PHE A 1  614  ? 30.562  -58.595  -23.145 1.00 112.57 ? 614  PHE A CZ    1 
ATOM   4753  N  N     . GLY A 1  615  ? 27.045  -54.556  -24.924 1.00 134.39 ? 615  GLY A N     1 
ATOM   4754  C  CA    . GLY A 1  615  ? 25.802  -55.007  -24.338 1.00 139.57 ? 615  GLY A CA    1 
ATOM   4755  C  C     . GLY A 1  615  ? 24.723  -53.947  -24.334 1.00 128.91 ? 615  GLY A C     1 
ATOM   4756  O  O     . GLY A 1  615  ? 24.954  -52.805  -23.925 1.00 125.09 ? 615  GLY A O     1 
ATOM   4757  N  N     . VAL A 1  616  ? 23.548  -54.309  -24.847 1.00 126.31 ? 616  VAL A N     1 
ATOM   4758  C  CA    . VAL A 1  616  ? 22.419  -53.395  -24.823 1.00 112.20 ? 616  VAL A CA    1 
ATOM   4759  C  C     . VAL A 1  616  ? 21.948  -53.231  -23.385 1.00 137.89 ? 616  VAL A C     1 
ATOM   4760  O  O     . VAL A 1  616  ? 21.860  -54.206  -22.623 1.00 151.62 ? 616  VAL A O     1 
ATOM   4761  C  CB    . VAL A 1  616  ? 21.282  -53.905  -25.726 1.00 99.00  ? 616  VAL A CB    1 
ATOM   4762  C  CG1   . VAL A 1  616  ? 20.270  -52.812  -25.943 1.00 109.17 ? 616  VAL A CG1   1 
ATOM   4763  C  CG2   . VAL A 1  616  ? 21.814  -54.391  -27.064 1.00 130.25 ? 616  VAL A CG2   1 
ATOM   4764  N  N     . VAL A 1  617  ? 21.673  -51.991  -22.998 1.00 130.29 ? 617  VAL A N     1 
ATOM   4765  C  CA    . VAL A 1  617  ? 21.251  -51.663  -21.643 1.00 125.86 ? 617  VAL A CA    1 
ATOM   4766  C  C     . VAL A 1  617  ? 19.730  -51.734  -21.574 1.00 133.98 ? 617  VAL A C     1 
ATOM   4767  O  O     . VAL A 1  617  ? 19.028  -51.134  -22.401 1.00 117.85 ? 617  VAL A O     1 
ATOM   4768  C  CB    . VAL A 1  617  ? 21.764  -50.274  -21.233 1.00 102.24 ? 617  VAL A CB    1 
ATOM   4769  C  CG1   . VAL A 1  617  ? 21.217  -49.874  -19.873 1.00 92.84  ? 617  VAL A CG1   1 
ATOM   4770  C  CG2   . VAL A 1  617  ? 23.284  -50.262  -21.246 1.00 96.32  ? 617  VAL A CG2   1 
ATOM   4771  N  N     . GLU A 1  618  ? 19.225  -52.476  -20.592 1.00 121.50 ? 618  GLU A N     1 
ATOM   4772  C  CA    . GLU A 1  618  ? 17.796  -52.655  -20.389 1.00 103.39 ? 618  GLU A CA    1 
ATOM   4773  C  C     . GLU A 1  618  ? 17.573  -53.051  -18.927 1.00 115.93 ? 618  GLU A C     1 
ATOM   4774  O  O     . GLU A 1  618  ? 18.498  -53.005  -18.108 1.00 125.87 ? 618  GLU A O     1 
ATOM   4775  C  CB    . GLU A 1  618  ? 17.264  -53.672  -21.405 1.00 93.55  ? 618  GLU A CB    1 
ATOM   4776  C  CG    . GLU A 1  618  ? 17.151  -55.123  -20.939 1.00 113.04 ? 618  GLU A CG    1 
ATOM   4777  C  CD    . GLU A 1  618  ? 18.444  -55.747  -20.439 1.00 135.10 ? 618  GLU A CD    1 
ATOM   4778  O  OE1   . GLU A 1  618  ? 19.528  -55.125  -20.509 1.00 137.98 ? 618  GLU A OE1   1 
ATOM   4779  O  OE2   . GLU A 1  618  ? 18.356  -56.896  -19.967 1.00 137.98 ? 618  GLU A OE2   1 
ATOM   4780  N  N     . LYS A 1  619  ? 16.334  -53.424  -18.598 1.00 99.06  ? 619  LYS A N     1 
ATOM   4781  C  CA    . LYS A 1  619  ? 15.892  -53.761  -17.248 1.00 90.30  ? 619  LYS A CA    1 
ATOM   4782  C  C     . LYS A 1  619  ? 16.898  -54.559  -16.427 1.00 106.49 ? 619  LYS A C     1 
ATOM   4783  O  O     . LYS A 1  619  ? 17.064  -54.302  -15.230 1.00 109.18 ? 619  LYS A O     1 
ATOM   4784  C  CB    . LYS A 1  619  ? 14.581  -54.545  -17.329 1.00 94.68  ? 619  LYS A CB    1 
ATOM   4785  C  CG    . LYS A 1  619  ? 13.778  -54.621  -16.039 1.00 89.23  ? 619  LYS A CG    1 
ATOM   4786  C  CD    . LYS A 1  619  ? 12.381  -55.117  -16.349 1.00 103.11 ? 619  LYS A CD    1 
ATOM   4787  C  CE    . LYS A 1  619  ? 11.538  -55.227  -15.105 1.00 127.48 ? 619  LYS A CE    1 
ATOM   4788  N  NZ    . LYS A 1  619  ? 10.223  -55.840  -15.439 1.00 137.90 ? 619  LYS A NZ    1 
ATOM   4789  N  N     . LYS A 1  620  ? 17.591  -55.513  -17.055 1.00 121.45 ? 620  LYS A N     1 
ATOM   4790  C  CA    . LYS A 1  620  ? 18.521  -56.345  -16.300 1.00 119.43 ? 620  LYS A CA    1 
ATOM   4791  C  C     . LYS A 1  620  ? 19.766  -55.581  -15.873 1.00 108.42 ? 620  LYS A C     1 
ATOM   4792  O  O     . LYS A 1  620  ? 20.507  -56.067  -15.011 1.00 125.65 ? 620  LYS A O     1 
ATOM   4793  C  CB    . LYS A 1  620  ? 18.917  -57.586  -17.117 1.00 120.30 ? 620  LYS A CB    1 
ATOM   4794  C  CG    . LYS A 1  620  ? 17.793  -58.626  -17.305 1.00 133.18 ? 620  LYS A CG    1 
ATOM   4795  C  CD    . LYS A 1  620  ? 18.300  -59.947  -17.910 1.00 121.28 ? 620  LYS A CD    1 
ATOM   4796  C  CE    . LYS A 1  620  ? 17.791  -60.182  -19.332 1.00 99.88  ? 620  LYS A CE    1 
ATOM   4797  N  NZ    . LYS A 1  620  ? 18.611  -59.490  -20.363 1.00 120.63 ? 620  LYS A NZ    1 
ATOM   4798  N  N     . THR A 1  621  ? 20.012  -54.409  -16.450 1.00 103.45 ? 621  THR A N     1 
ATOM   4799  C  CA    . THR A 1  621  ? 21.151  -53.577  -16.088 1.00 115.62 ? 621  THR A CA    1 
ATOM   4800  C  C     . THR A 1  621  ? 20.766  -52.416  -15.175 1.00 116.73 ? 621  THR A C     1 
ATOM   4801  O  O     . THR A 1  621  ? 21.488  -52.127  -14.215 1.00 118.95 ? 621  THR A O     1 
ATOM   4802  C  CB    . THR A 1  621  ? 21.818  -53.022  -17.355 1.00 117.30 ? 621  THR A CB    1 
ATOM   4803  O  OG1   . THR A 1  621  ? 22.077  -54.089  -18.280 1.00 96.89  ? 621  THR A OG1   1 
ATOM   4804  C  CG2   . THR A 1  621  ? 23.127  -52.313  -17.023 1.00 102.96 ? 621  THR A CG2   1 
ATOM   4805  N  N     . VAL A 1  622  ? 19.629  -51.761  -15.438 1.00 116.80 ? 622  VAL A N     1 
ATOM   4806  C  CA    . VAL A 1  622  ? 19.247  -50.513  -14.789 1.00 109.67 ? 622  VAL A CA    1 
ATOM   4807  C  C     . VAL A 1  622  ? 17.909  -50.600  -14.056 1.00 111.96 ? 622  VAL A C     1 
ATOM   4808  O  O     . VAL A 1  622  ? 17.380  -49.573  -13.619 1.00 110.62 ? 622  VAL A O     1 
ATOM   4809  C  CB    . VAL A 1  622  ? 19.234  -49.350  -15.799 1.00 97.21  ? 622  VAL A CB    1 
ATOM   4810  C  CG1   . VAL A 1  622  ? 20.632  -49.169  -16.412 1.00 90.09  ? 622  VAL A CG1   1 
ATOM   4811  C  CG2   . VAL A 1  622  ? 18.177  -49.592  -16.856 1.00 94.30  ? 622  VAL A CG2   1 
ATOM   4812  N  N     . GLY A 1  623  ? 17.329  -51.789  -13.935 1.00 107.73 ? 623  GLY A N     1 
ATOM   4813  C  CA    . GLY A 1  623  ? 16.117  -51.970  -13.168 1.00 90.73  ? 623  GLY A CA    1 
ATOM   4814  C  C     . GLY A 1  623  ? 16.444  -52.237  -11.712 1.00 92.99  ? 623  GLY A C     1 
ATOM   4815  O  O     . GLY A 1  623  ? 17.580  -52.086  -11.260 1.00 110.71 ? 623  GLY A O     1 
ATOM   4816  N  N     . SER A 1  624  ? 15.426  -52.672  -10.972 1.00 90.31  ? 624  SER A N     1 
ATOM   4817  C  CA    . SER A 1  624  ? 15.628  -53.148  -9.604  1.00 91.14  ? 624  SER A CA    1 
ATOM   4818  C  C     . SER A 1  624  ? 16.260  -54.527  -9.575  1.00 109.15 ? 624  SER A C     1 
ATOM   4819  O  O     . SER A 1  624  ? 15.884  -55.364  -8.750  1.00 118.38 ? 624  SER A O     1 
ATOM   4820  C  CB    . SER A 1  624  ? 14.283  -53.166  -8.885  1.00 114.76 ? 624  SER A CB    1 
ATOM   4821  O  OG    . SER A 1  624  ? 13.469  -52.074  -9.279  1.00 124.06 ? 624  SER A OG    1 
ATOM   4822  N  N     . SER A 1  625  ? 17.254  -54.764  -10.435 1.00 98.33  ? 625  SER A N     1 
ATOM   4823  C  CA    . SER A 1  625  ? 17.862  -56.076  -10.579 1.00 105.05 ? 625  SER A CA    1 
ATOM   4824  C  C     . SER A 1  625  ? 18.893  -56.320  -9.475  1.00 103.02 ? 625  SER A C     1 
ATOM   4825  O  O     . SER A 1  625  ? 19.455  -55.388  -8.893  1.00 112.71 ? 625  SER A O     1 
ATOM   4826  C  CB    . SER A 1  625  ? 18.478  -56.202  -11.971 1.00 107.74 ? 625  SER A CB    1 
ATOM   4827  O  OG    . SER A 1  625  ? 19.614  -55.373  -12.107 1.00 144.92 ? 625  SER A OG    1 
ATOM   4828  N  N     . ASN A 1  626  ? 19.184  -57.603  -9.239  1.00 90.09  ? 626  ASN A N     1 
ATOM   4829  C  CA    . ASN A 1  626  ? 19.988  -57.993  -8.082  1.00 109.09 ? 626  ASN A CA    1 
ATOM   4830  C  C     . ASN A 1  626  ? 21.440  -57.534  -8.208  1.00 117.76 ? 626  ASN A C     1 
ATOM   4831  O  O     . ASN A 1  626  ? 21.993  -56.916  -7.289  1.00 114.49 ? 626  ASN A O     1 
ATOM   4832  C  CB    . ASN A 1  626  ? 19.916  -59.515  -7.907  1.00 115.39 ? 626  ASN A CB    1 
ATOM   4833  C  CG    . ASN A 1  626  ? 19.825  -59.945  -6.449  1.00 144.46 ? 626  ASN A CG    1 
ATOM   4834  O  OD1   . ASN A 1  626  ? 20.836  -60.014  -5.740  1.00 149.87 ? 626  ASN A OD1   1 
ATOM   4835  N  ND2   . ASN A 1  626  ? 18.607  -60.236  -5.993  1.00 139.19 ? 626  ASN A ND2   1 
ATOM   4836  N  N     . GLY A 1  627  ? 22.064  -57.788  -9.345  1.00 97.53  ? 627  GLY A N     1 
ATOM   4837  C  CA    . GLY A 1  627  ? 23.455  -57.412  -9.488  1.00 114.44 ? 627  GLY A CA    1 
ATOM   4838  C  C     . GLY A 1  627  ? 23.615  -56.259  -10.442 1.00 118.90 ? 627  GLY A C     1 
ATOM   4839  O  O     . GLY A 1  627  ? 24.683  -56.082  -11.041 1.00 105.33 ? 627  GLY A O     1 
ATOM   4840  N  N     . GLY A 1  628  ? 22.557  -55.463  -10.570 1.00 133.63 ? 628  GLY A N     1 
ATOM   4841  C  CA    . GLY A 1  628  ? 22.507  -54.444  -11.588 1.00 133.52 ? 628  GLY A CA    1 
ATOM   4842  C  C     . GLY A 1  628  ? 23.388  -53.251  -11.287 1.00 117.91 ? 628  GLY A C     1 
ATOM   4843  O  O     . GLY A 1  628  ? 24.075  -53.158  -10.271 1.00 113.22 ? 628  GLY A O     1 
ATOM   4844  N  N     . LEU A 1  629  ? 23.357  -52.308  -12.224 1.00 123.40 ? 629  LEU A N     1 
ATOM   4845  C  CA    . LEU A 1  629  ? 24.173  -51.106  -12.108 1.00 109.81 ? 629  LEU A CA    1 
ATOM   4846  C  C     . LEU A 1  629  ? 23.846  -50.318  -10.842 1.00 108.97 ? 629  LEU A C     1 
ATOM   4847  O  O     . LEU A 1  629  ? 24.740  -49.746  -10.210 1.00 105.59 ? 629  LEU A O     1 
ATOM   4848  C  CB    . LEU A 1  629  ? 23.993  -50.243  -13.358 1.00 103.04 ? 629  LEU A CB    1 
ATOM   4849  C  CG    . LEU A 1  629  ? 24.838  -48.970  -13.396 1.00 102.01 ? 629  LEU A CG    1 
ATOM   4850  C  CD1   . LEU A 1  629  ? 26.322  -49.344  -13.374 1.00 110.24 ? 629  LEU A CD1   1 
ATOM   4851  C  CD2   . LEU A 1  629  ? 24.507  -48.116  -14.597 1.00 91.17  ? 629  LEU A CD2   1 
ATOM   4852  N  N     . ILE A 1  630  ? 22.575  -50.281  -10.446 1.00 113.24 ? 630  ILE A N     1 
ATOM   4853  C  CA    . ILE A 1  630  ? 22.198  -49.469  -9.297  1.00 99.78  ? 630  ILE A CA    1 
ATOM   4854  C  C     . ILE A 1  630  ? 22.685  -50.111  -7.998  1.00 101.92 ? 630  ILE A C     1 
ATOM   4855  O  O     . ILE A 1  630  ? 23.264  -49.435  -7.135  1.00 101.66 ? 630  ILE A O     1 
ATOM   4856  C  CB    . ILE A 1  630  ? 20.677  -49.247  -9.315  1.00 86.67  ? 630  ILE A CB    1 
ATOM   4857  C  CG1   . ILE A 1  630  ? 20.334  -48.200  -10.364 1.00 86.51  ? 630  ILE A CG1   1 
ATOM   4858  C  CG2   . ILE A 1  630  ? 20.166  -48.776  -7.966  1.00 85.67  ? 630  ILE A CG2   1 
ATOM   4859  C  CD1   . ILE A 1  630  ? 18.897  -48.238  -10.794 1.00 112.35 ? 630  ILE A CD1   1 
ATOM   4860  N  N     . HIS A 1  631  ? 22.538  -51.436  -7.870  1.00 96.27  ? 631  HIS A N     1 
ATOM   4861  C  CA    . HIS A 1  631  ? 23.032  -52.120  -6.673  1.00 104.32 ? 631  HIS A CA    1 
ATOM   4862  C  C     . HIS A 1  631  ? 24.543  -51.956  -6.542  1.00 101.42 ? 631  HIS A C     1 
ATOM   4863  O  O     . HIS A 1  631  ? 25.054  -51.724  -5.433  1.00 116.16 ? 631  HIS A O     1 
ATOM   4864  C  CB    . HIS A 1  631  ? 22.655  -53.614  -6.750  1.00 112.70 ? 631  HIS A CB    1 
ATOM   4865  C  CG    . HIS A 1  631  ? 22.720  -54.355  -5.443  1.00 106.99 ? 631  HIS A CG    1 
ATOM   4866  N  ND1   . HIS A 1  631  ? 23.711  -54.143  -4.511  1.00 124.14 ? 631  HIS A ND1   1 
ATOM   4867  C  CD2   . HIS A 1  631  ? 21.942  -55.348  -4.941  1.00 107.34 ? 631  HIS A CD2   1 
ATOM   4868  C  CE1   . HIS A 1  631  ? 23.524  -54.948  -3.477  1.00 132.02 ? 631  HIS A CE1   1 
ATOM   4869  N  NE2   . HIS A 1  631  ? 22.458  -55.692  -3.715  1.00 112.16 ? 631  HIS A NE2   1 
ATOM   4870  N  N     . VAL A 1  632  ? 25.243  -51.884  -7.679  1.00 98.44  ? 632  VAL A N     1 
ATOM   4871  C  CA    . VAL A 1  632  ? 26.698  -51.793  -7.655  1.00 105.92 ? 632  VAL A CA    1 
ATOM   4872  C  C     . VAL A 1  632  ? 27.120  -50.377  -7.299  1.00 100.40 ? 632  VAL A C     1 
ATOM   4873  O  O     . VAL A 1  632  ? 27.951  -50.178  -6.412  1.00 111.50 ? 632  VAL A O     1 
ATOM   4874  C  CB    . VAL A 1  632  ? 27.296  -52.229  -9.009  1.00 92.33  ? 632  VAL A CB    1 
ATOM   4875  C  CG1   . VAL A 1  632  ? 28.795  -52.014  -9.028  1.00 93.44  ? 632  VAL A CG1   1 
ATOM   4876  C  CG2   . VAL A 1  632  ? 26.958  -53.669  -9.335  1.00 93.19  ? 632  VAL A CG2   1 
ATOM   4877  N  N     . VAL A 1  633  ? 26.587  -49.375  -8.004  1.00 99.03  ? 633  VAL A N     1 
ATOM   4878  C  CA    . VAL A 1  633  ? 27.011  -48.000  -7.745  1.00 114.06 ? 633  VAL A CA    1 
ATOM   4879  C  C     . VAL A 1  633  ? 26.668  -47.624  -6.309  1.00 102.16 ? 633  VAL A C     1 
ATOM   4880  O  O     . VAL A 1  633  ? 27.436  -46.941  -5.621  1.00 91.66  ? 633  VAL A O     1 
ATOM   4881  C  CB    . VAL A 1  633  ? 26.375  -47.019  -8.759  1.00 89.49  ? 633  VAL A CB    1 
ATOM   4882  C  CG1   . VAL A 1  633  ? 26.844  -45.585  -8.504  1.00 89.32  ? 633  VAL A CG1   1 
ATOM   4883  C  CG2   . VAL A 1  633  ? 26.705  -47.412  -10.189 1.00 93.76  ? 633  VAL A CG2   1 
ATOM   4884  N  N     . THR A 1  634  ? 25.526  -48.110  -5.820  1.00 91.32  ? 634  THR A N     1 
ATOM   4885  C  CA    . THR A 1  634  ? 25.129  -47.805  -4.454  1.00 95.62  ? 634  THR A CA    1 
ATOM   4886  C  C     . THR A 1  634  ? 26.109  -48.395  -3.457  1.00 110.19 ? 634  THR A C     1 
ATOM   4887  O  O     . THR A 1  634  ? 26.535  -47.713  -2.517  1.00 125.98 ? 634  THR A O     1 
ATOM   4888  C  CB    . THR A 1  634  ? 23.708  -48.293  -4.187  1.00 95.03  ? 634  THR A CB    1 
ATOM   4889  O  OG1   . THR A 1  634  ? 22.819  -47.639  -5.094  1.00 117.40 ? 634  THR A OG1   1 
ATOM   4890  C  CG2   . THR A 1  634  ? 23.273  -47.910  -2.780  1.00 85.66  ? 634  THR A CG2   1 
ATOM   4891  N  N     . ARG A 1  635  ? 26.511  -49.658  -3.659  1.00 107.35 ? 635  ARG A N     1 
ATOM   4892  C  CA    . ARG A 1  635  ? 27.481  -50.244  -2.727  1.00 97.61  ? 635  ARG A CA    1 
ATOM   4893  C  C     . ARG A 1  635  ? 28.875  -49.630  -2.872  1.00 102.17 ? 635  ARG A C     1 
ATOM   4894  O  O     . ARG A 1  635  ? 29.533  -49.342  -1.867  1.00 126.08 ? 635  ARG A O     1 
ATOM   4895  C  CB    . ARG A 1  635  ? 27.526  -51.760  -2.908  1.00 102.55 ? 635  ARG A CB    1 
ATOM   4896  C  CG    . ARG A 1  635  ? 26.311  -52.489  -2.316  1.00 97.58  ? 635  ARG A CG    1 
ATOM   4897  C  CD    . ARG A 1  635  ? 26.516  -52.705  -0.838  1.00 89.54  ? 635  ARG A CD    1 
ATOM   4898  N  NE    . ARG A 1  635  ? 25.278  -52.518  -0.109  1.00 119.87 ? 635  ARG A NE    1 
ATOM   4899  C  CZ    . ARG A 1  635  ? 24.890  -51.341  0.367   1.00 146.14 ? 635  ARG A CZ    1 
ATOM   4900  N  NH1   . ARG A 1  635  ? 25.653  -50.269  0.179   1.00 155.36 ? 635  ARG A NH1   1 
ATOM   4901  N  NH2   . ARG A 1  635  ? 23.748  -51.222  1.029   1.00 140.67 ? 635  ARG A NH2   1 
ATOM   4902  N  N     . GLU A 1  636  ? 29.324  -49.392  -4.102  1.00 103.36 ? 636  GLU A N     1 
ATOM   4903  C  CA    . GLU A 1  636  ? 30.679  -48.899  -4.353  1.00 106.82 ? 636  GLU A CA    1 
ATOM   4904  C  C     . GLU A 1  636  ? 30.831  -47.430  -3.984  1.00 116.40 ? 636  GLU A C     1 
ATOM   4905  O  O     . GLU A 1  636  ? 31.678  -47.064  -3.159  1.00 120.79 ? 636  GLU A O     1 
ATOM   4906  C  CB    . GLU A 1  636  ? 31.061  -49.132  -5.809  1.00 104.56 ? 636  GLU A CB    1 
ATOM   4907  C  CG    . GLU A 1  636  ? 31.344  -50.587  -6.114  1.00 139.42 ? 636  GLU A CG    1 
ATOM   4908  C  CD    . GLU A 1  636  ? 32.592  -51.093  -5.430  1.00 143.20 ? 636  GLU A CD    1 
ATOM   4909  O  OE1   . GLU A 1  636  ? 33.604  -50.366  -5.427  1.00 146.37 ? 636  GLU A OE1   1 
ATOM   4910  O  OE2   . GLU A 1  636  ? 32.546  -52.207  -4.866  1.00 141.64 ? 636  GLU A OE2   1 
ATOM   4911  N  N     . LYS A 1  637  ? 30.020  -46.570  -4.592  1.00 119.20 ? 637  LYS A N     1 
ATOM   4912  C  CA    . LYS A 1  637  ? 30.237  -45.134  -4.500  1.00 105.89 ? 637  LYS A CA    1 
ATOM   4913  C  C     . LYS A 1  637  ? 29.351  -44.444  -3.473  1.00 94.81  ? 637  LYS A C     1 
ATOM   4914  O  O     . LYS A 1  637  ? 29.723  -43.369  -2.997  1.00 108.30 ? 637  LYS A O     1 
ATOM   4915  C  CB    . LYS A 1  637  ? 30.018  -44.476  -5.870  1.00 95.35  ? 637  LYS A CB    1 
ATOM   4916  C  CG    . LYS A 1  637  ? 31.127  -44.756  -6.878  1.00 119.46 ? 637  LYS A CG    1 
ATOM   4917  C  CD    . LYS A 1  637  ? 32.491  -44.799  -6.206  1.00 134.72 ? 637  LYS A CD    1 
ATOM   4918  C  CE    . LYS A 1  637  ? 33.617  -45.059  -7.191  1.00 129.37 ? 637  LYS A CE    1 
ATOM   4919  N  NZ    . LYS A 1  637  ? 34.784  -45.683  -6.493  1.00 140.68 ? 637  LYS A NZ    1 
ATOM   4920  N  N     . GLY A 1  638  ? 28.192  -45.006  -3.125  1.00 103.90 ? 638  GLY A N     1 
ATOM   4921  C  CA    . GLY A 1  638  ? 27.411  -44.423  -2.057  1.00 115.73 ? 638  GLY A CA    1 
ATOM   4922  C  C     . GLY A 1  638  ? 25.982  -44.090  -2.440  1.00 110.63 ? 638  GLY A C     1 
ATOM   4923  O  O     . GLY A 1  638  ? 25.613  -44.075  -3.617  1.00 134.42 ? 638  GLY A O     1 
ATOM   4924  N  N     . PRO A 1  639  ? 25.145  -43.822  -1.437  1.00 92.02  ? 639  PRO A N     1 
ATOM   4925  C  CA    . PRO A 1  639  ? 23.744  -43.467  -1.724  1.00 102.28 ? 639  PRO A CA    1 
ATOM   4926  C  C     . PRO A 1  639  ? 23.577  -42.210  -2.574  1.00 99.62  ? 639  PRO A C     1 
ATOM   4927  O  O     . PRO A 1  639  ? 22.764  -42.176  -3.510  1.00 83.96  ? 639  PRO A O     1 
ATOM   4928  C  CB    . PRO A 1  639  ? 23.163  -43.273  -0.322  1.00 83.72  ? 639  PRO A CB    1 
ATOM   4929  C  CG    . PRO A 1  639  ? 24.019  -44.139  0.564   1.00 100.49 ? 639  PRO A CG    1 
ATOM   4930  C  CD    . PRO A 1  639  ? 25.392  -43.988  0.003   1.00 106.60 ? 639  PRO A CD    1 
ATOM   4931  N  N     . GLN A 1  640  ? 24.322  -41.159  -2.253  1.00 95.99  ? 640  GLN A N     1 
ATOM   4932  C  CA    . GLN A 1  640  ? 24.177  -39.882  -2.939  1.00 84.42  ? 640  GLN A CA    1 
ATOM   4933  C  C     . GLN A 1  640  ? 24.723  -39.935  -4.362  1.00 95.23  ? 640  GLN A C     1 
ATOM   4934  O  O     . GLN A 1  640  ? 24.197  -39.263  -5.266  1.00 106.58 ? 640  GLN A O     1 
ATOM   4935  C  CB    . GLN A 1  640  ? 24.873  -38.791  -2.124  1.00 120.13 ? 640  GLN A CB    1 
ATOM   4936  C  CG    . GLN A 1  640  ? 24.765  -38.990  -0.591  1.00 152.09 ? 640  GLN A CG    1 
ATOM   4937  C  CD    . GLN A 1  640  ? 25.695  -40.096  -0.063  1.00 176.33 ? 640  GLN A CD    1 
ATOM   4938  O  OE1   . GLN A 1  640  ? 26.545  -40.608  -0.799  1.00 174.83 ? 640  GLN A OE1   1 
ATOM   4939  N  NE2   . GLN A 1  640  ? 25.502  -40.495  1.192   1.00 167.88 ? 640  GLN A NE2   1 
ATOM   4940  N  N     . VAL A 1  641  ? 25.765  -40.729  -4.592  1.00 106.88 ? 641  VAL A N     1 
ATOM   4941  C  CA    . VAL A 1  641  ? 26.275  -40.862  -5.950  1.00 102.64 ? 641  VAL A CA    1 
ATOM   4942  C  C     . VAL A 1  641  ? 25.300  -41.660  -6.804  1.00 104.48 ? 641  VAL A C     1 
ATOM   4943  O  O     . VAL A 1  641  ? 25.116  -41.370  -7.994  1.00 88.74  ? 641  VAL A O     1 
ATOM   4944  C  CB    . VAL A 1  641  ? 27.677  -41.496  -5.928  1.00 88.18  ? 641  VAL A CB    1 
ATOM   4945  C  CG1   . VAL A 1  641  ? 28.361  -41.373  -7.293  1.00 96.71  ? 641  VAL A CG1   1 
ATOM   4946  C  CG2   . VAL A 1  641  ? 28.503  -40.871  -4.830  1.00 88.42  ? 641  VAL A CG2   1 
ATOM   4947  N  N     . CYS A 1  642  ? 24.648  -42.670  -6.217  1.00 86.28  ? 642  CYS A N     1 
ATOM   4948  C  CA    . CYS A 1  642  ? 23.668  -43.416  -6.996  1.00 94.45  ? 642  CYS A CA    1 
ATOM   4949  C  C     . CYS A 1  642  ? 22.419  -42.582  -7.249  1.00 116.59 ? 642  CYS A C     1 
ATOM   4950  O  O     . CYS A 1  642  ? 21.832  -42.636  -8.346  1.00 121.37 ? 642  CYS A O     1 
ATOM   4951  C  CB    . CYS A 1  642  ? 23.314  -44.705  -6.261  1.00 85.72  ? 642  CYS A CB    1 
ATOM   4952  S  SG    . CYS A 1  642  ? 22.303  -45.837  -7.196  1.00 115.31 ? 642  CYS A SG    1 
ATOM   4953  N  N     . ALA A 1  643  ? 22.061  -41.731  -6.287  1.00 84.25  ? 643  ALA A N     1 
ATOM   4954  C  CA    . ALA A 1  643  ? 20.920  -40.854  -6.481  1.00 83.45  ? 643  ALA A CA    1 
ATOM   4955  C  C     . ALA A 1  643  ? 21.203  -39.843  -7.589  1.00 99.08  ? 643  ALA A C     1 
ATOM   4956  O  O     . ALA A 1  643  ? 20.296  -39.469  -8.344  1.00 119.20 ? 643  ALA A O     1 
ATOM   4957  C  CB    . ALA A 1  643  ? 20.548  -40.196  -5.156  1.00 82.70  ? 643  ALA A CB    1 
ATOM   4958  N  N     . LYS A 1  644  ? 22.456  -39.386  -7.711  1.00 84.67  ? 644  LYS A N     1 
ATOM   4959  C  CA    . LYS A 1  644  ? 22.781  -38.547  -8.863  1.00 85.51  ? 644  LYS A CA    1 
ATOM   4960  C  C     . LYS A 1  644  ? 22.784  -39.371  -10.146 1.00 105.33 ? 644  LYS A C     1 
ATOM   4961  O  O     . LYS A 1  644  ? 22.514  -38.838  -11.232 1.00 112.41 ? 644  LYS A O     1 
ATOM   4962  C  CB    . LYS A 1  644  ? 24.126  -37.850  -8.667  1.00 89.26  ? 644  LYS A CB    1 
ATOM   4963  C  CG    . LYS A 1  644  ? 24.093  -36.706  -7.669  1.00 140.13 ? 644  LYS A CG    1 
ATOM   4964  C  CD    . LYS A 1  644  ? 25.464  -36.061  -7.482  1.00 158.52 ? 644  LYS A CD    1 
ATOM   4965  C  CE    . LYS A 1  644  ? 25.381  -34.938  -6.462  1.00 158.35 ? 644  LYS A CE    1 
ATOM   4966  N  NZ    . LYS A 1  644  ? 26.620  -34.130  -6.442  1.00 158.05 ? 644  LYS A NZ    1 
ATOM   4967  N  N     . LEU A 1  645  ? 23.083  -40.672  -10.039 1.00 96.47  ? 645  LEU A N     1 
ATOM   4968  C  CA    . LEU A 1  645  ? 23.109  -41.526  -11.226 1.00 94.28  ? 645  LEU A CA    1 
ATOM   4969  C  C     . LEU A 1  645  ? 21.731  -41.630  -11.862 1.00 98.32  ? 645  LEU A C     1 
ATOM   4970  O  O     . LEU A 1  645  ? 21.599  -41.624  -13.098 1.00 106.55 ? 645  LEU A O     1 
ATOM   4971  C  CB    . LEU A 1  645  ? 23.629  -42.917  -10.876 1.00 87.30  ? 645  LEU A CB    1 
ATOM   4972  C  CG    . LEU A 1  645  ? 23.654  -43.844  -12.093 1.00 88.08  ? 645  LEU A CG    1 
ATOM   4973  C  CD1   . LEU A 1  645  ? 24.578  -43.302  -13.168 1.00 103.02 ? 645  LEU A CD1   1 
ATOM   4974  C  CD2   . LEU A 1  645  ? 24.042  -45.254  -11.711 1.00 88.52  ? 645  LEU A CD2   1 
ATOM   4975  N  N     . PHE A 1  646  ? 20.689  -41.697  -11.028 1.00 95.79  ? 646  PHE A N     1 
ATOM   4976  C  CA    . PHE A 1  646  ? 19.323  -41.644  -11.551 1.00 84.68  ? 646  PHE A CA    1 
ATOM   4977  C  C     . PHE A 1  646  ? 19.092  -40.363  -12.346 1.00 96.63  ? 646  PHE A C     1 
ATOM   4978  O  O     . PHE A 1  646  ? 18.645  -40.404  -13.495 1.00 95.24  ? 646  PHE A O     1 
ATOM   4979  C  CB    . PHE A 1  646  ? 18.302  -41.744  -10.411 1.00 83.63  ? 646  PHE A CB    1 
ATOM   4980  C  CG    . PHE A 1  646  ? 18.183  -43.112  -9.811  1.00 86.46  ? 646  PHE A CG    1 
ATOM   4981  C  CD1   . PHE A 1  646  ? 17.380  -44.073  -10.396 1.00 93.36  ? 646  PHE A CD1   1 
ATOM   4982  C  CD2   . PHE A 1  646  ? 18.869  -43.438  -8.656  1.00 99.30  ? 646  PHE A CD2   1 
ATOM   4983  C  CE1   . PHE A 1  646  ? 17.276  -45.339  -9.847  1.00 91.56  ? 646  PHE A CE1   1 
ATOM   4984  C  CE2   . PHE A 1  646  ? 18.768  -44.697  -8.113  1.00 98.23  ? 646  PHE A CE2   1 
ATOM   4985  C  CZ    . PHE A 1  646  ? 17.972  -45.645  -8.705  1.00 95.86  ? 646  PHE A CZ    1 
ATOM   4986  N  N     . GLY A 1  647  ? 19.359  -39.208  -11.738 1.00 84.43  ? 647  GLY A N     1 
ATOM   4987  C  CA    . GLY A 1  647  ? 19.091  -37.956  -12.426 1.00 113.20 ? 647  GLY A CA    1 
ATOM   4988  C  C     . GLY A 1  647  ? 19.843  -37.813  -13.738 1.00 109.45 ? 647  GLY A C     1 
ATOM   4989  O  O     . GLY A 1  647  ? 19.278  -37.370  -14.748 1.00 96.91  ? 647  GLY A O     1 
ATOM   4990  N  N     . ASN A 1  648  ? 21.099  -38.268  -13.768 1.00 95.73  ? 648  ASN A N     1 
ATOM   4991  C  CA    . ASN A 1  648  ? 21.910  -38.082  -14.968 1.00 92.75  ? 648  ASN A CA    1 
ATOM   4992  C  C     . ASN A 1  648  ? 21.503  -39.034  -16.086 1.00 92.42  ? 648  ASN A C     1 
ATOM   4993  O  O     . ASN A 1  648  ? 21.548  -38.661  -17.272 1.00 106.44 ? 648  ASN A O     1 
ATOM   4994  C  CB    . ASN A 1  648  ? 23.398  -38.242  -14.629 1.00 89.81  ? 648  ASN A CB    1 
ATOM   4995  C  CG    . ASN A 1  648  ? 23.935  -37.101  -13.751 1.00 100.90 ? 648  ASN A CG    1 
ATOM   4996  O  OD1   . ASN A 1  648  ? 23.325  -36.040  -13.638 1.00 117.93 ? 648  ASN A OD1   1 
ATOM   4997  N  ND2   . ASN A 1  648  ? 25.089  -37.321  -13.144 1.00 91.11  ? 648  ASN A ND2   1 
ATOM   4998  N  N     . ILE A 1  649  ? 21.036  -40.235  -15.741 1.00 91.57  ? 649  ILE A N     1 
ATOM   4999  C  CA    . ILE A 1  649  ? 20.527  -41.121  -16.783 1.00 91.81  ? 649  ILE A CA    1 
ATOM   5000  C  C     . ILE A 1  649  ? 19.176  -40.616  -17.280 1.00 102.40 ? 649  ILE A C     1 
ATOM   5001  O  O     . ILE A 1  649  ? 18.944  -40.497  -18.489 1.00 108.34 ? 649  ILE A O     1 
ATOM   5002  C  CB    . ILE A 1  649  ? 20.452  -42.568  -16.264 1.00 96.89  ? 649  ILE A CB    1 
ATOM   5003  C  CG1   . ILE A 1  649  ? 21.844  -43.080  -15.929 1.00 88.70  ? 649  ILE A CG1   1 
ATOM   5004  C  CG2   . ILE A 1  649  ? 19.830  -43.504  -17.282 1.00 88.95  ? 649  ILE A CG2   1 
ATOM   5005  C  CD1   . ILE A 1  649  ? 21.810  -44.346  -15.143 1.00 88.54  ? 649  ILE A CD1   1 
ATOM   5006  N  N     . GLN A 1  650  ? 18.282  -40.260  -16.352 1.00 108.20 ? 650  GLN A N     1 
ATOM   5007  C  CA    . GLN A 1  650  ? 16.977  -39.715  -16.716 1.00 115.30 ? 650  GLN A CA    1 
ATOM   5008  C  C     . GLN A 1  650  ? 17.072  -38.374  -17.427 1.00 115.09 ? 650  GLN A C     1 
ATOM   5009  O  O     . GLN A 1  650  ? 16.037  -37.846  -17.846 1.00 119.34 ? 650  GLN A O     1 
ATOM   5010  C  CB    . GLN A 1  650  ? 16.100  -39.536  -15.474 1.00 84.70  ? 650  GLN A CB    1 
ATOM   5011  C  CG    . GLN A 1  650  ? 15.828  -40.761  -14.642 1.00 84.30  ? 650  GLN A CG    1 
ATOM   5012  C  CD    . GLN A 1  650  ? 15.156  -40.375  -13.355 1.00 83.27  ? 650  GLN A CD    1 
ATOM   5013  O  OE1   . GLN A 1  650  ? 14.998  -39.199  -13.081 1.00 82.90  ? 650  GLN A OE1   1 
ATOM   5014  N  NE2   . GLN A 1  650  ? 14.749  -41.352  -12.562 1.00 111.32 ? 650  GLN A NE2   1 
ATOM   5015  N  N     . LYS A 1  651  ? 18.266  -37.796  -17.548 1.00 86.80  ? 651  LYS A N     1 
ATOM   5016  C  CA    . LYS A 1  651  ? 18.404  -36.551  -18.287 1.00 92.41  ? 651  LYS A CA    1 
ATOM   5017  C  C     . LYS A 1  651  ? 18.998  -36.771  -19.668 1.00 101.57 ? 651  LYS A C     1 
ATOM   5018  O  O     . LYS A 1  651  ? 18.495  -36.202  -20.656 1.00 112.44 ? 651  LYS A O     1 
ATOM   5019  C  CB    . LYS A 1  651  ? 19.279  -35.546  -17.520 1.00 96.50  ? 651  LYS A CB    1 
ATOM   5020  C  CG    . LYS A 1  651  ? 18.556  -34.756  -16.426 1.00 96.28  ? 651  LYS A CG    1 
ATOM   5021  C  CD    . LYS A 1  651  ? 19.480  -33.837  -15.640 1.00 88.10  ? 651  LYS A CD    1 
ATOM   5022  C  CE    . LYS A 1  651  ? 19.144  -33.895  -14.159 1.00 98.04  ? 651  LYS A CE    1 
ATOM   5023  N  NZ    . LYS A 1  651  ? 17.726  -33.562  -13.889 1.00 110.84 ? 651  LYS A NZ    1 
ATOM   5024  N  N     . VAL A 1  652  ? 19.974  -37.675  -19.781 1.00 114.95 ? 652  VAL A N     1 
ATOM   5025  C  CA    . VAL A 1  652  ? 20.525  -37.938  -21.108 1.00 105.44 ? 652  VAL A CA    1 
ATOM   5026  C  C     . VAL A 1  652  ? 19.578  -38.808  -21.915 1.00 106.27 ? 652  VAL A C     1 
ATOM   5027  O  O     . VAL A 1  652  ? 19.291  -38.521  -23.083 1.00 95.74  ? 652  VAL A O     1 
ATOM   5028  C  CB    . VAL A 1  652  ? 21.915  -38.584  -21.006 1.00 91.22  ? 652  VAL A CB    1 
ATOM   5029  C  CG1   . VAL A 1  652  ? 22.593  -38.560  -22.359 1.00 92.60  ? 652  VAL A CG1   1 
ATOM   5030  C  CG2   . VAL A 1  652  ? 22.760  -37.881  -19.984 1.00 91.03  ? 652  VAL A CG2   1 
ATOM   5031  N  N     . VAL A 1  653  ? 19.045  -39.861  -21.300 1.00 108.51 ? 653  VAL A N     1 
ATOM   5032  C  CA    . VAL A 1  653  ? 18.144  -40.740  -22.029 1.00 103.26 ? 653  VAL A CA    1 
ATOM   5033  C  C     . VAL A 1  653  ? 16.856  -40.000  -22.357 1.00 106.44 ? 653  VAL A C     1 
ATOM   5034  O  O     . VAL A 1  653  ? 16.343  -40.084  -23.477 1.00 94.31  ? 653  VAL A O     1 
ATOM   5035  C  CB    . VAL A 1  653  ? 17.868  -42.029  -21.233 1.00 92.29  ? 653  VAL A CB    1 
ATOM   5036  C  CG1   . VAL A 1  653  ? 16.976  -42.966  -22.038 1.00 90.93  ? 653  VAL A CG1   1 
ATOM   5037  C  CG2   . VAL A 1  653  ? 19.160  -42.723  -20.828 1.00 90.09  ? 653  VAL A CG2   1 
ATOM   5038  N  N     . ASN A 1  654  ? 16.325  -39.239  -21.400 1.00 105.13 ? 654  ASN A N     1 
ATOM   5039  C  CA    . ASN A 1  654  ? 15.076  -38.535  -21.666 1.00 105.21 ? 654  ASN A CA    1 
ATOM   5040  C  C     . ASN A 1  654  ? 15.252  -37.484  -22.754 1.00 88.79  ? 654  ASN A C     1 
ATOM   5041  O  O     . ASN A 1  654  ? 14.357  -37.291  -23.584 1.00 104.46 ? 654  ASN A O     1 
ATOM   5042  C  CB    . ASN A 1  654  ? 14.551  -37.878  -20.391 1.00 96.73  ? 654  ASN A CB    1 
ATOM   5043  C  CG    . ASN A 1  654  ? 13.704  -38.807  -19.565 1.00 106.28 ? 654  ASN A CG    1 
ATOM   5044  O  OD1   . ASN A 1  654  ? 13.014  -39.671  -20.099 1.00 100.10 ? 654  ASN A OD1   1 
ATOM   5045  N  ND2   . ASN A 1  654  ? 13.753  -38.638  -18.248 1.00 117.81 ? 654  ASN A ND2   1 
ATOM   5046  N  N     . PHE A 1  655  ? 16.397  -36.798  -22.775 1.00 97.33  ? 655  PHE A N     1 
ATOM   5047  C  CA    . PHE A 1  655  ? 16.626  -35.801  -23.820 1.00 95.95  ? 655  PHE A CA    1 
ATOM   5048  C  C     . PHE A 1  655  ? 16.748  -36.453  -25.195 1.00 93.59  ? 655  PHE A C     1 
ATOM   5049  O  O     . PHE A 1  655  ? 16.102  -36.028  -26.178 1.00 105.48 ? 655  PHE A O     1 
ATOM   5050  C  CB    . PHE A 1  655  ? 17.887  -35.002  -23.489 1.00 98.10  ? 655  PHE A CB    1 
ATOM   5051  C  CG    . PHE A 1  655  ? 18.303  -34.051  -24.569 1.00 91.57  ? 655  PHE A CG    1 
ATOM   5052  C  CD1   . PHE A 1  655  ? 17.871  -32.744  -24.543 1.00 91.39  ? 655  PHE A CD1   1 
ATOM   5053  C  CD2   . PHE A 1  655  ? 19.126  -34.450  -25.601 1.00 100.27 ? 655  PHE A CD2   1 
ATOM   5054  C  CE1   . PHE A 1  655  ? 18.241  -31.861  -25.528 1.00 105.00 ? 655  PHE A CE1   1 
ATOM   5055  C  CE2   . PHE A 1  655  ? 19.493  -33.562  -26.592 1.00 114.58 ? 655  PHE A CE2   1 
ATOM   5056  C  CZ    . PHE A 1  655  ? 19.051  -32.270  -26.551 1.00 109.63 ? 655  PHE A CZ    1 
ATOM   5057  N  N     . TRP A 1  656  ? 17.552  -37.520  -25.272 1.00 96.66  ? 656  TRP A N     1 
ATOM   5058  C  CA    . TRP A 1  656  ? 17.713  -38.224  -26.540 1.00 97.74  ? 656  TRP A CA    1 
ATOM   5059  C  C     . TRP A 1  656  ? 16.384  -38.773  -27.022 1.00 100.83 ? 656  TRP A C     1 
ATOM   5060  O  O     . TRP A 1  656  ? 16.073  -38.696  -28.211 1.00 108.19 ? 656  TRP A O     1 
ATOM   5061  C  CB    . TRP A 1  656  ? 18.746  -39.352  -26.415 1.00 105.64 ? 656  TRP A CB    1 
ATOM   5062  C  CG    . TRP A 1  656  ? 18.915  -40.135  -27.695 1.00 105.12 ? 656  TRP A CG    1 
ATOM   5063  C  CD1   . TRP A 1  656  ? 19.814  -39.897  -28.685 1.00 115.33 ? 656  TRP A CD1   1 
ATOM   5064  C  CD2   . TRP A 1  656  ? 18.145  -41.260  -28.125 1.00 111.97 ? 656  TRP A CD2   1 
ATOM   5065  N  NE1   . TRP A 1  656  ? 19.656  -40.798  -29.704 1.00 113.88 ? 656  TRP A NE1   1 
ATOM   5066  C  CE2   . TRP A 1  656  ? 18.636  -41.649  -29.382 1.00 111.23 ? 656  TRP A CE2   1 
ATOM   5067  C  CE3   . TRP A 1  656  ? 17.087  -41.975  -27.571 1.00 121.12 ? 656  TRP A CE3   1 
ATOM   5068  C  CZ2   . TRP A 1  656  ? 18.105  -42.720  -30.091 1.00 116.35 ? 656  TRP A CZ2   1 
ATOM   5069  C  CZ3   . TRP A 1  656  ? 16.564  -43.039  -28.281 1.00 130.58 ? 656  TRP A CZ3   1 
ATOM   5070  C  CH2   . TRP A 1  656  ? 17.072  -43.400  -29.524 1.00 120.77 ? 656  TRP A CH2   1 
ATOM   5071  N  N     . LEU A 1  657  ? 15.580  -39.321  -26.109 1.00 92.06  ? 657  LEU A N     1 
ATOM   5072  C  CA    . LEU A 1  657  ? 14.284  -39.858  -26.497 1.00 91.54  ? 657  LEU A CA    1 
ATOM   5073  C  C     . LEU A 1  657  ? 13.364  -38.736  -26.962 1.00 91.42  ? 657  LEU A C     1 
ATOM   5074  O  O     . LEU A 1  657  ? 12.606  -38.902  -27.921 1.00 113.51 ? 657  LEU A O     1 
ATOM   5075  C  CB    . LEU A 1  657  ? 13.673  -40.639  -25.336 1.00 90.48  ? 657  LEU A CB    1 
ATOM   5076  C  CG    . LEU A 1  657  ? 12.489  -41.517  -25.740 1.00 90.53  ? 657  LEU A CG    1 
ATOM   5077  C  CD1   . LEU A 1  657  ? 12.768  -42.210  -27.065 1.00 109.29 ? 657  LEU A CD1   1 
ATOM   5078  C  CD2   . LEU A 1  657  ? 12.147  -42.521  -24.658 1.00 89.76  ? 657  LEU A CD2   1 
ATOM   5079  N  N     . LEU A 1  658  ? 13.460  -37.568  -26.323 1.00 104.66 ? 658  LEU A N     1 
ATOM   5080  C  CA    . LEU A 1  658  ? 12.656  -36.422  -26.732 1.00 108.33 ? 658  LEU A CA    1 
ATOM   5081  C  C     . LEU A 1  658  ? 12.879  -36.098  -28.198 1.00 105.12 ? 658  LEU A C     1 
ATOM   5082  O  O     . LEU A 1  658  ? 11.940  -35.713  -28.907 1.00 92.37  ? 658  LEU A O     1 
ATOM   5083  C  CB    . LEU A 1  658  ? 12.980  -35.196  -25.870 1.00 105.55 ? 658  LEU A CB    1 
ATOM   5084  C  CG    . LEU A 1  658  ? 12.375  -33.865  -26.357 1.00 96.36  ? 658  LEU A CG    1 
ATOM   5085  C  CD1   . LEU A 1  658  ? 10.881  -33.828  -26.276 1.00 89.79  ? 658  LEU A CD1   1 
ATOM   5086  C  CD2   . LEU A 1  658  ? 12.948  -32.692  -25.590 1.00 118.26 ? 658  LEU A CD2   1 
ATOM   5087  N  N     . HIS A 1  659  ? 14.110  -36.276  -28.682 1.00 117.26 ? 659  HIS A N     1 
ATOM   5088  C  CA    . HIS A 1  659  ? 14.380  -35.919  -30.072 1.00 106.36 ? 659  HIS A CA    1 
ATOM   5089  C  C     . HIS A 1  659  ? 14.331  -37.103  -31.022 1.00 100.98 ? 659  HIS A C     1 
ATOM   5090  O  O     . HIS A 1  659  ? 14.105  -36.905  -32.220 1.00 125.12 ? 659  HIS A O     1 
ATOM   5091  C  CB    . HIS A 1  659  ? 15.734  -35.221  -30.193 1.00 114.50 ? 659  HIS A CB    1 
ATOM   5092  C  CG    . HIS A 1  659  ? 15.783  -33.926  -29.455 1.00 106.59 ? 659  HIS A CG    1 
ATOM   5093  N  ND1   . HIS A 1  659  ? 15.228  -32.769  -29.956 1.00 113.67 ? 659  HIS A ND1   1 
ATOM   5094  C  CD2   . HIS A 1  659  ? 16.256  -33.618  -28.225 1.00 109.30 ? 659  HIS A CD2   1 
ATOM   5095  C  CE1   . HIS A 1  659  ? 15.382  -31.796  -29.075 1.00 125.50 ? 659  HIS A CE1   1 
ATOM   5096  N  NE2   . HIS A 1  659  ? 16.004  -32.284  -28.017 1.00 113.84 ? 659  HIS A NE2   1 
ATOM   5097  N  N     . ASN A 1  660  ? 14.489  -38.321  -30.521 1.00 108.73 ? 660  ASN A N     1 
ATOM   5098  C  CA    . ASN A 1  660  ? 14.290  -39.496  -31.359 1.00 124.38 ? 660  ASN A CA    1 
ATOM   5099  C  C     . ASN A 1  660  ? 12.823  -39.847  -31.514 1.00 107.96 ? 660  ASN A C     1 
ATOM   5100  O  O     . ASN A 1  660  ? 12.421  -40.368  -32.560 1.00 106.38 ? 660  ASN A O     1 
ATOM   5101  C  CB    . ASN A 1  660  ? 15.016  -40.705  -30.775 1.00 112.26 ? 660  ASN A CB    1 
ATOM   5102  C  CG    . ASN A 1  660  ? 15.133  -41.823  -31.762 1.00 110.69 ? 660  ASN A CG    1 
ATOM   5103  O  OD1   . ASN A 1  660  ? 14.295  -42.721  -31.804 1.00 119.30 ? 660  ASN A OD1   1 
ATOM   5104  N  ND2   . ASN A 1  660  ? 16.159  -41.766  -32.589 1.00 127.62 ? 660  ASN A ND2   1 
ATOM   5105  N  N     . GLY A 1  661  ? 12.023  -39.565  -30.501 1.00 114.88 ? 661  GLY A N     1 
ATOM   5106  C  CA    . GLY A 1  661  ? 10.620  -39.896  -30.524 1.00 120.34 ? 661  GLY A CA    1 
ATOM   5107  C  C     . GLY A 1  661  ? 10.394  -41.381  -30.304 1.00 110.99 ? 661  GLY A C     1 
ATOM   5108  O  O     . GLY A 1  661  ? 11.309  -42.198  -30.370 1.00 102.96 ? 661  GLY A O     1 
ATOM   5109  N  N     . PHE A 1  662  ? 9.146   -41.721  -29.989 1.00 115.39 ? 662  PHE A N     1 
ATOM   5110  C  CA    . PHE A 1  662  ? 8.728   -43.105  -29.818 1.00 93.26  ? 662  PHE A CA    1 
ATOM   5111  C  C     . PHE A 1  662  ? 7.216   -43.145  -29.730 1.00 101.92 ? 662  PHE A C     1 
ATOM   5112  O  O     . PHE A 1  662  ? 6.617   -42.284  -29.084 1.00 121.67 ? 662  PHE A O     1 
ATOM   5113  C  CB    . PHE A 1  662  ? 9.331   -43.730  -28.557 1.00 92.45  ? 662  PHE A CB    1 
ATOM   5114  C  CG    . PHE A 1  662  ? 9.045   -45.196  -28.422 1.00 101.23 ? 662  PHE A CG    1 
ATOM   5115  C  CD1   . PHE A 1  662  ? 9.660   -46.115  -29.248 1.00 117.12 ? 662  PHE A CD1   1 
ATOM   5116  C  CD2   . PHE A 1  662  ? 8.148   -45.656  -27.481 1.00 103.57 ? 662  PHE A CD2   1 
ATOM   5117  C  CE1   . PHE A 1  662  ? 9.383   -47.466  -29.130 1.00 124.03 ? 662  PHE A CE1   1 
ATOM   5118  C  CE2   . PHE A 1  662  ? 7.873   -47.010  -27.360 1.00 101.25 ? 662  PHE A CE2   1 
ATOM   5119  C  CZ    . PHE A 1  662  ? 8.489   -47.910  -28.184 1.00 109.42 ? 662  PHE A CZ    1 
ATOM   5120  N  N     . SER A 1  663  ? 6.610   -44.167  -30.330 1.00 103.33 ? 663  SER A N     1 
ATOM   5121  C  CA    . SER A 1  663  ? 5.157   -44.263  -30.391 1.00 104.35 ? 663  SER A CA    1 
ATOM   5122  C  C     . SER A 1  663  ? 4.764   -45.730  -30.339 1.00 110.07 ? 663  SER A C     1 
ATOM   5123  O  O     . SER A 1  663  ? 5.617   -46.618  -30.298 1.00 134.29 ? 663  SER A O     1 
ATOM   5124  C  CB    . SER A 1  663  ? 4.613   -43.608  -31.666 1.00 105.75 ? 663  SER A CB    1 
ATOM   5125  O  OG    . SER A 1  663  ? 3.200   -43.689  -31.701 1.00 106.98 ? 663  SER A OG    1 
ATOM   5126  N  N     . THR A 1  664  ? 3.458   -45.985  -30.349 1.00 103.30 ? 664  THR A N     1 
ATOM   5127  C  CA    . THR A 1  664  ? 2.953   -47.321  -30.638 1.00 106.51 ? 664  THR A CA    1 
ATOM   5128  C  C     . THR A 1  664  ? 1.583   -47.184  -31.282 1.00 109.23 ? 664  THR A C     1 
ATOM   5129  O  O     . THR A 1  664  ? 0.717   -46.491  -30.746 1.00 98.63  ? 664  THR A O     1 
ATOM   5130  C  CB    . THR A 1  664  ? 2.877   -48.211  -29.391 1.00 103.34 ? 664  THR A CB    1 
ATOM   5131  O  OG1   . THR A 1  664  ? 2.196   -49.420  -29.725 1.00 113.70 ? 664  THR A OG1   1 
ATOM   5132  C  CG2   . THR A 1  664  ? 2.112   -47.553  -28.280 1.00 109.52 ? 664  THR A CG2   1 
ATOM   5133  N  N     . GLY A 1  665  ? 1.408   -47.801  -32.450 1.00 142.02 ? 665  GLY A N     1 
ATOM   5134  C  CA    . GLY A 1  665  ? 0.168   -47.743  -33.185 1.00 142.40 ? 665  GLY A CA    1 
ATOM   5135  C  C     . GLY A 1  665  ? -0.504  -49.104  -33.236 1.00 130.08 ? 665  GLY A C     1 
ATOM   5136  O  O     . GLY A 1  665  ? -0.036  -50.090  -32.672 1.00 128.90 ? 665  GLY A O     1 
ATOM   5137  N  N     . ILE A 1  666  ? -1.631  -49.137  -33.946 1.00 120.14 ? 666  ILE A N     1 
ATOM   5138  C  CA    . ILE A 1  666  ? -2.346  -50.392  -34.124 1.00 118.82 ? 666  ILE A CA    1 
ATOM   5139  C  C     . ILE A 1  666  ? -1.659  -51.293  -35.142 1.00 121.98 ? 666  ILE A C     1 
ATOM   5140  O  O     . ILE A 1  666  ? -1.796  -52.523  -35.070 1.00 119.16 ? 666  ILE A O     1 
ATOM   5141  C  CB    . ILE A 1  666  ? -3.812  -50.123  -34.509 1.00 114.13 ? 666  ILE A CB    1 
ATOM   5142  C  CG1   . ILE A 1  666  ? -4.672  -51.357  -34.203 1.00 120.93 ? 666  ILE A CG1   1 
ATOM   5143  C  CG2   . ILE A 1  666  ? -3.918  -49.658  -35.951 1.00 101.14 ? 666  ILE A CG2   1 
ATOM   5144  C  CD1   . ILE A 1  666  ? -6.093  -51.280  -34.705 1.00 119.81 ? 666  ILE A CD1   1 
ATOM   5145  N  N     . GLY A 1  667  ? -0.845  -50.725  -36.031 1.00 122.11 ? 667  GLY A N     1 
ATOM   5146  C  CA    . GLY A 1  667  ? -0.063  -51.558  -36.927 1.00 146.12 ? 667  GLY A CA    1 
ATOM   5147  C  C     . GLY A 1  667  ? 0.950   -52.421  -36.211 1.00 131.50 ? 667  GLY A C     1 
ATOM   5148  O  O     . GLY A 1  667  ? 1.435   -53.406  -36.783 1.00 120.73 ? 667  GLY A O     1 
ATOM   5149  N  N     . ASP A 1  668  ? 1.287   -52.064  -34.971 1.00 118.90 ? 668  ASP A N     1 
ATOM   5150  C  CA    . ASP A 1  668  ? 2.180   -52.848  -34.137 1.00 112.12 ? 668  ASP A CA    1 
ATOM   5151  C  C     . ASP A 1  668  ? 1.535   -54.149  -33.685 1.00 118.57 ? 668  ASP A C     1 
ATOM   5152  O  O     . ASP A 1  668  ? 2.210   -54.963  -33.048 1.00 124.22 ? 668  ASP A O     1 
ATOM   5153  C  CB    . ASP A 1  668  ? 2.611   -52.019  -32.924 1.00 103.72 ? 668  ASP A CB    1 
ATOM   5154  C  CG    . ASP A 1  668  ? 3.633   -50.945  -33.275 1.00 120.62 ? 668  ASP A CG    1 
ATOM   5155  O  OD1   . ASP A 1  668  ? 4.667   -51.283  -33.887 1.00 136.01 ? 668  ASP A OD1   1 
ATOM   5156  O  OD2   . ASP A 1  668  ? 3.404   -49.758  -32.956 1.00 118.02 ? 668  ASP A OD2   1 
ATOM   5157  N  N     . THR A 1  669  ? 0.244   -54.346  -33.973 1.00 127.14 ? 669  THR A N     1 
ATOM   5158  C  CA    . THR A 1  669  ? -0.461  -55.590  -33.689 1.00 119.90 ? 669  THR A CA    1 
ATOM   5159  C  C     . THR A 1  669  ? -0.761  -56.418  -34.939 1.00 127.19 ? 669  THR A C     1 
ATOM   5160  O  O     . THR A 1  669  ? -1.332  -57.506  -34.818 1.00 140.36 ? 669  THR A O     1 
ATOM   5161  C  CB    . THR A 1  669  ? -1.778  -55.280  -32.965 1.00 118.70 ? 669  THR A CB    1 
ATOM   5162  O  OG1   . THR A 1  669  ? -2.439  -54.198  -33.627 1.00 122.97 ? 669  THR A OG1   1 
ATOM   5163  C  CG2   . THR A 1  669  ? -1.522  -54.854  -31.528 1.00 99.10  ? 669  THR A CG2   1 
ATOM   5164  N  N     . ILE A 1  670  ? -0.411  -55.933  -36.132 1.00 134.06 ? 670  ILE A N     1 
ATOM   5165  C  CA    . ILE A 1  670  ? -0.684  -56.674  -37.362 1.00 137.52 ? 670  ILE A CA    1 
ATOM   5166  C  C     . ILE A 1  670  ? 0.153   -57.947  -37.424 1.00 137.99 ? 670  ILE A C     1 
ATOM   5167  O  O     . ILE A 1  670  ? 1.377   -57.925  -37.235 1.00 137.76 ? 670  ILE A O     1 
ATOM   5168  C  CB    . ILE A 1  670  ? -0.451  -55.777  -38.586 1.00 155.14 ? 670  ILE A CB    1 
ATOM   5169  C  CG1   . ILE A 1  670  ? -1.620  -54.794  -38.713 1.00 132.61 ? 670  ILE A CG1   1 
ATOM   5170  C  CG2   . ILE A 1  670  ? -0.272  -56.608  -39.869 1.00 164.35 ? 670  ILE A CG2   1 
ATOM   5171  C  CD1   . ILE A 1  670  ? -2.996  -55.424  -38.710 1.00 115.45 ? 670  ILE A CD1   1 
ATOM   5172  N  N     . ALA A 1  671  ? -0.512  -59.062  -37.703 1.00 143.41 ? 671  ALA A N     1 
ATOM   5173  C  CA    . ALA A 1  671  ? 0.051   -60.402  -37.794 1.00 133.60 ? 671  ALA A CA    1 
ATOM   5174  C  C     . ALA A 1  671  ? 0.708   -60.713  -39.137 1.00 157.77 ? 671  ALA A C     1 
ATOM   5175  O  O     . ALA A 1  671  ? 1.218   -61.825  -39.308 1.00 190.91 ? 671  ALA A O     1 
ATOM   5176  C  CB    . ALA A 1  671  ? -1.032  -61.429  -37.490 1.00 159.50 ? 671  ALA A CB    1 
ATOM   5177  N  N     . ASP A 1  672  ? 0.663   -59.799  -40.105 1.00 172.64 ? 672  ASP A N     1 
ATOM   5178  C  CA    . ASP A 1  672  ? 1.465   -59.923  -41.321 1.00 193.80 ? 672  ASP A CA    1 
ATOM   5179  C  C     . ASP A 1  672  ? 1.091   -61.113  -42.198 1.00 169.16 ? 672  ASP A C     1 
ATOM   5180  O  O     . ASP A 1  672  ? 1.917   -62.005  -42.424 1.00 151.58 ? 672  ASP A O     1 
ATOM   5181  C  CB    . ASP A 1  672  ? 2.956   -60.022  -40.969 1.00 222.72 ? 672  ASP A CB    1 
ATOM   5182  C  CG    . ASP A 1  672  ? 3.864   -60.032  -42.198 1.00 239.71 ? 672  ASP A CG    1 
ATOM   5183  O  OD1   . ASP A 1  672  ? 3.906   -59.027  -42.936 1.00 253.05 ? 672  ASP A OD1   1 
ATOM   5184  O  OD2   . ASP A 1  672  ? 4.530   -61.067  -42.428 1.00 234.51 ? 672  ASP A OD2   1 
ATOM   5185  N  N     . GLY A 1  673  ? -0.173  -61.197  -42.610 1.00 162.01 ? 673  GLY A N     1 
ATOM   5186  C  CA    . GLY A 1  673  ? -0.540  -62.094  -43.681 1.00 158.13 ? 673  GLY A CA    1 
ATOM   5187  C  C     . GLY A 1  673  ? -0.387  -63.535  -43.267 1.00 160.61 ? 673  GLY A C     1 
ATOM   5188  O  O     . GLY A 1  673  ? -1.010  -63.990  -42.317 1.00 167.78 ? 673  GLY A O     1 
ATOM   5189  N  N     . PRO A 1  674  ? 0.321   -64.307  -44.097 1.00 148.30 ? 674  PRO A N     1 
ATOM   5190  C  CA    . PRO A 1  674  ? 0.455   -65.762  -43.910 1.00 153.47 ? 674  PRO A CA    1 
ATOM   5191  C  C     . PRO A 1  674  ? 0.669   -66.297  -42.492 1.00 151.37 ? 674  PRO A C     1 
ATOM   5192  O  O     . PRO A 1  674  ? 0.258   -67.427  -42.200 1.00 174.98 ? 674  PRO A O     1 
ATOM   5193  C  CB    . PRO A 1  674  ? 1.674   -66.096  -44.783 1.00 159.39 ? 674  PRO A CB    1 
ATOM   5194  C  CG    . PRO A 1  674  ? 1.796   -64.952  -45.781 1.00 155.21 ? 674  PRO A CG    1 
ATOM   5195  C  CD    . PRO A 1  674  ? 0.831   -63.870  -45.406 1.00 146.91 ? 674  PRO A CD    1 
ATOM   5196  N  N     . THR A 1  675  ? 1.268   -65.499  -41.597 1.00 140.72 ? 675  THR A N     1 
ATOM   5197  C  CA    . THR A 1  675  ? 1.371   -65.893  -40.187 1.00 145.38 ? 675  THR A CA    1 
ATOM   5198  C  C     . THR A 1  675  ? 0.002   -66.111  -39.558 1.00 149.15 ? 675  THR A C     1 
ATOM   5199  O  O     . THR A 1  675  ? -0.169  -66.987  -38.707 1.00 166.43 ? 675  THR A O     1 
ATOM   5200  C  CB    . THR A 1  675  ? 2.157   -64.828  -39.418 1.00 139.51 ? 675  THR A CB    1 
ATOM   5201  O  OG1   . THR A 1  675  ? 3.438   -64.654  -40.034 1.00 164.04 ? 675  THR A OG1   1 
ATOM   5202  C  CG2   . THR A 1  675  ? 2.340   -65.195  -37.932 1.00 113.01 ? 675  THR A CG2   1 
ATOM   5203  N  N     . MET A 1  676  ? -0.976  -65.316  -39.965 1.00 135.81 ? 676  MET A N     1 
ATOM   5204  C  CA    . MET A 1  676  ? -2.364  -65.542  -39.593 1.00 156.47 ? 676  MET A CA    1 
ATOM   5205  C  C     . MET A 1  676  ? -2.845  -66.861  -40.186 1.00 162.99 ? 676  MET A C     1 
ATOM   5206  O  O     . MET A 1  676  ? -3.459  -67.688  -39.498 1.00 158.84 ? 676  MET A O     1 
ATOM   5207  C  CB    . MET A 1  676  ? -3.228  -64.383  -40.097 1.00 166.56 ? 676  MET A CB    1 
ATOM   5208  C  CG    . MET A 1  676  ? -3.404  -63.234  -39.105 1.00 145.84 ? 676  MET A CG    1 
ATOM   5209  S  SD    . MET A 1  676  ? -3.743  -63.786  -37.422 1.00 162.85 ? 676  MET A SD    1 
ATOM   5210  C  CE    . MET A 1  676  ? -4.532  -62.358  -36.682 1.00 168.58 ? 676  MET A CE    1 
ATOM   5211  N  N     . ARG A 1  677  ? -2.624  -67.036  -41.494 1.00 174.81 ? 677  ARG A N     1 
ATOM   5212  C  CA    . ARG A 1  677  ? -2.961  -68.286  -42.163 1.00 165.87 ? 677  ARG A CA    1 
ATOM   5213  C  C     . ARG A 1  677  ? -2.355  -69.471  -41.430 1.00 153.25 ? 677  ARG A C     1 
ATOM   5214  O  O     . ARG A 1  677  ? -3.027  -70.487  -41.221 1.00 164.77 ? 677  ARG A O     1 
ATOM   5215  C  CB    . ARG A 1  677  ? -2.468  -68.228  -43.615 1.00 166.41 ? 677  ARG A CB    1 
ATOM   5216  C  CG    . ARG A 1  677  ? -3.354  -68.927  -44.630 1.00 163.71 ? 677  ARG A CG    1 
ATOM   5217  C  CD    . ARG A 1  677  ? -2.581  -69.199  -45.909 1.00 179.42 ? 677  ARG A CD    1 
ATOM   5218  N  NE    . ARG A 1  677  ? -1.222  -69.658  -45.637 1.00 196.48 ? 677  ARG A NE    1 
ATOM   5219  C  CZ    . ARG A 1  677  ? -0.871  -70.934  -45.508 1.00 197.47 ? 677  ARG A CZ    1 
ATOM   5220  N  NH1   . ARG A 1  677  ? -1.781  -71.889  -45.626 1.00 193.01 ? 677  ARG A NH1   1 
ATOM   5221  N  NH2   . ARG A 1  677  ? 0.392   -71.257  -45.262 1.00 191.88 ? 677  ARG A NH2   1 
ATOM   5222  N  N     . GLU A 1  678  ? -1.089  -69.344  -41.009 1.00 141.61 ? 678  GLU A N     1 
ATOM   5223  C  CA    . GLU A 1  678  ? -0.421  -70.415  -40.280 1.00 154.89 ? 678  GLU A CA    1 
ATOM   5224  C  C     . GLU A 1  678  ? -0.877  -70.483  -38.827 1.00 138.86 ? 678  GLU A C     1 
ATOM   5225  O  O     . GLU A 1  678  ? -0.709  -71.528  -38.182 1.00 144.68 ? 678  GLU A O     1 
ATOM   5226  C  CB    . GLU A 1  678  ? 1.101   -70.235  -40.332 1.00 167.72 ? 678  GLU A CB    1 
ATOM   5227  C  CG    . GLU A 1  678  ? 1.902   -71.534  -40.117 1.00 186.32 ? 678  GLU A CG    1 
ATOM   5228  C  CD    . GLU A 1  678  ? 3.290   -71.288  -39.542 1.00 182.46 ? 678  GLU A CD    1 
ATOM   5229  O  OE1   . GLU A 1  678  ? 3.844   -72.219  -38.912 1.00 172.53 ? 678  GLU A OE1   1 
ATOM   5230  O  OE2   . GLU A 1  678  ? 3.811   -70.160  -39.680 1.00 177.76 ? 678  GLU A OE2   1 
ATOM   5231  N  N     . ILE A 1  679  ? -1.435  -69.400  -38.288 1.00 140.47 ? 679  ILE A N     1 
ATOM   5232  C  CA    . ILE A 1  679  ? -1.970  -69.431  -36.930 1.00 150.06 ? 679  ILE A CA    1 
ATOM   5233  C  C     . ILE A 1  679  ? -3.301  -70.169  -36.891 1.00 157.97 ? 679  ILE A C     1 
ATOM   5234  O  O     . ILE A 1  679  ? -3.505  -71.054  -36.053 1.00 166.24 ? 679  ILE A O     1 
ATOM   5235  C  CB    . ILE A 1  679  ? -2.101  -68.002  -36.349 1.00 130.96 ? 679  ILE A CB    1 
ATOM   5236  C  CG1   . ILE A 1  679  ? -0.781  -67.549  -35.715 1.00 126.96 ? 679  ILE A CG1   1 
ATOM   5237  C  CG2   . ILE A 1  679  ? -3.224  -67.918  -35.325 1.00 113.27 ? 679  ILE A CG2   1 
ATOM   5238  C  CD1   . ILE A 1  679  ? -0.710  -66.073  -35.444 1.00 130.30 ? 679  ILE A CD1   1 
ATOM   5239  N  N     . THR A 1  680  ? -4.229  -69.816  -37.790 1.00 152.58 ? 680  THR A N     1 
ATOM   5240  C  CA    . THR A 1  680  ? -5.517  -70.506  -37.812 1.00 153.31 ? 680  THR A CA    1 
ATOM   5241  C  C     . THR A 1  680  ? -5.364  -71.988  -38.140 1.00 162.87 ? 680  THR A C     1 
ATOM   5242  O  O     . THR A 1  680  ? -6.029  -72.823  -37.515 1.00 164.83 ? 680  THR A O     1 
ATOM   5243  C  CB    . THR A 1  680  ? -6.466  -69.830  -38.810 1.00 149.72 ? 680  THR A CB    1 
ATOM   5244  O  OG1   . THR A 1  680  ? -6.585  -68.433  -38.508 1.00 152.94 ? 680  THR A OG1   1 
ATOM   5245  C  CG2   . THR A 1  680  ? -7.852  -70.457  -38.739 1.00 144.05 ? 680  THR A CG2   1 
ATOM   5246  N  N     . GLU A 1  681  ? -4.393  -72.341  -38.991 1.00 162.25 ? 681  GLU A N     1 
ATOM   5247  C  CA    . GLU A 1  681  ? -4.073  -73.748  -39.212 1.00 165.28 ? 681  GLU A CA    1 
ATOM   5248  C  C     . GLU A 1  681  ? -3.701  -74.412  -37.899 1.00 168.32 ? 681  GLU A C     1 
ATOM   5249  O  O     . GLU A 1  681  ? -4.181  -75.511  -37.586 1.00 185.15 ? 681  GLU A O     1 
ATOM   5250  C  CB    . GLU A 1  681  ? -2.918  -73.874  -40.209 1.00 178.70 ? 681  GLU A CB    1 
ATOM   5251  C  CG    . GLU A 1  681  ? -3.287  -73.782  -41.679 1.00 186.05 ? 681  GLU A CG    1 
ATOM   5252  C  CD    . GLU A 1  681  ? -2.058  -73.783  -42.571 1.00 190.73 ? 681  GLU A CD    1 
ATOM   5253  O  OE1   . GLU A 1  681  ? -0.936  -73.980  -42.050 1.00 183.20 ? 681  GLU A OE1   1 
ATOM   5254  O  OE2   . GLU A 1  681  ? -2.214  -73.579  -43.792 1.00 194.58 ? 681  GLU A OE2   1 
ATOM   5255  N  N     . THR A 1  682  ? -2.941  -73.698  -37.068 1.00 152.27 ? 682  THR A N     1 
ATOM   5256  C  CA    . THR A 1  682  ? -2.522  -74.237  -35.782 1.00 153.02 ? 682  THR A CA    1 
ATOM   5257  C  C     . THR A 1  682  ? -3.727  -74.403  -34.870 1.00 145.32 ? 682  THR A C     1 
ATOM   5258  O  O     . THR A 1  682  ? -3.819  -75.387  -34.126 1.00 149.20 ? 682  THR A O     1 
ATOM   5259  C  CB    . THR A 1  682  ? -1.468  -73.321  -35.138 1.00 134.95 ? 682  THR A CB    1 
ATOM   5260  O  OG1   . THR A 1  682  ? -0.208  -73.492  -35.798 1.00 159.85 ? 682  THR A OG1   1 
ATOM   5261  C  CG2   . THR A 1  682  ? -1.288  -73.628  -33.652 1.00 117.21 ? 682  THR A CG2   1 
ATOM   5262  N  N     . ILE A 1  683  ? -4.647  -73.435  -34.883 1.00 142.66 ? 683  ILE A N     1 
ATOM   5263  C  CA    . ILE A 1  683  ? -5.838  -73.604  -34.064 1.00 139.91 ? 683  ILE A CA    1 
ATOM   5264  C  C     . ILE A 1  683  ? -6.729  -74.670  -34.681 1.00 152.30 ? 683  ILE A C     1 
ATOM   5265  O  O     . ILE A 1  683  ? -7.375  -75.445  -33.960 1.00 156.36 ? 683  ILE A O     1 
ATOM   5266  C  CB    . ILE A 1  683  ? -6.581  -72.259  -33.918 1.00 146.14 ? 683  ILE A CB    1 
ATOM   5267  C  CG1   . ILE A 1  683  ? -5.591  -71.099  -33.787 1.00 153.58 ? 683  ILE A CG1   1 
ATOM   5268  C  CG2   . ILE A 1  683  ? -7.483  -72.250  -32.686 1.00 119.64 ? 683  ILE A CG2   1 
ATOM   5269  C  CD1   . ILE A 1  683  ? -6.208  -69.724  -34.042 1.00 162.12 ? 683  ILE A CD1   1 
ATOM   5270  N  N     . ALA A 1  684  ? -6.655  -74.837  -36.007 1.00 169.83 ? 684  ALA A N     1 
ATOM   5271  C  CA    . ALA A 1  684  ? -7.501  -75.831  -36.654 1.00 168.35 ? 684  ALA A CA    1 
ATOM   5272  C  C     . ALA A 1  684  ? -7.100  -77.223  -36.204 1.00 176.19 ? 684  ALA A C     1 
ATOM   5273  O  O     . ALA A 1  684  ? -7.920  -77.969  -35.651 1.00 179.23 ? 684  ALA A O     1 
ATOM   5274  C  CB    . ALA A 1  684  ? -7.424  -75.688  -38.177 1.00 166.59 ? 684  ALA A CB    1 
ATOM   5275  N  N     . GLU A 1  685  ? -5.816  -77.555  -36.350 1.00 177.66 ? 685  GLU A N     1 
ATOM   5276  C  CA    . GLU A 1  685  ? -5.366  -78.870  -35.929 1.00 174.85 ? 685  GLU A CA    1 
ATOM   5277  C  C     . GLU A 1  685  ? -5.486  -79.051  -34.427 1.00 149.39 ? 685  GLU A C     1 
ATOM   5278  O  O     . GLU A 1  685  ? -5.395  -80.189  -33.956 1.00 170.66 ? 685  GLU A O     1 
ATOM   5279  C  CB    . GLU A 1  685  ? -3.917  -79.120  -36.365 1.00 185.61 ? 685  GLU A CB    1 
ATOM   5280  C  CG    . GLU A 1  685  ? -2.938  -78.027  -35.964 1.00 184.34 ? 685  GLU A CG    1 
ATOM   5281  C  CD    . GLU A 1  685  ? -1.523  -78.292  -36.454 1.00 197.45 ? 685  GLU A CD    1 
ATOM   5282  O  OE1   . GLU A 1  685  ? -1.301  -79.329  -37.117 1.00 205.80 ? 685  GLU A OE1   1 
ATOM   5283  O  OE2   . GLU A 1  685  ? -0.630  -77.467  -36.167 1.00 191.85 ? 685  GLU A OE2   1 
ATOM   5284  N  N     . ALA A 1  686  ? -5.686  -77.970  -33.662 1.00 132.74 ? 686  ALA A N     1 
ATOM   5285  C  CA    . ALA A 1  686  ? -5.959  -78.169  -32.244 1.00 136.10 ? 686  ALA A CA    1 
ATOM   5286  C  C     . ALA A 1  686  ? -7.438  -78.441  -32.001 1.00 147.46 ? 686  ALA A C     1 
ATOM   5287  O  O     . ALA A 1  686  ? -7.792  -79.365  -31.255 1.00 145.03 ? 686  ALA A O     1 
ATOM   5288  C  CB    . ALA A 1  686  ? -5.489  -76.954  -31.439 1.00 120.94 ? 686  ALA A CB    1 
ATOM   5289  N  N     . LYS A 1  687  ? -8.314  -77.720  -32.704 1.00 156.12 ? 687  LYS A N     1 
ATOM   5290  C  CA    . LYS A 1  687  ? -9.735  -78.025  -32.616 1.00 155.39 ? 687  LYS A CA    1 
ATOM   5291  C  C     . LYS A 1  687  ? -10.059 -79.396  -33.202 1.00 165.90 ? 687  LYS A C     1 
ATOM   5292  O  O     . LYS A 1  687  ? -11.134 -79.938  -32.925 1.00 181.84 ? 687  LYS A O     1 
ATOM   5293  C  CB    . LYS A 1  687  ? -10.551 -76.908  -33.284 1.00 123.24 ? 687  LYS A CB    1 
ATOM   5294  N  N     . LYS A 1  688  ? -9.140  -79.980  -33.974 1.00 155.02 ? 688  LYS A N     1 
ATOM   5295  C  CA    . LYS A 1  688  ? -9.300  -81.342  -34.465 1.00 154.45 ? 688  LYS A CA    1 
ATOM   5296  C  C     . LYS A 1  688  ? -8.805  -82.383  -33.471 1.00 155.63 ? 688  LYS A C     1 
ATOM   5297  O  O     . LYS A 1  688  ? -9.291  -83.520  -33.494 1.00 169.79 ? 688  LYS A O     1 
ATOM   5298  C  CB    . LYS A 1  688  ? -8.574  -81.524  -35.804 1.00 152.19 ? 688  LYS A CB    1 
ATOM   5299  N  N     . LYS A 1  689  ? -7.835  -82.038  -32.611 1.00 153.56 ? 689  LYS A N     1 
ATOM   5300  C  CA    . LYS A 1  689  ? -7.386  -83.017  -31.621 1.00 145.54 ? 689  LYS A CA    1 
ATOM   5301  C  C     . LYS A 1  689  ? -8.411  -83.214  -30.510 1.00 152.97 ? 689  LYS A C     1 
ATOM   5302  O  O     . LYS A 1  689  ? -8.663  -84.354  -30.097 1.00 169.14 ? 689  LYS A O     1 
ATOM   5303  C  CB    . LYS A 1  689  ? -6.034  -82.600  -31.031 1.00 126.91 ? 689  LYS A CB    1 
ATOM   5304  N  N     . VAL A 1  690  ? -9.127  -82.154  -30.133 1.00 149.21 ? 690  VAL A N     1 
ATOM   5305  C  CA    . VAL A 1  690  ? -10.110 -82.284  -29.064 1.00 148.08 ? 690  VAL A CA    1 
ATOM   5306  C  C     . VAL A 1  690  ? -11.331 -83.045  -29.554 1.00 157.43 ? 690  VAL A C     1 
ATOM   5307  O  O     . VAL A 1  690  ? -11.806 -83.972  -28.879 1.00 169.39 ? 690  VAL A O     1 
ATOM   5308  C  CB    . VAL A 1  690  ? -10.492 -80.889  -28.527 1.00 136.19 ? 690  VAL A CB    1 
ATOM   5309  C  CG1   . VAL A 1  690  ? -9.362  -80.294  -27.695 1.00 121.91 ? 690  VAL A CG1   1 
ATOM   5310  C  CG2   . VAL A 1  690  ? -10.827 -79.943  -29.670 1.00 149.01 ? 690  VAL A CG2   1 
ATOM   5311  N  N     . LEU A 1  691  ? -11.728 -82.811  -30.808 1.00 155.24 ? 691  LEU A N     1 
ATOM   5312  C  CA    . LEU A 1  691  ? -12.817 -83.590  -31.381 1.00 160.30 ? 691  LEU A CA    1 
ATOM   5313  C  C     . LEU A 1  691  ? -12.436 -85.055  -31.468 1.00 159.49 ? 691  LEU A C     1 
ATOM   5314  O  O     . LEU A 1  691  ? -13.320 -85.920  -31.482 1.00 169.68 ? 691  LEU A O     1 
ATOM   5315  C  CB    . LEU A 1  691  ? -13.199 -83.048  -32.763 1.00 152.90 ? 691  LEU A CB    1 
ATOM   5316  C  CG    . LEU A 1  691  ? -14.388 -83.706  -33.478 1.00 148.01 ? 691  LEU A CG    1 
ATOM   5317  C  CD1   . LEU A 1  691  ? -15.558 -83.905  -32.521 1.00 142.63 ? 691  LEU A CD1   1 
ATOM   5318  C  CD2   . LEU A 1  691  ? -14.831 -82.918  -34.711 1.00 138.99 ? 691  LEU A CD2   1 
ATOM   5319  N  N     . ASP A 1  692  ? -11.138 -85.352  -31.517 1.00 155.28 ? 692  ASP A N     1 
ATOM   5320  C  CA    . ASP A 1  692  ? -10.727 -86.746  -31.537 1.00 156.12 ? 692  ASP A CA    1 
ATOM   5321  C  C     . ASP A 1  692  ? -10.905 -87.362  -30.152 1.00 163.15 ? 692  ASP A C     1 
ATOM   5322  O  O     . ASP A 1  692  ? -11.656 -88.337  -29.981 1.00 176.16 ? 692  ASP A O     1 
ATOM   5323  C  CB    . ASP A 1  692  ? -9.271  -86.855  -32.006 1.00 144.14 ? 692  ASP A CB    1 
ATOM   5324  C  CG    . ASP A 1  692  ? -9.120  -86.685  -33.517 1.00 153.74 ? 692  ASP A CG    1 
ATOM   5325  O  OD1   . ASP A 1  692  ? -10.145 -86.663  -34.232 1.00 163.36 ? 692  ASP A OD1   1 
ATOM   5326  O  OD2   . ASP A 1  692  ? -7.970  -86.570  -33.994 1.00 158.12 ? 692  ASP A OD2   1 
ATOM   5327  N  N     . VAL A 1  693  ? -10.352 -86.693  -29.130 1.00 152.67 ? 693  VAL A N     1 
ATOM   5328  C  CA    . VAL A 1  693  ? -10.453 -87.168  -27.752 1.00 160.41 ? 693  VAL A CA    1 
ATOM   5329  C  C     . VAL A 1  693  ? -11.888 -87.162  -27.265 1.00 171.76 ? 693  VAL A C     1 
ATOM   5330  O  O     . VAL A 1  693  ? -12.211 -87.821  -26.270 1.00 168.87 ? 693  VAL A O     1 
ATOM   5331  C  CB    . VAL A 1  693  ? -9.540  -86.337  -26.826 1.00 155.27 ? 693  VAL A CB    1 
ATOM   5332  C  CG1   . VAL A 1  693  ? -9.290  -87.074  -25.518 1.00 147.83 ? 693  VAL A CG1   1 
ATOM   5333  C  CG2   . VAL A 1  693  ? -8.218  -86.033  -27.514 1.00 167.96 ? 693  VAL A CG2   1 
ATOM   5334  N  N     . THR A 1  694  ? -12.762 -86.419  -27.936 1.00 170.22 ? 694  THR A N     1 
ATOM   5335  C  CA    . THR A 1  694  ? -14.167 -86.453  -27.571 1.00 153.34 ? 694  THR A CA    1 
ATOM   5336  C  C     . THR A 1  694  ? -14.800 -87.758  -28.040 1.00 164.68 ? 694  THR A C     1 
ATOM   5337  O  O     . THR A 1  694  ? -15.318 -88.537  -27.224 1.00 166.08 ? 694  THR A O     1 
ATOM   5338  C  CB    . THR A 1  694  ? -14.892 -85.246  -28.166 1.00 136.32 ? 694  THR A CB    1 
ATOM   5339  O  OG1   . THR A 1  694  ? -14.596 -84.072  -27.395 1.00 140.29 ? 694  THR A OG1   1 
ATOM   5340  C  CG2   . THR A 1  694  ? -16.389 -85.475  -28.205 1.00 133.09 ? 694  THR A CG2   1 
ATOM   5341  N  N     . LYS A 1  695  ? -14.650 -88.075  -29.335 1.00 165.75 ? 695  LYS A N     1 
ATOM   5342  C  CA    . LYS A 1  695  ? -15.157 -89.348  -29.842 1.00 159.35 ? 695  LYS A CA    1 
ATOM   5343  C  C     . LYS A 1  695  ? -14.546 -90.523  -29.099 1.00 166.53 ? 695  LYS A C     1 
ATOM   5344  O  O     . LYS A 1  695  ? -15.168 -91.584  -28.994 1.00 175.88 ? 695  LYS A O     1 
ATOM   5345  C  CB    . LYS A 1  695  ? -14.929 -89.441  -31.355 1.00 158.89 ? 695  LYS A CB    1 
ATOM   5346  C  CG    . LYS A 1  695  ? -15.501 -88.258  -32.140 1.00 157.63 ? 695  LYS A CG    1 
ATOM   5347  C  CD    . LYS A 1  695  ? -17.015 -88.140  -31.920 1.00 171.30 ? 695  LYS A CD    1 
ATOM   5348  C  CE    . LYS A 1  695  ? -17.799 -88.114  -33.227 1.00 184.49 ? 695  LYS A CE    1 
ATOM   5349  N  NZ    . LYS A 1  695  ? -18.212 -89.474  -33.657 1.00 195.29 ? 695  LYS A NZ    1 
ATOM   5350  N  N     . GLU A 1  696  ? -13.338 -90.341  -28.575 1.00 159.28 ? 696  GLU A N     1 
ATOM   5351  C  CA    . GLU A 1  696  ? -12.707 -91.307  -27.695 1.00 167.80 ? 696  GLU A CA    1 
ATOM   5352  C  C     . GLU A 1  696  ? -13.556 -91.454  -26.438 1.00 160.82 ? 696  GLU A C     1 
ATOM   5353  O  O     . GLU A 1  696  ? -14.118 -92.521  -26.185 1.00 157.65 ? 696  GLU A O     1 
ATOM   5354  C  CB    . GLU A 1  696  ? -11.289 -90.882  -27.328 1.00 177.00 ? 696  GLU A CB    1 
ATOM   5355  C  CG    . GLU A 1  696  ? -10.221 -91.388  -28.274 1.00 185.19 ? 696  GLU A CG    1 
ATOM   5356  C  CD    . GLU A 1  696  ? -8.938  -91.694  -27.549 1.00 197.50 ? 696  GLU A CD    1 
ATOM   5357  O  OE1   . GLU A 1  696  ? -8.734  -92.879  -27.202 1.00 213.09 ? 696  GLU A OE1   1 
ATOM   5358  O  OE2   . GLU A 1  696  ? -8.165  -90.754  -27.269 1.00 186.06 ? 696  GLU A OE2   1 
ATOM   5359  N  N     . ALA A 1  697  ? -13.565 -90.417  -25.597 1.00 166.25 ? 697  ALA A N     1 
ATOM   5360  C  CA    . ALA A 1  697  ? -14.257 -90.500  -24.318 1.00 160.44 ? 697  ALA A CA    1 
ATOM   5361  C  C     . ALA A 1  697  ? -15.759 -90.743  -24.450 1.00 157.59 ? 697  ALA A C     1 
ATOM   5362  O  O     . ALA A 1  697  ? -16.385 -91.187  -23.478 1.00 156.46 ? 697  ALA A O     1 
ATOM   5363  C  CB    . ALA A 1  697  ? -13.996 -89.229  -23.508 1.00 154.82 ? 697  ALA A CB    1 
ATOM   5364  N  N     . GLN A 1  698  ? -16.345 -90.493  -25.626 1.00 154.40 ? 698  GLN A N     1 
ATOM   5365  C  CA    . GLN A 1  698  ? -17.741 -90.840  -25.881 1.00 163.90 ? 698  GLN A CA    1 
ATOM   5366  C  C     . GLN A 1  698  ? -17.962 -92.312  -26.206 1.00 173.39 ? 698  GLN A C     1 
ATOM   5367  O  O     . GLN A 1  698  ? -19.095 -92.790  -26.079 1.00 177.48 ? 698  GLN A O     1 
ATOM   5368  C  CB    . GLN A 1  698  ? -18.288 -89.972  -27.020 1.00 169.22 ? 698  GLN A CB    1 
ATOM   5369  C  CG    . GLN A 1  698  ? -18.582 -88.526  -26.610 1.00 149.14 ? 698  GLN A CG    1 
ATOM   5370  C  CD    . GLN A 1  698  ? -18.975 -87.654  -27.780 1.00 143.01 ? 698  GLN A CD    1 
ATOM   5371  O  OE1   . GLN A 1  698  ? -18.961 -88.088  -28.933 1.00 159.61 ? 698  GLN A OE1   1 
ATOM   5372  N  NE2   . GLN A 1  698  ? -19.350 -86.422  -27.489 1.00 135.80 ? 698  GLN A NE2   1 
ATOM   5373  N  N     . ALA A 1  699  ? -16.920 -93.036  -26.614 1.00 181.89 ? 699  ALA A N     1 
ATOM   5374  C  CA    . ALA A 1  699  ? -16.992 -94.468  -26.873 1.00 172.44 ? 699  ALA A CA    1 
ATOM   5375  C  C     . ALA A 1  699  ? -16.382 -95.304  -25.751 1.00 179.94 ? 699  ALA A C     1 
ATOM   5376  O  O     . ALA A 1  699  ? -16.054 -96.474  -25.974 1.00 201.82 ? 699  ALA A O     1 
ATOM   5377  C  CB    . ALA A 1  699  ? -16.321 -94.801  -28.205 1.00 156.30 ? 699  ALA A CB    1 
ATOM   5378  N  N     . ASN A 1  700  ? -16.211 -94.725  -24.559 1.00 176.04 ? 700  ASN A N     1 
ATOM   5379  C  CA    . ASN A 1  700  ? -15.697 -95.445  -23.389 1.00 177.89 ? 700  ASN A CA    1 
ATOM   5380  C  C     . ASN A 1  700  ? -14.318 -96.054  -23.647 1.00 175.70 ? 700  ASN A C     1 
ATOM   5381  O  O     . ASN A 1  700  ? -13.950 -97.064  -23.042 1.00 175.89 ? 700  ASN A O     1 
ATOM   5382  C  CB    . ASN A 1  700  ? -16.681 -96.530  -22.936 1.00 182.41 ? 700  ASN A CB    1 
ATOM   5383  C  CG    . ASN A 1  700  ? -16.781 -96.646  -21.418 1.00 181.68 ? 700  ASN A CG    1 
ATOM   5384  O  OD1   . ASN A 1  700  ? -15.916 -96.169  -20.681 1.00 176.34 ? 700  ASN A OD1   1 
ATOM   5385  N  ND2   . ASN A 1  700  ? -17.835 -97.306  -20.948 1.00 182.90 ? 700  ASN A ND2   1 
ATOM   5386  N  N     . LEU A 1  701  ? -13.533 -95.440  -24.530 1.00 169.05 ? 701  LEU A N     1 
ATOM   5387  C  CA    . LEU A 1  701  ? -12.246 -95.999  -24.918 1.00 167.13 ? 701  LEU A CA    1 
ATOM   5388  C  C     . LEU A 1  701  ? -11.082 -95.410  -24.141 1.00 178.26 ? 701  LEU A C     1 
ATOM   5389  O  O     . LEU A 1  701  ? -10.080 -96.099  -23.928 1.00 187.63 ? 701  LEU A O     1 
ATOM   5390  C  CB    . LEU A 1  701  ? -12.018 -95.766  -26.413 1.00 155.18 ? 701  LEU A CB    1 
ATOM   5391  C  CG    . LEU A 1  701  ? -12.898 -96.682  -27.261 1.00 154.46 ? 701  LEU A CG    1 
ATOM   5392  C  CD1   . LEU A 1  701  ? -12.748 -96.389  -28.743 1.00 162.55 ? 701  LEU A CD1   1 
ATOM   5393  C  CD2   . LEU A 1  701  ? -12.565 -98.133  -26.957 1.00 155.79 ? 701  LEU A CD2   1 
ATOM   5394  N  N     . LEU A 1  702  ? -11.194 -94.160  -23.709 1.00 184.72 ? 702  LEU A N     1 
ATOM   5395  C  CA    . LEU A 1  702  ? -10.169 -93.554  -22.874 1.00 187.02 ? 702  LEU A CA    1 
ATOM   5396  C  C     . LEU A 1  702  ? -10.147 -94.193  -21.489 1.00 186.60 ? 702  LEU A C     1 
ATOM   5397  O  O     . LEU A 1  702  ? -11.160 -94.696  -20.995 1.00 191.53 ? 702  LEU A O     1 
ATOM   5398  C  CB    . LEU A 1  702  ? -10.399 -92.050  -22.761 1.00 184.36 ? 702  LEU A CB    1 
ATOM   5399  C  CG    . LEU A 1  702  ? -9.371  -91.249  -23.558 1.00 183.39 ? 702  LEU A CG    1 
ATOM   5400  C  CD1   . LEU A 1  702  ? -9.281  -89.820  -23.055 1.00 185.58 ? 702  LEU A CD1   1 
ATOM   5401  C  CD2   . LEU A 1  702  ? -8.000  -91.933  -23.522 1.00 178.31 ? 702  LEU A CD2   1 
ATOM   5402  N  N     . THR A 1  703  ? -8.979  -94.148  -20.853 1.00 181.48 ? 703  THR A N     1 
ATOM   5403  C  CA    . THR A 1  703  ? -8.799  -94.683  -19.514 1.00 188.50 ? 703  THR A CA    1 
ATOM   5404  C  C     . THR A 1  703  ? -8.257  -93.593  -18.602 1.00 197.10 ? 703  THR A C     1 
ATOM   5405  O  O     . THR A 1  703  ? -7.360  -92.835  -18.984 1.00 197.04 ? 703  THR A O     1 
ATOM   5406  C  CB    . THR A 1  703  ? -7.840  -95.884  -19.526 1.00 179.16 ? 703  THR A CB    1 
ATOM   5407  O  OG1   . THR A 1  703  ? -8.421  -96.956  -20.281 1.00 186.26 ? 703  THR A OG1   1 
ATOM   5408  C  CG2   . THR A 1  703  ? -7.539  -96.365  -18.114 1.00 172.46 ? 703  THR A CG2   1 
ATOM   5409  N  N     . ALA A 1  704  ? -8.812  -93.523  -17.396 1.00 206.69 ? 704  ALA A N     1 
ATOM   5410  C  CA    . ALA A 1  704  ? -8.417  -92.500  -16.443 1.00 211.98 ? 704  ALA A CA    1 
ATOM   5411  C  C     . ALA A 1  704  ? -7.052  -92.809  -15.839 1.00 220.26 ? 704  ALA A C     1 
ATOM   5412  O  O     . ALA A 1  704  ? -6.704  -93.971  -15.610 1.00 226.09 ? 704  ALA A O     1 
ATOM   5413  C  CB    . ALA A 1  704  ? -9.462  -92.388  -15.337 1.00 214.65 ? 704  ALA A CB    1 
ATOM   5414  N  N     . LYS A 1  705  ? -6.274  -91.759  -15.585 1.00 220.69 ? 705  LYS A N     1 
ATOM   5415  C  CA    . LYS A 1  705  ? -5.130  -91.889  -14.701 1.00 216.08 ? 705  LYS A CA    1 
ATOM   5416  C  C     . LYS A 1  705  ? -5.614  -92.055  -13.262 1.00 215.33 ? 705  LYS A C     1 
ATOM   5417  O  O     . LYS A 1  705  ? -6.735  -91.674  -12.914 1.00 224.04 ? 705  LYS A O     1 
ATOM   5418  C  CB    . LYS A 1  705  ? -4.202  -90.678  -14.835 1.00 204.28 ? 705  LYS A CB    1 
ATOM   5419  C  CG    . LYS A 1  705  ? -3.612  -90.495  -16.229 1.00 198.84 ? 705  LYS A CG    1 
ATOM   5420  C  CD    . LYS A 1  705  ? -4.533  -89.750  -17.180 1.00 191.65 ? 705  LYS A CD    1 
ATOM   5421  C  CE    . LYS A 1  705  ? -3.748  -89.141  -18.325 1.00 183.75 ? 705  LYS A CE    1 
ATOM   5422  N  NZ    . LYS A 1  705  ? -4.450  -87.990  -18.955 1.00 177.49 ? 705  LYS A NZ    1 
ATOM   5423  N  N     . HIS A 1  706  ? -4.766  -92.660  -12.431 1.00 206.18 ? 706  HIS A N     1 
ATOM   5424  C  CA    . HIS A 1  706  ? -5.193  -93.050  -11.092 1.00 196.55 ? 706  HIS A CA    1 
ATOM   5425  C  C     . HIS A 1  706  ? -5.634  -91.849  -10.264 1.00 200.37 ? 706  HIS A C     1 
ATOM   5426  O  O     . HIS A 1  706  ? -5.038  -90.769  -10.327 1.00 210.88 ? 706  HIS A O     1 
ATOM   5427  C  CB    . HIS A 1  706  ? -4.068  -93.787  -10.367 1.00 187.41 ? 706  HIS A CB    1 
ATOM   5428  C  CG    . HIS A 1  706  ? -4.478  -94.356  -9.044  1.00 189.60 ? 706  HIS A CG    1 
ATOM   5429  N  ND1   . HIS A 1  706  ? -4.678  -95.706  -8.839  1.00 197.01 ? 706  HIS A ND1   1 
ATOM   5430  C  CD2   . HIS A 1  706  ? -4.731  -93.755  -7.857  1.00 184.86 ? 706  HIS A CD2   1 
ATOM   5431  C  CE1   . HIS A 1  706  ? -5.031  -95.912  -7.583  1.00 199.52 ? 706  HIS A CE1   1 
ATOM   5432  N  NE2   . HIS A 1  706  ? -5.071  -94.744  -6.966  1.00 197.91 ? 706  HIS A NE2   1 
ATOM   5433  N  N     . GLY A 1  707  ? -6.706  -92.045  -9.503  1.00 192.04 ? 707  GLY A N     1 
ATOM   5434  C  CA    . GLY A 1  707  ? -7.246  -91.022  -8.625  1.00 194.74 ? 707  GLY A CA    1 
ATOM   5435  C  C     . GLY A 1  707  ? -7.802  -89.817  -9.351  1.00 185.11 ? 707  GLY A C     1 
ATOM   5436  O  O     . GLY A 1  707  ? -7.664  -88.688  -8.864  1.00 163.97 ? 707  GLY A O     1 
ATOM   5437  N  N     . MET A 1  708  ? -8.435  -90.026  -10.499 1.00 192.54 ? 708  MET A N     1 
ATOM   5438  C  CA    . MET A 1  708  ? -8.943  -88.919  -11.295 1.00 181.16 ? 708  MET A CA    1 
ATOM   5439  C  C     . MET A 1  708  ? -10.091 -89.445  -12.145 1.00 187.18 ? 708  MET A C     1 
ATOM   5440  O  O     . MET A 1  708  ? -9.999  -90.549  -12.690 1.00 202.87 ? 708  MET A O     1 
ATOM   5441  C  CB    . MET A 1  708  ? -7.834  -88.314  -12.170 1.00 179.27 ? 708  MET A CB    1 
ATOM   5442  C  CG    . MET A 1  708  ? -8.162  -86.955  -12.772 1.00 188.33 ? 708  MET A CG    1 
ATOM   5443  S  SD    . MET A 1  708  ? -6.691  -85.977  -13.152 1.00 186.56 ? 708  MET A SD    1 
ATOM   5444  C  CE    . MET A 1  708  ? -5.808  -87.123  -14.212 1.00 178.64 ? 708  MET A CE    1 
ATOM   5445  N  N     . THR A 1  709  ? -11.166 -88.663  -12.250 1.00 176.18 ? 709  THR A N     1 
ATOM   5446  C  CA    . THR A 1  709  ? -12.327 -89.112  -13.005 1.00 149.15 ? 709  THR A CA    1 
ATOM   5447  C  C     . THR A 1  709  ? -11.956 -89.266  -14.474 1.00 144.47 ? 709  THR A C     1 
ATOM   5448  O  O     . THR A 1  709  ? -11.040 -88.613  -14.980 1.00 150.23 ? 709  THR A O     1 
ATOM   5449  C  CB    . THR A 1  709  ? -13.490 -88.119  -12.873 1.00 157.91 ? 709  THR A CB    1 
ATOM   5450  O  OG1   . THR A 1  709  ? -13.660 -87.749  -11.503 1.00 165.80 ? 709  THR A OG1   1 
ATOM   5451  C  CG2   . THR A 1  709  ? -14.785 -88.739  -13.370 1.00 167.25 ? 709  THR A CG2   1 
ATOM   5452  N  N     . LEU A 1  710  ? -12.660 -90.171  -15.153 1.00 146.20 ? 710  LEU A N     1 
ATOM   5453  C  CA    . LEU A 1  710  ? -12.600 -90.225  -16.610 1.00 155.01 ? 710  LEU A CA    1 
ATOM   5454  C  C     . LEU A 1  710  ? -12.896 -88.852  -17.205 1.00 153.63 ? 710  LEU A C     1 
ATOM   5455  O  O     . LEU A 1  710  ? -12.214 -88.390  -18.134 1.00 142.44 ? 710  LEU A O     1 
ATOM   5456  C  CB    . LEU A 1  710  ? -13.577 -91.279  -17.136 1.00 153.59 ? 710  LEU A CB    1 
ATOM   5457  C  CG    . LEU A 1  710  ? -13.188 -91.995  -18.432 1.00 166.17 ? 710  LEU A CG    1 
ATOM   5458  C  CD1   . LEU A 1  710  ? -11.673 -92.203  -18.540 1.00 167.12 ? 710  LEU A CD1   1 
ATOM   5459  C  CD2   . LEU A 1  710  ? -13.929 -93.320  -18.540 1.00 164.71 ? 710  LEU A CD2   1 
ATOM   5460  N  N     . ARG A 1  711  ? -13.868 -88.154  -16.617 1.00 154.36 ? 711  ARG A N     1 
ATOM   5461  C  CA    . ARG A 1  711  ? -14.200 -86.809  -17.055 1.00 140.00 ? 711  ARG A CA    1 
ATOM   5462  C  C     . ARG A 1  711  ? -13.115 -85.826  -16.652 1.00 133.52 ? 711  ARG A C     1 
ATOM   5463  O  O     . ARG A 1  711  ? -12.745 -84.949  -17.441 1.00 146.74 ? 711  ARG A O     1 
ATOM   5464  C  CB    . ARG A 1  711  ? -15.530 -86.395  -16.426 1.00 144.26 ? 711  ARG A CB    1 
ATOM   5465  C  CG    . ARG A 1  711  ? -16.723 -87.270  -16.785 1.00 141.53 ? 711  ARG A CG    1 
ATOM   5466  C  CD    . ARG A 1  711  ? -17.971 -86.647  -16.191 1.00 151.20 ? 711  ARG A CD    1 
ATOM   5467  N  NE    . ARG A 1  711  ? -19.187 -87.371  -16.525 1.00 156.50 ? 711  ARG A NE    1 
ATOM   5468  C  CZ    . ARG A 1  711  ? -19.959 -87.082  -17.566 1.00 151.81 ? 711  ARG A CZ    1 
ATOM   5469  N  NH1   . ARG A 1  711  ? -19.637 -86.084  -18.375 1.00 161.07 ? 711  ARG A NH1   1 
ATOM   5470  N  NH2   . ARG A 1  711  ? -21.056 -87.786  -17.793 1.00 145.72 ? 711  ARG A NH2   1 
ATOM   5471  N  N     . GLU A 1  712  ? -12.618 -85.929  -15.418 1.00 131.03 ? 712  GLU A N     1 
ATOM   5472  C  CA    . GLU A 1  712  ? -11.563 -85.015  -14.986 1.00 138.58 ? 712  GLU A CA    1 
ATOM   5473  C  C     . GLU A 1  712  ? -10.314 -85.205  -15.842 1.00 148.10 ? 712  GLU A C     1 
ATOM   5474  O  O     . GLU A 1  712  ? -9.650  -84.233  -16.213 1.00 157.14 ? 712  GLU A O     1 
ATOM   5475  C  CB    . GLU A 1  712  ? -11.261 -85.256  -13.509 1.00 143.40 ? 712  GLU A CB    1 
ATOM   5476  C  CG    . GLU A 1  712  ? -12.329 -84.707  -12.566 1.00 161.93 ? 712  GLU A CG    1 
ATOM   5477  C  CD    . GLU A 1  712  ? -11.958 -84.850  -11.103 1.00 165.94 ? 712  GLU A CD    1 
ATOM   5478  O  OE1   . GLU A 1  712  ? -12.236 -83.913  -10.326 1.00 168.38 ? 712  GLU A OE1   1 
ATOM   5479  O  OE2   . GLU A 1  712  ? -11.376 -85.893  -10.731 1.00 155.07 ? 712  GLU A OE2   1 
ATOM   5480  N  N     . SER A 1  713  ? -9.963  -86.466  -16.128 1.00 144.42 ? 713  SER A N     1 
ATOM   5481  C  CA    . SER A 1  713  ? -8.831  -86.767  -16.999 1.00 147.88 ? 713  SER A CA    1 
ATOM   5482  C  C     . SER A 1  713  ? -9.054  -86.195  -18.394 1.00 143.23 ? 713  SER A C     1 
ATOM   5483  O  O     . SER A 1  713  ? -8.121  -85.670  -19.027 1.00 162.60 ? 713  SER A O     1 
ATOM   5484  C  CB    . SER A 1  713  ? -8.606  -88.281  -17.076 1.00 156.23 ? 713  SER A CB    1 
ATOM   5485  O  OG    . SER A 1  713  ? -7.846  -88.779  -15.983 1.00 166.95 ? 713  SER A OG    1 
ATOM   5486  N  N     . PHE A 1  714  ? -10.312 -86.209  -18.845 1.00 125.79 ? 714  PHE A N     1 
ATOM   5487  C  CA    . PHE A 1  714  ? -10.655 -85.673  -20.159 1.00 135.61 ? 714  PHE A CA    1 
ATOM   5488  C  C     . PHE A 1  714  ? -10.471 -84.159  -20.207 1.00 139.41 ? 714  PHE A C     1 
ATOM   5489  O  O     . PHE A 1  714  ? -9.837  -83.633  -21.130 1.00 126.57 ? 714  PHE A O     1 
ATOM   5490  C  CB    . PHE A 1  714  ? -12.094 -86.076  -20.510 1.00 125.66 ? 714  PHE A CB    1 
ATOM   5491  C  CG    . PHE A 1  714  ? -12.724 -85.242  -21.597 1.00 141.16 ? 714  PHE A CG    1 
ATOM   5492  C  CD1   . PHE A 1  714  ? -12.488 -85.513  -22.935 1.00 139.05 ? 714  PHE A CD1   1 
ATOM   5493  C  CD2   . PHE A 1  714  ? -13.551 -84.180  -21.279 1.00 148.42 ? 714  PHE A CD2   1 
ATOM   5494  C  CE1   . PHE A 1  714  ? -13.069 -84.735  -23.931 1.00 132.56 ? 714  PHE A CE1   1 
ATOM   5495  C  CE2   . PHE A 1  714  ? -14.126 -83.402  -22.269 1.00 129.02 ? 714  PHE A CE2   1 
ATOM   5496  C  CZ    . PHE A 1  714  ? -13.885 -83.681  -23.593 1.00 126.73 ? 714  PHE A CZ    1 
ATOM   5497  N  N     . GLU A 1  715  ? -11.024 -83.434  -19.233 1.00 142.08 ? 715  GLU A N     1 
ATOM   5498  C  CA    . GLU A 1  715  ? -10.923 -81.979  -19.281 1.00 145.15 ? 715  GLU A CA    1 
ATOM   5499  C  C     . GLU A 1  715  ? -9.490  -81.523  -19.030 1.00 145.30 ? 715  GLU A C     1 
ATOM   5500  O  O     . GLU A 1  715  ? -9.018  -80.560  -19.652 1.00 140.63 ? 715  GLU A O     1 
ATOM   5501  C  CB    . GLU A 1  715  ? -11.871 -81.354  -18.257 1.00 142.01 ? 715  GLU A CB    1 
ATOM   5502  C  CG    . GLU A 1  715  ? -13.314 -81.336  -18.697 1.00 141.63 ? 715  GLU A CG    1 
ATOM   5503  C  CD    . GLU A 1  715  ? -13.769 -79.970  -19.149 1.00 159.14 ? 715  GLU A CD    1 
ATOM   5504  O  OE1   . GLU A 1  715  ? -13.114 -78.957  -18.810 1.00 163.25 ? 715  GLU A OE1   1 
ATOM   5505  O  OE2   . GLU A 1  715  ? -14.784 -79.919  -19.868 1.00 160.55 ? 715  GLU A OE2   1 
ATOM   5506  N  N     . ASP A 1  716  ? -8.775  -82.224  -18.141 1.00 143.05 ? 716  ASP A N     1 
ATOM   5507  C  CA    . ASP A 1  716  ? -7.355  -81.950  -17.951 1.00 157.09 ? 716  ASP A CA    1 
ATOM   5508  C  C     . ASP A 1  716  ? -6.578  -82.114  -19.245 1.00 153.52 ? 716  ASP A C     1 
ATOM   5509  O  O     . ASP A 1  716  ? -5.642  -81.350  -19.506 1.00 150.16 ? 716  ASP A O     1 
ATOM   5510  C  CB    . ASP A 1  716  ? -6.768  -82.866  -16.876 1.00 179.07 ? 716  ASP A CB    1 
ATOM   5511  C  CG    . ASP A 1  716  ? -5.255  -82.728  -16.755 1.00 200.92 ? 716  ASP A CG    1 
ATOM   5512  O  OD1   . ASP A 1  716  ? -4.772  -81.745  -16.151 1.00 204.55 ? 716  ASP A OD1   1 
ATOM   5513  O  OD2   . ASP A 1  716  ? -4.542  -83.607  -17.283 1.00 206.83 ? 716  ASP A OD2   1 
ATOM   5514  N  N     . ASN A 1  717  ? -6.987  -83.059  -20.096 1.00 156.20 ? 717  ASN A N     1 
ATOM   5515  C  CA    . ASN A 1  717  ? -6.341  -83.179  -21.400 1.00 158.32 ? 717  ASN A CA    1 
ATOM   5516  C  C     . ASN A 1  717  ? -6.716  -82.001  -22.298 1.00 152.22 ? 717  ASN A C     1 
ATOM   5517  O  O     . ASN A 1  717  ? -5.840  -81.308  -22.833 1.00 145.66 ? 717  ASN A O     1 
ATOM   5518  C  CB    . ASN A 1  717  ? -6.723  -84.517  -22.044 1.00 154.02 ? 717  ASN A CB    1 
ATOM   5519  C  CG    . ASN A 1  717  ? -5.812  -85.660  -21.612 1.00 158.79 ? 717  ASN A CG    1 
ATOM   5520  O  OD1   . ASN A 1  717  ? -4.616  -85.465  -21.400 1.00 165.28 ? 717  ASN A OD1   1 
ATOM   5521  N  ND2   . ASN A 1  717  ? -6.383  -86.855  -21.464 1.00 151.21 ? 717  ASN A ND2   1 
ATOM   5522  N  N     . VAL A 1  718  ? -8.020  -81.739  -22.439 1.00 152.55 ? 718  VAL A N     1 
ATOM   5523  C  CA    . VAL A 1  718  ? -8.516  -80.762  -23.412 1.00 143.43 ? 718  VAL A CA    1 
ATOM   5524  C  C     . VAL A 1  718  ? -7.925  -79.382  -23.152 1.00 139.84 ? 718  VAL A C     1 
ATOM   5525  O  O     . VAL A 1  718  ? -7.504  -78.679  -24.085 1.00 132.26 ? 718  VAL A O     1 
ATOM   5526  C  CB    . VAL A 1  718  ? -10.057 -80.709  -23.387 1.00 130.38 ? 718  VAL A CB    1 
ATOM   5527  C  CG1   . VAL A 1  718  ? -10.566 -79.697  -24.394 1.00 118.90 ? 718  VAL A CG1   1 
ATOM   5528  C  CG2   . VAL A 1  718  ? -10.679 -82.084  -23.644 1.00 131.97 ? 718  VAL A CG2   1 
ATOM   5529  N  N     . VAL A 1  719  ? -7.899  -78.964  -21.883 1.00 137.24 ? 719  VAL A N     1 
ATOM   5530  C  CA    . VAL A 1  719  ? -7.384  -77.638  -21.546 1.00 124.92 ? 719  VAL A CA    1 
ATOM   5531  C  C     . VAL A 1  719  ? -5.922  -77.508  -21.961 1.00 123.30 ? 719  VAL A C     1 
ATOM   5532  O  O     . VAL A 1  719  ? -5.522  -76.505  -22.575 1.00 133.84 ? 719  VAL A O     1 
ATOM   5533  C  CB    . VAL A 1  719  ? -7.574  -77.363  -20.040 1.00 111.65 ? 719  VAL A CB    1 
ATOM   5534  C  CG1   . VAL A 1  719  ? -6.784  -76.138  -19.608 1.00 133.71 ? 719  VAL A CG1   1 
ATOM   5535  C  CG2   . VAL A 1  719  ? -9.054  -77.213  -19.690 1.00 111.73 ? 719  VAL A CG2   1 
ATOM   5536  N  N     . ARG A 1  720  ? -5.116  -78.541  -21.689 1.00 123.29 ? 720  ARG A N     1 
ATOM   5537  C  CA    . ARG A 1  720  ? -3.712  -78.506  -22.089 1.00 126.40 ? 720  ARG A CA    1 
ATOM   5538  C  C     . ARG A 1  720  ? -3.586  -78.452  -23.604 1.00 130.10 ? 720  ARG A C     1 
ATOM   5539  O  O     . ARG A 1  720  ? -2.701  -77.767  -24.142 1.00 133.68 ? 720  ARG A O     1 
ATOM   5540  C  CB    . ARG A 1  720  ? -2.974  -79.720  -21.523 1.00 136.78 ? 720  ARG A CB    1 
ATOM   5541  C  CG    . ARG A 1  720  ? -1.458  -79.704  -21.737 1.00 148.37 ? 720  ARG A CG    1 
ATOM   5542  C  CD    . ARG A 1  720  ? -0.793  -80.921  -21.113 1.00 146.80 ? 720  ARG A CD    1 
ATOM   5543  N  NE    . ARG A 1  720  ? -1.552  -82.136  -21.380 1.00 165.88 ? 720  ARG A NE    1 
ATOM   5544  C  CZ    . ARG A 1  720  ? -2.294  -82.758  -20.470 1.00 182.28 ? 720  ARG A CZ    1 
ATOM   5545  N  NH1   . ARG A 1  720  ? -2.372  -82.271  -19.235 1.00 185.71 ? 720  ARG A NH1   1 
ATOM   5546  N  NH2   . ARG A 1  720  ? -2.961  -83.858  -20.795 1.00 175.01 ? 720  ARG A NH2   1 
ATOM   5547  N  N     . PHE A 1  721  ? -4.494  -79.137  -24.309 1.00 132.49 ? 721  PHE A N     1 
ATOM   5548  C  CA    . PHE A 1  721  ? -4.455  -79.120  -25.767 1.00 139.34 ? 721  PHE A CA    1 
ATOM   5549  C  C     . PHE A 1  721  ? -4.698  -77.711  -26.279 1.00 138.25 ? 721  PHE A C     1 
ATOM   5550  O  O     . PHE A 1  721  ? -4.102  -77.286  -27.277 1.00 136.35 ? 721  PHE A O     1 
ATOM   5551  C  CB    . PHE A 1  721  ? -5.505  -80.075  -26.341 1.00 139.13 ? 721  PHE A CB    1 
ATOM   5552  C  CG    . PHE A 1  721  ? -5.056  -81.502  -26.419 1.00 155.08 ? 721  PHE A CG    1 
ATOM   5553  C  CD1   . PHE A 1  721  ? -4.407  -82.101  -25.355 1.00 171.54 ? 721  PHE A CD1   1 
ATOM   5554  C  CD2   . PHE A 1  721  ? -5.270  -82.243  -27.572 1.00 151.68 ? 721  PHE A CD2   1 
ATOM   5555  C  CE1   . PHE A 1  721  ? -3.990  -83.408  -25.430 1.00 172.64 ? 721  PHE A CE1   1 
ATOM   5556  C  CE2   . PHE A 1  721  ? -4.852  -83.546  -27.654 1.00 165.20 ? 721  PHE A CE2   1 
ATOM   5557  C  CZ    . PHE A 1  721  ? -4.210  -84.131  -26.579 1.00 182.11 ? 721  PHE A CZ    1 
ATOM   5558  N  N     . LEU A 1  722  ? -5.573  -76.971  -25.597 1.00 124.66 ? 722  LEU A N     1 
ATOM   5559  C  CA    . LEU A 1  722  ? -6.015  -75.672  -26.096 1.00 131.12 ? 722  LEU A CA    1 
ATOM   5560  C  C     . LEU A 1  722  ? -4.944  -74.630  -25.805 1.00 151.31 ? 722  LEU A C     1 
ATOM   5561  O  O     . LEU A 1  722  ? -4.306  -74.102  -26.722 1.00 159.14 ? 722  LEU A O     1 
ATOM   5562  C  CB    . LEU A 1  722  ? -7.365  -75.283  -25.485 1.00 130.30 ? 722  LEU A CB    1 
ATOM   5563  C  CG    . LEU A 1  722  ? -8.588  -75.983  -26.082 1.00 124.70 ? 722  LEU A CG    1 
ATOM   5564  C  CD1   . LEU A 1  722  ? -9.829  -75.799  -25.212 1.00 124.62 ? 722  LEU A CD1   1 
ATOM   5565  C  CD2   . LEU A 1  722  ? -8.829  -75.463  -27.488 1.00 115.47 ? 722  LEU A CD2   1 
ATOM   5566  N  N     . ASN A 1  723  ? -4.726  -74.328  -24.524 1.00 160.56 ? 723  ASN A N     1 
ATOM   5567  C  CA    . ASN A 1  723  ? -3.814  -73.230  -24.242 1.00 164.44 ? 723  ASN A CA    1 
ATOM   5568  C  C     . ASN A 1  723  ? -2.359  -73.636  -24.425 1.00 158.66 ? 723  ASN A C     1 
ATOM   5569  O  O     . ASN A 1  723  ? -1.472  -72.788  -24.272 1.00 163.23 ? 723  ASN A O     1 
ATOM   5570  C  CB    . ASN A 1  723  ? -4.061  -72.667  -22.830 1.00 153.31 ? 723  ASN A CB    1 
ATOM   5571  C  CG    . ASN A 1  723  ? -3.750  -73.663  -21.734 1.00 146.16 ? 723  ASN A CG    1 
ATOM   5572  O  OD1   . ASN A 1  723  ? -3.558  -74.845  -21.994 1.00 154.20 ? 723  ASN A OD1   1 
ATOM   5573  N  ND2   . ASN A 1  723  ? -3.702  -73.187  -20.497 1.00 151.29 ? 723  ASN A ND2   1 
ATOM   5574  N  N     . GLU A 1  724  ? -2.093  -74.895  -24.794 1.00 161.53 ? 724  GLU A N     1 
ATOM   5575  C  CA    . GLU A 1  724  ? -0.791  -75.197  -25.373 1.00 162.86 ? 724  GLU A CA    1 
ATOM   5576  C  C     . GLU A 1  724  ? -0.721  -74.771  -26.833 1.00 149.70 ? 724  GLU A C     1 
ATOM   5577  O  O     . GLU A 1  724  ? 0.371   -74.471  -27.335 1.00 140.90 ? 724  GLU A O     1 
ATOM   5578  C  CB    . GLU A 1  724  ? -0.488  -76.694  -25.238 1.00 157.51 ? 724  GLU A CB    1 
ATOM   5579  C  CG    . GLU A 1  724  ? 0.231   -77.309  -26.432 1.00 168.98 ? 724  GLU A CG    1 
ATOM   5580  C  CD    . GLU A 1  724  ? 0.386   -78.812  -26.331 1.00 183.78 ? 724  GLU A CD    1 
ATOM   5581  O  OE1   . GLU A 1  724  ? 0.659   -79.322  -25.224 1.00 185.37 ? 724  GLU A OE1   1 
ATOM   5582  O  OE2   . GLU A 1  724  ? 0.246   -79.481  -27.375 1.00 188.11 ? 724  GLU A OE2   1 
ATOM   5583  N  N     . ALA A 1  725  ? -1.869  -74.706  -27.515 1.00 133.16 ? 725  ALA A N     1 
ATOM   5584  C  CA    . ALA A 1  725  ? -1.903  -74.142  -28.858 1.00 131.93 ? 725  ALA A CA    1 
ATOM   5585  C  C     . ALA A 1  725  ? -2.039  -72.624  -28.877 1.00 130.29 ? 725  ALA A C     1 
ATOM   5586  O  O     . ALA A 1  725  ? -1.542  -71.978  -29.813 1.00 141.30 ? 725  ALA A O     1 
ATOM   5587  C  CB    . ALA A 1  725  ? -3.043  -74.776  -29.659 1.00 140.64 ? 725  ALA A CB    1 
ATOM   5588  N  N     . ARG A 1  726  ? -2.648  -72.023  -27.850 1.00 124.91 ? 726  ARG A N     1 
ATOM   5589  C  CA    . ARG A 1  726  ? -2.641  -70.564  -27.775 1.00 138.45 ? 726  ARG A CA    1 
ATOM   5590  C  C     . ARG A 1  726  ? -1.222  -70.031  -27.651 1.00 141.42 ? 726  ARG A C     1 
ATOM   5591  O  O     . ARG A 1  726  ? -0.856  -69.047  -28.307 1.00 140.67 ? 726  ARG A O     1 
ATOM   5592  C  CB    . ARG A 1  726  ? -3.478  -70.064  -26.598 1.00 137.05 ? 726  ARG A CB    1 
ATOM   5593  C  CG    . ARG A 1  726  ? -3.285  -68.559  -26.377 1.00 130.39 ? 726  ARG A CG    1 
ATOM   5594  C  CD    . ARG A 1  726  ? -3.530  -68.126  -24.940 1.00 132.29 ? 726  ARG A CD    1 
ATOM   5595  N  NE    . ARG A 1  726  ? -2.780  -68.947  -23.994 1.00 129.61 ? 726  ARG A NE    1 
ATOM   5596  C  CZ    . ARG A 1  726  ? -3.004  -68.969  -22.686 1.00 140.06 ? 726  ARG A CZ    1 
ATOM   5597  N  NH1   . ARG A 1  726  ? -3.957  -68.205  -22.163 1.00 146.66 ? 726  ARG A NH1   1 
ATOM   5598  N  NH2   . ARG A 1  726  ? -2.287  -69.760  -21.900 1.00 137.94 ? 726  ARG A NH2   1 
ATOM   5599  N  N     . ASP A 1  727  ? -0.403  -70.681  -26.819 1.00 129.54 ? 727  ASP A N     1 
ATOM   5600  C  CA    . ASP A 1  727  ? 0.986   -70.274  -26.675 1.00 138.13 ? 727  ASP A CA    1 
ATOM   5601  C  C     . ASP A 1  727  ? 1.767   -70.508  -27.962 1.00 143.98 ? 727  ASP A C     1 
ATOM   5602  O  O     . ASP A 1  727  ? 2.712   -69.768  -28.260 1.00 160.51 ? 727  ASP A O     1 
ATOM   5603  C  CB    . ASP A 1  727  ? 1.633   -71.015  -25.497 1.00 147.49 ? 727  ASP A CB    1 
ATOM   5604  C  CG    . ASP A 1  727  ? 0.909   -70.774  -24.167 1.00 149.55 ? 727  ASP A CG    1 
ATOM   5605  O  OD1   . ASP A 1  727  ? 0.146   -69.789  -24.069 1.00 141.99 ? 727  ASP A OD1   1 
ATOM   5606  O  OD2   . ASP A 1  727  ? 1.091   -71.573  -23.218 1.00 150.10 ? 727  ASP A OD2   1 
ATOM   5607  N  N     . LYS A 1  728  ? 1.385   -71.518  -28.742 1.00 145.10 ? 728  LYS A N     1 
ATOM   5608  C  CA    . LYS A 1  728  ? 2.047   -71.741  -30.021 1.00 151.45 ? 728  LYS A CA    1 
ATOM   5609  C  C     . LYS A 1  728  ? 1.756   -70.607  -30.998 1.00 133.74 ? 728  LYS A C     1 
ATOM   5610  O  O     . LYS A 1  728  ? 2.670   -70.089  -31.651 1.00 144.48 ? 728  LYS A O     1 
ATOM   5611  C  CB    . LYS A 1  728  ? 1.642   -73.092  -30.612 1.00 156.88 ? 728  LYS A CB    1 
ATOM   5612  C  CG    . LYS A 1  728  ? 2.510   -73.498  -31.798 1.00 153.75 ? 728  LYS A CG    1 
ATOM   5613  C  CD    . LYS A 1  728  ? 2.237   -74.913  -32.275 1.00 155.46 ? 728  LYS A CD    1 
ATOM   5614  C  CE    . LYS A 1  728  ? 3.380   -75.415  -33.144 1.00 153.36 ? 728  LYS A CE    1 
ATOM   5615  N  NZ    . LYS A 1  728  ? 3.215   -76.842  -33.519 1.00 151.77 ? 728  LYS A NZ    1 
ATOM   5616  N  N     . ALA A 1  729  ? 0.486   -70.210  -31.123 1.00 121.12 ? 729  ALA A N     1 
ATOM   5617  C  CA    . ALA A 1  729  ? 0.177   -69.049  -31.960 1.00 134.18 ? 729  ALA A CA    1 
ATOM   5618  C  C     . ALA A 1  729  ? 0.822   -67.781  -31.412 1.00 147.21 ? 729  ALA A C     1 
ATOM   5619  O  O     . ALA A 1  729  ? 1.154   -66.853  -32.174 1.00 133.95 ? 729  ALA A O     1 
ATOM   5620  C  CB    . ALA A 1  729  ? -1.337  -68.875  -32.087 1.00 114.03 ? 729  ALA A CB    1 
ATOM   5621  N  N     . GLY A 1  730  ? 1.040   -67.747  -30.102 1.00 146.64 ? 730  GLY A N     1 
ATOM   5622  C  CA    . GLY A 1  730  ? 1.707   -66.644  -29.456 1.00 136.16 ? 730  GLY A CA    1 
ATOM   5623  C  C     . GLY A 1  730  ? 3.129   -66.535  -29.954 1.00 150.79 ? 730  GLY A C     1 
ATOM   5624  O  O     . GLY A 1  730  ? 3.487   -65.513  -30.542 1.00 161.64 ? 730  GLY A O     1 
ATOM   5625  N  N     . ARG A 1  731  ? 3.947   -67.578  -29.758 1.00 150.15 ? 731  ARG A N     1 
ATOM   5626  C  CA    . ARG A 1  731  ? 5.319   -67.516  -30.253 1.00 151.82 ? 731  ARG A CA    1 
ATOM   5627  C  C     . ARG A 1  731  ? 5.357   -67.347  -31.769 1.00 149.17 ? 731  ARG A C     1 
ATOM   5628  O  O     . ARG A 1  731  ? 6.311   -66.770  -32.304 1.00 171.11 ? 731  ARG A O     1 
ATOM   5629  C  CB    . ARG A 1  731  ? 6.096   -68.769  -29.835 1.00 146.71 ? 731  ARG A CB    1 
ATOM   5630  C  CG    . ARG A 1  731  ? 6.581   -68.787  -28.374 1.00 135.52 ? 731  ARG A CG    1 
ATOM   5631  C  CD    . ARG A 1  731  ? 6.016   -70.012  -27.667 1.00 149.72 ? 731  ARG A CD    1 
ATOM   5632  N  NE    . ARG A 1  731  ? 5.926   -71.153  -28.578 1.00 175.02 ? 731  ARG A NE    1 
ATOM   5633  C  CZ    . ARG A 1  731  ? 5.350   -72.315  -28.282 1.00 162.04 ? 731  ARG A CZ    1 
ATOM   5634  N  NH1   . ARG A 1  731  ? 4.804   -72.507  -27.086 1.00 150.22 ? 731  ARG A NH1   1 
ATOM   5635  N  NH2   . ARG A 1  731  ? 5.319   -73.288  -29.186 1.00 141.94 ? 731  ARG A NH2   1 
ATOM   5636  N  N     . LEU A 1  732  ? 4.329   -67.828  -32.475 1.00 121.83 ? 732  LEU A N     1 
ATOM   5637  C  CA    . LEU A 1  732  ? 4.266   -67.628  -33.922 1.00 129.26 ? 732  LEU A CA    1 
ATOM   5638  C  C     . LEU A 1  732  ? 4.168   -66.147  -34.279 1.00 131.95 ? 732  LEU A C     1 
ATOM   5639  O  O     . LEU A 1  732  ? 4.791   -65.683  -35.253 1.00 136.11 ? 732  LEU A O     1 
ATOM   5640  C  CB    . LEU A 1  732  ? 3.087   -68.407  -34.502 1.00 131.89 ? 732  LEU A CB    1 
ATOM   5641  C  CG    . LEU A 1  732  ? 3.447   -69.676  -35.271 1.00 131.20 ? 732  LEU A CG    1 
ATOM   5642  C  CD1   . LEU A 1  732  ? 2.194   -70.465  -35.610 1.00 124.49 ? 732  LEU A CD1   1 
ATOM   5643  C  CD2   . LEU A 1  732  ? 4.230   -69.302  -36.533 1.00 139.59 ? 732  LEU A CD2   1 
ATOM   5644  N  N     . ALA A 1  733  ? 3.461   -65.371  -33.456 1.00 127.50 ? 733  ALA A N     1 
ATOM   5645  C  CA    . ALA A 1  733  ? 3.377   -63.941  -33.721 1.00 129.75 ? 733  ALA A CA    1 
ATOM   5646  C  C     . ALA A 1  733  ? 4.557   -63.182  -33.130 1.00 121.88 ? 733  ALA A C     1 
ATOM   5647  O  O     . ALA A 1  733  ? 4.998   -62.188  -33.717 1.00 106.19 ? 733  ALA A O     1 
ATOM   5648  C  CB    . ALA A 1  733  ? 2.062   -63.379  -33.176 1.00 131.46 ? 733  ALA A CB    1 
ATOM   5649  N  N     . GLU A 1  734  ? 5.105   -63.641  -32.002 1.00 123.59 ? 734  GLU A N     1 
ATOM   5650  C  CA    . GLU A 1  734  ? 6.301   -63.001  -31.473 1.00 127.70 ? 734  GLU A CA    1 
ATOM   5651  C  C     . GLU A 1  734  ? 7.425   -63.098  -32.488 1.00 148.62 ? 734  GLU A C     1 
ATOM   5652  O  O     . GLU A 1  734  ? 8.205   -62.152  -32.661 1.00 149.97 ? 734  GLU A O     1 
ATOM   5653  C  CB    . GLU A 1  734  ? 6.722   -63.662  -30.160 1.00 142.11 ? 734  GLU A CB    1 
ATOM   5654  C  CG    . GLU A 1  734  ? 7.994   -63.093  -29.558 1.00 162.46 ? 734  GLU A CG    1 
ATOM   5655  C  CD    . GLU A 1  734  ? 8.163   -63.481  -28.106 1.00 181.88 ? 734  GLU A CD    1 
ATOM   5656  O  OE1   . GLU A 1  734  ? 8.127   -64.699  -27.813 1.00 187.75 ? 734  GLU A OE1   1 
ATOM   5657  O  OE2   . GLU A 1  734  ? 8.314   -62.571  -27.260 1.00 171.40 ? 734  GLU A OE2   1 
ATOM   5658  N  N     . VAL A 1  735  ? 7.496   -64.231  -33.199 1.00 147.72 ? 735  VAL A N     1 
ATOM   5659  C  CA    . VAL A 1  735  ? 8.568   -64.442  -34.164 1.00 130.02 ? 735  VAL A CA    1 
ATOM   5660  C  C     . VAL A 1  735  ? 8.256   -63.688  -35.443 1.00 137.16 ? 735  VAL A C     1 
ATOM   5661  O  O     . VAL A 1  735  ? 9.173   -63.183  -36.102 1.00 151.26 ? 735  VAL A O     1 
ATOM   5662  C  CB    . VAL A 1  735  ? 8.799   -65.943  -34.426 1.00 120.27 ? 735  VAL A CB    1 
ATOM   5663  C  CG1   . VAL A 1  735  ? 9.765   -66.169  -35.595 1.00 131.43 ? 735  VAL A CG1   1 
ATOM   5664  C  CG2   . VAL A 1  735  ? 9.350   -66.628  -33.176 1.00 132.37 ? 735  VAL A CG2   1 
ATOM   5665  N  N     . ASN A 1  736  ? 6.975   -63.578  -35.817 1.00 136.25 ? 736  ASN A N     1 
ATOM   5666  C  CA    . ASN A 1  736  ? 6.689   -62.810  -37.024 1.00 148.50 ? 736  ASN A CA    1 
ATOM   5667  C  C     . ASN A 1  736  ? 6.915   -61.309  -36.839 1.00 139.82 ? 736  ASN A C     1 
ATOM   5668  O  O     . ASN A 1  736  ? 7.146   -60.608  -37.828 1.00 142.38 ? 736  ASN A O     1 
ATOM   5669  C  CB    . ASN A 1  736  ? 5.261   -63.057  -37.512 1.00 164.21 ? 736  ASN A CB    1 
ATOM   5670  C  CG    . ASN A 1  736  ? 4.991   -62.399  -38.859 1.00 176.70 ? 736  ASN A CG    1 
ATOM   5671  O  OD1   . ASN A 1  736  ? 4.760   -61.194  -38.929 1.00 180.89 ? 736  ASN A OD1   1 
ATOM   5672  N  ND2   . ASN A 1  736  ? 5.060   -63.178  -39.934 1.00 169.20 ? 736  ASN A ND2   1 
ATOM   5673  N  N     . LEU A 1  737  ? 6.870   -60.802  -35.607 1.00 133.76 ? 737  LEU A N     1 
ATOM   5674  C  CA    . LEU A 1  737  ? 6.975   -59.362  -35.358 1.00 136.92 ? 737  LEU A CA    1 
ATOM   5675  C  C     . LEU A 1  737  ? 8.404   -58.857  -35.504 1.00 138.15 ? 737  LEU A C     1 
ATOM   5676  O  O     . LEU A 1  737  ? 9.303   -59.282  -34.769 1.00 124.81 ? 737  LEU A O     1 
ATOM   5677  C  CB    . LEU A 1  737  ? 6.419   -59.004  -33.985 1.00 142.53 ? 737  LEU A CB    1 
ATOM   5678  C  CG    . LEU A 1  737  ? 4.890   -59.082  -33.943 1.00 133.89 ? 737  LEU A CG    1 
ATOM   5679  C  CD1   . LEU A 1  737  ? 4.322   -58.521  -32.654 1.00 102.41 ? 737  LEU A CD1   1 
ATOM   5680  C  CD2   . LEU A 1  737  ? 4.341   -58.323  -35.138 1.00 125.91 ? 737  LEU A CD2   1 
ATOM   5681  N  N     . LYS A 1  738  ? 8.595   -57.930  -36.446 1.00 147.97 ? 738  LYS A N     1 
ATOM   5682  C  CA    . LYS A 1  738  ? 9.902   -57.359  -36.747 1.00 149.95 ? 738  LYS A CA    1 
ATOM   5683  C  C     . LYS A 1  738  ? 10.467  -56.636  -35.523 1.00 146.19 ? 738  LYS A C     1 
ATOM   5684  O  O     . LYS A 1  738  ? 9.742   -56.269  -34.595 1.00 125.35 ? 738  LYS A O     1 
ATOM   5685  C  CB    . LYS A 1  738  ? 9.785   -56.375  -37.919 1.00 146.78 ? 738  LYS A CB    1 
ATOM   5686  C  CG    . LYS A 1  738  ? 9.403   -57.002  -39.262 1.00 159.40 ? 738  LYS A CG    1 
ATOM   5687  C  CD    . LYS A 1  738  ? 8.153   -56.329  -39.830 1.00 149.27 ? 738  LYS A CD    1 
ATOM   5688  C  CE    . LYS A 1  738  ? 6.908   -56.901  -39.166 1.00 155.48 ? 738  LYS A CE    1 
ATOM   5689  N  NZ    . LYS A 1  738  ? 5.723   -56.011  -39.266 1.00 152.64 ? 738  LYS A NZ    1 
ATOM   5690  N  N     . ASP A 1  739  ? 11.787  -56.422  -35.530 1.00 158.66 ? 739  ASP A N     1 
ATOM   5691  C  CA    . ASP A 1  739  ? 12.434  -55.746  -34.414 1.00 151.93 ? 739  ASP A CA    1 
ATOM   5692  C  C     . ASP A 1  739  ? 12.080  -54.269  -34.311 1.00 138.07 ? 739  ASP A C     1 
ATOM   5693  O  O     . ASP A 1  739  ? 12.442  -53.629  -33.313 1.00 133.81 ? 739  ASP A O     1 
ATOM   5694  C  CB    . ASP A 1  739  ? 13.955  -55.905  -34.499 1.00 151.58 ? 739  ASP A CB    1 
ATOM   5695  C  CG    . ASP A 1  739  ? 14.428  -57.243  -33.966 1.00 173.45 ? 739  ASP A CG    1 
ATOM   5696  O  OD1   . ASP A 1  739  ? 13.711  -57.861  -33.152 1.00 175.77 ? 739  ASP A OD1   1 
ATOM   5697  O  OD2   . ASP A 1  739  ? 15.534  -57.675  -34.347 1.00 194.37 ? 739  ASP A OD2   1 
ATOM   5698  N  N     . LEU A 1  740  ? 11.357  -53.718  -35.283 1.00 128.60 ? 740  LEU A N     1 
ATOM   5699  C  CA    . LEU A 1  740  ? 10.863  -52.352  -35.171 1.00 121.19 ? 740  LEU A CA    1 
ATOM   5700  C  C     . LEU A 1  740  ? 9.495   -52.259  -34.518 1.00 117.08 ? 740  LEU A C     1 
ATOM   5701  O  O     . LEU A 1  740  ? 9.046   -51.145  -34.234 1.00 116.04 ? 740  LEU A O     1 
ATOM   5702  C  CB    . LEU A 1  740  ? 10.798  -51.666  -36.545 1.00 111.39 ? 740  LEU A CB    1 
ATOM   5703  C  CG    . LEU A 1  740  ? 10.227  -52.401  -37.765 1.00 126.86 ? 740  LEU A CG    1 
ATOM   5704  C  CD1   . LEU A 1  740  ? 8.749   -52.740  -37.622 1.00 134.92 ? 740  LEU A CD1   1 
ATOM   5705  C  CD2   . LEU A 1  740  ? 10.457  -51.569  -39.015 1.00 123.50 ? 740  LEU A CD2   1 
ATOM   5706  N  N     . ASN A 1  741  ? 8.811   -53.385  -34.317 1.00 126.75 ? 741  ASN A N     1 
ATOM   5707  C  CA    . ASN A 1  741  ? 7.493   -53.366  -33.694 1.00 112.15 ? 741  ASN A CA    1 
ATOM   5708  C  C     . ASN A 1  741  ? 7.599   -52.752  -32.310 1.00 116.01 ? 741  ASN A C     1 
ATOM   5709  O  O     . ASN A 1  741  ? 8.288   -53.281  -31.435 1.00 121.48 ? 741  ASN A O     1 
ATOM   5710  C  CB    . ASN A 1  741  ? 6.914   -54.780  -33.613 1.00 124.02 ? 741  ASN A CB    1 
ATOM   5711  C  CG    . ASN A 1  741  ? 5.499   -54.804  -33.068 1.00 128.68 ? 741  ASN A CG    1 
ATOM   5712  O  OD1   . ASN A 1  741  ? 5.262   -54.499  -31.897 1.00 128.46 ? 741  ASN A OD1   1 
ATOM   5713  N  ND2   . ASN A 1  741  ? 4.550   -55.185  -33.915 1.00 144.76 ? 741  ASN A ND2   1 
ATOM   5714  N  N     . ASN A 1  742  ? 6.925   -51.618  -32.126 1.00 120.03 ? 742  ASN A N     1 
ATOM   5715  C  CA    . ASN A 1  742  ? 7.148   -50.810  -30.934 1.00 120.04 ? 742  ASN A CA    1 
ATOM   5716  C  C     . ASN A 1  742  ? 6.734   -51.557  -29.668 1.00 120.82 ? 742  ASN A C     1 
ATOM   5717  O  O     . ASN A 1  742  ? 7.326   -51.351  -28.597 1.00 126.33 ? 742  ASN A O     1 
ATOM   5718  C  CB    . ASN A 1  742  ? 6.395   -49.485  -31.080 1.00 108.63 ? 742  ASN A CB    1 
ATOM   5719  C  CG    . ASN A 1  742  ? 6.928   -48.634  -32.242 1.00 121.95 ? 742  ASN A CG    1 
ATOM   5720  O  OD1   . ASN A 1  742  ? 7.736   -49.102  -33.041 1.00 131.23 ? 742  ASN A OD1   1 
ATOM   5721  N  ND2   . ASN A 1  742  ? 6.482   -47.383  -32.331 1.00 127.79 ? 742  ASN A ND2   1 
ATOM   5722  N  N     . VAL A 1  743  ? 5.745   -52.450  -29.776 1.00 103.38 ? 743  VAL A N     1 
ATOM   5723  C  CA    . VAL A 1  743  ? 5.366   -53.280  -28.636 1.00 104.76 ? 743  VAL A CA    1 
ATOM   5724  C  C     . VAL A 1  743  ? 6.484   -54.268  -28.326 1.00 109.82 ? 743  VAL A C     1 
ATOM   5725  O  O     . VAL A 1  743  ? 6.839   -54.485  -27.161 1.00 123.66 ? 743  VAL A O     1 
ATOM   5726  C  CB    . VAL A 1  743  ? 4.022   -53.991  -28.901 1.00 99.65  ? 743  VAL A CB    1 
ATOM   5727  C  CG1   . VAL A 1  743  ? 3.652   -54.921  -27.751 1.00 95.61  ? 743  VAL A CG1   1 
ATOM   5728  C  CG2   . VAL A 1  743  ? 2.920   -52.990  -29.165 1.00 99.75  ? 743  VAL A CG2   1 
ATOM   5729  N  N     . LYS A 1  744  ? 7.045   -54.897  -29.361 1.00 109.85 ? 744  LYS A N     1 
ATOM   5730  C  CA    . LYS A 1  744  ? 8.205   -55.755  -29.149 1.00 113.86 ? 744  LYS A CA    1 
ATOM   5731  C  C     . LYS A 1  744  ? 9.360   -54.953  -28.566 1.00 129.44 ? 744  LYS A C     1 
ATOM   5732  O  O     . LYS A 1  744  ? 10.102  -55.457  -27.721 1.00 132.77 ? 744  LYS A O     1 
ATOM   5733  C  CB    . LYS A 1  744  ? 8.630   -56.433  -30.459 1.00 118.38 ? 744  LYS A CB    1 
ATOM   5734  C  CG    . LYS A 1  744  ? 9.680   -57.547  -30.300 1.00 122.84 ? 744  LYS A CG    1 
ATOM   5735  C  CD    . LYS A 1  744  ? 9.788   -58.435  -31.549 1.00 142.59 ? 744  LYS A CD    1 
ATOM   5736  C  CE    . LYS A 1  744  ? 10.997  -59.378  -31.480 1.00 151.17 ? 744  LYS A CE    1 
ATOM   5737  N  NZ    . LYS A 1  744  ? 10.798  -60.547  -30.571 1.00 140.45 ? 744  LYS A NZ    1 
ATOM   5738  N  N     . GLN A 1  745  ? 9.536   -53.707  -29.018 1.00 134.82 ? 745  GLN A N     1 
ATOM   5739  C  CA    . GLN A 1  745  ? 10.591  -52.856  -28.478 1.00 122.23 ? 745  GLN A CA    1 
ATOM   5740  C  C     . GLN A 1  745  ? 10.407  -52.611  -26.984 1.00 130.95 ? 745  GLN A C     1 
ATOM   5741  O  O     . GLN A 1  745  ? 11.383  -52.585  -26.220 1.00 140.70 ? 745  GLN A O     1 
ATOM   5742  C  CB    . GLN A 1  745  ? 10.624  -51.529  -29.229 1.00 96.23  ? 745  GLN A CB    1 
ATOM   5743  C  CG    . GLN A 1  745  ? 11.346  -51.581  -30.566 1.00 108.14 ? 745  GLN A CG    1 
ATOM   5744  C  CD    . GLN A 1  745  ? 11.723  -50.202  -31.058 1.00 128.97 ? 745  GLN A CD    1 
ATOM   5745  O  OE1   . GLN A 1  745  ? 12.768  -49.666  -30.691 1.00 147.89 ? 745  GLN A OE1   1 
ATOM   5746  N  NE2   . GLN A 1  745  ? 10.870  -49.612  -31.879 1.00 125.49 ? 745  GLN A NE2   1 
ATOM   5747  N  N     . MET A 1  746  ? 9.158   -52.440  -26.548 1.00 130.05 ? 746  MET A N     1 
ATOM   5748  C  CA    . MET A 1  746  ? 8.893   -52.237  -25.128 1.00 118.25 ? 746  MET A CA    1 
ATOM   5749  C  C     . MET A 1  746  ? 9.046   -53.538  -24.350 1.00 111.23 ? 746  MET A C     1 
ATOM   5750  O  O     . MET A 1  746  ? 9.442   -53.521  -23.177 1.00 105.18 ? 746  MET A O     1 
ATOM   5751  C  CB    . MET A 1  746  ? 7.498   -51.641  -24.923 1.00 103.72 ? 746  MET A CB    1 
ATOM   5752  C  CG    . MET A 1  746  ? 7.466   -50.116  -24.943 1.00 105.70 ? 746  MET A CG    1 
ATOM   5753  S  SD    . MET A 1  746  ? 5.851   -49.424  -24.515 1.00 112.85 ? 746  MET A SD    1 
ATOM   5754  C  CE    . MET A 1  746  ? 4.931   -49.716  -26.019 1.00 102.80 ? 746  MET A CE    1 
ATOM   5755  N  N     . VAL A 1  747  ? 8.736   -54.676  -24.974 1.00 110.98 ? 747  VAL A N     1 
ATOM   5756  C  CA    . VAL A 1  747  ? 8.939   -55.936  -24.272 1.00 110.55 ? 747  VAL A CA    1 
ATOM   5757  C  C     . VAL A 1  747  ? 10.428  -56.236  -24.160 1.00 100.15 ? 747  VAL A C     1 
ATOM   5758  O  O     . VAL A 1  747  ? 10.880  -56.795  -23.154 1.00 108.42 ? 747  VAL A O     1 
ATOM   5759  C  CB    . VAL A 1  747  ? 8.168   -57.081  -24.966 1.00 106.43 ? 747  VAL A CB    1 
ATOM   5760  C  CG1   . VAL A 1  747  ? 8.414   -58.398  -24.258 1.00 105.01 ? 747  VAL A CG1   1 
ATOM   5761  C  CG2   . VAL A 1  747  ? 6.664   -56.794  -25.002 1.00 120.00 ? 747  VAL A CG2   1 
ATOM   5762  N  N     . MET A 1  748  ? 11.218  -55.864  -25.170 1.00 95.31  ? 748  MET A N     1 
ATOM   5763  C  CA    . MET A 1  748  ? 12.651  -56.133  -25.118 1.00 109.19 ? 748  MET A CA    1 
ATOM   5764  C  C     . MET A 1  748  ? 13.337  -55.211  -24.121 1.00 111.50 ? 748  MET A C     1 
ATOM   5765  O  O     . MET A 1  748  ? 14.187  -55.651  -23.337 1.00 121.54 ? 748  MET A O     1 
ATOM   5766  C  CB    . MET A 1  748  ? 13.271  -56.010  -26.513 1.00 113.83 ? 748  MET A CB    1 
ATOM   5767  C  CG    . MET A 1  748  ? 12.858  -57.128  -27.478 1.00 129.46 ? 748  MET A CG    1 
ATOM   5768  S  SD    . MET A 1  748  ? 13.556  -56.954  -29.137 1.00 156.09 ? 748  MET A SD    1 
ATOM   5769  C  CE    . MET A 1  748  ? 13.351  -55.197  -29.411 1.00 128.63 ? 748  MET A CE    1 
ATOM   5770  N  N     . ALA A 1  749  ? 12.948  -53.937  -24.097 1.00 120.85 ? 749  ALA A N     1 
ATOM   5771  C  CA    . ALA A 1  749  ? 13.526  -53.044  -23.101 1.00 126.75 ? 749  ALA A CA    1 
ATOM   5772  C  C     . ALA A 1  749  ? 13.066  -53.392  -21.694 1.00 116.40 ? 749  ALA A C     1 
ATOM   5773  O  O     . ALA A 1  749  ? 13.696  -52.963  -20.720 1.00 108.99 ? 749  ALA A O     1 
ATOM   5774  C  CB    . ALA A 1  749  ? 13.168  -51.591  -23.416 1.00 128.26 ? 749  ALA A CB    1 
ATOM   5775  N  N     . GLY A 1  750  ? 11.988  -54.157  -21.566 1.00 116.68 ? 750  GLY A N     1 
ATOM   5776  C  CA    . GLY A 1  750  ? 11.479  -54.478  -20.253 1.00 119.12 ? 750  GLY A CA    1 
ATOM   5777  C  C     . GLY A 1  750  ? 10.721  -53.359  -19.590 1.00 103.17 ? 750  GLY A C     1 
ATOM   5778  O  O     . GLY A 1  750  ? 10.590  -53.359  -18.360 1.00 90.29  ? 750  GLY A O     1 
ATOM   5779  N  N     . SER A 1  751  ? 10.209  -52.404  -20.369 1.00 109.37 ? 751  SER A N     1 
ATOM   5780  C  CA    . SER A 1  751  ? 9.522   -51.242  -19.820 1.00 88.53  ? 751  SER A CA    1 
ATOM   5781  C  C     . SER A 1  751  ? 8.033   -51.483  -19.620 1.00 88.57  ? 751  SER A C     1 
ATOM   5782  O  O     . SER A 1  751  ? 7.453   -50.942  -18.674 1.00 118.40 ? 751  SER A O     1 
ATOM   5783  C  CB    . SER A 1  751  ? 9.710   -50.032  -20.736 1.00 101.70 ? 751  SER A CB    1 
ATOM   5784  O  OG    . SER A 1  751  ? 9.384   -50.358  -22.075 1.00 123.50 ? 751  SER A OG    1 
ATOM   5785  N  N     . LYS A 1  752  ? 7.395   -52.252  -20.501 1.00 104.11 ? 752  LYS A N     1 
ATOM   5786  C  CA    . LYS A 1  752  ? 6.000   -52.632  -20.317 1.00 109.60 ? 752  LYS A CA    1 
ATOM   5787  C  C     . LYS A 1  752  ? 5.640   -53.708  -21.322 1.00 114.79 ? 752  LYS A C     1 
ATOM   5788  O  O     . LYS A 1  752  ? 6.154   -53.722  -22.444 1.00 112.45 ? 752  LYS A O     1 
ATOM   5789  C  CB    . LYS A 1  752  ? 5.044   -51.438  -20.455 1.00 88.26  ? 752  LYS A CB    1 
ATOM   5790  C  CG    . LYS A 1  752  ? 3.842   -51.556  -19.528 1.00 87.59  ? 752  LYS A CG    1 
ATOM   5791  C  CD    . LYS A 1  752  ? 4.267   -51.288  -18.085 1.00 104.29 ? 752  LYS A CD    1 
ATOM   5792  C  CE    . LYS A 1  752  ? 3.098   -51.040  -17.144 1.00 112.68 ? 752  LYS A CE    1 
ATOM   5793  N  NZ    . LYS A 1  752  ? 2.525   -49.673  -17.316 1.00 125.50 ? 752  LYS A NZ    1 
ATOM   5794  N  N     . GLY A 1  753  ? 4.781   -54.615  -20.898 1.00 126.94 ? 753  GLY A N     1 
ATOM   5795  C  CA    . GLY A 1  753  ? 4.313   -55.651  -21.786 1.00 128.94 ? 753  GLY A CA    1 
ATOM   5796  C  C     . GLY A 1  753  ? 5.090   -56.941  -21.617 1.00 120.40 ? 753  GLY A C     1 
ATOM   5797  O  O     . GLY A 1  753  ? 6.244   -56.959  -21.184 1.00 125.70 ? 753  GLY A O     1 
ATOM   5798  N  N     . SER A 1  754  ? 4.453   -58.038  -22.008 1.00 112.70 ? 754  SER A N     1 
ATOM   5799  C  CA    . SER A 1  754  ? 5.069   -59.349  -21.926 1.00 105.67 ? 754  SER A CA    1 
ATOM   5800  C  C     . SER A 1  754  ? 4.583   -60.186  -23.098 1.00 104.41 ? 754  SER A C     1 
ATOM   5801  O  O     . SER A 1  754  ? 3.788   -59.734  -23.922 1.00 121.98 ? 754  SER A O     1 
ATOM   5802  C  CB    . SER A 1  754  ? 4.748   -60.019  -20.588 1.00 123.85 ? 754  SER A CB    1 
ATOM   5803  O  OG    . SER A 1  754  ? 3.413   -59.741  -20.190 1.00 131.93 ? 754  SER A OG    1 
ATOM   5804  N  N     . PHE A 1  755  ? 5.030   -61.439  -23.134 1.00 126.24 ? 755  PHE A N     1 
ATOM   5805  C  CA    . PHE A 1  755  ? 4.691   -62.315  -24.250 1.00 128.14 ? 755  PHE A CA    1 
ATOM   5806  C  C     . PHE A 1  755  ? 3.182   -62.470  -24.405 1.00 122.40 ? 755  PHE A C     1 
ATOM   5807  O  O     . PHE A 1  755  ? 2.626   -62.264  -25.495 1.00 106.14 ? 755  PHE A O     1 
ATOM   5808  C  CB    . PHE A 1  755  ? 5.340   -63.677  -24.042 1.00 126.94 ? 755  PHE A CB    1 
ATOM   5809  C  CG    . PHE A 1  755  ? 4.822   -64.728  -24.967 1.00 132.55 ? 755  PHE A CG    1 
ATOM   5810  C  CD1   . PHE A 1  755  ? 5.290   -64.822  -26.266 1.00 142.29 ? 755  PHE A CD1   1 
ATOM   5811  C  CD2   . PHE A 1  755  ? 3.835   -65.601  -24.549 1.00 113.53 ? 755  PHE A CD2   1 
ATOM   5812  C  CE1   . PHE A 1  755  ? 4.801   -65.786  -27.114 1.00 133.79 ? 755  PHE A CE1   1 
ATOM   5813  C  CE2   . PHE A 1  755  ? 3.340   -66.558  -25.396 1.00 108.79 ? 755  PHE A CE2   1 
ATOM   5814  C  CZ    . PHE A 1  755  ? 3.821   -66.652  -26.676 1.00 128.68 ? 755  PHE A CZ    1 
ATOM   5815  N  N     . ILE A 1  756  ? 2.504   -62.831  -23.313 1.00 129.02 ? 756  ILE A N     1 
ATOM   5816  C  CA    . ILE A 1  756  ? 1.074   -63.125  -23.359 1.00 128.79 ? 756  ILE A CA    1 
ATOM   5817  C  C     . ILE A 1  756  ? 0.305   -61.945  -23.920 1.00 134.31 ? 756  ILE A C     1 
ATOM   5818  O  O     . ILE A 1  756  ? -0.742  -62.124  -24.551 1.00 120.29 ? 756  ILE A O     1 
ATOM   5819  C  CB    . ILE A 1  756  ? 0.557   -63.525  -21.959 1.00 129.00 ? 756  ILE A CB    1 
ATOM   5820  C  CG1   . ILE A 1  756  ? -0.967  -63.686  -21.969 1.00 144.01 ? 756  ILE A CG1   1 
ATOM   5821  C  CG2   . ILE A 1  756  ? 0.973   -62.512  -20.912 1.00 126.70 ? 756  ILE A CG2   1 
ATOM   5822  C  CD1   . ILE A 1  756  ? -1.574  -64.083  -20.630 1.00 157.99 ? 756  ILE A CD1   1 
ATOM   5823  N  N     . ASN A 1  757  ? 0.814   -60.727  -23.705 1.00 129.95 ? 757  ASN A N     1 
ATOM   5824  C  CA    . ASN A 1  757  ? 0.174   -59.524  -24.230 1.00 103.66 ? 757  ASN A CA    1 
ATOM   5825  C  C     . ASN A 1  757  ? 0.175   -59.526  -25.758 1.00 109.04 ? 757  ASN A C     1 
ATOM   5826  O  O     . ASN A 1  757  ? -0.858  -59.274  -26.394 1.00 106.51 ? 757  ASN A O     1 
ATOM   5827  C  CB    . ASN A 1  757  ? 0.892   -58.281  -23.693 1.00 100.42 ? 757  ASN A CB    1 
ATOM   5828  C  CG    . ASN A 1  757  ? 0.666   -58.051  -22.186 1.00 122.00 ? 757  ASN A CG    1 
ATOM   5829  O  OD1   . ASN A 1  757  ? 1.619   -57.830  -21.420 1.00 123.23 ? 757  ASN A OD1   1 
ATOM   5830  N  ND2   . ASN A 1  757  ? -0.590  -58.112  -21.761 1.00 105.72 ? 757  ASN A ND2   1 
ATOM   5831  N  N     . ILE A 1  758  ? 1.339   -59.792  -26.367 1.00 119.30 ? 758  ILE A N     1 
ATOM   5832  C  CA    . ILE A 1  758  ? 1.427   -59.897  -27.824 1.00 118.07 ? 758  ILE A CA    1 
ATOM   5833  C  C     . ILE A 1  758  ? 0.539   -61.027  -28.313 1.00 119.08 ? 758  ILE A C     1 
ATOM   5834  O  O     . ILE A 1  758  ? -0.154  -60.907  -29.335 1.00 116.41 ? 758  ILE A O     1 
ATOM   5835  C  CB    . ILE A 1  758  ? 2.892   -60.115  -28.265 1.00 104.60 ? 758  ILE A CB    1 
ATOM   5836  C  CG1   . ILE A 1  758  ? 3.814   -59.033  -27.708 1.00 111.70 ? 758  ILE A CG1   1 
ATOM   5837  C  CG2   . ILE A 1  758  ? 3.027   -60.187  -29.783 1.00 100.84 ? 758  ILE A CG2   1 
ATOM   5838  C  CD1   . ILE A 1  758  ? 5.240   -59.506  -27.515 1.00 122.52 ? 758  ILE A CD1   1 
ATOM   5839  N  N     . ALA A 1  759  ? 0.486   -62.112  -27.540 1.00 110.72 ? 759  ALA A N     1 
ATOM   5840  C  CA    . ALA A 1  759  ? -0.291  -63.271  -27.953 1.00 108.95 ? 759  ALA A CA    1 
ATOM   5841  C  C     . ALA A 1  759  ? -1.771  -62.932  -28.010 1.00 123.45 ? 759  ALA A C     1 
ATOM   5842  O  O     . ALA A 1  759  ? -2.435  -63.180  -29.023 1.00 129.71 ? 759  ALA A O     1 
ATOM   5843  C  CB    . ALA A 1  759  ? -0.029  -64.432  -26.998 1.00 118.78 ? 759  ALA A CB    1 
ATOM   5844  N  N     . GLN A 1  760  ? -2.308  -62.373  -26.924 1.00 100.34 ? 760  GLN A N     1 
ATOM   5845  C  CA    . GLN A 1  760  ? -3.735  -62.086  -26.866 1.00 114.25 ? 760  GLN A CA    1 
ATOM   5846  C  C     . GLN A 1  760  ? -4.113  -60.941  -27.799 1.00 121.79 ? 760  GLN A C     1 
ATOM   5847  O  O     . GLN A 1  760  ? -5.244  -60.901  -28.301 1.00 126.39 ? 760  GLN A O     1 
ATOM   5848  C  CB    . GLN A 1  760  ? -4.157  -61.765  -25.431 1.00 117.66 ? 760  GLN A CB    1 
ATOM   5849  C  CG    . GLN A 1  760  ? -4.132  -62.953  -24.468 1.00 99.19  ? 760  GLN A CG    1 
ATOM   5850  C  CD    . GLN A 1  760  ? -4.604  -62.586  -23.065 1.00 116.08 ? 760  GLN A CD    1 
ATOM   5851  O  OE1   . GLN A 1  760  ? -4.713  -61.410  -22.711 1.00 109.58 ? 760  GLN A OE1   1 
ATOM   5852  N  NE2   . GLN A 1  760  ? -4.897  -63.597  -22.267 1.00 131.85 ? 760  GLN A NE2   1 
ATOM   5853  N  N     . MET A 1  761  ? -3.195  -60.006  -28.054 1.00 117.49 ? 761  MET A N     1 
ATOM   5854  C  CA    . MET A 1  761  ? -3.590  -58.866  -28.873 1.00 120.56 ? 761  MET A CA    1 
ATOM   5855  C  C     . MET A 1  761  ? -3.541  -59.196  -30.357 1.00 124.14 ? 761  MET A C     1 
ATOM   5856  O  O     . MET A 1  761  ? -4.378  -58.700  -31.121 1.00 128.43 ? 761  MET A O     1 
ATOM   5857  C  CB    . MET A 1  761  ? -2.704  -57.647  -28.592 1.00 109.10 ? 761  MET A CB    1 
ATOM   5858  C  CG    . MET A 1  761  ? -3.136  -56.818  -27.407 1.00 115.32 ? 761  MET A CG    1 
ATOM   5859  S  SD    . MET A 1  761  ? -2.431  -55.163  -27.447 1.00 112.57 ? 761  MET A SD    1 
ATOM   5860  C  CE    . MET A 1  761  ? -0.724  -55.445  -26.965 1.00 95.30  ? 761  MET A CE    1 
ATOM   5861  N  N     . SER A 1  762  ? -2.607  -60.055  -30.774 1.00 118.61 ? 762  SER A N     1 
ATOM   5862  C  CA    . SER A 1  762  ? -2.377  -60.279  -32.196 1.00 138.59 ? 762  SER A CA    1 
ATOM   5863  C  C     . SER A 1  762  ? -2.779  -61.656  -32.705 1.00 141.80 ? 762  SER A C     1 
ATOM   5864  O  O     . SER A 1  762  ? -3.194  -61.763  -33.860 1.00 128.50 ? 762  SER A O     1 
ATOM   5865  C  CB    . SER A 1  762  ? -0.897  -60.047  -32.526 1.00 144.02 ? 762  SER A CB    1 
ATOM   5866  O  OG    . SER A 1  762  ? -0.532  -58.696  -32.276 1.00 143.55 ? 762  SER A OG    1 
ATOM   5867  N  N     . ALA A 1  763  ? -2.717  -62.695  -31.867 1.00 147.93 ? 763  ALA A N     1 
ATOM   5868  C  CA    . ALA A 1  763  ? -2.928  -64.077  -32.297 1.00 141.54 ? 763  ALA A CA    1 
ATOM   5869  C  C     . ALA A 1  763  ? -4.242  -64.638  -31.765 1.00 136.69 ? 763  ALA A C     1 
ATOM   5870  O  O     . ALA A 1  763  ? -5.193  -64.819  -32.533 1.00 131.35 ? 763  ALA A O     1 
ATOM   5871  C  CB    . ALA A 1  763  ? -1.749  -64.953  -31.863 1.00 138.52 ? 763  ALA A CB    1 
ATOM   5872  N  N     . CYS A 1  764  ? -4.312  -64.959  -30.476 1.00 133.40 ? 764  CYS A N     1 
ATOM   5873  C  CA    . CYS A 1  764  ? -5.503  -65.581  -29.913 1.00 140.39 ? 764  CYS A CA    1 
ATOM   5874  C  C     . CYS A 1  764  ? -5.535  -65.337  -28.408 1.00 137.51 ? 764  CYS A C     1 
ATOM   5875  O  O     . CYS A 1  764  ? -4.492  -65.292  -27.752 1.00 143.61 ? 764  CYS A O     1 
ATOM   5876  C  CB    . CYS A 1  764  ? -5.528  -67.082  -30.236 1.00 133.22 ? 764  CYS A CB    1 
ATOM   5877  S  SG    . CYS A 1  764  ? -6.470  -68.123  -29.131 1.00 142.34 ? 764  CYS A SG    1 
ATOM   5878  N  N     . VAL A 1  765  ? -6.749  -65.209  -27.866 1.00 124.12 ? 765  VAL A N     1 
ATOM   5879  C  CA    . VAL A 1  765  ? -6.907  -64.841  -26.460 1.00 116.30 ? 765  VAL A CA    1 
ATOM   5880  C  C     . VAL A 1  765  ? -6.663  -66.055  -25.571 1.00 123.86 ? 765  VAL A C     1 
ATOM   5881  O  O     . VAL A 1  765  ? -5.834  -66.024  -24.654 1.00 130.25 ? 765  VAL A O     1 
ATOM   5882  C  CB    . VAL A 1  765  ? -8.296  -64.224  -26.208 1.00 109.84 ? 765  VAL A CB    1 
ATOM   5883  C  CG1   . VAL A 1  765  ? -8.585  -64.137  -24.709 1.00 108.09 ? 765  VAL A CG1   1 
ATOM   5884  C  CG2   . VAL A 1  765  ? -8.413  -62.858  -26.862 1.00 102.07 ? 765  VAL A CG2   1 
ATOM   5885  N  N     . GLY A 1  766  ? -7.391  -67.132  -25.816 1.00 111.04 ? 766  GLY A N     1 
ATOM   5886  C  CA    . GLY A 1  766  ? -7.217  -68.355  -25.066 1.00 128.84 ? 766  GLY A CA    1 
ATOM   5887  C  C     . GLY A 1  766  ? -8.465  -68.710  -24.289 1.00 124.39 ? 766  GLY A C     1 
ATOM   5888  O  O     . GLY A 1  766  ? -9.481  -68.019  -24.339 1.00 105.27 ? 766  GLY A O     1 
ATOM   5889  N  N     . GLN A 1  767  ? -8.353  -69.798  -23.530 1.00 128.46 ? 767  GLN A N     1 
ATOM   5890  C  CA    . GLN A 1  767  ? -9.493  -70.341  -22.809 1.00 113.59 ? 767  GLN A CA    1 
ATOM   5891  C  C     . GLN A 1  767  ? -9.782  -69.504  -21.570 1.00 115.31 ? 767  GLN A C     1 
ATOM   5892  O  O     . GLN A 1  767  ? -8.882  -69.224  -20.774 1.00 125.67 ? 767  GLN A O     1 
ATOM   5893  C  CB    . GLN A 1  767  ? -9.236  -71.799  -22.419 1.00 107.42 ? 767  GLN A CB    1 
ATOM   5894  C  CG    . GLN A 1  767  ? -10.290 -72.371  -21.480 1.00 107.76 ? 767  GLN A CG    1 
ATOM   5895  C  CD    . GLN A 1  767  ? -11.526 -72.884  -22.190 1.00 137.65 ? 767  GLN A CD    1 
ATOM   5896  O  OE1   . GLN A 1  767  ? -11.455 -73.437  -23.287 1.00 147.16 ? 767  GLN A OE1   1 
ATOM   5897  N  NE2   . GLN A 1  767  ? -12.679 -72.677  -21.570 1.00 152.00 ? 767  GLN A NE2   1 
ATOM   5898  N  N     . GLN A 1  768  ? -11.036 -69.089  -21.421 1.00 115.39 ? 768  GLN A N     1 
ATOM   5899  C  CA    . GLN A 1  768  ? -11.479 -68.432  -20.201 1.00 112.01 ? 768  GLN A CA    1 
ATOM   5900  C  C     . GLN A 1  768  ? -11.768 -69.484  -19.137 1.00 113.16 ? 768  GLN A C     1 
ATOM   5901  O  O     . GLN A 1  768  ? -12.197 -70.600  -19.431 1.00 121.00 ? 768  GLN A O     1 
ATOM   5902  C  CB    . GLN A 1  768  ? -12.713 -67.569  -20.469 1.00 103.08 ? 768  GLN A CB    1 
ATOM   5903  C  CG    . GLN A 1  768  ? -12.553 -66.578  -21.618 1.00 102.87 ? 768  GLN A CG    1 
ATOM   5904  C  CD    . GLN A 1  768  ? -11.370 -65.649  -21.435 1.00 119.08 ? 768  GLN A CD    1 
ATOM   5905  O  OE1   . GLN A 1  768  ? -11.242 -64.974  -20.409 1.00 128.89 ? 768  GLN A OE1   1 
ATOM   5906  N  NE2   . GLN A 1  768  ? -10.477 -65.640  -22.408 1.00 115.72 ? 768  GLN A NE2   1 
ATOM   5907  N  N     . SER A 1  769  ? -11.543 -69.112  -17.887 1.00 118.81 ? 769  SER A N     1 
ATOM   5908  C  CA    . SER A 1  769  ? -11.694 -70.045  -16.790 1.00 113.84 ? 769  SER A CA    1 
ATOM   5909  C  C     . SER A 1  769  ? -12.382 -69.378  -15.621 1.00 109.94 ? 769  SER A C     1 
ATOM   5910  O  O     . SER A 1  769  ? -12.217 -68.182  -15.378 1.00 123.47 ? 769  SER A O     1 
ATOM   5911  C  CB    . SER A 1  769  ? -10.328 -70.568  -16.325 1.00 130.47 ? 769  SER A CB    1 
ATOM   5912  O  OG    . SER A 1  769  ? -10.374 -71.017  -14.977 1.00 145.39 ? 769  SER A OG    1 
ATOM   5913  N  N     . VAL A 1  770  ? -13.168 -70.173  -14.910 1.00 114.22 ? 770  VAL A N     1 
ATOM   5914  C  CA    . VAL A 1  770  ? -13.785 -69.758  -13.662 1.00 125.23 ? 770  VAL A CA    1 
ATOM   5915  C  C     . VAL A 1  770  ? -13.595 -70.895  -12.674 1.00 125.22 ? 770  VAL A C     1 
ATOM   5916  O  O     . VAL A 1  770  ? -13.993 -72.034  -12.949 1.00 120.67 ? 770  VAL A O     1 
ATOM   5917  C  CB    . VAL A 1  770  ? -15.269 -69.410  -13.822 1.00 104.62 ? 770  VAL A CB    1 
ATOM   5918  C  CG1   . VAL A 1  770  ? -15.852 -69.000  -12.475 1.00 101.29 ? 770  VAL A CG1   1 
ATOM   5919  C  CG2   . VAL A 1  770  ? -15.447 -68.325  -14.877 1.00 102.83 ? 770  VAL A CG2   1 
ATOM   5920  N  N     . GLU A 1  771  ? -12.972 -70.587  -11.541 1.00 128.33 ? 771  GLU A N     1 
ATOM   5921  C  CA    . GLU A 1  771  ? -12.721 -71.546  -10.474 1.00 115.28 ? 771  GLU A CA    1 
ATOM   5922  C  C     . GLU A 1  771  ? -11.873 -72.710  -10.970 1.00 127.37 ? 771  GLU A C     1 
ATOM   5923  O  O     . GLU A 1  771  ? -12.000 -73.838  -10.479 1.00 151.49 ? 771  GLU A O     1 
ATOM   5924  C  CB    . GLU A 1  771  ? -14.029 -72.063  -9.873  1.00 112.13 ? 771  GLU A CB    1 
ATOM   5925  C  CG    . GLU A 1  771  ? -14.637 -71.205  -8.766  1.00 129.95 ? 771  GLU A CG    1 
ATOM   5926  C  CD    . GLU A 1  771  ? -16.127 -71.480  -8.571  1.00 152.89 ? 771  GLU A CD    1 
ATOM   5927  O  OE1   . GLU A 1  771  ? -16.511 -72.661  -8.407  1.00 157.15 ? 771  GLU A OE1   1 
ATOM   5928  O  OE2   . GLU A 1  771  ? -16.921 -70.518  -8.603  1.00 157.83 ? 771  GLU A OE2   1 
ATOM   5929  N  N     . GLY A 1  772  ? -11.010 -72.457  -11.954 1.00 110.25 ? 772  GLY A N     1 
ATOM   5930  C  CA    . GLY A 1  772  ? -10.122 -73.508  -12.406 1.00 118.13 ? 772  GLY A CA    1 
ATOM   5931  C  C     . GLY A 1  772  ? -10.611 -74.197  -13.659 1.00 125.48 ? 772  GLY A C     1 
ATOM   5932  O  O     . GLY A 1  772  ? -9.874  -74.323  -14.643 1.00 132.66 ? 772  GLY A O     1 
ATOM   5933  N  N     . LYS A 1  773  ? -11.856 -74.668  -13.621 1.00 125.70 ? 773  LYS A N     1 
ATOM   5934  C  CA    . LYS A 1  773  ? -12.435 -75.380  -14.747 1.00 121.89 ? 773  LYS A CA    1 
ATOM   5935  C  C     . LYS A 1  773  ? -12.896 -74.401  -15.831 1.00 128.67 ? 773  LYS A C     1 
ATOM   5936  O  O     . LYS A 1  773  ? -12.931 -73.180  -15.643 1.00 106.03 ? 773  LYS A O     1 
ATOM   5937  C  CB    . LYS A 1  773  ? -13.607 -76.230  -14.272 1.00 124.52 ? 773  LYS A CB    1 
ATOM   5938  C  CG    . LYS A 1  773  ? -13.444 -76.777  -12.865 1.00 122.83 ? 773  LYS A CG    1 
ATOM   5939  C  CD    . LYS A 1  773  ? -14.791 -77.199  -12.283 1.00 138.21 ? 773  LYS A CD    1 
ATOM   5940  C  CE    . LYS A 1  773  ? -14.671 -77.557  -10.818 1.00 145.58 ? 773  LYS A CE    1 
ATOM   5941  N  NZ    . LYS A 1  773  ? -13.925 -76.462  -10.129 1.00 144.72 ? 773  LYS A NZ    1 
ATOM   5942  N  N     . ARG A 1  774  ? -13.373 -74.950  -16.941 1.00 140.73 ? 774  ARG A N     1 
ATOM   5943  C  CA    . ARG A 1  774  ? -13.872 -74.136  -18.039 1.00 116.38 ? 774  ARG A CA    1 
ATOM   5944  C  C     . ARG A 1  774  ? -15.227 -73.529  -17.655 1.00 120.11 ? 774  ARG A C     1 
ATOM   5945  O  O     . ARG A 1  774  ? -15.639 -73.540  -16.491 1.00 128.88 ? 774  ARG A O     1 
ATOM   5946  C  CB    . ARG A 1  774  ? -13.946 -74.969  -19.316 1.00 112.11 ? 774  ARG A CB    1 
ATOM   5947  C  CG    . ARG A 1  774  ? -12.591 -75.423  -19.818 1.00 121.72 ? 774  ARG A CG    1 
ATOM   5948  C  CD    . ARG A 1  774  ? -12.701 -76.072  -21.189 1.00 126.95 ? 774  ARG A CD    1 
ATOM   5949  N  NE    . ARG A 1  774  ? -13.364 -77.368  -21.143 1.00 148.30 ? 774  ARG A NE    1 
ATOM   5950  C  CZ    . ARG A 1  774  ? -13.840 -77.996  -22.216 1.00 136.38 ? 774  ARG A CZ    1 
ATOM   5951  N  NH1   . ARG A 1  774  ? -13.730 -77.444  -23.415 1.00 125.10 ? 774  ARG A NH1   1 
ATOM   5952  N  NH2   . ARG A 1  774  ? -14.442 -79.171  -22.091 1.00 118.29 ? 774  ARG A NH2   1 
ATOM   5953  N  N     . ILE A 1  775  ? -15.898 -72.906  -18.624 1.00 109.07 ? 775  ILE A N     1 
ATOM   5954  C  CA    . ILE A 1  775  ? -17.199 -72.292  -18.364 1.00 120.30 ? 775  ILE A CA    1 
ATOM   5955  C  C     . ILE A 1  775  ? -18.214 -73.384  -18.066 1.00 115.89 ? 775  ILE A C     1 
ATOM   5956  O  O     . ILE A 1  775  ? -18.477 -74.257  -18.900 1.00 112.34 ? 775  ILE A O     1 
ATOM   5957  C  CB    . ILE A 1  775  ? -17.648 -71.404  -19.533 1.00 123.03 ? 775  ILE A CB    1 
ATOM   5958  C  CG1   . ILE A 1  775  ? -16.587 -70.360  -19.837 1.00 112.95 ? 775  ILE A CG1   1 
ATOM   5959  C  CG2   . ILE A 1  775  ? -18.923 -70.650  -19.190 1.00 121.99 ? 775  ILE A CG2   1 
ATOM   5960  C  CD1   . ILE A 1  775  ? -16.339 -69.430  -18.680 1.00 105.59 ? 775  ILE A CD1   1 
ATOM   5961  N  N     . ALA A 1  776  ? -18.787 -73.336  -16.871 1.00 123.86 ? 776  ALA A N     1 
ATOM   5962  C  CA    . ALA A 1  776  ? -19.688 -74.371  -16.406 1.00 129.36 ? 776  ALA A CA    1 
ATOM   5963  C  C     . ALA A 1  776  ? -21.012 -74.305  -17.160 1.00 128.13 ? 776  ALA A C     1 
ATOM   5964  O  O     . ALA A 1  776  ? -21.308 -73.352  -17.887 1.00 127.07 ? 776  ALA A O     1 
ATOM   5965  C  CB    . ALA A 1  776  ? -19.930 -74.227  -14.903 1.00 127.25 ? 776  ALA A CB    1 
ATOM   5966  N  N     . PHE A 1  777  ? -21.814 -75.353  -16.986 1.00 130.30 ? 777  PHE A N     1 
ATOM   5967  C  CA    . PHE A 1  777  ? -23.166 -75.391  -17.532 1.00 116.12 ? 777  PHE A CA    1 
ATOM   5968  C  C     . PHE A 1  777  ? -24.073 -74.608  -16.585 1.00 120.10 ? 777  PHE A C     1 
ATOM   5969  O  O     . PHE A 1  777  ? -24.695 -75.146  -15.668 1.00 118.70 ? 777  PHE A O     1 
ATOM   5970  C  CB    . PHE A 1  777  ? -23.641 -76.824  -17.728 1.00 118.39 ? 777  PHE A CB    1 
ATOM   5971  C  CG    . PHE A 1  777  ? -22.959 -77.538  -18.866 1.00 142.17 ? 777  PHE A CG    1 
ATOM   5972  C  CD1   . PHE A 1  777  ? -22.289 -76.831  -19.851 1.00 153.95 ? 777  PHE A CD1   1 
ATOM   5973  C  CD2   . PHE A 1  777  ? -23.019 -78.915  -18.974 1.00 141.16 ? 777  PHE A CD2   1 
ATOM   5974  C  CE1   . PHE A 1  777  ? -21.672 -77.492  -20.905 1.00 152.00 ? 777  PHE A CE1   1 
ATOM   5975  C  CE2   . PHE A 1  777  ? -22.406 -79.574  -20.033 1.00 132.60 ? 777  PHE A CE2   1 
ATOM   5976  C  CZ    . PHE A 1  777  ? -21.736 -78.861  -20.993 1.00 129.04 ? 777  PHE A CZ    1 
ATOM   5977  N  N     . GLY A 1  778  ? -24.099 -73.290  -16.778 1.00 121.54 ? 778  GLY A N     1 
ATOM   5978  C  CA    . GLY A 1  778  ? -24.997 -72.470  -15.983 1.00 125.95 ? 778  GLY A CA    1 
ATOM   5979  C  C     . GLY A 1  778  ? -26.450 -72.800  -16.257 1.00 120.31 ? 778  GLY A C     1 
ATOM   5980  O  O     . GLY A 1  778  ? -27.266 -72.873  -15.334 1.00 115.23 ? 778  GLY A O     1 
ATOM   5981  N  N     . PHE A 1  779  ? -26.797 -72.963  -17.534 1.00 117.74 ? 779  PHE A N     1 
ATOM   5982  C  CA    . PHE A 1  779  ? -28.047 -73.583  -17.936 1.00 118.77 ? 779  PHE A CA    1 
ATOM   5983  C  C     . PHE A 1  779  ? -27.919 -75.099  -17.853 1.00 129.96 ? 779  PHE A C     1 
ATOM   5984  O  O     . PHE A 1  779  ? -26.835 -75.651  -17.648 1.00 154.13 ? 779  PHE A O     1 
ATOM   5985  C  CB    . PHE A 1  779  ? -28.424 -73.184  -19.366 1.00 138.94 ? 779  PHE A CB    1 
ATOM   5986  C  CG    . PHE A 1  779  ? -28.688 -71.715  -19.550 1.00 144.92 ? 779  PHE A CG    1 
ATOM   5987  C  CD1   . PHE A 1  779  ? -29.896 -71.163  -19.153 1.00 136.59 ? 779  PHE A CD1   1 
ATOM   5988  C  CD2   . PHE A 1  779  ? -27.726 -70.882  -20.101 1.00 137.75 ? 779  PHE A CD2   1 
ATOM   5989  C  CE1   . PHE A 1  779  ? -30.149 -69.815  -19.326 1.00 128.57 ? 779  PHE A CE1   1 
ATOM   5990  C  CE2   . PHE A 1  779  ? -27.971 -69.535  -20.253 1.00 122.51 ? 779  PHE A CE2   1 
ATOM   5991  C  CZ    . PHE A 1  779  ? -29.183 -69.004  -19.871 1.00 132.68 ? 779  PHE A CZ    1 
ATOM   5992  N  N     . VAL A 1  780  ? -29.040 -75.784  -18.058 1.00 137.43 ? 780  VAL A N     1 
ATOM   5993  C  CA    . VAL A 1  780  ? -29.032 -77.240  -18.004 1.00 135.26 ? 780  VAL A CA    1 
ATOM   5994  C  C     . VAL A 1  780  ? -28.273 -77.766  -19.220 1.00 130.79 ? 780  VAL A C     1 
ATOM   5995  O  O     . VAL A 1  780  ? -28.725 -77.614  -20.359 1.00 135.78 ? 780  VAL A O     1 
ATOM   5996  C  CB    . VAL A 1  780  ? -30.453 -77.807  -17.943 1.00 125.88 ? 780  VAL A CB    1 
ATOM   5997  C  CG1   . VAL A 1  780  ? -30.444 -79.273  -18.279 1.00 144.94 ? 780  VAL A CG1   1 
ATOM   5998  C  CG2   . VAL A 1  780  ? -31.048 -77.605  -16.562 1.00 125.35 ? 780  VAL A CG2   1 
ATOM   5999  N  N     . ASP A 1  781  ? -27.101 -78.354  -18.979 1.00 124.09 ? 781  ASP A N     1 
ATOM   6000  C  CA    . ASP A 1  781  ? -26.326 -79.098  -19.968 1.00 133.81 ? 781  ASP A CA    1 
ATOM   6001  C  C     . ASP A 1  781  ? -25.786 -78.226  -21.103 1.00 133.91 ? 781  ASP A C     1 
ATOM   6002  O  O     . ASP A 1  781  ? -25.480 -78.735  -22.188 1.00 132.85 ? 781  ASP A O     1 
ATOM   6003  C  CB    . ASP A 1  781  ? -27.139 -80.279  -20.515 1.00 138.22 ? 781  ASP A CB    1 
ATOM   6004  C  CG    . ASP A 1  781  ? -27.244 -81.435  -19.505 1.00 156.08 ? 781  ASP A CG    1 
ATOM   6005  O  OD1   . ASP A 1  781  ? -26.470 -81.457  -18.525 1.00 159.18 ? 781  ASP A OD1   1 
ATOM   6006  O  OD2   . ASP A 1  781  ? -28.108 -82.324  -19.676 1.00 167.53 ? 781  ASP A OD2   1 
ATOM   6007  N  N     . ARG A 1  782  ? -25.623 -76.926  -20.871 1.00 130.64 ? 782  ARG A N     1 
ATOM   6008  C  CA    . ARG A 1  782  ? -25.046 -76.036  -21.872 1.00 131.28 ? 782  ARG A CA    1 
ATOM   6009  C  C     . ARG A 1  782  ? -24.648 -74.733  -21.187 1.00 134.83 ? 782  ARG A C     1 
ATOM   6010  O  O     . ARG A 1  782  ? -25.143 -74.404  -20.104 1.00 118.22 ? 782  ARG A O     1 
ATOM   6011  C  CB    . ARG A 1  782  ? -26.029 -75.770  -23.019 1.00 122.74 ? 782  ARG A CB    1 
ATOM   6012  C  CG    . ARG A 1  782  ? -27.438 -75.459  -22.548 1.00 123.25 ? 782  ARG A CG    1 
ATOM   6013  C  CD    . ARG A 1  782  ? -28.422 -75.463  -23.703 1.00 125.04 ? 782  ARG A CD    1 
ATOM   6014  N  NE    . ARG A 1  782  ? -29.750 -75.047  -23.270 1.00 125.47 ? 782  ARG A NE    1 
ATOM   6015  C  CZ    . ARG A 1  782  ? -30.635 -74.474  -24.078 1.00 134.02 ? 782  ARG A CZ    1 
ATOM   6016  N  NH1   . ARG A 1  782  ? -30.317 -74.258  -25.347 1.00 126.72 ? 782  ARG A NH1   1 
ATOM   6017  N  NH2   . ARG A 1  782  ? -31.828 -74.110  -23.624 1.00 137.73 ? 782  ARG A NH2   1 
ATOM   6018  N  N     . THR A 1  783  ? -23.751 -73.987  -21.839 1.00 128.15 ? 783  THR A N     1 
ATOM   6019  C  CA    . THR A 1  783  ? -23.267 -72.726  -21.283 1.00 127.67 ? 783  THR A CA    1 
ATOM   6020  C  C     . THR A 1  783  ? -24.133 -71.533  -21.679 1.00 129.98 ? 783  THR A C     1 
ATOM   6021  O  O     . THR A 1  783  ? -24.283 -70.599  -20.884 1.00 113.74 ? 783  THR A O     1 
ATOM   6022  C  CB    . THR A 1  783  ? -21.820 -72.470  -21.724 1.00 129.24 ? 783  THR A CB    1 
ATOM   6023  O  OG1   . THR A 1  783  ? -21.763 -72.338  -23.147 1.00 131.23 ? 783  THR A OG1   1 
ATOM   6024  C  CG2   . THR A 1  783  ? -20.935 -73.638  -21.328 1.00 138.81 ? 783  THR A CG2   1 
ATOM   6025  N  N     . LEU A 1  784  ? -24.700 -71.544  -22.884 1.00 141.86 ? 784  LEU A N     1 
ATOM   6026  C  CA    . LEU A 1  784  ? -25.575 -70.495  -23.384 1.00 116.55 ? 784  LEU A CA    1 
ATOM   6027  C  C     . LEU A 1  784  ? -26.714 -71.109  -24.188 1.00 137.18 ? 784  LEU A C     1 
ATOM   6028  O  O     . LEU A 1  784  ? -26.544 -72.172  -24.800 1.00 156.33 ? 784  LEU A O     1 
ATOM   6029  C  CB    . LEU A 1  784  ? -24.769 -69.528  -24.266 1.00 123.54 ? 784  LEU A CB    1 
ATOM   6030  C  CG    . LEU A 1  784  ? -23.693 -68.718  -23.527 1.00 114.57 ? 784  LEU A CG    1 
ATOM   6031  C  CD1   . LEU A 1  784  ? -22.807 -67.912  -24.476 1.00 112.49 ? 784  LEU A CD1   1 
ATOM   6032  C  CD2   . LEU A 1  784  ? -24.358 -67.807  -22.517 1.00 115.25 ? 784  LEU A CD2   1 
ATOM   6033  N  N     . PRO A 1  785  ? -27.882 -70.457  -24.218 1.00 129.38 ? 785  PRO A N     1 
ATOM   6034  C  CA    . PRO A 1  785  ? -29.016 -70.999  -24.983 1.00 123.31 ? 785  PRO A CA    1 
ATOM   6035  C  C     . PRO A 1  785  ? -28.801 -71.017  -26.487 1.00 126.96 ? 785  PRO A C     1 
ATOM   6036  O  O     . PRO A 1  785  ? -29.663 -71.532  -27.212 1.00 131.88 ? 785  PRO A O     1 
ATOM   6037  C  CB    . PRO A 1  785  ? -30.172 -70.065  -24.599 1.00 121.21 ? 785  PRO A CB    1 
ATOM   6038  C  CG    . PRO A 1  785  ? -29.518 -68.818  -24.142 1.00 118.89 ? 785  PRO A CG    1 
ATOM   6039  C  CD    . PRO A 1  785  ? -28.237 -69.218  -23.508 1.00 119.91 ? 785  PRO A CD    1 
ATOM   6040  N  N     . HIS A 1  786  ? -27.677 -70.488  -26.968 1.00 133.84 ? 786  HIS A N     1 
ATOM   6041  C  CA    . HIS A 1  786  ? -27.304 -70.545  -28.369 1.00 140.82 ? 786  HIS A CA    1 
ATOM   6042  C  C     . HIS A 1  786  ? -26.541 -71.814  -28.701 1.00 138.57 ? 786  HIS A C     1 
ATOM   6043  O  O     . HIS A 1  786  ? -25.920 -71.894  -29.766 1.00 138.41 ? 786  HIS A O     1 
ATOM   6044  C  CB    . HIS A 1  786  ? -26.449 -69.328  -28.717 1.00 144.75 ? 786  HIS A CB    1 
ATOM   6045  C  CG    . HIS A 1  786  ? -26.973 -68.047  -28.150 1.00 137.82 ? 786  HIS A CG    1 
ATOM   6046  N  ND1   . HIS A 1  786  ? -27.036 -67.810  -26.794 1.00 133.92 ? 786  HIS A ND1   1 
ATOM   6047  C  CD2   . HIS A 1  786  ? -27.505 -66.956  -28.748 1.00 144.20 ? 786  HIS A CD2   1 
ATOM   6048  C  CE1   . HIS A 1  786  ? -27.558 -66.615  -26.581 1.00 143.73 ? 786  HIS A CE1   1 
ATOM   6049  N  NE2   . HIS A 1  786  ? -27.853 -66.077  -27.751 1.00 146.87 ? 786  HIS A NE2   1 
ATOM   6050  N  N     . PHE A 1  787  ? -26.638 -72.829  -27.845 1.00 141.79 ? 787  PHE A N     1 
ATOM   6051  C  CA    . PHE A 1  787  ? -25.873 -74.058  -27.972 1.00 143.61 ? 787  PHE A CA    1 
ATOM   6052  C  C     . PHE A 1  787  ? -26.786 -75.239  -27.702 1.00 148.77 ? 787  PHE A C     1 
ATOM   6053  O  O     . PHE A 1  787  ? -27.700 -75.166  -26.874 1.00 126.60 ? 787  PHE A O     1 
ATOM   6054  C  CB    . PHE A 1  787  ? -24.686 -74.076  -26.980 1.00 133.52 ? 787  PHE A CB    1 
ATOM   6055  C  CG    . PHE A 1  787  ? -23.491 -73.288  -27.438 1.00 134.15 ? 787  PHE A CG    1 
ATOM   6056  C  CD1   . PHE A 1  787  ? -23.298 -73.022  -28.779 1.00 154.81 ? 787  PHE A CD1   1 
ATOM   6057  C  CD2   . PHE A 1  787  ? -22.599 -72.752  -26.526 1.00 132.19 ? 787  PHE A CD2   1 
ATOM   6058  C  CE1   . PHE A 1  787  ? -22.209 -72.287  -29.212 1.00 150.42 ? 787  PHE A CE1   1 
ATOM   6059  C  CE2   . PHE A 1  787  ? -21.511 -71.999  -26.960 1.00 125.97 ? 787  PHE A CE2   1 
ATOM   6060  C  CZ    . PHE A 1  787  ? -21.319 -71.774  -28.303 1.00 134.93 ? 787  PHE A CZ    1 
ATOM   6061  N  N     . SER A 1  788  ? -26.511 -76.337  -28.394 1.00 143.44 ? 788  SER A N     1 
ATOM   6062  C  CA    . SER A 1  788  ? -27.221 -77.563  -28.103 1.00 136.70 ? 788  SER A CA    1 
ATOM   6063  C  C     . SER A 1  788  ? -26.677 -78.165  -26.813 1.00 145.45 ? 788  SER A C     1 
ATOM   6064  O  O     . SER A 1  788  ? -25.603 -77.798  -26.328 1.00 151.09 ? 788  SER A O     1 
ATOM   6065  C  CB    . SER A 1  788  ? -27.101 -78.541  -29.269 1.00 138.30 ? 788  SER A CB    1 
ATOM   6066  O  OG    . SER A 1  788  ? -28.148 -78.327  -30.205 1.00 137.80 ? 788  SER A OG    1 
ATOM   6067  N  N     . LYS A 1  789  ? -27.453 -79.075  -26.236 1.00 153.33 ? 789  LYS A N     1 
ATOM   6068  C  CA    . LYS A 1  789  ? -27.095 -79.639  -24.944 1.00 144.92 ? 789  LYS A CA    1 
ATOM   6069  C  C     . LYS A 1  789  ? -25.929 -80.618  -25.083 1.00 151.34 ? 789  LYS A C     1 
ATOM   6070  O  O     . LYS A 1  789  ? -25.647 -81.156  -26.162 1.00 133.88 ? 789  LYS A O     1 
ATOM   6071  C  CB    . LYS A 1  789  ? -28.305 -80.326  -24.312 1.00 132.33 ? 789  LYS A CB    1 
ATOM   6072  C  CG    . LYS A 1  789  ? -29.294 -79.360  -23.669 1.00 130.85 ? 789  LYS A CG    1 
ATOM   6073  C  CD    . LYS A 1  789  ? -30.476 -80.089  -23.037 1.00 145.02 ? 789  LYS A CD    1 
ATOM   6074  C  CE    . LYS A 1  789  ? -31.353 -79.119  -22.261 1.00 144.46 ? 789  LYS A CE    1 
ATOM   6075  N  NZ    . LYS A 1  789  ? -32.421 -79.799  -21.486 1.00 132.97 ? 789  LYS A NZ    1 
ATOM   6076  N  N     . ASP A 1  790  ? -25.257 -80.849  -23.953 1.00 166.00 ? 790  ASP A N     1 
ATOM   6077  C  CA    . ASP A 1  790  ? -24.090 -81.732  -23.873 1.00 158.36 ? 790  ASP A CA    1 
ATOM   6078  C  C     . ASP A 1  790  ? -23.051 -81.373  -24.934 1.00 149.17 ? 790  ASP A C     1 
ATOM   6079  O  O     . ASP A 1  790  ? -22.573 -82.222  -25.690 1.00 131.37 ? 790  ASP A O     1 
ATOM   6080  C  CB    . ASP A 1  790  ? -24.510 -83.200  -23.961 1.00 157.68 ? 790  ASP A CB    1 
ATOM   6081  C  CG    . ASP A 1  790  ? -25.401 -83.616  -22.801 1.00 154.95 ? 790  ASP A CG    1 
ATOM   6082  O  OD1   . ASP A 1  790  ? -25.274 -83.008  -21.720 1.00 149.50 ? 790  ASP A OD1   1 
ATOM   6083  O  OD2   . ASP A 1  790  ? -26.272 -84.495  -22.980 1.00 145.03 ? 790  ASP A OD2   1 
ATOM   6084  N  N     . ASP A 1  791  ? -22.715 -80.081  -24.994 1.00 149.12 ? 791  ASP A N     1 
ATOM   6085  C  CA    . ASP A 1  791  ? -21.780 -79.539  -25.977 1.00 144.23 ? 791  ASP A CA    1 
ATOM   6086  C  C     . ASP A 1  791  ? -20.495 -79.213  -25.221 1.00 145.14 ? 791  ASP A C     1 
ATOM   6087  O  O     . ASP A 1  791  ? -20.384 -78.158  -24.591 1.00 153.54 ? 791  ASP A O     1 
ATOM   6088  C  CB    . ASP A 1  791  ? -22.363 -78.317  -26.696 1.00 150.72 ? 791  ASP A CB    1 
ATOM   6089  C  CG    . ASP A 1  791  ? -21.539 -77.897  -27.919 1.00 146.01 ? 791  ASP A CG    1 
ATOM   6090  O  OD1   . ASP A 1  791  ? -20.362 -78.290  -28.005 1.00 142.92 ? 791  ASP A OD1   1 
ATOM   6091  O  OD2   . ASP A 1  791  ? -22.067 -77.188  -28.806 1.00 140.07 ? 791  ASP A OD2   1 
ATOM   6092  N  N     . TYR A 1  792  ? -19.527 -80.129  -25.285 1.00 150.15 ? 792  TYR A N     1 
ATOM   6093  C  CA    . TYR A 1  792  ? -18.234 -79.959  -24.637 1.00 134.43 ? 792  TYR A CA    1 
ATOM   6094  C  C     . TYR A 1  792  ? -17.195 -79.394  -25.586 1.00 140.41 ? 792  TYR A C     1 
ATOM   6095  O  O     . TYR A 1  792  ? -16.005 -79.381  -25.252 1.00 123.13 ? 792  TYR A O     1 
ATOM   6096  C  CB    . TYR A 1  792  ? -17.738 -81.295  -24.076 1.00 124.54 ? 792  TYR A CB    1 
ATOM   6097  C  CG    . TYR A 1  792  ? -18.546 -81.796  -22.905 1.00 133.18 ? 792  TYR A CG    1 
ATOM   6098  C  CD1   . TYR A 1  792  ? -18.275 -81.366  -21.623 1.00 140.54 ? 792  TYR A CD1   1 
ATOM   6099  C  CD2   . TYR A 1  792  ? -19.580 -82.705  -23.082 1.00 149.68 ? 792  TYR A CD2   1 
ATOM   6100  C  CE1   . TYR A 1  792  ? -19.015 -81.811  -20.542 1.00 147.09 ? 792  TYR A CE1   1 
ATOM   6101  C  CE2   . TYR A 1  792  ? -20.327 -83.159  -22.001 1.00 155.76 ? 792  TYR A CE2   1 
ATOM   6102  C  CZ    . TYR A 1  792  ? -20.035 -82.705  -20.730 1.00 154.72 ? 792  TYR A CZ    1 
ATOM   6103  O  OH    . TYR A 1  792  ? -20.753 -83.130  -19.633 1.00 152.18 ? 792  TYR A OH    1 
ATOM   6104  N  N     . SER A 1  793  ? -17.634 -78.843  -26.720 1.00 154.12 ? 793  SER A N     1 
ATOM   6105  C  CA    . SER A 1  793  ? -16.725 -78.335  -27.731 1.00 152.53 ? 793  SER A CA    1 
ATOM   6106  C  C     . SER A 1  793  ? -15.924 -77.164  -27.172 1.00 141.06 ? 793  SER A C     1 
ATOM   6107  O  O     . SER A 1  793  ? -16.305 -76.574  -26.160 1.00 155.48 ? 793  SER A O     1 
ATOM   6108  C  CB    . SER A 1  793  ? -17.511 -77.905  -28.973 1.00 158.47 ? 793  SER A CB    1 
ATOM   6109  O  OG    . SER A 1  793  ? -18.475 -76.911  -28.657 1.00 153.42 ? 793  SER A OG    1 
ATOM   6110  N  N     . PRO A 1  794  ? -14.791 -76.826  -27.805 1.00 144.53 ? 794  PRO A N     1 
ATOM   6111  C  CA    . PRO A 1  794  ? -13.978 -75.704  -27.285 1.00 153.00 ? 794  PRO A CA    1 
ATOM   6112  C  C     . PRO A 1  794  ? -14.706 -74.371  -27.276 1.00 148.10 ? 794  PRO A C     1 
ATOM   6113  O  O     . PRO A 1  794  ? -14.696 -73.660  -26.258 1.00 139.70 ? 794  PRO A O     1 
ATOM   6114  C  CB    . PRO A 1  794  ? -12.760 -75.699  -28.224 1.00 130.45 ? 794  PRO A CB    1 
ATOM   6115  C  CG    . PRO A 1  794  ? -13.206 -76.446  -29.455 1.00 124.72 ? 794  PRO A CG    1 
ATOM   6116  C  CD    . PRO A 1  794  ? -14.144 -77.490  -28.952 1.00 137.95 ? 794  PRO A CD    1 
ATOM   6117  N  N     . GLU A 1  795  ? -15.358 -74.025  -28.385 1.00 142.03 ? 795  GLU A N     1 
ATOM   6118  C  CA    . GLU A 1  795  ? -16.094 -72.780  -28.537 1.00 119.93 ? 795  GLU A CA    1 
ATOM   6119  C  C     . GLU A 1  795  ? -17.396 -72.757  -27.744 1.00 129.20 ? 795  GLU A C     1 
ATOM   6120  O  O     . GLU A 1  795  ? -18.144 -71.780  -27.850 1.00 141.74 ? 795  GLU A O     1 
ATOM   6121  C  CB    . GLU A 1  795  ? -16.367 -72.526  -30.026 1.00 126.90 ? 795  GLU A CB    1 
ATOM   6122  C  CG    . GLU A 1  795  ? -17.256 -73.572  -30.725 1.00 159.64 ? 795  GLU A CG    1 
ATOM   6123  C  CD    . GLU A 1  795  ? -16.504 -74.841  -31.146 1.00 175.19 ? 795  GLU A CD    1 
ATOM   6124  O  OE1   . GLU A 1  795  ? -15.270 -74.782  -31.331 1.00 175.64 ? 795  GLU A OE1   1 
ATOM   6125  O  OE2   . GLU A 1  795  ? -17.147 -75.904  -31.283 1.00 173.76 ? 795  GLU A OE2   1 
ATOM   6126  N  N     . SER A 1  796  ? -17.683 -73.797  -26.956 1.00 134.01 ? 796  SER A N     1 
ATOM   6127  C  CA    . SER A 1  796  ? -18.831 -73.833  -26.053 1.00 131.46 ? 796  SER A CA    1 
ATOM   6128  C  C     . SER A 1  796  ? -18.444 -73.628  -24.601 1.00 121.89 ? 796  SER A C     1 
ATOM   6129  O  O     . SER A 1  796  ? -19.154 -72.932  -23.872 1.00 114.81 ? 796  SER A O     1 
ATOM   6130  C  CB    . SER A 1  796  ? -19.578 -75.169  -26.163 1.00 131.74 ? 796  SER A CB    1 
ATOM   6131  O  OG    . SER A 1  796  ? -20.547 -75.299  -25.125 1.00 130.49 ? 796  SER A OG    1 
ATOM   6132  N  N     . LYS A 1  797  ? -17.334 -74.219  -24.167 1.00 128.57 ? 797  LYS A N     1 
ATOM   6133  C  CA    . LYS A 1  797  ? -16.869 -74.101  -22.794 1.00 125.27 ? 797  LYS A CA    1 
ATOM   6134  C  C     . LYS A 1  797  ? -15.978 -72.891  -22.563 1.00 122.53 ? 797  LYS A C     1 
ATOM   6135  O  O     . LYS A 1  797  ? -15.410 -72.753  -21.475 1.00 137.45 ? 797  LYS A O     1 
ATOM   6136  C  CB    . LYS A 1  797  ? -16.146 -75.383  -22.377 1.00 140.95 ? 797  LYS A CB    1 
ATOM   6137  C  CG    . LYS A 1  797  ? -17.032 -76.621  -22.426 1.00 143.16 ? 797  LYS A CG    1 
ATOM   6138  C  CD    . LYS A 1  797  ? -17.957 -76.693  -21.218 1.00 128.71 ? 797  LYS A CD    1 
ATOM   6139  C  CE    . LYS A 1  797  ? -17.316 -77.419  -20.046 1.00 129.31 ? 797  LYS A CE    1 
ATOM   6140  N  NZ    . LYS A 1  797  ? -18.305 -77.722  -18.966 1.00 134.57 ? 797  LYS A NZ    1 
ATOM   6141  N  N     . GLY A 1  798  ? -15.836 -72.021  -23.553 1.00 111.53 ? 798  GLY A N     1 
ATOM   6142  C  CA    . GLY A 1  798  ? -15.237 -70.731  -23.305 1.00 121.25 ? 798  GLY A CA    1 
ATOM   6143  C  C     . GLY A 1  798  ? -13.851 -70.549  -23.879 1.00 133.38 ? 798  GLY A C     1 
ATOM   6144  O  O     . GLY A 1  798  ? -13.050 -69.793  -23.324 1.00 132.71 ? 798  GLY A O     1 
ATOM   6145  N  N     . PHE A 1  799  ? -13.567 -71.174  -25.017 1.00 132.47 ? 799  PHE A N     1 
ATOM   6146  C  CA    . PHE A 1  799  ? -12.291 -70.967  -25.687 1.00 118.85 ? 799  PHE A CA    1 
ATOM   6147  C  C     . PHE A 1  799  ? -12.460 -69.806  -26.655 1.00 121.09 ? 799  PHE A C     1 
ATOM   6148  O  O     . PHE A 1  799  ? -13.274 -69.879  -27.585 1.00 135.32 ? 799  PHE A O     1 
ATOM   6149  C  CB    . PHE A 1  799  ? -11.820 -72.219  -26.430 1.00 134.57 ? 799  PHE A CB    1 
ATOM   6150  C  CG    . PHE A 1  799  ? -10.524 -72.021  -27.181 1.00 132.75 ? 799  PHE A CG    1 
ATOM   6151  C  CD1   . PHE A 1  799  ? -9.320  -71.962  -26.509 1.00 127.78 ? 799  PHE A CD1   1 
ATOM   6152  C  CD2   . PHE A 1  799  ? -10.515 -71.858  -28.559 1.00 135.82 ? 799  PHE A CD2   1 
ATOM   6153  C  CE1   . PHE A 1  799  ? -8.134  -71.760  -27.197 1.00 130.88 ? 799  PHE A CE1   1 
ATOM   6154  C  CE2   . PHE A 1  799  ? -9.320  -71.652  -29.248 1.00 112.87 ? 799  PHE A CE2   1 
ATOM   6155  C  CZ    . PHE A 1  799  ? -8.140  -71.605  -28.565 1.00 111.80 ? 799  PHE A CZ    1 
ATOM   6156  N  N     . VAL A 1  800  ? -11.694 -68.738  -26.441 1.00 120.12 ? 800  VAL A N     1 
ATOM   6157  C  CA    . VAL A 1  800  ? -11.741 -67.565  -27.309 1.00 123.64 ? 800  VAL A CA    1 
ATOM   6158  C  C     . VAL A 1  800  ? -10.710 -67.774  -28.409 1.00 130.25 ? 800  VAL A C     1 
ATOM   6159  O  O     . VAL A 1  800  ? -9.503  -67.786  -28.149 1.00 149.69 ? 800  VAL A O     1 
ATOM   6160  C  CB    . VAL A 1  800  ? -11.469 -66.264  -26.539 1.00 109.03 ? 800  VAL A CB    1 
ATOM   6161  C  CG1   . VAL A 1  800  ? -11.595 -65.071  -27.472 1.00 105.68 ? 800  VAL A CG1   1 
ATOM   6162  C  CG2   . VAL A 1  800  ? -12.402 -66.124  -25.336 1.00 105.21 ? 800  VAL A CG2   1 
ATOM   6163  N  N     . GLU A 1  801  ? -11.189 -67.907  -29.641 1.00 124.73 ? 801  GLU A N     1 
ATOM   6164  C  CA    . GLU A 1  801  ? -10.316 -68.222  -30.755 1.00 131.51 ? 801  GLU A CA    1 
ATOM   6165  C  C     . GLU A 1  801  ? -9.777  -66.973  -31.430 1.00 129.92 ? 801  GLU A C     1 
ATOM   6166  O  O     . GLU A 1  801  ? -8.750  -67.042  -32.121 1.00 125.97 ? 801  GLU A O     1 
ATOM   6167  C  CB    . GLU A 1  801  ? -11.072 -69.074  -31.779 1.00 132.51 ? 801  GLU A CB    1 
ATOM   6168  C  CG    . GLU A 1  801  ? -10.180 -69.928  -32.657 1.00 137.60 ? 801  GLU A CG    1 
ATOM   6169  C  CD    . GLU A 1  801  ? -10.741 -70.084  -34.040 1.00 147.19 ? 801  GLU A CD    1 
ATOM   6170  O  OE1   . GLU A 1  801  ? -9.963  -70.399  -34.972 1.00 151.95 ? 801  GLU A OE1   1 
ATOM   6171  O  OE2   . GLU A 1  801  ? -11.953 -69.855  -34.198 1.00 153.45 ? 801  GLU A OE2   1 
ATOM   6172  N  N     . ASN A 1  802  ? -10.412 -65.832  -31.215 1.00 134.14 ? 802  ASN A N     1 
ATOM   6173  C  CA    . ASN A 1  802  ? -10.078 -64.606  -31.914 1.00 127.64 ? 802  ASN A CA    1 
ATOM   6174  C  C     . ASN A 1  802  ? -9.121  -63.763  -31.079 1.00 137.43 ? 802  ASN A C     1 
ATOM   6175  O  O     . ASN A 1  802  ? -9.118  -63.818  -29.845 1.00 112.64 ? 802  ASN A O     1 
ATOM   6176  C  CB    . ASN A 1  802  ? -11.348 -63.809  -32.232 1.00 119.32 ? 802  ASN A CB    1 
ATOM   6177  C  CG    . ASN A 1  802  ? -12.057 -64.313  -33.471 1.00 124.92 ? 802  ASN A CG    1 
ATOM   6178  O  OD1   . ASN A 1  802  ? -11.436 -64.483  -34.520 1.00 133.33 ? 802  ASN A OD1   1 
ATOM   6179  N  ND2   . ASN A 1  802  ? -13.355 -64.561  -33.359 1.00 133.52 ? 802  ASN A ND2   1 
ATOM   6180  N  N     . SER A 1  803  ? -8.294  -62.985  -31.778 1.00 151.58 ? 803  SER A N     1 
ATOM   6181  C  CA    . SER A 1  803  ? -7.422  -62.006  -31.151 1.00 133.73 ? 803  SER A CA    1 
ATOM   6182  C  C     . SER A 1  803  ? -8.216  -60.760  -30.788 1.00 117.62 ? 803  SER A C     1 
ATOM   6183  O  O     . SER A 1  803  ? -9.339  -60.548  -31.255 1.00 134.20 ? 803  SER A O     1 
ATOM   6184  C  CB    . SER A 1  803  ? -6.268  -61.631  -32.082 1.00 138.21 ? 803  SER A CB    1 
ATOM   6185  O  OG    . SER A 1  803  ? -6.732  -61.287  -33.381 1.00 143.71 ? 803  SER A OG    1 
ATOM   6186  N  N     . TYR A 1  804  ? -7.618  -59.916  -29.945 1.00 113.86 ? 804  TYR A N     1 
ATOM   6187  C  CA    . TYR A 1  804  ? -8.263  -58.641  -29.636 1.00 117.60 ? 804  TYR A CA    1 
ATOM   6188  C  C     . TYR A 1  804  ? -8.336  -57.748  -30.863 1.00 117.05 ? 804  TYR A C     1 
ATOM   6189  O  O     . TYR A 1  804  ? -9.205  -56.873  -30.948 1.00 109.43 ? 804  TYR A O     1 
ATOM   6190  C  CB    . TYR A 1  804  ? -7.545  -57.909  -28.506 1.00 102.74 ? 804  TYR A CB    1 
ATOM   6191  C  CG    . TYR A 1  804  ? -7.833  -58.465  -27.130 1.00 106.13 ? 804  TYR A CG    1 
ATOM   6192  C  CD1   . TYR A 1  804  ? -9.035  -58.212  -26.501 1.00 107.93 ? 804  TYR A CD1   1 
ATOM   6193  C  CD2   . TYR A 1  804  ? -6.888  -59.194  -26.440 1.00 110.49 ? 804  TYR A CD2   1 
ATOM   6194  C  CE1   . TYR A 1  804  ? -9.299  -58.704  -25.240 1.00 118.10 ? 804  TYR A CE1   1 
ATOM   6195  C  CE2   . TYR A 1  804  ? -7.149  -59.686  -25.177 1.00 100.50 ? 804  TYR A CE2   1 
ATOM   6196  C  CZ    . TYR A 1  804  ? -8.351  -59.438  -24.584 1.00 103.61 ? 804  TYR A CZ    1 
ATOM   6197  O  OH    . TYR A 1  804  ? -8.599  -59.933  -23.325 1.00 114.62 ? 804  TYR A OH    1 
ATOM   6198  N  N     . LEU A 1  805  ? -7.404  -57.928  -31.795 1.00 121.51 ? 805  LEU A N     1 
ATOM   6199  C  CA    . LEU A 1  805  ? -7.439  -57.181  -33.045 1.00 104.54 ? 805  LEU A CA    1 
ATOM   6200  C  C     . LEU A 1  805  ? -8.647  -57.573  -33.886 1.00 120.38 ? 805  LEU A C     1 
ATOM   6201  O  O     . LEU A 1  805  ? -9.341  -56.710  -34.433 1.00 132.08 ? 805  LEU A O     1 
ATOM   6202  C  CB    . LEU A 1  805  ? -6.146  -57.407  -33.821 1.00 103.75 ? 805  LEU A CB    1 
ATOM   6203  C  CG    . LEU A 1  805  ? -6.164  -56.789  -35.214 1.00 104.77 ? 805  LEU A CG    1 
ATOM   6204  C  CD1   . LEU A 1  805  ? -5.677  -55.367  -35.141 1.00 117.02 ? 805  LEU A CD1   1 
ATOM   6205  C  CD2   . LEU A 1  805  ? -5.324  -57.594  -36.191 1.00 143.22 ? 805  LEU A CD2   1 
ATOM   6206  N  N     . ARG A 1  806  ? -8.909  -58.876  -34.014 1.00 113.64 ? 806  ARG A N     1 
ATOM   6207  C  CA    . ARG A 1  806  ? -10.027 -59.323  -34.838 1.00 115.09 ? 806  ARG A CA    1 
ATOM   6208  C  C     . ARG A 1  806  ? -11.358 -59.014  -34.173 1.00 118.16 ? 806  ARG A C     1 
ATOM   6209  O  O     . ARG A 1  806  ? -12.263 -58.458  -34.804 1.00 138.15 ? 806  ARG A O     1 
ATOM   6210  C  CB    . ARG A 1  806  ? -9.915  -60.816  -35.149 1.00 136.52 ? 806  ARG A CB    1 
ATOM   6211  C  CG    . ARG A 1  806  ? -8.904  -61.115  -36.222 1.00 153.49 ? 806  ARG A CG    1 
ATOM   6212  C  CD    . ARG A 1  806  ? -9.000  -62.554  -36.681 1.00 159.35 ? 806  ARG A CD    1 
ATOM   6213  N  NE    . ARG A 1  806  ? -8.268  -62.735  -37.926 1.00 160.74 ? 806  ARG A NE    1 
ATOM   6214  C  CZ    . ARG A 1  806  ? -8.104  -63.904  -38.529 1.00 177.62 ? 806  ARG A CZ    1 
ATOM   6215  N  NH1   . ARG A 1  806  ? -8.615  -65.006  -37.999 1.00 174.33 ? 806  ARG A NH1   1 
ATOM   6216  N  NH2   . ARG A 1  806  ? -7.426  -63.969  -39.665 1.00 193.22 ? 806  ARG A NH2   1 
ATOM   6217  N  N     . GLY A 1  807  ? -11.501 -59.374  -32.903 1.00 108.99 ? 807  GLY A N     1 
ATOM   6218  C  CA    . GLY A 1  807  ? -12.750 -59.036  -32.232 1.00 117.99 ? 807  GLY A CA    1 
ATOM   6219  C  C     . GLY A 1  807  ? -13.465 -60.293  -31.777 1.00 137.21 ? 807  GLY A C     1 
ATOM   6220  O  O     . GLY A 1  807  ? -13.624 -61.273  -32.512 1.00 152.54 ? 807  GLY A O     1 
ATOM   6221  N  N     . LEU A 1  808  ? -13.920 -60.245  -30.534 1.00 122.74 ? 808  LEU A N     1 
ATOM   6222  C  CA    . LEU A 1  808  ? -14.621 -61.361  -29.927 1.00 118.26 ? 808  LEU A CA    1 
ATOM   6223  C  C     . LEU A 1  808  ? -16.032 -61.509  -30.488 1.00 124.42 ? 808  LEU A C     1 
ATOM   6224  O  O     . LEU A 1  808  ? -16.654 -60.544  -30.938 1.00 137.25 ? 808  LEU A O     1 
ATOM   6225  C  CB    . LEU A 1  808  ? -14.674 -61.178  -28.409 1.00 104.61 ? 808  LEU A CB    1 
ATOM   6226  C  CG    . LEU A 1  808  ? -13.491 -61.760  -27.630 1.00 103.82 ? 808  LEU A CG    1 
ATOM   6227  C  CD1   . LEU A 1  808  ? -12.193 -61.087  -28.000 1.00 103.02 ? 808  LEU A CD1   1 
ATOM   6228  C  CD2   . LEU A 1  808  ? -13.729 -61.661  -26.135 1.00 102.59 ? 808  LEU A CD2   1 
ATOM   6229  N  N     . THR A 1  809  ? -16.526 -62.746  -30.474 1.00 125.20 ? 809  THR A N     1 
ATOM   6230  C  CA    . THR A 1  809  ? -17.917 -62.991  -30.801 1.00 115.43 ? 809  THR A CA    1 
ATOM   6231  C  C     . THR A 1  809  ? -18.719 -62.790  -29.527 1.00 131.21 ? 809  THR A C     1 
ATOM   6232  O  O     . THR A 1  809  ? -18.150 -62.743  -28.432 1.00 150.24 ? 809  THR A O     1 
ATOM   6233  C  CB    . THR A 1  809  ? -18.106 -64.413  -31.322 1.00 124.28 ? 809  THR A CB    1 
ATOM   6234  O  OG1   . THR A 1  809  ? -18.128 -65.319  -30.213 1.00 129.97 ? 809  THR A OG1   1 
ATOM   6235  C  CG2   . THR A 1  809  ? -16.968 -64.805  -32.257 1.00 138.97 ? 809  THR A CG2   1 
ATOM   6236  N  N     . PRO A 1  810  ? -20.033 -62.614  -29.624 1.00 123.55 ? 810  PRO A N     1 
ATOM   6237  C  CA    . PRO A 1  810  ? -20.826 -62.419  -28.399 1.00 122.22 ? 810  PRO A CA    1 
ATOM   6238  C  C     . PRO A 1  810  ? -20.613 -63.505  -27.362 1.00 127.11 ? 810  PRO A C     1 
ATOM   6239  O  O     . PRO A 1  810  ? -20.617 -63.228  -26.150 1.00 117.97 ? 810  PRO A O     1 
ATOM   6240  C  CB    . PRO A 1  810  ? -22.265 -62.413  -28.926 1.00 122.76 ? 810  PRO A CB    1 
ATOM   6241  C  CG    . PRO A 1  810  ? -22.133 -61.932  -30.347 1.00 111.57 ? 810  PRO A CG    1 
ATOM   6242  C  CD    . PRO A 1  810  ? -20.839 -62.460  -30.849 1.00 116.98 ? 810  PRO A CD    1 
ATOM   6243  N  N     . GLN A 1  811  ? -20.321 -64.722  -27.819 1.00 131.12 ? 811  GLN A N     1 
ATOM   6244  C  CA    . GLN A 1  811  ? -20.043 -65.823  -26.911 1.00 118.18 ? 811  GLN A CA    1 
ATOM   6245  C  C     . GLN A 1  811  ? -18.679 -65.642  -26.256 1.00 122.12 ? 811  GLN A C     1 
ATOM   6246  O  O     . GLN A 1  811  ? -18.554 -65.694  -25.022 1.00 113.16 ? 811  GLN A O     1 
ATOM   6247  C  CB    . GLN A 1  811  ? -20.099 -67.131  -27.699 1.00 112.45 ? 811  GLN A CB    1 
ATOM   6248  C  CG    . GLN A 1  811  ? -21.474 -67.436  -28.306 1.00 124.89 ? 811  GLN A CG    1 
ATOM   6249  C  CD    . GLN A 1  811  ? -21.539 -67.131  -29.802 1.00 142.14 ? 811  GLN A CD    1 
ATOM   6250  O  OE1   . GLN A 1  811  ? -20.905 -67.800  -30.621 1.00 159.68 ? 811  GLN A OE1   1 
ATOM   6251  N  NE2   . GLN A 1  811  ? -22.276 -66.091  -30.155 1.00 139.10 ? 811  GLN A NE2   1 
ATOM   6252  N  N     . GLU A 1  812  ? -17.654 -65.353  -27.064 1.00 116.83 ? 812  GLU A N     1 
ATOM   6253  C  CA    . GLU A 1  812  ? -16.334 -65.110  -26.498 1.00 117.21 ? 812  GLU A CA    1 
ATOM   6254  C  C     . GLU A 1  812  ? -16.384 -63.889  -25.597 1.00 127.19 ? 812  GLU A C     1 
ATOM   6255  O  O     . GLU A 1  812  ? -15.715 -63.843  -24.559 1.00 120.47 ? 812  GLU A O     1 
ATOM   6256  C  CB    . GLU A 1  812  ? -15.301 -64.909  -27.610 1.00 107.40 ? 812  GLU A CB    1 
ATOM   6257  C  CG    . GLU A 1  812  ? -15.386 -65.905  -28.754 1.00 116.26 ? 812  GLU A CG    1 
ATOM   6258  C  CD    . GLU A 1  812  ? -14.277 -65.728  -29.777 1.00 133.35 ? 812  GLU A CD    1 
ATOM   6259  O  OE1   . GLU A 1  812  ? -14.270 -64.700  -30.483 1.00 145.66 ? 812  GLU A OE1   1 
ATOM   6260  O  OE2   . GLU A 1  812  ? -13.422 -66.629  -29.893 1.00 141.31 ? 812  GLU A OE2   1 
ATOM   6261  N  N     . PHE A 1  813  ? -17.186 -62.888  -25.980 1.00 112.41 ? 813  PHE A N     1 
ATOM   6262  C  CA    . PHE A 1  813  ? -17.262 -61.659  -25.202 1.00 106.57 ? 813  PHE A CA    1 
ATOM   6263  C  C     . PHE A 1  813  ? -17.860 -61.931  -23.832 1.00 118.37 ? 813  PHE A C     1 
ATOM   6264  O  O     . PHE A 1  813  ? -17.379 -61.411  -22.813 1.00 128.77 ? 813  PHE A O     1 
ATOM   6265  C  CB    . PHE A 1  813  ? -18.076 -60.589  -25.937 1.00 104.41 ? 813  PHE A CB    1 
ATOM   6266  C  CG    . PHE A 1  813  ? -18.134 -59.261  -25.199 1.00 110.70 ? 813  PHE A CG    1 
ATOM   6267  C  CD1   . PHE A 1  813  ? -17.103 -58.335  -25.305 1.00 104.82 ? 813  PHE A CD1   1 
ATOM   6268  C  CD2   . PHE A 1  813  ? -19.222 -58.941  -24.401 1.00 102.11 ? 813  PHE A CD2   1 
ATOM   6269  C  CE1   . PHE A 1  813  ? -17.158 -57.138  -24.622 1.00 100.55 ? 813  PHE A CE1   1 
ATOM   6270  C  CE2   . PHE A 1  813  ? -19.276 -57.733  -23.719 1.00 100.73 ? 813  PHE A CE2   1 
ATOM   6271  C  CZ    . PHE A 1  813  ? -18.247 -56.837  -23.833 1.00 104.10 ? 813  PHE A CZ    1 
ATOM   6272  N  N     . PHE A 1  814  ? -18.884 -62.781  -23.779 1.00 115.81 ? 814  PHE A N     1 
ATOM   6273  C  CA    . PHE A 1  814  ? -19.517 -63.032  -22.494 1.00 113.96 ? 814  PHE A CA    1 
ATOM   6274  C  C     . PHE A 1  814  ? -18.649 -63.924  -21.611 1.00 126.88 ? 814  PHE A C     1 
ATOM   6275  O  O     . PHE A 1  814  ? -18.494 -63.658  -20.410 1.00 121.67 ? 814  PHE A O     1 
ATOM   6276  C  CB    . PHE A 1  814  ? -20.887 -63.673  -22.713 1.00 105.75 ? 814  PHE A CB    1 
ATOM   6277  C  CG    . PHE A 1  814  ? -21.723 -63.754  -21.472 1.00 105.49 ? 814  PHE A CG    1 
ATOM   6278  C  CD1   . PHE A 1  814  ? -22.557 -62.720  -21.101 1.00 104.93 ? 814  PHE A CD1   1 
ATOM   6279  C  CD2   . PHE A 1  814  ? -21.626 -64.840  -20.636 1.00 117.99 ? 814  PHE A CD2   1 
ATOM   6280  C  CE1   . PHE A 1  814  ? -23.316 -62.805  -19.939 1.00 104.75 ? 814  PHE A CE1   1 
ATOM   6281  C  CE2   . PHE A 1  814  ? -22.375 -64.918  -19.478 1.00 133.06 ? 814  PHE A CE2   1 
ATOM   6282  C  CZ    . PHE A 1  814  ? -23.218 -63.898  -19.133 1.00 105.09 ? 814  PHE A CZ    1 
ATOM   6283  N  N     . PHE A 1  815  ? -18.021 -64.948  -22.201 1.00 108.17 ? 815  PHE A N     1 
ATOM   6284  C  CA    . PHE A 1  815  ? -17.126 -65.813  -21.432 1.00 104.36 ? 815  PHE A CA    1 
ATOM   6285  C  C     . PHE A 1  815  ? -15.932 -65.034  -20.891 1.00 125.42 ? 815  PHE A C     1 
ATOM   6286  O  O     . PHE A 1  815  ? -15.554 -65.178  -19.716 1.00 131.01 ? 815  PHE A O     1 
ATOM   6287  C  CB    . PHE A 1  815  ? -16.669 -66.979  -22.311 1.00 118.58 ? 815  PHE A CB    1 
ATOM   6288  C  CG    . PHE A 1  815  ? -17.798 -67.899  -22.738 1.00 124.95 ? 815  PHE A CG    1 
ATOM   6289  C  CD1   . PHE A 1  815  ? -18.976 -67.948  -22.024 1.00 107.98 ? 815  PHE A CD1   1 
ATOM   6290  C  CD2   . PHE A 1  815  ? -17.711 -68.641  -23.912 1.00 128.74 ? 815  PHE A CD2   1 
ATOM   6291  C  CE1   . PHE A 1  815  ? -20.018 -68.753  -22.439 1.00 111.06 ? 815  PHE A CE1   1 
ATOM   6292  C  CE2   . PHE A 1  815  ? -18.755 -69.449  -24.324 1.00 113.23 ? 815  PHE A CE2   1 
ATOM   6293  C  CZ    . PHE A 1  815  ? -19.908 -69.499  -23.585 1.00 115.97 ? 815  PHE A CZ    1 
ATOM   6294  N  N     . HIS A 1  816  ? -15.334 -64.189  -21.735 1.00 114.15 ? 816  HIS A N     1 
ATOM   6295  C  CA    . HIS A 1  816  ? -14.220 -63.358  -21.292 1.00 112.63 ? 816  HIS A CA    1 
ATOM   6296  C  C     . HIS A 1  816  ? -14.674 -62.418  -20.186 1.00 123.26 ? 816  HIS A C     1 
ATOM   6297  O  O     . HIS A 1  816  ? -13.900 -62.109  -19.266 1.00 137.74 ? 816  HIS A O     1 
ATOM   6298  C  CB    . HIS A 1  816  ? -13.635 -62.581  -22.481 1.00 100.44 ? 816  HIS A CB    1 
ATOM   6299  C  CG    . HIS A 1  816  ? -12.365 -61.848  -22.165 1.00 114.15 ? 816  HIS A CG    1 
ATOM   6300  N  ND1   . HIS A 1  816  ? -11.681 -62.024  -20.982 1.00 131.75 ? 816  HIS A ND1   1 
ATOM   6301  C  CD2   . HIS A 1  816  ? -11.689 -60.895  -22.852 1.00 120.13 ? 816  HIS A CD2   1 
ATOM   6302  C  CE1   . HIS A 1  816  ? -10.624 -61.230  -20.964 1.00 136.27 ? 816  HIS A CE1   1 
ATOM   6303  N  NE2   . HIS A 1  816  ? -10.609 -60.531  -22.084 1.00 117.33 ? 816  HIS A NE2   1 
ATOM   6304  N  N     . ALA A 1  817  ? -15.943 -61.994  -20.228 1.00 99.50  ? 817  ALA A N     1 
ATOM   6305  C  CA    . ALA A 1  817  ? -16.446 -61.146  -19.154 1.00 107.85 ? 817  ALA A CA    1 
ATOM   6306  C  C     . ALA A 1  817  ? -16.545 -61.924  -17.847 1.00 119.32 ? 817  ALA A C     1 
ATOM   6307  O  O     . ALA A 1  817  ? -16.244 -61.391  -16.768 1.00 137.69 ? 817  ALA A O     1 
ATOM   6308  C  CB    . ALA A 1  817  ? -17.804 -60.576  -19.551 1.00 110.07 ? 817  ALA A CB    1 
ATOM   6309  N  N     . MET A 1  818  ? -16.934 -63.194  -17.931 1.00 109.02 ? 818  MET A N     1 
ATOM   6310  C  CA    . MET A 1  818  ? -16.996 -64.044  -16.744 1.00 116.17 ? 818  MET A CA    1 
ATOM   6311  C  C     . MET A 1  818  ? -15.612 -64.224  -16.131 1.00 107.37 ? 818  MET A C     1 
ATOM   6312  O  O     . MET A 1  818  ? -15.435 -64.115  -14.902 1.00 108.41 ? 818  MET A O     1 
ATOM   6313  C  CB    . MET A 1  818  ? -17.589 -65.396  -17.121 1.00 122.97 ? 818  MET A CB    1 
ATOM   6314  C  CG    . MET A 1  818  ? -19.099 -65.402  -17.264 1.00 120.08 ? 818  MET A CG    1 
ATOM   6315  S  SD    . MET A 1  818  ? -19.673 -66.769  -18.295 1.00 126.63 ? 818  MET A SD    1 
ATOM   6316  C  CE    . MET A 1  818  ? -20.516 -67.801  -17.110 1.00 122.82 ? 818  MET A CE    1 
ATOM   6317  N  N     . GLY A 1  819  ? -14.612 -64.473  -16.984 1.00 110.88 ? 819  GLY A N     1 
ATOM   6318  C  CA    . GLY A 1  819  ? -13.269 -64.648  -16.474 1.00 131.57 ? 819  GLY A CA    1 
ATOM   6319  C  C     . GLY A 1  819  ? -12.730 -63.386  -15.838 1.00 126.07 ? 819  GLY A C     1 
ATOM   6320  O  O     . GLY A 1  819  ? -12.051 -63.444  -14.812 1.00 135.06 ? 819  GLY A O     1 
ATOM   6321  N  N     . GLY A 1  820  ? -13.039 -62.227  -16.425 1.00 105.37 ? 820  GLY A N     1 
ATOM   6322  C  CA    . GLY A 1  820  ? -12.559 -60.985  -15.846 1.00 119.65 ? 820  GLY A CA    1 
ATOM   6323  C  C     . GLY A 1  820  ? -13.203 -60.726  -14.492 1.00 112.08 ? 820  GLY A C     1 
ATOM   6324  O  O     . GLY A 1  820  ? -12.553 -60.235  -13.556 1.00 137.32 ? 820  GLY A O     1 
ATOM   6325  N  N     . ARG A 1  821  ? -14.497 -61.051  -14.374 1.00 94.38  ? 821  ARG A N     1 
ATOM   6326  C  CA    . ARG A 1  821  ? -15.161 -60.838  -13.111 1.00 116.70 ? 821  ARG A CA    1 
ATOM   6327  C  C     . ARG A 1  821  ? -14.564 -61.729  -12.036 1.00 133.45 ? 821  ARG A C     1 
ATOM   6328  O  O     . ARG A 1  821  ? -14.584 -61.366  -10.854 1.00 142.86 ? 821  ARG A O     1 
ATOM   6329  C  CB    . ARG A 1  821  ? -16.661 -61.068  -13.209 1.00 103.24 ? 821  ARG A CB    1 
ATOM   6330  C  CG    . ARG A 1  821  ? -17.454 -59.822  -13.470 1.00 109.00 ? 821  ARG A CG    1 
ATOM   6331  C  CD    . ARG A 1  821  ? -18.653 -59.775  -12.557 1.00 94.70  ? 821  ARG A CD    1 
ATOM   6332  N  NE    . ARG A 1  821  ? -19.706 -59.038  -13.239 1.00 108.59 ? 821  ARG A NE    1 
ATOM   6333  C  CZ    . ARG A 1  821  ? -20.993 -59.215  -12.985 1.00 153.55 ? 821  ARG A CZ    1 
ATOM   6334  N  NH1   . ARG A 1  821  ? -21.357 -60.106  -12.068 1.00 177.03 ? 821  ARG A NH1   1 
ATOM   6335  N  NH2   . ARG A 1  821  ? -21.911 -58.509  -13.629 1.00 157.91 ? 821  ARG A NH2   1 
ATOM   6336  N  N     . GLU A 1  822  ? -14.025 -62.892  -12.405 1.00 130.77 ? 822  GLU A N     1 
ATOM   6337  C  CA    . GLU A 1  822  ? -13.443 -63.714  -11.358 1.00 130.51 ? 822  GLU A CA    1 
ATOM   6338  C  C     . GLU A 1  822  ? -12.212 -63.039  -10.766 1.00 130.08 ? 822  GLU A C     1 
ATOM   6339  O  O     . GLU A 1  822  ? -12.003 -63.076  -9.547  1.00 123.42 ? 822  GLU A O     1 
ATOM   6340  C  CB    . GLU A 1  822  ? -13.059 -65.101  -11.877 1.00 141.19 ? 822  GLU A CB    1 
ATOM   6341  C  CG    . GLU A 1  822  ? -13.098 -66.160  -10.781 1.00 145.86 ? 822  GLU A CG    1 
ATOM   6342  C  CD    . GLU A 1  822  ? -12.241 -67.368  -11.084 1.00 140.22 ? 822  GLU A CD    1 
ATOM   6343  O  OE1   . GLU A 1  822  ? -11.775 -67.495  -12.236 1.00 142.56 ? 822  GLU A OE1   1 
ATOM   6344  O  OE2   . GLU A 1  822  ? -12.003 -68.170  -10.156 1.00 135.40 ? 822  GLU A OE2   1 
ATOM   6345  N  N     . GLY A 1  823  ? -11.417 -62.372  -11.599 1.00 127.44 ? 823  GLY A N     1 
ATOM   6346  C  CA    . GLY A 1  823  ? -10.249 -61.671  -11.095 1.00 112.62 ? 823  GLY A CA    1 
ATOM   6347  C  C     . GLY A 1  823  ? -10.584 -60.449  -10.262 1.00 114.54 ? 823  GLY A C     1 
ATOM   6348  O  O     . GLY A 1  823  ? -9.930  -60.171  -9.246  1.00 112.86 ? 823  GLY A O     1 
ATOM   6349  N  N     . LEU A 1  824  ? -11.610 -59.702  -10.672 1.00 110.42 ? 824  LEU A N     1 
ATOM   6350  C  CA    . LEU A 1  824  ? -12.024 -58.555  -9.871  1.00 102.87 ? 824  LEU A CA    1 
ATOM   6351  C  C     . LEU A 1  824  ? -12.635 -58.978  -8.539  1.00 93.53  ? 824  LEU A C     1 
ATOM   6352  O  O     . LEU A 1  824  ? -12.375 -58.356  -7.498  1.00 105.52 ? 824  LEU A O     1 
ATOM   6353  C  CB    . LEU A 1  824  ? -13.009 -57.697  -10.665 1.00 97.36  ? 824  LEU A CB    1 
ATOM   6354  C  CG    . LEU A 1  824  ? -12.354 -56.880  -11.779 1.00 111.47 ? 824  LEU A CG    1 
ATOM   6355  C  CD1   . LEU A 1  824  ? -13.382 -56.075  -12.533 1.00 91.34  ? 824  LEU A CD1   1 
ATOM   6356  C  CD2   . LEU A 1  824  ? -11.277 -55.962  -11.205 1.00 134.15 ? 824  LEU A CD2   1 
ATOM   6357  N  N     . ILE A 1  825  ? -13.418 -60.052  -8.537  1.00 102.61 ? 825  ILE A N     1 
ATOM   6358  C  CA    . ILE A 1  825  ? -13.924 -60.577  -7.274  1.00 96.54  ? 825  ILE A CA    1 
ATOM   6359  C  C     . ILE A 1  825  ? -12.768 -61.026  -6.399  1.00 105.33 ? 825  ILE A C     1 
ATOM   6360  O  O     . ILE A 1  825  ? -12.708 -60.696  -5.216  1.00 117.82 ? 825  ILE A O     1 
ATOM   6361  C  CB    . ILE A 1  825  ? -14.913 -61.728  -7.523  1.00 99.18  ? 825  ILE A CB    1 
ATOM   6362  C  CG1   . ILE A 1  825  ? -16.255 -61.202  -8.034  1.00 95.52  ? 825  ILE A CG1   1 
ATOM   6363  C  CG2   . ILE A 1  825  ? -15.151 -62.494  -6.237  1.00 92.25  ? 825  ILE A CG2   1 
ATOM   6364  C  CD1   . ILE A 1  825  ? -17.006 -62.203  -8.925  1.00 117.75 ? 825  ILE A CD1   1 
ATOM   6365  N  N     . ASP A 1  826  ? -11.817 -61.764  -6.977  1.00 114.22 ? 826  ASP A N     1 
ATOM   6366  C  CA    . ASP A 1  826  ? -10.656 -62.219  -6.214  1.00 115.82 ? 826  ASP A CA    1 
ATOM   6367  C  C     . ASP A 1  826  ? -9.956  -61.054  -5.526  1.00 114.15 ? 826  ASP A C     1 
ATOM   6368  O  O     . ASP A 1  826  ? -9.761  -61.060  -4.302  1.00 124.55 ? 826  ASP A O     1 
ATOM   6369  C  CB    . ASP A 1  826  ? -9.679  -62.966  -7.126  1.00 131.20 ? 826  ASP A CB    1 
ATOM   6370  C  CG    . ASP A 1  826  ? -8.800  -63.947  -6.358  1.00 157.00 ? 826  ASP A CG    1 
ATOM   6371  O  OD1   . ASP A 1  826  ? -9.323  -64.629  -5.454  1.00 161.26 ? 826  ASP A OD1   1 
ATOM   6372  O  OD2   . ASP A 1  826  ? -7.584  -64.017  -6.628  1.00 168.92 ? 826  ASP A OD2   1 
ATOM   6373  N  N     . THR A 1  827  ? -9.654  -60.002  -6.292  1.00 115.10 ? 827  THR A N     1 
ATOM   6374  C  CA    . THR A 1  827  ? -9.054  -58.797  -5.720  1.00 110.00 ? 827  THR A CA    1 
ATOM   6375  C  C     . THR A 1  827  ? -9.865  -58.258  -4.545  1.00 112.51 ? 827  THR A C     1 
ATOM   6376  O  O     . THR A 1  827  ? -9.340  -58.095  -3.434  1.00 120.68 ? 827  THR A O     1 
ATOM   6377  C  CB    . THR A 1  827  ? -8.910  -57.724  -6.803  1.00 106.45 ? 827  THR A CB    1 
ATOM   6378  O  OG1   . THR A 1  827  ? -8.008  -58.175  -7.823  1.00 117.28 ? 827  THR A OG1   1 
ATOM   6379  C  CG2   . THR A 1  827  ? -8.397  -56.436  -6.212  1.00 105.97 ? 827  THR A CG2   1 
ATOM   6380  N  N     . ALA A 1  828  ? -11.163 -58.027  -4.756  1.00 116.49 ? 828  ALA A N     1 
ATOM   6381  C  CA    . ALA A 1  828  ? -11.979 -57.404  -3.715  1.00 122.02 ? 828  ALA A CA    1 
ATOM   6382  C  C     . ALA A 1  828  ? -12.085 -58.293  -2.482  1.00 139.65 ? 828  ALA A C     1 
ATOM   6383  O  O     . ALA A 1  828  ? -11.892 -57.835  -1.350  1.00 158.42 ? 828  ALA A O     1 
ATOM   6384  C  CB    . ALA A 1  828  ? -13.367 -57.090  -4.264  1.00 112.00 ? 828  ALA A CB    1 
ATOM   6385  N  N     . VAL A 1  829  ? -12.383 -59.573  -2.693  1.00 140.64 ? 829  VAL A N     1 
ATOM   6386  C  CA    . VAL A 1  829  ? -12.565 -60.550  -1.625  1.00 141.92 ? 829  VAL A CA    1 
ATOM   6387  C  C     . VAL A 1  829  ? -11.286 -60.706  -0.815  1.00 145.29 ? 829  VAL A C     1 
ATOM   6388  O  O     . VAL A 1  829  ? -11.329 -61.067  0.368   1.00 136.81 ? 829  VAL A O     1 
ATOM   6389  C  CB    . VAL A 1  829  ? -13.032 -61.894  -2.228  1.00 146.80 ? 829  VAL A CB    1 
ATOM   6390  C  CG1   . VAL A 1  829  ? -12.625 -63.074  -1.360  1.00 148.07 ? 829  VAL A CG1   1 
ATOM   6391  C  CG2   . VAL A 1  829  ? -14.546 -61.896  -2.437  1.00 153.75 ? 829  VAL A CG2   1 
ATOM   6392  N  N     . LYS A 1  830  ? -10.133 -60.408  -1.414  1.00 150.52 ? 830  LYS A N     1 
ATOM   6393  C  CA    . LYS A 1  830  ? -8.869  -60.699  -0.750  1.00 161.40 ? 830  LYS A CA    1 
ATOM   6394  C  C     . LYS A 1  830  ? -8.201  -59.476  -0.128  1.00 148.34 ? 830  LYS A C     1 
ATOM   6395  O  O     . LYS A 1  830  ? -7.346  -59.651  0.747   1.00 149.45 ? 830  LYS A O     1 
ATOM   6396  C  CB    . LYS A 1  830  ? -7.882  -61.354  -1.731  1.00 169.43 ? 830  LYS A CB    1 
ATOM   6397  C  CG    . LYS A 1  830  ? -8.260  -62.749  -2.243  1.00 169.92 ? 830  LYS A CG    1 
ATOM   6398  C  CD    . LYS A 1  830  ? -7.034  -63.643  -2.417  1.00 163.87 ? 830  LYS A CD    1 
ATOM   6399  C  CE    . LYS A 1  830  ? -7.409  -64.997  -3.000  1.00 154.29 ? 830  LYS A CE    1 
ATOM   6400  N  NZ    . LYS A 1  830  ? -8.564  -65.616  -2.302  1.00 157.23 ? 830  LYS A NZ    1 
ATOM   6401  N  N     . THR A 1  831  ? -8.556  -58.250  -0.535  1.00 147.17 ? 831  THR A N     1 
ATOM   6402  C  CA    . THR A 1  831  ? -7.877  -57.089  0.047   1.00 143.15 ? 831  THR A CA    1 
ATOM   6403  C  C     . THR A 1  831  ? -8.129  -56.960  1.548   1.00 127.38 ? 831  THR A C     1 
ATOM   6404  O  O     . THR A 1  831  ? -7.223  -56.583  2.304   1.00 135.50 ? 831  THR A O     1 
ATOM   6405  C  CB    . THR A 1  831  ? -8.291  -55.785  -0.653  1.00 133.10 ? 831  THR A CB    1 
ATOM   6406  O  OG1   . THR A 1  831  ? -9.718  -55.664  -0.663  1.00 172.26 ? 831  THR A OG1   1 
ATOM   6407  C  CG2   . THR A 1  831  ? -7.726  -55.665  -2.078  1.00 96.05  ? 831  THR A CG2   1 
ATOM   6408  N  N     . ALA A 1  832  ? -9.333  -57.301  2.013   1.00 108.50 ? 832  ALA A N     1 
ATOM   6409  C  CA    . ALA A 1  832  ? -9.587  -57.257  3.453   1.00 118.41 ? 832  ALA A CA    1 
ATOM   6410  C  C     . ALA A 1  832  ? -8.728  -58.265  4.192   1.00 102.33 ? 832  ALA A C     1 
ATOM   6411  O  O     . ALA A 1  832  ? -8.241  -57.994  5.302   1.00 115.43 ? 832  ALA A O     1 
ATOM   6412  C  CB    . ALA A 1  832  ? -11.070 -57.502  3.734   1.00 135.69 ? 832  ALA A CB    1 
ATOM   6413  N  N     . GLU A 1  833  ? -8.384  -59.346  3.514   1.00 110.33 ? 833  GLU A N     1 
ATOM   6414  C  CA    . GLU A 1  833  ? -7.645  -60.422  4.145   1.00 135.40 ? 833  GLU A CA    1 
ATOM   6415  C  C     . GLU A 1  833  ? -6.179  -60.040  4.211   1.00 121.89 ? 833  GLU A C     1 
ATOM   6416  O  O     . GLU A 1  833  ? -5.540  -60.182  5.258   1.00 121.98 ? 833  GLU A O     1 
ATOM   6417  C  CB    . GLU A 1  833  ? -7.851  -61.738  3.390   1.00 153.04 ? 833  GLU A CB    1 
ATOM   6418  C  CG    . GLU A 1  833  ? -9.258  -62.301  3.471   1.00 158.03 ? 833  GLU A CG    1 
ATOM   6419  C  CD    . GLU A 1  833  ? -9.376  -63.659  2.803   1.00 185.32 ? 833  GLU A CD    1 
ATOM   6420  O  OE1   . GLU A 1  833  ? -8.824  -63.837  1.693   1.00 190.45 ? 833  GLU A OE1   1 
ATOM   6421  O  OE2   . GLU A 1  833  ? -9.999  -64.559  3.403   1.00 191.34 ? 833  GLU A OE2   1 
ATOM   6422  N  N     . THR A 1  834  ? -5.623  -59.581  3.089   1.00 100.56 ? 834  THR A N     1 
ATOM   6423  C  CA    . THR A 1  834  ? -4.210  -59.237  3.077   1.00 93.51  ? 834  THR A CA    1 
ATOM   6424  C  C     . THR A 1  834  ? -3.944  -58.059  4.006   1.00 98.08  ? 834  THR A C     1 
ATOM   6425  O  O     . THR A 1  834  ? -2.940  -58.038  4.726   1.00 126.51 ? 834  THR A O     1 
ATOM   6426  C  CB    . THR A 1  834  ? -3.779  -58.885  1.643   1.00 96.77  ? 834  THR A CB    1 
ATOM   6427  O  OG1   . THR A 1  834  ? -4.085  -59.963  0.752   1.00 109.93 ? 834  THR A OG1   1 
ATOM   6428  C  CG2   . THR A 1  834  ? -2.286  -58.595  1.548   1.00 115.66 ? 834  THR A CG2   1 
ATOM   6429  N  N     . GLY A 1  835  ? -4.841  -57.075  4.021   1.00 87.20  ? 835  GLY A N     1 
ATOM   6430  C  CA    . GLY A 1  835  ? -4.674  -55.955  4.938   1.00 115.76 ? 835  GLY A CA    1 
ATOM   6431  C  C     . GLY A 1  835  ? -4.739  -56.330  6.408   1.00 103.35 ? 835  GLY A C     1 
ATOM   6432  O  O     . GLY A 1  835  ? -3.957  -55.826  7.231   1.00 124.30 ? 835  GLY A O     1 
ATOM   6433  N  N     . TYR A 1  836  ? -5.609  -57.281  6.746   1.00 82.33  ? 836  TYR A N     1 
ATOM   6434  C  CA    . TYR A 1  836  ? -5.705  -57.704  8.139   1.00 105.30 ? 836  TYR A CA    1 
ATOM   6435  C  C     . TYR A 1  836  ? -4.581  -58.656  8.549   1.00 112.38 ? 836  TYR A C     1 
ATOM   6436  O  O     . TYR A 1  836  ? -4.137  -58.615  9.707   1.00 116.21 ? 836  TYR A O     1 
ATOM   6437  C  CB    . TYR A 1  836  ? -7.086  -58.335  8.367   1.00 105.70 ? 836  TYR A CB    1 
ATOM   6438  C  CG    . TYR A 1  836  ? -7.378  -58.854  9.766   1.00 92.66  ? 836  TYR A CG    1 
ATOM   6439  C  CD1   . TYR A 1  836  ? -7.352  -58.004  10.849  1.00 112.21 ? 836  TYR A CD1   1 
ATOM   6440  C  CD2   . TYR A 1  836  ? -7.757  -60.160  9.991   1.00 89.26  ? 836  TYR A CD2   1 
ATOM   6441  C  CE1   . TYR A 1  836  ? -7.640  -58.450  12.128  1.00 102.16 ? 836  TYR A CE1   1 
ATOM   6442  C  CE2   . TYR A 1  836  ? -8.058  -60.611  11.272  1.00 90.67  ? 836  TYR A CE2   1 
ATOM   6443  C  CZ    . TYR A 1  836  ? -7.996  -59.752  12.332  1.00 98.85  ? 836  TYR A CZ    1 
ATOM   6444  O  OH    . TYR A 1  836  ? -8.287  -60.201  13.603  1.00 119.55 ? 836  TYR A OH    1 
ATOM   6445  N  N     . ILE A 1  837  ? -4.093  -59.488  7.619   1.00 113.52 ? 837  ILE A N     1 
ATOM   6446  C  CA    . ILE A 1  837  ? -2.889  -60.288  7.857   1.00 111.21 ? 837  ILE A CA    1 
ATOM   6447  C  C     . ILE A 1  837  ? -1.687  -59.382  8.068   1.00 102.36 ? 837  ILE A C     1 
ATOM   6448  O  O     . ILE A 1  837  ? -0.828  -59.634  8.930   1.00 86.85  ? 837  ILE A O     1 
ATOM   6449  C  CB    . ILE A 1  837  ? -2.651  -61.241  6.665   1.00 101.47 ? 837  ILE A CB    1 
ATOM   6450  C  CG1   . ILE A 1  837  ? -3.408  -62.558  6.833   1.00 103.31 ? 837  ILE A CG1   1 
ATOM   6451  C  CG2   . ILE A 1  837  ? -1.162  -61.461  6.414   1.00 89.93  ? 837  ILE A CG2   1 
ATOM   6452  C  CD1   . ILE A 1  837  ? -3.186  -63.515  5.685   1.00 98.66  ? 837  ILE A CD1   1 
ATOM   6453  N  N     . GLN A 1  838  ? -1.623  -58.298  7.296   1.00 101.91 ? 838  GLN A N     1 
ATOM   6454  C  CA    . GLN A 1  838  ? -0.539  -57.345  7.457   1.00 90.33  ? 838  GLN A CA    1 
ATOM   6455  C  C     . GLN A 1  838  ? -0.566  -56.766  8.855   1.00 84.28  ? 838  GLN A C     1 
ATOM   6456  O  O     . GLN A 1  838  ? 0.465   -56.719  9.543   1.00 101.58 ? 838  GLN A O     1 
ATOM   6457  C  CB    . GLN A 1  838  ? -0.656  -56.246  6.395   1.00 109.01 ? 838  GLN A CB    1 
ATOM   6458  C  CG    . GLN A 1  838  ? 0.662   -55.586  5.994   1.00 140.59 ? 838  GLN A CG    1 
ATOM   6459  C  CD    . GLN A 1  838  ? 1.025   -54.413  6.898   1.00 157.71 ? 838  GLN A CD    1 
ATOM   6460  O  OE1   . GLN A 1  838  ? 0.282   -54.070  7.819   1.00 169.11 ? 838  GLN A OE1   1 
ATOM   6461  N  NE2   . GLN A 1  838  ? 2.171   -53.793  6.637   1.00 137.39 ? 838  GLN A NE2   1 
ATOM   6462  N  N     . ARG A 1  839  ? -1.762  -56.417  9.336   1.00 92.05  ? 839  ARG A N     1 
ATOM   6463  C  CA    . ARG A 1  839  ? -1.817  -55.818  10.660  1.00 80.86  ? 839  ARG A CA    1 
ATOM   6464  C  C     . ARG A 1  839  ? -1.416  -56.822  11.727  1.00 85.88  ? 839  ARG A C     1 
ATOM   6465  O  O     . ARG A 1  839  ? -0.675  -56.489  12.656  1.00 99.69  ? 839  ARG A O     1 
ATOM   6466  C  CB    . ARG A 1  839  ? -3.208  -55.269  10.965  1.00 83.49  ? 839  ARG A CB    1 
ATOM   6467  C  CG    . ARG A 1  839  ? -3.335  -54.870  12.427  1.00 80.57  ? 839  ARG A CG    1 
ATOM   6468  C  CD    . ARG A 1  839  ? -4.438  -53.869  12.661  1.00 82.96  ? 839  ARG A CD    1 
ATOM   6469  N  NE    . ARG A 1  839  ? -4.215  -53.243  13.955  1.00 79.92  ? 839  ARG A NE    1 
ATOM   6470  C  CZ    . ARG A 1  839  ? -4.858  -53.559  15.073  1.00 100.00 ? 839  ARG A CZ    1 
ATOM   6471  N  NH1   . ARG A 1  839  ? -5.797  -54.507  15.079  1.00 112.36 ? 839  ARG A NH1   1 
ATOM   6472  N  NH2   . ARG A 1  839  ? -4.559  -52.921  16.197  1.00 91.50  ? 839  ARG A NH2   1 
ATOM   6473  N  N     . ARG A 1  840  ? -1.925  -58.043  11.641  1.00 84.78  ? 840  ARG A N     1 
ATOM   6474  C  CA    . ARG A 1  840  ? -1.605  -59.017  12.673  1.00 83.15  ? 840  ARG A CA    1 
ATOM   6475  C  C     . ARG A 1  840  ? -0.099  -59.276  12.730  1.00 88.40  ? 840  ARG A C     1 
ATOM   6476  O  O     . ARG A 1  840  ? 0.482   -59.405  13.817  1.00 105.07 ? 840  ARG A O     1 
ATOM   6477  C  CB    . ARG A 1  840  ? -2.400  -60.299  12.414  1.00 102.47 ? 840  ARG A CB    1 
ATOM   6478  C  CG    . ARG A 1  840  ? -3.854  -60.249  12.900  1.00 100.27 ? 840  ARG A CG    1 
ATOM   6479  C  CD    . ARG A 1  840  ? -4.783  -61.029  11.956  1.00 115.21 ? 840  ARG A CD    1 
ATOM   6480  N  NE    . ARG A 1  840  ? -4.352  -62.400  11.694  1.00 116.07 ? 840  ARG A NE    1 
ATOM   6481  C  CZ    . ARG A 1  840  ? -4.688  -63.105  10.612  1.00 109.13 ? 840  ARG A CZ    1 
ATOM   6482  N  NH1   . ARG A 1  840  ? -5.464  -62.580  9.666   1.00 99.37  ? 840  ARG A NH1   1 
ATOM   6483  N  NH2   . ARG A 1  840  ? -4.258  -64.352  10.474  1.00 87.55  ? 840  ARG A NH2   1 
ATOM   6484  N  N     . LEU A 1  841  ? 0.561   -59.302  11.567  1.00 95.13  ? 841  LEU A N     1 
ATOM   6485  C  CA    . LEU A 1  841  ? 2.012   -59.475  11.551  1.00 83.27  ? 841  LEU A CA    1 
ATOM   6486  C  C     . LEU A 1  841  ? 2.709   -58.321  12.262  1.00 90.54  ? 841  LEU A C     1 
ATOM   6487  O  O     . LEU A 1  841  ? 3.571   -58.531  13.130  1.00 82.84  ? 841  LEU A O     1 
ATOM   6488  C  CB    . LEU A 1  841  ? 2.504   -59.598  10.111  1.00 83.29  ? 841  LEU A CB    1 
ATOM   6489  C  CG    . LEU A 1  841  ? 2.177   -60.912  9.423   1.00 84.23  ? 841  LEU A CG    1 
ATOM   6490  C  CD1   . LEU A 1  841  ? 2.108   -60.756  7.931   1.00 84.09  ? 841  LEU A CD1   1 
ATOM   6491  C  CD2   . LEU A 1  841  ? 3.273   -61.872  9.779   1.00 85.02  ? 841  LEU A CD2   1 
ATOM   6492  N  N     . VAL A 1  842  ? 2.319   -57.089  11.939  1.00 98.24  ? 842  VAL A N     1 
ATOM   6493  C  CA    . VAL A 1  842  ? 3.023   -55.956  12.521  1.00 81.04  ? 842  VAL A CA    1 
ATOM   6494  C  C     . VAL A 1  842  ? 2.780   -55.924  14.021  1.00 94.49  ? 842  VAL A C     1 
ATOM   6495  O  O     . VAL A 1  842  ? 3.709   -55.766  14.818  1.00 106.07 ? 842  VAL A O     1 
ATOM   6496  C  CB    . VAL A 1  842  ? 2.610   -54.643  11.850  1.00 80.17  ? 842  VAL A CB    1 
ATOM   6497  C  CG1   . VAL A 1  842  ? 3.195   -53.498  12.620  1.00 83.20  ? 842  VAL A CG1   1 
ATOM   6498  C  CG2   . VAL A 1  842  ? 3.088   -54.622  10.413  1.00 88.83  ? 842  VAL A CG2   1 
ATOM   6499  N  N     . LYS A 1  843  ? 1.524   -56.033  14.428  1.00 100.65 ? 843  LYS A N     1 
ATOM   6500  C  CA    . LYS A 1  843  ? 1.237   -55.948  15.848  1.00 97.33  ? 843  LYS A CA    1 
ATOM   6501  C  C     . LYS A 1  843  ? 1.854   -57.106  16.620  1.00 94.35  ? 843  LYS A C     1 
ATOM   6502  O  O     . LYS A 1  843  ? 2.094   -56.959  17.824  1.00 82.51  ? 843  LYS A O     1 
ATOM   6503  C  CB    . LYS A 1  843  ? -0.274  -55.878  16.082  1.00 85.23  ? 843  LYS A CB    1 
ATOM   6504  C  CG    . LYS A 1  843  ? -0.767  -54.466  16.321  1.00 80.67  ? 843  LYS A CG    1 
ATOM   6505  C  CD    . LYS A 1  843  ? -0.048  -53.832  17.488  1.00 80.52  ? 843  LYS A CD    1 
ATOM   6506  C  CE    . LYS A 1  843  ? -0.646  -52.493  17.845  1.00 88.03  ? 843  LYS A CE    1 
ATOM   6507  N  NZ    . LYS A 1  843  ? -0.723  -51.584  16.673  1.00 106.10 ? 843  LYS A NZ    1 
ATOM   6508  N  N     . ALA A 1  844  ? 2.207   -58.206  15.947  1.00 91.51  ? 844  ALA A N     1 
ATOM   6509  C  CA    . ALA A 1  844  ? 2.774   -59.363  16.635  1.00 83.93  ? 844  ALA A CA    1 
ATOM   6510  C  C     . ALA A 1  844  ? 4.290   -59.316  16.719  1.00 84.02  ? 844  ALA A C     1 
ATOM   6511  O  O     . ALA A 1  844  ? 4.866   -59.984  17.586  1.00 87.45  ? 844  ALA A O     1 
ATOM   6512  C  CB    . ALA A 1  844  ? 2.337   -60.670  15.955  1.00 84.74  ? 844  ALA A CB    1 
ATOM   6513  N  N     . LEU A 1  845  ? 4.949   -58.596  15.809  1.00 88.74  ? 845  LEU A N     1 
ATOM   6514  C  CA    . LEU A 1  845  ? 6.405   -58.462  15.830  1.00 83.73  ? 845  LEU A CA    1 
ATOM   6515  C  C     . LEU A 1  845  ? 6.899   -57.070  16.248  1.00 82.76  ? 845  LEU A C     1 
ATOM   6516  O  O     . LEU A 1  845  ? 8.112   -56.853  16.291  1.00 105.35 ? 845  LEU A O     1 
ATOM   6517  C  CB    . LEU A 1  845  ? 6.982   -58.836  14.451  1.00 83.65  ? 845  LEU A CB    1 
ATOM   6518  C  CG    . LEU A 1  845  ? 6.451   -60.172  13.932  1.00 84.44  ? 845  LEU A CG    1 
ATOM   6519  C  CD1   . LEU A 1  845  ? 7.052   -60.567  12.604  1.00 84.66  ? 845  LEU A CD1   1 
ATOM   6520  C  CD2   . LEU A 1  845  ? 6.791   -61.183  14.978  1.00 85.40  ? 845  LEU A CD2   1 
ATOM   6521  N  N     . GLU A 1  846  ? 6.004   -56.154  16.639  1.00 95.81  ? 846  GLU A N     1 
ATOM   6522  C  CA    . GLU A 1  846  ? 6.347   -54.732  16.694  1.00 86.15  ? 846  GLU A CA    1 
ATOM   6523  C  C     . GLU A 1  846  ? 7.474   -54.434  17.681  1.00 85.97  ? 846  GLU A C     1 
ATOM   6524  O  O     . GLU A 1  846  ? 8.349   -53.607  17.393  1.00 94.97  ? 846  GLU A O     1 
ATOM   6525  C  CB    . GLU A 1  846  ? 5.091   -53.913  17.021  1.00 85.85  ? 846  GLU A CB    1 
ATOM   6526  C  CG    . GLU A 1  846  ? 4.642   -53.941  18.481  1.00 93.56  ? 846  GLU A CG    1 
ATOM   6527  C  CD    . GLU A 1  846  ? 3.315   -53.229  18.720  1.00 108.01 ? 846  GLU A CD    1 
ATOM   6528  O  OE1   . GLU A 1  846  ? 2.875   -52.430  17.865  1.00 94.41  ? 846  GLU A OE1   1 
ATOM   6529  O  OE2   . GLU A 1  846  ? 2.718   -53.451  19.789  1.00 115.59 ? 846  GLU A OE2   1 
ATOM   6530  N  N     . ASP A 1  847  ? 7.516   -55.146  18.808  1.00 86.22  ? 847  ASP A N     1 
ATOM   6531  C  CA    . ASP A 1  847  ? 8.450   -54.854  19.887  1.00 86.10  ? 847  ASP A CA    1 
ATOM   6532  C  C     . ASP A 1  847  ? 9.747   -55.640  19.774  1.00 86.44  ? 847  ASP A C     1 
ATOM   6533  O  O     . ASP A 1  847  ? 10.439  -55.821  20.781  1.00 129.94 ? 847  ASP A O     1 
ATOM   6534  C  CB    . ASP A 1  847  ? 7.811   -55.122  21.261  1.00 88.80  ? 847  ASP A CB    1 
ATOM   6535  C  CG    . ASP A 1  847  ? 7.387   -56.596  21.470  1.00 110.37 ? 847  ASP A CG    1 
ATOM   6536  O  OD1   . ASP A 1  847  ? 6.771   -57.216  20.575  1.00 104.18 ? 847  ASP A OD1   1 
ATOM   6537  O  OD2   . ASP A 1  847  ? 7.673   -57.148  22.557  1.00 113.21 ? 847  ASP A OD2   1 
ATOM   6538  N  N     . ILE A 1  848  ? 10.112  -56.082  18.577  1.00 86.64  ? 848  ILE A N     1 
ATOM   6539  C  CA    . ILE A 1  848  ? 11.296  -56.905  18.369  1.00 89.99  ? 848  ILE A CA    1 
ATOM   6540  C  C     . ILE A 1  848  ? 12.352  -56.036  17.708  1.00 86.70  ? 848  ILE A C     1 
ATOM   6541  O  O     . ILE A 1  848  ? 12.070  -55.389  16.691  1.00 98.00  ? 848  ILE A O     1 
ATOM   6542  C  CB    . ILE A 1  848  ? 10.997  -58.149  17.514  1.00 87.60  ? 848  ILE A CB    1 
ATOM   6543  C  CG1   . ILE A 1  848  ? 9.953   -59.020  18.192  1.00 103.58 ? 848  ILE A CG1   1 
ATOM   6544  C  CG2   . ILE A 1  848  ? 12.237  -58.984  17.320  1.00 88.05  ? 848  ILE A CG2   1 
ATOM   6545  C  CD1   . ILE A 1  848  ? 9.674   -60.291  17.444  1.00 121.54 ? 848  ILE A CD1   1 
ATOM   6546  N  N     . MET A 1  849  ? 13.550  -55.997  18.301  1.00 92.79  ? 849  MET A N     1 
ATOM   6547  C  CA    . MET A 1  849  ? 14.681  -55.262  17.747  1.00 103.96 ? 849  MET A CA    1 
ATOM   6548  C  C     . MET A 1  849  ? 15.976  -55.903  18.223  1.00 104.38 ? 849  MET A C     1 
ATOM   6549  O  O     . MET A 1  849  ? 15.999  -56.685  19.178  1.00 96.65  ? 849  MET A O     1 
ATOM   6550  C  CB    . MET A 1  849  ? 14.655  -53.784  18.144  1.00 103.74 ? 849  MET A CB    1 
ATOM   6551  C  CG    . MET A 1  849  ? 15.124  -53.485  19.557  1.00 109.79 ? 849  MET A CG    1 
ATOM   6552  S  SD    . MET A 1  849  ? 15.347  -51.698  19.783  1.00 86.46  ? 849  MET A SD    1 
ATOM   6553  C  CE    . MET A 1  849  ? 16.689  -51.628  20.955  1.00 85.17  ? 849  MET A CE    1 
ATOM   6554  N  N     . VAL A 1  850  ? 17.067  -55.518  17.573  1.00 97.04  ? 850  VAL A N     1 
ATOM   6555  C  CA    . VAL A 1  850  ? 18.393  -55.994  17.941  1.00 87.08  ? 850  VAL A CA    1 
ATOM   6556  C  C     . VAL A 1  850  ? 18.920  -55.123  19.068  1.00 86.74  ? 850  VAL A C     1 
ATOM   6557  O  O     . VAL A 1  850  ? 18.891  -53.893  18.973  1.00 101.75 ? 850  VAL A O     1 
ATOM   6558  C  CB    . VAL A 1  850  ? 19.328  -55.943  16.729  1.00 87.16  ? 850  VAL A CB    1 
ATOM   6559  C  CG1   . VAL A 1  850  ? 20.704  -56.400  17.111  1.00 92.83  ? 850  VAL A CG1   1 
ATOM   6560  C  CG2   . VAL A 1  850  ? 18.742  -56.742  15.578  1.00 87.52  ? 850  VAL A CG2   1 
ATOM   6561  N  N     . HIS A 1  851  ? 19.376  -55.746  20.147  1.00 87.10  ? 851  HIS A N     1 
ATOM   6562  C  CA    . HIS A 1  851  ? 19.956  -54.988  21.239  1.00 86.87  ? 851  HIS A CA    1 
ATOM   6563  C  C     . HIS A 1  851  ? 21.464  -54.964  21.060  1.00 95.03  ? 851  HIS A C     1 
ATOM   6564  O  O     . HIS A 1  851  ? 22.016  -55.598  20.157  1.00 90.76  ? 851  HIS A O     1 
ATOM   6565  C  CB    . HIS A 1  851  ? 19.587  -55.569  22.593  1.00 90.34  ? 851  HIS A CB    1 
ATOM   6566  C  CG    . HIS A 1  851  ? 18.133  -55.458  22.911  1.00 99.72  ? 851  HIS A CG    1 
ATOM   6567  N  ND1   . HIS A 1  851  ? 17.154  -55.830  22.016  1.00 99.50  ? 851  HIS A ND1   1 
ATOM   6568  C  CD2   . HIS A 1  851  ? 17.491  -55.014  24.014  1.00 89.42  ? 851  HIS A CD2   1 
ATOM   6569  C  CE1   . HIS A 1  851  ? 15.968  -55.645  22.564  1.00 113.55 ? 851  HIS A CE1   1 
ATOM   6570  N  NE2   . HIS A 1  851  ? 16.145  -55.148  23.775  1.00 110.93 ? 851  HIS A NE2   1 
ATOM   6571  N  N     . TYR A 1  852  ? 22.136  -54.240  21.947  1.00 90.28  ? 852  TYR A N     1 
ATOM   6572  C  CA    . TYR A 1  852  ? 23.576  -54.034  21.854  1.00 86.93  ? 852  TYR A CA    1 
ATOM   6573  C  C     . TYR A 1  852  ? 24.421  -55.266  22.176  1.00 101.25 ? 852  TYR A C     1 
ATOM   6574  O  O     . TYR A 1  852  ? 25.647  -55.146  22.300  1.00 124.26 ? 852  TYR A O     1 
ATOM   6575  C  CB    . TYR A 1  852  ? 23.957  -52.893  22.783  1.00 92.86  ? 852  TYR A CB    1 
ATOM   6576  C  CG    . TYR A 1  852  ? 23.702  -51.543  22.186  1.00 85.90  ? 852  TYR A CG    1 
ATOM   6577  C  CD1   . TYR A 1  852  ? 24.521  -51.049  21.198  1.00 107.44 ? 852  TYR A CD1   1 
ATOM   6578  C  CD2   . TYR A 1  852  ? 22.685  -50.737  22.646  1.00 85.49  ? 852  TYR A CD2   1 
ATOM   6579  C  CE1   . TYR A 1  852  ? 24.310  -49.814  20.647  1.00 103.35 ? 852  TYR A CE1   1 
ATOM   6580  C  CE2   . TYR A 1  852  ? 22.471  -49.490  22.103  1.00 87.42  ? 852  TYR A CE2   1 
ATOM   6581  C  CZ    . TYR A 1  852  ? 23.290  -49.034  21.103  1.00 91.81  ? 852  TYR A CZ    1 
ATOM   6582  O  OH    . TYR A 1  852  ? 23.095  -47.797  20.536  1.00 85.53  ? 852  TYR A OH    1 
ATOM   6583  N  N     . ASP A 1  853  ? 23.820  -56.442  22.302  1.00 88.14  ? 853  ASP A N     1 
ATOM   6584  C  CA    . ASP A 1  853  ? 24.572  -57.680  22.398  1.00 88.89  ? 853  ASP A CA    1 
ATOM   6585  C  C     . ASP A 1  853  ? 24.287  -58.578  21.206  1.00 89.97  ? 853  ASP A C     1 
ATOM   6586  O  O     . ASP A 1  853  ? 24.595  -59.777  21.237  1.00 108.81 ? 853  ASP A O     1 
ATOM   6587  C  CB    . ASP A 1  853  ? 24.257  -58.413  23.704  1.00 99.00  ? 853  ASP A CB    1 
ATOM   6588  C  CG    . ASP A 1  853  ? 22.782  -58.736  23.864  1.00 101.07 ? 853  ASP A CG    1 
ATOM   6589  O  OD1   . ASP A 1  853  ? 22.000  -58.481  22.931  1.00 108.01 ? 853  ASP A OD1   1 
ATOM   6590  O  OD2   . ASP A 1  853  ? 22.400  -59.303  24.908  1.00 92.22  ? 853  ASP A OD2   1 
ATOM   6591  N  N     . ASN A 1  854  ? 23.713  -58.000  20.152  1.00 93.25  ? 854  ASN A N     1 
ATOM   6592  C  CA    . ASN A 1  854  ? 23.314  -58.649  18.912  1.00 104.81 ? 854  ASN A CA    1 
ATOM   6593  C  C     . ASN A 1  854  ? 22.166  -59.627  19.099  1.00 105.74 ? 854  ASN A C     1 
ATOM   6594  O  O     . ASN A 1  854  ? 21.662  -60.144  18.096  1.00 110.60 ? 854  ASN A O     1 
ATOM   6595  C  CB    . ASN A 1  854  ? 24.474  -59.362  18.217  1.00 129.20 ? 854  ASN A CB    1 
ATOM   6596  C  CG    . ASN A 1  854  ? 25.548  -58.408  17.804  1.00 135.11 ? 854  ASN A CG    1 
ATOM   6597  O  OD1   . ASN A 1  854  ? 26.568  -58.282  18.484  1.00 132.60 ? 854  ASN A OD1   1 
ATOM   6598  N  ND2   . ASN A 1  854  ? 25.313  -57.690  16.700  1.00 110.65 ? 854  ASN A ND2   1 
ATOM   6599  N  N     . THR A 1  855  ? 21.698  -59.856  20.329  1.00 89.44  ? 855  THR A N     1 
ATOM   6600  C  CA    . THR A 1  855  ? 20.549  -60.725  20.536  1.00 89.75  ? 855  THR A CA    1 
ATOM   6601  C  C     . THR A 1  855  ? 19.282  -59.995  20.099  1.00 94.22  ? 855  THR A C     1 
ATOM   6602  O  O     . THR A 1  855  ? 19.196  -58.768  20.149  1.00 95.78  ? 855  THR A O     1 
ATOM   6603  C  CB    . THR A 1  855  ? 20.447  -61.180  22.015  1.00 90.08  ? 855  THR A CB    1 
ATOM   6604  O  OG1   . THR A 1  855  ? 20.017  -60.109  22.858  1.00 94.32  ? 855  THR A OG1   1 
ATOM   6605  C  CG2   . THR A 1  855  ? 21.790  -61.654  22.546  1.00 92.10  ? 855  THR A CG2   1 
ATOM   6606  N  N     . THR A 1  856  ? 18.330  -60.760  19.577  1.00 107.92 ? 856  THR A N     1 
ATOM   6607  C  CA    . THR A 1  856  ? 17.064  -60.236  19.081  1.00 89.03  ? 856  THR A CA    1 
ATOM   6608  C  C     . THR A 1  856  ? 15.993  -60.551  20.111  1.00 89.11  ? 856  THR A C     1 
ATOM   6609  O  O     . THR A 1  856  ? 15.700  -61.723  20.370  1.00 104.89 ? 856  THR A O     1 
ATOM   6610  C  CB    . THR A 1  856  ? 16.706  -60.834  17.722  1.00 89.30  ? 856  THR A CB    1 
ATOM   6611  O  OG1   . THR A 1  856  ? 17.725  -60.510  16.781  1.00 89.25  ? 856  THR A OG1   1 
ATOM   6612  C  CG2   . THR A 1  856  ? 15.406  -60.321  17.238  1.00 94.35  ? 856  THR A CG2   1 
ATOM   6613  N  N     . ARG A 1  857  ? 15.421  -59.508  20.707  1.00 90.05  ? 857  ARG A N     1 
ATOM   6614  C  CA    . ARG A 1  857  ? 14.539  -59.683  21.848  1.00 99.47  ? 857  ARG A CA    1 
ATOM   6615  C  C     . ARG A 1  857  ? 13.263  -58.887  21.627  1.00 107.88 ? 857  ARG A C     1 
ATOM   6616  O  O     . ARG A 1  857  ? 13.194  -58.002  20.769  1.00 112.39 ? 857  ARG A O     1 
ATOM   6617  C  CB    . ARG A 1  857  ? 15.187  -59.253  23.170  1.00 88.55  ? 857  ARG A CB    1 
ATOM   6618  C  CG    . ARG A 1  857  ? 16.626  -59.692  23.333  1.00 88.93  ? 857  ARG A CG    1 
ATOM   6619  C  CD    . ARG A 1  857  ? 17.000  -59.897  24.790  1.00 90.21  ? 857  ARG A CD    1 
ATOM   6620  N  NE    . ARG A 1  857  ? 18.409  -60.219  24.945  1.00 89.59  ? 857  ARG A NE    1 
ATOM   6621  C  CZ    . ARG A 1  857  ? 18.971  -60.489  26.114  1.00 99.17  ? 857  ARG A CZ    1 
ATOM   6622  N  NH1   . ARG A 1  857  ? 18.242  -60.474  27.225  1.00 90.03  ? 857  ARG A NH1   1 
ATOM   6623  N  NH2   . ARG A 1  857  ? 20.267  -60.755  26.176  1.00 113.93 ? 857  ARG A NH2   1 
ATOM   6624  N  N     . ASN A 1  858  ? 12.240  -59.254  22.392  1.00 106.94 ? 858  ASN A N     1 
ATOM   6625  C  CA    . ASN A 1  858  ? 10.990  -58.527  22.463  1.00 97.43  ? 858  ASN A CA    1 
ATOM   6626  C  C     . ASN A 1  858  ? 11.066  -57.593  23.662  1.00 96.35  ? 858  ASN A C     1 
ATOM   6627  O  O     . ASN A 1  858  ? 12.141  -57.374  24.239  1.00 105.35 ? 858  ASN A O     1 
ATOM   6628  C  CB    . ASN A 1  858  ? 9.782   -59.476  22.562  1.00 97.40  ? 858  ASN A CB    1 
ATOM   6629  C  CG    . ASN A 1  858  ? 9.806   -60.353  23.812  1.00 88.75  ? 858  ASN A CG    1 
ATOM   6630  O  OD1   . ASN A 1  858  ? 10.327  -59.970  24.860  1.00 102.99 ? 858  ASN A OD1   1 
ATOM   6631  N  ND2   . ASN A 1  858  ? 9.205   -61.525  23.709  1.00 92.74  ? 858  ASN A ND2   1 
ATOM   6632  N  N     . SER A 1  859  ? 9.912   -57.041  24.047  1.00 89.73  ? 859  SER A N     1 
ATOM   6633  C  CA    . SER A 1  859  ? 9.823   -56.067  25.126  1.00 102.21 ? 859  SER A CA    1 
ATOM   6634  C  C     . SER A 1  859  ? 9.916   -56.713  26.502  1.00 96.25  ? 859  SER A C     1 
ATOM   6635  O  O     . SER A 1  859  ? 9.749   -56.024  27.518  1.00 108.09 ? 859  SER A O     1 
ATOM   6636  C  CB    . SER A 1  859  ? 8.522   -55.270  24.992  1.00 96.25  ? 859  SER A CB    1 
ATOM   6637  O  OG    . SER A 1  859  ? 7.446   -56.125  24.626  1.00 98.66  ? 859  SER A OG    1 
ATOM   6638  N  N     . LEU A 1  860  ? 10.080  -58.028  26.556  1.00 91.63  ? 860  LEU A N     1 
ATOM   6639  C  CA    . LEU A 1  860  ? 10.291  -58.733  27.809  1.00 108.16 ? 860  LEU A CA    1 
ATOM   6640  C  C     . LEU A 1  860  ? 11.741  -59.146  28.000  1.00 110.49 ? 860  LEU A C     1 
ATOM   6641  O  O     . LEU A 1  860  ? 12.069  -59.770  29.016  1.00 127.80 ? 860  LEU A O     1 
ATOM   6642  C  CB    . LEU A 1  860  ? 9.381   -59.966  27.890  1.00 99.23  ? 860  LEU A CB    1 
ATOM   6643  C  CG    . LEU A 1  860  ? 7.894   -59.652  28.044  1.00 88.82  ? 860  LEU A CG    1 
ATOM   6644  C  CD1   . LEU A 1  860  ? 7.086   -60.918  28.233  1.00 89.42  ? 860  LEU A CD1   1 
ATOM   6645  C  CD2   . LEU A 1  860  ? 7.689   -58.694  29.210  1.00 88.56  ? 860  LEU A CD2   1 
ATOM   6646  N  N     . GLY A 1  861  ? 12.614  -58.809  27.058  1.00 97.71  ? 861  GLY A N     1 
ATOM   6647  C  CA    . GLY A 1  861  ? 13.944  -59.359  27.092  1.00 102.85 ? 861  GLY A CA    1 
ATOM   6648  C  C     . GLY A 1  861  ? 14.032  -60.806  26.679  1.00 93.13  ? 861  GLY A C     1 
ATOM   6649  O  O     . GLY A 1  861  ? 15.133  -61.362  26.683  1.00 99.76  ? 861  GLY A O     1 
ATOM   6650  N  N     . ASN A 1  862  ? 12.907  -61.436  26.336  1.00 93.59  ? 862  ASN A N     1 
ATOM   6651  C  CA    . ASN A 1  862  ? 12.929  -62.816  25.870  1.00 90.47  ? 862  ASN A CA    1 
ATOM   6652  C  C     . ASN A 1  862  ? 13.707  -62.884  24.558  1.00 99.50  ? 862  ASN A C     1 
ATOM   6653  O  O     . ASN A 1  862  ? 13.471  -62.089  23.645  1.00 106.66 ? 862  ASN A O     1 
ATOM   6654  C  CB    . ASN A 1  862  ? 11.495  -63.354  25.671  1.00 103.34 ? 862  ASN A CB    1 
ATOM   6655  C  CG    . ASN A 1  862  ? 10.652  -63.406  26.972  1.00 110.03 ? 862  ASN A CG    1 
ATOM   6656  O  OD1   . ASN A 1  862  ? 11.155  -63.210  28.082  1.00 103.22 ? 862  ASN A OD1   1 
ATOM   6657  N  ND2   . ASN A 1  862  ? 9.361   -63.716  26.820  1.00 126.98 ? 862  ASN A ND2   1 
ATOM   6658  N  N     . VAL A 1  863  ? 14.634  -63.833  24.457  1.00 94.33  ? 863  VAL A N     1 
ATOM   6659  C  CA    . VAL A 1  863  ? 15.466  -63.953  23.262  1.00 105.01 ? 863  VAL A CA    1 
ATOM   6660  C  C     . VAL A 1  863  ? 14.662  -64.678  22.185  1.00 110.04 ? 863  VAL A C     1 
ATOM   6661  O  O     . VAL A 1  863  ? 14.109  -65.758  22.416  1.00 113.99 ? 863  VAL A O     1 
ATOM   6662  C  CB    . VAL A 1  863  ? 16.800  -64.667  23.555  1.00 95.39  ? 863  VAL A CB    1 
ATOM   6663  C  CG1   . VAL A 1  863  ? 17.564  -64.963  22.261  1.00 91.86  ? 863  VAL A CG1   1 
ATOM   6664  C  CG2   . VAL A 1  863  ? 17.672  -63.828  24.507  1.00 91.42  ? 863  VAL A CG2   1 
ATOM   6665  N  N     . ILE A 1  864  ? 14.492  -64.020  21.048  1.00 102.24 ? 864  ILE A N     1 
ATOM   6666  C  CA    . ILE A 1  864  ? 13.879  -64.644  19.887  1.00 100.82 ? 864  ILE A CA    1 
ATOM   6667  C  C     . ILE A 1  864  ? 14.942  -65.249  18.986  1.00 110.28 ? 864  ILE A C     1 
ATOM   6668  O  O     . ILE A 1  864  ? 14.793  -66.375  18.511  1.00 115.11 ? 864  ILE A O     1 
ATOM   6669  C  CB    . ILE A 1  864  ? 13.034  -63.590  19.139  1.00 90.45  ? 864  ILE A CB    1 
ATOM   6670  C  CG1   . ILE A 1  864  ? 12.079  -62.903  20.105  1.00 90.01  ? 864  ILE A CG1   1 
ATOM   6671  C  CG2   . ILE A 1  864  ? 12.315  -64.176  17.955  1.00 90.72  ? 864  ILE A CG2   1 
ATOM   6672  C  CD1   . ILE A 1  864  ? 10.803  -63.646  20.318  1.00 118.23 ? 864  ILE A CD1   1 
ATOM   6673  N  N     . GLN A 1  865  ? 16.035  -64.520  18.781  1.00 101.03 ? 865  GLN A N     1 
ATOM   6674  C  CA    . GLN A 1  865  ? 17.148  -64.953  17.946  1.00 91.65  ? 865  GLN A CA    1 
ATOM   6675  C  C     . GLN A 1  865  ? 18.432  -64.523  18.630  1.00 107.92 ? 865  GLN A C     1 
ATOM   6676  O  O     . GLN A 1  865  ? 18.590  -63.344  18.949  1.00 137.84 ? 865  GLN A O     1 
ATOM   6677  C  CB    . GLN A 1  865  ? 17.058  -64.323  16.551  1.00 101.91 ? 865  GLN A CB    1 
ATOM   6678  C  CG    . GLN A 1  865  ? 15.935  -64.852  15.661  1.00 103.33 ? 865  GLN A CG    1 
ATOM   6679  C  CD    . GLN A 1  865  ? 16.003  -64.290  14.250  1.00 91.28  ? 865  GLN A CD    1 
ATOM   6680  O  OE1   . GLN A 1  865  ? 16.346  -63.129  14.056  1.00 90.67  ? 865  GLN A OE1   1 
ATOM   6681  N  NE2   . GLN A 1  865  ? 15.599  -65.086  13.270  1.00 96.77  ? 865  GLN A NE2   1 
ATOM   6682  N  N     . PHE A 1  866  ? 19.335  -65.461  18.886  1.00 92.25  ? 866  PHE A N     1 
ATOM   6683  C  CA    . PHE A 1  866  ? 20.557  -65.080  19.582  1.00 92.22  ? 866  PHE A CA    1 
ATOM   6684  C  C     . PHE A 1  866  ? 21.434  -64.157  18.733  1.00 102.49 ? 866  PHE A C     1 
ATOM   6685  O  O     . PHE A 1  866  ? 22.112  -63.273  19.268  1.00 109.31 ? 866  PHE A O     1 
ATOM   6686  C  CB    . PHE A 1  866  ? 21.320  -66.331  20.007  1.00 93.13  ? 866  PHE A CB    1 
ATOM   6687  C  CG    . PHE A 1  866  ? 20.714  -67.020  21.187  1.00 93.53  ? 866  PHE A CG    1 
ATOM   6688  C  CD1   . PHE A 1  866  ? 19.681  -67.920  21.026  1.00 102.73 ? 866  PHE A CD1   1 
ATOM   6689  C  CD2   . PHE A 1  866  ? 21.136  -66.721  22.469  1.00 104.14 ? 866  PHE A CD2   1 
ATOM   6690  C  CE1   . PHE A 1  866  ? 19.106  -68.535  22.121  1.00 94.31  ? 866  PHE A CE1   1 
ATOM   6691  C  CE2   . PHE A 1  866  ? 20.562  -67.333  23.561  1.00 93.91  ? 866  PHE A CE2   1 
ATOM   6692  C  CZ    . PHE A 1  866  ? 19.548  -68.234  23.385  1.00 104.83 ? 866  PHE A CZ    1 
ATOM   6693  N  N     . ILE A 1  867  ? 21.433  -64.341  17.417  1.00 91.87  ? 867  ILE A N     1 
ATOM   6694  C  CA    . ILE A 1  867  ? 22.085  -63.439  16.473  1.00 101.43 ? 867  ILE A CA    1 
ATOM   6695  C  C     . ILE A 1  867  ? 21.106  -63.216  15.325  1.00 103.25 ? 867  ILE A C     1 
ATOM   6696  O  O     . ILE A 1  867  ? 20.552  -64.182  14.790  1.00 108.82 ? 867  ILE A O     1 
ATOM   6697  C  CB    . ILE A 1  867  ? 23.438  -64.015  15.991  1.00 101.01 ? 867  ILE A CB    1 
ATOM   6698  C  CG1   . ILE A 1  867  ? 24.428  -64.093  17.167  1.00 139.83 ? 867  ILE A CG1   1 
ATOM   6699  C  CG2   . ILE A 1  867  ? 24.080  -63.193  14.888  1.00 91.67  ? 867  ILE A CG2   1 
ATOM   6700  C  CD1   . ILE A 1  867  ? 24.548  -65.481  17.876  1.00 127.32 ? 867  ILE A CD1   1 
ATOM   6701  N  N     . TYR A 1  868  ? 20.785  -61.952  15.034  1.00 90.46  ? 868  TYR A N     1 
ATOM   6702  C  CA    . TYR A 1  868  ? 19.676  -61.670  14.130  1.00 91.45  ? 868  TYR A CA    1 
ATOM   6703  C  C     . TYR A 1  868  ? 19.921  -62.298  12.763  1.00 90.70  ? 868  TYR A C     1 
ATOM   6704  O  O     . TYR A 1  868  ? 20.958  -62.080  12.141  1.00 100.24 ? 868  TYR A O     1 
ATOM   6705  C  CB    . TYR A 1  868  ? 19.488  -60.149  14.022  1.00 89.38  ? 868  TYR A CB    1 
ATOM   6706  C  CG    . TYR A 1  868  ? 18.712  -59.708  12.813  1.00 89.17  ? 868  TYR A CG    1 
ATOM   6707  C  CD1   . TYR A 1  868  ? 17.419  -60.105  12.611  1.00 96.59  ? 868  TYR A CD1   1 
ATOM   6708  C  CD2   . TYR A 1  868  ? 19.288  -58.890  11.863  1.00 90.80  ? 868  TYR A CD2   1 
ATOM   6709  C  CE1   . TYR A 1  868  ? 16.728  -59.719  11.475  1.00 108.93 ? 868  TYR A CE1   1 
ATOM   6710  C  CE2   . TYR A 1  868  ? 18.591  -58.490  10.734  1.00 89.74  ? 868  TYR A CE2   1 
ATOM   6711  C  CZ    . TYR A 1  868  ? 17.309  -58.904  10.554  1.00 88.91  ? 868  TYR A CZ    1 
ATOM   6712  O  OH    . TYR A 1  868  ? 16.597  -58.528  9.447   1.00 88.84  ? 868  TYR A OH    1 
ATOM   6713  N  N     . GLY A 1  869  ? 18.944  -63.056  12.278  1.00 91.06  ? 869  GLY A N     1 
ATOM   6714  C  CA    . GLY A 1  869  ? 19.132  -63.745  11.018  1.00 91.63  ? 869  GLY A CA    1 
ATOM   6715  C  C     . GLY A 1  869  ? 20.149  -64.864  11.036  1.00 102.74 ? 869  GLY A C     1 
ATOM   6716  O  O     . GLY A 1  869  ? 20.482  -65.394  9.971   1.00 99.87  ? 869  GLY A O     1 
ATOM   6717  N  N     . GLU A 1  870  ? 20.593  -65.293  12.217  1.00 92.59  ? 870  GLU A N     1 
ATOM   6718  C  CA    . GLU A 1  870  ? 21.604  -66.318  12.434  1.00 93.35  ? 870  GLU A CA    1 
ATOM   6719  C  C     . GLU A 1  870  ? 22.997  -65.904  11.936  1.00 107.24 ? 870  GLU A C     1 
ATOM   6720  O  O     . GLU A 1  870  ? 23.954  -66.683  12.092  1.00 119.54 ? 870  GLU A O     1 
ATOM   6721  C  CB    . GLU A 1  870  ? 21.182  -67.646  11.788  1.00 94.20  ? 870  GLU A CB    1 
ATOM   6722  C  CG    . GLU A 1  870  ? 19.997  -68.293  12.483  1.00 105.10 ? 870  GLU A CG    1 
ATOM   6723  C  CD    . GLU A 1  870  ? 19.242  -69.295  11.624  1.00 128.27 ? 870  GLU A CD    1 
ATOM   6724  O  OE1   . GLU A 1  870  ? 19.854  -69.921  10.742  1.00 129.41 ? 870  GLU A OE1   1 
ATOM   6725  O  OE2   . GLU A 1  870  ? 18.022  -69.464  11.842  1.00 126.52 ? 870  GLU A OE2   1 
ATOM   6726  N  N     . ASP A 1  871  ? 23.162  -64.676  11.426  1.00 92.67  ? 871  ASP A N     1 
ATOM   6727  C  CA    . ASP A 1  871  ? 24.449  -64.177  10.949  1.00 92.62  ? 871  ASP A CA    1 
ATOM   6728  C  C     . ASP A 1  871  ? 24.787  -62.745  11.338  1.00 97.90  ? 871  ASP A C     1 
ATOM   6729  O  O     . ASP A 1  871  ? 25.950  -62.360  11.196  1.00 106.60 ? 871  ASP A O     1 
ATOM   6730  C  CB    . ASP A 1  871  ? 24.524  -64.319  9.410   1.00 108.87 ? 871  ASP A CB    1 
ATOM   6731  C  CG    . ASP A 1  871  ? 23.589  -63.355  8.649   1.00 96.35  ? 871  ASP A CG    1 
ATOM   6732  O  OD1   . ASP A 1  871  ? 22.706  -62.705  9.246   1.00 91.71  ? 871  ASP A OD1   1 
ATOM   6733  O  OD2   . ASP A 1  871  ? 23.691  -63.319  7.405   1.00 92.51  ? 871  ASP A OD2   1 
ATOM   6734  N  N     . GLY A 1  872  ? 23.845  -61.960  11.844  1.00 98.85  ? 872  GLY A N     1 
ATOM   6735  C  CA    . GLY A 1  872  ? 24.138  -60.634  12.342  1.00 90.37  ? 872  GLY A CA    1 
ATOM   6736  C  C     . GLY A 1  872  ? 24.307  -59.577  11.280  1.00 89.93  ? 872  GLY A C     1 
ATOM   6737  O  O     . GLY A 1  872  ? 24.939  -58.556  11.543  1.00 123.95 ? 872  GLY A O     1 
ATOM   6738  N  N     . MET A 1  873  ? 23.719  -59.757  10.106  1.00 90.08  ? 873  MET A N     1 
ATOM   6739  C  CA    . MET A 1  873  ? 23.945  -58.864  8.982   1.00 100.78 ? 873  MET A CA    1 
ATOM   6740  C  C     . MET A 1  873  ? 22.707  -58.038  8.627   1.00 90.03  ? 873  MET A C     1 
ATOM   6741  O  O     . MET A 1  873  ? 21.578  -58.522  8.734   1.00 89.38  ? 873  MET A O     1 
ATOM   6742  C  CB    . MET A 1  873  ? 24.393  -59.688  7.778   1.00 90.49  ? 873  MET A CB    1 
ATOM   6743  C  CG    . MET A 1  873  ? 25.636  -60.482  8.036   1.00 91.06  ? 873  MET A CG    1 
ATOM   6744  S  SD    . MET A 1  873  ? 27.074  -59.380  8.111   1.00 90.65  ? 873  MET A SD    1 
ATOM   6745  C  CE    . MET A 1  873  ? 28.336  -60.409  8.883   1.00 115.25 ? 873  MET A CE    1 
ATOM   6746  N  N     . ASP A 1  874  ? 22.935  -56.780  8.225   1.00 88.74  ? 874  ASP A N     1 
ATOM   6747  C  CA    . ASP A 1  874  ? 21.903  -55.942  7.627   1.00 88.34  ? 874  ASP A CA    1 
ATOM   6748  C  C     . ASP A 1  874  ? 21.605  -56.475  6.238   1.00 88.84  ? 874  ASP A C     1 
ATOM   6749  O  O     . ASP A 1  874  ? 22.518  -56.629  5.422   1.00 95.81  ? 874  ASP A O     1 
ATOM   6750  C  CB    . ASP A 1  874  ? 22.354  -54.484  7.555   1.00 118.92 ? 874  ASP A CB    1 
ATOM   6751  C  CG    . ASP A 1  874  ? 21.194  -53.507  7.405   1.00 120.78 ? 874  ASP A CG    1 
ATOM   6752  O  OD1   . ASP A 1  874  ? 20.632  -53.387  6.294   1.00 104.73 ? 874  ASP A OD1   1 
ATOM   6753  O  OD2   . ASP A 1  874  ? 20.859  -52.838  8.403   1.00 123.47 ? 874  ASP A OD2   1 
ATOM   6754  N  N     . ALA A 1  875  ? 20.339  -56.801  5.983   1.00 92.88  ? 875  ALA A N     1 
ATOM   6755  C  CA    . ALA A 1  875  ? 19.968  -57.435  4.724   1.00 89.50  ? 875  ALA A CA    1 
ATOM   6756  C  C     . ALA A 1  875  ? 20.294  -56.571  3.512   1.00 103.62 ? 875  ALA A C     1 
ATOM   6757  O  O     . ALA A 1  875  ? 20.435  -57.105  2.404   1.00 102.68 ? 875  ALA A O     1 
ATOM   6758  C  CB    . ALA A 1  875  ? 18.488  -57.777  4.758   1.00 102.96 ? 875  ALA A CB    1 
ATOM   6759  N  N     . ALA A 1  876  ? 20.429  -55.252  3.703   1.00 96.76  ? 876  ALA A N     1 
ATOM   6760  C  CA    . ALA A 1  876  ? 20.747  -54.347  2.606   1.00 88.67  ? 876  ALA A CA    1 
ATOM   6761  C  C     . ALA A 1  876  ? 22.183  -54.491  2.129   1.00 102.38 ? 876  ALA A C     1 
ATOM   6762  O  O     . ALA A 1  876  ? 22.470  -54.151  0.975   1.00 99.58  ? 876  ALA A O     1 
ATOM   6763  C  CB    . ALA A 1  876  ? 20.484  -52.913  3.034   1.00 89.38  ? 876  ALA A CB    1 
ATOM   6764  N  N     . HIS A 1  877  ? 23.067  -55.027  2.973   1.00 107.09 ? 877  HIS A N     1 
ATOM   6765  C  CA    . HIS A 1  877  ? 24.488  -55.192  2.679   1.00 101.28 ? 877  HIS A CA    1 
ATOM   6766  C  C     . HIS A 1  877  ? 24.804  -56.617  2.270   1.00 91.87  ? 877  HIS A C     1 
ATOM   6767  O  O     . HIS A 1  877  ? 25.839  -57.154  2.659   1.00 108.62 ? 877  HIS A O     1 
ATOM   6768  C  CB    . HIS A 1  877  ? 25.342  -54.831  3.891   1.00 112.60 ? 877  HIS A CB    1 
ATOM   6769  C  CG    . HIS A 1  877  ? 25.314  -53.387  4.258   1.00 104.74 ? 877  HIS A CG    1 
ATOM   6770  N  ND1   . HIS A 1  877  ? 24.557  -52.897  5.299   1.00 114.02 ? 877  HIS A ND1   1 
ATOM   6771  C  CD2   . HIS A 1  877  ? 25.957  -52.325  3.723   1.00 103.92 ? 877  HIS A CD2   1 
ATOM   6772  C  CE1   . HIS A 1  877  ? 24.733  -51.593  5.391   1.00 130.65 ? 877  HIS A CE1   1 
ATOM   6773  N  NE2   . HIS A 1  877  ? 25.576  -51.220  4.444   1.00 129.35 ? 877  HIS A NE2   1 
ATOM   6774  N  N     . ILE A 1  878  ? 23.964  -57.236  1.448   1.00 119.73 ? 878  ILE A N     1 
ATOM   6775  C  CA    . ILE A 1  878  ? 24.071  -58.660  1.158   1.00 91.45  ? 878  ILE A CA    1 
ATOM   6776  C  C     . ILE A 1  878  ? 23.757  -58.892  -0.311  1.00 109.30 ? 878  ILE A C     1 
ATOM   6777  O  O     . ILE A 1  878  ? 22.755  -58.380  -0.819  1.00 124.76 ? 878  ILE A O     1 
ATOM   6778  C  CB    . ILE A 1  878  ? 23.113  -59.466  2.047   1.00 91.51  ? 878  ILE A CB    1 
ATOM   6779  C  CG1   . ILE A 1  878  ? 23.762  -59.734  3.394   1.00 91.37  ? 878  ILE A CG1   1 
ATOM   6780  C  CG2   . ILE A 1  878  ? 22.745  -60.750  1.392   1.00 113.35 ? 878  ILE A CG2   1 
ATOM   6781  C  CD1   . ILE A 1  878  ? 22.912  -60.547  4.315   1.00 100.15 ? 878  ILE A CD1   1 
ATOM   6782  N  N     . GLU A 1  879  ? 24.605  -59.656  -0.999  1.00 92.71  ? 879  GLU A N     1 
ATOM   6783  C  CA    . GLU A 1  879  ? 24.402  -59.938  -2.414  1.00 93.33  ? 879  GLU A CA    1 
ATOM   6784  C  C     . GLU A 1  879  ? 24.531  -61.437  -2.655  1.00 113.97 ? 879  GLU A C     1 
ATOM   6785  O  O     . GLU A 1  879  ? 25.211  -62.155  -1.920  1.00 106.38 ? 879  GLU A O     1 
ATOM   6786  C  CB    . GLU A 1  879  ? 25.387  -59.171  -3.326  1.00 93.35  ? 879  GLU A CB    1 
ATOM   6787  C  CG    . GLU A 1  879  ? 25.824  -57.817  -2.788  1.00 92.49  ? 879  GLU A CG    1 
ATOM   6788  C  CD    . GLU A 1  879  ? 26.781  -57.106  -3.715  1.00 101.49 ? 879  GLU A CD    1 
ATOM   6789  O  OE1   . GLU A 1  879  ? 26.952  -57.568  -4.862  1.00 108.76 ? 879  GLU A OE1   1 
ATOM   6790  O  OE2   . GLU A 1  879  ? 27.369  -56.088  -3.297  1.00 113.74 ? 879  GLU A OE2   1 
ATOM   6791  N  N     . LYS A 1  880  ? 23.886  -61.906  -3.705  1.00 111.57 ? 880  LYS A N     1 
ATOM   6792  C  CA    . LYS A 1  880  ? 23.921  -63.322  -4.042  1.00 100.10 ? 880  LYS A CA    1 
ATOM   6793  C  C     . LYS A 1  880  ? 25.226  -63.618  -4.757  1.00 96.41  ? 880  LYS A C     1 
ATOM   6794  O  O     . LYS A 1  880  ? 25.399  -63.251  -5.920  1.00 133.27 ? 880  LYS A O     1 
ATOM   6795  C  CB    . LYS A 1  880  ? 22.729  -63.698  -4.913  1.00 125.23 ? 880  LYS A CB    1 
ATOM   6796  C  CG    . LYS A 1  880  ? 22.519  -65.184  -5.064  1.00 126.22 ? 880  LYS A CG    1 
ATOM   6797  C  CD    . LYS A 1  880  ? 21.115  -65.483  -5.563  1.00 138.89 ? 880  LYS A CD    1 
ATOM   6798  C  CE    . LYS A 1  880  ? 20.837  -64.816  -6.895  1.00 139.71 ? 880  LYS A CE    1 
ATOM   6799  N  NZ    . LYS A 1  880  ? 19.376  -64.604  -7.084  1.00 138.65 ? 880  LYS A NZ    1 
ATOM   6800  N  N     . GLN A 1  881  ? 26.171  -64.247  -4.069  1.00 108.66 ? 881  GLN A N     1 
ATOM   6801  C  CA    . GLN A 1  881  ? 27.382  -64.696  -4.742  1.00 133.95 ? 881  GLN A CA    1 
ATOM   6802  C  C     . GLN A 1  881  ? 27.444  -66.220  -4.714  1.00 118.94 ? 881  GLN A C     1 
ATOM   6803  O  O     . GLN A 1  881  ? 26.724  -66.882  -3.968  1.00 100.48 ? 881  GLN A O     1 
ATOM   6804  C  CB    . GLN A 1  881  ? 28.627  -64.055  -4.127  1.00 116.16 ? 881  GLN A CB    1 
ATOM   6805  C  CG    . GLN A 1  881  ? 28.522  -63.809  -2.644  1.00 102.41 ? 881  GLN A CG    1 
ATOM   6806  C  CD    . GLN A 1  881  ? 29.575  -62.827  -2.181  1.00 111.46 ? 881  GLN A CD    1 
ATOM   6807  O  OE1   . GLN A 1  881  ? 30.576  -62.598  -2.871  1.00 107.03 ? 881  GLN A OE1   1 
ATOM   6808  N  NE2   . GLN A 1  881  ? 29.336  -62.202  -1.036  1.00 94.82  ? 881  GLN A NE2   1 
ATOM   6809  N  N     . SER A 1  882  ? 28.318  -66.781  -5.547  1.00 126.74 ? 882  SER A N     1 
ATOM   6810  C  CA    . SER A 1  882  ? 28.410  -68.226  -5.728  1.00 116.72 ? 882  SER A CA    1 
ATOM   6811  C  C     . SER A 1  882  ? 29.521  -68.802  -4.860  1.00 102.75 ? 882  SER A C     1 
ATOM   6812  O  O     . SER A 1  882  ? 30.582  -68.190  -4.694  1.00 116.05 ? 882  SER A O     1 
ATOM   6813  C  CB    . SER A 1  882  ? 28.655  -68.595  -7.197  1.00 119.85 ? 882  SER A CB    1 
ATOM   6814  O  OG    . SER A 1  882  ? 30.037  -68.680  -7.509  1.00 134.72 ? 882  SER A OG    1 
ATOM   6815  N  N     . LEU A 1  883  ? 29.251  -69.962  -4.267  1.00 102.85 ? 883  LEU A N     1 
ATOM   6816  C  CA    . LEU A 1  883  ? 30.247  -70.696  -3.487  1.00 124.74 ? 883  LEU A CA    1 
ATOM   6817  C  C     . LEU A 1  883  ? 30.993  -71.646  -4.422  1.00 143.21 ? 883  LEU A C     1 
ATOM   6818  O  O     . LEU A 1  883  ? 30.581  -72.787  -4.662  1.00 128.67 ? 883  LEU A O     1 
ATOM   6819  C  CB    . LEU A 1  883  ? 29.563  -71.419  -2.334  1.00 116.68 ? 883  LEU A CB    1 
ATOM   6820  C  CG    . LEU A 1  883  ? 29.357  -70.494  -1.126  1.00 100.34 ? 883  LEU A CG    1 
ATOM   6821  C  CD1   . LEU A 1  883  ? 28.185  -70.895  -0.265  1.00 100.13 ? 883  LEU A CD1   1 
ATOM   6822  C  CD2   . LEU A 1  883  ? 30.610  -70.465  -0.296  1.00 123.71 ? 883  LEU A CD2   1 
ATOM   6823  N  N     . ASP A 1  884  ? 32.137  -71.172  -4.933  1.00 151.53 ? 884  ASP A N     1 
ATOM   6824  C  CA    . ASP A 1  884  ? 32.887  -71.814  -6.013  1.00 155.24 ? 884  ASP A CA    1 
ATOM   6825  C  C     . ASP A 1  884  ? 33.458  -73.158  -5.645  1.00 157.22 ? 884  ASP A C     1 
ATOM   6826  O  O     . ASP A 1  884  ? 34.209  -73.698  -6.474  1.00 162.64 ? 884  ASP A O     1 
ATOM   6827  C  CB    . ASP A 1  884  ? 34.027  -70.894  -6.457  1.00 141.17 ? 884  ASP A CB    1 
ATOM   6828  C  CG    . ASP A 1  884  ? 33.621  -69.958  -7.569  1.00 147.23 ? 884  ASP A CG    1 
ATOM   6829  O  OD1   . ASP A 1  884  ? 32.662  -70.277  -8.306  1.00 151.68 ? 884  ASP A OD1   1 
ATOM   6830  O  OD2   . ASP A 1  884  ? 34.271  -68.903  -7.718  1.00 153.87 ? 884  ASP A OD2   1 
ATOM   6831  N  N     . THR A 1  885  ? 33.112  -73.735  -4.498  1.00 146.43 ? 885  THR A N     1 
ATOM   6832  C  CA    . THR A 1  885  ? 33.789  -74.915  -3.979  1.00 128.00 ? 885  THR A CA    1 
ATOM   6833  C  C     . THR A 1  885  ? 32.782  -75.998  -3.620  1.00 131.89 ? 885  THR A C     1 
ATOM   6834  O  O     . THR A 1  885  ? 32.970  -76.741  -2.656  1.00 142.07 ? 885  THR A O     1 
ATOM   6835  C  CB    . THR A 1  885  ? 34.647  -74.547  -2.762  1.00 105.20 ? 885  THR A CB    1 
ATOM   6836  O  OG1   . THR A 1  885  ? 35.189  -75.719  -2.171  1.00 106.11 ? 885  THR A OG1   1 
ATOM   6837  C  CG2   . THR A 1  885  ? 33.807  -73.927  -1.693  1.00 113.65 ? 885  THR A CG2   1 
ATOM   6838  N  N     . ILE A 1  886  ? 31.706  -76.141  -4.396  1.00 137.09 ? 886  ILE A N     1 
ATOM   6839  C  CA    . ILE A 1  886  ? 30.664  -77.093  -4.016  1.00 125.91 ? 886  ILE A CA    1 
ATOM   6840  C  C     . ILE A 1  886  ? 30.318  -77.999  -5.191  1.00 124.31 ? 886  ILE A C     1 
ATOM   6841  O  O     . ILE A 1  886  ? 29.880  -79.138  -5.003  1.00 133.06 ? 886  ILE A O     1 
ATOM   6842  C  CB    . ILE A 1  886  ? 29.409  -76.356  -3.494  1.00 118.47 ? 886  ILE A CB    1 
ATOM   6843  C  CG1   . ILE A 1  886  ? 28.665  -77.217  -2.472  1.00 123.00 ? 886  ILE A CG1   1 
ATOM   6844  C  CG2   . ILE A 1  886  ? 28.459  -75.980  -4.635  1.00 105.59 ? 886  ILE A CG2   1 
ATOM   6845  C  CD1   . ILE A 1  886  ? 27.414  -76.570  -1.909  1.00 104.86 ? 886  ILE A CD1   1 
ATOM   6846  N  N     . GLY A 1  887  ? 30.537  -77.517  -6.411  1.00 120.23 ? 887  GLY A N     1 
ATOM   6847  C  CA    . GLY A 1  887  ? 30.123  -78.209  -7.605  1.00 112.83 ? 887  GLY A CA    1 
ATOM   6848  C  C     . GLY A 1  887  ? 31.290  -78.776  -8.388  1.00 122.01 ? 887  GLY A C     1 
ATOM   6849  O  O     . GLY A 1  887  ? 32.434  -78.816  -7.929  1.00 128.94 ? 887  GLY A O     1 
ATOM   6850  N  N     . GLY A 1  888  ? 30.974  -79.231  -9.596  1.00 126.23 ? 888  GLY A N     1 
ATOM   6851  C  CA    . GLY A 1  888  ? 31.993  -79.760  -10.477 1.00 141.79 ? 888  GLY A CA    1 
ATOM   6852  C  C     . GLY A 1  888  ? 32.536  -81.083  -9.995  1.00 136.27 ? 888  GLY A C     1 
ATOM   6853  O  O     . GLY A 1  888  ? 32.222  -81.533  -8.889  1.00 122.14 ? 888  GLY A O     1 
ATOM   6854  N  N     . SER A 1  889  ? 33.369  -81.712  -10.811 1.00 131.72 ? 889  SER A N     1 
ATOM   6855  C  CA    . SER A 1  889  ? 33.917  -82.994  -10.419 1.00 138.12 ? 889  SER A CA    1 
ATOM   6856  C  C     . SER A 1  889  ? 34.858  -82.844  -9.232  1.00 139.13 ? 889  SER A C     1 
ATOM   6857  O  O     . SER A 1  889  ? 35.400  -81.767  -8.955  1.00 123.45 ? 889  SER A O     1 
ATOM   6858  C  CB    . SER A 1  889  ? 34.669  -83.627  -11.591 1.00 155.09 ? 889  SER A CB    1 
ATOM   6859  O  OG    . SER A 1  889  ? 35.768  -82.814  -11.977 1.00 158.83 ? 889  SER A OG    1 
ATOM   6860  N  N     . ASP A 1  890  ? 35.041  -83.960  -8.520  1.00 143.80 ? 890  ASP A N     1 
ATOM   6861  C  CA    . ASP A 1  890  ? 36.072  -84.023  -7.495  1.00 129.92 ? 890  ASP A CA    1 
ATOM   6862  C  C     . ASP A 1  890  ? 37.440  -83.735  -8.094  1.00 136.90 ? 890  ASP A C     1 
ATOM   6863  O  O     . ASP A 1  890  ? 38.350  -83.312  -7.372  1.00 129.83 ? 890  ASP A O     1 
ATOM   6864  C  CB    . ASP A 1  890  ? 36.065  -85.408  -6.824  1.00 117.90 ? 890  ASP A CB    1 
ATOM   6865  C  CG    . ASP A 1  890  ? 35.235  -85.450  -5.546  1.00 131.71 ? 890  ASP A CG    1 
ATOM   6866  O  OD1   . ASP A 1  890  ? 35.591  -84.731  -4.591  1.00 158.68 ? 890  ASP A OD1   1 
ATOM   6867  O  OD2   . ASP A 1  890  ? 34.226  -86.185  -5.485  1.00 136.86 ? 890  ASP A OD2   1 
ATOM   6868  N  N     . ALA A 1  891  ? 37.584  -83.914  -9.412  1.00 138.82 ? 891  ALA A N     1 
ATOM   6869  C  CA    . ALA A 1  891  ? 38.850  -83.674  -10.092 1.00 123.68 ? 891  ALA A CA    1 
ATOM   6870  C  C     . ALA A 1  891  ? 39.036  -82.210  -10.460 1.00 121.72 ? 891  ALA A C     1 
ATOM   6871  O  O     . ALA A 1  891  ? 40.088  -81.634  -10.179 1.00 126.34 ? 891  ALA A O     1 
ATOM   6872  C  CB    . ALA A 1  891  ? 38.949  -84.558  -11.336 1.00 125.93 ? 891  ALA A CB    1 
ATOM   6873  N  N     . ALA A 1  892  ? 38.037  -81.587  -11.098 1.00 130.88 ? 892  ALA A N     1 
ATOM   6874  C  CA    . ALA A 1  892  ? 38.154  -80.166  -11.442 1.00 132.97 ? 892  ALA A CA    1 
ATOM   6875  C  C     . ALA A 1  892  ? 38.394  -79.310  -10.205 1.00 115.73 ? 892  ALA A C     1 
ATOM   6876  O  O     . ALA A 1  892  ? 39.093  -78.282  -10.266 1.00 117.49 ? 892  ALA A O     1 
ATOM   6877  C  CB    . ALA A 1  892  ? 36.901  -79.699  -12.181 1.00 130.90 ? 892  ALA A CB    1 
ATOM   6878  N  N     . PHE A 1  893  ? 37.847  -79.748  -9.072  1.00 112.98 ? 893  PHE A N     1 
ATOM   6879  C  CA    . PHE A 1  893  ? 38.201  -79.191  -7.775  1.00 112.03 ? 893  PHE A CA    1 
ATOM   6880  C  C     . PHE A 1  893  ? 39.706  -79.250  -7.553  1.00 131.66 ? 893  PHE A C     1 
ATOM   6881  O  O     . PHE A 1  893  ? 40.351  -78.234  -7.259  1.00 135.05 ? 893  PHE A O     1 
ATOM   6882  C  CB    . PHE A 1  893  ? 37.461  -79.975  -6.687  1.00 112.08 ? 893  PHE A CB    1 
ATOM   6883  C  CG    . PHE A 1  893  ? 37.766  -79.530  -5.283  1.00 111.23 ? 893  PHE A CG    1 
ATOM   6884  C  CD1   . PHE A 1  893  ? 36.947  -78.635  -4.626  1.00 115.55 ? 893  PHE A CD1   1 
ATOM   6885  C  CD2   . PHE A 1  893  ? 38.867  -80.029  -4.609  1.00 119.89 ? 893  PHE A CD2   1 
ATOM   6886  C  CE1   . PHE A 1  893  ? 37.233  -78.234  -3.325  1.00 109.22 ? 893  PHE A CE1   1 
ATOM   6887  C  CE2   . PHE A 1  893  ? 39.152  -79.631  -3.317  1.00 123.56 ? 893  PHE A CE2   1 
ATOM   6888  C  CZ    . PHE A 1  893  ? 38.331  -78.730  -2.676  1.00 121.68 ? 893  PHE A CZ    1 
ATOM   6889  N  N     . GLU A 1  894  ? 40.284  -80.443  -7.704  1.00 128.04 ? 894  GLU A N     1 
ATOM   6890  C  CA    . GLU A 1  894  ? 41.702  -80.621  -7.422  1.00 114.30 ? 894  GLU A CA    1 
ATOM   6891  C  C     . GLU A 1  894  ? 42.542  -79.797  -8.392  1.00 124.34 ? 894  GLU A C     1 
ATOM   6892  O  O     . GLU A 1  894  ? 43.536  -79.172  -7.998  1.00 113.81 ? 894  GLU A O     1 
ATOM   6893  C  CB    . GLU A 1  894  ? 42.033  -82.116  -7.514  1.00 128.93 ? 894  GLU A CB    1 
ATOM   6894  C  CG    . GLU A 1  894  ? 43.449  -82.476  -7.927  1.00 148.83 ? 894  GLU A CG    1 
ATOM   6895  C  CD    . GLU A 1  894  ? 43.800  -83.903  -7.559  1.00 161.82 ? 894  GLU A CD    1 
ATOM   6896  O  OE1   . GLU A 1  894  ? 42.862  -84.694  -7.317  1.00 141.63 ? 894  GLU A OE1   1 
ATOM   6897  O  OE2   . GLU A 1  894  ? 45.006  -84.235  -7.527  1.00 189.75 ? 894  GLU A OE2   1 
ATOM   6898  N  N     . LYS A 1  895  ? 42.127  -79.752  -9.661  1.00 121.39 ? 895  LYS A N     1 
ATOM   6899  C  CA    . LYS A 1  895  ? 42.840  -78.979  -10.667 1.00 118.77 ? 895  LYS A CA    1 
ATOM   6900  C  C     . LYS A 1  895  ? 42.850  -77.507  -10.317 1.00 129.98 ? 895  LYS A C     1 
ATOM   6901  O  O     . LYS A 1  895  ? 43.832  -76.807  -10.598 1.00 131.53 ? 895  LYS A O     1 
ATOM   6902  C  CB    . LYS A 1  895  ? 42.195  -79.172  -12.046 1.00 115.16 ? 895  LYS A CB    1 
ATOM   6903  C  CG    . LYS A 1  895  ? 43.000  -78.571  -13.205 1.00 127.97 ? 895  LYS A CG    1 
ATOM   6904  C  CD    . LYS A 1  895  ? 42.269  -78.693  -14.542 1.00 135.18 ? 895  LYS A CD    1 
ATOM   6905  C  CE    . LYS A 1  895  ? 42.796  -77.683  -15.555 1.00 135.16 ? 895  LYS A CE    1 
ATOM   6906  N  NZ    . LYS A 1  895  ? 44.097  -78.109  -16.138 1.00 144.57 ? 895  LYS A NZ    1 
ATOM   6907  N  N     . ARG A 1  896  ? 41.788  -77.032  -9.665  1.00 124.61 ? 896  ARG A N     1 
ATOM   6908  C  CA    . ARG A 1  896  ? 41.715  -75.608  -9.378  1.00 120.32 ? 896  ARG A CA    1 
ATOM   6909  C  C     . ARG A 1  896  ? 42.435  -75.246  -8.085  1.00 125.00 ? 896  ARG A C     1 
ATOM   6910  O  O     . ARG A 1  896  ? 43.085  -74.193  -8.027  1.00 137.66 ? 896  ARG A O     1 
ATOM   6911  C  CB    . ARG A 1  896  ? 40.260  -75.146  -9.292  1.00 109.76 ? 896  ARG A CB    1 
ATOM   6912  C  CG    . ARG A 1  896  ? 40.111  -73.634  -9.206  1.00 112.34 ? 896  ARG A CG    1 
ATOM   6913  C  CD    . ARG A 1  896  ? 38.678  -73.230  -8.966  1.00 126.70 ? 896  ARG A CD    1 
ATOM   6914  N  NE    . ARG A 1  896  ? 38.242  -72.224  -9.915  1.00 135.96 ? 896  ARG A NE    1 
ATOM   6915  C  CZ    . ARG A 1  896  ? 36.958  -71.955  -10.141 1.00 144.92 ? 896  ARG A CZ    1 
ATOM   6916  N  NH1   . ARG A 1  896  ? 36.021  -72.623  -9.478  1.00 117.58 ? 896  ARG A NH1   1 
ATOM   6917  N  NH2   . ARG A 1  896  ? 36.620  -71.033  -11.032 1.00 163.61 ? 896  ARG A NH2   1 
ATOM   6918  N  N     . TYR A 1  897  ? 42.347  -76.091  -7.054  1.00 110.28 ? 897  TYR A N     1 
ATOM   6919  C  CA    . TYR A 1  897  ? 42.772  -75.705  -5.710  1.00 109.58 ? 897  TYR A CA    1 
ATOM   6920  C  C     . TYR A 1  897  ? 44.022  -76.413  -5.203  1.00 120.93 ? 897  TYR A C     1 
ATOM   6921  O  O     . TYR A 1  897  ? 44.666  -75.899  -4.285  1.00 117.09 ? 897  TYR A O     1 
ATOM   6922  C  CB    . TYR A 1  897  ? 41.639  -75.936  -4.698  1.00 109.05 ? 897  TYR A CB    1 
ATOM   6923  C  CG    . TYR A 1  897  ? 40.465  -75.024  -4.947  1.00 121.97 ? 897  TYR A CG    1 
ATOM   6924  C  CD1   . TYR A 1  897  ? 40.433  -73.748  -4.419  1.00 106.73 ? 897  TYR A CD1   1 
ATOM   6925  C  CD2   . TYR A 1  897  ? 39.386  -75.439  -5.702  1.00 132.07 ? 897  TYR A CD2   1 
ATOM   6926  C  CE1   . TYR A 1  897  ? 39.371  -72.902  -4.656  1.00 114.75 ? 897  TYR A CE1   1 
ATOM   6927  C  CE2   . TYR A 1  897  ? 38.313  -74.598  -5.931  1.00 138.91 ? 897  TYR A CE2   1 
ATOM   6928  C  CZ    . TYR A 1  897  ? 38.313  -73.334  -5.411  1.00 131.18 ? 897  TYR A CZ    1 
ATOM   6929  O  OH    . TYR A 1  897  ? 37.243  -72.504  -5.652  1.00 143.89 ? 897  TYR A OH    1 
ATOM   6930  N  N     . ARG A 1  898  ? 44.390  -77.556  -5.769  1.00 122.66 ? 898  ARG A N     1 
ATOM   6931  C  CA    . ARG A 1  898  ? 45.500  -78.328  -5.231  1.00 112.68 ? 898  ARG A CA    1 
ATOM   6932  C  C     . ARG A 1  898  ? 46.825  -77.724  -5.675  1.00 112.76 ? 898  ARG A C     1 
ATOM   6933  O  O     . ARG A 1  898  ? 47.006  -77.385  -6.848  1.00 117.29 ? 898  ARG A O     1 
ATOM   6934  C  CB    . ARG A 1  898  ? 45.404  -79.790  -5.660  1.00 119.47 ? 898  ARG A CB    1 
ATOM   6935  C  CG    . ARG A 1  898  ? 46.607  -80.627  -5.276  1.00 121.42 ? 898  ARG A CG    1 
ATOM   6936  C  CD    . ARG A 1  898  ? 46.811  -80.717  -3.776  1.00 116.82 ? 898  ARG A CD    1 
ATOM   6937  N  NE    . ARG A 1  898  ? 47.552  -81.924  -3.423  1.00 150.85 ? 898  ARG A NE    1 
ATOM   6938  C  CZ    . ARG A 1  898  ? 48.206  -82.093  -2.279  1.00 142.83 ? 898  ARG A CZ    1 
ATOM   6939  N  NH1   . ARG A 1  898  ? 48.226  -81.131  -1.362  1.00 115.17 ? 898  ARG A NH1   1 
ATOM   6940  N  NH2   . ARG A 1  898  ? 48.852  -83.228  -2.054  1.00 149.96 ? 898  ARG A NH2   1 
ATOM   6941  N  N     . VAL A 1  899  ? 47.733  -77.544  -4.722  1.00 112.61 ? 899  VAL A N     1 
ATOM   6942  C  CA    . VAL A 1  899  ? 49.099  -77.129  -5.005  1.00 112.85 ? 899  VAL A CA    1 
ATOM   6943  C  C     . VAL A 1  899  ? 50.027  -78.121  -4.322  1.00 129.61 ? 899  VAL A C     1 
ATOM   6944  O  O     . VAL A 1  899  ? 49.959  -78.298  -3.101  1.00 130.72 ? 899  VAL A O     1 
ATOM   6945  C  CB    . VAL A 1  899  ? 49.379  -75.692  -4.538  1.00 111.51 ? 899  VAL A CB    1 
ATOM   6946  C  CG1   . VAL A 1  899  ? 50.872  -75.445  -4.414  1.00 111.83 ? 899  VAL A CG1   1 
ATOM   6947  C  CG2   . VAL A 1  899  ? 48.780  -74.716  -5.528  1.00 123.28 ? 899  VAL A CG2   1 
ATOM   6948  N  N     . ASP A 1  900  ? 50.872  -78.781  -5.115  1.00 133.40 ? 900  ASP A N     1 
ATOM   6949  C  CA    . ASP A 1  900  ? 51.797  -79.816  -4.657  1.00 129.19 ? 900  ASP A CA    1 
ATOM   6950  C  C     . ASP A 1  900  ? 53.216  -79.351  -4.959  1.00 120.30 ? 900  ASP A C     1 
ATOM   6951  O  O     . ASP A 1  900  ? 53.691  -79.485  -6.089  1.00 120.98 ? 900  ASP A O     1 
ATOM   6952  C  CB    . ASP A 1  900  ? 51.500  -81.154  -5.337  1.00 140.78 ? 900  ASP A CB    1 
ATOM   6953  C  CG    . ASP A 1  900  ? 52.133  -82.337  -4.614  1.00 140.97 ? 900  ASP A CG    1 
ATOM   6954  O  OD1   . ASP A 1  900  ? 53.200  -82.155  -3.987  1.00 127.12 ? 900  ASP A OD1   1 
ATOM   6955  O  OD2   . ASP A 1  900  ? 51.575  -83.457  -4.687  1.00 142.47 ? 900  ASP A OD2   1 
ATOM   6956  N  N     . LEU A 1  901  ? 53.874  -78.765  -3.957  1.00 125.63 ? 901  LEU A N     1 
ATOM   6957  C  CA    . LEU A 1  901  ? 55.244  -78.285  -4.104  1.00 119.78 ? 901  LEU A CA    1 
ATOM   6958  C  C     . LEU A 1  901  ? 56.244  -79.418  -4.288  1.00 125.56 ? 901  LEU A C     1 
ATOM   6959  O  O     . LEU A 1  901  ? 57.405  -79.155  -4.615  1.00 123.52 ? 901  LEU A O     1 
ATOM   6960  C  CB    . LEU A 1  901  ? 55.638  -77.443  -2.888  1.00 115.23 ? 901  LEU A CB    1 
ATOM   6961  C  CG    . LEU A 1  901  ? 54.911  -76.106  -2.763  1.00 113.62 ? 901  LEU A CG    1 
ATOM   6962  C  CD1   . LEU A 1  901  ? 55.571  -75.215  -1.720  1.00 112.81 ? 901  LEU A CD1   1 
ATOM   6963  C  CD2   . LEU A 1  901  ? 54.866  -75.419  -4.114  1.00 113.37 ? 901  LEU A CD2   1 
ATOM   6964  N  N     . LEU A 1  902  ? 55.830  -80.659  -4.040  1.00 133.23 ? 902  LEU A N     1 
ATOM   6965  C  CA    . LEU A 1  902  ? 56.680  -81.828  -4.175  1.00 120.40 ? 902  LEU A CA    1 
ATOM   6966  C  C     . LEU A 1  902  ? 56.439  -82.581  -5.483  1.00 136.50 ? 902  LEU A C     1 
ATOM   6967  O  O     . LEU A 1  902  ? 56.855  -83.738  -5.608  1.00 159.86 ? 902  LEU A O     1 
ATOM   6968  C  CB    . LEU A 1  902  ? 56.477  -82.744  -2.970  1.00 123.04 ? 902  LEU A CB    1 
ATOM   6969  C  CG    . LEU A 1  902  ? 56.374  -81.965  -1.652  1.00 119.69 ? 902  LEU A CG    1 
ATOM   6970  C  CD1   . LEU A 1  902  ? 56.101  -82.892  -0.481  1.00 123.96 ? 902  LEU A CD1   1 
ATOM   6971  C  CD2   . LEU A 1  902  ? 57.614  -81.126  -1.399  1.00 119.37 ? 902  LEU A CD2   1 
ATOM   6972  N  N     . ASN A 1  903  ? 55.786  -81.954  -6.460  1.00 120.85 ? 903  ASN A N     1 
ATOM   6973  C  CA    . ASN A 1  903  ? 55.450  -82.619  -7.714  1.00 121.82 ? 903  ASN A CA    1 
ATOM   6974  C  C     . ASN A 1  903  ? 55.648  -81.619  -8.842  1.00 136.65 ? 903  ASN A C     1 
ATOM   6975  O  O     . ASN A 1  903  ? 55.072  -80.530  -8.816  1.00 153.67 ? 903  ASN A O     1 
ATOM   6976  C  CB    . ASN A 1  903  ? 54.015  -83.170  -7.697  1.00 121.73 ? 903  ASN A CB    1 
ATOM   6977  C  CG    . ASN A 1  903  ? 53.589  -83.766  -9.036  1.00 136.78 ? 903  ASN A CG    1 
ATOM   6978  O  OD1   . ASN A 1  903  ? 54.403  -83.964  -9.935  1.00 156.27 ? 903  ASN A OD1   1 
ATOM   6979  N  ND2   . ASN A 1  903  ? 52.302  -84.054  -9.166  1.00 166.60 ? 903  ASN A ND2   1 
ATOM   6980  N  N     . THR A 1  904  ? 56.457  -81.998  -9.837  1.00 143.97 ? 904  THR A N     1 
ATOM   6981  C  CA    . THR A 1  904  ? 56.881  -81.065  -10.875 1.00 139.20 ? 904  THR A CA    1 
ATOM   6982  C  C     . THR A 1  904  ? 55.778  -80.756  -11.880 1.00 144.15 ? 904  THR A C     1 
ATOM   6983  O  O     . THR A 1  904  ? 55.905  -79.790  -12.640 1.00 144.20 ? 904  THR A O     1 
ATOM   6984  C  CB    . THR A 1  904  ? 58.086  -81.643  -11.618 1.00 132.28 ? 904  THR A CB    1 
ATOM   6985  O  OG1   . THR A 1  904  ? 57.707  -82.871  -12.252 1.00 135.77 ? 904  THR A OG1   1 
ATOM   6986  C  CG2   . THR A 1  904  ? 59.212  -81.929  -10.655 1.00 124.03 ? 904  THR A CG2   1 
ATOM   6987  N  N     . ASP A 1  905  ? 54.718  -81.561  -11.920 1.00 139.49 ? 905  ASP A N     1 
ATOM   6988  C  CA    . ASP A 1  905  ? 53.569  -81.268  -12.763 1.00 145.17 ? 905  ASP A CA    1 
ATOM   6989  C  C     . ASP A 1  905  ? 52.475  -80.510  -12.019 1.00 148.60 ? 905  ASP A C     1 
ATOM   6990  O  O     . ASP A 1  905  ? 51.717  -79.761  -12.647 1.00 159.29 ? 905  ASP A O     1 
ATOM   6991  C  CB    . ASP A 1  905  ? 52.989  -82.569  -13.337 1.00 145.44 ? 905  ASP A CB    1 
ATOM   6992  C  CG    . ASP A 1  905  ? 54.043  -83.437  -14.011 1.00 148.96 ? 905  ASP A CG    1 
ATOM   6993  O  OD1   . ASP A 1  905  ? 55.055  -82.881  -14.486 1.00 152.57 ? 905  ASP A OD1   1 
ATOM   6994  O  OD2   . ASP A 1  905  ? 53.859  -84.675  -14.073 1.00 143.14 ? 905  ASP A OD2   1 
ATOM   6995  N  N     . HIS A 1  906  ? 52.405  -80.650  -10.690 1.00 132.58 ? 906  HIS A N     1 
ATOM   6996  C  CA    . HIS A 1  906  ? 51.343  -80.061  -9.880  1.00 125.06 ? 906  HIS A CA    1 
ATOM   6997  C  C     . HIS A 1  906  ? 51.872  -79.016  -8.900  1.00 124.62 ? 906  HIS A C     1 
ATOM   6998  O  O     . HIS A 1  906  ? 51.252  -78.760  -7.865  1.00 131.60 ? 906  HIS A O     1 
ATOM   6999  C  CB    . HIS A 1  906  ? 50.575  -81.154  -9.131  1.00 118.79 ? 906  HIS A CB    1 
ATOM   7000  C  CG    . HIS A 1  906  ? 49.797  -82.067  -10.027 1.00 131.28 ? 906  HIS A CG    1 
ATOM   7001  N  ND1   . HIS A 1  906  ? 50.102  -82.227  -11.362 1.00 133.53 ? 906  HIS A ND1   1 
ATOM   7002  C  CD2   . HIS A 1  906  ? 48.738  -82.877  -9.783  1.00 141.22 ? 906  HIS A CD2   1 
ATOM   7003  C  CE1   . HIS A 1  906  ? 49.262  -83.089  -11.904 1.00 152.11 ? 906  HIS A CE1   1 
ATOM   7004  N  NE2   . HIS A 1  906  ? 48.424  -83.500  -10.968 1.00 149.03 ? 906  HIS A NE2   1 
ATOM   7005  N  N     . THR A 1  907  ? 53.004  -78.394  -9.211  1.00 120.72 ? 907  THR A N     1 
ATOM   7006  C  CA    . THR A 1  907  ? 53.547  -77.324  -8.387  1.00 128.11 ? 907  THR A CA    1 
ATOM   7007  C  C     . THR A 1  907  ? 53.114  -75.979  -8.955  1.00 140.38 ? 907  THR A C     1 
ATOM   7008  O  O     . THR A 1  907  ? 52.558  -75.883  -10.052 1.00 141.74 ? 907  THR A O     1 
ATOM   7009  C  CB    . THR A 1  907  ? 55.082  -77.395  -8.276  1.00 124.41 ? 907  THR A CB    1 
ATOM   7010  O  OG1   . THR A 1  907  ? 55.494  -76.722  -7.081  1.00 122.00 ? 907  THR A OG1   1 
ATOM   7011  C  CG2   . THR A 1  907  ? 55.781  -76.716  -9.455  1.00 119.12 ? 907  THR A CG2   1 
ATOM   7012  N  N     . LEU A 1  908  ? 53.310  -74.941  -8.157  1.00 141.32 ? 908  LEU A N     1 
ATOM   7013  C  CA    . LEU A 1  908  ? 53.138  -73.578  -8.638  1.00 130.93 ? 908  LEU A CA    1 
ATOM   7014  C  C     . LEU A 1  908  ? 54.185  -73.284  -9.704  1.00 131.69 ? 908  LEU A C     1 
ATOM   7015  O  O     . LEU A 1  908  ? 55.386  -73.391  -9.443  1.00 138.55 ? 908  LEU A O     1 
ATOM   7016  C  CB    . LEU A 1  908  ? 53.254  -72.585  -7.490  1.00 111.33 ? 908  LEU A CB    1 
ATOM   7017  C  CG    . LEU A 1  908  ? 52.001  -72.526  -6.638  1.00 110.48 ? 908  LEU A CG    1 
ATOM   7018  C  CD1   . LEU A 1  908  ? 52.211  -71.647  -5.412  1.00 109.38 ? 908  LEU A CD1   1 
ATOM   7019  C  CD2   . LEU A 1  908  ? 50.901  -72.004  -7.531  1.00 109.94 ? 908  LEU A CD2   1 
ATOM   7020  N  N     . ASP A 1  909  ? 53.733  -72.984  -10.914 1.00 138.09 ? 909  ASP A N     1 
ATOM   7021  C  CA    . ASP A 1  909  ? 54.653  -72.705  -12.003 1.00 147.38 ? 909  ASP A CA    1 
ATOM   7022  C  C     . ASP A 1  909  ? 55.508  -71.487  -11.657 1.00 141.19 ? 909  ASP A C     1 
ATOM   7023  O  O     . ASP A 1  909  ? 55.007  -70.520  -11.068 1.00 151.67 ? 909  ASP A O     1 
ATOM   7024  C  CB    . ASP A 1  909  ? 53.869  -72.463  -13.296 1.00 157.94 ? 909  ASP A CB    1 
ATOM   7025  C  CG    . ASP A 1  909  ? 54.721  -72.608  -14.538 1.00 171.53 ? 909  ASP A CG    1 
ATOM   7026  O  OD1   . ASP A 1  909  ? 55.387  -71.623  -14.924 1.00 165.69 ? 909  ASP A OD1   1 
ATOM   7027  O  OD2   . ASP A 1  909  ? 54.732  -73.712  -15.125 1.00 179.46 ? 909  ASP A OD2   1 
ATOM   7028  N  N     . PRO A 1  910  ? 56.807  -71.507  -11.973 1.00 141.07 ? 910  PRO A N     1 
ATOM   7029  C  CA    . PRO A 1  910  ? 57.666  -70.364  -11.624 1.00 141.48 ? 910  PRO A CA    1 
ATOM   7030  C  C     . PRO A 1  910  ? 57.312  -69.088  -12.363 1.00 142.18 ? 910  PRO A C     1 
ATOM   7031  O  O     . PRO A 1  910  ? 57.848  -68.026  -12.020 1.00 134.11 ? 910  PRO A O     1 
ATOM   7032  C  CB    . PRO A 1  910  ? 59.066  -70.854  -11.999 1.00 115.25 ? 910  PRO A CB    1 
ATOM   7033  C  CG    . PRO A 1  910  ? 58.811  -71.835  -13.096 1.00 142.62 ? 910  PRO A CG    1 
ATOM   7034  C  CD    . PRO A 1  910  ? 57.548  -72.546  -12.705 1.00 146.65 ? 910  PRO A CD    1 
ATOM   7035  N  N     . SER A 1  911  ? 56.405  -69.158  -13.340 1.00 132.31 ? 911  SER A N     1 
ATOM   7036  C  CA    . SER A 1  911  ? 55.911  -67.967  -14.010 1.00 123.59 ? 911  SER A CA    1 
ATOM   7037  C  C     . SER A 1  911  ? 54.906  -67.204  -13.172 1.00 127.66 ? 911  SER A C     1 
ATOM   7038  O  O     . SER A 1  911  ? 54.747  -65.992  -13.376 1.00 132.16 ? 911  SER A O     1 
ATOM   7039  C  CB    . SER A 1  911  ? 55.255  -68.343  -15.343 1.00 133.78 ? 911  SER A CB    1 
ATOM   7040  O  OG    . SER A 1  911  ? 54.266  -69.350  -15.173 1.00 128.46 ? 911  SER A OG    1 
ATOM   7041  N  N     . LEU A 1  912  ? 54.250  -67.879  -12.222 1.00 122.34 ? 912  LEU A N     1 
ATOM   7042  C  CA    . LEU A 1  912  ? 53.205  -67.247  -11.428 1.00 114.54 ? 912  LEU A CA    1 
ATOM   7043  C  C     . LEU A 1  912  ? 53.745  -66.404  -10.286 1.00 114.44 ? 912  LEU A C     1 
ATOM   7044  O  O     . LEU A 1  912  ? 53.029  -65.518  -9.805  1.00 141.76 ? 912  LEU A O     1 
ATOM   7045  C  CB    . LEU A 1  912  ? 52.252  -68.311  -10.860 1.00 108.78 ? 912  LEU A CB    1 
ATOM   7046  C  CG    . LEU A 1  912  ? 51.585  -69.169  -11.934 1.00 119.33 ? 912  LEU A CG    1 
ATOM   7047  C  CD1   . LEU A 1  912  ? 50.538  -70.100  -11.321 1.00 111.89 ? 912  LEU A CD1   1 
ATOM   7048  C  CD2   . LEU A 1  912  ? 51.003  -68.287  -13.044 1.00 128.91 ? 912  LEU A CD2   1 
ATOM   7049  N  N     . LEU A 1  913  ? 54.968  -66.657  -9.835  1.00 114.24 ? 913  LEU A N     1 
ATOM   7050  C  CA    . LEU A 1  913  ? 55.515  -65.909  -8.713  1.00 126.79 ? 913  LEU A CA    1 
ATOM   7051  C  C     . LEU A 1  913  ? 57.034  -66.049  -8.742  1.00 142.03 ? 913  LEU A C     1 
ATOM   7052  O  O     . LEU A 1  913  ? 57.586  -66.899  -9.446  1.00 148.44 ? 913  LEU A O     1 
ATOM   7053  C  CB    . LEU A 1  913  ? 54.901  -66.377  -7.389  1.00 106.86 ? 913  LEU A CB    1 
ATOM   7054  C  CG    . LEU A 1  913  ? 55.388  -67.721  -6.870  1.00 115.10 ? 913  LEU A CG    1 
ATOM   7055  C  CD1   . LEU A 1  913  ? 56.388  -67.450  -5.805  1.00 129.91 ? 913  LEU A CD1   1 
ATOM   7056  C  CD2   . LEU A 1  913  ? 54.283  -68.608  -6.358  1.00 108.69 ? 913  LEU A CD2   1 
ATOM   7057  N  N     . GLU A 1  914  ? 57.698  -65.211  -7.946  1.00 132.33 ? 914  GLU A N     1 
ATOM   7058  C  CA    . GLU A 1  914  ? 59.139  -65.032  -8.044  1.00 132.07 ? 914  GLU A CA    1 
ATOM   7059  C  C     . GLU A 1  914  ? 59.916  -66.038  -7.205  1.00 140.41 ? 914  GLU A C     1 
ATOM   7060  O  O     . GLU A 1  914  ? 61.000  -66.470  -7.627  1.00 160.81 ? 914  GLU A O     1 
ATOM   7061  C  CB    . GLU A 1  914  ? 59.504  -63.609  -7.606  1.00 128.18 ? 914  GLU A CB    1 
ATOM   7062  C  CG    . GLU A 1  914  ? 58.776  -62.517  -8.385  1.00 126.75 ? 914  GLU A CG    1 
ATOM   7063  C  CD    . GLU A 1  914  ? 59.067  -61.135  -7.838  1.00 135.38 ? 914  GLU A CD    1 
ATOM   7064  O  OE1   . GLU A 1  914  ? 58.953  -60.150  -8.603  1.00 132.39 ? 914  GLU A OE1   1 
ATOM   7065  O  OE2   . GLU A 1  914  ? 59.419  -61.035  -6.644  1.00 127.48 ? 914  GLU A OE2   1 
ATOM   7066  N  N     . SER A 1  915  ? 59.389  -66.433  -6.049  1.00 124.31 ? 915  SER A N     1 
ATOM   7067  C  CA    . SER A 1  915  ? 59.993  -67.520  -5.290  1.00 142.06 ? 915  SER A CA    1 
ATOM   7068  C  C     . SER A 1  915  ? 59.570  -68.877  -5.825  1.00 143.78 ? 915  SER A C     1 
ATOM   7069  O  O     . SER A 1  915  ? 59.560  -69.865  -5.086  1.00 125.26 ? 915  SER A O     1 
ATOM   7070  C  CB    . SER A 1  915  ? 59.654  -67.421  -3.798  1.00 140.95 ? 915  SER A CB    1 
ATOM   7071  O  OG    . SER A 1  915  ? 58.274  -67.231  -3.553  1.00 128.65 ? 915  SER A OG    1 
ATOM   7072  N  N     . GLY A 1  916  ? 59.219  -68.938  -7.109  1.00 153.91 ? 916  GLY A N     1 
ATOM   7073  C  CA    . GLY A 1  916  ? 58.629  -70.155  -7.641  1.00 149.30 ? 916  GLY A CA    1 
ATOM   7074  C  C     . GLY A 1  916  ? 59.604  -71.316  -7.670  1.00 132.33 ? 916  GLY A C     1 
ATOM   7075  O  O     . GLY A 1  916  ? 59.291  -72.419  -7.216  1.00 126.74 ? 916  GLY A O     1 
ATOM   7076  N  N     . SER A 1  917  ? 60.811  -71.074  -8.186  1.00 135.85 ? 917  SER A N     1 
ATOM   7077  C  CA    . SER A 1  917  ? 61.776  -72.157  -8.329  1.00 126.14 ? 917  SER A CA    1 
ATOM   7078  C  C     . SER A 1  917  ? 62.392  -72.556  -6.998  1.00 126.13 ? 917  SER A C     1 
ATOM   7079  O  O     . SER A 1  917  ? 62.764  -73.723  -6.827  1.00 154.00 ? 917  SER A O     1 
ATOM   7080  C  CB    . SER A 1  917  ? 62.871  -71.767  -9.330  1.00 121.70 ? 917  SER A CB    1 
ATOM   7081  O  OG    . SER A 1  917  ? 63.620  -70.653  -8.869  1.00 147.74 ? 917  SER A OG    1 
ATOM   7082  N  N     . GLU A 1  918  ? 62.486  -71.629  -6.041  1.00 114.02 ? 918  GLU A N     1 
ATOM   7083  C  CA    . GLU A 1  918  ? 63.159  -71.917  -4.778  1.00 125.49 ? 918  GLU A CA    1 
ATOM   7084  C  C     . GLU A 1  918  ? 62.234  -72.519  -3.730  1.00 120.77 ? 918  GLU A C     1 
ATOM   7085  O  O     . GLU A 1  918  ? 62.715  -72.935  -2.668  1.00 120.73 ? 918  GLU A O     1 
ATOM   7086  C  CB    . GLU A 1  918  ? 63.829  -70.649  -4.213  1.00 122.90 ? 918  GLU A CB    1 
ATOM   7087  C  CG    . GLU A 1  918  ? 62.882  -69.490  -3.938  1.00 131.02 ? 918  GLU A CG    1 
ATOM   7088  C  CD    . GLU A 1  918  ? 63.552  -68.331  -3.210  1.00 150.60 ? 918  GLU A CD    1 
ATOM   7089  O  OE1   . GLU A 1  918  ? 64.226  -67.513  -3.872  1.00 162.89 ? 918  GLU A OE1   1 
ATOM   7090  O  OE2   . GLU A 1  918  ? 63.411  -68.242  -1.970  1.00 148.98 ? 918  GLU A OE2   1 
ATOM   7091  N  N     . ILE A 1  919  ? 60.942  -72.669  -4.030  1.00 113.60 ? 919  ILE A N     1 
ATOM   7092  C  CA    . ILE A 1  919  ? 60.028  -73.355  -3.123  1.00 132.06 ? 919  ILE A CA    1 
ATOM   7093  C  C     . ILE A 1  919  ? 59.676  -74.754  -3.606  1.00 133.59 ? 919  ILE A C     1 
ATOM   7094  O  O     . ILE A 1  919  ? 58.955  -75.486  -2.911  1.00 114.92 ? 919  ILE A O     1 
ATOM   7095  C  CB    . ILE A 1  919  ? 58.729  -72.545  -2.906  1.00 113.88 ? 919  ILE A CB    1 
ATOM   7096  C  CG1   . ILE A 1  919  ? 57.955  -72.424  -4.219  1.00 112.07 ? 919  ILE A CG1   1 
ATOM   7097  C  CG2   . ILE A 1  919  ? 59.024  -71.165  -2.323  1.00 114.18 ? 919  ILE A CG2   1 
ATOM   7098  C  CD1   . ILE A 1  919  ? 56.509  -72.017  -4.052  1.00 113.48 ? 919  ILE A CD1   1 
ATOM   7099  N  N     . LEU A 1  920  ? 60.167  -75.153  -4.771  1.00 123.12 ? 920  LEU A N     1 
ATOM   7100  C  CA    . LEU A 1  920  ? 59.984  -76.523  -5.226  1.00 117.07 ? 920  LEU A CA    1 
ATOM   7101  C  C     . LEU A 1  920  ? 60.649  -77.487  -4.252  1.00 122.49 ? 920  LEU A C     1 
ATOM   7102  O  O     . LEU A 1  920  ? 61.849  -77.388  -3.977  1.00 119.17 ? 920  LEU A O     1 
ATOM   7103  C  CB    . LEU A 1  920  ? 60.556  -76.690  -6.630  1.00 117.96 ? 920  LEU A CB    1 
ATOM   7104  C  CG    . LEU A 1  920  ? 60.456  -78.101  -7.199  1.00 119.47 ? 920  LEU A CG    1 
ATOM   7105  C  CD1   . LEU A 1  920  ? 59.035  -78.595  -7.146  1.00 119.25 ? 920  LEU A CD1   1 
ATOM   7106  C  CD2   . LEU A 1  920  ? 60.958  -78.113  -8.625  1.00 120.23 ? 920  LEU A CD2   1 
ATOM   7107  N  N     . GLY A 1  921  ? 59.858  -78.411  -3.723  1.00 118.38 ? 921  GLY A N     1 
ATOM   7108  C  CA    . GLY A 1  921  ? 60.336  -79.369  -2.752  1.00 119.30 ? 921  GLY A CA    1 
ATOM   7109  C  C     . GLY A 1  921  ? 60.440  -78.866  -1.327  1.00 133.90 ? 921  GLY A C     1 
ATOM   7110  O  O     . GLY A 1  921  ? 60.976  -79.587  -0.481  1.00 145.39 ? 921  GLY A O     1 
ATOM   7111  N  N     . ASP A 1  922  ? 59.928  -77.670  -1.022  1.00 128.30 ? 922  ASP A N     1 
ATOM   7112  C  CA    . ASP A 1  922  ? 59.949  -77.149  0.348   1.00 123.12 ? 922  ASP A CA    1 
ATOM   7113  C  C     . ASP A 1  922  ? 58.949  -77.947  1.176   1.00 127.75 ? 922  ASP A C     1 
ATOM   7114  O  O     . ASP A 1  922  ? 57.739  -77.844  0.965   1.00 150.08 ? 922  ASP A O     1 
ATOM   7115  C  CB    . ASP A 1  922  ? 59.642  -75.653  0.383   1.00 114.81 ? 922  ASP A CB    1 
ATOM   7116  C  CG    . ASP A 1  922  ? 60.023  -75.002  1.717   1.00 141.46 ? 922  ASP A CG    1 
ATOM   7117  O  OD1   . ASP A 1  922  ? 59.663  -75.545  2.787   1.00 152.15 ? 922  ASP A OD1   1 
ATOM   7118  O  OD2   . ASP A 1  922  ? 60.705  -73.954  1.706   1.00 146.74 ? 922  ASP A OD2   1 
ATOM   7119  N  N     . LEU A 1  923  ? 59.449  -78.744  2.120   1.00 122.25 ? 923  LEU A N     1 
ATOM   7120  C  CA    . LEU A 1  923  ? 58.578  -79.659  2.852   1.00 117.49 ? 923  LEU A CA    1 
ATOM   7121  C  C     . LEU A 1  923  ? 57.659  -78.927  3.822   1.00 124.98 ? 923  LEU A C     1 
ATOM   7122  O  O     . LEU A 1  923  ? 56.492  -79.308  3.982   1.00 149.32 ? 923  LEU A O     1 
ATOM   7123  C  CB    . LEU A 1  923  ? 59.430  -80.675  3.610   1.00 130.28 ? 923  LEU A CB    1 
ATOM   7124  C  CG    . LEU A 1  923  ? 60.016  -81.853  2.837   1.00 121.98 ? 923  LEU A CG    1 
ATOM   7125  C  CD1   . LEU A 1  923  ? 60.629  -82.847  3.813   1.00 121.67 ? 923  LEU A CD1   1 
ATOM   7126  C  CD2   . LEU A 1  923  ? 58.935  -82.499  1.998   1.00 141.24 ? 923  LEU A CD2   1 
ATOM   7127  N  N     . LYS A 1  924  ? 58.158  -77.875  4.472   1.00 130.88 ? 924  LYS A N     1 
ATOM   7128  C  CA    . LYS A 1  924  ? 57.338  -77.145  5.438   1.00 145.85 ? 924  LYS A CA    1 
ATOM   7129  C  C     . LYS A 1  924  ? 56.275  -76.306  4.733   1.00 134.04 ? 924  LYS A C     1 
ATOM   7130  O  O     . LYS A 1  924  ? 55.126  -76.202  5.203   1.00 142.11 ? 924  LYS A O     1 
ATOM   7131  C  CB    . LYS A 1  924  ? 58.230  -76.295  6.344   1.00 132.10 ? 924  LYS A CB    1 
ATOM   7132  C  CG    . LYS A 1  924  ? 59.316  -77.112  7.066   1.00 117.27 ? 924  LYS A CG    1 
ATOM   7133  C  CD    . LYS A 1  924  ? 60.369  -76.228  7.701   1.00 114.46 ? 924  LYS A CD    1 
ATOM   7134  C  CE    . LYS A 1  924  ? 60.914  -75.247  6.683   1.00 139.94 ? 924  LYS A CE    1 
ATOM   7135  N  NZ    . LYS A 1  924  ? 61.749  -75.867  5.622   1.00 145.02 ? 924  LYS A NZ    1 
ATOM   7136  N  N     . LEU A 1  925  ? 56.623  -75.732  3.579   1.00 112.65 ? 925  LEU A N     1 
ATOM   7137  C  CA    . LEU A 1  925  ? 55.627  -74.958  2.856   1.00 111.60 ? 925  LEU A CA    1 
ATOM   7138  C  C     . LEU A 1  925  ? 54.538  -75.882  2.341   1.00 123.52 ? 925  LEU A C     1 
ATOM   7139  O  O     . LEU A 1  925  ? 53.349  -75.533  2.359   1.00 140.60 ? 925  LEU A O     1 
ATOM   7140  C  CB    . LEU A 1  925  ? 56.281  -74.230  1.686   1.00 111.45 ? 925  LEU A CB    1 
ATOM   7141  C  CG    . LEU A 1  925  ? 57.094  -73.000  2.045   1.00 110.65 ? 925  LEU A CG    1 
ATOM   7142  C  CD1   . LEU A 1  925  ? 57.302  -72.169  0.791   1.00 110.27 ? 925  LEU A CD1   1 
ATOM   7143  C  CD2   . LEU A 1  925  ? 56.443  -72.231  3.181   1.00 109.48 ? 925  LEU A CD2   1 
ATOM   7144  N  N     . GLN A 1  926  ? 54.929  -77.076  1.886   1.00 113.42 ? 926  GLN A N     1 
ATOM   7145  C  CA    . GLN A 1  926  ? 53.935  -78.041  1.442   1.00 113.97 ? 926  GLN A CA    1 
ATOM   7146  C  C     . GLN A 1  926  ? 53.064  -78.469  2.610   1.00 120.90 ? 926  GLN A C     1 
ATOM   7147  O  O     . GLN A 1  926  ? 51.901  -78.824  2.415   1.00 129.83 ? 926  GLN A O     1 
ATOM   7148  C  CB    . GLN A 1  926  ? 54.594  -79.246  0.774   1.00 115.57 ? 926  GLN A CB    1 
ATOM   7149  C  CG    . GLN A 1  926  ? 53.585  -80.254  0.241   1.00 121.42 ? 926  GLN A CG    1 
ATOM   7150  C  CD    . GLN A 1  926  ? 52.699  -79.675  -0.842  1.00 123.60 ? 926  GLN A CD    1 
ATOM   7151  O  OE1   . GLN A 1  926  ? 53.109  -78.786  -1.583  1.00 125.87 ? 926  GLN A OE1   1 
ATOM   7152  N  NE2   . GLN A 1  926  ? 51.461  -80.147  -0.907  1.00 131.26 ? 926  GLN A NE2   1 
ATOM   7153  N  N     . VAL A 1  927  ? 53.624  -78.496  3.824   1.00 113.82 ? 927  VAL A N     1 
ATOM   7154  C  CA    . VAL A 1  927  ? 52.816  -78.791  5.006   1.00 115.87 ? 927  VAL A CA    1 
ATOM   7155  C  C     . VAL A 1  927  ? 51.741  -77.726  5.194   1.00 112.04 ? 927  VAL A C     1 
ATOM   7156  O  O     . VAL A 1  927  ? 50.574  -78.035  5.494   1.00 122.48 ? 927  VAL A O     1 
ATOM   7157  C  CB    . VAL A 1  927  ? 53.725  -78.929  6.246   1.00 113.94 ? 927  VAL A CB    1 
ATOM   7158  C  CG1   . VAL A 1  927  ? 52.932  -78.807  7.531   1.00 113.32 ? 927  VAL A CG1   1 
ATOM   7159  C  CG2   . VAL A 1  927  ? 54.453  -80.276  6.216   1.00 139.06 ? 927  VAL A CG2   1 
ATOM   7160  N  N     . LEU A 1  928  ? 52.081  -76.471  4.888   1.00 111.07 ? 928  LEU A N     1 
ATOM   7161  C  CA    . LEU A 1  928  ? 51.080  -75.401  4.940   1.00 119.37 ? 928  LEU A CA    1 
ATOM   7162  C  C     . LEU A 1  928  ? 50.013  -75.559  3.858   1.00 121.51 ? 928  LEU A C     1 
ATOM   7163  O  O     . LEU A 1  928  ? 48.808  -75.457  4.138   1.00 108.91 ? 928  LEU A O     1 
ATOM   7164  C  CB    . LEU A 1  928  ? 51.753  -74.032  4.831   1.00 108.75 ? 928  LEU A CB    1 
ATOM   7165  C  CG    . LEU A 1  928  ? 52.025  -73.365  6.180   1.00 112.87 ? 928  LEU A CG    1 
ATOM   7166  C  CD1   . LEU A 1  928  ? 52.704  -72.040  5.977   1.00 112.74 ? 928  LEU A CD1   1 
ATOM   7167  C  CD2   . LEU A 1  928  ? 50.739  -73.187  6.967   1.00 127.23 ? 928  LEU A CD2   1 
ATOM   7168  N  N     . LEU A 1  929  ? 50.432  -75.756  2.610   1.00 110.11 ? 929  LEU A N     1 
ATOM   7169  C  CA    . LEU A 1  929  ? 49.468  -75.871  1.520   1.00 111.71 ? 929  LEU A CA    1 
ATOM   7170  C  C     . LEU A 1  929  ? 48.631  -77.138  1.640   1.00 116.98 ? 929  LEU A C     1 
ATOM   7171  O  O     . LEU A 1  929  ? 47.479  -77.174  1.192   1.00 129.69 ? 929  LEU A O     1 
ATOM   7172  C  CB    . LEU A 1  929  ? 50.203  -75.854  0.185   1.00 110.64 ? 929  LEU A CB    1 
ATOM   7173  C  CG    . LEU A 1  929  ? 50.748  -74.488  -0.214  1.00 117.92 ? 929  LEU A CG    1 
ATOM   7174  C  CD1   . LEU A 1  929  ? 51.881  -74.684  -1.185  1.00 126.80 ? 929  LEU A CD1   1 
ATOM   7175  C  CD2   . LEU A 1  929  ? 49.652  -73.624  -0.820  1.00 108.70 ? 929  LEU A CD2   1 
ATOM   7176  N  N     . ASP A 1  930  ? 49.184  -78.170  2.269   1.00 128.90 ? 930  ASP A N     1 
ATOM   7177  C  CA    . ASP A 1  930  ? 48.422  -79.374  2.567   1.00 135.48 ? 930  ASP A CA    1 
ATOM   7178  C  C     . ASP A 1  930  ? 47.312  -79.080  3.562   1.00 125.17 ? 930  ASP A C     1 
ATOM   7179  O  O     . ASP A 1  930  ? 46.165  -79.494  3.359   1.00 129.26 ? 930  ASP A O     1 
ATOM   7180  C  CB    . ASP A 1  930  ? 49.366  -80.460  3.094   1.00 136.34 ? 930  ASP A CB    1 
ATOM   7181  C  CG    . ASP A 1  930  ? 49.920  -81.343  1.985   1.00 138.54 ? 930  ASP A CG    1 
ATOM   7182  O  OD1   . ASP A 1  930  ? 49.279  -81.415  0.915   1.00 139.95 ? 930  ASP A OD1   1 
ATOM   7183  O  OD2   . ASP A 1  930  ? 50.999  -81.953  2.171   1.00 130.78 ? 930  ASP A OD2   1 
ATOM   7184  N  N     . GLU A 1  931  ? 47.621  -78.356  4.644   1.00 119.07 ? 931  GLU A N     1 
ATOM   7185  C  CA    . GLU A 1  931  ? 46.549  -78.089  5.602   1.00 131.81 ? 931  GLU A CA    1 
ATOM   7186  C  C     . GLU A 1  931  ? 45.535  -77.090  5.046   1.00 115.12 ? 931  GLU A C     1 
ATOM   7187  O  O     . GLU A 1  931  ? 44.344  -77.149  5.397   1.00 109.60 ? 931  GLU A O     1 
ATOM   7188  C  CB    . GLU A 1  931  ? 47.105  -77.596  6.936   1.00 155.93 ? 931  GLU A CB    1 
ATOM   7189  C  CG    . GLU A 1  931  ? 47.259  -76.095  7.049   1.00 171.02 ? 931  GLU A CG    1 
ATOM   7190  C  CD    . GLU A 1  931  ? 47.825  -75.681  8.391   1.00 186.92 ? 931  GLU A CD    1 
ATOM   7191  O  OE1   . GLU A 1  931  ? 48.721  -76.390  8.901   1.00 186.41 ? 931  GLU A OE1   1 
ATOM   7192  O  OE2   . GLU A 1  931  ? 47.349  -74.671  8.950   1.00 190.57 ? 931  GLU A OE2   1 
ATOM   7193  N  N     . GLU A 1  932  ? 45.968  -76.229  4.114   1.00 110.85 ? 932  GLU A N     1 
ATOM   7194  C  CA    . GLU A 1  932  ? 45.025  -75.400  3.368   1.00 114.54 ? 932  GLU A CA    1 
ATOM   7195  C  C     . GLU A 1  932  ? 44.059  -76.270  2.569   1.00 118.40 ? 932  GLU A C     1 
ATOM   7196  O  O     . GLU A 1  932  ? 42.837  -76.056  2.589   1.00 130.75 ? 932  GLU A O     1 
ATOM   7197  C  CB    . GLU A 1  932  ? 45.765  -74.435  2.427   1.00 107.17 ? 932  GLU A CB    1 
ATOM   7198  C  CG    . GLU A 1  932  ? 44.979  -74.127  1.127   1.00 108.54 ? 932  GLU A CG    1 
ATOM   7199  C  CD    . GLU A 1  932  ? 45.574  -72.995  0.267   1.00 131.85 ? 932  GLU A CD    1 
ATOM   7200  O  OE1   . GLU A 1  932  ? 45.665  -73.163  -0.971  1.00 119.08 ? 932  GLU A OE1   1 
ATOM   7201  O  OE2   . GLU A 1  932  ? 45.960  -71.942  0.821   1.00 126.61 ? 932  GLU A OE2   1 
ATOM   7202  N  N     . TYR A 1  933  ? 44.593  -77.260  1.851   1.00 115.97 ? 933  TYR A N     1 
ATOM   7203  C  CA    . TYR A 1  933  ? 43.756  -78.077  0.986   1.00 114.12 ? 933  TYR A CA    1 
ATOM   7204  C  C     . TYR A 1  933  ? 42.835  -78.974  1.811   1.00 121.75 ? 933  TYR A C     1 
ATOM   7205  O  O     . TYR A 1  933  ? 41.689  -79.234  1.410   1.00 119.32 ? 933  TYR A O     1 
ATOM   7206  C  CB    . TYR A 1  933  ? 44.654  -78.897  0.049   1.00 127.53 ? 933  TYR A CB    1 
ATOM   7207  C  CG    . TYR A 1  933  ? 43.935  -79.684  -1.027  1.00 127.50 ? 933  TYR A CG    1 
ATOM   7208  C  CD1   . TYR A 1  933  ? 43.603  -79.100  -2.237  1.00 133.86 ? 933  TYR A CD1   1 
ATOM   7209  C  CD2   . TYR A 1  933  ? 43.608  -81.014  -0.843  1.00 119.35 ? 933  TYR A CD2   1 
ATOM   7210  C  CE1   . TYR A 1  933  ? 42.945  -79.819  -3.223  1.00 117.31 ? 933  TYR A CE1   1 
ATOM   7211  C  CE2   . TYR A 1  933  ? 42.950  -81.735  -1.828  1.00 120.46 ? 933  TYR A CE2   1 
ATOM   7212  C  CZ    . TYR A 1  933  ? 42.623  -81.130  -3.016  1.00 113.63 ? 933  TYR A CZ    1 
ATOM   7213  O  OH    . TYR A 1  933  ? 41.973  -81.826  -4.012  1.00 135.18 ? 933  TYR A OH    1 
ATOM   7214  N  N     . LYS A 1  934  ? 43.288  -79.400  2.993   1.00 123.74 ? 934  LYS A N     1 
ATOM   7215  C  CA    . LYS A 1  934  ? 42.418  -80.186  3.854   1.00 132.13 ? 934  LYS A CA    1 
ATOM   7216  C  C     . LYS A 1  934  ? 41.330  -79.310  4.461   1.00 119.45 ? 934  LYS A C     1 
ATOM   7217  O  O     . LYS A 1  934  ? 40.227  -79.806  4.735   1.00 127.79 ? 934  LYS A O     1 
ATOM   7218  C  CB    . LYS A 1  934  ? 43.238  -80.912  4.934   1.00 124.22 ? 934  LYS A CB    1 
ATOM   7219  C  CG    . LYS A 1  934  ? 43.657  -82.351  4.549   1.00 151.81 ? 934  LYS A CG    1 
ATOM   7220  C  CD    . LYS A 1  934  ? 45.072  -82.405  3.954   1.00 170.39 ? 934  LYS A CD    1 
ATOM   7221  C  CE    . LYS A 1  934  ? 45.360  -83.719  3.208   1.00 164.56 ? 934  LYS A CE    1 
ATOM   7222  N  NZ    . LYS A 1  934  ? 46.308  -83.540  2.056   1.00 121.12 ? 934  LYS A NZ    1 
ATOM   7223  N  N     . GLN A 1  935  ? 41.561  -77.996  4.542   1.00 113.01 ? 935  GLN A N     1 
ATOM   7224  C  CA    . GLN A 1  935  ? 40.480  -77.137  5.013   1.00 118.53 ? 935  GLN A CA    1 
ATOM   7225  C  C     . GLN A 1  935  ? 39.468  -76.878  3.904   1.00 113.14 ? 935  GLN A C     1 
ATOM   7226  O  O     . GLN A 1  935  ? 38.263  -76.824  4.172   1.00 113.20 ? 935  GLN A O     1 
ATOM   7227  C  CB    . GLN A 1  935  ? 41.031  -75.816  5.564   1.00 114.02 ? 935  GLN A CB    1 
ATOM   7228  C  CG    . GLN A 1  935  ? 39.985  -74.928  6.235   1.00 104.88 ? 935  GLN A CG    1 
ATOM   7229  C  CD    . GLN A 1  935  ? 39.265  -75.627  7.368   1.00 116.54 ? 935  GLN A CD    1 
ATOM   7230  O  OE1   . GLN A 1  935  ? 38.047  -75.538  7.494   1.00 116.53 ? 935  GLN A OE1   1 
ATOM   7231  N  NE2   . GLN A 1  935  ? 40.016  -76.341  8.190   1.00 143.39 ? 935  GLN A NE2   1 
ATOM   7232  N  N     . LEU A 1  936  ? 39.929  -76.720  2.654   1.00 107.07 ? 936  LEU A N     1 
ATOM   7233  C  CA    . LEU A 1  936  ? 38.989  -76.552  1.542   1.00 106.88 ? 936  LEU A CA    1 
ATOM   7234  C  C     . LEU A 1  936  ? 38.166  -77.814  1.286   1.00 107.78 ? 936  LEU A C     1 
ATOM   7235  O  O     . LEU A 1  936  ? 36.987  -77.730  0.915   1.00 130.68 ? 936  LEU A O     1 
ATOM   7236  C  CB    . LEU A 1  936  ? 39.728  -76.151  0.260   1.00 107.09 ? 936  LEU A CB    1 
ATOM   7237  C  CG    . LEU A 1  936  ? 40.822  -75.072  0.262   1.00 116.57 ? 936  LEU A CG    1 
ATOM   7238  C  CD1   . LEU A 1  936  ? 41.184  -74.701  -1.167  1.00 107.79 ? 936  LEU A CD1   1 
ATOM   7239  C  CD2   . LEU A 1  936  ? 40.467  -73.830  1.062   1.00 123.38 ? 936  LEU A CD2   1 
ATOM   7240  N  N     . VAL A 1  937  ? 38.744  -78.989  1.513   1.00 117.53 ? 937  VAL A N     1 
ATOM   7241  C  CA    . VAL A 1  937  ? 37.936  -80.188  1.341   1.00 126.28 ? 937  VAL A CA    1 
ATOM   7242  C  C     . VAL A 1  937  ? 37.007  -80.382  2.544   1.00 123.02 ? 937  VAL A C     1 
ATOM   7243  O  O     . VAL A 1  937  ? 35.864  -80.849  2.389   1.00 109.51 ? 937  VAL A O     1 
ATOM   7244  C  CB    . VAL A 1  937  ? 38.841  -81.411  1.079   1.00 111.31 ? 937  VAL A CB    1 
ATOM   7245  C  CG1   . VAL A 1  937  ? 39.437  -81.943  2.372   1.00 111.71 ? 937  VAL A CG1   1 
ATOM   7246  C  CG2   . VAL A 1  937  ? 38.064  -82.509  0.337   1.00 116.82 ? 937  VAL A CG2   1 
ATOM   7247  N  N     . LYS A 1  938  ? 37.417  -79.914  3.728   1.00 120.82 ? 938  LYS A N     1 
ATOM   7248  C  CA    . LYS A 1  938  ? 36.504  -79.939  4.864   1.00 109.77 ? 938  LYS A CA    1 
ATOM   7249  C  C     . LYS A 1  938  ? 35.319  -79.032  4.598   1.00 116.90 ? 938  LYS A C     1 
ATOM   7250  O  O     . LYS A 1  938  ? 34.174  -79.377  4.918   1.00 108.81 ? 938  LYS A O     1 
ATOM   7251  C  CB    . LYS A 1  938  ? 37.242  -79.506  6.130   1.00 107.98 ? 938  LYS A CB    1 
ATOM   7252  C  CG    . LYS A 1  938  ? 36.402  -79.526  7.394   1.00 107.54 ? 938  LYS A CG    1 
ATOM   7253  C  CD    . LYS A 1  938  ? 37.180  -78.972  8.580   1.00 107.14 ? 938  LYS A CD    1 
ATOM   7254  C  CE    . LYS A 1  938  ? 36.503  -79.326  9.886   1.00 126.61 ? 938  LYS A CE    1 
ATOM   7255  N  NZ    . LYS A 1  938  ? 37.085  -78.542  11.002  1.00 142.46 ? 938  LYS A NZ    1 
ATOM   7256  N  N     . ASP A 1  939  ? 35.581  -77.900  3.944   1.00 130.97 ? 939  ASP A N     1 
ATOM   7257  C  CA    . ASP A 1  939  ? 34.532  -76.958  3.587   1.00 116.70 ? 939  ASP A CA    1 
ATOM   7258  C  C     . ASP A 1  939  ? 33.591  -77.568  2.560   1.00 107.80 ? 939  ASP A C     1 
ATOM   7259  O  O     . ASP A 1  939  ? 32.377  -77.381  2.642   1.00 112.36 ? 939  ASP A O     1 
ATOM   7260  C  CB    . ASP A 1  939  ? 35.168  -75.677  3.049   1.00 105.61 ? 939  ASP A CB    1 
ATOM   7261  C  CG    . ASP A 1  939  ? 35.857  -74.883  4.137   1.00 122.85 ? 939  ASP A CG    1 
ATOM   7262  O  OD1   . ASP A 1  939  ? 35.832  -75.345  5.298   1.00 121.81 ? 939  ASP A OD1   1 
ATOM   7263  O  OD2   . ASP A 1  939  ? 36.460  -73.822  3.842   1.00 122.39 ? 939  ASP A OD2   1 
ATOM   7264  N  N     . ARG A 1  940  ? 34.135  -78.260  1.558   1.00 106.90 ? 940  ARG A N     1 
ATOM   7265  C  CA    . ARG A 1  940  ? 33.277  -78.902  0.565   1.00 111.89 ? 940  ARG A CA    1 
ATOM   7266  C  C     . ARG A 1  940  ? 32.344  -79.921  1.217   1.00 109.28 ? 940  ARG A C     1 
ATOM   7267  O  O     . ARG A 1  940  ? 31.162  -80.041  0.849   1.00 107.83 ? 940  ARG A O     1 
ATOM   7268  C  CB    . ARG A 1  940  ? 34.134  -79.581  -0.500  1.00 119.04 ? 940  ARG A CB    1 
ATOM   7269  C  CG    . ARG A 1  940  ? 33.440  -79.687  -1.838  1.00 124.34 ? 940  ARG A CG    1 
ATOM   7270  C  CD    . ARG A 1  940  ? 34.128  -80.643  -2.774  1.00 118.57 ? 940  ARG A CD    1 
ATOM   7271  N  NE    . ARG A 1  940  ? 33.687  -80.442  -4.145  1.00 125.63 ? 940  ARG A NE    1 
ATOM   7272  C  CZ    . ARG A 1  940  ? 33.747  -81.388  -5.070  1.00 133.52 ? 940  ARG A CZ    1 
ATOM   7273  N  NH1   . ARG A 1  940  ? 34.216  -82.583  -4.748  1.00 141.43 ? 940  ARG A NH1   1 
ATOM   7274  N  NH2   . ARG A 1  940  ? 33.333  -81.146  -6.306  1.00 138.11 ? 940  ARG A NH2   1 
ATOM   7275  N  N     . LYS A 1  941  ? 32.846  -80.613  2.244   1.00 116.11 ? 941  LYS A N     1 
ATOM   7276  C  CA    . LYS A 1  941  ? 32.000  -81.514  3.017   1.00 108.83 ? 941  LYS A CA    1 
ATOM   7277  C  C     . LYS A 1  941  ? 30.900  -80.739  3.722   1.00 117.31 ? 941  LYS A C     1 
ATOM   7278  O  O     . LYS A 1  941  ? 29.710  -81.055  3.585   1.00 113.51 ? 941  LYS A O     1 
ATOM   7279  C  CB    . LYS A 1  941  ? 32.846  -82.267  4.044   1.00 109.53 ? 941  LYS A CB    1 
ATOM   7280  C  CG    . LYS A 1  941  ? 32.183  -83.502  4.643   1.00 118.38 ? 941  LYS A CG    1 
ATOM   7281  C  CD    . LYS A 1  941  ? 33.207  -84.448  5.257   1.00 134.56 ? 941  LYS A CD    1 
ATOM   7282  C  CE    . LYS A 1  941  ? 32.538  -85.523  6.093   1.00 136.30 ? 941  LYS A CE    1 
ATOM   7283  N  NZ    . LYS A 1  941  ? 31.819  -84.931  7.258   1.00 147.90 ? 941  LYS A NZ    1 
ATOM   7284  N  N     . PHE A 1  942  ? 31.280  -79.675  4.434   1.00 136.63 ? 942  PHE A N     1 
ATOM   7285  C  CA    . PHE A 1  942  ? 30.309  -78.912  5.213   1.00 107.41 ? 942  PHE A CA    1 
ATOM   7286  C  C     . PHE A 1  942  ? 29.242  -78.300  4.321   1.00 108.84 ? 942  PHE A C     1 
ATOM   7287  O  O     . PHE A 1  942  ? 28.054  -78.293  4.667   1.00 121.88 ? 942  PHE A O     1 
ATOM   7288  C  CB    . PHE A 1  942  ? 31.038  -77.824  6.001   1.00 106.08 ? 942  PHE A CB    1 
ATOM   7289  C  CG    . PHE A 1  942  ? 30.136  -76.991  6.839   1.00 105.44 ? 942  PHE A CG    1 
ATOM   7290  C  CD1   . PHE A 1  942  ? 29.701  -77.440  8.065   1.00 112.15 ? 942  PHE A CD1   1 
ATOM   7291  C  CD2   . PHE A 1  942  ? 29.730  -75.746  6.410   1.00 103.21 ? 942  PHE A CD2   1 
ATOM   7292  C  CE1   . PHE A 1  942  ? 28.857  -76.675  8.833   1.00 102.73 ? 942  PHE A CE1   1 
ATOM   7293  C  CE2   . PHE A 1  942  ? 28.894  -74.987  7.182   1.00 101.63 ? 942  PHE A CE2   1 
ATOM   7294  C  CZ    . PHE A 1  942  ? 28.456  -75.456  8.393   1.00 101.71 ? 942  PHE A CZ    1 
ATOM   7295  N  N     . LEU A 1  943  ? 29.649  -77.770  3.173   1.00 118.03 ? 943  LEU A N     1 
ATOM   7296  C  CA    . LEU A 1  943  ? 28.707  -77.121  2.280   1.00 108.60 ? 943  LEU A CA    1 
ATOM   7297  C  C     . LEU A 1  943  ? 27.728  -78.130  1.715   1.00 115.89 ? 943  LEU A C     1 
ATOM   7298  O  O     . LEU A 1  943  ? 26.531  -77.846  1.601   1.00 117.07 ? 943  LEU A O     1 
ATOM   7299  C  CB    . LEU A 1  943  ? 29.455  -76.407  1.161   1.00 104.24 ? 943  LEU A CB    1 
ATOM   7300  C  CG    . LEU A 1  943  ? 30.269  -75.213  1.643   1.00 103.33 ? 943  LEU A CG    1 
ATOM   7301  C  CD1   . LEU A 1  943  ? 30.796  -74.484  0.446   1.00 103.21 ? 943  LEU A CD1   1 
ATOM   7302  C  CD2   . LEU A 1  943  ? 29.402  -74.300  2.494   1.00 102.19 ? 943  LEU A CD2   1 
ATOM   7303  N  N     . ARG A 1  944  ? 28.216  -79.320  1.349   1.00 125.36 ? 944  ARG A N     1 
ATOM   7304  C  CA    . ARG A 1  944  ? 27.258  -80.292  0.849   1.00 107.09 ? 944  ARG A CA    1 
ATOM   7305  C  C     . ARG A 1  944  ? 26.380  -80.868  1.948   1.00 107.09 ? 944  ARG A C     1 
ATOM   7306  O  O     . ARG A 1  944  ? 25.330  -81.433  1.627   1.00 117.33 ? 944  ARG A O     1 
ATOM   7307  C  CB    . ARG A 1  944  ? 27.968  -81.400  0.087   1.00 108.45 ? 944  ARG A CB    1 
ATOM   7308  C  CG    . ARG A 1  944  ? 28.621  -80.901  -1.181  1.00 108.56 ? 944  ARG A CG    1 
ATOM   7309  C  CD    . ARG A 1  944  ? 29.188  -82.037  -1.981  1.00 109.97 ? 944  ARG A CD    1 
ATOM   7310  N  NE    . ARG A 1  944  ? 29.720  -81.566  -3.246  1.00 110.11 ? 944  ARG A NE    1 
ATOM   7311  C  CZ    . ARG A 1  944  ? 29.973  -82.356  -4.281  1.00 114.36 ? 944  ARG A CZ    1 
ATOM   7312  N  NH1   . ARG A 1  944  ? 29.738  -83.658  -4.198  1.00 130.82 ? 944  ARG A NH1   1 
ATOM   7313  N  NH2   . ARG A 1  944  ? 30.477  -81.850  -5.396  1.00 121.11 ? 944  ARG A NH2   1 
ATOM   7314  N  N     . GLU A 1  945  ? 26.743  -80.688  3.229   1.00 116.49 ? 945  GLU A N     1 
ATOM   7315  C  CA    . GLU A 1  945  ? 25.826  -81.078  4.301   1.00 124.81 ? 945  GLU A CA    1 
ATOM   7316  C  C     . GLU A 1  945  ? 24.752  -80.020  4.503   1.00 120.98 ? 945  GLU A C     1 
ATOM   7317  O  O     . GLU A 1  945  ? 23.580  -80.355  4.720   1.00 126.06 ? 945  GLU A O     1 
ATOM   7318  C  CB    . GLU A 1  945  ? 26.574  -81.318  5.624   1.00 114.63 ? 945  GLU A CB    1 
ATOM   7319  C  CG    . GLU A 1  945  ? 27.212  -82.705  5.773   1.00 147.81 ? 945  GLU A CG    1 
ATOM   7320  C  CD    . GLU A 1  945  ? 28.266  -82.758  6.869   1.00 156.71 ? 945  GLU A CD    1 
ATOM   7321  O  OE1   . GLU A 1  945  ? 28.244  -81.874  7.752   1.00 159.57 ? 945  GLU A OE1   1 
ATOM   7322  O  OE2   . GLU A 1  945  ? 29.113  -83.681  6.844   1.00 140.09 ? 945  GLU A OE2   1 
ATOM   7323  N  N     . VAL A 1  946  ? 25.126  -78.745  4.383   1.00 115.47 ? 946  VAL A N     1 
ATOM   7324  C  CA    . VAL A 1  946  ? 24.162  -77.660  4.556   1.00 112.01 ? 946  VAL A CA    1 
ATOM   7325  C  C     . VAL A 1  946  ? 23.229  -77.553  3.352   1.00 115.38 ? 946  VAL A C     1 
ATOM   7326  O  O     . VAL A 1  946  ? 22.002  -77.523  3.497   1.00 125.55 ? 946  VAL A O     1 
ATOM   7327  C  CB    . VAL A 1  946  ? 24.896  -76.330  4.798   1.00 102.28 ? 946  VAL A CB    1 
ATOM   7328  C  CG1   . VAL A 1  946  ? 23.950  -75.176  4.539   1.00 101.25 ? 946  VAL A CG1   1 
ATOM   7329  C  CG2   . VAL A 1  946  ? 25.455  -76.261  6.215   1.00 102.05 ? 946  VAL A CG2   1 
ATOM   7330  N  N     . PHE A 1  947  ? 23.790  -77.465  2.153   1.00 107.72 ? 947  PHE A N     1 
ATOM   7331  C  CA    . PHE A 1  947  ? 22.996  -77.276  0.942   1.00 103.67 ? 947  PHE A CA    1 
ATOM   7332  C  C     . PHE A 1  947  ? 22.939  -78.602  0.187   1.00 109.38 ? 947  PHE A C     1 
ATOM   7333  O  O     . PHE A 1  947  ? 23.783  -78.893  -0.661  1.00 134.79 ? 947  PHE A O     1 
ATOM   7334  C  CB    . PHE A 1  947  ? 23.594  -76.169  0.079   1.00 113.40 ? 947  PHE A CB    1 
ATOM   7335  C  CG    . PHE A 1  947  ? 23.685  -74.831  0.773   1.00 101.92 ? 947  PHE A CG    1 
ATOM   7336  C  CD1   . PHE A 1  947  ? 22.570  -74.054  0.967   1.00 116.42 ? 947  PHE A CD1   1 
ATOM   7337  C  CD2   . PHE A 1  947  ? 24.901  -74.325  1.175   1.00 111.69 ? 947  PHE A CD2   1 
ATOM   7338  C  CE1   . PHE A 1  947  ? 22.655  -72.818  1.589   1.00 114.54 ? 947  PHE A CE1   1 
ATOM   7339  C  CE2   . PHE A 1  947  ? 24.984  -73.086  1.790   1.00 104.61 ? 947  PHE A CE2   1 
ATOM   7340  C  CZ    . PHE A 1  947  ? 23.866  -72.339  1.993   1.00 99.74  ? 947  PHE A CZ    1 
ATOM   7341  N  N     . VAL A 1  948  ? 21.906  -79.396  0.473   1.00 119.69 ? 948  VAL A N     1 
ATOM   7342  C  CA    . VAL A 1  948  ? 21.894  -80.796  0.049   1.00 116.63 ? 948  VAL A CA    1 
ATOM   7343  C  C     . VAL A 1  948  ? 21.812  -80.909  -1.467  1.00 112.86 ? 948  VAL A C     1 
ATOM   7344  O  O     . VAL A 1  948  ? 22.487  -81.749  -2.077  1.00 134.37 ? 948  VAL A O     1 
ATOM   7345  C  CB    . VAL A 1  948  ? 20.749  -81.546  0.747   1.00 106.87 ? 948  VAL A CB    1 
ATOM   7346  C  CG1   . VAL A 1  948  ? 21.139  -81.834  2.177   1.00 115.42 ? 948  VAL A CG1   1 
ATOM   7347  C  CG2   . VAL A 1  948  ? 19.502  -80.684  0.748   1.00 133.90 ? 948  VAL A CG2   1 
ATOM   7348  N  N     . ASP A 1  949  ? 21.014  -80.059  -2.102  1.00 122.11 ? 949  ASP A N     1 
ATOM   7349  C  CA    . ASP A 1  949  ? 20.764  -80.211  -3.526  1.00 126.34 ? 949  ASP A CA    1 
ATOM   7350  C  C     . ASP A 1  949  ? 21.868  -79.642  -4.405  1.00 123.54 ? 949  ASP A C     1 
ATOM   7351  O  O     . ASP A 1  949  ? 21.796  -79.796  -5.632  1.00 122.67 ? 949  ASP A O     1 
ATOM   7352  C  CB    . ASP A 1  949  ? 19.419  -79.544  -3.861  1.00 139.80 ? 949  ASP A CB    1 
ATOM   7353  C  CG    . ASP A 1  949  ? 19.538  -78.039  -4.068  1.00 138.46 ? 949  ASP A CG    1 
ATOM   7354  O  OD1   . ASP A 1  949  ? 19.881  -77.301  -3.109  1.00 138.20 ? 949  ASP A OD1   1 
ATOM   7355  O  OD2   . ASP A 1  949  ? 19.291  -77.593  -5.203  1.00 144.63 ? 949  ASP A OD2   1 
ATOM   7356  N  N     . GLY A 1  950  ? 22.929  -79.093  -3.815  1.00 121.30 ? 950  GLY A N     1 
ATOM   7357  C  CA    . GLY A 1  950  ? 24.054  -78.573  -4.558  1.00 106.81 ? 950  GLY A CA    1 
ATOM   7358  C  C     . GLY A 1  950  ? 23.968  -77.111  -4.956  1.00 131.75 ? 950  GLY A C     1 
ATOM   7359  O  O     . GLY A 1  950  ? 24.892  -76.619  -5.619  1.00 126.84 ? 950  GLY A O     1 
ATOM   7360  N  N     . GLU A 1  951  ? 22.928  -76.382  -4.542  1.00 117.59 ? 951  GLU A N     1 
ATOM   7361  C  CA    . GLU A 1  951  ? 22.817  -74.987  -4.947  1.00 117.35 ? 951  GLU A CA    1 
ATOM   7362  C  C     . GLU A 1  951  ? 23.979  -74.186  -4.382  1.00 119.29 ? 951  GLU A C     1 
ATOM   7363  O  O     . GLU A 1  951  ? 24.302  -74.283  -3.195  1.00 114.66 ? 951  GLU A O     1 
ATOM   7364  C  CB    . GLU A 1  951  ? 21.494  -74.372  -4.499  1.00 128.32 ? 951  GLU A CB    1 
ATOM   7365  C  CG    . GLU A 1  951  ? 21.373  -72.914  -4.918  1.00 121.82 ? 951  GLU A CG    1 
ATOM   7366  C  CD    . GLU A 1  951  ? 21.276  -72.771  -6.428  1.00 137.41 ? 951  GLU A CD    1 
ATOM   7367  O  OE1   . GLU A 1  951  ? 20.456  -73.489  -7.046  1.00 143.65 ? 951  GLU A OE1   1 
ATOM   7368  O  OE2   . GLU A 1  951  ? 22.060  -71.990  -7.006  1.00 127.88 ? 951  GLU A OE2   1 
ATOM   7369  N  N     . ALA A 1  952  ? 24.612  -73.394  -5.247  1.00 114.03 ? 952  ALA A N     1 
ATOM   7370  C  CA    . ALA A 1  952  ? 25.841  -72.694  -4.909  1.00 113.21 ? 952  ALA A CA    1 
ATOM   7371  C  C     . ALA A 1  952  ? 25.671  -71.197  -4.704  1.00 125.81 ? 952  ALA A C     1 
ATOM   7372  O  O     . ALA A 1  952  ? 26.489  -70.591  -4.004  1.00 117.59 ? 952  ALA A O     1 
ATOM   7373  C  CB    . ALA A 1  952  ? 26.895  -72.918  -6.002  1.00 120.34 ? 952  ALA A CB    1 
ATOM   7374  N  N     . ASN A 1  953  ? 24.634  -70.593  -5.274  1.00 122.86 ? 953  ASN A N     1 
ATOM   7375  C  CA    . ASN A 1  953  ? 24.470  -69.145  -5.251  1.00 100.61 ? 953  ASN A CA    1 
ATOM   7376  C  C     . ASN A 1  953  ? 23.621  -68.792  -4.036  1.00 106.91 ? 953  ASN A C     1 
ATOM   7377  O  O     . ASN A 1  953  ? 22.421  -69.080  -4.001  1.00 122.39 ? 953  ASN A O     1 
ATOM   7378  C  CB    . ASN A 1  953  ? 23.834  -68.677  -6.555  1.00 110.74 ? 953  ASN A CB    1 
ATOM   7379  C  CG    . ASN A 1  953  ? 24.681  -69.023  -7.768  1.00 119.41 ? 953  ASN A CG    1 
ATOM   7380  O  OD1   . ASN A 1  953  ? 25.775  -68.491  -7.947  1.00 116.18 ? 953  ASN A OD1   1 
ATOM   7381  N  ND2   . ASN A 1  953  ? 24.175  -69.918  -8.607  1.00 123.96 ? 953  ASN A ND2   1 
ATOM   7382  N  N     . TRP A 1  954  ? 24.236  -68.116  -3.062  1.00 112.53 ? 954  TRP A N     1 
ATOM   7383  C  CA    . TRP A 1  954  ? 23.581  -67.800  -1.811  1.00 97.73  ? 954  TRP A CA    1 
ATOM   7384  C  C     . TRP A 1  954  ? 23.942  -66.405  -1.328  1.00 106.22 ? 954  TRP A C     1 
ATOM   7385  O  O     . TRP A 1  954  ? 25.119  -66.013  -1.351  1.00 118.22 ? 954  TRP A O     1 
ATOM   7386  C  CB    . TRP A 1  954  ? 23.998  -68.839  -0.758  1.00 98.13  ? 954  TRP A CB    1 
ATOM   7387  C  CG    . TRP A 1  954  ? 23.469  -70.166  -1.105  1.00 102.83 ? 954  TRP A CG    1 
ATOM   7388  C  CD1   . TRP A 1  954  ? 24.100  -71.156  -1.802  1.00 110.12 ? 954  TRP A CD1   1 
ATOM   7389  C  CD2   . TRP A 1  954  ? 22.160  -70.645  -0.820  1.00 114.09 ? 954  TRP A CD2   1 
ATOM   7390  N  NE1   . TRP A 1  954  ? 23.252  -72.230  -1.961  1.00 119.14 ? 954  TRP A NE1   1 
ATOM   7391  C  CE2   . TRP A 1  954  ? 22.054  -71.932  -1.368  1.00 116.99 ? 954  TRP A CE2   1 
ATOM   7392  C  CE3   . TRP A 1  954  ? 21.065  -70.108  -0.149  1.00 103.18 ? 954  TRP A CE3   1 
ATOM   7393  C  CZ2   . TRP A 1  954  ? 20.895  -72.684  -1.263  1.00 132.30 ? 954  TRP A CZ2   1 
ATOM   7394  C  CZ3   . TRP A 1  954  ? 19.927  -70.857  -0.045  1.00 98.72  ? 954  TRP A CZ3   1 
ATOM   7395  C  CH2   . TRP A 1  954  ? 19.847  -72.131  -0.590  1.00 118.45 ? 954  TRP A CH2   1 
ATOM   7396  N  N     . PRO A 1  955  ? 22.952  -65.646  -0.872  1.00 100.69 ? 955  PRO A N     1 
ATOM   7397  C  CA    . PRO A 1  955  ? 23.208  -64.263  -0.468  1.00 102.90 ? 955  PRO A CA    1 
ATOM   7398  C  C     . PRO A 1  955  ? 24.112  -64.205  0.756   1.00 112.92 ? 955  PRO A C     1 
ATOM   7399  O  O     . PRO A 1  955  ? 23.798  -64.791  1.795   1.00 94.71  ? 955  PRO A O     1 
ATOM   7400  C  CB    . PRO A 1  955  ? 21.805  -63.736  -0.160  1.00 100.95 ? 955  PRO A CB    1 
ATOM   7401  C  CG    . PRO A 1  955  ? 21.016  -64.955  0.168   1.00 94.96  ? 955  PRO A CG    1 
ATOM   7402  C  CD    . PRO A 1  955  ? 21.543  -66.024  -0.708  1.00 105.22 ? 955  PRO A CD    1 
ATOM   7403  N  N     . LEU A 1  956  ? 25.200  -63.445  0.635   1.00 101.48 ? 956  LEU A N     1 
ATOM   7404  C  CA    . LEU A 1  956  ? 26.276  -63.324  1.608   1.00 94.22  ? 956  LEU A CA    1 
ATOM   7405  C  C     . LEU A 1  956  ? 26.772  -61.884  1.627   1.00 93.44  ? 956  LEU A C     1 
ATOM   7406  O  O     . LEU A 1  956  ? 26.532  -61.132  0.676   1.00 122.87 ? 956  LEU A O     1 
ATOM   7407  C  CB    . LEU A 1  956  ? 27.425  -64.291  1.274   1.00 125.87 ? 956  LEU A CB    1 
ATOM   7408  C  CG    . LEU A 1  956  ? 27.239  -65.717  1.805   1.00 95.81  ? 956  LEU A CG    1 
ATOM   7409  C  CD1   . LEU A 1  956  ? 28.416  -66.596  1.486   1.00 105.38 ? 956  LEU A CD1   1 
ATOM   7410  C  CD2   . LEU A 1  956  ? 27.033  -65.659  3.299   1.00 95.35  ? 956  LEU A CD2   1 
ATOM   7411  N  N     . PRO A 1  957  ? 27.465  -61.455  2.727   1.00 93.00  ? 957  PRO A N     1 
ATOM   7412  C  CA    . PRO A 1  957  ? 27.689  -60.024  2.960   1.00 105.34 ? 957  PRO A CA    1 
ATOM   7413  C  C     . PRO A 1  957  ? 28.612  -59.320  1.970   1.00 140.01 ? 957  PRO A C     1 
ATOM   7414  O  O     . PRO A 1  957  ? 28.258  -58.236  1.496   1.00 190.73 ? 957  PRO A O     1 
ATOM   7415  C  CB    . PRO A 1  957  ? 28.274  -59.994  4.374   1.00 91.90  ? 957  PRO A CB    1 
ATOM   7416  C  CG    . PRO A 1  957  ? 27.720  -61.139  5.009   1.00 97.23  ? 957  PRO A CG    1 
ATOM   7417  C  CD    . PRO A 1  957  ? 27.690  -62.212  3.965   1.00 127.74 ? 957  PRO A CD    1 
ATOM   7418  N  N     . VAL A 1  958  ? 29.782  -59.862  1.644   1.00 92.74  ? 958  VAL A N     1 
ATOM   7419  C  CA    . VAL A 1  958  ? 30.782  -59.083  0.914   1.00 92.67  ? 958  VAL A CA    1 
ATOM   7420  C  C     . VAL A 1  958  ? 30.948  -59.643  -0.490  1.00 108.13 ? 958  VAL A C     1 
ATOM   7421  O  O     . VAL A 1  958  ? 31.322  -60.805  -0.659  1.00 123.05 ? 958  VAL A O     1 
ATOM   7422  C  CB    . VAL A 1  958  ? 32.123  -59.058  1.650   1.00 92.69  ? 958  VAL A CB    1 
ATOM   7423  C  CG1   . VAL A 1  958  ? 33.186  -58.510  0.730   1.00 122.20 ? 958  VAL A CG1   1 
ATOM   7424  C  CG2   . VAL A 1  958  ? 32.006  -58.214  2.918   1.00 91.88  ? 958  VAL A CG2   1 
ATOM   7425  N  N     . ASN A 1  959  ? 30.676  -58.817  -1.501  1.00 93.24  ? 959  ASN A N     1 
ATOM   7426  C  CA    . ASN A 1  959  ? 30.851  -59.232  -2.894  1.00 93.97  ? 959  ASN A CA    1 
ATOM   7427  C  C     . ASN A 1  959  ? 32.342  -59.220  -3.167  1.00 106.70 ? 959  ASN A C     1 
ATOM   7428  O  O     . ASN A 1  959  ? 32.927  -58.169  -3.438  1.00 116.27 ? 959  ASN A O     1 
ATOM   7429  C  CB    . ASN A 1  959  ? 30.082  -58.332  -3.860  1.00 93.70  ? 959  ASN A CB    1 
ATOM   7430  C  CG    . ASN A 1  959  ? 30.044  -58.882  -5.303  1.00 102.91 ? 959  ASN A CG    1 
ATOM   7431  O  OD1   . ASN A 1  959  ? 30.929  -59.620  -5.727  1.00 100.90 ? 959  ASN A OD1   1 
ATOM   7432  N  ND2   . ASN A 1  959  ? 29.021  -58.483  -6.066  1.00 124.85 ? 959  ASN A ND2   1 
ATOM   7433  N  N     . ILE A 1  960  ? 32.968  -60.393  -3.054  1.00 104.53 ? 960  ILE A N     1 
ATOM   7434  C  CA    . ILE A 1  960  ? 34.416  -60.477  -3.195  1.00 101.06 ? 960  ILE A CA    1 
ATOM   7435  C  C     . ILE A 1  960  ? 34.819  -60.395  -4.669  1.00 106.97 ? 960  ILE A C     1 
ATOM   7436  O  O     . ILE A 1  960  ? 35.911  -59.909  -5.002  1.00 96.02  ? 960  ILE A O     1 
ATOM   7437  C  CB    . ILE A 1  960  ? 34.926  -61.764  -2.522  1.00 96.07  ? 960  ILE A CB    1 
ATOM   7438  C  CG1   . ILE A 1  960  ? 34.802  -61.651  -1.009  1.00 95.49  ? 960  ILE A CG1   1 
ATOM   7439  C  CG2   . ILE A 1  960  ? 36.363  -62.005  -2.838  1.00 96.63  ? 960  ILE A CG2   1 
ATOM   7440  C  CD1   . ILE A 1  960  ? 34.996  -62.948  -0.277  1.00 96.12  ? 960  ILE A CD1   1 
ATOM   7441  N  N     . ARG A 1  961  ? 33.936  -60.799  -5.581  1.00 97.27  ? 961  ARG A N     1 
ATOM   7442  C  CA    . ARG A 1  961  ? 34.274  -60.727  -6.998  1.00 96.99  ? 961  ARG A CA    1 
ATOM   7443  C  C     . ARG A 1  961  ? 34.507  -59.287  -7.434  1.00 100.58 ? 961  ARG A C     1 
ATOM   7444  O  O     . ARG A 1  961  ? 35.490  -58.983  -8.121  1.00 102.13 ? 961  ARG A O     1 
ATOM   7445  C  CB    . ARG A 1  961  ? 33.175  -61.373  -7.827  1.00 97.53  ? 961  ARG A CB    1 
ATOM   7446  C  CG    . ARG A 1  961  ? 33.470  -61.415  -9.301  1.00 98.55  ? 961  ARG A CG    1 
ATOM   7447  C  CD    . ARG A 1  961  ? 32.833  -62.643  -9.899  1.00 132.48 ? 961  ARG A CD    1 
ATOM   7448  N  NE    . ARG A 1  961  ? 32.513  -62.444  -11.301 1.00 151.60 ? 961  ARG A NE    1 
ATOM   7449  C  CZ    . ARG A 1  961  ? 31.480  -61.718  -11.719 1.00 162.04 ? 961  ARG A CZ    1 
ATOM   7450  N  NH1   . ARG A 1  961  ? 30.675  -61.135  -10.838 1.00 147.05 ? 961  ARG A NH1   1 
ATOM   7451  N  NH2   . ARG A 1  961  ? 31.249  -61.587  -13.017 1.00 167.42 ? 961  ARG A NH2   1 
ATOM   7452  N  N     . ARG A 1  962  ? 33.625  -58.377  -7.023  1.00 116.92 ? 962  ARG A N     1 
ATOM   7453  C  CA    . ARG A 1  962  ? 33.832  -56.976  -7.371  1.00 113.00 ? 962  ARG A CA    1 
ATOM   7454  C  C     . ARG A 1  962  ? 35.021  -56.410  -6.606  1.00 114.40 ? 962  ARG A C     1 
ATOM   7455  O  O     . ARG A 1  962  ? 35.798  -55.617  -7.153  1.00 120.26 ? 962  ARG A O     1 
ATOM   7456  C  CB    . ARG A 1  962  ? 32.566  -56.154  -7.084  1.00 102.94 ? 962  ARG A CB    1 
ATOM   7457  C  CG    . ARG A 1  962  ? 31.502  -56.122  -8.196  1.00 118.41 ? 962  ARG A CG    1 
ATOM   7458  C  CD    . ARG A 1  962  ? 30.404  -55.099  -7.893  1.00 111.06 ? 962  ARG A CD    1 
ATOM   7459  N  NE    . ARG A 1  962  ? 29.660  -55.379  -6.668  1.00 110.17 ? 962  ARG A NE    1 
ATOM   7460  C  CZ    . ARG A 1  962  ? 29.896  -54.765  -5.510  1.00 125.62 ? 962  ARG A CZ    1 
ATOM   7461  N  NH1   . ARG A 1  962  ? 30.861  -53.855  -5.434  1.00 133.89 ? 962  ARG A NH1   1 
ATOM   7462  N  NH2   . ARG A 1  962  ? 29.176  -55.056  -4.433  1.00 101.33 ? 962  ARG A NH2   1 
ATOM   7463  N  N     . ILE A 1  963  ? 35.206  -56.846  -5.354  1.00 106.89 ? 963  ILE A N     1 
ATOM   7464  C  CA    . ILE A 1  963  ? 36.280  -56.313  -4.524  1.00 93.89  ? 963  ILE A CA    1 
ATOM   7465  C  C     . ILE A 1  963  ? 37.630  -56.704  -5.083  1.00 94.57  ? 963  ILE A C     1 
ATOM   7466  O  O     . ILE A 1  963  ? 38.639  -56.095  -4.721  1.00 101.26 ? 963  ILE A O     1 
ATOM   7467  C  CB    . ILE A 1  963  ? 36.157  -56.789  -3.057  1.00 94.80  ? 963  ILE A CB    1 
ATOM   7468  C  CG1   . ILE A 1  963  ? 36.682  -55.743  -2.081  1.00 107.41 ? 963  ILE A CG1   1 
ATOM   7469  C  CG2   . ILE A 1  963  ? 37.006  -57.997  -2.814  1.00 140.97 ? 963  ILE A CG2   1 
ATOM   7470  C  CD1   . ILE A 1  963  ? 36.352  -56.078  -0.635  1.00 94.70  ? 963  ILE A CD1   1 
ATOM   7471  N  N     . ILE A 1  964  ? 37.671  -57.697  -5.968  1.00 100.44 ? 964  ILE A N     1 
ATOM   7472  C  CA    . ILE A 1  964  ? 38.912  -58.124  -6.603  1.00 110.44 ? 964  ILE A CA    1 
ATOM   7473  C  C     . ILE A 1  964  ? 39.055  -57.555  -8.008  1.00 96.50  ? 964  ILE A C     1 
ATOM   7474  O  O     . ILE A 1  964  ? 40.145  -57.134  -8.391  1.00 105.05 ? 964  ILE A O     1 
ATOM   7475  C  CB    . ILE A 1  964  ? 39.005  -59.669  -6.606  1.00 107.81 ? 964  ILE A CB    1 
ATOM   7476  C  CG1   . ILE A 1  964  ? 39.592  -60.171  -5.294  1.00 97.08  ? 964  ILE A CG1   1 
ATOM   7477  C  CG2   . ILE A 1  964  ? 39.841  -60.214  -7.761  1.00 98.14  ? 964  ILE A CG2   1 
ATOM   7478  C  CD1   . ILE A 1  964  ? 39.475  -61.643  -5.155  1.00 104.56 ? 964  ILE A CD1   1 
ATOM   7479  N  N     . GLN A 1  965  ? 37.966  -57.503  -8.781  1.00 96.58  ? 965  GLN A N     1 
ATOM   7480  C  CA    . GLN A 1  965  ? 38.004  -56.785  -10.055 1.00 113.19 ? 965  GLN A CA    1 
ATOM   7481  C  C     . GLN A 1  965  ? 38.448  -55.341  -9.864  1.00 112.32 ? 965  GLN A C     1 
ATOM   7482  O  O     . GLN A 1  965  ? 39.188  -54.782  -10.695 1.00 105.16 ? 965  GLN A O     1 
ATOM   7483  C  CB    . GLN A 1  965  ? 36.622  -56.829  -10.700 1.00 113.21 ? 965  GLN A CB    1 
ATOM   7484  C  CG    . GLN A 1  965  ? 36.227  -58.208  -11.215 1.00 137.82 ? 965  GLN A CG    1 
ATOM   7485  C  CD    . GLN A 1  965  ? 34.734  -58.329  -11.435 1.00 138.12 ? 965  GLN A CD    1 
ATOM   7486  O  OE1   . GLN A 1  965  ? 33.962  -57.500  -10.955 1.00 138.58 ? 965  GLN A OE1   1 
ATOM   7487  N  NE2   . GLN A 1  965  ? 34.319  -59.370  -12.150 1.00 128.49 ? 965  GLN A NE2   1 
ATOM   7488  N  N     . ASN A 1  966  ? 38.061  -54.756  -8.732  1.00 104.86 ? 966  ASN A N     1 
ATOM   7489  C  CA    . ASN A 1  966  ? 38.539  -53.435  -8.361  1.00 108.04 ? 966  ASN A CA    1 
ATOM   7490  C  C     . ASN A 1  966  ? 40.049  -53.441  -8.199  1.00 102.20 ? 966  ASN A C     1 
ATOM   7491  O  O     . ASN A 1  966  ? 40.734  -52.552  -8.699  1.00 115.34 ? 966  ASN A O     1 
ATOM   7492  C  CB    . ASN A 1  966  ? 37.847  -52.969  -7.079  1.00 117.31 ? 966  ASN A CB    1 
ATOM   7493  C  CG    . ASN A 1  966  ? 36.360  -52.660  -7.283  1.00 113.75 ? 966  ASN A CG    1 
ATOM   7494  O  OD1   . ASN A 1  966  ? 35.878  -52.548  -8.415  1.00 100.56 ? 966  ASN A OD1   1 
ATOM   7495  N  ND2   . ASN A 1  966  ? 35.632  -52.520  -6.178  1.00 120.77 ? 966  ASN A ND2   1 
ATOM   7496  N  N     . ALA A 1  967  ? 40.590  -54.421  -7.480  1.00 106.37 ? 967  ALA A N     1 
ATOM   7497  C  CA    . ALA A 1  967  ? 42.039  -54.450  -7.300  1.00 120.07 ? 967  ALA A CA    1 
ATOM   7498  C  C     . ALA A 1  967  ? 42.756  -54.614  -8.639  1.00 112.18 ? 967  ALA A C     1 
ATOM   7499  O  O     . ALA A 1  967  ? 43.759  -53.940  -8.908  1.00 96.83  ? 967  ALA A O     1 
ATOM   7500  C  CB    . ALA A 1  967  ? 42.431  -55.566  -6.332  1.00 97.42  ? 967  ALA A CB    1 
ATOM   7501  N  N     . GLN A 1  968  ? 42.239  -55.504  -9.493  1.00 106.64 ? 968  GLN A N     1 
ATOM   7502  C  CA    . GLN A 1  968  ? 42.808  -55.731  -10.819 1.00 113.79 ? 968  GLN A CA    1 
ATOM   7503  C  C     . GLN A 1  968  ? 42.809  -54.464  -11.653 1.00 134.53 ? 968  GLN A C     1 
ATOM   7504  O  O     . GLN A 1  968  ? 43.661  -54.304  -12.534 1.00 169.42 ? 968  GLN A O     1 
ATOM   7505  C  CB    . GLN A 1  968  ? 42.033  -56.819  -11.561 1.00 110.45 ? 968  GLN A CB    1 
ATOM   7506  C  CG    . GLN A 1  968  ? 42.116  -58.205  -10.958 1.00 120.85 ? 968  GLN A CG    1 
ATOM   7507  C  CD    . GLN A 1  968  ? 41.392  -59.227  -11.808 1.00 143.88 ? 968  GLN A CD    1 
ATOM   7508  O  OE1   . GLN A 1  968  ? 40.162  -59.258  -11.836 1.00 144.64 ? 968  GLN A OE1   1 
ATOM   7509  N  NE2   . GLN A 1  968  ? 42.146  -60.070  -12.504 1.00 150.72 ? 968  GLN A NE2   1 
ATOM   7510  N  N     . GLN A 1  969  ? 41.875  -53.552  -11.397 1.00 115.13 ? 969  GLN A N     1 
ATOM   7511  C  CA    . GLN A 1  969  ? 41.866  -52.323  -12.180 1.00 111.58 ? 969  GLN A CA    1 
ATOM   7512  C  C     . GLN A 1  969  ? 42.678  -51.224  -11.502 1.00 113.27 ? 969  GLN A C     1 
ATOM   7513  O  O     . GLN A 1  969  ? 43.524  -50.587  -12.138 1.00 106.12 ? 969  GLN A O     1 
ATOM   7514  C  CB    . GLN A 1  969  ? 40.431  -51.853  -12.403 1.00 99.96  ? 969  GLN A CB    1 
ATOM   7515  C  CG    . GLN A 1  969  ? 40.341  -50.437  -12.913 1.00 111.49 ? 969  GLN A CG    1 
ATOM   7516  C  CD    . GLN A 1  969  ? 39.964  -50.412  -14.365 1.00 146.87 ? 969  GLN A CD    1 
ATOM   7517  O  OE1   . GLN A 1  969  ? 39.820  -51.463  -14.993 1.00 146.96 ? 969  GLN A OE1   1 
ATOM   7518  N  NE2   . GLN A 1  969  ? 39.860  -49.218  -14.931 1.00 166.78 ? 969  GLN A NE2   1 
ATOM   7519  N  N     . THR A 1  970  ? 42.452  -51.028  -10.204 1.00 106.44 ? 970  THR A N     1 
ATOM   7520  C  CA    . THR A 1  970  ? 43.154  -50.012  -9.430  1.00 110.58 ? 970  THR A CA    1 
ATOM   7521  C  C     . THR A 1  970  ? 44.657  -50.154  -9.568  1.00 112.89 ? 970  THR A C     1 
ATOM   7522  O  O     . THR A 1  970  ? 45.375  -49.149  -9.592  1.00 120.11 ? 970  THR A O     1 
ATOM   7523  C  CB    . THR A 1  970  ? 42.744  -50.116  -7.945  1.00 107.76 ? 970  THR A CB    1 
ATOM   7524  O  OG1   . THR A 1  970  ? 41.407  -49.635  -7.771  1.00 124.69 ? 970  THR A OG1   1 
ATOM   7525  C  CG2   . THR A 1  970  ? 43.702  -49.371  -7.002  1.00 92.85  ? 970  THR A CG2   1 
ATOM   7526  N  N     . PHE A 1  971  ? 45.152  -51.381  -9.688  1.00 123.69 ? 971  PHE A N     1 
ATOM   7527  C  CA    . PHE A 1  971  ? 46.585  -51.608  -9.639  1.00 116.80 ? 971  PHE A CA    1 
ATOM   7528  C  C     . PHE A 1  971  ? 47.214  -52.016  -10.967 1.00 121.59 ? 971  PHE A C     1 
ATOM   7529  O  O     . PHE A 1  971  ? 48.413  -52.311  -10.992 1.00 120.95 ? 971  PHE A O     1 
ATOM   7530  C  CB    . PHE A 1  971  ? 46.890  -52.648  -8.563  1.00 95.85  ? 971  PHE A CB    1 
ATOM   7531  C  CG    . PHE A 1  971  ? 46.785  -52.110  -7.155  1.00 98.54  ? 971  PHE A CG    1 
ATOM   7532  C  CD1   . PHE A 1  971  ? 47.780  -51.296  -6.633  1.00 105.67 ? 971  PHE A CD1   1 
ATOM   7533  C  CD2   . PHE A 1  971  ? 45.722  -52.455  -6.334  1.00 94.58  ? 971  PHE A CD2   1 
ATOM   7534  C  CE1   . PHE A 1  971  ? 47.704  -50.811  -5.330  1.00 93.87  ? 971  PHE A CE1   1 
ATOM   7535  C  CE2   . PHE A 1  971  ? 45.656  -51.976  -5.024  1.00 100.97 ? 971  PHE A CE2   1 
ATOM   7536  C  CZ    . PHE A 1  971  ? 46.653  -51.157  -4.530  1.00 93.50  ? 971  PHE A CZ    1 
ATOM   7537  N  N     . HIS A 1  972  ? 46.454  -52.041  -12.061 1.00 134.33 ? 972  HIS A N     1 
ATOM   7538  C  CA    . HIS A 1  972  ? 47.003  -52.293  -13.393 1.00 144.09 ? 972  HIS A CA    1 
ATOM   7539  C  C     . HIS A 1  972  ? 47.800  -53.599  -13.392 1.00 142.30 ? 972  HIS A C     1 
ATOM   7540  O  O     . HIS A 1  972  ? 49.028  -53.631  -13.499 1.00 157.34 ? 972  HIS A O     1 
ATOM   7541  C  CB    . HIS A 1  972  ? 47.839  -51.101  -13.870 1.00 166.64 ? 972  HIS A CB    1 
ATOM   7542  C  CG    . HIS A 1  972  ? 47.159  -49.779  -13.687 1.00 172.28 ? 972  HIS A CG    1 
ATOM   7543  N  ND1   . HIS A 1  972  ? 45.910  -49.506  -14.205 1.00 167.12 ? 972  HIS A ND1   1 
ATOM   7544  C  CD2   . HIS A 1  972  ? 47.551  -48.657  -13.036 1.00 168.18 ? 972  HIS A CD2   1 
ATOM   7545  C  CE1   . HIS A 1  972  ? 45.563  -48.273  -13.882 1.00 170.44 ? 972  HIS A CE1   1 
ATOM   7546  N  NE2   . HIS A 1  972  ? 46.541  -47.736  -13.174 1.00 172.60 ? 972  HIS A NE2   1 
ATOM   7547  N  N     . ILE A 1  973  ? 47.055  -54.684  -13.240 1.00 130.31 ? 973  ILE A N     1 
ATOM   7548  C  CA    . ILE A 1  973  ? 47.635  -56.006  -13.055 1.00 140.85 ? 973  ILE A CA    1 
ATOM   7549  C  C     . ILE A 1  973  ? 47.758  -56.648  -14.426 1.00 172.77 ? 973  ILE A C     1 
ATOM   7550  O  O     . ILE A 1  973  ? 46.767  -56.782  -15.153 1.00 176.58 ? 973  ILE A O     1 
ATOM   7551  C  CB    . ILE A 1  973  ? 46.776  -56.856  -12.104 1.00 121.43 ? 973  ILE A CB    1 
ATOM   7552  C  CG1   . ILE A 1  973  ? 47.130  -56.524  -10.652 1.00 104.89 ? 973  ILE A CG1   1 
ATOM   7553  C  CG2   . ILE A 1  973  ? 46.903  -58.349  -12.400 1.00 131.77 ? 973  ILE A CG2   1 
ATOM   7554  C  CD1   . ILE A 1  973  ? 46.328  -57.288  -9.623  1.00 123.19 ? 973  ILE A CD1   1 
ATOM   7555  N  N     . ASP A 1  974  ? 48.982  -57.034  -14.783 1.00 178.66 ? 974  ASP A N     1 
ATOM   7556  C  CA    . ASP A 1  974  ? 49.242  -57.711  -16.043 1.00 187.06 ? 974  ASP A CA    1 
ATOM   7557  C  C     . ASP A 1  974  ? 49.402  -59.199  -15.792 1.00 179.81 ? 974  ASP A C     1 
ATOM   7558  O  O     . ASP A 1  974  ? 50.055  -59.620  -14.832 1.00 161.77 ? 974  ASP A O     1 
ATOM   7559  C  CB    . ASP A 1  974  ? 50.499  -57.172  -16.736 1.00 175.41 ? 974  ASP A CB    1 
ATOM   7560  C  CG    . ASP A 1  974  ? 51.754  -57.381  -15.912 1.00 178.20 ? 974  ASP A CG    1 
ATOM   7561  O  OD1   . ASP A 1  974  ? 51.649  -57.434  -14.666 1.00 184.01 ? 974  ASP A OD1   1 
ATOM   7562  O  OD2   . ASP A 1  974  ? 52.841  -57.528  -16.506 1.00 184.18 ? 974  ASP A OD2   1 
ATOM   7563  N  N     . HIS A 1  975  ? 48.772  -59.989  -16.647 1.00 188.27 ? 975  HIS A N     1 
ATOM   7564  C  CA    . HIS A 1  975  ? 48.794  -61.438  -16.517 1.00 187.21 ? 975  HIS A CA    1 
ATOM   7565  C  C     . HIS A 1  975  ? 50.095  -62.022  -17.045 1.00 173.16 ? 975  HIS A C     1 
ATOM   7566  O  O     . HIS A 1  975  ? 50.098  -63.099  -17.643 1.00 168.48 ? 975  HIS A O     1 
ATOM   7567  C  CB    . HIS A 1  975  ? 47.580  -62.031  -17.236 1.00 202.22 ? 975  HIS A CB    1 
ATOM   7568  C  CG    . HIS A 1  975  ? 46.252  -61.545  -16.715 1.00 206.51 ? 975  HIS A CG    1 
ATOM   7569  N  ND1   . HIS A 1  975  ? 46.135  -60.562  -15.753 1.00 199.33 ? 975  HIS A ND1   1 
ATOM   7570  C  CD2   . HIS A 1  975  ? 44.984  -61.898  -17.040 1.00 197.70 ? 975  HIS A CD2   1 
ATOM   7571  C  CE1   . HIS A 1  975  ? 44.857  -60.340  -15.500 1.00 182.79 ? 975  HIS A CE1   1 
ATOM   7572  N  NE2   . HIS A 1  975  ? 44.137  -61.136  -16.270 1.00 188.78 ? 975  HIS A NE2   1 
ATOM   7573  N  N     . THR A 1  976  ? 51.215  -61.312  -16.851 1.00 174.03 ? 976  THR A N     1 
ATOM   7574  C  CA    . THR A 1  976  ? 52.516  -61.780  -17.317 1.00 174.19 ? 976  THR A CA    1 
ATOM   7575  C  C     . THR A 1  976  ? 53.531  -61.789  -16.182 1.00 179.55 ? 976  THR A C     1 
ATOM   7576  O  O     . THR A 1  976  ? 54.131  -62.828  -15.887 1.00 190.55 ? 976  THR A O     1 
ATOM   7577  C  CB    . THR A 1  976  ? 53.062  -60.884  -18.434 1.00 147.14 ? 976  THR A CB    1 
ATOM   7578  O  OG1   . THR A 1  976  ? 53.618  -59.699  -17.853 1.00 156.73 ? 976  THR A OG1   1 
ATOM   7579  C  CG2   . THR A 1  976  ? 51.961  -60.468  -19.390 1.00 123.84 ? 976  THR A CG2   1 
ATOM   7580  N  N     . LYS A 1  977  ? 53.734  -60.637  -15.545 1.00 164.69 ? 977  LYS A N     1 
ATOM   7581  C  CA    . LYS A 1  977  ? 54.725  -60.557  -14.488 1.00 164.09 ? 977  LYS A CA    1 
ATOM   7582  C  C     . LYS A 1  977  ? 54.357  -61.510  -13.352 1.00 169.74 ? 977  LYS A C     1 
ATOM   7583  O  O     . LYS A 1  977  ? 53.176  -61.721  -13.056 1.00 176.12 ? 977  LYS A O     1 
ATOM   7584  C  CB    . LYS A 1  977  ? 54.847  -59.124  -13.971 1.00 169.95 ? 977  LYS A CB    1 
ATOM   7585  C  CG    . LYS A 1  977  ? 55.757  -58.250  -14.827 1.00 176.78 ? 977  LYS A CG    1 
ATOM   7586  C  CD    . LYS A 1  977  ? 55.709  -56.788  -14.400 1.00 180.54 ? 977  LYS A CD    1 
ATOM   7587  C  CE    . LYS A 1  977  ? 56.549  -55.917  -15.325 1.00 176.34 ? 977  LYS A CE    1 
ATOM   7588  N  NZ    . LYS A 1  977  ? 58.005  -56.049  -15.025 1.00 167.48 ? 977  LYS A NZ    1 
ATOM   7589  N  N     . PRO A 1  978  ? 55.350  -62.089  -12.692 1.00 154.04 ? 978  PRO A N     1 
ATOM   7590  C  CA    . PRO A 1  978  ? 55.077  -62.990  -11.572 1.00 139.41 ? 978  PRO A CA    1 
ATOM   7591  C  C     . PRO A 1  978  ? 54.827  -62.217  -10.285 1.00 122.06 ? 978  PRO A C     1 
ATOM   7592  O  O     . PRO A 1  978  ? 55.419  -61.165  -10.036 1.00 137.41 ? 978  PRO A O     1 
ATOM   7593  C  CB    . PRO A 1  978  ? 56.360  -63.821  -11.485 1.00 124.20 ? 978  PRO A CB    1 
ATOM   7594  C  CG    . PRO A 1  978  ? 57.412  -62.866  -11.937 1.00 141.26 ? 978  PRO A CG    1 
ATOM   7595  C  CD    . PRO A 1  978  ? 56.788  -62.004  -12.996 1.00 147.91 ? 978  PRO A CD    1 
ATOM   7596  N  N     . SER A 1  979  ? 53.948  -62.762  -9.451  1.00 104.62 ? 979  SER A N     1 
ATOM   7597  C  CA    . SER A 1  979  ? 53.601  -62.091  -8.209  1.00 115.48 ? 979  SER A CA    1 
ATOM   7598  C  C     . SER A 1  979  ? 54.764  -62.145  -7.229  1.00 103.62 ? 979  SER A C     1 
ATOM   7599  O  O     . SER A 1  979  ? 55.546  -63.099  -7.203  1.00 135.49 ? 979  SER A O     1 
ATOM   7600  C  CB    . SER A 1  979  ? 52.367  -62.737  -7.575  1.00 117.85 ? 979  SER A CB    1 
ATOM   7601  O  OG    . SER A 1  979  ? 52.148  -62.250  -6.261  1.00 116.84 ? 979  SER A OG    1 
ATOM   7602  N  N     . ASP A 1  980  ? 54.866  -61.093  -6.422  1.00 102.63 ? 980  ASP A N     1 
ATOM   7603  C  CA    . ASP A 1  980  ? 55.788  -60.991  -5.300  1.00 110.79 ? 980  ASP A CA    1 
ATOM   7604  C  C     . ASP A 1  980  ? 55.194  -61.521  -3.995  1.00 123.13 ? 980  ASP A C     1 
ATOM   7605  O  O     . ASP A 1  980  ? 55.760  -61.277  -2.921  1.00 105.40 ? 980  ASP A O     1 
ATOM   7606  C  CB    . ASP A 1  980  ? 56.247  -59.546  -5.115  1.00 127.20 ? 980  ASP A CB    1 
ATOM   7607  C  CG    . ASP A 1  980  ? 55.101  -58.606  -4.850  1.00 134.92 ? 980  ASP A CG    1 
ATOM   7608  O  OD1   . ASP A 1  980  ? 54.014  -58.839  -5.412  1.00 146.89 ? 980  ASP A OD1   1 
ATOM   7609  O  OD2   . ASP A 1  980  ? 55.288  -57.639  -4.081  1.00 129.34 ? 980  ASP A OD2   1 
ATOM   7610  N  N     . LEU A 1  981  ? 54.037  -62.171  -4.056  1.00 117.91 ? 981  LEU A N     1 
ATOM   7611  C  CA    . LEU A 1  981  ? 53.483  -62.848  -2.893  1.00 104.19 ? 981  LEU A CA    1 
ATOM   7612  C  C     . LEU A 1  981  ? 54.285  -64.095  -2.525  1.00 112.81 ? 981  LEU A C     1 
ATOM   7613  O  O     . LEU A 1  981  ? 54.935  -64.722  -3.368  1.00 124.45 ? 981  LEU A O     1 
ATOM   7614  C  CB    . LEU A 1  981  ? 52.023  -63.236  -3.156  1.00 102.05 ? 981  LEU A CB    1 
ATOM   7615  C  CG    . LEU A 1  981  ? 51.035  -62.074  -3.221  1.00 115.14 ? 981  LEU A CG    1 
ATOM   7616  C  CD1   . LEU A 1  981  ? 49.786  -62.419  -4.001  1.00 100.97 ? 981  LEU A CD1   1 
ATOM   7617  C  CD2   . LEU A 1  981  ? 50.684  -61.675  -1.806  1.00 126.00 ? 981  LEU A CD2   1 
ATOM   7618  N  N     . THR A 1  982  ? 54.247  -64.449  -1.242  1.00 113.59 ? 982  THR A N     1 
ATOM   7619  C  CA    . THR A 1  982  ? 54.746  -65.747  -0.819  1.00 107.91 ? 982  THR A CA    1 
ATOM   7620  C  C     . THR A 1  982  ? 53.554  -66.557  -0.307  1.00 104.32 ? 982  THR A C     1 
ATOM   7621  O  O     . THR A 1  982  ? 52.507  -66.004  0.045   1.00 118.69 ? 982  THR A O     1 
ATOM   7622  C  CB    . THR A 1  982  ? 55.857  -65.618  0.241   1.00 104.39 ? 982  THR A CB    1 
ATOM   7623  O  OG1   . THR A 1  982  ? 55.359  -65.080  1.468   1.00 103.51 ? 982  THR A OG1   1 
ATOM   7624  C  CG2   . THR A 1  982  ? 56.878  -64.638  -0.253  1.00 117.11 ? 982  THR A CG2   1 
ATOM   7625  N  N     . ILE A 1  983  ? 53.689  -67.886  -0.325  1.00 106.81 ? 983  ILE A N     1 
ATOM   7626  C  CA    . ILE A 1  983  ? 52.580  -68.726  0.125   1.00 119.59 ? 983  ILE A CA    1 
ATOM   7627  C  C     . ILE A 1  983  ? 52.287  -68.475  1.601   1.00 128.19 ? 983  ILE A C     1 
ATOM   7628  O  O     . ILE A 1  983  ? 51.144  -68.628  2.061   1.00 137.23 ? 983  ILE A O     1 
ATOM   7629  C  CB    . ILE A 1  983  ? 52.866  -70.219  -0.201  1.00 111.72 ? 983  ILE A CB    1 
ATOM   7630  C  CG1   . ILE A 1  983  ? 53.874  -70.853  0.752   1.00 139.77 ? 983  ILE A CG1   1 
ATOM   7631  C  CG2   . ILE A 1  983  ? 53.358  -70.402  -1.643  1.00 107.66 ? 983  ILE A CG2   1 
ATOM   7632  C  CD1   . ILE A 1  983  ? 53.256  -71.420  2.035   1.00 161.56 ? 983  ILE A CD1   1 
ATOM   7633  N  N     . LYS A 1  984  ? 53.291  -68.020  2.355   1.00 114.48 ? 984  LYS A N     1 
ATOM   7634  C  CA    . LYS A 1  984  ? 53.066  -67.609  3.740   1.00 113.32 ? 984  LYS A CA    1 
ATOM   7635  C  C     . LYS A 1  984  ? 52.245  -66.327  3.805   1.00 113.79 ? 984  LYS A C     1 
ATOM   7636  O  O     . LYS A 1  984  ? 51.383  -66.176  4.680   1.00 112.42 ? 984  LYS A O     1 
ATOM   7637  C  CB    . LYS A 1  984  ? 54.416  -67.423  4.436   1.00 104.59 ? 984  LYS A CB    1 
ATOM   7638  C  CG    . LYS A 1  984  ? 54.611  -68.174  5.743   1.00 104.90 ? 984  LYS A CG    1 
ATOM   7639  C  CD    . LYS A 1  984  ? 56.086  -68.489  5.943   1.00 114.91 ? 984  LYS A CD    1 
ATOM   7640  C  CE    . LYS A 1  984  ? 56.289  -69.435  7.106   1.00 126.93 ? 984  LYS A CE    1 
ATOM   7641  N  NZ    . LYS A 1  984  ? 57.599  -70.125  6.973   1.00 135.10 ? 984  LYS A NZ    1 
ATOM   7642  N  N     . ASP A 1  985  ? 52.456  -65.429  2.835   1.00 112.18 ? 985  ASP A N     1 
ATOM   7643  C  CA    . ASP A 1  985  ? 51.683  -64.193  2.756   1.00 109.55 ? 985  ASP A CA    1 
ATOM   7644  C  C     . ASP A 1  985  ? 50.212  -64.501  2.539   1.00 100.89 ? 985  ASP A C     1 
ATOM   7645  O  O     . ASP A 1  985  ? 49.345  -63.941  3.216   1.00 125.63 ? 985  ASP A O     1 
ATOM   7646  C  CB    . ASP A 1  985  ? 52.214  -63.287  1.629   1.00 108.54 ? 985  ASP A CB    1 
ATOM   7647  C  CG    . ASP A 1  985  ? 53.433  -62.463  2.045   1.00 121.95 ? 985  ASP A CG    1 
ATOM   7648  O  OD1   . ASP A 1  985  ? 53.582  -62.183  3.254   1.00 132.37 ? 985  ASP A OD1   1 
ATOM   7649  O  OD2   . ASP A 1  985  ? 54.242  -62.095  1.160   1.00 131.20 ? 985  ASP A OD2   1 
ATOM   7650  N  N     . ILE A 1  986  ? 49.912  -65.335  1.547   1.00 101.60 ? 986  ILE A N     1 
ATOM   7651  C  CA    . ILE A 1  986  ? 48.523  -65.623  1.221   1.00 102.11 ? 986  ILE A CA    1 
ATOM   7652  C  C     . ILE A 1  986  ? 47.867  -66.436  2.336   1.00 105.36 ? 986  ILE A C     1 
ATOM   7653  O  O     . ILE A 1  986  ? 46.824  -66.052  2.886   1.00 109.13 ? 986  ILE A O     1 
ATOM   7654  C  CB    . ILE A 1  986  ? 48.453  -66.382  -0.117  1.00 102.25 ? 986  ILE A CB    1 
ATOM   7655  C  CG1   . ILE A 1  986  ? 49.284  -65.684  -1.186  1.00 102.30 ? 986  ILE A CG1   1 
ATOM   7656  C  CG2   . ILE A 1  986  ? 47.027  -66.526  -0.581  1.00 113.45 ? 986  ILE A CG2   1 
ATOM   7657  C  CD1   . ILE A 1  986  ? 49.033  -66.217  -2.580  1.00 113.67 ? 986  ILE A CD1   1 
ATOM   7658  N  N     . VAL A 1  987  ? 48.512  -67.534  2.734   1.00 102.50 ? 987  VAL A N     1 
ATOM   7659  C  CA    . VAL A 1  987  ? 47.890  -68.478  3.661   1.00 115.40 ? 987  VAL A CA    1 
ATOM   7660  C  C     . VAL A 1  987  ? 47.704  -67.848  5.037   1.00 109.84 ? 987  VAL A C     1 
ATOM   7661  O  O     . VAL A 1  987  ? 46.644  -67.989  5.669   1.00 125.40 ? 987  VAL A O     1 
ATOM   7662  C  CB    . VAL A 1  987  ? 48.700  -69.787  3.713   1.00 109.91 ? 987  VAL A CB    1 
ATOM   7663  C  CG1   . VAL A 1  987  ? 48.420  -70.544  4.991   1.00 123.16 ? 987  VAL A CG1   1 
ATOM   7664  C  CG2   . VAL A 1  987  ? 48.358  -70.660  2.510   1.00 104.96 ? 987  VAL A CG2   1 
ATOM   7665  N  N     . LEU A 1  988  ? 48.712  -67.118  5.508   1.00 101.77 ? 988  LEU A N     1 
ATOM   7666  C  CA    . LEU A 1  988  ? 48.629  -66.511  6.828   1.00 119.92 ? 988  LEU A CA    1 
ATOM   7667  C  C     . LEU A 1  988  ? 47.858  -65.203  6.778   1.00 125.21 ? 988  LEU A C     1 
ATOM   7668  O  O     . LEU A 1  988  ? 47.263  -64.795  7.781   1.00 136.28 ? 988  LEU A O     1 
ATOM   7669  C  CB    . LEU A 1  988  ? 50.028  -66.303  7.406   1.00 132.06 ? 988  LEU A CB    1 
ATOM   7670  C  CG    . LEU A 1  988  ? 50.601  -67.586  8.004   1.00 119.44 ? 988  LEU A CG    1 
ATOM   7671  C  CD1   . LEU A 1  988  ? 51.292  -68.409  6.937   1.00 120.16 ? 988  LEU A CD1   1 
ATOM   7672  C  CD2   . LEU A 1  988  ? 51.540  -67.257  9.164   1.00 118.94 ? 988  LEU A CD2   1 
ATOM   7673  N  N     . GLY A 1  989  ? 47.902  -64.506  5.647   1.00 126.01 ? 989  GLY A N     1 
ATOM   7674  C  CA    . GLY A 1  989  ? 47.109  -63.300  5.521   1.00 125.97 ? 989  GLY A CA    1 
ATOM   7675  C  C     . GLY A 1  989  ? 45.625  -63.589  5.624   1.00 108.36 ? 989  GLY A C     1 
ATOM   7676  O  O     . GLY A 1  989  ? 44.885  -62.845  6.272   1.00 116.59 ? 989  GLY A O     1 
ATOM   7677  N  N     . VAL A 1  990  ? 45.170  -64.669  4.970   1.00 112.84 ? 990  VAL A N     1 
ATOM   7678  C  CA    . VAL A 1  990  ? 43.762  -65.067  5.044   1.00 98.65  ? 990  VAL A CA    1 
ATOM   7679  C  C     . VAL A 1  990  ? 43.424  -65.684  6.394   1.00 98.77  ? 990  VAL A C     1 
ATOM   7680  O  O     . VAL A 1  990  ? 42.382  -65.378  7.000   1.00 116.97 ? 990  VAL A O     1 
ATOM   7681  C  CB    . VAL A 1  990  ? 43.430  -66.051  3.910   1.00 99.46  ? 990  VAL A CB    1 
ATOM   7682  C  CG1   . VAL A 1  990  ? 41.992  -66.512  4.018   1.00 99.32  ? 990  VAL A CG1   1 
ATOM   7683  C  CG2   . VAL A 1  990  ? 43.688  -65.424  2.540   1.00 99.37  ? 990  VAL A CG2   1 
ATOM   7684  N  N     . LYS A 1  991  ? 44.312  -66.538  6.908   1.00 110.64 ? 991  LYS A N     1 
ATOM   7685  C  CA    . LYS A 1  991  ? 44.084  -67.103  8.232   1.00 122.81 ? 991  LYS A CA    1 
ATOM   7686  C  C     . LYS A 1  991  ? 43.984  -66.011  9.283   1.00 126.23 ? 991  LYS A C     1 
ATOM   7687  O  O     . LYS A 1  991  ? 43.135  -66.084  10.180  1.00 107.03 ? 991  LYS A O     1 
ATOM   7688  C  CB    . LYS A 1  991  ? 45.211  -68.085  8.572   1.00 116.41 ? 991  LYS A CB    1 
ATOM   7689  C  CG    . LYS A 1  991  ? 44.891  -69.089  9.664   1.00 110.30 ? 991  LYS A CG    1 
ATOM   7690  C  CD    . LYS A 1  991  ? 45.816  -70.291  9.567   1.00 111.06 ? 991  LYS A CD    1 
ATOM   7691  C  CE    . LYS A 1  991  ? 45.522  -71.262  10.682  1.00 134.61 ? 991  LYS A CE    1 
ATOM   7692  N  NZ    . LYS A 1  991  ? 46.117  -72.589  10.383  1.00 148.92 ? 991  LYS A NZ    1 
ATOM   7693  N  N     . ASP A 1  992  ? 44.735  -64.917  9.091   1.00 124.13 ? 992  ASP A N     1 
ATOM   7694  C  CA    . ASP A 1  992  ? 44.712  -63.809  10.036  1.00 129.16 ? 992  ASP A CA    1 
ATOM   7695  C  C     . ASP A 1  992  ? 43.477  -62.963  9.807   1.00 114.90 ? 992  ASP A C     1 
ATOM   7696  O  O     . ASP A 1  992  ? 42.866  -62.482  10.766  1.00 125.19 ? 992  ASP A O     1 
ATOM   7697  C  CB    . ASP A 1  992  ? 45.977  -62.959  9.881   1.00 150.61 ? 992  ASP A CB    1 
ATOM   7698  C  CG    . ASP A 1  992  ? 46.108  -61.880  10.955  1.00 175.11 ? 992  ASP A CG    1 
ATOM   7699  O  OD1   . ASP A 1  992  ? 46.461  -62.224  12.104  1.00 186.16 ? 992  ASP A OD1   1 
ATOM   7700  O  OD2   . ASP A 1  992  ? 45.840  -60.694  10.658  1.00 176.22 ? 992  ASP A OD2   1 
ATOM   7701  N  N     . LEU A 1  993  ? 43.091  -62.789  8.540   1.00 114.36 ? 993  LEU A N     1 
ATOM   7702  C  CA    . LEU A 1  993  ? 41.915  -61.981  8.232   1.00 113.86 ? 993  LEU A CA    1 
ATOM   7703  C  C     . LEU A 1  993  ? 40.675  -62.530  8.916   1.00 108.31 ? 993  LEU A C     1 
ATOM   7704  O  O     . LEU A 1  993  ? 39.834  -61.763  9.399   1.00 106.06 ? 993  LEU A O     1 
ATOM   7705  C  CB    . LEU A 1  993  ? 41.678  -61.932  6.720   1.00 96.92  ? 993  LEU A CB    1 
ATOM   7706  C  CG    . LEU A 1  993  ? 40.313  -61.349  6.311   1.00 94.94  ? 993  LEU A CG    1 
ATOM   7707  C  CD1   . LEU A 1  993  ? 40.106  -59.963  6.870   1.00 93.93  ? 993  LEU A CD1   1 
ATOM   7708  C  CD2   . LEU A 1  993  ? 40.072  -61.356  4.807   1.00 95.13  ? 993  LEU A CD2   1 
ATOM   7709  N  N     . GLN A 1  994  ? 40.561  -63.855  9.007   1.00 115.23 ? 994  GLN A N     1 
ATOM   7710  C  CA    . GLN A 1  994  ? 39.315  -64.417  9.516   1.00 96.26  ? 994  GLN A CA    1 
ATOM   7711  C  C     . GLN A 1  994  ? 39.058  -64.002  10.958  1.00 95.78  ? 994  GLN A C     1 
ATOM   7712  O  O     . GLN A 1  994  ? 37.929  -63.651  11.309  1.00 124.89 ? 994  GLN A O     1 
ATOM   7713  C  CB    . GLN A 1  994  ? 39.302  -65.937  9.385   1.00 97.32  ? 994  GLN A CB    1 
ATOM   7714  C  CG    . GLN A 1  994  ? 39.561  -66.458  7.984   1.00 97.92  ? 994  GLN A CG    1 
ATOM   7715  C  CD    . GLN A 1  994  ? 39.379  -67.957  7.912   1.00 137.41 ? 994  GLN A CD    1 
ATOM   7716  O  OE1   . GLN A 1  994  ? 38.632  -68.542  8.705   1.00 127.09 ? 994  GLN A OE1   1 
ATOM   7717  N  NE2   . GLN A 1  994  ? 40.096  -68.596  6.998   1.00 140.09 ? 994  GLN A NE2   1 
ATOM   7718  N  N     . GLU A 1  995  ? 40.084  -64.000  11.806  1.00 119.12 ? 995  GLU A N     1 
ATOM   7719  C  CA    . GLU A 1  995  ? 39.815  -63.645  13.194  1.00 124.40 ? 995  GLU A CA    1 
ATOM   7720  C  C     . GLU A 1  995  ? 39.586  -62.155  13.390  1.00 102.24 ? 995  GLU A C     1 
ATOM   7721  O  O     . GLU A 1  995  ? 39.451  -61.717  14.535  1.00 107.98 ? 995  GLU A O     1 
ATOM   7722  C  CB    . GLU A 1  995  ? 40.949  -64.129  14.113  1.00 130.53 ? 995  GLU A CB    1 
ATOM   7723  C  CG    . GLU A 1  995  ? 42.362  -64.036  13.543  1.00 153.69 ? 995  GLU A CG    1 
ATOM   7724  C  CD    . GLU A 1  995  ? 43.432  -64.352  14.589  1.00 188.13 ? 995  GLU A CD    1 
ATOM   7725  O  OE1   . GLU A 1  995  ? 43.053  -64.671  15.737  1.00 195.62 ? 995  GLU A OE1   1 
ATOM   7726  O  OE2   . GLU A 1  995  ? 44.644  -64.286  14.268  1.00 186.02 ? 995  GLU A OE2   1 
ATOM   7727  N  N     . ASN A 1  996  ? 39.494  -61.383  12.309  1.00 94.11  ? 996  ASN A N     1 
ATOM   7728  C  CA    . ASN A 1  996  ? 39.101  -59.981  12.363  1.00 110.80 ? 996  ASN A CA    1 
ATOM   7729  C  C     . ASN A 1  996  ? 37.703  -59.735  11.814  1.00 106.27 ? 996  ASN A C     1 
ATOM   7730  O  O     . ASN A 1  996  ? 37.208  -58.604  11.895  1.00 91.84  ? 996  ASN A O     1 
ATOM   7731  C  CB    . ASN A 1  996  ? 40.124  -59.095  11.628  1.00 112.18 ? 996  ASN A CB    1 
ATOM   7732  C  CG    . ASN A 1  996  ? 41.460  -59.017  12.345  1.00 133.49 ? 996  ASN A CG    1 
ATOM   7733  O  OD1   . ASN A 1  996  ? 41.512  -58.971  13.576  1.00 140.07 ? 996  ASN A OD1   1 
ATOM   7734  N  ND2   . ASN A 1  996  ? 42.545  -58.991  11.581  1.00 152.43 ? 996  ASN A ND2   1 
ATOM   7735  N  N     . LEU A 1  997  ? 37.048  -60.758  11.275  1.00 94.89  ? 997  LEU A N     1 
ATOM   7736  C  CA    . LEU A 1  997  ? 35.668  -60.617  10.822  1.00 92.74  ? 997  LEU A CA    1 
ATOM   7737  C  C     . LEU A 1  997  ? 34.771  -60.789  12.036  1.00 95.87  ? 997  LEU A C     1 
ATOM   7738  O  O     . LEU A 1  997  ? 34.329  -61.889  12.360  1.00 116.96 ? 997  LEU A O     1 
ATOM   7739  C  CB    . LEU A 1  997  ? 35.345  -61.636  9.742   1.00 93.39  ? 997  LEU A CB    1 
ATOM   7740  C  CG    . LEU A 1  997  ? 36.327  -61.664  8.585   1.00 93.78  ? 997  LEU A CG    1 
ATOM   7741  C  CD1   . LEU A 1  997  ? 35.910  -62.694  7.541   1.00 94.47  ? 997  LEU A CD1   1 
ATOM   7742  C  CD2   . LEU A 1  997  ? 36.422  -60.265  8.003   1.00 106.39 ? 997  LEU A CD2   1 
ATOM   7743  N  N     . LEU A 1  998  ? 34.454  -59.683  12.691  1.00 91.76  ? 998  LEU A N     1 
ATOM   7744  C  CA    . LEU A 1  998  ? 33.867  -59.728  14.015  1.00 103.95 ? 998  LEU A CA    1 
ATOM   7745  C  C     . LEU A 1  998  ? 32.410  -59.304  13.977  1.00 103.65 ? 998  LEU A C     1 
ATOM   7746  O  O     . LEU A 1  998  ? 32.060  -58.289  13.367  1.00 115.96 ? 998  LEU A O     1 
ATOM   7747  C  CB    . LEU A 1  998  ? 34.641  -58.823  14.965  1.00 91.23  ? 998  LEU A CB    1 
ATOM   7748  C  CG    . LEU A 1  998  ? 35.599  -59.573  15.860  1.00 91.89  ? 998  LEU A CG    1 
ATOM   7749  C  CD1   . LEU A 1  998  ? 36.772  -59.982  15.037  1.00 92.43  ? 998  LEU A CD1   1 
ATOM   7750  C  CD2   . LEU A 1  998  ? 36.009  -58.688  17.027  1.00 113.05 ? 998  LEU A CD2   1 
ATOM   7751  N  N     . VAL A 1  999  ? 31.584  -60.076  14.687  1.00 93.75  ? 999  VAL A N     1 
ATOM   7752  C  CA    . VAL A 1  999  ? 30.169  -59.804  14.905  1.00 90.81  ? 999  VAL A CA    1 
ATOM   7753  C  C     . VAL A 1  999  ? 29.921  -59.653  16.401  1.00 111.92 ? 999  VAL A C     1 
ATOM   7754  O  O     . VAL A 1  999  ? 29.481  -58.598  16.867  1.00 141.58 ? 999  VAL A O     1 
ATOM   7755  C  CB    . VAL A 1  999  ? 29.296  -60.915  14.311  1.00 91.30  ? 999  VAL A CB    1 
ATOM   7756  C  CG1   . VAL A 1  999  ? 27.844  -60.630  14.596  1.00 116.90 ? 999  VAL A CG1   1 
ATOM   7757  C  CG2   . VAL A 1  999  ? 29.545  -61.035  12.817  1.00 91.49  ? 999  VAL A CG2   1 
ATOM   7758  N  N     . LEU A 1  1000 ? 30.161  -60.713  17.157  1.00 91.32  ? 1000 LEU A N     1 
ATOM   7759  C  CA    . LEU A 1  1000 ? 30.127  -60.648  18.610  1.00 105.25 ? 1000 LEU A CA    1 
ATOM   7760  C  C     . LEU A 1  1000 ? 31.532  -60.377  19.142  1.00 103.04 ? 1000 LEU A C     1 
ATOM   7761  O  O     . LEU A 1  1000 ? 32.526  -60.531  18.429  1.00 115.97 ? 1000 LEU A O     1 
ATOM   7762  C  CB    . LEU A 1  1000 ? 29.569  -61.945  19.193  1.00 91.98  ? 1000 LEU A CB    1 
ATOM   7763  C  CG    . LEU A 1  1000 ? 28.144  -62.270  18.741  1.00 97.37  ? 1000 LEU A CG    1 
ATOM   7764  C  CD1   . LEU A 1  1000 ? 28.112  -63.032  17.439  1.00 97.80  ? 1000 LEU A CD1   1 
ATOM   7765  C  CD2   . LEU A 1  1000 ? 27.412  -63.050  19.835  1.00 126.23 ? 1000 LEU A CD2   1 
ATOM   7766  N  N     . ARG A 1  1001 ? 31.613  -59.970  20.419  1.00 98.62  ? 1001 ARG A N     1 
ATOM   7767  C  CA    . ARG A 1  1001 ? 32.880  -59.463  20.934  1.00 101.30 ? 1001 ARG A CA    1 
ATOM   7768  C  C     . ARG A 1  1001 ? 33.129  -59.820  22.389  1.00 108.10 ? 1001 ARG A C     1 
ATOM   7769  O  O     . ARG A 1  1001 ? 34.078  -59.297  22.984  1.00 160.22 ? 1001 ARG A O     1 
ATOM   7770  C  CB    . ARG A 1  1001 ? 32.957  -57.935  20.763  1.00 107.31 ? 1001 ARG A CB    1 
ATOM   7771  C  CG    . ARG A 1  1001 ? 33.264  -57.479  19.341  1.00 90.26  ? 1001 ARG A CG    1 
ATOM   7772  C  CD    . ARG A 1  1001 ? 33.122  -55.988  19.204  1.00 105.45 ? 1001 ARG A CD    1 
ATOM   7773  N  NE    . ARG A 1  1001 ? 33.986  -55.484  18.145  1.00 107.98 ? 1001 ARG A NE    1 
ATOM   7774  C  CZ    . ARG A 1  1001 ? 33.586  -55.264  16.896  1.00 113.20 ? 1001 ARG A CZ    1 
ATOM   7775  N  NH1   . ARG A 1  1001 ? 32.321  -55.492  16.544  1.00 90.55  ? 1001 ARG A NH1   1 
ATOM   7776  N  NH2   . ARG A 1  1001 ? 34.451  -54.803  16.000  1.00 108.71 ? 1001 ARG A NH2   1 
ATOM   7777  N  N     . GLY A 1  1002 ? 32.351  -60.713  22.965  1.00 112.64 ? 1002 GLY A N     1 
ATOM   7778  C  CA    . GLY A 1  1002 ? 32.574  -61.095  24.339  1.00 146.19 ? 1002 GLY A CA    1 
ATOM   7779  C  C     . GLY A 1  1002 ? 33.884  -61.843  24.522  1.00 131.37 ? 1002 GLY A C     1 
ATOM   7780  O  O     . GLY A 1  1002 ? 34.439  -62.447  23.600  1.00 111.52 ? 1002 GLY A O     1 
ATOM   7781  N  N     . LYS A 1  1003 ? 34.377  -61.812  25.753  1.00 123.25 ? 1003 LYS A N     1 
ATOM   7782  C  CA    . LYS A 1  1003 ? 35.624  -62.484  26.113  1.00 121.77 ? 1003 LYS A CA    1 
ATOM   7783  C  C     . LYS A 1  1003 ? 35.339  -63.773  26.885  1.00 113.92 ? 1003 LYS A C     1 
ATOM   7784  O  O     . LYS A 1  1003 ? 35.692  -63.914  28.051  1.00 109.73 ? 1003 LYS A O     1 
ATOM   7785  C  CB    . LYS A 1  1003 ? 36.504  -61.540  26.923  1.00 126.58 ? 1003 LYS A CB    1 
ATOM   7786  C  CG    . LYS A 1  1003 ? 37.397  -60.645  26.098  1.00 138.00 ? 1003 LYS A CG    1 
ATOM   7787  C  CD    . LYS A 1  1003 ? 38.261  -59.787  27.011  1.00 142.95 ? 1003 LYS A CD    1 
ATOM   7788  C  CE    . LYS A 1  1003 ? 39.189  -58.883  26.223  1.00 127.64 ? 1003 LYS A CE    1 
ATOM   7789  N  NZ    . LYS A 1  1003 ? 39.937  -57.963  27.120  1.00 130.72 ? 1003 LYS A NZ    1 
ATOM   7790  N  N     . ASN A 1  1004 ? 34.672  -64.721  26.221  1.00 115.44 ? 1004 ASN A N     1 
ATOM   7791  C  CA    . ASN A 1  1004 ? 34.427  -66.035  26.810  1.00 116.24 ? 1004 ASN A CA    1 
ATOM   7792  C  C     . ASN A 1  1004 ? 34.090  -67.026  25.705  1.00 120.09 ? 1004 ASN A C     1 
ATOM   7793  O  O     . ASN A 1  1004 ? 33.767  -66.646  24.575  1.00 107.20 ? 1004 ASN A O     1 
ATOM   7794  C  CB    . ASN A 1  1004 ? 33.304  -66.018  27.855  1.00 121.04 ? 1004 ASN A CB    1 
ATOM   7795  C  CG    . ASN A 1  1004 ? 32.047  -65.350  27.358  1.00 117.68 ? 1004 ASN A CG    1 
ATOM   7796  O  OD1   . ASN A 1  1004 ? 31.218  -65.967  26.680  1.00 122.48 ? 1004 ASN A OD1   1 
ATOM   7797  N  ND2   . ASN A 1  1004 ? 31.904  -64.078  27.674  1.00 124.17 ? 1004 ASN A ND2   1 
ATOM   7798  N  N     . GLU A 1  1005 ? 34.184  -68.312  26.048  1.00 119.86 ? 1005 GLU A N     1 
ATOM   7799  C  CA    . GLU A 1  1005 ? 34.118  -69.337  25.017  1.00 134.08 ? 1005 GLU A CA    1 
ATOM   7800  C  C     . GLU A 1  1005 ? 32.710  -69.477  24.459  1.00 121.01 ? 1005 GLU A C     1 
ATOM   7801  O  O     . GLU A 1  1005 ? 32.551  -69.928  23.319  1.00 103.46 ? 1005 GLU A O     1 
ATOM   7802  C  CB    . GLU A 1  1005 ? 34.643  -70.675  25.549  1.00 143.18 ? 1005 GLU A CB    1 
ATOM   7803  C  CG    . GLU A 1  1005 ? 36.165  -70.694  25.693  1.00 173.17 ? 1005 GLU A CG    1 
ATOM   7804  C  CD    . GLU A 1  1005 ? 36.877  -69.895  24.601  1.00 180.25 ? 1005 GLU A CD    1 
ATOM   7805  O  OE1   . GLU A 1  1005 ? 36.796  -70.281  23.415  1.00 178.09 ? 1005 GLU A OE1   1 
ATOM   7806  O  OE2   . GLU A 1  1005 ? 37.499  -68.860  24.930  1.00 160.62 ? 1005 GLU A OE2   1 
ATOM   7807  N  N     . ILE A 1  1006 ? 31.691  -69.080  25.222  1.00 132.22 ? 1006 ILE A N     1 
ATOM   7808  C  CA    . ILE A 1  1006 ? 30.327  -69.092  24.697  1.00 122.31 ? 1006 ILE A CA    1 
ATOM   7809  C  C     . ILE A 1  1006 ? 30.190  -68.092  23.555  1.00 112.89 ? 1006 ILE A C     1 
ATOM   7810  O  O     . ILE A 1  1006 ? 29.724  -68.429  22.458  1.00 131.29 ? 1006 ILE A O     1 
ATOM   7811  C  CB    . ILE A 1  1006 ? 29.298  -68.795  25.804  1.00 102.53 ? 1006 ILE A CB    1 
ATOM   7812  C  CG1   . ILE A 1  1006 ? 29.192  -69.929  26.821  1.00 119.12 ? 1006 ILE A CG1   1 
ATOM   7813  C  CG2   . ILE A 1  1006 ? 27.942  -68.610  25.199  1.00 103.66 ? 1006 ILE A CG2   1 
ATOM   7814  C  CD1   . ILE A 1  1006 ? 27.886  -69.887  27.650  1.00 97.87  ? 1006 ILE A CD1   1 
ATOM   7815  N  N     . ILE A 1  1007 ? 30.589  -66.844  23.797  1.00 101.71 ? 1007 ILE A N     1 
ATOM   7816  C  CA    . ILE A 1  1007 ? 30.462  -65.817  22.769  1.00 106.20 ? 1007 ILE A CA    1 
ATOM   7817  C  C     . ILE A 1  1007 ? 31.455  -66.050  21.640  1.00 106.49 ? 1007 ILE A C     1 
ATOM   7818  O  O     . ILE A 1  1007 ? 31.160  -65.760  20.474  1.00 94.85  ? 1007 ILE A O     1 
ATOM   7819  C  CB    . ILE A 1  1007 ? 30.661  -64.415  23.378  1.00 94.15  ? 1007 ILE A CB    1 
ATOM   7820  C  CG1   . ILE A 1  1007 ? 29.618  -64.116  24.453  1.00 93.85  ? 1007 ILE A CG1   1 
ATOM   7821  C  CG2   . ILE A 1  1007 ? 30.555  -63.366  22.309  1.00 93.33  ? 1007 ILE A CG2   1 
ATOM   7822  C  CD1   . ILE A 1  1007 ? 28.198  -64.275  24.002  1.00 93.55  ? 1007 ILE A CD1   1 
ATOM   7823  N  N     . GLN A 1  1008 ? 32.639  -66.576  21.954  1.00 104.71 ? 1008 GLN A N     1 
ATOM   7824  C  CA    . GLN A 1  1008 ? 33.639  -66.804  20.918  1.00 96.25  ? 1008 GLN A CA    1 
ATOM   7825  C  C     . GLN A 1  1008 ? 33.249  -67.970  20.018  1.00 96.88  ? 1008 GLN A C     1 
ATOM   7826  O  O     . GLN A 1  1008 ? 33.446  -67.923  18.791  1.00 97.26  ? 1008 GLN A O     1 
ATOM   7827  C  CB    . GLN A 1  1008 ? 34.993  -67.036  21.582  1.00 100.36 ? 1008 GLN A CB    1 
ATOM   7828  C  CG    . GLN A 1  1008 ? 35.637  -65.745  22.061  1.00 96.21  ? 1008 GLN A CG    1 
ATOM   7829  C  CD    . GLN A 1  1008 ? 35.914  -64.776  20.938  1.00 117.88 ? 1008 GLN A CD    1 
ATOM   7830  O  OE1   . GLN A 1  1008 ? 36.415  -65.157  19.879  1.00 126.02 ? 1008 GLN A OE1   1 
ATOM   7831  N  NE2   . GLN A 1  1008 ? 35.551  -63.518  21.147  1.00 126.44 ? 1008 GLN A NE2   1 
ATOM   7832  N  N     . ASN A 1  1009 ? 32.624  -68.992  20.599  1.00 97.49  ? 1009 ASN A N     1 
ATOM   7833  C  CA    . ASN A 1  1009 ? 32.042  -70.049  19.787  1.00 107.80 ? 1009 ASN A CA    1 
ATOM   7834  C  C     . ASN A 1  1009 ? 30.877  -69.510  18.962  1.00 107.20 ? 1009 ASN A C     1 
ATOM   7835  O  O     . ASN A 1  1009 ? 30.760  -69.819  17.770  1.00 113.83 ? 1009 ASN A O     1 
ATOM   7836  C  CB    . ASN A 1  1009 ? 31.597  -71.208  20.688  1.00 117.13 ? 1009 ASN A CB    1 
ATOM   7837  C  CG    . ASN A 1  1009 ? 32.505  -72.437  20.575  1.00 136.72 ? 1009 ASN A CG    1 
ATOM   7838  O  OD1   . ASN A 1  1009 ? 33.727  -72.317  20.462  1.00 156.17 ? 1009 ASN A OD1   1 
ATOM   7839  N  ND2   . ASN A 1  1009 ? 31.903  -73.622  20.586  1.00 135.95 ? 1009 ASN A ND2   1 
ATOM   7840  N  N     . ALA A 1  1010 ? 30.047  -68.642  19.555  1.00 96.67  ? 1010 ALA A N     1 
ATOM   7841  C  CA    . ALA A 1  1010 ? 28.969  -68.025  18.791  1.00 97.19  ? 1010 ALA A CA    1 
ATOM   7842  C  C     . ALA A 1  1010 ? 29.500  -67.222  17.618  1.00 100.05 ? 1010 ALA A C     1 
ATOM   7843  O  O     . ALA A 1  1010 ? 28.826  -67.089  16.586  1.00 104.65 ? 1010 ALA A O     1 
ATOM   7844  C  CB    . ALA A 1  1010 ? 28.156  -67.110  19.702  1.00 110.08 ? 1010 ALA A CB    1 
ATOM   7845  N  N     . GLN A 1  1011 ? 30.707  -66.683  17.771  1.00 107.56 ? 1011 GLN A N     1 
ATOM   7846  C  CA    . GLN A 1  1011 ? 31.363  -65.939  16.707  1.00 94.85  ? 1011 GLN A CA    1 
ATOM   7847  C  C     . GLN A 1  1011 ? 31.783  -66.863  15.568  1.00 95.58  ? 1011 GLN A C     1 
ATOM   7848  O  O     . GLN A 1  1011 ? 31.469  -66.605  14.400  1.00 118.24 ? 1011 GLN A O     1 
ATOM   7849  C  CB    . GLN A 1  1011 ? 32.566  -65.198  17.270  1.00 94.67  ? 1011 GLN A CB    1 
ATOM   7850  C  CG    . GLN A 1  1011 ? 33.531  -64.712  16.229  1.00 94.58  ? 1011 GLN A CG    1 
ATOM   7851  C  CD    . GLN A 1  1011 ? 32.983  -63.552  15.467  1.00 96.06  ? 1011 GLN A CD    1 
ATOM   7852  O  OE1   . GLN A 1  1011 ? 31.996  -62.952  15.873  1.00 133.94 ? 1011 GLN A OE1   1 
ATOM   7853  N  NE2   . GLN A 1  1011 ? 33.611  -63.221  14.356  1.00 99.26  ? 1011 GLN A NE2   1 
ATOM   7854  N  N     . ARG A 1  1012 ? 32.504  -67.946  15.888  1.00 96.51  ? 1012 ARG A N     1 
ATOM   7855  C  CA    . ARG A 1  1012 ? 32.912  -68.847  14.818  1.00 100.45 ? 1012 ARG A CA    1 
ATOM   7856  C  C     . ARG A 1  1012 ? 31.704  -69.459  14.131  1.00 126.99 ? 1012 ARG A C     1 
ATOM   7857  O  O     . ARG A 1  1012 ? 31.740  -69.731  12.916  1.00 135.39 ? 1012 ARG A O     1 
ATOM   7858  C  CB    . ARG A 1  1012 ? 33.839  -69.947  15.349  1.00 101.01 ? 1012 ARG A CB    1 
ATOM   7859  C  CG    . ARG A 1  1012 ? 35.239  -69.446  15.692  1.00 135.80 ? 1012 ARG A CG    1 
ATOM   7860  C  CD    . ARG A 1  1012 ? 36.066  -70.500  16.383  1.00 152.66 ? 1012 ARG A CD    1 
ATOM   7861  N  NE    . ARG A 1  1012 ? 36.392  -70.111  17.750  1.00 151.55 ? 1012 ARG A NE    1 
ATOM   7862  C  CZ    . ARG A 1  1012 ? 35.789  -70.606  18.814  1.00 140.19 ? 1012 ARG A CZ    1 
ATOM   7863  N  NH1   . ARG A 1  1012 ? 34.822  -71.505  18.652  1.00 145.06 ? 1012 ARG A NH1   1 
ATOM   7864  N  NH2   . ARG A 1  1012 ? 36.142  -70.225  20.039  1.00 117.27 ? 1012 ARG A NH2   1 
ATOM   7865  N  N     . ASP A 1  1013 ? 30.596  -69.588  14.861  1.00 97.21  ? 1013 ASP A N     1 
ATOM   7866  C  CA    . ASP A 1  1013 ? 29.370  -70.074  14.249  1.00 97.28  ? 1013 ASP A CA    1 
ATOM   7867  C  C     . ASP A 1  1013 ? 28.846  -69.050  13.256  1.00 110.30 ? 1013 ASP A C     1 
ATOM   7868  O  O     . ASP A 1  1013 ? 28.725  -69.330  12.055  1.00 118.25 ? 1013 ASP A O     1 
ATOM   7869  C  CB    . ASP A 1  1013 ? 28.311  -70.394  15.325  1.00 108.76 ? 1013 ASP A CB    1 
ATOM   7870  C  CG    . ASP A 1  1013 ? 28.566  -71.728  16.070  1.00 126.15 ? 1013 ASP A CG    1 
ATOM   7871  O  OD1   . ASP A 1  1013 ? 29.046  -72.699  15.447  1.00 138.01 ? 1013 ASP A OD1   1 
ATOM   7872  O  OD2   . ASP A 1  1013 ? 28.257  -71.819  17.282  1.00 129.34 ? 1013 ASP A OD2   1 
ATOM   7873  N  N     . ALA A 1  1014 ? 28.614  -67.824  13.726  1.00 96.20  ? 1014 ALA A N     1 
ATOM   7874  C  CA    . ALA A 1  1014 ? 28.035  -66.799  12.867  1.00 110.43 ? 1014 ALA A CA    1 
ATOM   7875  C  C     . ALA A 1  1014 ? 28.922  -66.435  11.681  1.00 99.23  ? 1014 ALA A C     1 
ATOM   7876  O  O     . ALA A 1  1014 ? 28.435  -65.862  10.697  1.00 101.40 ? 1014 ALA A O     1 
ATOM   7877  C  CB    . ALA A 1  1014 ? 27.736  -65.553  13.703  1.00 131.98 ? 1014 ALA A CB    1 
ATOM   7878  N  N     . VAL A 1  1015 ? 30.189  -66.820  11.714  1.00 114.75 ? 1015 VAL A N     1 
ATOM   7879  C  CA    . VAL A 1  1015 ? 31.148  -66.427  10.692  1.00 103.12 ? 1015 VAL A CA    1 
ATOM   7880  C  C     . VAL A 1  1015 ? 31.524  -67.608  9.789   1.00 129.47 ? 1015 VAL A C     1 
ATOM   7881  O  O     . VAL A 1  1015 ? 32.119  -67.395  8.710   1.00 97.17  ? 1015 VAL A O     1 
ATOM   7882  C  CB    . VAL A 1  1015 ? 32.366  -65.748  11.360  1.00 95.17  ? 1015 VAL A CB    1 
ATOM   7883  C  CG1   . VAL A 1  1015 ? 33.579  -65.772  10.547  1.00 115.44 ? 1015 VAL A CG1   1 
ATOM   7884  C  CG2   . VAL A 1  1015 ? 32.013  -64.308  11.699  1.00 94.11  ? 1015 VAL A CG2   1 
ATOM   7885  N  N     . THR A 1  1016 ? 31.086  -68.828  10.146  1.00 128.68 ? 1016 THR A N     1 
ATOM   7886  C  CA    . THR A 1  1016 ? 31.497  -70.067  9.480   1.00 110.17 ? 1016 THR A CA    1 
ATOM   7887  C  C     . THR A 1  1016 ? 31.278  -70.021  7.964   1.00 106.42 ? 1016 THR A C     1 
ATOM   7888  O  O     . THR A 1  1016 ? 32.211  -70.231  7.173   1.00 107.23 ? 1016 THR A O     1 
ATOM   7889  C  CB    . THR A 1  1016 ? 30.715  -71.241  10.093  1.00 98.78  ? 1016 THR A CB    1 
ATOM   7890  O  OG1   . THR A 1  1016 ? 31.216  -71.553  11.400  1.00 124.67 ? 1016 THR A OG1   1 
ATOM   7891  C  CG2   . THR A 1  1016 ? 30.758  -72.482  9.206   1.00 99.83  ? 1016 THR A CG2   1 
ATOM   7892  N  N     . LEU A 1  1017 ? 30.046  -69.749  7.534   1.00 118.72 ? 1017 LEU A N     1 
ATOM   7893  C  CA    . LEU A 1  1017 ? 29.753  -69.863  6.108   1.00 102.95 ? 1017 LEU A CA    1 
ATOM   7894  C  C     . LEU A 1  1017 ? 30.516  -68.817  5.305   1.00 109.68 ? 1017 LEU A C     1 
ATOM   7895  O  O     . LEU A 1  1017 ? 31.053  -69.116  4.223   1.00 102.72 ? 1017 LEU A O     1 
ATOM   7896  C  CB    . LEU A 1  1017 ? 28.251  -69.749  5.860   1.00 110.53 ? 1017 LEU A CB    1 
ATOM   7897  C  CG    . LEU A 1  1017 ? 27.863  -69.772  4.380   1.00 98.25  ? 1017 LEU A CG    1 
ATOM   7898  C  CD1   . LEU A 1  1017 ? 28.237  -71.085  3.724   1.00 99.20  ? 1017 LEU A CD1   1 
ATOM   7899  C  CD2   . LEU A 1  1017 ? 26.387  -69.514  4.243   1.00 97.60  ? 1017 LEU A CD2   1 
ATOM   7900  N  N     . PHE A 1  1018 ? 30.596  -67.585  5.828   1.00 117.09 ? 1018 PHE A N     1 
ATOM   7901  C  CA    . PHE A 1  1018 ? 31.307  -66.550  5.086   1.00 114.77 ? 1018 PHE A CA    1 
ATOM   7902  C  C     . PHE A 1  1018 ? 32.759  -66.952  4.916   1.00 97.00  ? 1018 PHE A C     1 
ATOM   7903  O  O     . PHE A 1  1018 ? 33.344  -66.753  3.848   1.00 99.62  ? 1018 PHE A O     1 
ATOM   7904  C  CB    . PHE A 1  1018 ? 31.223  -65.177  5.772   1.00 110.84 ? 1018 PHE A CB    1 
ATOM   7905  C  CG    . PHE A 1  1018 ? 31.961  -64.083  5.017   1.00 94.90  ? 1018 PHE A CG    1 
ATOM   7906  C  CD1   . PHE A 1  1018 ? 31.521  -63.659  3.774   1.00 94.80  ? 1018 PHE A CD1   1 
ATOM   7907  C  CD2   . PHE A 1  1018 ? 33.125  -63.531  5.517   1.00 94.70  ? 1018 PHE A CD2   1 
ATOM   7908  C  CE1   . PHE A 1  1018 ? 32.214  -62.691  3.067   1.00 103.61 ? 1018 PHE A CE1   1 
ATOM   7909  C  CE2   . PHE A 1  1018 ? 33.822  -62.564  4.797   1.00 94.38  ? 1018 PHE A CE2   1 
ATOM   7910  C  CZ    . PHE A 1  1018 ? 33.363  -62.151  3.577   1.00 98.55  ? 1018 PHE A CZ    1 
ATOM   7911  N  N     . CYS A 1  1019 ? 33.354  -67.539  5.961   1.00 97.34  ? 1019 CYS A N     1 
ATOM   7912  C  CA    . CYS A 1  1019 ? 34.743  -67.958  5.844   1.00 98.00  ? 1019 CYS A CA    1 
ATOM   7913  C  C     . CYS A 1  1019 ? 34.908  -69.071  4.822   1.00 104.35 ? 1019 CYS A C     1 
ATOM   7914  O  O     . CYS A 1  1019 ? 35.945  -69.147  4.153   1.00 99.50  ? 1019 CYS A O     1 
ATOM   7915  C  CB    . CYS A 1  1019 ? 35.267  -68.376  7.205   1.00 116.26 ? 1019 CYS A CB    1 
ATOM   7916  S  SG    . CYS A 1  1019 ? 35.467  -66.961  8.231   1.00 101.26 ? 1019 CYS A SG    1 
ATOM   7917  N  N     . CYS A 1  1020 ? 33.915  -69.957  4.700   1.00 112.17 ? 1020 CYS A N     1 
ATOM   7918  C  CA    . CYS A 1  1020 ? 33.967  -70.951  3.632   1.00 106.65 ? 1020 CYS A CA    1 
ATOM   7919  C  C     . CYS A 1  1020 ? 34.015  -70.288  2.261   1.00 108.18 ? 1020 CYS A C     1 
ATOM   7920  O  O     . CYS A 1  1020 ? 34.787  -70.701  1.383   1.00 105.13 ? 1020 CYS A O     1 
ATOM   7921  C  CB    . CYS A 1  1020 ? 32.769  -71.895  3.701   1.00 100.84 ? 1020 CYS A CB    1 
ATOM   7922  S  SG    . CYS A 1  1020 ? 32.683  -72.956  5.131   1.00 121.32 ? 1020 CYS A SG    1 
ATOM   7923  N  N     . LEU A 1  1021 ? 33.259  -69.203  2.084   1.00 99.34  ? 1021 LEU A N     1 
ATOM   7924  C  CA    . LEU A 1  1021 ? 33.371  -68.457  0.833   1.00 99.16  ? 1021 LEU A CA    1 
ATOM   7925  C  C     . LEU A 1  1021 ? 34.733  -67.790  0.683   1.00 108.16 ? 1021 LEU A C     1 
ATOM   7926  O  O     . LEU A 1  1021 ? 35.333  -67.816  -0.403  1.00 112.79 ? 1021 LEU A O     1 
ATOM   7927  C  CB    . LEU A 1  1021 ? 32.254  -67.415  0.745   1.00 98.20  ? 1021 LEU A CB    1 
ATOM   7928  C  CG    . LEU A 1  1021 ? 32.328  -66.499  -0.485  1.00 97.95  ? 1021 LEU A CG    1 
ATOM   7929  C  CD1   . LEU A 1  1021 ? 31.631  -67.063  -1.714  1.00 98.57  ? 1021 LEU A CD1   1 
ATOM   7930  C  CD2   . LEU A 1  1021 ? 31.772  -65.139  -0.164  1.00 96.83  ? 1021 LEU A CD2   1 
ATOM   7931  N  N     . LEU A 1  1022 ? 35.258  -67.233  1.770   1.00 98.49  ? 1022 LEU A N     1 
ATOM   7932  C  CA    . LEU A 1  1022 ? 36.519  -66.508  1.705   1.00 98.31  ? 1022 LEU A CA    1 
ATOM   7933  C  C     . LEU A 1  1022 ? 37.660  -67.438  1.317   1.00 107.39 ? 1022 LEU A C     1 
ATOM   7934  O  O     . LEU A 1  1022 ? 38.413  -67.155  0.378   1.00 111.64 ? 1022 LEU A O     1 
ATOM   7935  C  CB    . LEU A 1  1022 ? 36.776  -65.841  3.049   1.00 97.60  ? 1022 LEU A CB    1 
ATOM   7936  C  CG    . LEU A 1  1022 ? 38.045  -65.032  3.173   1.00 97.34  ? 1022 LEU A CG    1 
ATOM   7937  C  CD1   . LEU A 1  1022 ? 37.942  -63.830  2.265   1.00 131.39 ? 1022 LEU A CD1   1 
ATOM   7938  C  CD2   . LEU A 1  1022 ? 38.228  -64.618  4.612   1.00 96.82  ? 1022 LEU A CD2   1 
ATOM   7939  N  N     . ARG A 1  1023 ? 37.786  -68.565  2.015   1.00 104.26 ? 1023 ARG A N     1 
ATOM   7940  C  CA    . ARG A 1  1023 ? 38.851  -69.501  1.706   1.00 101.11 ? 1023 ARG A CA    1 
ATOM   7941  C  C     . ARG A 1  1023 ? 38.630  -70.076  0.321   1.00 101.83 ? 1023 ARG A C     1 
ATOM   7942  O  O     . ARG A 1  1023 ? 39.598  -70.366  -0.393  1.00 115.19 ? 1023 ARG A O     1 
ATOM   7943  C  CB    . ARG A 1  1023 ? 38.890  -70.644  2.722   1.00 101.75 ? 1023 ARG A CB    1 
ATOM   7944  C  CG    . ARG A 1  1023 ? 38.962  -70.220  4.165   1.00 101.14 ? 1023 ARG A CG    1 
ATOM   7945  C  CD    . ARG A 1  1023 ? 39.083  -71.435  5.075   1.00 101.95 ? 1023 ARG A CD    1 
ATOM   7946  N  NE    . ARG A 1  1023 ? 38.389  -71.186  6.324   1.00 112.01 ? 1023 ARG A NE    1 
ATOM   7947  C  CZ    . ARG A 1  1023 ? 37.260  -71.806  6.659   1.00 114.57 ? 1023 ARG A CZ    1 
ATOM   7948  N  NH1   . ARG A 1  1023 ? 36.750  -72.698  5.838   1.00 102.12 ? 1023 ARG A NH1   1 
ATOM   7949  N  NH2   . ARG A 1  1023 ? 36.646  -71.524  7.801   1.00 100.86 ? 1023 ARG A NH2   1 
ATOM   7950  N  N     . SER A 1  1024 ? 37.362  -70.207  -0.092  1.00 105.02 ? 1024 SER A N     1 
ATOM   7951  C  CA    . SER A 1  1024 ? 37.095  -70.767  -1.405  1.00 103.15 ? 1024 SER A CA    1 
ATOM   7952  C  C     . SER A 1  1024 ? 37.519  -69.827  -2.510  1.00 111.45 ? 1024 SER A C     1 
ATOM   7953  O  O     . SER A 1  1024 ? 37.850  -70.291  -3.607  1.00 110.16 ? 1024 SER A O     1 
ATOM   7954  C  CB    . SER A 1  1024 ? 35.591  -71.104  -1.556  1.00 122.58 ? 1024 SER A CB    1 
ATOM   7955  O  OG    . SER A 1  1024 ? 34.755  -69.985  -1.859  1.00 105.72 ? 1024 SER A OG    1 
ATOM   7956  N  N     . ARG A 1  1025 ? 37.638  -68.533  -2.218  1.00 117.84 ? 1025 ARG A N     1 
ATOM   7957  C  CA    . ARG A 1  1025 ? 37.990  -67.560  -3.246  1.00 110.67 ? 1025 ARG A CA    1 
ATOM   7958  C  C     . ARG A 1  1025 ? 39.389  -67.000  -3.115  1.00 107.17 ? 1025 ARG A C     1 
ATOM   7959  O  O     . ARG A 1  1025 ? 39.934  -66.536  -4.118  1.00 106.24 ? 1025 ARG A O     1 
ATOM   7960  C  CB    . ARG A 1  1025 ? 36.973  -66.409  -3.282  1.00 99.83  ? 1025 ARG A CB    1 
ATOM   7961  C  CG    . ARG A 1  1025 ? 35.574  -66.901  -3.580  1.00 99.94  ? 1025 ARG A CG    1 
ATOM   7962  C  CD    . ARG A 1  1025 ? 34.790  -65.897  -4.396  1.00 99.37  ? 1025 ARG A CD    1 
ATOM   7963  N  NE    . ARG A 1  1025 ? 33.554  -66.487  -4.891  1.00 99.69  ? 1025 ARG A NE    1 
ATOM   7964  C  CZ    . ARG A 1  1025 ? 32.593  -65.802  -5.495  1.00 129.60 ? 1025 ARG A CZ    1 
ATOM   7965  N  NH1   . ARG A 1  1025 ? 32.717  -64.492  -5.676  1.00 147.31 ? 1025 ARG A NH1   1 
ATOM   7966  N  NH2   . ARG A 1  1025 ? 31.499  -66.422  -5.910  1.00 142.36 ? 1025 ARG A NH2   1 
ATOM   7967  N  N     . LEU A 1  1026 ? 39.976  -67.040  -1.918  1.00 100.61 ? 1026 LEU A N     1 
ATOM   7968  C  CA    . LEU A 1  1026 ? 41.359  -66.626  -1.708  1.00 100.63 ? 1026 LEU A CA    1 
ATOM   7969  C  C     . LEU A 1  1026 ? 42.294  -67.820  -1.541  1.00 121.83 ? 1026 LEU A C     1 
ATOM   7970  O  O     . LEU A 1  1026 ? 43.314  -67.729  -0.850  1.00 120.61 ? 1026 LEU A O     1 
ATOM   7971  C  CB    . LEU A 1  1026 ? 41.451  -65.672  -0.515  1.00 99.63  ? 1026 LEU A CB    1 
ATOM   7972  C  CG    . LEU A 1  1026 ? 40.611  -64.400  -0.736  1.00 110.39 ? 1026 LEU A CG    1 
ATOM   7973  C  CD1   . LEU A 1  1026 ? 40.821  -63.332  0.335   1.00 97.62  ? 1026 LEU A CD1   1 
ATOM   7974  C  CD2   . LEU A 1  1026 ? 40.885  -63.822  -2.120  1.00 98.67  ? 1026 LEU A CD2   1 
ATOM   7975  N  N     . ALA A 1  1027 ? 41.967  -68.943  -2.177  1.00 130.02 ? 1027 ALA A N     1 
ATOM   7976  C  CA    . ALA A 1  1027 ? 42.893  -70.062  -2.206  1.00 118.61 ? 1027 ALA A CA    1 
ATOM   7977  C  C     . ALA A 1  1027 ? 44.128  -69.689  -3.017  1.00 116.21 ? 1027 ALA A C     1 
ATOM   7978  O  O     . ALA A 1  1027 ? 44.067  -68.872  -3.940  1.00 105.96 ? 1027 ALA A O     1 
ATOM   7979  C  CB    . ALA A 1  1027 ? 42.220  -71.287  -2.818  1.00 128.02 ? 1027 ALA A CB    1 
ATOM   7980  N  N     . THR A 1  1028 ? 45.246  -70.345  -2.697  1.00 111.01 ? 1028 THR A N     1 
ATOM   7981  C  CA    . THR A 1  1028 ? 46.549  -69.910  -3.202  1.00 111.74 ? 1028 THR A CA    1 
ATOM   7982  C  C     . THR A 1  1028 ? 46.611  -69.939  -4.726  1.00 105.72 ? 1028 THR A C     1 
ATOM   7983  O  O     . THR A 1  1028 ? 47.008  -68.954  -5.368  1.00 107.16 ? 1028 THR A O     1 
ATOM   7984  C  CB    . THR A 1  1028 ? 47.652  -70.770  -2.595  1.00 120.74 ? 1028 THR A CB    1 
ATOM   7985  O  OG1   . THR A 1  1028 ? 47.769  -70.462  -1.202  1.00 115.07 ? 1028 THR A OG1   1 
ATOM   7986  C  CG2   . THR A 1  1028 ? 48.983  -70.487  -3.275  1.00 120.53 ? 1028 THR A CG2   1 
ATOM   7987  N  N     . ARG A 1  1029 ? 46.207  -71.058  -5.327  1.00 107.11 ? 1029 ARG A N     1 
ATOM   7988  C  CA    . ARG A 1  1029 ? 46.294  -71.175  -6.778  1.00 115.72 ? 1029 ARG A CA    1 
ATOM   7989  C  C     . ARG A 1  1029 ? 45.339  -70.220  -7.467  1.00 115.77 ? 1029 ARG A C     1 
ATOM   7990  O  O     . ARG A 1  1029 ? 45.626  -69.748  -8.573  1.00 119.46 ? 1029 ARG A O     1 
ATOM   7991  C  CB    . ARG A 1  1029 ? 46.003  -72.599  -7.233  1.00 129.37 ? 1029 ARG A CB    1 
ATOM   7992  C  CG    . ARG A 1  1029 ? 46.245  -72.775  -8.721  1.00 137.43 ? 1029 ARG A CG    1 
ATOM   7993  C  CD    . ARG A 1  1029 ? 45.963  -74.174  -9.202  1.00 151.99 ? 1029 ARG A CD    1 
ATOM   7994  N  NE    . ARG A 1  1029 ? 47.034  -75.101  -8.879  1.00 139.50 ? 1029 ARG A NE    1 
ATOM   7995  C  CZ    . ARG A 1  1029 ? 48.229  -75.073  -9.449  1.00 144.78 ? 1029 ARG A CZ    1 
ATOM   7996  N  NH1   . ARG A 1  1029 ? 48.509  -74.162  -10.375 1.00 133.19 ? 1029 ARG A NH1   1 
ATOM   7997  N  NH2   . ARG A 1  1029 ? 49.143  -75.962  -9.098  1.00 162.49 ? 1029 ARG A NH2   1 
ATOM   7998  N  N     . ARG A 1  1030 ? 44.206  -69.904  -6.835  1.00 122.27 ? 1030 ARG A N     1 
ATOM   7999  C  CA    . ARG A 1  1030 ? 43.298  -68.920  -7.415  1.00 120.51 ? 1030 ARG A CA    1 
ATOM   8000  C  C     . ARG A 1  1030 ? 43.930  -67.534  -7.407  1.00 117.68 ? 1030 ARG A C     1 
ATOM   8001  O  O     . ARG A 1  1030 ? 43.991  -66.868  -8.447  1.00 104.07 ? 1030 ARG A O     1 
ATOM   8002  C  CB    . ARG A 1  1030 ? 41.976  -68.919  -6.648  1.00 104.19 ? 1030 ARG A CB    1 
ATOM   8003  C  CG    . ARG A 1  1030 ? 40.922  -69.834  -7.225  1.00 116.23 ? 1030 ARG A CG    1 
ATOM   8004  C  CD    . ARG A 1  1030 ? 39.521  -69.378  -6.840  1.00 120.14 ? 1030 ARG A CD    1 
ATOM   8005  N  NE    . ARG A 1  1030 ? 38.633  -69.317  -7.988  1.00 116.61 ? 1030 ARG A NE    1 
ATOM   8006  C  CZ    . ARG A 1  1030 ? 37.339  -69.048  -7.910  1.00 128.80 ? 1030 ARG A CZ    1 
ATOM   8007  N  NH1   . ARG A 1  1030 ? 36.775  -68.820  -6.727  1.00 124.78 ? 1030 ARG A NH1   1 
ATOM   8008  N  NH2   . ARG A 1  1030 ? 36.615  -68.967  -9.015  1.00 148.05 ? 1030 ARG A NH2   1 
ATOM   8009  N  N     . VAL A 1  1031 ? 44.479  -67.123  -6.252  1.00 110.23 ? 1031 VAL A N     1 
ATOM   8010  C  CA    . VAL A 1  1031 ? 45.098  -65.801  -6.104  1.00 102.60 ? 1031 VAL A CA    1 
ATOM   8011  C  C     . VAL A 1  1031 ? 46.252  -65.628  -7.068  1.00 123.64 ? 1031 VAL A C     1 
ATOM   8012  O  O     . VAL A 1  1031 ? 46.500  -64.519  -7.559  1.00 134.42 ? 1031 VAL A O     1 
ATOM   8013  C  CB    . VAL A 1  1031 ? 45.585  -65.596  -4.649  1.00 102.08 ? 1031 VAL A CB    1 
ATOM   8014  C  CG1   . VAL A 1  1031 ? 46.322  -64.282  -4.483  1.00 101.32 ? 1031 VAL A CG1   1 
ATOM   8015  C  CG2   . VAL A 1  1031 ? 44.429  -65.639  -3.677  1.00 129.14 ? 1031 VAL A CG2   1 
ATOM   8016  N  N     . LEU A 1  1032 ? 46.955  -66.716  -7.382  1.00 119.49 ? 1032 LEU A N     1 
ATOM   8017  C  CA    . LEU A 1  1032 ? 48.195  -66.606  -8.137  1.00 104.94 ? 1032 LEU A CA    1 
ATOM   8018  C  C     . LEU A 1  1032 ? 48.040  -66.892  -9.617  1.00 105.72 ? 1032 LEU A C     1 
ATOM   8019  O  O     . LEU A 1  1032 ? 48.800  -66.344  -10.423 1.00 138.78 ? 1032 LEU A O     1 
ATOM   8020  C  CB    . LEU A 1  1032 ? 49.252  -67.542  -7.551  1.00 105.77 ? 1032 LEU A CB    1 
ATOM   8021  C  CG    . LEU A 1  1032 ? 49.770  -67.037  -6.215  1.00 105.07 ? 1032 LEU A CG    1 
ATOM   8022  C  CD1   . LEU A 1  1032 ? 50.575  -68.112  -5.549  1.00 105.95 ? 1032 LEU A CD1   1 
ATOM   8023  C  CD2   . LEU A 1  1032 ? 50.607  -65.808  -6.456  1.00 104.52 ? 1032 LEU A CD2   1 
ATOM   8024  N  N     . GLN A 1  1033 ? 47.080  -67.728  -9.993  1.00 106.20 ? 1033 GLN A N     1 
ATOM   8025  C  CA    . GLN A 1  1033 ? 46.908  -68.136  -11.377 1.00 113.04 ? 1033 GLN A CA    1 
ATOM   8026  C  C     . GLN A 1  1033 ? 45.690  -67.520  -12.032 1.00 131.36 ? 1033 GLN A C     1 
ATOM   8027  O  O     . GLN A 1  1033 ? 45.720  -67.264  -13.236 1.00 154.36 ? 1033 GLN A O     1 
ATOM   8028  C  CB    . GLN A 1  1033 ? 46.805  -69.662  -11.470 1.00 128.10 ? 1033 GLN A CB    1 
ATOM   8029  C  CG    . GLN A 1  1033 ? 46.842  -70.210  -12.882 1.00 139.67 ? 1033 GLN A CG    1 
ATOM   8030  C  CD    . GLN A 1  1033 ? 47.063  -71.705  -12.913 1.00 139.55 ? 1033 GLN A CD    1 
ATOM   8031  O  OE1   . GLN A 1  1033 ? 46.511  -72.446  -12.097 1.00 142.73 ? 1033 GLN A OE1   1 
ATOM   8032  N  NE2   . GLN A 1  1033 ? 47.882  -72.156  -13.849 1.00 144.39 ? 1033 GLN A NE2   1 
ATOM   8033  N  N     . GLU A 1  1034 ? 44.623  -67.273  -11.273 1.00 121.54 ? 1034 GLU A N     1 
ATOM   8034  C  CA    . GLU A 1  1034 ? 43.456  -66.599  -11.828 1.00 111.82 ? 1034 GLU A CA    1 
ATOM   8035  C  C     . GLU A 1  1034 ? 43.579  -65.084  -11.659 1.00 128.21 ? 1034 GLU A C     1 
ATOM   8036  O  O     . GLU A 1  1034 ? 43.528  -64.342  -12.644 1.00 130.61 ? 1034 GLU A O     1 
ATOM   8037  C  CB    . GLU A 1  1034 ? 42.170  -67.117  -11.169 1.00 107.67 ? 1034 GLU A CB    1 
ATOM   8038  C  CG    . GLU A 1  1034 ? 42.159  -68.603  -10.835 1.00 109.82 ? 1034 GLU A CG    1 
ATOM   8039  C  CD    . GLU A 1  1034 ? 40.755  -69.202  -10.821 1.00 129.47 ? 1034 GLU A CD    1 
ATOM   8040  O  OE1   . GLU A 1  1034 ? 39.807  -68.553  -11.318 1.00 122.87 ? 1034 GLU A OE1   1 
ATOM   8041  O  OE2   . GLU A 1  1034 ? 40.599  -70.331  -10.312 1.00 132.27 ? 1034 GLU A OE2   1 
ATOM   8042  N  N     . TYR A 1  1035 ? 43.777  -64.615  -10.418 1.00 121.51 ? 1035 TYR A N     1 
ATOM   8043  C  CA    . TYR A 1  1035 ? 43.716  -63.181  -10.138 1.00 110.73 ? 1035 TYR A CA    1 
ATOM   8044  C  C     . TYR A 1  1035 ? 45.031  -62.470  -10.429 1.00 114.91 ? 1035 TYR A C     1 
ATOM   8045  O  O     . TYR A 1  1035 ? 45.019  -61.277  -10.751 1.00 131.84 ? 1035 TYR A O     1 
ATOM   8046  C  CB    . TYR A 1  1035 ? 43.327  -62.912  -8.676  1.00 109.79 ? 1035 TYR A CB    1 
ATOM   8047  C  CG    . TYR A 1  1035 ? 42.124  -63.678  -8.164  1.00 101.09 ? 1035 TYR A CG    1 
ATOM   8048  C  CD1   . TYR A 1  1035 ? 41.179  -64.188  -9.036  1.00 102.13 ? 1035 TYR A CD1   1 
ATOM   8049  C  CD2   . TYR A 1  1035 ? 41.941  -63.903  -6.803  1.00 100.65 ? 1035 TYR A CD2   1 
ATOM   8050  C  CE1   . TYR A 1  1035 ? 40.086  -64.911  -8.574  1.00 117.48 ? 1035 TYR A CE1   1 
ATOM   8051  C  CE2   . TYR A 1  1035 ? 40.842  -64.633  -6.332  1.00 104.56 ? 1035 TYR A CE2   1 
ATOM   8052  C  CZ    . TYR A 1  1035 ? 39.919  -65.131  -7.227  1.00 117.60 ? 1035 TYR A CZ    1 
ATOM   8053  O  OH    . TYR A 1  1035 ? 38.827  -65.854  -6.793  1.00 114.55 ? 1035 TYR A OH    1 
ATOM   8054  N  N     . ARG A 1  1036 ? 46.160  -63.168  -10.307 1.00 113.27 ? 1036 ARG A N     1 
ATOM   8055  C  CA    . ARG A 1  1036 ? 47.476  -62.576  -10.550 1.00 112.90 ? 1036 ARG A CA    1 
ATOM   8056  C  C     . ARG A 1  1036 ? 47.741  -61.409  -9.596  1.00 101.73 ? 1036 ARG A C     1 
ATOM   8057  O  O     . ARG A 1  1036 ? 48.299  -60.382  -9.982  1.00 102.35 ? 1036 ARG A O     1 
ATOM   8058  C  CB    . ARG A 1  1036 ? 47.621  -62.134  -12.009 1.00 108.20 ? 1036 ARG A CB    1 
ATOM   8059  C  CG    . ARG A 1  1036 ? 47.460  -63.254  -13.018 1.00 121.59 ? 1036 ARG A CG    1 
ATOM   8060  C  CD    . ARG A 1  1036 ? 48.368  -64.409  -12.685 1.00 145.05 ? 1036 ARG A CD    1 
ATOM   8061  N  NE    . ARG A 1  1036 ? 48.348  -65.403  -13.745 1.00 156.89 ? 1036 ARG A NE    1 
ATOM   8062  C  CZ    . ARG A 1  1036 ? 49.240  -65.443  -14.724 1.00 161.61 ? 1036 ARG A CZ    1 
ATOM   8063  N  NH1   . ARG A 1  1036 ? 50.212  -64.537  -14.761 1.00 160.12 ? 1036 ARG A NH1   1 
ATOM   8064  N  NH2   . ARG A 1  1036 ? 49.157  -66.381  -15.660 1.00 149.55 ? 1036 ARG A NH2   1 
ATOM   8065  N  N     . LEU A 1  1037 ? 47.371  -61.571  -8.329  1.00 101.21 ? 1037 LEU A N     1 
ATOM   8066  C  CA    . LEU A 1  1037 ? 47.467  -60.439  -7.420  1.00 112.99 ? 1037 LEU A CA    1 
ATOM   8067  C  C     . LEU A 1  1037 ? 48.909  -60.144  -7.002  1.00 108.72 ? 1037 LEU A C     1 
ATOM   8068  O  O     . LEU A 1  1037 ? 49.812  -60.977  -7.097  1.00 111.41 ? 1037 LEU A O     1 
ATOM   8069  C  CB    . LEU A 1  1037 ? 46.618  -60.678  -6.172  1.00 130.37 ? 1037 LEU A CB    1 
ATOM   8070  C  CG    . LEU A 1  1037 ? 45.116  -60.790  -6.397  1.00 118.91 ? 1037 LEU A CG    1 
ATOM   8071  C  CD1   . LEU A 1  1037 ? 44.402  -60.579  -5.084  1.00 115.01 ? 1037 LEU A CD1   1 
ATOM   8072  C  CD2   . LEU A 1  1037 ? 44.658  -59.777  -7.422  1.00 98.92  ? 1037 LEU A CD2   1 
ATOM   8073  N  N     . THR A 1  1038 ? 49.109  -58.915  -6.548  1.00 107.71 ? 1038 THR A N     1 
ATOM   8074  C  CA    . THR A 1  1038 ? 50.354  -58.446  -5.971  1.00 99.19  ? 1038 THR A CA    1 
ATOM   8075  C  C     . THR A 1  1038 ? 50.171  -58.370  -4.464  1.00 100.66 ? 1038 THR A C     1 
ATOM   8076  O  O     . THR A 1  1038 ? 49.056  -58.193  -3.972  1.00 124.44 ? 1038 THR A O     1 
ATOM   8077  C  CB    . THR A 1  1038 ? 50.708  -57.072  -6.543  1.00 108.63 ? 1038 THR A CB    1 
ATOM   8078  O  OG1   . THR A 1  1038 ? 50.800  -57.183  -7.966  1.00 119.86 ? 1038 THR A OG1   1 
ATOM   8079  C  CG2   . THR A 1  1038 ? 52.019  -56.522  -5.982  1.00 124.64 ? 1038 THR A CG2   1 
ATOM   8080  N  N     . LYS A 1  1039 ? 51.272  -58.513  -3.728  1.00 103.32 ? 1039 LYS A N     1 
ATOM   8081  C  CA    . LYS A 1  1039 ? 51.245  -58.229  -2.297  1.00 115.84 ? 1039 LYS A CA    1 
ATOM   8082  C  C     . LYS A 1  1039 ? 50.591  -56.881  -1.991  1.00 124.98 ? 1039 LYS A C     1 
ATOM   8083  O  O     . LYS A 1  1039 ? 49.891  -56.741  -0.974  1.00 112.05 ? 1039 LYS A O     1 
ATOM   8084  C  CB    . LYS A 1  1039 ? 52.676  -58.317  -1.755  1.00 102.06 ? 1039 LYS A CB    1 
ATOM   8085  C  CG    . LYS A 1  1039 ? 52.905  -57.768  -0.362  1.00 102.92 ? 1039 LYS A CG    1 
ATOM   8086  C  CD    . LYS A 1  1039 ? 52.377  -58.661  0.733   1.00 99.74  ? 1039 LYS A CD    1 
ATOM   8087  C  CE    . LYS A 1  1039 ? 52.705  -58.070  2.098   1.00 108.31 ? 1039 LYS A CE    1 
ATOM   8088  N  NZ    . LYS A 1  1039 ? 51.955  -58.753  3.189   1.00 121.84 ? 1039 LYS A NZ    1 
ATOM   8089  N  N     . GLN A 1  1040 ? 50.717  -55.921  -2.909  1.00 129.34 ? 1040 GLN A N     1 
ATOM   8090  C  CA    . GLN A 1  1040 ? 49.976  -54.666  -2.823  1.00 111.27 ? 1040 GLN A CA    1 
ATOM   8091  C  C     . GLN A 1  1040 ? 48.479  -54.904  -2.930  1.00 101.85 ? 1040 GLN A C     1 
ATOM   8092  O  O     . GLN A 1  1040 ? 47.716  -54.661  -1.982  1.00 120.98 ? 1040 GLN A O     1 
ATOM   8093  C  CB    . GLN A 1  1040 ? 50.424  -53.726  -3.942  1.00 119.08 ? 1040 GLN A CB    1 
ATOM   8094  C  CG    . GLN A 1  1040 ? 50.636  -52.282  -3.517  1.00 123.44 ? 1040 GLN A CG    1 
ATOM   8095  C  CD    . GLN A 1  1040 ? 50.743  -51.361  -4.705  1.00 122.27 ? 1040 GLN A CD    1 
ATOM   8096  O  OE1   . GLN A 1  1040 ? 50.893  -51.812  -5.842  1.00 117.12 ? 1040 GLN A OE1   1 
ATOM   8097  N  NE2   . GLN A 1  1040 ? 50.659  -50.063  -4.454  1.00 118.30 ? 1040 GLN A NE2   1 
ATOM   8098  N  N     . ALA A 1  1041 ? 48.046  -55.396  -4.089  1.00 96.01  ? 1041 ALA A N     1 
ATOM   8099  C  CA    . ALA A 1  1041 ? 46.620  -55.577  -4.335  1.00 116.70 ? 1041 ALA A CA    1 
ATOM   8100  C  C     . ALA A 1  1041 ? 46.007  -56.547  -3.332  1.00 117.37 ? 1041 ALA A C     1 
ATOM   8101  O  O     . ALA A 1  1041 ? 44.853  -56.384  -2.925  1.00 125.20 ? 1041 ALA A O     1 
ATOM   8102  C  CB    . ALA A 1  1041 ? 46.395  -56.073  -5.766  1.00 99.38  ? 1041 ALA A CB    1 
ATOM   8103  N  N     . PHE A 1  1042 ? 46.757  -57.573  -2.943  1.00 109.57 ? 1042 PHE A N     1 
ATOM   8104  C  CA    . PHE A 1  1042 ? 46.259  -58.556  -1.990  1.00 96.73  ? 1042 PHE A CA    1 
ATOM   8105  C  C     . PHE A 1  1042 ? 46.031  -57.934  -0.612  1.00 108.35 ? 1042 PHE A C     1 
ATOM   8106  O  O     . PHE A 1  1042 ? 44.954  -58.090  -0.025  1.00 127.21 ? 1042 PHE A O     1 
ATOM   8107  C  CB    . PHE A 1  1042 ? 47.245  -59.724  -1.907  1.00 97.73  ? 1042 PHE A CB    1 
ATOM   8108  C  CG    . PHE A 1  1042 ? 46.821  -60.832  -0.977  1.00 104.89 ? 1042 PHE A CG    1 
ATOM   8109  C  CD1   . PHE A 1  1042 ? 46.039  -61.875  -1.433  1.00 98.63  ? 1042 PHE A CD1   1 
ATOM   8110  C  CD2   . PHE A 1  1042 ? 47.219  -60.839  0.350   1.00 106.09 ? 1042 PHE A CD2   1 
ATOM   8111  C  CE1   . PHE A 1  1042 ? 45.661  -62.892  -0.584  1.00 98.97  ? 1042 PHE A CE1   1 
ATOM   8112  C  CE2   . PHE A 1  1042 ? 46.834  -61.855  1.198   1.00 100.18 ? 1042 PHE A CE2   1 
ATOM   8113  C  CZ    . PHE A 1  1042 ? 46.057  -62.874  0.731   1.00 98.74  ? 1042 PHE A CZ    1 
ATOM   8114  N  N     . ASP A 1  1043 ? 47.037  -57.223  -0.076  1.00 109.64 ? 1043 ASP A N     1 
ATOM   8115  C  CA    . ASP A 1  1043 ? 46.860  -56.544  1.211   1.00 104.50 ? 1043 ASP A CA    1 
ATOM   8116  C  C     . ASP A 1  1043 ? 45.698  -55.561  1.173   1.00 109.47 ? 1043 ASP A C     1 
ATOM   8117  O  O     . ASP A 1  1043 ? 44.941  -55.427  2.154   1.00 108.17 ? 1043 ASP A O     1 
ATOM   8118  C  CB    . ASP A 1  1043 ? 48.140  -55.787  1.578   1.00 109.15 ? 1043 ASP A CB    1 
ATOM   8119  C  CG    . ASP A 1  1043 ? 49.217  -56.685  2.166   1.00 105.11 ? 1043 ASP A CG    1 
ATOM   8120  O  OD1   . ASP A 1  1043 ? 49.123  -57.921  2.019   1.00 124.56 ? 1043 ASP A OD1   1 
ATOM   8121  O  OD2   . ASP A 1  1043 ? 50.177  -56.150  2.766   1.00 98.05  ? 1043 ASP A OD2   1 
ATOM   8122  N  N     . TRP A 1  1044 ? 45.476  -54.958  0.009   1.00 110.12 ? 1044 TRP A N     1 
ATOM   8123  C  CA    . TRP A 1  1044 ? 44.391  -54.001  -0.141  1.00 108.41 ? 1044 TRP A CA    1 
ATOM   8124  C  C     . TRP A 1  1044 ? 43.038  -54.710  -0.185  1.00 104.50 ? 1044 TRP A C     1 
ATOM   8125  O  O     . TRP A 1  1044 ? 42.057  -54.218  0.391   1.00 121.69 ? 1044 TRP A O     1 
ATOM   8126  C  CB    . TRP A 1  1044 ? 44.664  -53.162  -1.396  1.00 108.21 ? 1044 TRP A CB    1 
ATOM   8127  C  CG    . TRP A 1  1044 ? 43.675  -52.098  -1.715  1.00 113.61 ? 1044 TRP A CG    1 
ATOM   8128  C  CD1   . TRP A 1  1044 ? 43.698  -50.807  -1.282  1.00 123.93 ? 1044 TRP A CD1   1 
ATOM   8129  C  CD2   . TRP A 1  1044 ? 42.555  -52.204  -2.593  1.00 112.40 ? 1044 TRP A CD2   1 
ATOM   8130  N  NE1   . TRP A 1  1044 ? 42.635  -50.114  -1.802  1.00 115.16 ? 1044 TRP A NE1   1 
ATOM   8131  C  CE2   . TRP A 1  1044 ? 41.922  -50.950  -2.616  1.00 95.39  ? 1044 TRP A CE2   1 
ATOM   8132  C  CE3   . TRP A 1  1044 ? 42.013  -53.243  -3.349  1.00 127.00 ? 1044 TRP A CE3   1 
ATOM   8133  C  CZ2   . TRP A 1  1044 ? 40.786  -50.708  -3.366  1.00 107.21 ? 1044 TRP A CZ2   1 
ATOM   8134  C  CZ3   . TRP A 1  1044 ? 40.869  -52.995  -4.095  1.00 98.68  ? 1044 TRP A CZ3   1 
ATOM   8135  C  CH2   . TRP A 1  1044 ? 40.275  -51.745  -4.095  1.00 96.17  ? 1044 TRP A CH2   1 
ATOM   8136  N  N     . VAL A 1  1045 ? 42.982  -55.890  -0.819  1.00 109.89 ? 1045 VAL A N     1 
ATOM   8137  C  CA    . VAL A 1  1045 ? 41.763  -56.705  -0.835  1.00 106.40 ? 1045 VAL A CA    1 
ATOM   8138  C  C     . VAL A 1  1045 ? 41.406  -57.154  0.577   1.00 93.88  ? 1045 VAL A C     1 
ATOM   8139  O  O     . VAL A 1  1045 ? 40.229  -57.206  0.950   1.00 112.82 ? 1045 VAL A O     1 
ATOM   8140  C  CB    . VAL A 1  1045 ? 41.933  -57.919  -1.780  1.00 95.12  ? 1045 VAL A CB    1 
ATOM   8141  C  CG1   . VAL A 1  1045 ? 40.834  -58.953  -1.567  1.00 95.39  ? 1045 VAL A CG1   1 
ATOM   8142  C  CG2   . VAL A 1  1045 ? 41.951  -57.506  -3.249  1.00 95.34  ? 1045 VAL A CG2   1 
ATOM   8143  N  N     . LEU A 1  1046 ? 42.408  -57.521  1.373   1.00 94.15  ? 1046 LEU A N     1 
ATOM   8144  C  CA    . LEU A 1  1046 ? 42.125  -57.955  2.736   1.00 94.02  ? 1046 LEU A CA    1 
ATOM   8145  C  C     . LEU A 1  1046 ? 41.569  -56.806  3.564   1.00 104.19 ? 1046 LEU A C     1 
ATOM   8146  O  O     . LEU A 1  1046 ? 40.601  -56.983  4.321   1.00 121.30 ? 1046 LEU A O     1 
ATOM   8147  C  CB    . LEU A 1  1046 ? 43.379  -58.538  3.394   1.00 124.66 ? 1046 LEU A CB    1 
ATOM   8148  C  CG    . LEU A 1  1046 ? 43.932  -59.865  2.862   1.00 95.65  ? 1046 LEU A CG    1 
ATOM   8149  C  CD1   . LEU A 1  1046 ? 44.704  -60.616  3.946   1.00 96.14  ? 1046 LEU A CD1   1 
ATOM   8150  C  CD2   . LEU A 1  1046 ? 42.812  -60.702  2.291   1.00 95.98  ? 1046 LEU A CD2   1 
ATOM   8151  N  N     . SER A 1  1047 ? 42.155  -55.608  3.422   1.00 116.72 ? 1047 SER A N     1 
ATOM   8152  C  CA    . SER A 1  1047 ? 41.658  -54.479  4.209   1.00 115.33 ? 1047 SER A CA    1 
ATOM   8153  C  C     . SER A 1  1047 ? 40.249  -54.089  3.784   1.00 108.85 ? 1047 SER A C     1 
ATOM   8154  O  O     . SER A 1  1047 ? 39.396  -53.799  4.637   1.00 123.95 ? 1047 SER A O     1 
ATOM   8155  C  CB    . SER A 1  1047 ? 42.597  -53.277  4.097   1.00 124.46 ? 1047 SER A CB    1 
ATOM   8156  O  OG    . SER A 1  1047 ? 43.680  -53.372  5.010   1.00 155.50 ? 1047 SER A OG    1 
ATOM   8157  N  N     . ASN A 1  1048 ? 39.958  -54.141  2.481   1.00 101.97 ? 1048 ASN A N     1 
ATOM   8158  C  CA    . ASN A 1  1048 ? 38.606  -53.816  2.022   1.00 96.20  ? 1048 ASN A CA    1 
ATOM   8159  C  C     . ASN A 1  1048 ? 37.589  -54.851  2.486   1.00 91.27  ? 1048 ASN A C     1 
ATOM   8160  O  O     . ASN A 1  1048 ? 36.484  -54.494  2.904   1.00 105.99 ? 1048 ASN A O     1 
ATOM   8161  C  CB    . ASN A 1  1048 ? 38.589  -53.669  0.501   1.00 91.37  ? 1048 ASN A CB    1 
ATOM   8162  C  CG    . ASN A 1  1048 ? 38.681  -52.221  0.058   1.00 125.08 ? 1048 ASN A CG    1 
ATOM   8163  O  OD1   . ASN A 1  1048 ? 38.022  -51.345  0.618   1.00 149.55 ? 1048 ASN A OD1   1 
ATOM   8164  N  ND2   . ASN A 1  1048 ? 39.563  -51.950  -0.892  1.00 117.53 ? 1048 ASN A ND2   1 
ATOM   8165  N  N     . ILE A 1  1049 ? 37.935  -56.135  2.422   1.00 109.11 ? 1049 ILE A N     1 
ATOM   8166  C  CA    . ILE A 1  1049 ? 37.023  -57.170  2.909   1.00 103.74 ? 1049 ILE A CA    1 
ATOM   8167  C  C     . ILE A 1  1049 ? 36.706  -56.950  4.385   1.00 91.79  ? 1049 ILE A C     1 
ATOM   8168  O  O     . ILE A 1  1049 ? 35.543  -57.002  4.800   1.00 95.28  ? 1049 ILE A O     1 
ATOM   8169  C  CB    . ILE A 1  1049 ? 37.611  -58.576  2.662   1.00 105.16 ? 1049 ILE A CB    1 
ATOM   8170  C  CG1   . ILE A 1  1049 ? 37.506  -58.975  1.194   1.00 93.85  ? 1049 ILE A CG1   1 
ATOM   8171  C  CG2   . ILE A 1  1049 ? 36.916  -59.612  3.507   1.00 113.71 ? 1049 ILE A CG2   1 
ATOM   8172  C  CD1   . ILE A 1  1049 ? 38.009  -60.362  0.910   1.00 94.87  ? 1049 ILE A CD1   1 
ATOM   8173  N  N     . GLU A 1  1050 ? 37.726  -56.653  5.196   1.00 98.37  ? 1050 GLU A N     1 
ATOM   8174  C  CA    . GLU A 1  1050 ? 37.460  -56.405  6.611   1.00 95.75  ? 1050 GLU A CA    1 
ATOM   8175  C  C     . GLU A 1  1050 ? 36.564  -55.184  6.788   1.00 112.49 ? 1050 GLU A C     1 
ATOM   8176  O  O     . GLU A 1  1050 ? 35.596  -55.215  7.567   1.00 90.07  ? 1050 GLU A O     1 
ATOM   8177  C  CB    . GLU A 1  1050 ? 38.781  -56.233  7.370   1.00 91.36  ? 1050 GLU A CB    1 
ATOM   8178  C  CG    . GLU A 1  1050 ? 38.654  -56.314  8.884   1.00 91.17  ? 1050 GLU A CG    1 
ATOM   8179  C  CD    . GLU A 1  1050 ? 39.886  -55.820  9.614   1.00 112.61 ? 1050 GLU A CD    1 
ATOM   8180  O  OE1   . GLU A 1  1050 ? 41.006  -55.935  9.070   1.00 145.84 ? 1050 GLU A OE1   1 
ATOM   8181  O  OE2   . GLU A 1  1050 ? 39.730  -55.307  10.738  1.00 117.64 ? 1050 GLU A OE2   1 
ATOM   8182  N  N     . ALA A 1  1051 ? 36.788  -54.149  5.977   1.00 104.86 ? 1051 ALA A N     1 
ATOM   8183  C  CA    . ALA A 1  1051 ? 35.994  -52.935  6.112   1.00 103.99 ? 1051 ALA A CA    1 
ATOM   8184  C  C     . ALA A 1  1051 ? 34.537  -53.195  5.756   1.00 105.06 ? 1051 ALA A C     1 
ATOM   8185  O  O     . ALA A 1  1051 ? 33.635  -52.944  6.565   1.00 111.82 ? 1051 ALA A O     1 
ATOM   8186  C  CB    . ALA A 1  1051 ? 36.580  -51.832  5.234   1.00 115.01 ? 1051 ALA A CB    1 
ATOM   8187  N  N     . GLN A 1  1052 ? 34.285  -53.724  4.553   1.00 100.06 ? 1052 GLN A N     1 
ATOM   8188  C  CA    . GLN A 1  1052 ? 32.911  -53.926  4.103   1.00 98.17  ? 1052 GLN A CA    1 
ATOM   8189  C  C     . GLN A 1  1052 ? 32.188  -54.949  4.961   1.00 100.51 ? 1052 GLN A C     1 
ATOM   8190  O  O     . GLN A 1  1052 ? 30.966  -54.850  5.161   1.00 124.26 ? 1052 GLN A O     1 
ATOM   8191  C  CB    . GLN A 1  1052 ? 32.910  -54.367  2.636   1.00 90.10  ? 1052 GLN A CB    1 
ATOM   8192  C  CG    . GLN A 1  1052 ? 33.684  -53.435  1.716   1.00 93.01  ? 1052 GLN A CG    1 
ATOM   8193  C  CD    . GLN A 1  1052 ? 33.508  -53.747  0.244   1.00 100.11 ? 1052 GLN A CD    1 
ATOM   8194  O  OE1   . GLN A 1  1052 ? 32.850  -54.709  -0.126  1.00 95.13  ? 1052 GLN A OE1   1 
ATOM   8195  N  NE2   . GLN A 1  1052 ? 34.064  -52.897  -0.605  1.00 140.16 ? 1052 GLN A NE2   1 
ATOM   8196  N  N     . PHE A 1  1053 ? 32.937  -55.872  5.555   1.00 95.79  ? 1053 PHE A N     1 
ATOM   8197  C  CA    . PHE A 1  1053 ? 32.330  -56.833  6.459   1.00 90.46  ? 1053 PHE A CA    1 
ATOM   8198  C  C     . PHE A 1  1053 ? 31.817  -56.115  7.696   1.00 95.24  ? 1053 PHE A C     1 
ATOM   8199  O  O     . PHE A 1  1053 ? 30.636  -56.214  8.045   1.00 106.98 ? 1053 PHE A O     1 
ATOM   8200  C  CB    . PHE A 1  1053 ? 33.323  -57.938  6.824   1.00 91.18  ? 1053 PHE A CB    1 
ATOM   8201  C  CG    . PHE A 1  1053 ? 32.723  -59.027  7.649   1.00 91.54  ? 1053 PHE A CG    1 
ATOM   8202  C  CD1   . PHE A 1  1053 ? 32.140  -60.121  7.050   1.00 92.14  ? 1053 PHE A CD1   1 
ATOM   8203  C  CD2   . PHE A 1  1053 ? 32.702  -58.941  9.024   1.00 101.46 ? 1053 PHE A CD2   1 
ATOM   8204  C  CE1   . PHE A 1  1053 ? 31.566  -61.110  7.816   1.00 92.49  ? 1053 PHE A CE1   1 
ATOM   8205  C  CE2   . PHE A 1  1053 ? 32.128  -59.929  9.787   1.00 94.00  ? 1053 PHE A CE2   1 
ATOM   8206  C  CZ    . PHE A 1  1053 ? 31.568  -61.009  9.185   1.00 92.24  ? 1053 PHE A CZ    1 
ATOM   8207  N  N     . LEU A 1  1054 ? 32.693  -55.383  8.382   1.00 92.99  ? 1054 LEU A N     1 
ATOM   8208  C  CA    . LEU A 1  1054 ? 32.228  -54.694  9.578   1.00 88.88  ? 1054 LEU A CA    1 
ATOM   8209  C  C     . LEU A 1  1054 ? 31.090  -53.727  9.263   1.00 103.96 ? 1054 LEU A C     1 
ATOM   8210  O  O     . LEU A 1  1054 ? 30.178  -53.564  10.082  1.00 89.63  ? 1054 LEU A O     1 
ATOM   8211  C  CB    . LEU A 1  1054 ? 33.391  -53.962  10.223  1.00 92.25  ? 1054 LEU A CB    1 
ATOM   8212  C  CG    . LEU A 1  1054 ? 34.491  -54.893  10.681  1.00 89.30  ? 1054 LEU A CG    1 
ATOM   8213  C  CD1   . LEU A 1  1054 ? 35.777  -54.144  10.695  1.00 89.19  ? 1054 LEU A CD1   1 
ATOM   8214  C  CD2   . LEU A 1  1054 ? 34.133  -55.355  12.071  1.00 89.35  ? 1054 LEU A CD2   1 
ATOM   8215  N  N     . ARG A 1  1055 ? 31.101  -53.116  8.069   1.00 99.65  ? 1055 ARG A N     1 
ATOM   8216  C  CA    . ARG A 1  1055 ? 29.995  -52.263  7.639   1.00 99.75  ? 1055 ARG A CA    1 
ATOM   8217  C  C     . ARG A 1  1055 ? 28.706  -53.037  7.441   1.00 106.85 ? 1055 ARG A C     1 
ATOM   8218  O  O     . ARG A 1  1055 ? 27.626  -52.424  7.476   1.00 112.13 ? 1055 ARG A O     1 
ATOM   8219  C  CB    . ARG A 1  1055 ? 30.305  -51.532  6.331   1.00 97.29  ? 1055 ARG A CB    1 
ATOM   8220  C  CG    . ARG A 1  1055 ? 31.127  -50.270  6.452   1.00 106.69 ? 1055 ARG A CG    1 
ATOM   8221  C  CD    . ARG A 1  1055 ? 31.544  -49.766  5.080   1.00 104.64 ? 1055 ARG A CD    1 
ATOM   8222  N  NE    . ARG A 1  1055 ? 32.800  -49.037  5.180   1.00 142.33 ? 1055 ARG A NE    1 
ATOM   8223  C  CZ    . ARG A 1  1055 ? 33.676  -48.935  4.190   1.00 162.98 ? 1055 ARG A CZ    1 
ATOM   8224  N  NH1   . ARG A 1  1055 ? 33.424  -49.527  3.032   1.00 166.19 ? 1055 ARG A NH1   1 
ATOM   8225  N  NH2   . ARG A 1  1055 ? 34.803  -48.254  4.359   1.00 165.09 ? 1055 ARG A NH2   1 
ATOM   8226  N  N     . SER A 1  1056 ? 28.791  -54.355  7.216   1.00 92.85  ? 1056 SER A N     1 
ATOM   8227  C  CA    . SER A 1  1056 ? 27.607  -55.143  6.876   1.00 104.02 ? 1056 SER A CA    1 
ATOM   8228  C  C     . SER A 1  1056 ? 26.875  -55.699  8.098   1.00 88.72  ? 1056 SER A C     1 
ATOM   8229  O  O     . SER A 1  1056 ? 25.755  -56.191  7.954   1.00 88.84  ? 1056 SER A O     1 
ATOM   8230  C  CB    . SER A 1  1056 ? 27.971  -56.299  5.932   1.00 89.56  ? 1056 SER A CB    1 
ATOM   8231  O  OG    . SER A 1  1056 ? 28.328  -55.831  4.635   1.00 96.17  ? 1056 SER A OG    1 
ATOM   8232  N  N     . VAL A 1  1057 ? 27.449  -55.603  9.297   1.00 93.15  ? 1057 VAL A N     1 
ATOM   8233  C  CA    . VAL A 1  1057 ? 26.759  -56.074  10.494  1.00 88.56  ? 1057 VAL A CA    1 
ATOM   8234  C  C     . VAL A 1  1057 ? 25.578  -55.155  10.801  1.00 100.77 ? 1057 VAL A C     1 
ATOM   8235  O  O     . VAL A 1  1057 ? 25.595  -53.961  10.470  1.00 138.43 ? 1057 VAL A O     1 
ATOM   8236  C  CB    . VAL A 1  1057 ? 27.751  -56.139  11.671  1.00 88.61  ? 1057 VAL A CB    1 
ATOM   8237  C  CG1   . VAL A 1  1057 ? 27.077  -56.616  12.931  1.00 88.64  ? 1057 VAL A CG1   1 
ATOM   8238  C  CG2   . VAL A 1  1057 ? 28.890  -57.085  11.332  1.00 89.31  ? 1057 VAL A CG2   1 
ATOM   8239  N  N     . VAL A 1  1058 ? 24.512  -55.728  11.384  1.00 87.98  ? 1058 VAL A N     1 
ATOM   8240  C  CA    . VAL A 1  1058 ? 23.350  -54.931  11.790  1.00 98.07  ? 1058 VAL A CA    1 
ATOM   8241  C  C     . VAL A 1  1058 ? 23.745  -53.935  12.877  1.00 108.06 ? 1058 VAL A C     1 
ATOM   8242  O  O     . VAL A 1  1058 ? 24.594  -54.216  13.734  1.00 108.77 ? 1058 VAL A O     1 
ATOM   8243  C  CB    . VAL A 1  1058 ? 22.187  -55.798  12.305  1.00 97.02  ? 1058 VAL A CB    1 
ATOM   8244  C  CG1   . VAL A 1  1058 ? 21.408  -56.384  11.175  1.00 87.97  ? 1058 VAL A CG1   1 
ATOM   8245  C  CG2   . VAL A 1  1058 ? 22.712  -56.884  13.221  1.00 113.40 ? 1058 VAL A CG2   1 
ATOM   8246  N  N     . HIS A 1  1059 ? 23.048  -52.791  12.895  1.00 97.62  ? 1059 HIS A N     1 
ATOM   8247  C  CA    . HIS A 1  1059 ? 23.229  -51.788  13.939  1.00 86.04  ? 1059 HIS A CA    1 
ATOM   8248  C  C     . HIS A 1  1059 ? 22.190  -52.005  15.033  1.00 85.78  ? 1059 HIS A C     1 
ATOM   8249  O  O     . HIS A 1  1059 ? 20.986  -51.937  14.748  1.00 105.66 ? 1059 HIS A O     1 
ATOM   8250  C  CB    . HIS A 1  1059 ? 23.099  -50.372  13.378  1.00 91.66  ? 1059 HIS A CB    1 
ATOM   8251  C  CG    . HIS A 1  1059 ? 23.984  -50.070  12.206  1.00 85.38  ? 1059 HIS A CG    1 
ATOM   8252  N  ND1   . HIS A 1  1059 ? 24.833  -48.984  12.190  1.00 85.05  ? 1059 HIS A ND1   1 
ATOM   8253  C  CD2   . HIS A 1  1059 ? 24.156  -50.698  11.018  1.00 106.82 ? 1059 HIS A CD2   1 
ATOM   8254  C  CE1   . HIS A 1  1059 ? 25.487  -48.954  11.041  1.00 118.16 ? 1059 HIS A CE1   1 
ATOM   8255  N  NE2   . HIS A 1  1059 ? 25.100  -49.988  10.315  1.00 117.82 ? 1059 HIS A NE2   1 
ATOM   8256  N  N     . PRO A 1  1060 ? 22.597  -52.271  16.268  1.00 85.89  ? 1060 PRO A N     1 
ATOM   8257  C  CA    . PRO A 1  1060 ? 21.644  -52.348  17.376  1.00 85.80  ? 1060 PRO A CA    1 
ATOM   8258  C  C     . PRO A 1  1060 ? 20.691  -51.173  17.379  1.00 86.66  ? 1060 PRO A C     1 
ATOM   8259  O  O     . PRO A 1  1060 ? 21.118  -50.012  17.344  1.00 84.82  ? 1060 PRO A O     1 
ATOM   8260  C  CB    . PRO A 1  1060 ? 22.540  -52.330  18.620  1.00 85.90  ? 1060 PRO A CB    1 
ATOM   8261  C  CG    . PRO A 1  1060 ? 23.911  -52.387  18.130  1.00 86.08  ? 1060 PRO A CG    1 
ATOM   8262  C  CD    . PRO A 1  1060 ? 23.922  -52.712  16.684  1.00 86.22  ? 1060 PRO A CD    1 
ATOM   8263  N  N     . GLY A 1  1061 ? 19.402  -51.478  17.291  1.00 94.10  ? 1061 GLY A N     1 
ATOM   8264  C  CA    . GLY A 1  1061 ? 18.393  -50.458  17.170  1.00 84.79  ? 1061 GLY A CA    1 
ATOM   8265  C  C     . GLY A 1  1061 ? 17.463  -50.755  16.024  1.00 97.42  ? 1061 GLY A C     1 
ATOM   8266  O  O     . GLY A 1  1061 ? 16.295  -50.360  16.069  1.00 117.79 ? 1061 GLY A O     1 
ATOM   8267  N  N     . GLU A 1  1062 ? 17.945  -51.510  15.030  1.00 85.24  ? 1062 GLU A N     1 
ATOM   8268  C  CA    . GLU A 1  1062 ? 17.092  -51.897  13.910  1.00 86.69  ? 1062 GLU A CA    1 
ATOM   8269  C  C     . GLU A 1  1062 ? 15.833  -52.548  14.425  1.00 100.52 ? 1062 GLU A C     1 
ATOM   8270  O  O     . GLU A 1  1062 ? 15.886  -53.523  15.179  1.00 95.16  ? 1062 GLU A O     1 
ATOM   8271  C  CB    . GLU A 1  1062 ? 17.820  -52.850  12.966  1.00 85.92  ? 1062 GLU A CB    1 
ATOM   8272  C  CG    . GLU A 1  1062 ? 18.756  -52.160  11.984  1.00 111.53 ? 1062 GLU A CG    1 
ATOM   8273  C  CD    . GLU A 1  1062 ? 18.019  -51.550  10.824  1.00 112.88 ? 1062 GLU A CD    1 
ATOM   8274  O  OE1   . GLU A 1  1062 ? 17.128  -52.228  10.273  1.00 91.85  ? 1062 GLU A OE1   1 
ATOM   8275  O  OE2   . GLU A 1  1062 ? 18.306  -50.385  10.485  1.00 124.91 ? 1062 GLU A OE2   1 
ATOM   8276  N  N     . MET A 1  1063 ? 14.696  -51.939  14.096  1.00 86.61  ? 1063 MET A N     1 
ATOM   8277  C  CA    . MET A 1  1063 ? 13.414  -52.498  14.494  1.00 85.46  ? 1063 MET A CA    1 
ATOM   8278  C  C     . MET A 1  1063 ? 13.118  -53.635  13.513  1.00 90.92  ? 1063 MET A C     1 
ATOM   8279  O  O     . MET A 1  1063 ? 12.278  -53.547  12.613  1.00 86.03  ? 1063 MET A O     1 
ATOM   8280  C  CB    . MET A 1  1063 ? 12.347  -51.414  14.511  1.00 110.31 ? 1063 MET A CB    1 
ATOM   8281  C  CG    . MET A 1  1063 ? 12.606  -50.365  15.578  1.00 96.10  ? 1063 MET A CG    1 
ATOM   8282  S  SD    . MET A 1  1063 ? 12.744  -51.136  17.196  1.00 84.79  ? 1063 MET A SD    1 
ATOM   8283  C  CE    . MET A 1  1063 ? 11.198  -52.078  17.293  1.00 85.10  ? 1063 MET A CE    1 
ATOM   8284  N  N     . VAL A 1  1064 ? 13.819  -54.750  13.741  1.00 89.07  ? 1064 VAL A N     1 
ATOM   8285  C  CA    . VAL A 1  1064 ? 13.727  -55.946  12.908  1.00 99.86  ? 1064 VAL A CA    1 
ATOM   8286  C  C     . VAL A 1  1064 ? 12.302  -56.509  12.854  1.00 105.46 ? 1064 VAL A C     1 
ATOM   8287  O  O     . VAL A 1  1064 ? 11.887  -57.079  11.836  1.00 87.60  ? 1064 VAL A O     1 
ATOM   8288  C  CB    . VAL A 1  1064 ? 14.753  -56.986  13.413  1.00 87.49  ? 1064 VAL A CB    1 
ATOM   8289  C  CG1   . VAL A 1  1064 ? 14.329  -58.373  13.021  1.00 147.76 ? 1064 VAL A CG1   1 
ATOM   8290  C  CG2   . VAL A 1  1064 ? 16.145  -56.683  12.857  1.00 87.49  ? 1064 VAL A CG2   1 
ATOM   8291  N  N     . GLY A 1  1065 ? 11.551  -56.400  13.941  1.00 103.23 ? 1065 GLY A N     1 
ATOM   8292  C  CA    . GLY A 1  1065 ? 10.210  -56.945  13.993  1.00 87.26  ? 1065 GLY A CA    1 
ATOM   8293  C  C     . GLY A 1  1065 ? 9.288   -56.374  12.941  1.00 99.33  ? 1065 GLY A C     1 
ATOM   8294  O  O     . GLY A 1  1065 ? 8.732   -57.101  12.102  1.00 88.86  ? 1065 GLY A O     1 
ATOM   8295  N  N     . VAL A 1  1066 ? 9.123   -55.050  12.979  1.00 86.57  ? 1066 VAL A N     1 
ATOM   8296  C  CA    . VAL A 1  1066 ? 8.248   -54.412  12.004  1.00 99.23  ? 1066 VAL A CA    1 
ATOM   8297  C  C     . VAL A 1  1066 ? 8.799   -54.623  10.603  1.00 86.73  ? 1066 VAL A C     1 
ATOM   8298  O  O     . VAL A 1  1066 ? 8.046   -54.862  9.656   1.00 87.00  ? 1066 VAL A O     1 
ATOM   8299  C  CB    . VAL A 1  1066 ? 8.052   -52.916  12.327  1.00 85.85  ? 1066 VAL A CB    1 
ATOM   8300  C  CG1   . VAL A 1  1066 ? 7.064   -52.279  11.354  1.00 85.79  ? 1066 VAL A CG1   1 
ATOM   8301  C  CG2   . VAL A 1  1066 ? 7.585   -52.732  13.761  1.00 85.62  ? 1066 VAL A CG2   1 
ATOM   8302  N  N     . LEU A 1  1067 ? 10.118  -54.576  10.449  1.00 86.73  ? 1067 LEU A N     1 
ATOM   8303  C  CA    . LEU A 1  1067 ? 10.693  -54.797  9.128   1.00 88.76  ? 1067 LEU A CA    1 
ATOM   8304  C  C     . LEU A 1  1067 ? 10.299  -56.174  8.598   1.00 87.71  ? 1067 LEU A C     1 
ATOM   8305  O  O     . LEU A 1  1067 ? 9.927   -56.319  7.432   1.00 95.32  ? 1067 LEU A O     1 
ATOM   8306  C  CB    . LEU A 1  1067 ? 12.220  -54.630  9.190   1.00 86.97  ? 1067 LEU A CB    1 
ATOM   8307  C  CG    . LEU A 1  1067 ? 13.012  -54.061  8.000   1.00 86.97  ? 1067 LEU A CG    1 
ATOM   8308  C  CD1   . LEU A 1  1067 ? 14.391  -53.660  8.468   1.00 130.72 ? 1067 LEU A CD1   1 
ATOM   8309  C  CD2   . LEU A 1  1067 ? 13.150  -55.008  6.844   1.00 87.60  ? 1067 LEU A CD2   1 
ATOM   8310  N  N     . ALA A 1  1068 ? 10.352  -57.193  9.451   1.00 95.51  ? 1068 ALA A N     1 
ATOM   8311  C  CA    . ALA A 1  1068 ? 9.983   -58.542  9.042   1.00 88.67  ? 1068 ALA A CA    1 
ATOM   8312  C  C     . ALA A 1  1068 ? 8.511   -58.619  8.680   1.00 90.51  ? 1068 ALA A C     1 
ATOM   8313  O  O     . ALA A 1  1068 ? 8.137   -59.214  7.656   1.00 90.95  ? 1068 ALA A O     1 
ATOM   8314  C  CB    . ALA A 1  1068 ? 10.313  -59.532  10.152  1.00 90.09  ? 1068 ALA A CB    1 
ATOM   8315  N  N     . ALA A 1  1069 ? 7.659   -57.994  9.492   1.00 92.67  ? 1069 ALA A N     1 
ATOM   8316  C  CA    . ALA A 1  1069 ? 6.234   -58.038  9.203   1.00 88.45  ? 1069 ALA A CA    1 
ATOM   8317  C  C     . ALA A 1  1069 ? 5.925   -57.370  7.873   1.00 88.44  ? 1069 ALA A C     1 
ATOM   8318  O  O     . ALA A 1  1069 ? 5.271   -57.962  7.017   1.00 100.09 ? 1069 ALA A O     1 
ATOM   8319  C  CB    . ALA A 1  1069 ? 5.460   -57.366  10.328  1.00 87.97  ? 1069 ALA A CB    1 
ATOM   8320  N  N     . GLN A 1  1070 ? 6.425   -56.150  7.669   1.00 87.97  ? 1070 GLN A N     1 
ATOM   8321  C  CA    . GLN A 1  1070 ? 6.200   -55.424  6.421   1.00 87.98  ? 1070 GLN A CA    1 
ATOM   8322  C  C     . GLN A 1  1070 ? 6.831   -56.136  5.231   1.00 88.54  ? 1070 GLN A C     1 
ATOM   8323  O  O     . GLN A 1  1070 ? 6.274   -56.130  4.121   1.00 93.07  ? 1070 GLN A O     1 
ATOM   8324  C  CB    . GLN A 1  1070 ? 6.781   -54.016  6.552   1.00 87.38  ? 1070 GLN A CB    1 
ATOM   8325  C  CG    . GLN A 1  1070 ? 6.165   -53.114  7.627   1.00 86.83  ? 1070 GLN A CG    1 
ATOM   8326  C  CD    . GLN A 1  1070 ? 6.725   -51.697  7.589   1.00 93.36  ? 1070 GLN A CD    1 
ATOM   8327  O  OE1   . GLN A 1  1070 ? 7.877   -51.488  7.208   1.00 103.48 ? 1070 GLN A OE1   1 
ATOM   8328  N  NE2   . GLN A 1  1070 ? 5.921   -50.724  7.992   1.00 120.59 ? 1070 GLN A NE2   1 
ATOM   8329  N  N     . SER A 1  1071 ? 7.959   -56.800  5.459   1.00 88.72  ? 1071 SER A N     1 
ATOM   8330  C  CA    . SER A 1  1071 ? 8.652   -57.495  4.386   1.00 100.65 ? 1071 SER A CA    1 
ATOM   8331  C  C     . SER A 1  1071 ? 7.883   -58.726  3.938   1.00 96.46  ? 1071 SER A C     1 
ATOM   8332  O  O     . SER A 1  1071 ? 8.033   -59.150  2.789   1.00 97.78  ? 1071 SER A O     1 
ATOM   8333  C  CB    . SER A 1  1071 ? 10.066  -57.902  4.830   1.00 89.33  ? 1071 SER A CB    1 
ATOM   8334  O  OG    . SER A 1  1071 ? 10.934  -56.796  5.012   1.00 92.13  ? 1071 SER A OG    1 
ATOM   8335  N  N     . ILE A 1  1072 ? 7.080   -59.321  4.822   1.00 101.43 ? 1072 ILE A N     1 
ATOM   8336  C  CA    . ILE A 1  1072 ? 6.227   -60.450  4.435   1.00 94.03  ? 1072 ILE A CA    1 
ATOM   8337  C  C     . ILE A 1  1072 ? 4.884   -59.967  3.902   1.00 111.09 ? 1072 ILE A C     1 
ATOM   8338  O  O     . ILE A 1  1072 ? 4.429   -60.395  2.838   1.00 107.10 ? 1072 ILE A O     1 
ATOM   8339  C  CB    . ILE A 1  1072 ? 6.028   -61.421  5.625   1.00 90.82  ? 1072 ILE A CB    1 
ATOM   8340  C  CG1   . ILE A 1  1072 ? 7.312   -62.188  5.937   1.00 91.10  ? 1072 ILE A CG1   1 
ATOM   8341  C  CG2   . ILE A 1  1072 ? 4.910   -62.391  5.349   1.00 91.39  ? 1072 ILE A CG2   1 
ATOM   8342  C  CD1   . ILE A 1  1072 ? 7.516   -62.529  7.406   1.00 90.92  ? 1072 ILE A CD1   1 
ATOM   8343  N  N     . GLY A 1  1073 ? 4.251   -59.051  4.637   1.00 93.99  ? 1073 GLY A N     1 
ATOM   8344  C  CA    . GLY A 1  1073 ? 2.905   -58.612  4.319   1.00 90.03  ? 1073 GLY A CA    1 
ATOM   8345  C  C     . GLY A 1  1073 ? 2.802   -57.872  3.007   1.00 104.20 ? 1073 GLY A C     1 
ATOM   8346  O  O     . GLY A 1  1073 ? 1.737   -57.872  2.375   1.00 124.06 ? 1073 GLY A O     1 
ATOM   8347  N  N     . GLU A 1  1074 ? 3.898   -57.244  2.569   1.00 98.33  ? 1074 GLU A N     1 
ATOM   8348  C  CA    . GLU A 1  1074 ? 3.755   -56.434  1.370   1.00 107.52 ? 1074 GLU A CA    1 
ATOM   8349  C  C     . GLU A 1  1074 ? 3.768   -57.338  0.138   1.00 110.73 ? 1074 GLU A C     1 
ATOM   8350  O  O     . GLU A 1  1074 ? 2.928   -57.148  -0.748  1.00 123.04 ? 1074 GLU A O     1 
ATOM   8351  C  CB    . GLU A 1  1074 ? 4.837   -55.348  1.286   1.00 89.53  ? 1074 GLU A CB    1 
ATOM   8352  C  CG    . GLU A 1  1074 ? 4.730   -54.472  0.046   1.00 89.65  ? 1074 GLU A CG    1 
ATOM   8353  C  CD    . GLU A 1  1074 ? 5.716   -54.873  -1.027  1.00 115.62 ? 1074 GLU A CD    1 
ATOM   8354  O  OE1   . GLU A 1  1074 ? 6.890   -55.119  -0.701  1.00 135.64 ? 1074 GLU A OE1   1 
ATOM   8355  O  OE2   . GLU A 1  1074 ? 5.309   -54.985  -2.196  1.00 139.15 ? 1074 GLU A OE2   1 
ATOM   8356  N  N     . PRO A 1  1075 ? 4.648   -58.343  0.035   1.00 115.97 ? 1075 PRO A N     1 
ATOM   8357  C  CA    . PRO A 1  1075 ? 4.468   -59.329  -1.050  1.00 114.78 ? 1075 PRO A CA    1 
ATOM   8358  C  C     . PRO A 1  1075 ? 3.131   -60.040  -1.018  1.00 119.83 ? 1075 PRO A C     1 
ATOM   8359  O  O     . PRO A 1  1075 ? 2.618   -60.431  -2.076  1.00 123.41 ? 1075 PRO A O     1 
ATOM   8360  C  CB    . PRO A 1  1075 ? 5.628   -60.313  -0.849  1.00 110.78 ? 1075 PRO A CB    1 
ATOM   8361  C  CG    . PRO A 1  1075 ? 6.426   -59.801  0.287   1.00 123.48 ? 1075 PRO A CG    1 
ATOM   8362  C  CD    . PRO A 1  1075 ? 6.013   -58.405  0.582   1.00 122.81 ? 1075 PRO A CD    1 
ATOM   8363  N  N     . ALA A 1  1076 ? 2.564   -60.249  0.169   1.00 112.62 ? 1076 ALA A N     1 
ATOM   8364  C  CA    . ALA A 1  1076 ? 1.239   -60.841  0.265   1.00 92.47  ? 1076 ALA A CA    1 
ATOM   8365  C  C     . ALA A 1  1076 ? 0.199   -60.011  -0.463  1.00 93.96  ? 1076 ALA A C     1 
ATOM   8366  O  O     . ALA A 1  1076 ? -0.829  -60.545  -0.887  1.00 108.93 ? 1076 ALA A O     1 
ATOM   8367  C  CB    . ALA A 1  1076 ? 0.860   -60.982  1.739   1.00 92.03  ? 1076 ALA A CB    1 
ATOM   8368  N  N     . THR A 1  1077 ? 0.477   -58.724  -0.655  1.00 114.66 ? 1077 THR A N     1 
ATOM   8369  C  CA    . THR A 1  1077 ? -0.443  -57.844  -1.354  1.00 96.90  ? 1077 THR A CA    1 
ATOM   8370  C  C     . THR A 1  1077 ? -0.447  -58.125  -2.846  1.00 121.96 ? 1077 THR A C     1 
ATOM   8371  O  O     . THR A 1  1077 ? -1.517  -58.179  -3.466  1.00 129.39 ? 1077 THR A O     1 
ATOM   8372  C  CB    . THR A 1  1077 ? -0.027  -56.401  -1.076  1.00 106.97 ? 1077 THR A CB    1 
ATOM   8373  O  OG1   . THR A 1  1077 ? -0.479  -56.039  0.229   1.00 95.22  ? 1077 THR A OG1   1 
ATOM   8374  C  CG2   . THR A 1  1077 ? -0.591  -55.422  -2.111  1.00 145.59 ? 1077 THR A CG2   1 
ATOM   8375  N  N     . GLN A 1  1078 ? 0.738   -58.359  -3.429  1.00 123.40 ? 1078 GLN A N     1 
ATOM   8376  C  CA    . GLN A 1  1078 ? 0.884   -58.511  -4.872  1.00 130.57 ? 1078 GLN A CA    1 
ATOM   8377  C  C     . GLN A 1  1078 ? 0.560   -59.919  -5.366  1.00 137.63 ? 1078 GLN A C     1 
ATOM   8378  O  O     . GLN A 1  1078 ? 0.879   -60.249  -6.520  1.00 144.59 ? 1078 GLN A O     1 
ATOM   8379  C  CB    . GLN A 1  1078 ? 2.305   -58.121  -5.303  1.00 131.04 ? 1078 GLN A CB    1 
ATOM   8380  C  CG    . GLN A 1  1078 ? 2.903   -56.916  -4.585  1.00 132.42 ? 1078 GLN A CG    1 
ATOM   8381  C  CD    . GLN A 1  1078 ? 2.565   -55.606  -5.266  1.00 169.68 ? 1078 GLN A CD    1 
ATOM   8382  O  OE1   . GLN A 1  1078 ? 1.683   -54.874  -4.816  1.00 173.69 ? 1078 GLN A OE1   1 
ATOM   8383  N  NE2   . GLN A 1  1078 ? 3.257   -55.307  -6.362  1.00 179.34 ? 1078 GLN A NE2   1 
ATOM   8384  N  N     . MET A 1  1079 ? -0.109  -60.740  -4.558  1.00 126.44 ? 1079 MET A N     1 
ATOM   8385  C  CA    . MET A 1  1079 ? -0.352  -62.130  -4.926  1.00 134.61 ? 1079 MET A CA    1 
ATOM   8386  C  C     . MET A 1  1079 ? -1.663  -62.167  -5.690  1.00 168.65 ? 1079 MET A C     1 
ATOM   8387  O  O     . MET A 1  1079 ? -2.744  -62.159  -5.097  1.00 165.87 ? 1079 MET A O     1 
ATOM   8388  C  CB    . MET A 1  1079 ? -0.377  -63.035  -3.697  1.00 121.38 ? 1079 MET A CB    1 
ATOM   8389  C  CG    . MET A 1  1079 ? 0.864   -62.898  -2.846  1.00 138.52 ? 1079 MET A CG    1 
ATOM   8390  S  SD    . MET A 1  1079 ? 1.371   -64.421  -2.029  1.00 136.42 ? 1079 MET A SD    1 
ATOM   8391  C  CE    . MET A 1  1079 ? 0.359   -64.417  -0.558  1.00 97.62  ? 1079 MET A CE    1 
ATOM   8392  N  N     . THR A 1  1080 ? -1.553  -62.216  -7.020  1.00 197.14 ? 1080 THR A N     1 
ATOM   8393  C  CA    . THR A 1  1080 ? -2.693  -62.430  -7.911  1.00 205.59 ? 1080 THR A CA    1 
ATOM   8394  C  C     . THR A 1  1080 ? -2.827  -63.930  -8.165  1.00 207.17 ? 1080 THR A C     1 
ATOM   8395  O  O     . THR A 1  1080 ? -2.520  -64.462  -9.232  1.00 205.42 ? 1080 THR A O     1 
ATOM   8396  C  CB    . THR A 1  1080 ? -2.524  -61.647  -9.211  1.00 196.55 ? 1080 THR A CB    1 
ATOM   8397  O  OG1   . THR A 1  1080 ? -2.264  -60.269  -8.916  1.00 186.94 ? 1080 THR A OG1   1 
ATOM   8398  C  CG2   . THR A 1  1080 ? -3.787  -61.736  -10.063 1.00 187.65 ? 1080 THR A CG2   1 
ATOM   8399  N  N     . LEU A 1  1081 ? -3.267  -64.613  -7.119  1.00 211.91 ? 1081 LEU A N     1 
ATOM   8400  C  CA    . LEU A 1  1081 ? -3.484  -66.045  -7.138  1.00 220.30 ? 1081 LEU A CA    1 
ATOM   8401  C  C     . LEU A 1  1081 ? -4.944  -66.276  -7.557  1.00 237.80 ? 1081 LEU A C     1 
ATOM   8402  O  O     . LEU A 1  1081 ? -5.667  -65.315  -7.824  1.00 230.55 ? 1081 LEU A O     1 
ATOM   8403  C  CB    . LEU A 1  1081 ? -3.078  -66.581  -5.764  1.00 200.33 ? 1081 LEU A CB    1 
ATOM   8404  C  CG    . LEU A 1  1081 ? -1.559  -66.749  -5.685  1.00 197.12 ? 1081 LEU A CG    1 
ATOM   8405  C  CD1   . LEU A 1  1081 ? -1.092  -66.883  -4.260  1.00 206.08 ? 1081 LEU A CD1   1 
ATOM   8406  C  CD2   . LEU A 1  1081 ? -1.111  -67.966  -6.503  1.00 172.16 ? 1081 LEU A CD2   1 
ATOM   8407  N  N     . ASN A 1  1082 ? -5.414  -67.527  -7.657  1.00 251.90 ? 1082 ASN A N     1 
ATOM   8408  C  CA    . ASN A 1  1082 ? -4.809  -68.773  -7.183  1.00 237.20 ? 1082 ASN A CA    1 
ATOM   8409  C  C     . ASN A 1  1082 ? -4.233  -69.617  -8.328  1.00 213.12 ? 1082 ASN A C     1 
ATOM   8410  O  O     . ASN A 1  1082 ? -4.106  -70.840  -8.224  1.00 192.01 ? 1082 ASN A O     1 
ATOM   8411  C  CB    . ASN A 1  1082 ? -5.851  -69.569  -6.389  1.00 230.80 ? 1082 ASN A CB    1 
ATOM   8412  C  CG    . ASN A 1  1082 ? -6.513  -68.738  -5.281  1.00 209.86 ? 1082 ASN A CG    1 
ATOM   8413  O  OD1   . ASN A 1  1082 ? -5.851  -67.964  -4.583  1.00 210.67 ? 1082 ASN A OD1   1 
ATOM   8414  N  ND2   . ASN A 1  1082 ? -7.822  -68.903  -5.120  1.00 177.97 ? 1082 ASN A ND2   1 
ATOM   8415  N  N     . LYS A 1  1092 ? 0.243   -81.832  -8.357  1.00 187.65 ? 1092 LYS A N     1 
ATOM   8416  C  CA    . LYS A 1  1092 ? -0.649  -81.690  -7.208  1.00 192.69 ? 1092 LYS A CA    1 
ATOM   8417  C  C     . LYS A 1  1092 ? -1.227  -80.275  -7.096  1.00 201.13 ? 1092 LYS A C     1 
ATOM   8418  O  O     . LYS A 1  1092 ? -0.485  -79.291  -7.153  1.00 193.61 ? 1092 LYS A O     1 
ATOM   8419  C  CB    . LYS A 1  1092 ? 0.089   -82.048  -5.921  1.00 170.53 ? 1092 LYS A CB    1 
ATOM   8420  C  CG    . LYS A 1  1092 ? -0.823  -82.192  -4.721  1.00 149.48 ? 1092 LYS A CG    1 
ATOM   8421  C  CD    . LYS A 1  1092 ? -1.711  -83.416  -4.848  1.00 146.82 ? 1092 LYS A CD    1 
ATOM   8422  C  CE    . LYS A 1  1092 ? -3.099  -83.137  -4.305  1.00 158.71 ? 1092 LYS A CE    1 
ATOM   8423  N  NZ    . LYS A 1  1092 ? -3.126  -83.040  -2.819  1.00 142.61 ? 1092 LYS A NZ    1 
ATOM   8424  N  N     . LYS A 1  1093 ? -2.545  -80.175  -6.913  1.00 200.64 ? 1093 LYS A N     1 
ATOM   8425  C  CA    . LYS A 1  1093 ? -3.214  -78.893  -6.720  1.00 188.66 ? 1093 LYS A CA    1 
ATOM   8426  C  C     . LYS A 1  1093 ? -3.501  -78.729  -5.229  1.00 165.25 ? 1093 LYS A C     1 
ATOM   8427  O  O     . LYS A 1  1093 ? -4.337  -79.439  -4.660  1.00 145.37 ? 1093 LYS A O     1 
ATOM   8428  C  CB    . LYS A 1  1093 ? -4.478  -78.797  -7.569  1.00 181.17 ? 1093 LYS A CB    1 
ATOM   8429  C  CG    . LYS A 1  1093 ? -4.403  -77.697  -8.634  1.00 166.34 ? 1093 LYS A CG    1 
ATOM   8430  C  CD    . LYS A 1  1093 ? -5.484  -77.835  -9.692  1.00 176.08 ? 1093 LYS A CD    1 
ATOM   8431  C  CE    . LYS A 1  1093 ? -5.037  -78.788  -10.796 1.00 175.19 ? 1093 LYS A CE    1 
ATOM   8432  N  NZ    . LYS A 1  1093 ? -5.876  -78.689  -12.025 1.00 161.55 ? 1093 LYS A NZ    1 
ATOM   8433  N  N     . VAL A 1  1094 ? -2.792  -77.788  -4.611  1.00 160.92 ? 1094 VAL A N     1 
ATOM   8434  C  CA    . VAL A 1  1094 ? -2.855  -77.522  -3.184  1.00 149.81 ? 1094 VAL A CA    1 
ATOM   8435  C  C     . VAL A 1  1094 ? -3.244  -76.061  -2.968  1.00 156.42 ? 1094 VAL A C     1 
ATOM   8436  O  O     . VAL A 1  1094 ? -3.192  -75.234  -3.879  1.00 175.65 ? 1094 VAL A O     1 
ATOM   8437  C  CB    . VAL A 1  1094 ? -1.530  -77.852  -2.477  1.00 145.88 ? 1094 VAL A CB    1 
ATOM   8438  C  CG1   . VAL A 1  1094 ? -1.387  -79.360  -2.300  1.00 147.72 ? 1094 VAL A CG1   1 
ATOM   8439  C  CG2   . VAL A 1  1094 ? -0.373  -77.315  -3.292  1.00 136.51 ? 1094 VAL A CG2   1 
ATOM   8440  N  N     . THR A 1  1095 ? -3.628  -75.754  -1.729  1.00 143.94 ? 1095 THR A N     1 
ATOM   8441  C  CA    . THR A 1  1095 ? -4.092  -74.414  -1.397  1.00 135.54 ? 1095 THR A CA    1 
ATOM   8442  C  C     . THR A 1  1095 ? -2.988  -73.394  -1.674  1.00 156.42 ? 1095 THR A C     1 
ATOM   8443  O  O     . THR A 1  1095 ? -1.829  -73.584  -1.297  1.00 133.83 ? 1095 THR A O     1 
ATOM   8444  C  CB    . THR A 1  1095 ? -4.544  -74.364  0.070   1.00 115.24 ? 1095 THR A CB    1 
ATOM   8445  O  OG1   . THR A 1  1095 ? -3.702  -75.202  0.869   1.00 123.81 ? 1095 THR A OG1   1 
ATOM   8446  C  CG2   . THR A 1  1095 ? -5.984  -74.836  0.215   1.00 119.16 ? 1095 THR A CG2   1 
ATOM   8447  N  N     . SER A 1  1096 ? -3.365  -72.307  -2.347  1.00 176.90 ? 1096 SER A N     1 
ATOM   8448  C  CA    . SER A 1  1096 ? -2.456  -71.295  -2.869  1.00 173.03 ? 1096 SER A CA    1 
ATOM   8449  C  C     . SER A 1  1096 ? -2.171  -70.225  -1.820  1.00 159.25 ? 1096 SER A C     1 
ATOM   8450  O  O     . SER A 1  1096 ? -2.784  -70.189  -0.755  1.00 160.71 ? 1096 SER A O     1 
ATOM   8451  C  CB    . SER A 1  1096 ? -3.056  -70.656  -4.118  1.00 186.46 ? 1096 SER A CB    1 
ATOM   8452  O  OG    . SER A 1  1096 ? -4.441  -70.429  -3.924  1.00 190.07 ? 1096 SER A OG    1 
ATOM   8453  N  N     . GLY A 1  1097 ? -1.218  -69.346  -2.138  1.00 164.17 ? 1097 GLY A N     1 
ATOM   8454  C  CA    . GLY A 1  1097 ? -0.719  -68.349  -1.203  1.00 158.02 ? 1097 GLY A CA    1 
ATOM   8455  C  C     . GLY A 1  1097 ? -1.659  -67.633  -0.242  1.00 130.19 ? 1097 GLY A C     1 
ATOM   8456  O  O     . GLY A 1  1097 ? -1.636  -67.966  0.931   1.00 148.35 ? 1097 GLY A O     1 
ATOM   8457  N  N     . VAL A 1  1098 ? -2.473  -66.662  -0.670  1.00 98.88  ? 1098 VAL A N     1 
ATOM   8458  C  CA    . VAL A 1  1098 ? -3.247  -65.854  0.299   1.00 115.63 ? 1098 VAL A CA    1 
ATOM   8459  C  C     . VAL A 1  1098 ? -4.139  -66.681  1.222   1.00 110.90 ? 1098 VAL A C     1 
ATOM   8460  O  O     . VAL A 1  1098 ? -4.133  -66.441  2.448   1.00 105.44 ? 1098 VAL A O     1 
ATOM   8461  C  CB    . VAL A 1  1098 ? -4.007  -64.733  -0.427  1.00 123.05 ? 1098 VAL A CB    1 
ATOM   8462  C  CG1   . VAL A 1  1098 ? -4.673  -63.816  0.591   1.00 94.30  ? 1098 VAL A CG1   1 
ATOM   8463  C  CG2   . VAL A 1  1098 ? -3.081  -63.929  -1.372  1.00 125.64 ? 1098 VAL A CG2   1 
ATOM   8464  N  N     . PRO A 1  1099 ? -4.884  -67.684  0.740   1.00 121.26 ? 1099 PRO A N     1 
ATOM   8465  C  CA    . PRO A 1  1099 ? -5.618  -68.554  1.678   1.00 107.94 ? 1099 PRO A CA    1 
ATOM   8466  C  C     . PRO A 1  1099 ? -4.710  -69.444  2.506   1.00 112.32 ? 1099 PRO A C     1 
ATOM   8467  O  O     . PRO A 1  1099 ? -5.012  -69.692  3.682   1.00 109.11 ? 1099 PRO A O     1 
ATOM   8468  C  CB    . PRO A 1  1099 ? -6.549  -69.355  0.759   1.00 110.39 ? 1099 PRO A CB    1 
ATOM   8469  C  CG    . PRO A 1  1099 ? -6.642  -68.532  -0.492  1.00 113.41 ? 1099 PRO A CG    1 
ATOM   8470  C  CD    . PRO A 1  1099 ? -5.302  -67.920  -0.654  1.00 107.02 ? 1099 PRO A CD    1 
ATOM   8471  N  N     . ARG A 1  1100 ? -3.632  -69.974  1.926   1.00 121.57 ? 1100 ARG A N     1 
ATOM   8472  C  CA    . ARG A 1  1100 ? -2.767  -70.860  2.697   1.00 122.12 ? 1100 ARG A CA    1 
ATOM   8473  C  C     . ARG A 1  1100 ? -2.013  -70.085  3.771   1.00 106.81 ? 1100 ARG A C     1 
ATOM   8474  O  O     . ARG A 1  1100 ? -1.836  -70.577  4.884   1.00 110.82 ? 1100 ARG A O     1 
ATOM   8475  C  CB    . ARG A 1  1100 ? -1.799  -71.591  1.749   1.00 108.53 ? 1100 ARG A CB    1 
ATOM   8476  C  CG    . ARG A 1  1100 ? -0.710  -72.409  2.429   1.00 106.22 ? 1100 ARG A CG    1 
ATOM   8477  C  CD    . ARG A 1  1100 ? -1.243  -73.506  3.320   1.00 98.47  ? 1100 ARG A CD    1 
ATOM   8478  N  NE    . ARG A 1  1100 ? -0.138  -74.221  3.939   1.00 105.14 ? 1100 ARG A NE    1 
ATOM   8479  C  CZ    . ARG A 1  1100 ? -0.257  -75.023  4.993   1.00 123.78 ? 1100 ARG A CZ    1 
ATOM   8480  N  NH1   . ARG A 1  1100 ? -1.437  -75.216  5.574   1.00 105.69 ? 1100 ARG A NH1   1 
ATOM   8481  N  NH2   . ARG A 1  1100 ? 0.817   -75.620  5.485   1.00 151.01 ? 1100 ARG A NH2   1 
ATOM   8482  N  N     . LEU A 1  1101 ? -1.581  -68.869  3.464   1.00 105.34 ? 1101 LEU A N     1 
ATOM   8483  C  CA    . LEU A 1  1101 ? -0.962  -67.997  4.455   1.00 105.52 ? 1101 LEU A CA    1 
ATOM   8484  C  C     . LEU A 1  1101 ? -1.944  -67.642  5.562   1.00 106.56 ? 1101 LEU A C     1 
ATOM   8485  O  O     . LEU A 1  1101 ? -1.567  -67.559  6.739   1.00 113.79 ? 1101 LEU A O     1 
ATOM   8486  C  CB    . LEU A 1  1101 ? -0.425  -66.743  3.774   1.00 102.21 ? 1101 LEU A CB    1 
ATOM   8487  C  CG    . LEU A 1  1101 ? 0.110   -65.656  4.693   1.00 93.44  ? 1101 LEU A CG    1 
ATOM   8488  C  CD1   . LEU A 1  1101 ? 1.488   -66.045  5.224   1.00 93.43  ? 1101 LEU A CD1   1 
ATOM   8489  C  CD2   . LEU A 1  1101 ? 0.128   -64.343  3.943   1.00 92.98  ? 1101 LEU A CD2   1 
ATOM   8490  N  N     . LYS A 1  1102 ? -3.222  -67.469  5.209   1.00 94.47  ? 1102 LYS A N     1 
ATOM   8491  C  CA    . LYS A 1  1102 ? -4.232  -67.315  6.253   1.00 104.23 ? 1102 LYS A CA    1 
ATOM   8492  C  C     . LYS A 1  1102 ? -4.319  -68.572  7.116   1.00 106.14 ? 1102 LYS A C     1 
ATOM   8493  O  O     . LYS A 1  1102 ? -4.420  -68.489  8.346   1.00 96.77  ? 1102 LYS A O     1 
ATOM   8494  C  CB    . LYS A 1  1102 ? -5.593  -67.006  5.613   1.00 102.59 ? 1102 LYS A CB    1 
ATOM   8495  C  CG    . LYS A 1  1102 ? -6.705  -66.536  6.559   1.00 122.53 ? 1102 LYS A CG    1 
ATOM   8496  C  CD    . LYS A 1  1102 ? -7.948  -66.093  5.777   1.00 148.48 ? 1102 LYS A CD    1 
ATOM   8497  C  CE    . LYS A 1  1102 ? -9.210  -66.300  6.598   1.00 144.16 ? 1102 LYS A CE    1 
ATOM   8498  N  NZ    . LYS A 1  1102 ? -10.343 -66.695  5.722   1.00 134.23 ? 1102 LYS A NZ    1 
ATOM   8499  N  N     . GLU A 1  1103 ? -4.194  -69.742  6.490   1.00 101.17 ? 1103 GLU A N     1 
ATOM   8500  C  CA    . GLU A 1  1103 ? -4.162  -71.004  7.225   1.00 99.49  ? 1103 GLU A CA    1 
ATOM   8501  C  C     . GLU A 1  1103 ? -2.981  -71.050  8.192   1.00 103.40 ? 1103 GLU A C     1 
ATOM   8502  O  O     . GLU A 1  1103 ? -3.144  -71.367  9.377   1.00 120.76 ? 1103 GLU A O     1 
ATOM   8503  C  CB    . GLU A 1  1103 ? -4.107  -72.161  6.213   1.00 96.92  ? 1103 GLU A CB    1 
ATOM   8504  C  CG    . GLU A 1  1103 ? -5.329  -73.077  6.156   1.00 97.57  ? 1103 GLU A CG    1 
ATOM   8505  C  CD    . GLU A 1  1103 ? -5.373  -73.933  4.890   1.00 123.86 ? 1103 GLU A CD    1 
ATOM   8506  O  OE1   . GLU A 1  1103 ? -4.489  -74.786  4.681   1.00 132.35 ? 1103 GLU A OE1   1 
ATOM   8507  O  OE2   . GLU A 1  1103 ? -6.306  -73.738  4.085   1.00 149.20 ? 1103 GLU A OE2   1 
ATOM   8508  N  N     . ILE A 1  1104 ? -1.785  -70.726  7.695   1.00 104.36 ? 1104 ILE A N     1 
ATOM   8509  C  CA    . ILE A 1  1104 ? -0.547  -70.876  8.457   1.00 99.50  ? 1104 ILE A CA    1 
ATOM   8510  C  C     . ILE A 1  1104 ? -0.517  -69.917  9.636   1.00 113.35 ? 1104 ILE A C     1 
ATOM   8511  O  O     . ILE A 1  1104 ? -0.172  -70.292  10.763  1.00 115.71 ? 1104 ILE A O     1 
ATOM   8512  C  CB    . ILE A 1  1104 ? 0.666   -70.628  7.539   1.00 95.47  ? 1104 ILE A CB    1 
ATOM   8513  C  CG1   . ILE A 1  1104 ? 0.679   -71.574  6.342   1.00 96.34  ? 1104 ILE A CG1   1 
ATOM   8514  C  CG2   . ILE A 1  1104 ? 1.935   -70.766  8.314   1.00 95.36  ? 1104 ILE A CG2   1 
ATOM   8515  C  CD1   . ILE A 1  1104 ? 1.834   -71.349  5.383   1.00 96.43  ? 1104 ILE A CD1   1 
ATOM   8516  N  N     . LEU A 1  1105 ? -0.842  -68.652  9.383   1.00 94.30  ? 1105 LEU A N     1 
ATOM   8517  C  CA    . LEU A 1  1105 ? -0.710  -67.646  10.424  1.00 98.23  ? 1105 LEU A CA    1 
ATOM   8518  C  C     . LEU A 1  1105 ? -1.707  -67.866  11.549  1.00 108.63 ? 1105 LEU A C     1 
ATOM   8519  O  O     . LEU A 1  1105 ? -1.443  -67.464  12.689  1.00 108.47 ? 1105 LEU A O     1 
ATOM   8520  C  CB    . LEU A 1  1105 ? -0.894  -66.258  9.814   1.00 108.53 ? 1105 LEU A CB    1 
ATOM   8521  C  CG    . LEU A 1  1105 ? 0.360   -65.718  9.121   1.00 101.75 ? 1105 LEU A CG    1 
ATOM   8522  C  CD1   . LEU A 1  1105 ? 0.063   -64.531  8.219   1.00 91.95  ? 1105 LEU A CD1   1 
ATOM   8523  C  CD2   . LEU A 1  1105 ? 1.390   -65.349  10.157  1.00 102.38 ? 1105 LEU A CD2   1 
ATOM   8524  N  N     . ASN A 1  1106 ? -2.805  -68.560  11.266  1.00 101.95 ? 1106 ASN A N     1 
ATOM   8525  C  CA    . ASN A 1  1106 ? -3.853  -68.817  12.237  1.00 104.05 ? 1106 ASN A CA    1 
ATOM   8526  C  C     . ASN A 1  1106 ? -3.657  -70.124  12.997  1.00 119.82 ? 1106 ASN A C     1 
ATOM   8527  O  O     . ASN A 1  1106 ? -4.468  -70.426  13.884  1.00 121.83 ? 1106 ASN A O     1 
ATOM   8528  C  CB    . ASN A 1  1106 ? -5.216  -68.819  11.532  1.00 117.10 ? 1106 ASN A CB    1 
ATOM   8529  C  CG    . ASN A 1  1106 ? -5.664  -67.428  11.118  1.00 122.13 ? 1106 ASN A CG    1 
ATOM   8530  O  OD1   . ASN A 1  1106 ? -5.392  -66.449  11.815  1.00 100.65 ? 1106 ASN A OD1   1 
ATOM   8531  N  ND2   . ASN A 1  1106 ? -6.372  -67.337  9.994   1.00 131.78 ? 1106 ASN A ND2   1 
ATOM   8532  N  N     . VAL A 1  1107 ? -2.602  -70.888  12.681  1.00 119.67 ? 1107 VAL A N     1 
ATOM   8533  C  CA    . VAL A 1  1107 ? -2.435  -72.266  13.146  1.00 127.64 ? 1107 VAL A CA    1 
ATOM   8534  C  C     . VAL A 1  1107 ? -3.761  -72.976  12.869  1.00 123.16 ? 1107 VAL A C     1 
ATOM   8535  O  O     . VAL A 1  1107 ? -4.549  -73.259  13.782  1.00 109.01 ? 1107 VAL A O     1 
ATOM   8536  C  CB    . VAL A 1  1107 ? -1.988  -72.327  14.627  1.00 124.98 ? 1107 VAL A CB    1 
ATOM   8537  C  CG1   . VAL A 1  1107 ? -2.065  -73.739  15.212  1.00 123.19 ? 1107 VAL A CG1   1 
ATOM   8538  C  CG2   . VAL A 1  1107 ? -0.573  -71.815  14.765  1.00 117.19 ? 1107 VAL A CG2   1 
ATOM   8539  N  N     . ALA A 1  1108 ? -4.021  -73.254  11.596  1.00 114.99 ? 1108 ALA A N     1 
ATOM   8540  C  CA    . ALA A 1  1108 ? -5.305  -73.816  11.216  1.00 109.58 ? 1108 ALA A CA    1 
ATOM   8541  C  C     . ALA A 1  1108 ? -5.349  -75.272  11.636  1.00 131.54 ? 1108 ALA A C     1 
ATOM   8542  O  O     . ALA A 1  1108 ? -4.493  -76.066  11.233  1.00 149.56 ? 1108 ALA A O     1 
ATOM   8543  C  CB    . ALA A 1  1108 ? -5.515  -73.682  9.710   1.00 97.44  ? 1108 ALA A CB    1 
ATOM   8544  N  N     . LYS A 1  1109 ? -6.349  -75.619  12.448  1.00 122.98 ? 1109 LYS A N     1 
ATOM   8545  C  CA    . LYS A 1  1109 ? -6.447  -76.988  12.940  1.00 113.98 ? 1109 LYS A CA    1 
ATOM   8546  C  C     . LYS A 1  1109 ? -6.825  -77.953  11.824  1.00 106.80 ? 1109 LYS A C     1 
ATOM   8547  O  O     . LYS A 1  1109 ? -6.217  -79.018  11.686  1.00 119.76 ? 1109 LYS A O     1 
ATOM   8548  C  CB    . LYS A 1  1109 ? -7.444  -77.076  14.095  1.00 106.65 ? 1109 LYS A CB    1 
ATOM   8549  C  CG    . LYS A 1  1109 ? -7.124  -76.202  15.299  1.00 117.76 ? 1109 LYS A CG    1 
ATOM   8550  C  CD    . LYS A 1  1109 ? -6.559  -77.065  16.425  1.00 143.92 ? 1109 LYS A CD    1 
ATOM   8551  C  CE    . LYS A 1  1109 ? -5.796  -76.255  17.460  1.00 146.06 ? 1109 LYS A CE    1 
ATOM   8552  N  NZ    . LYS A 1  1109 ? -6.711  -75.631  18.455  1.00 150.14 ? 1109 LYS A NZ    1 
ATOM   8553  N  N     . ASN A 1  1110 ? -7.781  -77.573  10.987  1.00 125.63 ? 1110 ASN A N     1 
ATOM   8554  C  CA    . ASN A 1  1110 ? -8.281  -78.414  9.909   1.00 127.63 ? 1110 ASN A CA    1 
ATOM   8555  C  C     . ASN A 1  1110 ? -7.975  -77.698  8.605   1.00 112.67 ? 1110 ASN A C     1 
ATOM   8556  O  O     . ASN A 1  1110 ? -8.794  -76.923  8.108   1.00 99.75  ? 1110 ASN A O     1 
ATOM   8557  C  CB    . ASN A 1  1110 ? -9.780  -78.675  10.063  1.00 149.00 ? 1110 ASN A CB    1 
ATOM   8558  C  CG    . ASN A 1  1110 ? -10.251 -79.871  9.247   1.00 185.68 ? 1110 ASN A CG    1 
ATOM   8559  O  OD1   . ASN A 1  1110 ? -9.696  -80.171  8.188   1.00 203.29 ? 1110 ASN A OD1   1 
ATOM   8560  N  ND2   . ASN A 1  1110 ? -11.289 -80.549  9.729   1.00 183.73 ? 1110 ASN A ND2   1 
ATOM   8561  N  N     . MET A 1  1111 ? -6.784  -77.948  8.065   1.00 113.95 ? 1111 MET A N     1 
ATOM   8562  C  CA    . MET A 1  1111 ? -6.387  -77.315  6.819   1.00 123.52 ? 1111 MET A CA    1 
ATOM   8563  C  C     . MET A 1  1111 ? -7.080  -77.999  5.641   1.00 111.66 ? 1111 MET A C     1 
ATOM   8564  O  O     . MET A 1  1111 ? -7.692  -79.059  5.781   1.00 103.35 ? 1111 MET A O     1 
ATOM   8565  C  CB    . MET A 1  1111 ? -4.868  -77.366  6.661   1.00 122.65 ? 1111 MET A CB    1 
ATOM   8566  C  CG    . MET A 1  1111 ? -4.233  -78.608  7.247   1.00 133.56 ? 1111 MET A CG    1 
ATOM   8567  S  SD    . MET A 1  1111 ? -2.509  -78.755  6.754   1.00 135.43 ? 1111 MET A SD    1 
ATOM   8568  C  CE    . MET A 1  1111 ? -2.678  -78.725  4.974   1.00 106.03 ? 1111 MET A CE    1 
ATOM   8569  N  N     . LYS A 1  1112 ? -6.911  -77.422  4.449   1.00 112.61 ? 1112 LYS A N     1 
ATOM   8570  C  CA    . LYS A 1  1112 ? -7.719  -77.798  3.290   1.00 122.08 ? 1112 LYS A CA    1 
ATOM   8571  C  C     . LYS A 1  1112 ? -7.080  -78.839  2.374   1.00 106.56 ? 1112 LYS A C     1 
ATOM   8572  O  O     . LYS A 1  1112 ? -7.804  -79.616  1.749   1.00 109.08 ? 1112 LYS A O     1 
ATOM   8573  C  CB    . LYS A 1  1112 ? -8.067  -76.559  2.455   1.00 117.11 ? 1112 LYS A CB    1 
ATOM   8574  C  CG    . LYS A 1  1112 ? -9.437  -76.605  1.795   1.00 139.79 ? 1112 LYS A CG    1 
ATOM   8575  C  CD    . LYS A 1  1112 ? -9.669  -75.374  0.920   1.00 166.18 ? 1112 LYS A CD    1 
ATOM   8576  C  CE    . LYS A 1  1112 ? -9.843  -74.107  1.758   1.00 171.40 ? 1112 LYS A CE    1 
ATOM   8577  N  NZ    . LYS A 1  1112 ? -9.328  -72.885  1.071   1.00 143.00 ? 1112 LYS A NZ    1 
ATOM   8578  N  N     . THR A 1  1113 ? -5.759  -78.868  2.253   1.00 115.57 ? 1113 THR A N     1 
ATOM   8579  C  CA    . THR A 1  1113 ? -5.058  -79.818  1.389   1.00 118.90 ? 1113 THR A CA    1 
ATOM   8580  C  C     . THR A 1  1113 ? -3.968  -80.532  2.186   1.00 131.50 ? 1113 THR A C     1 
ATOM   8581  O  O     . THR A 1  1113 ? -2.772  -80.314  1.952   1.00 155.71 ? 1113 THR A O     1 
ATOM   8582  C  CB    . THR A 1  1113 ? -4.463  -79.096  0.175   1.00 125.86 ? 1113 THR A CB    1 
ATOM   8583  O  OG1   . THR A 1  1113 ? -3.901  -77.838  0.580   1.00 157.71 ? 1113 THR A OG1   1 
ATOM   8584  C  CG2   . THR A 1  1113 ? -5.509  -78.829  -0.879  1.00 103.75 ? 1113 THR A CG2   1 
ATOM   8585  N  N     . PRO A 1  1114 ? -4.346  -81.400  3.148   1.00 105.31 ? 1114 PRO A N     1 
ATOM   8586  C  CA    . PRO A 1  1114 ? -3.321  -82.081  3.955   1.00 104.68 ? 1114 PRO A CA    1 
ATOM   8587  C  C     . PRO A 1  1114 ? -2.582  -83.158  3.169   1.00 125.98 ? 1114 PRO A C     1 
ATOM   8588  O  O     . PRO A 1  1114 ? -2.810  -84.355  3.370   1.00 169.79 ? 1114 PRO A O     1 
ATOM   8589  C  CB    . PRO A 1  1114 ? -4.128  -82.668  5.123   1.00 107.24 ? 1114 PRO A CB    1 
ATOM   8590  C  CG    . PRO A 1  1114 ? -5.382  -81.830  5.176   1.00 112.54 ? 1114 PRO A CG    1 
ATOM   8591  C  CD    . PRO A 1  1114 ? -5.686  -81.580  3.730   1.00 110.78 ? 1114 PRO A CD    1 
ATOM   8592  N  N     . SER A 1  1115 ? -1.685  -82.751  2.273   1.00 136.41 ? 1115 SER A N     1 
ATOM   8593  C  CA    . SER A 1  1115 ? -0.911  -83.719  1.510   1.00 132.85 ? 1115 SER A CA    1 
ATOM   8594  C  C     . SER A 1  1115 ? 0.195   -84.306  2.373   1.00 118.00 ? 1115 SER A C     1 
ATOM   8595  O  O     . SER A 1  1115 ? 0.488   -83.832  3.474   1.00 114.48 ? 1115 SER A O     1 
ATOM   8596  C  CB    . SER A 1  1115 ? -0.302  -83.085  0.254   1.00 153.72 ? 1115 SER A CB    1 
ATOM   8597  O  OG    . SER A 1  1115 ? 0.884   -83.765  -0.159  1.00 148.34 ? 1115 SER A OG    1 
ATOM   8598  N  N     . LEU A 1  1116 ? 0.790   -85.378  1.865   1.00 120.36 ? 1116 LEU A N     1 
ATOM   8599  C  CA    . LEU A 1  1116 ? 1.887   -86.048  2.543   1.00 121.45 ? 1116 LEU A CA    1 
ATOM   8600  C  C     . LEU A 1  1116 ? 2.857   -86.531  1.478   1.00 122.02 ? 1116 LEU A C     1 
ATOM   8601  O  O     . LEU A 1  1116 ? 2.458   -87.252  0.559   1.00 124.95 ? 1116 LEU A O     1 
ATOM   8602  C  CB    . LEU A 1  1116 ? 1.372   -87.212  3.395   1.00 121.44 ? 1116 LEU A CB    1 
ATOM   8603  C  CG    . LEU A 1  1116 ? 2.098   -87.504  4.708   1.00 111.54 ? 1116 LEU A CG    1 
ATOM   8604  C  CD1   . LEU A 1  1116 ? 1.441   -88.661  5.444   1.00 109.41 ? 1116 LEU A CD1   1 
ATOM   8605  C  CD2   . LEU A 1  1116 ? 3.568   -87.774  4.474   1.00 115.95 ? 1116 LEU A CD2   1 
ATOM   8606  N  N     . THR A 1  1117 ? 4.105   -86.098  1.560   1.00 120.88 ? 1117 THR A N     1 
ATOM   8607  C  CA    . THR A 1  1117 ? 5.121   -86.451  0.576   1.00 112.29 ? 1117 THR A CA    1 
ATOM   8608  C  C     . THR A 1  1117 ? 6.020   -87.509  1.214   1.00 109.99 ? 1117 THR A C     1 
ATOM   8609  O  O     . THR A 1  1117 ? 6.734   -87.226  2.182   1.00 122.15 ? 1117 THR A O     1 
ATOM   8610  C  CB    . THR A 1  1117 ? 5.890   -85.211  0.124   1.00 119.42 ? 1117 THR A CB    1 
ATOM   8611  O  OG1   . THR A 1  1117 ? 4.951   -84.217  -0.301  1.00 126.23 ? 1117 THR A OG1   1 
ATOM   8612  C  CG2   . THR A 1  1117 ? 6.813   -85.521  -1.044  1.00 125.71 ? 1117 THR A CG2   1 
ATOM   8613  N  N     . VAL A 1  1118 ? 5.941   -88.738  0.705   1.00 124.36 ? 1118 VAL A N     1 
ATOM   8614  C  CA    . VAL A 1  1118 ? 6.698   -89.876  1.226   1.00 141.02 ? 1118 VAL A CA    1 
ATOM   8615  C  C     . VAL A 1  1118 ? 7.759   -90.272  0.205   1.00 131.88 ? 1118 VAL A C     1 
ATOM   8616  O  O     . VAL A 1  1118 ? 7.437   -90.673  -0.921  1.00 113.75 ? 1118 VAL A O     1 
ATOM   8617  C  CB    . VAL A 1  1118 ? 5.780   -91.069  1.567   1.00 138.58 ? 1118 VAL A CB    1 
ATOM   8618  C  CG1   . VAL A 1  1118 ? 4.995   -90.816  2.840   1.00 138.64 ? 1118 VAL A CG1   1 
ATOM   8619  C  CG2   . VAL A 1  1118 ? 4.793   -91.343  0.452   1.00 122.93 ? 1118 VAL A CG2   1 
ATOM   8620  N  N     . TYR A 1  1119 ? 9.025   -90.121  0.586   1.00 130.84 ? 1119 TYR A N     1 
ATOM   8621  C  CA    . TYR A 1  1119 ? 10.136  -90.653  -0.188  1.00 113.78 ? 1119 TYR A CA    1 
ATOM   8622  C  C     . TYR A 1  1119 ? 10.429  -92.067  0.274   1.00 120.66 ? 1119 TYR A C     1 
ATOM   8623  O  O     . TYR A 1  1119 ? 10.236  -92.405  1.445   1.00 138.41 ? 1119 TYR A O     1 
ATOM   8624  C  CB    . TYR A 1  1119 ? 11.393  -89.783  -0.055  1.00 124.61 ? 1119 TYR A CB    1 
ATOM   8625  C  CG    . TYR A 1  1119 ? 11.164  -88.341  -0.439  1.00 111.83 ? 1119 TYR A CG    1 
ATOM   8626  C  CD1   . TYR A 1  1119 ? 11.506  -87.877  -1.697  1.00 116.61 ? 1119 TYR A CD1   1 
ATOM   8627  C  CD2   . TYR A 1  1119 ? 10.585  -87.452  0.447   1.00 110.65 ? 1119 TYR A CD2   1 
ATOM   8628  C  CE1   . TYR A 1  1119 ? 11.277  -86.555  -2.061  1.00 128.97 ? 1119 TYR A CE1   1 
ATOM   8629  C  CE2   . TYR A 1  1119 ? 10.354  -86.138  0.094   1.00 121.76 ? 1119 TYR A CE2   1 
ATOM   8630  C  CZ    . TYR A 1  1119 ? 10.699  -85.692  -1.161  1.00 128.73 ? 1119 TYR A CZ    1 
ATOM   8631  O  OH    . TYR A 1  1119 ? 10.464  -84.380  -1.510  1.00 121.99 ? 1119 TYR A OH    1 
ATOM   8632  N  N     . LEU A 1  1120 ? 10.828  -92.909  -0.671  1.00 121.87 ? 1120 LEU A N     1 
ATOM   8633  C  CA    . LEU A 1  1120 ? 11.056  -94.324  -0.416  1.00 152.53 ? 1120 LEU A CA    1 
ATOM   8634  C  C     . LEU A 1  1120 ? 12.539  -94.598  -0.174  1.00 143.71 ? 1120 LEU A C     1 
ATOM   8635  O  O     . LEU A 1  1120 ? 13.393  -93.728  -0.365  1.00 149.25 ? 1120 LEU A O     1 
ATOM   8636  C  CB    . LEU A 1  1120 ? 10.511  -95.168  -1.576  1.00 164.16 ? 1120 LEU A CB    1 
ATOM   8637  C  CG    . LEU A 1  1120 ? 10.769  -94.723  -3.023  1.00 172.18 ? 1120 LEU A CG    1 
ATOM   8638  C  CD1   . LEU A 1  1120 ? 12.248  -94.655  -3.409  1.00 181.00 ? 1120 LEU A CD1   1 
ATOM   8639  C  CD2   . LEU A 1  1120 ? 9.997   -95.647  -3.970  1.00 120.14 ? 1120 LEU A CD2   1 
ATOM   8640  N  N     . GLU A 1  1121 ? 12.836  -95.837  0.254   1.00 140.47 ? 1121 GLU A N     1 
ATOM   8641  C  CA    . GLU A 1  1121 ? 14.167  -96.264  0.679   1.00 148.01 ? 1121 GLU A CA    1 
ATOM   8642  C  C     . GLU A 1  1121 ? 15.216  -95.956  -0.386  1.00 158.94 ? 1121 GLU A C     1 
ATOM   8643  O  O     . GLU A 1  1121 ? 14.900  -95.945  -1.586  1.00 150.13 ? 1121 GLU A O     1 
ATOM   8644  C  CB    . GLU A 1  1121 ? 14.192  -97.759  1.002   1.00 170.29 ? 1121 GLU A CB    1 
ATOM   8645  C  CG    . GLU A 1  1121 ? 14.434  -98.075  2.473   1.00 180.90 ? 1121 GLU A CG    1 
ATOM   8646  C  CD    . GLU A 1  1121 ? 14.068  -99.501  2.834   1.00 185.69 ? 1121 GLU A CD    1 
ATOM   8647  O  OE1   . GLU A 1  1121 ? 14.458  -100.426 2.085   1.00 181.65 ? 1121 GLU A OE1   1 
ATOM   8648  O  OE2   . GLU A 1  1121 ? 13.392  -99.694  3.868   1.00 181.26 ? 1121 GLU A OE2   1 
ATOM   8649  N  N     . PRO A 1  1122 ? 16.469  -95.700  0.018   1.00 164.98 ? 1122 PRO A N     1 
ATOM   8650  C  CA    . PRO A 1  1122 ? 17.465  -95.182  -0.945  1.00 161.13 ? 1122 PRO A CA    1 
ATOM   8651  C  C     . PRO A 1  1122 ? 17.675  -96.063  -2.170  1.00 158.80 ? 1122 PRO A C     1 
ATOM   8652  O  O     . PRO A 1  1122 ? 17.649  -95.565  -3.306  1.00 155.07 ? 1122 PRO A O     1 
ATOM   8653  C  CB    . PRO A 1  1122 ? 18.732  -95.075  -0.086  1.00 141.00 ? 1122 PRO A CB    1 
ATOM   8654  C  CG    . PRO A 1  1122 ? 18.214  -94.858  1.307   1.00 134.31 ? 1122 PRO A CG    1 
ATOM   8655  C  CD    . PRO A 1  1122 ? 16.980  -95.700  1.401   1.00 149.28 ? 1122 PRO A CD    1 
ATOM   8656  N  N     . GLY A 1  1123 ? 17.882  -97.362  -1.972  1.00 157.55 ? 1123 GLY A N     1 
ATOM   8657  C  CA    . GLY A 1  1123 ? 18.147  -98.277  -3.066  1.00 168.85 ? 1123 GLY A CA    1 
ATOM   8658  C  C     . GLY A 1  1123 ? 16.908  -98.636  -3.864  1.00 184.38 ? 1123 GLY A C     1 
ATOM   8659  O  O     . GLY A 1  1123 ? 16.748  -99.795  -4.265  1.00 188.00 ? 1123 GLY A O     1 
ATOM   8660  N  N     . HIS A 1  1124 ? 16.016  -97.654  -4.105  1.00 181.17 ? 1124 HIS A N     1 
ATOM   8661  C  CA    . HIS A 1  1124 ? 14.763  -97.932  -4.797  1.00 179.20 ? 1124 HIS A CA    1 
ATOM   8662  C  C     . HIS A 1  1124 ? 14.275  -96.723  -5.590  1.00 185.45 ? 1124 HIS A C     1 
ATOM   8663  O  O     . HIS A 1  1124 ? 13.071  -96.594  -5.839  1.00 189.95 ? 1124 HIS A O     1 
ATOM   8664  C  CB    . HIS A 1  1124 ? 13.683  -98.347  -3.786  1.00 190.39 ? 1124 HIS A CB    1 
ATOM   8665  C  CG    . HIS A 1  1124 ? 14.013  -99.600  -3.033  1.00 203.77 ? 1124 HIS A CG    1 
ATOM   8666  N  ND1   . HIS A 1  1124 ? 14.567  -99.576  -1.770  1.00 204.50 ? 1124 HIS A ND1   1 
ATOM   8667  C  CD2   . HIS A 1  1124 ? 13.912  -100.907 -3.373  1.00 203.60 ? 1124 HIS A CD2   1 
ATOM   8668  C  CE1   . HIS A 1  1124 ? 14.769  -100.813 -1.355  1.00 201.98 ? 1124 HIS A CE1   1 
ATOM   8669  N  NE2   . HIS A 1  1124 ? 14.384  -101.640 -2.311  1.00 203.03 ? 1124 HIS A NE2   1 
ATOM   8670  N  N     . ALA A 1  1125 ? 15.192  -95.841  -6.001  1.00 184.88 ? 1125 ALA A N     1 
ATOM   8671  C  CA    . ALA A 1  1125 ? 14.809  -94.587  -6.647  1.00 178.97 ? 1125 ALA A CA    1 
ATOM   8672  C  C     . ALA A 1  1125 ? 14.018  -94.845  -7.926  1.00 170.05 ? 1125 ALA A C     1 
ATOM   8673  O  O     . ALA A 1  1125 ? 12.936  -94.280  -8.129  1.00 160.63 ? 1125 ALA A O     1 
ATOM   8674  C  CB    . ALA A 1  1125 ? 16.055  -93.746  -6.940  1.00 172.28 ? 1125 ALA A CB    1 
ATOM   8675  N  N     . ALA A 1  1126 ? 14.558  -95.682  -8.810  1.00 160.35 ? 1126 ALA A N     1 
ATOM   8676  C  CA    . ALA A 1  1126 ? 13.935  -95.985  -10.089 1.00 143.03 ? 1126 ALA A CA    1 
ATOM   8677  C  C     . ALA A 1  1126 ? 13.011  -97.193  -10.031 1.00 159.74 ? 1126 ALA A C     1 
ATOM   8678  O  O     . ALA A 1  1126 ? 12.275  -97.431  -10.995 1.00 155.78 ? 1126 ALA A O     1 
ATOM   8679  C  CB    . ALA A 1  1126 ? 15.004  -96.217  -11.161 1.00 134.50 ? 1126 ALA A CB    1 
ATOM   8680  N  N     . ASP A 1  1127 ? 13.014  -97.953  -8.932  1.00 176.00 ? 1127 ASP A N     1 
ATOM   8681  C  CA    . ASP A 1  1127 ? 12.160  -99.136  -8.857  1.00 199.25 ? 1127 ASP A CA    1 
ATOM   8682  C  C     . ASP A 1  1127 ? 10.697  -98.711  -8.856  1.00 187.82 ? 1127 ASP A C     1 
ATOM   8683  O  O     . ASP A 1  1127 ? 10.126  -98.398  -7.805  1.00 189.42 ? 1127 ASP A O     1 
ATOM   8684  C  CB    . ASP A 1  1127 ? 12.492  -99.970  -7.612  1.00 212.80 ? 1127 ASP A CB    1 
ATOM   8685  C  CG    . ASP A 1  1127 ? 11.829  -101.350 -7.621  1.00 211.36 ? 1127 ASP A CG    1 
ATOM   8686  O  OD1   . ASP A 1  1127 ? 11.045  -101.643 -8.548  1.00 214.41 ? 1127 ASP A OD1   1 
ATOM   8687  O  OD2   . ASP A 1  1127 ? 12.094  -102.143 -6.688  1.00 201.91 ? 1127 ASP A OD2   1 
ATOM   8688  N  N     . GLN A 1  1128 ? 10.089  -98.691  -10.043 1.00 170.04 ? 1128 GLN A N     1 
ATOM   8689  C  CA    . GLN A 1  1128 ? 8.706   -98.255  -10.153 1.00 163.49 ? 1128 GLN A CA    1 
ATOM   8690  C  C     . GLN A 1  1128 ? 7.768   -99.258  -9.500  1.00 179.20 ? 1128 GLN A C     1 
ATOM   8691  O  O     . GLN A 1  1128 ? 6.740   -98.878  -8.931  1.00 176.65 ? 1128 GLN A O     1 
ATOM   8692  C  CB    . GLN A 1  1128 ? 8.345   -98.060  -11.627 1.00 157.32 ? 1128 GLN A CB    1 
ATOM   8693  C  CG    . GLN A 1  1128 ? 7.078   -97.249  -11.863 1.00 159.47 ? 1128 GLN A CG    1 
ATOM   8694  C  CD    . GLN A 1  1128 ? 6.315   -97.725  -13.077 1.00 172.50 ? 1128 GLN A CD    1 
ATOM   8695  O  OE1   . GLN A 1  1128 ? 6.236   -98.926  -13.340 1.00 188.05 ? 1128 GLN A OE1   1 
ATOM   8696  N  NE2   . GLN A 1  1128 ? 5.767   -96.784  -13.840 1.00 157.34 ? 1128 GLN A NE2   1 
ATOM   8697  N  N     . GLU A 1  1129 ? 8.099   -100.544 -9.611  1.00 187.94 ? 1129 GLU A N     1 
ATOM   8698  C  CA    . GLU A 1  1129 ? 7.293   -101.588 -9.004  1.00 204.41 ? 1129 GLU A CA    1 
ATOM   8699  C  C     . GLU A 1  1129 ? 7.272   -101.456 -7.484  1.00 196.71 ? 1129 GLU A C     1 
ATOM   8700  O  O     . GLU A 1  1129 ? 6.240   -101.685 -6.846  1.00 196.58 ? 1129 GLU A O     1 
ATOM   8701  C  CB    . GLU A 1  1129 ? 7.804   -102.966 -9.437  1.00 216.16 ? 1129 GLU A CB    1 
ATOM   8702  C  CG    . GLU A 1  1129 ? 7.034   -103.578 -10.614 1.00 215.38 ? 1129 GLU A CG    1 
ATOM   8703  C  CD    . GLU A 1  1129 ? 5.574   -103.176 -10.610 1.00 216.36 ? 1129 GLU A CD    1 
ATOM   8704  O  OE1   . GLU A 1  1129 ? 5.205   -102.258 -11.376 1.00 211.25 ? 1129 GLU A OE1   1 
ATOM   8705  O  OE2   . GLU A 1  1129 ? 4.799   -103.749 -9.813  1.00 215.60 ? 1129 GLU A OE2   1 
ATOM   8706  N  N     . GLN A 1  1130 ? 8.415   -101.115 -6.888  1.00 190.14 ? 1130 GLN A N     1 
ATOM   8707  C  CA    . GLN A 1  1130 ? 8.468   -100.835 -5.459  1.00 190.35 ? 1130 GLN A CA    1 
ATOM   8708  C  C     . GLN A 1  1130 ? 7.561   -99.672  -5.078  1.00 185.54 ? 1130 GLN A C     1 
ATOM   8709  O  O     . GLN A 1  1130 ? 6.848   -99.732  -4.066  1.00 188.85 ? 1130 GLN A O     1 
ATOM   8710  C  CB    . GLN A 1  1130 ? 9.907   -100.545 -5.032  1.00 189.88 ? 1130 GLN A CB    1 
ATOM   8711  C  CG    . GLN A 1  1130 ? 10.037  -99.802  -3.713  1.00 187.74 ? 1130 GLN A CG    1 
ATOM   8712  C  CD    . GLN A 1  1130 ? 9.927   -100.726 -2.515  1.00 185.29 ? 1130 GLN A CD    1 
ATOM   8713  O  OE1   . GLN A 1  1130 ? 9.099   -101.637 -2.487  1.00 201.93 ? 1130 GLN A OE1   1 
ATOM   8714  N  NE2   . GLN A 1  1130 ? 10.772  -100.499 -1.521  1.00 166.18 ? 1130 GLN A NE2   1 
ATOM   8715  N  N     . ALA A 1  1131 ? 7.554   -98.615  -5.887  1.00 176.41 ? 1131 ALA A N     1 
ATOM   8716  C  CA    . ALA A 1  1131 ? 6.638   -97.504  -5.654  1.00 165.41 ? 1131 ALA A CA    1 
ATOM   8717  C  C     . ALA A 1  1131 ? 5.185   -97.944  -5.764  1.00 159.57 ? 1131 ALA A C     1 
ATOM   8718  O  O     . ALA A 1  1131 ? 4.342   -97.522  -4.963  1.00 149.50 ? 1131 ALA A O     1 
ATOM   8719  C  CB    . ALA A 1  1131 ? 6.930   -96.377  -6.641  1.00 171.96 ? 1131 ALA A CB    1 
ATOM   8720  N  N     . LYS A 1  1132 ? 4.875   -98.792  -6.748  1.00 157.22 ? 1132 LYS A N     1 
ATOM   8721  C  CA    . LYS A 1  1132 ? 3.522   -99.319  -6.879  1.00 152.67 ? 1132 LYS A CA    1 
ATOM   8722  C  C     . LYS A 1  1132 ? 3.142   -100.133 -5.648  1.00 145.88 ? 1132 LYS A C     1 
ATOM   8723  O  O     . LYS A 1  1132 ? 1.998   -100.060 -5.163  1.00 138.72 ? 1132 LYS A O     1 
ATOM   8724  C  CB    . LYS A 1  1132 ? 3.428   -100.186 -8.142  1.00 166.92 ? 1132 LYS A CB    1 
ATOM   8725  C  CG    . LYS A 1  1132 ? 2.747   -99.547  -9.356  1.00 173.26 ? 1132 LYS A CG    1 
ATOM   8726  C  CD    . LYS A 1  1132 ? 2.547   -100.560 -10.493 1.00 187.12 ? 1132 LYS A CD    1 
ATOM   8727  C  CE    . LYS A 1  1132 ? 1.309   -101.430 -10.266 1.00 182.21 ? 1132 LYS A CE    1 
ATOM   8728  N  NZ    . LYS A 1  1132 ? 0.064   -100.833 -10.828 1.00 164.50 ? 1132 LYS A NZ    1 
ATOM   8729  N  N     . LEU A 1  1133 ? 4.116   -100.853 -5.086  1.00 151.27 ? 1133 LEU A N     1 
ATOM   8730  C  CA    . LEU A 1  1133 ? 3.851   -101.669 -3.907  1.00 159.53 ? 1133 LEU A CA    1 
ATOM   8731  C  C     . LEU A 1  1133 ? 3.593   -100.792 -2.695  1.00 144.12 ? 1133 LEU A C     1 
ATOM   8732  O  O     . LEU A 1  1133 ? 2.756   -101.126 -1.850  1.00 141.65 ? 1133 LEU A O     1 
ATOM   8733  C  CB    . LEU A 1  1133 ? 5.022   -102.625 -3.650  1.00 156.32 ? 1133 LEU A CB    1 
ATOM   8734  C  CG    . LEU A 1  1133 ? 4.998   -104.046 -4.225  1.00 154.10 ? 1133 LEU A CG    1 
ATOM   8735  C  CD1   . LEU A 1  1133 ? 4.475   -104.089 -5.655  1.00 150.76 ? 1133 LEU A CD1   1 
ATOM   8736  C  CD2   . LEU A 1  1133 ? 6.398   -104.641 -4.153  1.00 147.59 ? 1133 LEU A CD2   1 
ATOM   8737  N  N     . ILE A 1  1134 ? 4.310   -99.672  -2.577  1.00 144.31 ? 1134 ILE A N     1 
ATOM   8738  C  CA    . ILE A 1  1134 ? 4.046   -98.824  -1.422  1.00 143.08 ? 1134 ILE A CA    1 
ATOM   8739  C  C     . ILE A 1  1134 ? 2.711   -98.112  -1.600  1.00 142.81 ? 1134 ILE A C     1 
ATOM   8740  O  O     . ILE A 1  1134 ? 1.969   -97.907  -0.623  1.00 137.96 ? 1134 ILE A O     1 
ATOM   8741  C  CB    . ILE A 1  1134 ? 5.200   -97.825  -1.216  1.00 135.49 ? 1134 ILE A CB    1 
ATOM   8742  C  CG1   . ILE A 1  1134 ? 6.533   -98.563  -1.087  1.00 144.25 ? 1134 ILE A CG1   1 
ATOM   8743  C  CG2   . ILE A 1  1134 ? 4.969   -96.977  0.031   1.00 119.33 ? 1134 ILE A CG2   1 
ATOM   8744  C  CD1   . ILE A 1  1134 ? 6.753   -99.207  0.264   1.00 154.17 ? 1134 ILE A CD1   1 
ATOM   8745  N  N     . ARG A 1  1135 ? 2.352   -97.776  -2.850  1.00 142.90 ? 1135 ARG A N     1 
ATOM   8746  C  CA    . ARG A 1  1135 ? 1.048   -97.170  -3.098  1.00 141.72 ? 1135 ARG A CA    1 
ATOM   8747  C  C     . ARG A 1  1135 ? -0.046  -98.077  -2.579  1.00 150.57 ? 1135 ARG A C     1 
ATOM   8748  O  O     . ARG A 1  1135 ? -0.905  -97.653  -1.799  1.00 144.33 ? 1135 ARG A O     1 
ATOM   8749  C  CB    . ARG A 1  1135 ? 0.809   -96.891  -4.588  1.00 149.47 ? 1135 ARG A CB    1 
ATOM   8750  C  CG    . ARG A 1  1135 ? -0.463  -96.035  -4.822  1.00 152.32 ? 1135 ARG A CG    1 
ATOM   8751  C  CD    . ARG A 1  1135 ? -1.333  -96.474  -6.001  1.00 155.88 ? 1135 ARG A CD    1 
ATOM   8752  N  NE    . ARG A 1  1135 ? -0.599  -97.116  -7.084  1.00 183.03 ? 1135 ARG A NE    1 
ATOM   8753  C  CZ    . ARG A 1  1135 ? -0.882  -98.332  -7.544  1.00 208.54 ? 1135 ARG A CZ    1 
ATOM   8754  N  NH1   . ARG A 1  1135 ? -1.879  -99.032  -7.014  1.00 221.10 ? 1135 ARG A NH1   1 
ATOM   8755  N  NH2   . ARG A 1  1135 ? -0.178  -98.848  -8.537  1.00 200.88 ? 1135 ARG A NH2   1 
ATOM   8756  N  N     . SER A 1  1136 ? -0.009  -99.350  -2.995  1.00 156.84 ? 1136 SER A N     1 
ATOM   8757  C  CA    . SER A 1  1136 ? -0.998  -100.300 -2.510  1.00 154.75 ? 1136 SER A CA    1 
ATOM   8758  C  C     . SER A 1  1136 ? -0.832  -100.571 -1.021  1.00 150.25 ? 1136 SER A C     1 
ATOM   8759  O  O     . SER A 1  1136 ? -1.796  -100.981 -0.364  1.00 152.00 ? 1136 SER A O     1 
ATOM   8760  C  CB    . SER A 1  1136 ? -0.890  -101.608 -3.309  1.00 154.02 ? 1136 SER A CB    1 
ATOM   8761  O  OG    . SER A 1  1136 ? -0.919  -101.378 -4.713  1.00 141.80 ? 1136 SER A OG    1 
ATOM   8762  N  N     . ALA A 1  1137 ? 0.359   -100.301 -0.476  1.00 147.98 ? 1137 ALA A N     1 
ATOM   8763  C  CA    . ALA A 1  1137 ? 0.651   -100.587 0.922   1.00 145.90 ? 1137 ALA A CA    1 
ATOM   8764  C  C     . ALA A 1  1137 ? 0.042   -99.571  1.877   1.00 135.02 ? 1137 ALA A C     1 
ATOM   8765  O  O     . ALA A 1  1137 ? -0.244  -99.919  3.030   1.00 120.86 ? 1137 ALA A O     1 
ATOM   8766  C  CB    . ALA A 1  1137 ? 2.167   -100.642 1.136   1.00 138.55 ? 1137 ALA A CB    1 
ATOM   8767  N  N     . ILE A 1  1138 ? -0.190  -98.331  1.424   1.00 133.92 ? 1138 ILE A N     1 
ATOM   8768  C  CA    . ILE A 1  1138 ? -0.644  -97.284  2.343   1.00 140.59 ? 1138 ILE A CA    1 
ATOM   8769  C  C     . ILE A 1  1138 ? -2.002  -96.713  1.947   1.00 144.91 ? 1138 ILE A C     1 
ATOM   8770  O  O     . ILE A 1  1138 ? -2.738  -96.203  2.800   1.00 134.56 ? 1138 ILE A O     1 
ATOM   8771  C  CB    . ILE A 1  1138 ? 0.372   -96.127  2.438   1.00 149.88 ? 1138 ILE A CB    1 
ATOM   8772  C  CG1   . ILE A 1  1138 ? 0.609   -95.516  1.057   1.00 148.56 ? 1138 ILE A CG1   1 
ATOM   8773  C  CG2   . ILE A 1  1138 ? 1.688   -96.596  3.049   1.00 143.24 ? 1138 ILE A CG2   1 
ATOM   8774  C  CD1   . ILE A 1  1138 ? 1.398   -94.235  1.077   1.00 115.91 ? 1138 ILE A CD1   1 
ATOM   8775  N  N     . GLU A 1  1139 ? -2.334  -96.760  0.659   1.00 164.10 ? 1139 GLU A N     1 
ATOM   8776  C  CA    . GLU A 1  1139 ? -3.561  -96.137  0.172   1.00 157.58 ? 1139 GLU A CA    1 
ATOM   8777  C  C     . GLU A 1  1139 ? -4.776  -96.871  0.724   1.00 157.10 ? 1139 GLU A C     1 
ATOM   8778  O  O     . GLU A 1  1139 ? -4.969  -98.061  0.453   1.00 172.79 ? 1139 GLU A O     1 
ATOM   8779  C  CB    . GLU A 1  1139 ? -3.595  -96.121  -1.354  1.00 165.23 ? 1139 GLU A CB    1 
ATOM   8780  C  CG    . GLU A 1  1139 ? -4.962  -95.811  -1.934  1.00 164.05 ? 1139 GLU A CG    1 
ATOM   8781  C  CD    . GLU A 1  1139 ? -4.973  -95.907  -3.441  1.00 180.38 ? 1139 GLU A CD    1 
ATOM   8782  O  OE1   . GLU A 1  1139 ? -4.843  -97.028  -3.981  1.00 187.01 ? 1139 GLU A OE1   1 
ATOM   8783  O  OE2   . GLU A 1  1139 ? -5.084  -94.848  -4.089  1.00 174.70 ? 1139 GLU A OE2   1 
ATOM   8784  N  N     . HIS A 1  1140 ? -5.586  -96.163  1.506   1.00 144.96 ? 1140 HIS A N     1 
ATOM   8785  C  CA    . HIS A 1  1140 ? -6.733  -96.773  2.163   1.00 151.75 ? 1140 HIS A CA    1 
ATOM   8786  C  C     . HIS A 1  1140 ? -7.722  -97.285  1.131   1.00 156.65 ? 1140 HIS A C     1 
ATOM   8787  O  O     . HIS A 1  1140 ? -7.866  -96.720  0.046   1.00 162.40 ? 1140 HIS A O     1 
ATOM   8788  C  CB    . HIS A 1  1140 ? -7.440  -95.739  3.037   1.00 151.38 ? 1140 HIS A CB    1 
ATOM   8789  C  CG    . HIS A 1  1140 ? -8.259  -96.307  4.152   1.00 131.44 ? 1140 HIS A CG    1 
ATOM   8790  N  ND1   . HIS A 1  1140 ? -9.501  -95.80