data_5OXV
# 
_entry.id   5OXV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.299 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5OXV         
WWPDB D_1200006525 
# 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.db_id          5OY7 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5OXV 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ekundayo, B.' 1 0000-0003-0348-4680 
'Schalch, T.'  2 0000-0002-0758-3013 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Mol. Biol.' 
_citation.journal_id_ASTM           JMOBAK 
_citation.journal_id_CSD            0070 
_citation.journal_id_ISSN           1089-8638 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            429 
_citation.language                  ? 
_citation.page_first                3031 
_citation.page_last                 3042 
_citation.title                     'Capturing Structural Heterogeneity in Chromatin Fibers.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2017.09.002 
_citation.pdbx_database_id_PubMed   28893533 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ekundayo, B.'   1 ? 
primary 'Richmond, T.J.' 2 ? 
primary 'Schalch, T.'    3 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   124.74 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5OXV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     348.839 
_cell.length_a_esd                 ? 
_cell.length_b                     63.274 
_cell.length_b_esd                 ? 
_cell.length_c                     271.361 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5OXV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA STRAND 1 (601-based sequence model)' 96886.500 1 ? ? ? ? 
2 polymer man 'Histone H2B 1.1'                         13979.291 4 ? ? ? ? 
3 polymer man 'Histone H2A'                             14109.436 4 ? ? ? ? 
4 polymer man 'Histone H4'                              11263.231 4 ? ? ? ? 
5 polymer man 'Histone H3.2'                            15303.930 4 ? ? ? ? 
6 polymer man 'DNA STRAND 2 (601-based sequence model)' 96147.062 1 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        H2B1.1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DC)(DG)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)
(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)
(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)
(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)
(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)
(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)
(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)
(DG)(DG)(DA)(DT)(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DA)(DG)(DT)(DA)(DC)(DT)(DG)(DC)
(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)
(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)
(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)
(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)
(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)
(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)
(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)
(DT)(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DG)(DA)(DG)(DT)
;
;CTGCGCAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCG
CGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGAGTACTGC
ACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTA
CGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAGGGAGT
;
J       ? 
2 'polypeptide(L)'        no no 
;MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
;MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
R,N,H,D ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
Q,M,G,C ? 
4 'polypeptide(L)'        no no 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
P,L,F,B ? 
5 'polypeptide(L)'        no no 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
O,K,E,A ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)
(DG)(DC)(DC)(DG)(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)
(DC)(DG)(DT)(DA)(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)
(DC)(DT)(DT)(DA)(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)
(DG)(DT)(DC)(DC)(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)
(DC)(DA)(DA)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)
(DC)(DT)(DC)(DC)(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)
(DT)(DA)(DT)(DA)(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DC)(DA)(DG)(DT)(DA)(DC)(DT)
(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)
(DA)(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)
(DG)(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)
(DA)(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)
(DC)(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)
(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)
(DA)(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)
(DC)(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DC)(DA)(DG)(DT)
;
;ATCCCCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCT
GTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCAGTACT
CCTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCC
CCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCAGT
;
I       ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DC  n 
1 2   DT  n 
1 3   DG  n 
1 4   DC  n 
1 5   DG  n 
1 6   DC  n 
1 7   DA  n 
1 8   DG  n 
1 9   DG  n 
1 10  DA  n 
1 11  DT  n 
1 12  DG  n 
1 13  DT  n 
1 14  DA  n 
1 15  DT  n 
1 16  DA  n 
1 17  DT  n 
1 18  DA  n 
1 19  DT  n 
1 20  DC  n 
1 21  DT  n 
1 22  DG  n 
1 23  DA  n 
1 24  DC  n 
1 25  DA  n 
1 26  DC  n 
1 27  DG  n 
1 28  DT  n 
1 29  DG  n 
1 30  DC  n 
1 31  DC  n 
1 32  DT  n 
1 33  DG  n 
1 34  DG  n 
1 35  DA  n 
1 36  DG  n 
1 37  DA  n 
1 38  DC  n 
1 39  DT  n 
1 40  DA  n 
1 41  DG  n 
1 42  DG  n 
1 43  DG  n 
1 44  DA  n 
1 45  DG  n 
1 46  DT  n 
1 47  DA  n 
1 48  DA  n 
1 49  DT  n 
1 50  DC  n 
1 51  DC  n 
1 52  DC  n 
1 53  DC  n 
1 54  DT  n 
1 55  DT  n 
1 56  DG  n 
1 57  DG  n 
1 58  DC  n 
1 59  DG  n 
1 60  DG  n 
1 61  DT  n 
1 62  DT  n 
1 63  DA  n 
1 64  DA  n 
1 65  DA  n 
1 66  DA  n 
1 67  DC  n 
1 68  DG  n 
1 69  DC  n 
1 70  DG  n 
1 71  DG  n 
1 72  DG  n 
1 73  DG  n 
1 74  DG  n 
1 75  DA  n 
1 76  DC  n 
1 77  DA  n 
1 78  DG  n 
1 79  DC  n 
1 80  DG  n 
1 81  DC  n 
1 82  DG  n 
1 83  DT  n 
1 84  DA  n 
1 85  DC  n 
1 86  DG  n 
1 87  DT  n 
1 88  DG  n 
1 89  DC  n 
1 90  DG  n 
1 91  DT  n 
1 92  DT  n 
1 93  DT  n 
1 94  DA  n 
1 95  DA  n 
1 96  DG  n 
1 97  DC  n 
1 98  DG  n 
1 99  DG  n 
1 100 DT  n 
1 101 DG  n 
1 102 DC  n 
1 103 DT  n 
1 104 DA  n 
1 105 DG  n 
1 106 DA  n 
1 107 DG  n 
1 108 DC  n 
1 109 DT  n 
1 110 DG  n 
1 111 DT  n 
1 112 DC  n 
1 113 DT  n 
1 114 DA  n 
1 115 DC  n 
1 116 DG  n 
1 117 DA  n 
1 118 DC  n 
1 119 DC  n 
1 120 DA  n 
1 121 DA  n 
1 122 DT  n 
1 123 DT  n 
1 124 DG  n 
1 125 DA  n 
1 126 DG  n 
1 127 DC  n 
1 128 DG  n 
1 129 DG  n 
1 130 DC  n 
1 131 DC  n 
1 132 DT  n 
1 133 DC  n 
1 134 DG  n 
1 135 DG  n 
1 136 DC  n 
1 137 DA  n 
1 138 DC  n 
1 139 DC  n 
1 140 DG  n 
1 141 DG  n 
1 142 DG  n 
1 143 DA  n 
1 144 DT  n 
1 145 DT  n 
1 146 DC  n 
1 147 DT  n 
1 148 DC  n 
1 149 DC  n 
1 150 DA  n 
1 151 DG  n 
1 152 DG  n 
1 153 DA  n 
1 154 DG  n 
1 155 DT  n 
1 156 DA  n 
1 157 DC  n 
1 158 DT  n 
1 159 DG  n 
1 160 DC  n 
1 161 DA  n 
1 162 DC  n 
1 163 DA  n 
1 164 DG  n 
1 165 DG  n 
1 166 DA  n 
1 167 DT  n 
1 168 DG  n 
1 169 DT  n 
1 170 DA  n 
1 171 DT  n 
1 172 DA  n 
1 173 DT  n 
1 174 DA  n 
1 175 DT  n 
1 176 DC  n 
1 177 DT  n 
1 178 DG  n 
1 179 DA  n 
1 180 DC  n 
1 181 DA  n 
1 182 DC  n 
1 183 DG  n 
1 184 DT  n 
1 185 DG  n 
1 186 DC  n 
1 187 DC  n 
1 188 DT  n 
1 189 DG  n 
1 190 DG  n 
1 191 DA  n 
1 192 DG  n 
1 193 DA  n 
1 194 DC  n 
1 195 DT  n 
1 196 DA  n 
1 197 DG  n 
1 198 DG  n 
1 199 DG  n 
1 200 DA  n 
1 201 DG  n 
1 202 DT  n 
1 203 DA  n 
1 204 DA  n 
1 205 DT  n 
1 206 DC  n 
1 207 DC  n 
1 208 DC  n 
1 209 DC  n 
1 210 DT  n 
1 211 DT  n 
1 212 DG  n 
1 213 DG  n 
1 214 DC  n 
1 215 DG  n 
1 216 DG  n 
1 217 DT  n 
1 218 DT  n 
1 219 DA  n 
1 220 DA  n 
1 221 DA  n 
1 222 DA  n 
1 223 DC  n 
1 224 DG  n 
1 225 DC  n 
1 226 DG  n 
1 227 DG  n 
1 228 DG  n 
1 229 DG  n 
1 230 DG  n 
1 231 DA  n 
1 232 DC  n 
1 233 DA  n 
1 234 DG  n 
1 235 DC  n 
1 236 DG  n 
1 237 DC  n 
1 238 DG  n 
1 239 DT  n 
1 240 DA  n 
1 241 DC  n 
1 242 DG  n 
1 243 DT  n 
1 244 DG  n 
1 245 DC  n 
1 246 DG  n 
1 247 DT  n 
1 248 DT  n 
1 249 DT  n 
1 250 DA  n 
1 251 DA  n 
1 252 DG  n 
1 253 DC  n 
1 254 DG  n 
1 255 DG  n 
1 256 DT  n 
1 257 DG  n 
1 258 DC  n 
1 259 DT  n 
1 260 DA  n 
1 261 DG  n 
1 262 DA  n 
1 263 DG  n 
1 264 DC  n 
1 265 DT  n 
1 266 DG  n 
1 267 DT  n 
1 268 DC  n 
1 269 DT  n 
1 270 DA  n 
1 271 DC  n 
1 272 DG  n 
1 273 DA  n 
1 274 DC  n 
1 275 DC  n 
1 276 DA  n 
1 277 DA  n 
1 278 DT  n 
1 279 DT  n 
1 280 DG  n 
1 281 DA  n 
1 282 DG  n 
1 283 DC  n 
1 284 DG  n 
1 285 DG  n 
1 286 DC  n 
1 287 DC  n 
1 288 DT  n 
1 289 DC  n 
1 290 DG  n 
1 291 DG  n 
1 292 DC  n 
1 293 DA  n 
1 294 DC  n 
1 295 DC  n 
1 296 DG  n 
1 297 DG  n 
1 298 DG  n 
1 299 DA  n 
1 300 DT  n 
1 301 DT  n 
1 302 DC  n 
1 303 DT  n 
1 304 DC  n 
1 305 DC  n 
1 306 DA  n 
1 307 DG  n 
1 308 DG  n 
1 309 DG  n 
1 310 DA  n 
1 311 DG  n 
1 312 DT  n 
2 1   MET n 
2 2   PRO n 
2 3   GLU n 
2 4   PRO n 
2 5   ALA n 
2 6   LYS n 
2 7   SER n 
2 8   ALA n 
2 9   PRO n 
2 10  ALA n 
2 11  PRO n 
2 12  LYS n 
2 13  LYS n 
2 14  GLY n 
2 15  SER n 
2 16  LYS n 
2 17  LYS n 
2 18  ALA n 
2 19  VAL n 
2 20  THR n 
2 21  LYS n 
2 22  THR n 
2 23  GLN n 
2 24  LYS n 
2 25  LYS n 
2 26  ASP n 
2 27  GLY n 
2 28  LYS n 
2 29  LYS n 
2 30  ARG n 
2 31  ARG n 
2 32  LYS n 
2 33  THR n 
2 34  ARG n 
2 35  LYS n 
2 36  GLU n 
2 37  SER n 
2 38  TYR n 
2 39  ALA n 
2 40  ILE n 
2 41  TYR n 
2 42  VAL n 
2 43  TYR n 
2 44  LYS n 
2 45  VAL n 
2 46  LEU n 
2 47  LYS n 
2 48  GLN n 
2 49  VAL n 
2 50  HIS n 
2 51  PRO n 
2 52  ASP n 
2 53  THR n 
2 54  GLY n 
2 55  ILE n 
2 56  SER n 
2 57  SER n 
2 58  LYS n 
2 59  ALA n 
2 60  MET n 
2 61  SER n 
2 62  ILE n 
2 63  MET n 
2 64  ASN n 
2 65  SER n 
2 66  PHE n 
2 67  VAL n 
2 68  ASN n 
2 69  ASP n 
2 70  VAL n 
2 71  PHE n 
2 72  GLU n 
2 73  ARG n 
2 74  ILE n 
2 75  ALA n 
2 76  GLY n 
2 77  GLU n 
2 78  ALA n 
2 79  SER n 
2 80  ARG n 
2 81  LEU n 
2 82  ALA n 
2 83  HIS n 
2 84  TYR n 
2 85  ASN n 
2 86  LYS n 
2 87  ARG n 
2 88  SER n 
2 89  THR n 
2 90  ILE n 
2 91  THR n 
2 92  SER n 
2 93  ARG n 
2 94  GLU n 
2 95  ILE n 
2 96  GLN n 
2 97  THR n 
2 98  ALA n 
2 99  VAL n 
2 100 ARG n 
2 101 LEU n 
2 102 LEU n 
2 103 LEU n 
2 104 PRO n 
2 105 GLY n 
2 106 GLU n 
2 107 LEU n 
2 108 ALA n 
2 109 LYS n 
2 110 HIS n 
2 111 ALA n 
2 112 VAL n 
2 113 SER n 
2 114 GLU n 
2 115 GLY n 
2 116 THR n 
2 117 LYS n 
2 118 ALA n 
2 119 VAL n 
2 120 THR n 
2 121 LYS n 
2 122 TYR n 
2 123 THR n 
2 124 SER n 
2 125 ALA n 
2 126 LYS n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLN n 
3 8   GLY n 
3 9   GLY n 
3 10  LYS n 
3 11  THR n 
3 12  ARG n 
3 13  ALA n 
3 14  LYS n 
3 15  ALA n 
3 16  LYS n 
3 17  THR n 
3 18  ARG n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  ALA n 
3 23  GLY n 
3 24  LEU n 
3 25  GLN n 
3 26  PHE n 
3 27  PRO n 
3 28  VAL n 
3 29  GLY n 
3 30  ARG n 
3 31  VAL n 
3 32  HIS n 
3 33  ARG n 
3 34  LEU n 
3 35  LEU n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  ASN n 
3 40  TYR n 
3 41  ALA n 
3 42  GLU n 
3 43  ARG n 
3 44  VAL n 
3 45  GLY n 
3 46  ALA n 
3 47  GLY n 
3 48  ALA n 
3 49  PRO n 
3 50  VAL n 
3 51  TYR n 
3 52  LEU n 
3 53  ALA n 
3 54  ALA n 
3 55  VAL n 
3 56  LEU n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  THR n 
3 61  ALA n 
3 62  GLU n 
3 63  ILE n 
3 64  LEU n 
3 65  GLU n 
3 66  LEU n 
3 67  ALA n 
3 68  GLY n 
3 69  ASN n 
3 70  ALA n 
3 71  ALA n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  LYS n 
3 77  THR n 
3 78  ARG n 
3 79  ILE n 
3 80  ILE n 
3 81  PRO n 
3 82  ARG n 
3 83  HIS n 
3 84  LEU n 
3 85  GLN n 
3 86  LEU n 
3 87  ALA n 
3 88  VAL n 
3 89  ARG n 
3 90  ASN n 
3 91  ASP n 
3 92  GLU n 
3 93  GLU n 
3 94  LEU n 
3 95  ASN n 
3 96  LYS n 
3 97  LEU n 
3 98  LEU n 
3 99  GLY n 
3 100 ARG n 
3 101 VAL n 
3 102 THR n 
3 103 ILE n 
3 104 ALA n 
3 105 GLN n 
3 106 GLY n 
3 107 GLY n 
3 108 VAL n 
3 109 LEU n 
3 110 PRO n 
3 111 ASN n 
3 112 ILE n 
3 113 GLN n 
3 114 SER n 
3 115 VAL n 
3 116 LEU n 
3 117 LEU n 
3 118 PRO n 
3 119 LYS n 
3 120 LYS n 
3 121 THR n 
3 122 GLU n 
3 123 SER n 
3 124 SER n 
3 125 LYS n 
3 126 SER n 
3 127 ALA n 
3 128 LYS n 
3 129 SER n 
3 130 LYS n 
4 1   SER n 
4 2   GLY n 
4 3   ARG n 
4 4   GLY n 
4 5   LYS n 
4 6   GLY n 
4 7   GLY n 
4 8   LYS n 
4 9   GLY n 
4 10  LEU n 
4 11  GLY n 
4 12  LYS n 
4 13  GLY n 
4 14  GLY n 
4 15  ALA n 
4 16  LYS n 
4 17  ARG n 
4 18  HIS n 
4 19  ARG n 
4 20  LYS n 
4 21  VAL n 
4 22  LEU n 
4 23  ARG n 
4 24  ASP n 
4 25  ASN n 
4 26  ILE n 
4 27  GLN n 
4 28  GLY n 
4 29  ILE n 
4 30  THR n 
4 31  LYS n 
4 32  PRO n 
4 33  ALA n 
4 34  ILE n 
4 35  ARG n 
4 36  ARG n 
4 37  LEU n 
4 38  ALA n 
4 39  ARG n 
4 40  ARG n 
4 41  GLY n 
4 42  GLY n 
4 43  VAL n 
4 44  LYS n 
4 45  ARG n 
4 46  ILE n 
4 47  SER n 
4 48  GLY n 
4 49  LEU n 
4 50  ILE n 
4 51  TYR n 
4 52  GLU n 
4 53  GLU n 
4 54  THR n 
4 55  ARG n 
4 56  GLY n 
4 57  VAL n 
4 58  LEU n 
4 59  LYS n 
4 60  VAL n 
4 61  PHE n 
4 62  LEU n 
4 63  GLU n 
4 64  ASN n 
4 65  VAL n 
4 66  ILE n 
4 67  ARG n 
4 68  ASP n 
4 69  ALA n 
4 70  VAL n 
4 71  THR n 
4 72  TYR n 
4 73  THR n 
4 74  GLU n 
4 75  HIS n 
4 76  ALA n 
4 77  LYS n 
4 78  ARG n 
4 79  LYS n 
4 80  THR n 
4 81  VAL n 
4 82  THR n 
4 83  ALA n 
4 84  MET n 
4 85  ASP n 
4 86  VAL n 
4 87  VAL n 
4 88  TYR n 
4 89  ALA n 
4 90  LEU n 
4 91  LYS n 
4 92  ARG n 
4 93  GLN n 
4 94  GLY n 
4 95  ARG n 
4 96  THR n 
4 97  LEU n 
4 98  TYR n 
4 99  GLY n 
4 100 PHE n 
4 101 GLY n 
4 102 GLY n 
5 1   ALA n 
5 2   ARG n 
5 3   THR n 
5 4   LYS n 
5 5   GLN n 
5 6   THR n 
5 7   ALA n 
5 8   ARG n 
5 9   LYS n 
5 10  SER n 
5 11  THR n 
5 12  GLY n 
5 13  GLY n 
5 14  LYS n 
5 15  ALA n 
5 16  PRO n 
5 17  ARG n 
5 18  LYS n 
5 19  GLN n 
5 20  LEU n 
5 21  ALA n 
5 22  THR n 
5 23  LYS n 
5 24  ALA n 
5 25  ALA n 
5 26  ARG n 
5 27  LYS n 
5 28  SER n 
5 29  ALA n 
5 30  PRO n 
5 31  ALA n 
5 32  THR n 
5 33  GLY n 
5 34  GLY n 
5 35  VAL n 
5 36  LYS n 
5 37  LYS n 
5 38  PRO n 
5 39  HIS n 
5 40  ARG n 
5 41  TYR n 
5 42  ARG n 
5 43  PRO n 
5 44  GLY n 
5 45  THR n 
5 46  VAL n 
5 47  ALA n 
5 48  LEU n 
5 49  ARG n 
5 50  GLU n 
5 51  ILE n 
5 52  ARG n 
5 53  ARG n 
5 54  TYR n 
5 55  GLN n 
5 56  LYS n 
5 57  SER n 
5 58  THR n 
5 59  GLU n 
5 60  LEU n 
5 61  LEU n 
5 62  ILE n 
5 63  ARG n 
5 64  LYS n 
5 65  LEU n 
5 66  PRO n 
5 67  PHE n 
5 68  GLN n 
5 69  ARG n 
5 70  LEU n 
5 71  VAL n 
5 72  ARG n 
5 73  GLU n 
5 74  ILE n 
5 75  ALA n 
5 76  GLN n 
5 77  ASP n 
5 78  PHE n 
5 79  LYS n 
5 80  THR n 
5 81  ASP n 
5 82  LEU n 
5 83  ARG n 
5 84  PHE n 
5 85  GLN n 
5 86  SER n 
5 87  SER n 
5 88  ALA n 
5 89  VAL n 
5 90  MET n 
5 91  ALA n 
5 92  LEU n 
5 93  GLN n 
5 94  GLU n 
5 95  ALA n 
5 96  SER n 
5 97  GLU n 
5 98  ALA n 
5 99  TYR n 
5 100 LEU n 
5 101 VAL n 
5 102 ALA n 
5 103 LEU n 
5 104 PHE n 
5 105 GLU n 
5 106 ASP n 
5 107 THR n 
5 108 ASN n 
5 109 LEU n 
5 110 CYS n 
5 111 ALA n 
5 112 ILE n 
5 113 HIS n 
5 114 ALA n 
5 115 LYS n 
5 116 ARG n 
5 117 VAL n 
5 118 THR n 
5 119 ILE n 
5 120 MET n 
5 121 PRO n 
5 122 LYS n 
5 123 ASP n 
5 124 ILE n 
5 125 GLN n 
5 126 LEU n 
5 127 ALA n 
5 128 ARG n 
5 129 ARG n 
5 130 ILE n 
5 131 ARG n 
5 132 GLY n 
5 133 GLU n 
5 134 ARG n 
5 135 ALA n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DC  n 
6 5   DC  n 
6 6   DC  n 
6 7   DT  n 
6 8   DG  n 
6 9   DG  n 
6 10  DA  n 
6 11  DG  n 
6 12  DA  n 
6 13  DA  n 
6 14  DT  n 
6 15  DC  n 
6 16  DC  n 
6 17  DC  n 
6 18  DG  n 
6 19  DG  n 
6 20  DT  n 
6 21  DG  n 
6 22  DC  n 
6 23  DC  n 
6 24  DG  n 
6 25  DA  n 
6 26  DG  n 
6 27  DG  n 
6 28  DC  n 
6 29  DC  n 
6 30  DG  n 
6 31  DC  n 
6 32  DT  n 
6 33  DC  n 
6 34  DA  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DG  n 
6 39  DG  n 
6 40  DT  n 
6 41  DC  n 
6 42  DG  n 
6 43  DT  n 
6 44  DA  n 
6 45  DG  n 
6 46  DA  n 
6 47  DC  n 
6 48  DA  n 
6 49  DG  n 
6 50  DC  n 
6 51  DT  n 
6 52  DC  n 
6 53  DT  n 
6 54  DA  n 
6 55  DG  n 
6 56  DC  n 
6 57  DA  n 
6 58  DC  n 
6 59  DC  n 
6 60  DG  n 
6 61  DC  n 
6 62  DT  n 
6 63  DT  n 
6 64  DA  n 
6 65  DA  n 
6 66  DA  n 
6 67  DC  n 
6 68  DG  n 
6 69  DC  n 
6 70  DA  n 
6 71  DC  n 
6 72  DG  n 
6 73  DT  n 
6 74  DA  n 
6 75  DC  n 
6 76  DG  n 
6 77  DC  n 
6 78  DG  n 
6 79  DC  n 
6 80  DT  n 
6 81  DG  n 
6 82  DT  n 
6 83  DC  n 
6 84  DC  n 
6 85  DC  n 
6 86  DC  n 
6 87  DC  n 
6 88  DG  n 
6 89  DC  n 
6 90  DG  n 
6 91  DT  n 
6 92  DT  n 
6 93  DT  n 
6 94  DT  n 
6 95  DA  n 
6 96  DA  n 
6 97  DC  n 
6 98  DC  n 
6 99  DG  n 
6 100 DC  n 
6 101 DC  n 
6 102 DA  n 
6 103 DA  n 
6 104 DG  n 
6 105 DG  n 
6 106 DG  n 
6 107 DG  n 
6 108 DA  n 
6 109 DT  n 
6 110 DT  n 
6 111 DA  n 
6 112 DC  n 
6 113 DT  n 
6 114 DC  n 
6 115 DC  n 
6 116 DC  n 
6 117 DT  n 
6 118 DA  n 
6 119 DG  n 
6 120 DT  n 
6 121 DC  n 
6 122 DT  n 
6 123 DC  n 
6 124 DC  n 
6 125 DA  n 
6 126 DG  n 
6 127 DG  n 
6 128 DC  n 
6 129 DA  n 
6 130 DC  n 
6 131 DG  n 
6 132 DT  n 
6 133 DG  n 
6 134 DT  n 
6 135 DC  n 
6 136 DA  n 
6 137 DG  n 
6 138 DA  n 
6 139 DT  n 
6 140 DA  n 
6 141 DT  n 
6 142 DA  n 
6 143 DT  n 
6 144 DA  n 
6 145 DC  n 
6 146 DA  n 
6 147 DT  n 
6 148 DC  n 
6 149 DC  n 
6 150 DT  n 
6 151 DG  n 
6 152 DT  n 
6 153 DG  n 
6 154 DC  n 
6 155 DA  n 
6 156 DG  n 
6 157 DT  n 
6 158 DA  n 
6 159 DC  n 
6 160 DT  n 
6 161 DC  n 
6 162 DC  n 
6 163 DT  n 
6 164 DG  n 
6 165 DG  n 
6 166 DA  n 
6 167 DG  n 
6 168 DA  n 
6 169 DA  n 
6 170 DT  n 
6 171 DC  n 
6 172 DC  n 
6 173 DC  n 
6 174 DG  n 
6 175 DG  n 
6 176 DT  n 
6 177 DG  n 
6 178 DC  n 
6 179 DC  n 
6 180 DG  n 
6 181 DA  n 
6 182 DG  n 
6 183 DG  n 
6 184 DC  n 
6 185 DC  n 
6 186 DG  n 
6 187 DC  n 
6 188 DT  n 
6 189 DC  n 
6 190 DA  n 
6 191 DA  n 
6 192 DT  n 
6 193 DT  n 
6 194 DG  n 
6 195 DG  n 
6 196 DT  n 
6 197 DC  n 
6 198 DG  n 
6 199 DT  n 
6 200 DA  n 
6 201 DG  n 
6 202 DA  n 
6 203 DC  n 
6 204 DA  n 
6 205 DG  n 
6 206 DC  n 
6 207 DT  n 
6 208 DC  n 
6 209 DT  n 
6 210 DA  n 
6 211 DG  n 
6 212 DC  n 
6 213 DA  n 
6 214 DC  n 
6 215 DC  n 
6 216 DG  n 
6 217 DC  n 
6 218 DT  n 
6 219 DT  n 
6 220 DA  n 
6 221 DA  n 
6 222 DA  n 
6 223 DC  n 
6 224 DG  n 
6 225 DC  n 
6 226 DA  n 
6 227 DC  n 
6 228 DG  n 
6 229 DT  n 
6 230 DA  n 
6 231 DC  n 
6 232 DG  n 
6 233 DC  n 
6 234 DG  n 
6 235 DC  n 
6 236 DT  n 
6 237 DG  n 
6 238 DT  n 
6 239 DC  n 
6 240 DC  n 
6 241 DC  n 
6 242 DC  n 
6 243 DC  n 
6 244 DG  n 
6 245 DC  n 
6 246 DG  n 
6 247 DT  n 
6 248 DT  n 
6 249 DT  n 
6 250 DT  n 
6 251 DA  n 
6 252 DA  n 
6 253 DC  n 
6 254 DC  n 
6 255 DG  n 
6 256 DC  n 
6 257 DC  n 
6 258 DA  n 
6 259 DA  n 
6 260 DG  n 
6 261 DG  n 
6 262 DG  n 
6 263 DG  n 
6 264 DA  n 
6 265 DT  n 
6 266 DT  n 
6 267 DA  n 
6 268 DC  n 
6 269 DT  n 
6 270 DC  n 
6 271 DC  n 
6 272 DC  n 
6 273 DT  n 
6 274 DA  n 
6 275 DG  n 
6 276 DT  n 
6 277 DC  n 
6 278 DT  n 
6 279 DC  n 
6 280 DC  n 
6 281 DA  n 
6 282 DG  n 
6 283 DG  n 
6 284 DC  n 
6 285 DA  n 
6 286 DC  n 
6 287 DG  n 
6 288 DT  n 
6 289 DG  n 
6 290 DT  n 
6 291 DC  n 
6 292 DA  n 
6 293 DG  n 
6 294 DA  n 
6 295 DT  n 
6 296 DA  n 
6 297 DT  n 
6 298 DA  n 
6 299 DT  n 
6 300 DA  n 
6 301 DC  n 
6 302 DA  n 
6 303 DT  n 
6 304 DC  n 
6 305 DC  n 
6 306 DT  n 
6 307 DG  n 
6 308 DT  n 
6 309 DG  n 
6 310 DC  n 
6 311 DA  n 
6 312 DG  n 
6 313 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 312 ?                     ? ?                      ? ? ? ? ? ? 'synthetic construct' 32630 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 126 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130 'African clawed frog' ? 'hist1h2aj, LOC494591' ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 102 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 135 'African clawed frog' ? ?                      ? ? ? ? ? ? 'Xenopus laevis'      8355  ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 313 ?                     ? ?                      ? ? ? ? ? ? 'synthetic construct' 32630 ? ? 
? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5OXV         5OXV   ? 1 ? 1 
2 UNP H2B11_XENLA  P02281 ? 2 
;MPEPAKSAPAPKKGSKKAVTKTQKKDGKKRRKSRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASR
LAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK
;
1 
3 UNP Q6AZJ8_XENLA Q6AZJ8 ? 3 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESSKSAKSK
;
1 
4 UNP H4_XENLA     P62799 ? 4 
;SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKT
VTAMDVVYALKRQGRTLYGFGG
;
2 
5 UNP H32_XENLA    P84233 ? 5 
;ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKT
DLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
2 
6 PDB 5OXV         5OXV   ? 6 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5OXV J 1 ? 312 ? 5OXV   -312 ? -1  ? -312 -1  
2  2 5OXV R 1 ? 126 ? P02281 1    ? 126 ? -3   122 
3  3 5OXV Q 1 ? 130 ? Q6AZJ8 1    ? 130 ? 0    129 
4  4 5OXV P 1 ? 102 ? P62799 2    ? 103 ? 1    102 
5  5 5OXV O 1 ? 135 ? P84233 2    ? 136 ? 1    135 
6  2 5OXV N 1 ? 126 ? P02281 1    ? 126 ? -3   122 
7  3 5OXV M 1 ? 130 ? Q6AZJ8 1    ? 130 ? 0    129 
8  4 5OXV L 1 ? 102 ? P62799 2    ? 103 ? 1    102 
9  5 5OXV K 1 ? 135 ? P84233 2    ? 136 ? 1    135 
10 6 5OXV I 1 ? 313 ? 5OXV   1    ? 313 ? 1    313 
11 2 5OXV H 1 ? 126 ? P02281 1    ? 126 ? -3   122 
12 3 5OXV G 1 ? 130 ? Q6AZJ8 1    ? 130 ? 0    129 
13 4 5OXV F 1 ? 102 ? P62799 2    ? 103 ? 1    102 
14 5 5OXV E 1 ? 135 ? P84233 2    ? 136 ? 1    135 
15 2 5OXV D 1 ? 126 ? P02281 1    ? 126 ? -3   122 
16 3 5OXV C 1 ? 130 ? Q6AZJ8 1    ? 130 ? 0    129 
17 4 5OXV B 1 ? 102 ? P62799 2    ? 103 ? 1    102 
18 5 5OXV A 1 ? 135 ? P84233 2    ? 136 ? 1    135 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2  5OXV THR R 33  ? UNP P02281 SER 33  conflict 29  1 
5  5OXV ALA O 102 ? UNP P84233 GLY 103 conflict 102 2 
6  5OXV THR N 33  ? UNP P02281 SER 33  conflict 29  3 
9  5OXV ALA K 102 ? UNP P84233 GLY 103 conflict 102 4 
11 5OXV THR H 33  ? UNP P02281 SER 33  conflict 29  5 
14 5OXV ALA E 102 ? UNP P84233 GLY 103 conflict 102 6 
15 5OXV THR D 33  ? UNP P02281 SER 33  conflict 29  7 
18 5OXV ALA A 102 ? UNP P84233 GLY 103 conflict 102 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5OXV 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.99 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         58.87 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30-60 mM KCl, 90-110 mM MgCl2 and 5 mM Na-cacodylate, pH 6' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-10-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5OXV 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                6.72 
_reflns.d_resolution_low                 200 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       9194 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                0.163 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.98 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  6.72 
_reflns_shell.d_res_low                   7.51 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           2554 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                4.943 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.164 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5OXV 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            6.721 
_refine.ls_d_res_low                             71.666 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     8045 
_refine.ls_number_reflns_R_free                  1016 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    87.76 
_refine.ls_percent_reflns_R_free                 12.63 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.3208 
_refine.ls_R_factor_R_free                       0.3522 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.3170 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3LZ0 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 58.89 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            1.49 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11918 
_refine_hist.pdbx_number_atoms_nucleic_acid   12730 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               24648 
_refine_hist.d_res_high                       6.721 
_refine_hist.d_res_low                        71.666 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 26353 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.472  ? 38268 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 31.659 ? 10878 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.083  ? 4362  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 2691  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 6.7213  7.0754  . . 63  394  35.00 . . . 0.4815 . 0.5085 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.0754  7.5182  . . 126 924  85.00 . . . 0.5179 . 0.4974 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.5182  8.0980  . . 148 1142 99.00 . . . 0.4525 . 0.4178 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.0980  8.9116  . . 165 1106 98.00 . . . 0.4076 . 0.4003 . . . . . . . . . . 
'X-RAY DIFFRACTION' 8.9116  10.1979 . . 174 1111 99.00 . . . 0.4323 . 0.3840 . . . . . . . . . . 
'X-RAY DIFFRACTION' 10.1979 12.8363 . . 179 1147 99.00 . . . 0.3851 . 0.3965 . . . . . . . . . . 
'X-RAY DIFFRACTION' 12.8363 71.6697 . . 161 1205 99.00 . . . 0.2986 . 0.2460 . . . . . . . . . . 
# 
_struct.entry_id                     5OXV 
_struct.title                        'Structure of the 4_601_157 tetranucleosome (C2 form)' 
_struct.pdbx_descriptor              'Histone H2B 1.1, Histone H2A, Histone H4, Histone H3/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5OXV 
_struct_keywords.text            'nucleosome, histone, DNA, tetranucleosome, chromatin fiber, GENE REGULATION' 
_struct_keywords.pdbx_keywords   'GENE REGULATION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 5 ? 
O N N 2 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR B 38  ? HIS B 50  ? TYR R 34  HIS R 46  1 ? 13 
HELX_P HELX_P2  AA2 SER B 56  ? ASN B 85  ? SER R 52  ASN R 81  1 ? 30 
HELX_P HELX_P3  AA3 THR B 91  ? LEU B 103 ? THR R 87  LEU R 99  1 ? 13 
HELX_P HELX_P4  AA4 PRO B 104 ? ALA B 125 ? PRO R 100 ALA R 121 1 ? 22 
HELX_P HELX_P5  AA5 THR C 17  ? ALA C 22  ? THR Q 16  ALA Q 21  1 ? 6  
HELX_P HELX_P6  AA6 PRO C 27  ? LYS C 37  ? PRO Q 26  LYS Q 36  1 ? 11 
HELX_P HELX_P7  AA7 ALA C 46  ? ASN C 74  ? ALA Q 45  ASN Q 73  1 ? 29 
HELX_P HELX_P8  AA8 ILE C 80  ? ASP C 91  ? ILE Q 79  ASP Q 90  1 ? 12 
HELX_P HELX_P9  AA9 GLU C 93  ? LEU C 98  ? GLU Q 92  LEU Q 97  1 ? 6  
HELX_P HELX_P10 AB1 GLN C 113 ? LEU C 117 ? GLN Q 112 LEU Q 116 5 ? 5  
HELX_P HELX_P11 AB2 ASN D 25  ? ILE D 29  ? ASN P 25  ILE P 29  5 ? 5  
HELX_P HELX_P12 AB3 THR D 30  ? GLY D 41  ? THR P 30  GLY P 41  1 ? 12 
HELX_P HELX_P13 AB4 LEU D 49  ? ALA D 76  ? LEU P 49  ALA P 76  1 ? 28 
HELX_P HELX_P14 AB5 THR D 82  ? GLN D 93  ? THR P 82  GLN P 93  1 ? 12 
HELX_P HELX_P15 AB6 GLY E 44  ? LYS E 56  ? GLY O 44  LYS O 56  1 ? 13 
HELX_P HELX_P16 AB7 ARG E 63  ? ASP E 77  ? ARG O 63  ASP O 77  1 ? 15 
HELX_P HELX_P17 AB8 GLN E 85  ? ALA E 114 ? GLN O 85  ALA O 114 1 ? 30 
HELX_P HELX_P18 AB9 MET E 120 ? GLY E 132 ? MET O 120 GLY O 132 1 ? 13 
HELX_P HELX_P19 AC1 TYR F 38  ? HIS F 50  ? TYR N 34  HIS N 46  1 ? 13 
HELX_P HELX_P20 AC2 SER F 56  ? ASN F 85  ? SER N 52  ASN N 81  1 ? 30 
HELX_P HELX_P21 AC3 THR F 91  ? LEU F 103 ? THR N 87  LEU N 99  1 ? 13 
HELX_P HELX_P22 AC4 PRO F 104 ? ALA F 125 ? PRO N 100 ALA N 121 1 ? 22 
HELX_P HELX_P23 AC5 SER G 19  ? GLY G 23  ? SER M 18  GLY M 22  5 ? 5  
HELX_P HELX_P24 AC6 PRO G 27  ? GLY G 38  ? PRO M 26  GLY M 37  1 ? 12 
HELX_P HELX_P25 AC7 GLY G 47  ? ASN G 74  ? GLY M 46  ASN M 73  1 ? 28 
HELX_P HELX_P26 AC8 ILE G 80  ? ASP G 91  ? ILE M 79  ASP M 90  1 ? 12 
HELX_P HELX_P27 AC9 ASP G 91  ? LEU G 98  ? ASP M 90  LEU M 97  1 ? 8  
HELX_P HELX_P28 AD1 GLN G 113 ? LEU G 117 ? GLN M 112 LEU M 116 5 ? 5  
HELX_P HELX_P29 AD2 ASP H 24  ? ILE H 29  ? ASP L 24  ILE L 29  5 ? 6  
HELX_P HELX_P30 AD3 THR H 30  ? GLY H 41  ? THR L 30  GLY L 41  1 ? 12 
HELX_P HELX_P31 AD4 LEU H 49  ? ALA H 76  ? LEU L 49  ALA L 76  1 ? 28 
HELX_P HELX_P32 AD5 THR H 82  ? GLN H 93  ? THR L 82  GLN L 93  1 ? 12 
HELX_P HELX_P33 AD6 GLY I 44  ? SER I 57  ? GLY K 44  SER K 57  1 ? 14 
HELX_P HELX_P34 AD7 ARG I 63  ? ASP I 77  ? ARG K 63  ASP K 77  1 ? 15 
HELX_P HELX_P35 AD8 GLN I 85  ? ALA I 114 ? GLN K 85  ALA K 114 1 ? 30 
HELX_P HELX_P36 AD9 MET I 120 ? GLY I 132 ? MET K 120 GLY K 132 1 ? 13 
HELX_P HELX_P37 AE1 TYR K 38  ? HIS K 50  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P38 AE2 SER K 56  ? ASN K 85  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P39 AE3 THR K 91  ? LEU K 103 ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P40 AE4 PRO K 104 ? ALA K 125 ? PRO H 100 ALA H 121 1 ? 22 
HELX_P HELX_P41 AE5 THR L 17  ? ALA L 22  ? THR G 16  ALA G 21  1 ? 6  
HELX_P HELX_P42 AE6 PRO L 27  ? LYS L 37  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P43 AE7 ALA L 46  ? ASN L 74  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P44 AE8 ILE L 80  ? ASP L 91  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P45 AE9 GLU L 93  ? LEU L 98  ? GLU G 92  LEU G 97  1 ? 6  
HELX_P HELX_P46 AF1 GLN L 113 ? LEU L 117 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P47 AF2 ASN M 25  ? ILE M 29  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P48 AF3 THR M 30  ? GLY M 41  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P49 AF4 LEU M 49  ? ALA M 76  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P50 AF5 THR M 82  ? GLN M 93  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P51 AF6 GLY N 44  ? LYS N 56  ? GLY E 44  LYS E 56  1 ? 13 
HELX_P HELX_P52 AF7 ARG N 63  ? ASP N 77  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P53 AF8 GLN N 85  ? ALA N 114 ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P54 AF9 MET N 120 ? GLY N 132 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P55 AG1 TYR O 38  ? HIS O 50  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P56 AG2 SER O 56  ? ASN O 85  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P57 AG3 THR O 91  ? LEU O 103 ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P58 AG4 PRO O 104 ? ALA O 125 ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P59 AG5 SER P 19  ? GLY P 23  ? SER C 18  GLY C 22  5 ? 5  
HELX_P HELX_P60 AG6 PRO P 27  ? GLY P 38  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P61 AG7 GLY P 47  ? ASN P 74  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P62 AG8 ILE P 80  ? ASP P 91  ? ILE C 79  ASP C 90  1 ? 12 
HELX_P HELX_P63 AG9 ASP P 91  ? LEU P 98  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P64 AH1 GLN P 113 ? LEU P 117 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P65 AH2 ASP Q 24  ? ILE Q 29  ? ASP B 24  ILE B 29  5 ? 6  
HELX_P HELX_P66 AH3 THR Q 30  ? GLY Q 41  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P67 AH4 LEU Q 49  ? ALA Q 76  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P68 AH5 THR Q 82  ? GLN Q 93  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P69 AH6 GLY R 44  ? SER R 57  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P70 AH7 ARG R 63  ? ASP R 77  ? ARG A 63  ASP A 77  1 ? 15 
HELX_P HELX_P71 AH8 GLN R 85  ? ALA R 114 ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P72 AH9 MET R 120 ? GLY R 132 ? MET A 120 GLY A 132 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? A DC 1   N3 ? ? ? 1_555 J DG 312 N1 ? ? J DC -312 I DG 312 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog2   hydrog ? ? A DC 1   N4 ? ? ? 1_555 J DG 312 O6 ? ? J DC -312 I DG 312 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog3   hydrog ? ? A DC 1   O2 ? ? ? 1_555 J DG 312 N2 ? ? J DC -312 I DG 312 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog4   hydrog ? ? A DT 2   N3 ? ? ? 1_555 J DA 311 N1 ? ? J DT -311 I DA 311 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog5   hydrog ? ? A DT 2   O4 ? ? ? 1_555 J DA 311 N6 ? ? J DT -311 I DA 311 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog6   hydrog ? ? A DG 3   N1 ? ? ? 1_555 J DC 310 O2 ? ? J DG -310 I DC 310 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog7   hydrog ? ? A DC 4   N3 ? ? ? 1_555 J DG 309 N1 ? ? J DC -309 I DG 309 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog8   hydrog ? ? A DC 4   N4 ? ? ? 1_555 J DG 309 O6 ? ? J DC -309 I DG 309 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog9   hydrog ? ? A DC 4   O2 ? ? ? 1_555 J DG 309 N2 ? ? J DC -309 I DG 309 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog10  hydrog ? ? A DG 5   N1 ? ? ? 1_555 J DT 308 O2 ? ? J DG -308 I DT 308 1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? ? 
hydrog11  hydrog ? ? A DG 5   O6 ? ? ? 1_555 J DT 308 N3 ? ? J DG -308 I DT 308 1_555 ? ? ? ? ? ? TYPE_28_PAIR            ? ? 
hydrog12  hydrog ? ? A DC 6   N3 ? ? ? 1_555 J DG 307 N1 ? ? J DC -307 I DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog13  hydrog ? ? A DC 6   N4 ? ? ? 1_555 J DG 307 O6 ? ? J DC -307 I DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog14  hydrog ? ? A DC 6   O2 ? ? ? 1_555 J DG 307 N2 ? ? J DC -307 I DG 307 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog15  hydrog ? ? A DA 7   N1 ? ? ? 1_555 J DT 306 N3 ? ? J DA -306 I DT 306 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog16  hydrog ? ? A DA 7   N6 ? ? ? 1_555 J DT 306 O4 ? ? J DA -306 I DT 306 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog17  hydrog ? ? A DG 8   N1 ? ? ? 1_555 J DC 305 N3 ? ? J DG -305 I DC 305 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog18  hydrog ? ? A DG 8   N2 ? ? ? 1_555 J DC 305 O2 ? ? J DG -305 I DC 305 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog19  hydrog ? ? A DG 8   O6 ? ? ? 1_555 J DC 305 N4 ? ? J DG -305 I DC 305 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog20  hydrog ? ? A DG 9   N2 ? ? ? 1_555 J DC 304 O2 ? ? J DG -304 I DC 304 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog21  hydrog ? ? A DA 10  N1 ? ? ? 1_555 J DT 303 N3 ? ? J DA -303 I DT 303 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog22  hydrog ? ? A DA 10  N6 ? ? ? 1_555 J DT 303 O4 ? ? J DA -303 I DT 303 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog23  hydrog ? ? A DT 11  N3 ? ? ? 1_555 J DA 302 N1 ? ? J DT -302 I DA 302 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog24  hydrog ? ? A DT 11  O4 ? ? ? 1_555 J DA 302 N6 ? ? J DT -302 I DA 302 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog25  hydrog ? ? A DG 12  N1 ? ? ? 1_555 J DC 301 N3 ? ? J DG -301 I DC 301 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog26  hydrog ? ? A DG 12  N2 ? ? ? 1_555 J DC 301 O2 ? ? J DG -301 I DC 301 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog27  hydrog ? ? A DG 12  O6 ? ? ? 1_555 J DC 301 N4 ? ? J DG -301 I DC 301 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog28  hydrog ? ? A DT 13  N3 ? ? ? 1_555 J DA 300 N1 ? ? J DT -300 I DA 300 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog29  hydrog ? ? A DT 13  O4 ? ? ? 1_555 J DA 300 N6 ? ? J DT -300 I DA 300 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog30  hydrog ? ? A DA 14  N1 ? ? ? 1_555 J DT 299 N3 ? ? J DA -299 I DT 299 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog31  hydrog ? ? A DA 14  N6 ? ? ? 1_555 J DT 299 O4 ? ? J DA -299 I DT 299 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog32  hydrog ? ? A DT 15  N3 ? ? ? 1_555 J DA 298 N1 ? ? J DT -298 I DA 298 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog33  hydrog ? ? A DT 15  O4 ? ? ? 1_555 J DA 298 N6 ? ? J DT -298 I DA 298 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog34  hydrog ? ? A DA 16  N1 ? ? ? 1_555 J DT 297 N3 ? ? J DA -297 I DT 297 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog35  hydrog ? ? A DA 16  N6 ? ? ? 1_555 J DT 297 O4 ? ? J DA -297 I DT 297 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog36  hydrog ? ? A DT 17  N3 ? ? ? 1_555 J DA 296 N1 ? ? J DT -296 I DA 296 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog37  hydrog ? ? A DT 17  O4 ? ? ? 1_555 J DA 296 N6 ? ? J DT -296 I DA 296 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog38  hydrog ? ? A DA 18  N1 ? ? ? 1_555 J DT 295 N3 ? ? J DA -295 I DT 295 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog39  hydrog ? ? A DA 18  N6 ? ? ? 1_555 J DT 295 O4 ? ? J DA -295 I DT 295 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog40  hydrog ? ? A DT 19  N3 ? ? ? 1_555 J DA 294 N1 ? ? J DT -294 I DA 294 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog41  hydrog ? ? A DT 19  O4 ? ? ? 1_555 J DA 294 N6 ? ? J DT -294 I DA 294 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog42  hydrog ? ? A DC 20  N3 ? ? ? 1_555 J DG 293 N1 ? ? J DC -293 I DG 293 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog43  hydrog ? ? A DC 20  N4 ? ? ? 1_555 J DG 293 O6 ? ? J DC -293 I DG 293 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog44  hydrog ? ? A DC 20  O2 ? ? ? 1_555 J DG 293 N2 ? ? J DC -293 I DG 293 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog45  hydrog ? ? A DT 21  N3 ? ? ? 1_555 J DA 292 N1 ? ? J DT -292 I DA 292 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog46  hydrog ? ? A DT 21  O4 ? ? ? 1_555 J DA 292 N6 ? ? J DT -292 I DA 292 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog47  hydrog ? ? A DG 22  N1 ? ? ? 1_555 J DC 291 N3 ? ? J DG -291 I DC 291 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog48  hydrog ? ? A DG 22  N2 ? ? ? 1_555 J DC 291 O2 ? ? J DG -291 I DC 291 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog49  hydrog ? ? A DG 22  O6 ? ? ? 1_555 J DC 291 N4 ? ? J DG -291 I DC 291 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog50  hydrog ? ? A DA 23  N1 ? ? ? 1_555 J DT 290 N3 ? ? J DA -290 I DT 290 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog51  hydrog ? ? A DA 23  N6 ? ? ? 1_555 J DT 290 O4 ? ? J DA -290 I DT 290 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog52  hydrog ? ? A DC 24  N3 ? ? ? 1_555 J DG 289 N1 ? ? J DC -289 I DG 289 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog53  hydrog ? ? A DC 24  N4 ? ? ? 1_555 J DG 289 O6 ? ? J DC -289 I DG 289 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog54  hydrog ? ? A DC 24  O2 ? ? ? 1_555 J DG 289 N2 ? ? J DC -289 I DG 289 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog55  hydrog ? ? A DA 25  N1 ? ? ? 1_555 J DT 288 N3 ? ? J DA -288 I DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog56  hydrog ? ? A DA 25  N6 ? ? ? 1_555 J DT 288 O4 ? ? J DA -288 I DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog57  hydrog ? ? A DC 26  N3 ? ? ? 1_555 J DG 287 N1 ? ? J DC -287 I DG 287 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog58  hydrog ? ? A DC 26  N4 ? ? ? 1_555 J DG 287 O6 ? ? J DC -287 I DG 287 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog59  hydrog ? ? A DC 26  O2 ? ? ? 1_555 J DG 287 N2 ? ? J DC -287 I DG 287 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog60  hydrog ? ? A DG 27  N1 ? ? ? 1_555 J DC 286 N3 ? ? J DG -286 I DC 286 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog61  hydrog ? ? A DG 27  N2 ? ? ? 1_555 J DC 286 O2 ? ? J DG -286 I DC 286 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog62  hydrog ? ? A DG 27  O6 ? ? ? 1_555 J DC 286 N4 ? ? J DG -286 I DC 286 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog63  hydrog ? ? A DT 28  N3 ? ? ? 1_555 J DA 285 N1 ? ? J DT -285 I DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog64  hydrog ? ? A DT 28  O4 ? ? ? 1_555 J DA 285 N6 ? ? J DT -285 I DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog65  hydrog ? ? A DG 29  N1 ? ? ? 1_555 J DC 284 N3 ? ? J DG -284 I DC 284 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog66  hydrog ? ? A DG 29  N2 ? ? ? 1_555 J DC 284 O2 ? ? J DG -284 I DC 284 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog67  hydrog ? ? A DG 29  O6 ? ? ? 1_555 J DC 284 N4 ? ? J DG -284 I DC 284 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog68  hydrog ? ? A DC 30  N3 ? ? ? 1_555 J DG 283 N1 ? ? J DC -283 I DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog69  hydrog ? ? A DC 30  N4 ? ? ? 1_555 J DG 283 O6 ? ? J DC -283 I DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog70  hydrog ? ? A DC 30  O2 ? ? ? 1_555 J DG 283 N2 ? ? J DC -283 I DG 283 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog71  hydrog ? ? A DC 31  N3 ? ? ? 1_555 J DA 281 N6 ? ? J DC -282 I DA 281 1_555 ? ? ? ? ? ? TYPE_25_PAIR            ? ? 
hydrog72  hydrog ? ? A DC 31  N4 ? ? ? 1_555 J DA 281 N7 ? ? J DC -282 I DA 281 1_555 ? ? ? ? ? ? TYPE_25_PAIR            ? ? 
hydrog73  hydrog ? ? A DT 32  N3 ? ? ? 1_555 J DA 281 N1 ? ? J DT -281 I DA 281 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog74  hydrog ? ? A DT 32  O4 ? ? ? 1_555 J DA 281 N6 ? ? J DT -281 I DA 281 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog75  hydrog ? ? A DG 33  O6 ? ? ? 1_555 J DC 279 N4 ? ? J DG -280 I DC 279 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog76  hydrog ? ? A DG 33  N2 ? ? ? 1_555 J DC 280 O2 ? ? J DG -280 I DC 280 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog77  hydrog ? ? A DG 34  N1 ? ? ? 1_555 J DC 279 N3 ? ? J DG -279 I DC 279 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog78  hydrog ? ? A DG 34  N2 ? ? ? 1_555 J DC 279 O2 ? ? J DG -279 I DC 279 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog79  hydrog ? ? A DG 34  O6 ? ? ? 1_555 J DC 279 N4 ? ? J DG -279 I DC 279 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog80  hydrog ? ? A DA 35  N1 ? ? ? 1_555 J DT 278 N3 ? ? J DA -278 I DT 278 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog81  hydrog ? ? A DA 35  N6 ? ? ? 1_555 J DT 278 O4 ? ? J DA -278 I DT 278 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog82  hydrog ? ? A DG 36  N1 ? ? ? 1_555 J DC 277 N3 ? ? J DG -277 I DC 277 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog83  hydrog ? ? A DG 36  N2 ? ? ? 1_555 J DC 277 O2 ? ? J DG -277 I DC 277 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog84  hydrog ? ? A DG 36  O6 ? ? ? 1_555 J DC 277 N4 ? ? J DG -277 I DC 277 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog85  hydrog ? ? A DA 37  N1 ? ? ? 1_555 J DT 276 N3 ? ? J DA -276 I DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog86  hydrog ? ? A DA 37  N6 ? ? ? 1_555 J DT 276 O4 ? ? J DA -276 I DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog87  hydrog ? ? A DC 38  N3 ? ? ? 1_555 J DG 275 N1 ? ? J DC -275 I DG 275 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog88  hydrog ? ? A DC 38  N4 ? ? ? 1_555 J DG 275 O6 ? ? J DC -275 I DG 275 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog89  hydrog ? ? A DC 38  O2 ? ? ? 1_555 J DG 275 N2 ? ? J DC -275 I DG 275 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog90  hydrog ? ? A DT 39  N3 ? ? ? 1_555 J DA 274 N1 ? ? J DT -274 I DA 274 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog91  hydrog ? ? A DT 39  O4 ? ? ? 1_555 J DA 274 N6 ? ? J DT -274 I DA 274 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog92  hydrog ? ? A DA 40  N1 ? ? ? 1_555 J DT 273 N3 ? ? J DA -273 I DT 273 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog93  hydrog ? ? A DA 40  N6 ? ? ? 1_555 J DT 273 O4 ? ? J DA -273 I DT 273 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog94  hydrog ? ? A DG 41  N1 ? ? ? 1_555 J DC 272 N3 ? ? J DG -272 I DC 272 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog95  hydrog ? ? A DG 41  N2 ? ? ? 1_555 J DC 272 O2 ? ? J DG -272 I DC 272 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog96  hydrog ? ? A DG 41  O6 ? ? ? 1_555 J DC 272 N4 ? ? J DG -272 I DC 272 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog97  hydrog ? ? A DG 42  N1 ? ? ? 1_555 J DC 271 N3 ? ? J DG -271 I DC 271 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog98  hydrog ? ? A DG 42  N2 ? ? ? 1_555 J DC 271 O2 ? ? J DG -271 I DC 271 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog99  hydrog ? ? A DG 42  O6 ? ? ? 1_555 J DC 271 N4 ? ? J DG -271 I DC 271 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog100 hydrog ? ? A DG 43  N1 ? ? ? 1_555 J DC 270 N3 ? ? J DG -270 I DC 270 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog101 hydrog ? ? A DG 43  N2 ? ? ? 1_555 J DC 270 O2 ? ? J DG -270 I DC 270 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog102 hydrog ? ? A DG 43  O6 ? ? ? 1_555 J DC 270 N4 ? ? J DG -270 I DC 270 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog103 hydrog ? ? A DA 44  N1 ? ? ? 1_555 J DT 269 N3 ? ? J DA -269 I DT 269 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog104 hydrog ? ? A DA 44  N6 ? ? ? 1_555 J DT 269 O4 ? ? J DA -269 I DT 269 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog105 hydrog ? ? A DG 45  N1 ? ? ? 1_555 J DA 267 N1 ? ? J DG -268 I DA 267 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog106 hydrog ? ? A DG 45  O6 ? ? ? 1_555 J DA 267 N6 ? ? J DG -268 I DA 267 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog107 hydrog ? ? A DG 45  N1 ? ? ? 1_555 J DC 268 N3 ? ? J DG -268 I DC 268 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog108 hydrog ? ? A DG 45  N2 ? ? ? 1_555 J DC 268 O2 ? ? J DG -268 I DC 268 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog109 hydrog ? ? A DG 45  O6 ? ? ? 1_555 J DC 268 N4 ? ? J DG -268 I DC 268 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog110 hydrog ? ? A DT 46  N3 ? ? ? 1_555 J DA 267 N1 ? ? J DT -267 I DA 267 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog111 hydrog ? ? A DT 46  O4 ? ? ? 1_555 J DA 267 N6 ? ? J DT -267 I DA 267 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog112 hydrog ? ? A DA 47  N1 ? ? ? 1_555 J DT 266 N3 ? ? J DA -266 I DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog113 hydrog ? ? A DA 47  N6 ? ? ? 1_555 J DT 266 O4 ? ? J DA -266 I DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog114 hydrog ? ? A DA 48  N1 ? ? ? 1_555 J DT 265 N3 ? ? J DA -265 I DT 265 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog115 hydrog ? ? A DA 48  N6 ? ? ? 1_555 J DT 265 O4 ? ? J DA -265 I DT 265 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog116 hydrog ? ? A DT 49  N3 ? ? ? 1_555 J DA 264 N1 ? ? J DT -264 I DA 264 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog117 hydrog ? ? A DT 49  O4 ? ? ? 1_555 J DA 264 N6 ? ? J DT -264 I DA 264 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog118 hydrog ? ? A DC 50  O2 ? ? ? 1_555 J DG 263 N2 ? ? J DC -263 I DG 263 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog119 hydrog ? ? A DC 51  N4 ? ? ? 1_555 J DG 262 O6 ? ? J DC -262 I DG 262 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog120 hydrog ? ? A DC 51  O2 ? ? ? 1_555 J DG 263 N2 ? ? J DC -262 I DG 263 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog121 hydrog ? ? A DC 52  N3 ? ? ? 1_555 J DG 261 N1 ? ? J DC -261 I DG 261 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog122 hydrog ? ? A DC 52  N4 ? ? ? 1_555 J DG 261 O6 ? ? J DC -261 I DG 261 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog123 hydrog ? ? A DC 52  O2 ? ? ? 1_555 J DG 261 N2 ? ? J DC -261 I DG 261 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog124 hydrog ? ? A DC 53  N3 ? ? ? 1_555 J DG 260 N1 ? ? J DC -260 I DG 260 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog125 hydrog ? ? A DC 53  N4 ? ? ? 1_555 J DG 260 O6 ? ? J DC -260 I DG 260 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog126 hydrog ? ? A DC 53  O2 ? ? ? 1_555 J DG 260 N2 ? ? J DC -260 I DG 260 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog127 hydrog ? ? A DT 54  N3 ? ? ? 1_555 J DA 259 N1 ? ? J DT -259 I DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog128 hydrog ? ? A DT 54  O4 ? ? ? 1_555 J DA 259 N6 ? ? J DT -259 I DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog129 hydrog ? ? A DT 55  N3 ? ? ? 1_555 J DA 258 N1 ? ? J DT -258 I DA 258 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog130 hydrog ? ? A DT 55  O4 ? ? ? 1_555 J DA 258 N6 ? ? J DT -258 I DA 258 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog131 hydrog ? ? A DG 56  N1 ? ? ? 1_555 J DC 257 N3 ? ? J DG -257 I DC 257 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog132 hydrog ? ? A DG 56  N2 ? ? ? 1_555 J DC 257 O2 ? ? J DG -257 I DC 257 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog133 hydrog ? ? A DG 56  O6 ? ? ? 1_555 J DC 257 N4 ? ? J DG -257 I DC 257 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog134 hydrog ? ? A DG 57  N1 ? ? ? 1_555 J DC 256 O2 ? ? J DG -256 I DC 256 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog135 hydrog ? ? A DG 57  N2 ? ? ? 1_555 J DC 257 O2 ? ? J DG -256 I DC 257 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog136 hydrog ? ? A DC 58  N3 ? ? ? 1_555 J DG 255 N1 ? ? J DC -255 I DG 255 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog137 hydrog ? ? A DC 58  N4 ? ? ? 1_555 J DG 255 O6 ? ? J DC -255 I DG 255 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog138 hydrog ? ? A DC 58  O2 ? ? ? 1_555 J DG 255 N2 ? ? J DC -255 I DG 255 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog139 hydrog ? ? A DG 59  O6 ? ? ? 1_555 J DC 253 N4 ? ? J DG -254 I DC 253 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog140 hydrog ? ? A DG 59  N2 ? ? ? 1_555 J DC 254 N3 ? ? J DG -254 I DC 254 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog141 hydrog ? ? A DG 60  N1 ? ? ? 1_555 J DC 253 N3 ? ? J DG -253 I DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog142 hydrog ? ? A DG 60  N2 ? ? ? 1_555 J DC 253 O2 ? ? J DG -253 I DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog143 hydrog ? ? A DG 60  O6 ? ? ? 1_555 J DC 253 N4 ? ? J DG -253 I DC 253 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog144 hydrog ? ? A DT 62  N3 ? ? ? 1_555 J DA 251 N1 ? ? J DT -251 I DA 251 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog145 hydrog ? ? A DT 62  O4 ? ? ? 1_555 J DA 251 N6 ? ? J DT -251 I DA 251 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog146 hydrog ? ? A DA 63  N1 ? ? ? 1_555 J DT 250 N3 ? ? J DA -250 I DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog147 hydrog ? ? A DA 63  N6 ? ? ? 1_555 J DT 250 O4 ? ? J DA -250 I DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog148 hydrog ? ? A DA 64  N1 ? ? ? 1_555 J DT 249 N3 ? ? J DA -249 I DT 249 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog149 hydrog ? ? A DA 64  N6 ? ? ? 1_555 J DT 249 O4 ? ? J DA -249 I DT 249 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog150 hydrog ? ? A DA 65  N1 ? ? ? 1_555 J DT 248 N3 ? ? J DA -248 I DT 248 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog151 hydrog ? ? A DA 65  N6 ? ? ? 1_555 J DT 248 O4 ? ? J DA -248 I DT 248 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog152 hydrog ? ? A DA 66  N1 ? ? ? 1_555 J DT 247 N3 ? ? J DA -247 I DT 247 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog153 hydrog ? ? A DA 66  N6 ? ? ? 1_555 J DT 247 O4 ? ? J DA -247 I DT 247 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog154 hydrog ? ? A DC 67  N3 ? ? ? 1_555 J DG 246 N1 ? ? J DC -246 I DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog155 hydrog ? ? A DC 67  N4 ? ? ? 1_555 J DG 246 O6 ? ? J DC -246 I DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog156 hydrog ? ? A DC 67  O2 ? ? ? 1_555 J DG 246 N2 ? ? J DC -246 I DG 246 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog157 hydrog ? ? A DG 68  N1 ? ? ? 1_555 J DC 245 N3 ? ? J DG -245 I DC 245 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog158 hydrog ? ? A DG 68  N2 ? ? ? 1_555 J DC 245 O2 ? ? J DG -245 I DC 245 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog159 hydrog ? ? A DG 68  O6 ? ? ? 1_555 J DC 245 N4 ? ? J DG -245 I DC 245 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog160 hydrog ? ? A DC 69  N3 ? ? ? 1_555 J DG 244 N2 ? ? J DC -244 I DG 244 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog161 hydrog ? ? A DC 69  O2 ? ? ? 1_555 J DG 244 N1 ? ? J DC -244 I DG 244 1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog162 hydrog ? ? A DG 70  N1 ? ? ? 1_555 J DC 243 N3 ? ? J DG -243 I DC 243 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog163 hydrog ? ? A DG 70  N2 ? ? ? 1_555 J DC 243 O2 ? ? J DG -243 I DC 243 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog164 hydrog ? ? A DG 70  O6 ? ? ? 1_555 J DC 243 N4 ? ? J DG -243 I DC 243 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog165 hydrog ? ? A DG 71  N1 ? ? ? 1_555 J DC 242 N3 ? ? J DG -242 I DC 242 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog166 hydrog ? ? A DG 71  N2 ? ? ? 1_555 J DC 242 O2 ? ? J DG -242 I DC 242 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog167 hydrog ? ? A DG 71  O6 ? ? ? 1_555 J DC 242 N4 ? ? J DG -242 I DC 242 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog168 hydrog ? ? A DG 72  N1 ? ? ? 1_555 J DC 241 N3 ? ? J DG -241 I DC 241 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog169 hydrog ? ? A DG 72  N2 ? ? ? 1_555 J DC 241 O2 ? ? J DG -241 I DC 241 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog170 hydrog ? ? A DG 72  O6 ? ? ? 1_555 J DC 241 N4 ? ? J DG -241 I DC 241 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog171 hydrog ? ? A DG 73  N1 ? ? ? 1_555 J DC 240 N3 ? ? J DG -240 I DC 240 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog172 hydrog ? ? A DG 73  N2 ? ? ? 1_555 J DC 240 O2 ? ? J DG -240 I DC 240 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog173 hydrog ? ? A DG 73  O6 ? ? ? 1_555 J DC 240 N4 ? ? J DG -240 I DC 240 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog174 hydrog ? ? A DG 74  N1 ? ? ? 1_555 J DC 239 N3 ? ? J DG -239 I DC 239 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog175 hydrog ? ? A DG 74  N2 ? ? ? 1_555 J DC 239 O2 ? ? J DG -239 I DC 239 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog176 hydrog ? ? A DG 74  O6 ? ? ? 1_555 J DC 239 N4 ? ? J DG -239 I DC 239 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog177 hydrog ? ? A DA 75  N1 ? ? ? 1_555 J DT 238 N3 ? ? J DA -238 I DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog178 hydrog ? ? A DA 75  N6 ? ? ? 1_555 J DT 238 O4 ? ? J DA -238 I DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog179 hydrog ? ? A DC 76  N3 ? ? ? 1_555 J DG 237 N1 ? ? J DC -237 I DG 237 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog180 hydrog ? ? A DC 76  N4 ? ? ? 1_555 J DG 237 O6 ? ? J DC -237 I DG 237 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog181 hydrog ? ? A DC 76  O2 ? ? ? 1_555 J DG 237 N2 ? ? J DC -237 I DG 237 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog182 hydrog ? ? A DA 77  N1 ? ? ? 1_555 J DT 236 N3 ? ? J DA -236 I DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog183 hydrog ? ? A DA 77  N6 ? ? ? 1_555 J DT 236 O4 ? ? J DA -236 I DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog184 hydrog ? ? A DG 78  N1 ? ? ? 1_555 J DC 235 N3 ? ? J DG -235 I DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog185 hydrog ? ? A DG 78  N2 ? ? ? 1_555 J DC 235 O2 ? ? J DG -235 I DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog186 hydrog ? ? A DG 78  O6 ? ? ? 1_555 J DC 235 N4 ? ? J DG -235 I DC 235 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog187 hydrog ? ? A DC 79  N3 ? ? ? 1_555 J DG 234 N1 ? ? J DC -234 I DG 234 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog188 hydrog ? ? A DC 79  N4 ? ? ? 1_555 J DG 234 O6 ? ? J DC -234 I DG 234 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog189 hydrog ? ? A DC 79  O2 ? ? ? 1_555 J DG 234 N2 ? ? J DC -234 I DG 234 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog190 hydrog ? ? A DG 80  N1 ? ? ? 1_555 J DC 233 N3 ? ? J DG -233 I DC 233 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog191 hydrog ? ? A DG 80  N2 ? ? ? 1_555 J DC 233 O2 ? ? J DG -233 I DC 233 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog192 hydrog ? ? A DG 80  O6 ? ? ? 1_555 J DC 233 N4 ? ? J DG -233 I DC 233 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog193 hydrog ? ? A DC 81  N3 ? ? ? 1_555 J DG 232 N1 ? ? J DC -232 I DG 232 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog194 hydrog ? ? A DC 81  N4 ? ? ? 1_555 J DG 232 O6 ? ? J DC -232 I DG 232 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog195 hydrog ? ? A DC 81  O2 ? ? ? 1_555 J DG 232 N2 ? ? J DC -232 I DG 232 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog196 hydrog ? ? A DG 82  N1 ? ? ? 1_555 J DC 231 N3 ? ? J DG -231 I DC 231 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog197 hydrog ? ? A DG 82  N2 ? ? ? 1_555 J DC 231 O2 ? ? J DG -231 I DC 231 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog198 hydrog ? ? A DG 82  O6 ? ? ? 1_555 J DC 231 N4 ? ? J DG -231 I DC 231 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog199 hydrog ? ? A DT 83  N3 ? ? ? 1_555 J DA 230 N1 ? ? J DT -230 I DA 230 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog200 hydrog ? ? A DT 83  O4 ? ? ? 1_555 J DA 230 N6 ? ? J DT -230 I DA 230 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog201 hydrog ? ? A DA 84  N1 ? ? ? 1_555 J DT 229 N3 ? ? J DA -229 I DT 229 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog202 hydrog ? ? A DA 84  N6 ? ? ? 1_555 J DT 229 O4 ? ? J DA -229 I DT 229 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog203 hydrog ? ? A DC 85  N3 ? ? ? 1_555 J DG 228 N1 ? ? J DC -228 I DG 228 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog204 hydrog ? ? A DC 85  N4 ? ? ? 1_555 J DG 228 O6 ? ? J DC -228 I DG 228 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog205 hydrog ? ? A DC 85  O2 ? ? ? 1_555 J DG 228 N2 ? ? J DC -228 I DG 228 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog206 hydrog ? ? A DG 86  N1 ? ? ? 1_555 J DC 227 N3 ? ? J DG -227 I DC 227 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog207 hydrog ? ? A DG 86  N2 ? ? ? 1_555 J DC 227 O2 ? ? J DG -227 I DC 227 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog208 hydrog ? ? A DG 86  O6 ? ? ? 1_555 J DC 227 N4 ? ? J DG -227 I DC 227 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog209 hydrog ? ? A DT 87  N3 ? ? ? 1_555 J DA 226 N1 ? ? J DT -226 I DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog210 hydrog ? ? A DT 87  O4 ? ? ? 1_555 J DA 226 N6 ? ? J DT -226 I DA 226 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog211 hydrog ? ? A DG 88  N1 ? ? ? 1_555 J DC 225 N3 ? ? J DG -225 I DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog212 hydrog ? ? A DG 88  N2 ? ? ? 1_555 J DC 225 O2 ? ? J DG -225 I DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog213 hydrog ? ? A DG 88  O6 ? ? ? 1_555 J DC 225 N4 ? ? J DG -225 I DC 225 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog214 hydrog ? ? A DC 89  N3 ? ? ? 1_555 J DG 224 N1 ? ? J DC -224 I DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog215 hydrog ? ? A DC 89  N4 ? ? ? 1_555 J DG 224 O6 ? ? J DC -224 I DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog216 hydrog ? ? A DC 89  O2 ? ? ? 1_555 J DG 224 N2 ? ? J DC -224 I DG 224 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog217 hydrog ? ? A DG 90  N1 ? ? ? 1_555 J DC 223 N3 ? ? J DG -223 I DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog218 hydrog ? ? A DG 90  N2 ? ? ? 1_555 J DC 223 O2 ? ? J DG -223 I DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog219 hydrog ? ? A DG 90  O6 ? ? ? 1_555 J DC 223 N4 ? ? J DG -223 I DC 223 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog220 hydrog ? ? A DT 91  N3 ? ? ? 1_555 J DA 222 N1 ? ? J DT -222 I DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog221 hydrog ? ? A DT 91  O4 ? ? ? 1_555 J DA 222 N6 ? ? J DT -222 I DA 222 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog222 hydrog ? ? A DT 92  N3 ? ? ? 1_555 J DA 221 N1 ? ? J DT -221 I DA 221 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog223 hydrog ? ? A DT 92  O4 ? ? ? 1_555 J DA 221 N6 ? ? J DT -221 I DA 221 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog224 hydrog ? ? A DT 93  N3 ? ? ? 1_555 J DA 220 N1 ? ? J DT -220 I DA 220 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog225 hydrog ? ? A DT 93  O4 ? ? ? 1_555 J DA 220 N6 ? ? J DT -220 I DA 220 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog226 hydrog ? ? A DA 94  N1 ? ? ? 1_555 J DT 219 N3 ? ? J DA -219 I DT 219 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog227 hydrog ? ? A DA 94  N6 ? ? ? 1_555 J DT 219 O4 ? ? J DA -219 I DT 219 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog228 hydrog ? ? A DA 95  N1 ? ? ? 1_555 J DT 218 N3 ? ? J DA -218 I DT 218 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog229 hydrog ? ? A DA 95  N6 ? ? ? 1_555 J DT 218 O4 ? ? J DA -218 I DT 218 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog230 hydrog ? ? A DG 96  N1 ? ? ? 1_555 J DC 217 N3 ? ? J DG -217 I DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog231 hydrog ? ? A DG 96  N2 ? ? ? 1_555 J DC 217 O2 ? ? J DG -217 I DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog232 hydrog ? ? A DG 96  O6 ? ? ? 1_555 J DC 217 N4 ? ? J DG -217 I DC 217 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog233 hydrog ? ? A DC 97  N3 ? ? ? 1_555 J DG 216 N1 ? ? J DC -216 I DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog234 hydrog ? ? A DC 97  N4 ? ? ? 1_555 J DG 216 O6 ? ? J DC -216 I DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog235 hydrog ? ? A DC 97  O2 ? ? ? 1_555 J DG 216 N2 ? ? J DC -216 I DG 216 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog236 hydrog ? ? A DG 98  N1 ? ? ? 1_555 J DC 215 N3 ? ? J DG -215 I DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog237 hydrog ? ? A DG 98  N2 ? ? ? 1_555 J DC 215 O2 ? ? J DG -215 I DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog238 hydrog ? ? A DG 98  O6 ? ? ? 1_555 J DC 215 N4 ? ? J DG -215 I DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog239 hydrog ? ? A DG 99  N1 ? ? ? 1_555 J DC 214 N3 ? ? J DG -214 I DC 214 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog240 hydrog ? ? A DG 99  N2 ? ? ? 1_555 J DC 214 O2 ? ? J DG -214 I DC 214 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog241 hydrog ? ? A DG 99  O6 ? ? ? 1_555 J DC 214 N4 ? ? J DG -214 I DC 214 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog242 hydrog ? ? A DG 99  N1 ? ? ? 1_555 J DC 215 N3 ? ? J DG -214 I DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog243 hydrog ? ? A DG 99  N2 ? ? ? 1_555 J DC 215 O2 ? ? J DG -214 I DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog244 hydrog ? ? A DG 99  O6 ? ? ? 1_555 J DC 215 N4 ? ? J DG -214 I DC 215 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog245 hydrog ? ? A DT 100 N3 ? ? ? 1_555 J DA 213 N1 ? ? J DT -213 I DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog246 hydrog ? ? A DT 100 O4 ? ? ? 1_555 J DA 213 N6 ? ? J DT -213 I DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog247 hydrog ? ? A DG 101 N1 ? ? ? 1_555 J DC 212 N3 ? ? J DG -212 I DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog248 hydrog ? ? A DG 101 N2 ? ? ? 1_555 J DC 212 O2 ? ? J DG -212 I DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog249 hydrog ? ? A DG 101 O6 ? ? ? 1_555 J DC 212 N4 ? ? J DG -212 I DC 212 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog250 hydrog ? ? A DC 102 N3 ? ? ? 1_555 J DG 211 N1 ? ? J DC -211 I DG 211 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog251 hydrog ? ? A DC 102 N4 ? ? ? 1_555 J DG 211 O6 ? ? J DC -211 I DG 211 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog252 hydrog ? ? A DC 102 O2 ? ? ? 1_555 J DG 211 N2 ? ? J DC -211 I DG 211 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog253 hydrog ? ? A DT 103 N3 ? ? ? 1_555 J DA 210 N1 ? ? J DT -210 I DA 210 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog254 hydrog ? ? A DT 103 O4 ? ? ? 1_555 J DA 210 N6 ? ? J DT -210 I DA 210 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog255 hydrog ? ? A DA 104 N1 ? ? ? 1_555 J DT 209 N3 ? ? J DA -209 I DT 209 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog256 hydrog ? ? A DA 104 N6 ? ? ? 1_555 J DT 209 O4 ? ? J DA -209 I DT 209 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog257 hydrog ? ? A DG 105 N1 ? ? ? 1_555 J DC 208 N3 ? ? J DG -208 I DC 208 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog258 hydrog ? ? A DG 105 N2 ? ? ? 1_555 J DC 208 O2 ? ? J DG -208 I DC 208 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog259 hydrog ? ? A DG 105 O6 ? ? ? 1_555 J DC 208 N4 ? ? J DG -208 I DC 208 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog260 hydrog ? ? A DA 106 N1 ? ? ? 1_555 J DT 207 N3 ? ? J DA -207 I DT 207 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog261 hydrog ? ? A DA 106 N6 ? ? ? 1_555 J DT 207 O4 ? ? J DA -207 I DT 207 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog262 hydrog ? ? A DG 107 N1 ? ? ? 1_555 J DC 206 N3 ? ? J DG -206 I DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog263 hydrog ? ? A DG 107 N2 ? ? ? 1_555 J DC 206 O2 ? ? J DG -206 I DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog264 hydrog ? ? A DG 107 O6 ? ? ? 1_555 J DC 206 N4 ? ? J DG -206 I DC 206 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog265 hydrog ? ? A DC 108 N3 ? ? ? 1_555 J DG 205 N1 ? ? J DC -205 I DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog266 hydrog ? ? A DC 108 N4 ? ? ? 1_555 J DG 205 O6 ? ? J DC -205 I DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog267 hydrog ? ? A DC 108 O2 ? ? ? 1_555 J DG 205 N2 ? ? J DC -205 I DG 205 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog268 hydrog ? ? A DT 109 O4 ? ? ? 1_555 J DC 203 N4 ? ? J DT -204 I DC 203 1_555 ? ? ? ? ? ? 'DT-DC MISPAIR'         ? ? 
hydrog269 hydrog ? ? A DT 109 N3 ? ? ? 1_555 J DA 204 N1 ? ? J DT -204 I DA 204 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog270 hydrog ? ? A DG 110 N1 ? ? ? 1_555 J DA 202 N1 ? ? J DG -203 I DA 202 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog271 hydrog ? ? A DG 110 O6 ? ? ? 1_555 J DA 202 N6 ? ? J DG -203 I DA 202 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog272 hydrog ? ? A DG 110 N1 ? ? ? 1_555 J DC 203 N3 ? ? J DG -203 I DC 203 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog273 hydrog ? ? A DG 110 N2 ? ? ? 1_555 J DC 203 O2 ? ? J DG -203 I DC 203 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog274 hydrog ? ? A DG 110 O6 ? ? ? 1_555 J DC 203 N4 ? ? J DG -203 I DC 203 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog275 hydrog ? ? A DT 111 N3 ? ? ? 1_555 J DA 202 N1 ? ? J DT -202 I DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog276 hydrog ? ? A DT 111 O4 ? ? ? 1_555 J DA 202 N6 ? ? J DT -202 I DA 202 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog277 hydrog ? ? A DC 112 N3 ? ? ? 1_555 J DG 201 N1 ? ? J DC -201 I DG 201 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog278 hydrog ? ? A DC 112 N4 ? ? ? 1_555 J DG 201 O6 ? ? J DC -201 I DG 201 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog279 hydrog ? ? A DC 112 O2 ? ? ? 1_555 J DG 201 N2 ? ? J DC -201 I DG 201 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog280 hydrog ? ? A DT 113 N3 ? ? ? 1_555 J DA 200 N1 ? ? J DT -200 I DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog281 hydrog ? ? A DT 113 O4 ? ? ? 1_555 J DA 200 N6 ? ? J DT -200 I DA 200 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog282 hydrog ? ? A DA 114 N1 ? ? ? 1_555 J DT 199 N3 ? ? J DA -199 I DT 199 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog283 hydrog ? ? A DA 114 N6 ? ? ? 1_555 J DT 199 O4 ? ? J DA -199 I DT 199 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog284 hydrog ? ? A DC 115 N3 ? ? ? 1_555 J DG 198 N1 ? ? J DC -198 I DG 198 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog285 hydrog ? ? A DC 115 N4 ? ? ? 1_555 J DG 198 O6 ? ? J DC -198 I DG 198 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog286 hydrog ? ? A DC 115 O2 ? ? ? 1_555 J DG 198 N2 ? ? J DC -198 I DG 198 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog287 hydrog ? ? A DG 116 N1 ? ? ? 1_555 J DC 197 N3 ? ? J DG -197 I DC 197 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog288 hydrog ? ? A DG 116 N2 ? ? ? 1_555 J DC 197 O2 ? ? J DG -197 I DC 197 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog289 hydrog ? ? A DG 116 O6 ? ? ? 1_555 J DC 197 N4 ? ? J DG -197 I DC 197 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog290 hydrog ? ? A DA 117 N1 ? ? ? 1_555 J DT 196 N3 ? ? J DA -196 I DT 196 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog291 hydrog ? ? A DA 117 N6 ? ? ? 1_555 J DT 196 O4 ? ? J DA -196 I DT 196 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog292 hydrog ? ? A DC 118 N3 ? ? ? 1_555 J DG 195 N1 ? ? J DC -195 I DG 195 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog293 hydrog ? ? A DC 118 N4 ? ? ? 1_555 J DG 195 O6 ? ? J DC -195 I DG 195 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog294 hydrog ? ? A DC 118 O2 ? ? ? 1_555 J DG 195 N2 ? ? J DC -195 I DG 195 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog295 hydrog ? ? A DC 119 O2 ? ? ? 1_555 J DG 194 N2 ? ? J DC -194 I DG 194 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog296 hydrog ? ? A DA 120 N1 ? ? ? 1_555 J DT 193 N3 ? ? J DA -193 I DT 193 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog297 hydrog ? ? A DA 120 N6 ? ? ? 1_555 J DT 193 O4 ? ? J DA -193 I DT 193 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog298 hydrog ? ? A DA 121 N1 ? ? ? 1_555 J DT 192 N3 ? ? J DA -192 I DT 192 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog299 hydrog ? ? A DA 121 N6 ? ? ? 1_555 J DT 192 O4 ? ? J DA -192 I DT 192 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog300 hydrog ? ? A DT 122 N3 ? ? ? 1_555 J DA 191 N1 ? ? J DT -191 I DA 191 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog301 hydrog ? ? A DT 122 O4 ? ? ? 1_555 J DA 191 N6 ? ? J DT -191 I DA 191 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog302 hydrog ? ? A DT 123 N3 ? ? ? 1_555 J DA 190 N1 ? ? J DT -190 I DA 190 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog303 hydrog ? ? A DT 123 O4 ? ? ? 1_555 J DA 190 N6 ? ? J DT -190 I DA 190 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog304 hydrog ? ? A DG 124 N1 ? ? ? 1_555 J DC 189 N3 ? ? J DG -189 I DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog305 hydrog ? ? A DG 124 N2 ? ? ? 1_555 J DC 189 O2 ? ? J DG -189 I DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog306 hydrog ? ? A DG 124 O6 ? ? ? 1_555 J DC 189 N4 ? ? J DG -189 I DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog307 hydrog ? ? A DA 125 N1 ? ? ? 1_555 J DT 188 N3 ? ? J DA -188 I DT 188 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog308 hydrog ? ? A DA 125 N6 ? ? ? 1_555 J DT 188 O4 ? ? J DA -188 I DT 188 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog309 hydrog ? ? A DG 126 N1 ? ? ? 1_555 J DC 187 N3 ? ? J DG -187 I DC 187 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog310 hydrog ? ? A DG 126 N2 ? ? ? 1_555 J DC 187 O2 ? ? J DG -187 I DC 187 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog311 hydrog ? ? A DG 126 O6 ? ? ? 1_555 J DC 187 N4 ? ? J DG -187 I DC 187 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog312 hydrog ? ? A DC 127 N3 ? ? ? 1_555 J DG 186 N1 ? ? J DC -186 I DG 186 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog313 hydrog ? ? A DC 127 N4 ? ? ? 1_555 J DG 186 O6 ? ? J DC -186 I DG 186 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog314 hydrog ? ? A DC 127 O2 ? ? ? 1_555 J DG 186 N2 ? ? J DC -186 I DG 186 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog315 hydrog ? ? A DG 128 N1 ? ? ? 1_555 J DC 185 N3 ? ? J DG -185 I DC 185 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog316 hydrog ? ? A DG 128 N2 ? ? ? 1_555 J DC 185 O2 ? ? J DG -185 I DC 185 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog317 hydrog ? ? A DG 128 O6 ? ? ? 1_555 J DC 185 N4 ? ? J DG -185 I DC 185 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog318 hydrog ? ? A DG 129 N1 ? ? ? 1_555 J DC 184 N3 ? ? J DG -184 I DC 184 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog319 hydrog ? ? A DG 129 N2 ? ? ? 1_555 J DC 184 O2 ? ? J DG -184 I DC 184 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog320 hydrog ? ? A DG 129 O6 ? ? ? 1_555 J DC 184 N4 ? ? J DG -184 I DC 184 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog321 hydrog ? ? A DC 130 N3 ? ? ? 1_555 J DG 183 N1 ? ? J DC -183 I DG 183 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog322 hydrog ? ? A DC 130 N4 ? ? ? 1_555 J DG 183 O6 ? ? J DC -183 I DG 183 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog323 hydrog ? ? A DC 130 O2 ? ? ? 1_555 J DG 183 N2 ? ? J DC -183 I DG 183 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog324 hydrog ? ? A DC 131 N3 ? ? ? 1_555 J DG 182 N2 ? ? J DC -182 I DG 182 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog325 hydrog ? ? A DT 132 N3 ? ? ? 1_555 J DA 181 N1 ? ? J DT -181 I DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog326 hydrog ? ? A DT 132 O4 ? ? ? 1_555 J DA 181 N6 ? ? J DT -181 I DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog327 hydrog ? ? A DC 133 O2 ? ? ? 1_555 J DG 180 N2 ? ? J DC -180 I DG 180 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog328 hydrog ? ? A DG 134 N1 ? ? ? 1_555 J DC 179 N3 ? ? J DG -179 I DC 179 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog329 hydrog ? ? A DG 134 N2 ? ? ? 1_555 J DC 179 O2 ? ? J DG -179 I DC 179 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog330 hydrog ? ? A DG 134 O6 ? ? ? 1_555 J DC 179 N4 ? ? J DG -179 I DC 179 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog331 hydrog ? ? A DG 135 N1 ? ? ? 1_555 J DC 178 N3 ? ? J DG -178 I DC 178 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog332 hydrog ? ? A DG 135 N2 ? ? ? 1_555 J DC 178 O2 ? ? J DG -178 I DC 178 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog333 hydrog ? ? A DG 135 O6 ? ? ? 1_555 J DC 178 N4 ? ? J DG -178 I DC 178 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog334 hydrog ? ? A DC 136 N3 ? ? ? 1_555 J DG 177 N1 ? ? J DC -177 I DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog335 hydrog ? ? A DC 136 N4 ? ? ? 1_555 J DG 177 O6 ? ? J DC -177 I DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog336 hydrog ? ? A DC 136 O2 ? ? ? 1_555 J DG 177 N2 ? ? J DC -177 I DG 177 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog337 hydrog ? ? A DC 138 N3 ? ? ? 1_555 J DG 175 N1 ? ? J DC -175 I DG 175 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog338 hydrog ? ? A DC 138 N4 ? ? ? 1_555 J DG 175 O6 ? ? J DC -175 I DG 175 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog339 hydrog ? ? A DC 138 O2 ? ? ? 1_555 J DG 175 N2 ? ? J DC -175 I DG 175 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog340 hydrog ? ? A DC 139 N3 ? ? ? 1_555 J DG 174 N1 ? ? J DC -174 I DG 174 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog341 hydrog ? ? A DC 139 N4 ? ? ? 1_555 J DG 174 O6 ? ? J DC -174 I DG 174 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog342 hydrog ? ? A DC 139 O2 ? ? ? 1_555 J DG 174 N2 ? ? J DC -174 I DG 174 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog343 hydrog ? ? A DG 140 N2 ? ? ? 1_555 J DC 173 N3 ? ? J DG -173 I DC 173 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog344 hydrog ? ? A DG 141 O6 ? ? ? 1_555 J DC 171 N4 ? ? J DG -172 I DC 171 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog345 hydrog ? ? A DG 141 N2 ? ? ? 1_555 J DC 172 O2 ? ? J DG -172 I DC 172 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog346 hydrog ? ? A DG 142 N2 ? ? ? 1_555 J DC 171 O2 ? ? J DG -171 I DC 171 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog347 hydrog ? ? A DA 143 N1 ? ? ? 1_555 J DT 170 N3 ? ? J DA -170 I DT 170 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog348 hydrog ? ? A DA 143 N6 ? ? ? 1_555 J DT 170 O4 ? ? J DA -170 I DT 170 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog349 hydrog ? ? A DT 144 N3 ? ? ? 1_555 J DA 169 N1 ? ? J DT -169 I DA 169 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog350 hydrog ? ? A DT 144 O4 ? ? ? 1_555 J DA 169 N6 ? ? J DT -169 I DA 169 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog351 hydrog ? ? A DT 145 O2 ? ? ? 1_555 J DA 168 N6 ? ? J DT -168 I DA 168 1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog352 hydrog ? ? A DC 146 N3 ? ? ? 1_555 J DG 167 N1 ? ? J DC -167 I DG 167 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog353 hydrog ? ? A DC 146 N4 ? ? ? 1_555 J DG 167 O6 ? ? J DC -167 I DG 167 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog354 hydrog ? ? A DC 146 O2 ? ? ? 1_555 J DG 167 N2 ? ? J DC -167 I DG 167 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog355 hydrog ? ? A DT 147 N3 ? ? ? 1_555 J DA 166 N1 ? ? J DT -166 I DA 166 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog356 hydrog ? ? A DT 147 O4 ? ? ? 1_555 J DA 166 N6 ? ? J DT -166 I DA 166 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog357 hydrog ? ? A DC 148 N3 ? ? ? 1_555 J DG 165 N2 ? ? J DC -165 I DG 165 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog358 hydrog ? ? A DC 149 N3 ? ? ? 1_555 J DG 164 N1 ? ? J DC -164 I DG 164 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog359 hydrog ? ? A DA 150 N1 ? ? ? 1_555 J DT 163 N3 ? ? J DA -163 I DT 163 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog360 hydrog ? ? A DA 150 N6 ? ? ? 1_555 J DT 163 O4 ? ? J DA -163 I DT 163 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog361 hydrog ? ? A DG 151 O6 ? ? ? 1_555 J DC 162 N4 ? ? J DG -162 I DC 162 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog362 hydrog ? ? A DG 152 N2 ? ? ? 1_555 J DC 161 N3 ? ? J DG -161 I DC 161 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog363 hydrog ? ? A DA 153 N6 ? ? ? 1_555 J DC 159 N3 ? ? J DA -160 I DC 159 1_555 ? ? ? ? ? ? 'DA-DC MISPAIR'         ? ? 
hydrog364 hydrog ? ? A DA 153 N1 ? ? ? 1_555 J DT 160 N3 ? ? J DA -160 I DT 160 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog365 hydrog ? ? A DT 155 N3 ? ? ? 1_555 J DA 158 N1 ? ? J DT -158 I DA 158 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog366 hydrog ? ? A DT 155 O4 ? ? ? 1_555 J DA 158 N6 ? ? J DT -158 I DA 158 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog367 hydrog ? ? A DA 156 N1 ? ? ? 1_555 J DT 157 N3 ? ? J DA -157 I DT 157 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog368 hydrog ? ? A DC 157 O2 ? ? ? 1_555 J DG 156 N2 ? ? J DC -156 I DG 156 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog369 hydrog ? ? A DG 159 N2 ? ? ? 1_555 J DC 154 O2 ? ? J DG -154 I DC 154 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog370 hydrog ? ? A DG 159 N2 ? ? ? 1_555 J DA 155 N1 ? ? J DG -154 I DA 155 1_555 ? ? ? ? ? ? 'DG-DA MISPAIR'         ? ? 
hydrog371 hydrog ? ? A DC 160 O2 ? ? ? 1_555 J DG 153 N1 ? ? J DC -153 I DG 153 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog372 hydrog ? ? A DA 161 N1 ? ? ? 1_555 J DT 152 N3 ? ? J DA -152 I DT 152 1_555 ? ? ? ? ? ? 'DA-DT PAIR'            ? ? 
hydrog373 hydrog ? ? A DC 162 N3 ? ? ? 1_555 J DG 151 N1 ? ? J DC -151 I DG 151 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog374 hydrog ? ? A DC 162 N4 ? ? ? 1_555 J DG 151 O6 ? ? J DC -151 I DG 151 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog375 hydrog ? ? A DC 162 O2 ? ? ? 1_555 J DG 151 N2 ? ? J DC -151 I DG 151 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog376 hydrog ? ? A DA 163 N1 ? ? ? 1_555 J DT 150 N3 ? ? J DA -150 I DT 150 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog377 hydrog ? ? A DA 163 N6 ? ? ? 1_555 J DT 150 O4 ? ? J DA -150 I DT 150 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog378 hydrog ? ? A DG 164 N1 ? ? ? 1_555 J DC 149 O2 ? ? J DG -149 I DC 149 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog379 hydrog ? ? A DG 164 N2 ? ? ? 1_555 J DT 150 O2 ? ? J DG -149 I DT 150 1_555 ? ? ? ? ? ? 'DG-DT MISPAIR'         ? ? 
hydrog380 hydrog ? ? A DG 165 N2 ? ? ? 1_555 J DC 148 O2 ? ? J DG -148 I DC 148 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog381 hydrog ? ? A DA 166 N1 ? ? ? 1_555 J DT 147 N3 ? ? J DA -147 I DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog382 hydrog ? ? A DA 166 N6 ? ? ? 1_555 J DT 147 O4 ? ? J DA -147 I DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog383 hydrog ? ? A DT 167 N3 ? ? ? 1_555 J DA 146 N1 ? ? J DT -146 I DA 146 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog384 hydrog ? ? A DT 167 O4 ? ? ? 1_555 J DA 146 N6 ? ? J DT -146 I DA 146 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog385 hydrog ? ? A DG 168 N1 ? ? ? 1_555 J DC 145 N3 ? ? J DG -145 I DC 145 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog386 hydrog ? ? A DG 168 N2 ? ? ? 1_555 J DC 145 O2 ? ? J DG -145 I DC 145 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog387 hydrog ? ? A DG 168 O6 ? ? ? 1_555 J DC 145 N4 ? ? J DG -145 I DC 145 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog388 hydrog ? ? A DT 169 N3 ? ? ? 1_555 J DA 144 N1 ? ? J DT -144 I DA 144 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog389 hydrog ? ? A DT 169 O4 ? ? ? 1_555 J DA 144 N6 ? ? J DT -144 I DA 144 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog390 hydrog ? ? A DA 170 N1 ? ? ? 1_555 J DT 143 N3 ? ? J DA -143 I DT 143 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog391 hydrog ? ? A DA 170 N6 ? ? ? 1_555 J DT 143 O4 ? ? J DA -143 I DT 143 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog392 hydrog ? ? A DT 171 N3 ? ? ? 1_555 J DA 142 N1 ? ? J DT -142 I DA 142 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog393 hydrog ? ? A DT 171 O4 ? ? ? 1_555 J DA 142 N6 ? ? J DT -142 I DA 142 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog394 hydrog ? ? A DA 172 N1 ? ? ? 1_555 J DT 141 N3 ? ? J DA -141 I DT 141 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog395 hydrog ? ? A DA 172 N6 ? ? ? 1_555 J DT 141 O4 ? ? J DA -141 I DT 141 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog396 hydrog ? ? A DT 173 N3 ? ? ? 1_555 J DA 140 N1 ? ? J DT -140 I DA 140 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog397 hydrog ? ? A DT 173 O4 ? ? ? 1_555 J DA 140 N6 ? ? J DT -140 I DA 140 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog398 hydrog ? ? A DA 174 N1 ? ? ? 1_555 J DT 139 N3 ? ? J DA -139 I DT 139 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog399 hydrog ? ? A DA 174 N6 ? ? ? 1_555 J DT 139 O4 ? ? J DA -139 I DT 139 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog400 hydrog ? ? A DT 175 N3 ? ? ? 1_555 J DA 138 N1 ? ? J DT -138 I DA 138 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog401 hydrog ? ? A DT 175 O4 ? ? ? 1_555 J DA 138 N6 ? ? J DT -138 I DA 138 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog402 hydrog ? ? A DC 176 N3 ? ? ? 1_555 J DG 137 N1 ? ? J DC -137 I DG 137 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog403 hydrog ? ? A DC 176 N4 ? ? ? 1_555 J DG 137 O6 ? ? J DC -137 I DG 137 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog404 hydrog ? ? A DC 176 O2 ? ? ? 1_555 J DG 137 N2 ? ? J DC -137 I DG 137 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog405 hydrog ? ? A DT 177 N3 ? ? ? 1_555 J DA 136 N1 ? ? J DT -136 I DA 136 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog406 hydrog ? ? A DT 177 O4 ? ? ? 1_555 J DA 136 N6 ? ? J DT -136 I DA 136 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog407 hydrog ? ? A DG 178 N1 ? ? ? 1_555 J DC 135 N3 ? ? J DG -135 I DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog408 hydrog ? ? A DG 178 N2 ? ? ? 1_555 J DC 135 O2 ? ? J DG -135 I DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog409 hydrog ? ? A DG 178 O6 ? ? ? 1_555 J DC 135 N4 ? ? J DG -135 I DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog410 hydrog ? ? A DA 179 N1 ? ? ? 1_555 J DT 134 N3 ? ? J DA -134 I DT 134 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog411 hydrog ? ? A DA 179 N6 ? ? ? 1_555 J DT 134 O4 ? ? J DA -134 I DT 134 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog412 hydrog ? ? A DC 180 N3 ? ? ? 1_555 J DG 133 N1 ? ? J DC -133 I DG 133 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog413 hydrog ? ? A DC 180 N4 ? ? ? 1_555 J DG 133 O6 ? ? J DC -133 I DG 133 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog414 hydrog ? ? A DC 180 O2 ? ? ? 1_555 J DG 133 N2 ? ? J DC -133 I DG 133 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog415 hydrog ? ? A DA 181 N1 ? ? ? 1_555 J DT 132 N3 ? ? J DA -132 I DT 132 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog416 hydrog ? ? A DA 181 N6 ? ? ? 1_555 J DT 132 O4 ? ? J DA -132 I DT 132 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog417 hydrog ? ? A DC 182 N3 ? ? ? 1_555 J DG 131 N1 ? ? J DC -131 I DG 131 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog418 hydrog ? ? A DC 182 N4 ? ? ? 1_555 J DG 131 O6 ? ? J DC -131 I DG 131 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog419 hydrog ? ? A DC 182 O2 ? ? ? 1_555 J DG 131 N2 ? ? J DC -131 I DG 131 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog420 hydrog ? ? A DG 183 N1 ? ? ? 1_555 J DC 130 N3 ? ? J DG -130 I DC 130 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog421 hydrog ? ? A DG 183 N2 ? ? ? 1_555 J DC 130 O2 ? ? J DG -130 I DC 130 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog422 hydrog ? ? A DG 183 O6 ? ? ? 1_555 J DC 130 N4 ? ? J DG -130 I DC 130 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog423 hydrog ? ? A DT 184 N3 ? ? ? 1_555 J DA 129 N1 ? ? J DT -129 I DA 129 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog424 hydrog ? ? A DT 184 O4 ? ? ? 1_555 J DA 129 N6 ? ? J DT -129 I DA 129 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog425 hydrog ? ? A DG 185 N1 ? ? ? 1_555 J DC 128 N3 ? ? J DG -128 I DC 128 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog426 hydrog ? ? A DG 185 N2 ? ? ? 1_555 J DC 128 O2 ? ? J DG -128 I DC 128 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog427 hydrog ? ? A DG 185 O6 ? ? ? 1_555 J DC 128 N4 ? ? J DG -128 I DC 128 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog428 hydrog ? ? A DC 186 N3 ? ? ? 1_555 J DG 127 N1 ? ? J DC -127 I DG 127 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog429 hydrog ? ? A DC 186 N4 ? ? ? 1_555 J DG 127 O6 ? ? J DC -127 I DG 127 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog430 hydrog ? ? A DC 186 O2 ? ? ? 1_555 J DG 127 N2 ? ? J DC -127 I DG 127 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog431 hydrog ? ? A DC 187 N3 ? ? ? 1_555 J DA 125 N6 ? ? J DC -126 I DA 125 1_555 ? ? ? ? ? ? TYPE_25_PAIR            ? ? 
hydrog432 hydrog ? ? A DC 187 N4 ? ? ? 1_555 J DA 125 N7 ? ? J DC -126 I DA 125 1_555 ? ? ? ? ? ? TYPE_25_PAIR            ? ? 
hydrog433 hydrog ? ? A DT 188 N3 ? ? ? 1_555 J DA 125 N1 ? ? J DT -125 I DA 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog434 hydrog ? ? A DT 188 O4 ? ? ? 1_555 J DA 125 N6 ? ? J DT -125 I DA 125 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog435 hydrog ? ? A DG 189 O6 ? ? ? 1_555 J DC 123 N4 ? ? J DG -124 I DC 123 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog436 hydrog ? ? A DG 189 N2 ? ? ? 1_555 J DC 124 O2 ? ? J DG -124 I DC 124 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog437 hydrog ? ? A DG 190 N1 ? ? ? 1_555 J DC 123 N3 ? ? J DG -123 I DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog438 hydrog ? ? A DG 190 N2 ? ? ? 1_555 J DC 123 O2 ? ? J DG -123 I DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog439 hydrog ? ? A DG 190 O6 ? ? ? 1_555 J DC 123 N4 ? ? J DG -123 I DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog440 hydrog ? ? A DA 191 N1 ? ? ? 1_555 J DT 122 N3 ? ? J DA -122 I DT 122 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog441 hydrog ? ? A DA 191 N6 ? ? ? 1_555 J DT 122 O4 ? ? J DA -122 I DT 122 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog442 hydrog ? ? A DG 192 N1 ? ? ? 1_555 J DC 121 N3 ? ? J DG -121 I DC 121 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog443 hydrog ? ? A DG 192 N2 ? ? ? 1_555 J DC 121 O2 ? ? J DG -121 I DC 121 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog444 hydrog ? ? A DG 192 O6 ? ? ? 1_555 J DC 121 N4 ? ? J DG -121 I DC 121 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog445 hydrog ? ? A DA 193 N1 ? ? ? 1_555 J DT 120 N3 ? ? J DA -120 I DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog446 hydrog ? ? A DA 193 N6 ? ? ? 1_555 J DT 120 O4 ? ? J DA -120 I DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog447 hydrog ? ? A DC 194 N3 ? ? ? 1_555 J DG 119 N1 ? ? J DC -119 I DG 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog448 hydrog ? ? A DC 194 N4 ? ? ? 1_555 J DG 119 O6 ? ? J DC -119 I DG 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog449 hydrog ? ? A DC 194 O2 ? ? ? 1_555 J DG 119 N2 ? ? J DC -119 I DG 119 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog450 hydrog ? ? A DT 195 N3 ? ? ? 1_555 J DA 118 N1 ? ? J DT -118 I DA 118 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog451 hydrog ? ? A DT 195 O4 ? ? ? 1_555 J DA 118 N6 ? ? J DT -118 I DA 118 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog452 hydrog ? ? A DA 196 N1 ? ? ? 1_555 J DT 117 N3 ? ? J DA -117 I DT 117 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog453 hydrog ? ? A DA 196 N6 ? ? ? 1_555 J DT 117 O4 ? ? J DA -117 I DT 117 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog454 hydrog ? ? A DG 197 N1 ? ? ? 1_555 J DC 116 N3 ? ? J DG -116 I DC 116 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog455 hydrog ? ? A DG 197 N2 ? ? ? 1_555 J DC 116 O2 ? ? J DG -116 I DC 116 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog456 hydrog ? ? A DG 197 O6 ? ? ? 1_555 J DC 116 N4 ? ? J DG -116 I DC 116 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog457 hydrog ? ? A DG 198 N1 ? ? ? 1_555 J DC 115 N3 ? ? J DG -115 I DC 115 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog458 hydrog ? ? A DG 198 N2 ? ? ? 1_555 J DC 115 O2 ? ? J DG -115 I DC 115 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog459 hydrog ? ? A DG 198 O6 ? ? ? 1_555 J DC 115 N4 ? ? J DG -115 I DC 115 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog460 hydrog ? ? A DG 199 N1 ? ? ? 1_555 J DC 114 N3 ? ? J DG -114 I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog461 hydrog ? ? A DG 199 N2 ? ? ? 1_555 J DC 114 O2 ? ? J DG -114 I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog462 hydrog ? ? A DG 199 O6 ? ? ? 1_555 J DC 114 N4 ? ? J DG -114 I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog463 hydrog ? ? A DA 200 N1 ? ? ? 1_555 J DT 113 N3 ? ? J DA -113 I DT 113 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog464 hydrog ? ? A DA 200 N6 ? ? ? 1_555 J DT 113 O4 ? ? J DA -113 I DT 113 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog465 hydrog ? ? A DG 201 N1 ? ? ? 1_555 J DA 111 N1 ? ? J DG -112 I DA 111 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog466 hydrog ? ? A DG 201 O6 ? ? ? 1_555 J DA 111 N6 ? ? J DG -112 I DA 111 1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog467 hydrog ? ? A DG 201 N1 ? ? ? 1_555 J DC 112 N3 ? ? J DG -112 I DC 112 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog468 hydrog ? ? A DG 201 N2 ? ? ? 1_555 J DC 112 O2 ? ? J DG -112 I DC 112 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog469 hydrog ? ? A DG 201 O6 ? ? ? 1_555 J DC 112 N4 ? ? J DG -112 I DC 112 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog470 hydrog ? ? A DT 202 N3 ? ? ? 1_555 J DA 111 N1 ? ? J DT -111 I DA 111 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog471 hydrog ? ? A DT 202 O4 ? ? ? 1_555 J DA 111 N6 ? ? J DT -111 I DA 111 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog472 hydrog ? ? A DA 203 N1 ? ? ? 1_555 J DT 110 N3 ? ? J DA -110 I DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog473 hydrog ? ? A DA 203 N6 ? ? ? 1_555 J DT 110 O4 ? ? J DA -110 I DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog474 hydrog ? ? A DA 204 N1 ? ? ? 1_555 J DT 109 N3 ? ? J DA -109 I DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog475 hydrog ? ? A DA 204 N6 ? ? ? 1_555 J DT 109 O4 ? ? J DA -109 I DT 109 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog476 hydrog ? ? A DT 205 N3 ? ? ? 1_555 J DA 108 N1 ? ? J DT -108 I DA 108 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog477 hydrog ? ? A DT 205 O4 ? ? ? 1_555 J DA 108 N6 ? ? J DT -108 I DA 108 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog478 hydrog ? ? A DC 206 O2 ? ? ? 1_555 J DG 107 N2 ? ? J DC -107 I DG 107 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog479 hydrog ? ? A DC 207 N4 ? ? ? 1_555 J DG 106 O6 ? ? J DC -106 I DG 106 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog480 hydrog ? ? A DC 207 O2 ? ? ? 1_555 J DG 107 N2 ? ? J DC -106 I DG 107 1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog481 hydrog ? ? A DC 208 N3 ? ? ? 1_555 J DG 105 N1 ? ? J DC -105 I DG 105 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog482 hydrog ? ? A DC 208 N4 ? ? ? 1_555 J DG 105 O6 ? ? J DC -105 I DG 105 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog483 hydrog ? ? A DC 208 O2 ? ? ? 1_555 J DG 105 N2 ? ? J DC -105 I DG 105 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog484 hydrog ? ? A DC 209 N3 ? ? ? 1_555 J DG 104 N1 ? ? J DC -104 I DG 104 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog485 hydrog ? ? A DC 209 N4 ? ? ? 1_555 J DG 104 O6 ? ? J DC -104 I DG 104 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog486 hydrog ? ? A DC 209 O2 ? ? ? 1_555 J DG 104 N2 ? ? J DC -104 I DG 104 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog487 hydrog ? ? A DT 210 N3 ? ? ? 1_555 J DA 103 N1 ? ? J DT -103 I DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog488 hydrog ? ? A DT 210 O4 ? ? ? 1_555 J DA 103 N6 ? ? J DT -103 I DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog489 hydrog ? ? A DT 211 N3 ? ? ? 1_555 J DA 102 N1 ? ? J DT -102 I DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog490 hydrog ? ? A DT 211 O4 ? ? ? 1_555 J DA 102 N6 ? ? J DT -102 I DA 102 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog491 hydrog ? ? A DG 212 N1 ? ? ? 1_555 J DC 101 N3 ? ? J DG -101 I DC 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog492 hydrog ? ? A DG 212 N2 ? ? ? 1_555 J DC 101 O2 ? ? J DG -101 I DC 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog493 hydrog ? ? A DG 212 O6 ? ? ? 1_555 J DC 101 N4 ? ? J DG -101 I DC 101 1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog494 hydrog ? ? A DG 213 N1 ? ? ? 1_555 J DC 100 O2 ? ? J DG -100 I DC 100 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog495 hydrog ? ? A DG 213 N2 ? ? ? 1_555 J DC 101 O2 ? ? J DG -100 I DC 101 1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog496 hydrog ? ? A DC 214 N3 ? ? ? 1_555 J DG 99  N1 ? ? J DC -99  I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog497 hydrog ? ? A DC 214 N4 ? ? ? 1_555 J DG 99  O6 ? ? J DC -99  I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog498 hydrog ? ? A DC 214 O2 ? ? ? 1_555 J DG 99  N2 ? ? J DC -99  I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog499 hydrog ? ? A DG 215 O6 ? ? ? 1_555 J DC 97  N4 ? ? J DG -98  I DC 97  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog500 hydrog ? ? A DG 215 N2 ? ? ? 1_555 J DC 98  N3 ? ? J DG -98  I DC 98  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog501 hydrog ? ? A DG 216 N1 ? ? ? 1_555 J DC 97  N3 ? ? J DG -97  I DC 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog502 hydrog ? ? A DG 216 N2 ? ? ? 1_555 J DC 97  O2 ? ? J DG -97  I DC 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog503 hydrog ? ? A DG 216 O6 ? ? ? 1_555 J DC 97  N4 ? ? J DG -97  I DC 97  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog504 hydrog ? ? A DT 218 N3 ? ? ? 1_555 J DA 95  N1 ? ? J DT -95  I DA 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog505 hydrog ? ? A DT 218 O4 ? ? ? 1_555 J DA 95  N6 ? ? J DT -95  I DA 95  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog506 hydrog ? ? A DA 219 N1 ? ? ? 1_555 J DT 94  N3 ? ? J DA -94  I DT 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog507 hydrog ? ? A DA 219 N6 ? ? ? 1_555 J DT 94  O4 ? ? J DA -94  I DT 94  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog508 hydrog ? ? A DA 220 N1 ? ? ? 1_555 J DT 93  N3 ? ? J DA -93  I DT 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog509 hydrog ? ? A DA 220 N6 ? ? ? 1_555 J DT 93  O4 ? ? J DA -93  I DT 93  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog510 hydrog ? ? A DA 221 N1 ? ? ? 1_555 J DT 92  N3 ? ? J DA -92  I DT 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog511 hydrog ? ? A DA 221 N6 ? ? ? 1_555 J DT 92  O4 ? ? J DA -92  I DT 92  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog512 hydrog ? ? A DA 222 N1 ? ? ? 1_555 J DT 91  N3 ? ? J DA -91  I DT 91  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog513 hydrog ? ? A DA 222 N6 ? ? ? 1_555 J DT 91  O4 ? ? J DA -91  I DT 91  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog514 hydrog ? ? A DC 223 N3 ? ? ? 1_555 J DG 90  N1 ? ? J DC -90  I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog515 hydrog ? ? A DC 223 N4 ? ? ? 1_555 J DG 90  O6 ? ? J DC -90  I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog516 hydrog ? ? A DC 223 O2 ? ? ? 1_555 J DG 90  N2 ? ? J DC -90  I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog517 hydrog ? ? A DG 224 N1 ? ? ? 1_555 J DC 89  N3 ? ? J DG -89  I DC 89  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog518 hydrog ? ? A DG 224 N2 ? ? ? 1_555 J DC 89  O2 ? ? J DG -89  I DC 89  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog519 hydrog ? ? A DG 224 O6 ? ? ? 1_555 J DC 89  N4 ? ? J DG -89  I DC 89  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog520 hydrog ? ? A DC 225 N3 ? ? ? 1_555 J DG 88  N2 ? ? J DC -88  I DG 88  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog521 hydrog ? ? A DC 225 O2 ? ? ? 1_555 J DG 88  N1 ? ? J DC -88  I DG 88  1_555 ? ? ? ? ? ? 'REVERSED WATSON-CRICK' ? ? 
hydrog522 hydrog ? ? A DG 226 N1 ? ? ? 1_555 J DC 87  N3 ? ? J DG -87  I DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog523 hydrog ? ? A DG 226 N2 ? ? ? 1_555 J DC 87  O2 ? ? J DG -87  I DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog524 hydrog ? ? A DG 226 O6 ? ? ? 1_555 J DC 87  N4 ? ? J DG -87  I DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog525 hydrog ? ? A DG 227 N1 ? ? ? 1_555 J DC 86  N3 ? ? J DG -86  I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog526 hydrog ? ? A DG 227 N2 ? ? ? 1_555 J DC 86  O2 ? ? J DG -86  I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog527 hydrog ? ? A DG 227 O6 ? ? ? 1_555 J DC 86  N4 ? ? J DG -86  I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog528 hydrog ? ? A DG 228 N1 ? ? ? 1_555 J DC 85  N3 ? ? J DG -85  I DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog529 hydrog ? ? A DG 228 N2 ? ? ? 1_555 J DC 85  O2 ? ? J DG -85  I DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog530 hydrog ? ? A DG 228 O6 ? ? ? 1_555 J DC 85  N4 ? ? J DG -85  I DC 85  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog531 hydrog ? ? A DG 229 N1 ? ? ? 1_555 J DC 84  N3 ? ? J DG -84  I DC 84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog532 hydrog ? ? A DG 229 N2 ? ? ? 1_555 J DC 84  O2 ? ? J DG -84  I DC 84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog533 hydrog ? ? A DG 229 O6 ? ? ? 1_555 J DC 84  N4 ? ? J DG -84  I DC 84  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog534 hydrog ? ? A DG 230 N1 ? ? ? 1_555 J DC 83  N3 ? ? J DG -83  I DC 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog535 hydrog ? ? A DG 230 N2 ? ? ? 1_555 J DC 83  O2 ? ? J DG -83  I DC 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog536 hydrog ? ? A DG 230 O6 ? ? ? 1_555 J DC 83  N4 ? ? J DG -83  I DC 83  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog537 hydrog ? ? A DA 231 N1 ? ? ? 1_555 J DT 82  N3 ? ? J DA -82  I DT 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog538 hydrog ? ? A DA 231 N6 ? ? ? 1_555 J DT 82  O4 ? ? J DA -82  I DT 82  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog539 hydrog ? ? A DC 232 N3 ? ? ? 1_555 J DG 81  N1 ? ? J DC -81  I DG 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog540 hydrog ? ? A DC 232 N4 ? ? ? 1_555 J DG 81  O6 ? ? J DC -81  I DG 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog541 hydrog ? ? A DC 232 O2 ? ? ? 1_555 J DG 81  N2 ? ? J DC -81  I DG 81  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog542 hydrog ? ? A DA 233 N1 ? ? ? 1_555 J DT 80  N3 ? ? J DA -80  I DT 80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog543 hydrog ? ? A DA 233 N6 ? ? ? 1_555 J DT 80  O4 ? ? J DA -80  I DT 80  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog544 hydrog ? ? A DG 234 N1 ? ? ? 1_555 J DC 79  N3 ? ? J DG -79  I DC 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog545 hydrog ? ? A DG 234 N2 ? ? ? 1_555 J DC 79  O2 ? ? J DG -79  I DC 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog546 hydrog ? ? A DG 234 O6 ? ? ? 1_555 J DC 79  N4 ? ? J DG -79  I DC 79  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog547 hydrog ? ? A DC 235 N3 ? ? ? 1_555 J DG 78  N1 ? ? J DC -78  I DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog548 hydrog ? ? A DC 235 N4 ? ? ? 1_555 J DG 78  O6 ? ? J DC -78  I DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog549 hydrog ? ? A DC 235 O2 ? ? ? 1_555 J DG 78  N2 ? ? J DC -78  I DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog550 hydrog ? ? A DG 236 N1 ? ? ? 1_555 J DC 77  N3 ? ? J DG -77  I DC 77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog551 hydrog ? ? A DG 236 N2 ? ? ? 1_555 J DC 77  O2 ? ? J DG -77  I DC 77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog552 hydrog ? ? A DG 236 O6 ? ? ? 1_555 J DC 77  N4 ? ? J DG -77  I DC 77  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog553 hydrog ? ? A DC 237 N3 ? ? ? 1_555 J DG 76  N1 ? ? J DC -76  I DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog554 hydrog ? ? A DC 237 N4 ? ? ? 1_555 J DG 76  O6 ? ? J DC -76  I DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog555 hydrog ? ? A DC 237 O2 ? ? ? 1_555 J DG 76  N2 ? ? J DC -76  I DG 76  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog556 hydrog ? ? A DG 238 N1 ? ? ? 1_555 J DC 75  N3 ? ? J DG -75  I DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog557 hydrog ? ? A DG 238 N2 ? ? ? 1_555 J DC 75  O2 ? ? J DG -75  I DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog558 hydrog ? ? A DG 238 O6 ? ? ? 1_555 J DC 75  N4 ? ? J DG -75  I DC 75  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog559 hydrog ? ? A DT 239 N3 ? ? ? 1_555 J DA 74  N1 ? ? J DT -74  I DA 74  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog560 hydrog ? ? A DT 239 O4 ? ? ? 1_555 J DA 74  N6 ? ? J DT -74  I DA 74  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog561 hydrog ? ? A DA 240 N1 ? ? ? 1_555 J DT 73  N3 ? ? J DA -73  I DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog562 hydrog ? ? A DA 240 N6 ? ? ? 1_555 J DT 73  O4 ? ? J DA -73  I DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog563 hydrog ? ? A DC 241 N3 ? ? ? 1_555 J DG 72  N1 ? ? J DC -72  I DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog564 hydrog ? ? A DC 241 N4 ? ? ? 1_555 J DG 72  O6 ? ? J DC -72  I DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog565 hydrog ? ? A DC 241 O2 ? ? ? 1_555 J DG 72  N2 ? ? J DC -72  I DG 72  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog566 hydrog ? ? A DG 242 N1 ? ? ? 1_555 J DC 71  N3 ? ? J DG -71  I DC 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog567 hydrog ? ? A DG 242 N2 ? ? ? 1_555 J DC 71  O2 ? ? J DG -71  I DC 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog568 hydrog ? ? A DG 242 O6 ? ? ? 1_555 J DC 71  N4 ? ? J DG -71  I DC 71  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog569 hydrog ? ? A DT 243 N3 ? ? ? 1_555 J DA 70  N1 ? ? J DT -70  I DA 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog570 hydrog ? ? A DT 243 O4 ? ? ? 1_555 J DA 70  N6 ? ? J DT -70  I DA 70  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog571 hydrog ? ? A DG 244 N1 ? ? ? 1_555 J DC 69  N3 ? ? J DG -69  I DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog572 hydrog ? ? A DG 244 N2 ? ? ? 1_555 J DC 69  O2 ? ? J DG -69  I DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog573 hydrog ? ? A DG 244 O6 ? ? ? 1_555 J DC 69  N4 ? ? J DG -69  I DC 69  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog574 hydrog ? ? A DC 245 N3 ? ? ? 1_555 J DG 68  N1 ? ? J DC -68  I DG 68  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog575 hydrog ? ? A DC 245 N4 ? ? ? 1_555 J DG 68  O6 ? ? J DC -68  I DG 68  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog576 hydrog ? ? A DC 245 O2 ? ? ? 1_555 J DG 68  N2 ? ? J DC -68  I DG 68  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog577 hydrog ? ? A DG 246 N1 ? ? ? 1_555 J DC 67  N3 ? ? J DG -67  I DC 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog578 hydrog ? ? A DG 246 N2 ? ? ? 1_555 J DC 67  O2 ? ? J DG -67  I DC 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog579 hydrog ? ? A DG 246 O6 ? ? ? 1_555 J DC 67  N4 ? ? J DG -67  I DC 67  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog580 hydrog ? ? A DT 247 N3 ? ? ? 1_555 J DA 66  N1 ? ? J DT -66  I DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog581 hydrog ? ? A DT 247 O4 ? ? ? 1_555 J DA 66  N6 ? ? J DT -66  I DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog582 hydrog ? ? A DT 248 N3 ? ? ? 1_555 J DA 65  N1 ? ? J DT -65  I DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog583 hydrog ? ? A DT 248 O4 ? ? ? 1_555 J DA 65  N6 ? ? J DT -65  I DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog584 hydrog ? ? A DT 249 N3 ? ? ? 1_555 J DA 64  N1 ? ? J DT -64  I DA 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog585 hydrog ? ? A DT 249 O4 ? ? ? 1_555 J DA 64  N6 ? ? J DT -64  I DA 64  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog586 hydrog ? ? A DA 250 N1 ? ? ? 1_555 J DT 63  N3 ? ? J DA -63  I DT 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog587 hydrog ? ? A DA 250 N6 ? ? ? 1_555 J DT 63  O4 ? ? J DA -63  I DT 63  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog588 hydrog ? ? A DA 251 N1 ? ? ? 1_555 J DT 62  N3 ? ? J DA -62  I DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog589 hydrog ? ? A DA 251 N6 ? ? ? 1_555 J DT 62  O4 ? ? J DA -62  I DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog590 hydrog ? ? A DG 252 N1 ? ? ? 1_555 J DC 61  N3 ? ? J DG -61  I DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog591 hydrog ? ? A DG 252 N2 ? ? ? 1_555 J DC 61  O2 ? ? J DG -61  I DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog592 hydrog ? ? A DG 252 O6 ? ? ? 1_555 J DC 61  N4 ? ? J DG -61  I DC 61  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog593 hydrog ? ? A DC 253 N3 ? ? ? 1_555 J DG 60  N1 ? ? J DC -60  I DG 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog594 hydrog ? ? A DC 253 N4 ? ? ? 1_555 J DG 60  O6 ? ? J DC -60  I DG 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog595 hydrog ? ? A DC 253 O2 ? ? ? 1_555 J DG 60  N2 ? ? J DC -60  I DG 60  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog596 hydrog ? ? A DG 254 N1 ? ? ? 1_555 J DC 59  N3 ? ? J DG -59  I DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog597 hydrog ? ? A DG 254 N2 ? ? ? 1_555 J DC 59  O2 ? ? J DG -59  I DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog598 hydrog ? ? A DG 254 O6 ? ? ? 1_555 J DC 59  N4 ? ? J DG -59  I DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog599 hydrog ? ? A DG 255 N1 ? ? ? 1_555 J DC 58  N3 ? ? J DG -58  I DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog600 hydrog ? ? A DG 255 N2 ? ? ? 1_555 J DC 58  O2 ? ? J DG -58  I DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog601 hydrog ? ? A DG 255 O6 ? ? ? 1_555 J DC 58  N4 ? ? J DG -58  I DC 58  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog602 hydrog ? ? A DG 255 N1 ? ? ? 1_555 J DC 59  N3 ? ? J DG -58  I DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog603 hydrog ? ? A DG 255 N2 ? ? ? 1_555 J DC 59  O2 ? ? J DG -58  I DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog604 hydrog ? ? A DG 255 O6 ? ? ? 1_555 J DC 59  N4 ? ? J DG -58  I DC 59  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog605 hydrog ? ? A DT 256 N3 ? ? ? 1_555 J DA 57  N1 ? ? J DT -57  I DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog606 hydrog ? ? A DT 256 O4 ? ? ? 1_555 J DA 57  N6 ? ? J DT -57  I DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog607 hydrog ? ? A DG 257 N1 ? ? ? 1_555 J DC 56  N3 ? ? J DG -56  I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog608 hydrog ? ? A DG 257 N2 ? ? ? 1_555 J DC 56  O2 ? ? J DG -56  I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog609 hydrog ? ? A DG 257 O6 ? ? ? 1_555 J DC 56  N4 ? ? J DG -56  I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog610 hydrog ? ? A DC 258 N3 ? ? ? 1_555 J DG 55  N1 ? ? J DC -55  I DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog611 hydrog ? ? A DC 258 N4 ? ? ? 1_555 J DG 55  O6 ? ? J DC -55  I DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog612 hydrog ? ? A DC 258 O2 ? ? ? 1_555 J DG 55  N2 ? ? J DC -55  I DG 55  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog613 hydrog ? ? A DT 259 N3 ? ? ? 1_555 J DA 54  N1 ? ? J DT -54  I DA 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog614 hydrog ? ? A DT 259 O4 ? ? ? 1_555 J DA 54  N6 ? ? J DT -54  I DA 54  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog615 hydrog ? ? A DA 260 N1 ? ? ? 1_555 J DT 53  N3 ? ? J DA -53  I DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog616 hydrog ? ? A DA 260 N6 ? ? ? 1_555 J DT 53  O4 ? ? J DA -53  I DT 53  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog617 hydrog ? ? A DG 261 N1 ? ? ? 1_555 J DC 52  N3 ? ? J DG -52  I DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog618 hydrog ? ? A DG 261 N2 ? ? ? 1_555 J DC 52  O2 ? ? J DG -52  I DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog619 hydrog ? ? A DG 261 O6 ? ? ? 1_555 J DC 52  N4 ? ? J DG -52  I DC 52  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog620 hydrog ? ? A DA 262 N1 ? ? ? 1_555 J DT 51  N3 ? ? J DA -51  I DT 51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog621 hydrog ? ? A DA 262 N6 ? ? ? 1_555 J DT 51  O4 ? ? J DA -51  I DT 51  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog622 hydrog ? ? A DG 263 N1 ? ? ? 1_555 J DC 50  N3 ? ? J DG -50  I DC 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog623 hydrog ? ? A DG 263 N2 ? ? ? 1_555 J DC 50  O2 ? ? J DG -50  I DC 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog624 hydrog ? ? A DG 263 O6 ? ? ? 1_555 J DC 50  N4 ? ? J DG -50  I DC 50  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog625 hydrog ? ? A DC 264 N3 ? ? ? 1_555 J DG 49  N1 ? ? J DC -49  I DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog626 hydrog ? ? A DC 264 N4 ? ? ? 1_555 J DG 49  O6 ? ? J DC -49  I DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog627 hydrog ? ? A DC 264 O2 ? ? ? 1_555 J DG 49  N2 ? ? J DC -49  I DG 49  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog628 hydrog ? ? A DT 265 O4 ? ? ? 1_555 J DC 47  N4 ? ? J DT -48  I DC 47  1_555 ? ? ? ? ? ? 'DT-DC MISPAIR'         ? ? 
hydrog629 hydrog ? ? A DT 265 N3 ? ? ? 1_555 J DA 48  N1 ? ? J DT -48  I DA 48  1_555 ? ? ? ? ? ? 'DT-DA PAIR'            ? ? 
hydrog630 hydrog ? ? A DG 266 N1 ? ? ? 1_555 J DA 46  N1 ? ? J DG -47  I DA 46  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog631 hydrog ? ? A DG 266 O6 ? ? ? 1_555 J DA 46  N6 ? ? J DG -47  I DA 46  1_555 ? ? ? ? ? ? TYPE_8_PAIR             ? ? 
hydrog632 hydrog ? ? A DG 266 N1 ? ? ? 1_555 J DC 47  N3 ? ? J DG -47  I DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog633 hydrog ? ? A DG 266 N2 ? ? ? 1_555 J DC 47  O2 ? ? J DG -47  I DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog634 hydrog ? ? A DG 266 O6 ? ? ? 1_555 J DC 47  N4 ? ? J DG -47  I DC 47  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog635 hydrog ? ? A DT 267 N3 ? ? ? 1_555 J DA 46  N1 ? ? J DT -46  I DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog636 hydrog ? ? A DT 267 O4 ? ? ? 1_555 J DA 46  N6 ? ? J DT -46  I DA 46  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog637 hydrog ? ? A DC 268 N3 ? ? ? 1_555 J DG 45  N1 ? ? J DC -45  I DG 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog638 hydrog ? ? A DC 268 N4 ? ? ? 1_555 J DG 45  O6 ? ? J DC -45  I DG 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog639 hydrog ? ? A DC 268 O2 ? ? ? 1_555 J DG 45  N2 ? ? J DC -45  I DG 45  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog640 hydrog ? ? A DT 269 N3 ? ? ? 1_555 J DA 44  N1 ? ? J DT -44  I DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog641 hydrog ? ? A DT 269 O4 ? ? ? 1_555 J DA 44  N6 ? ? J DT -44  I DA 44  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog642 hydrog ? ? A DA 270 N1 ? ? ? 1_555 J DT 43  N3 ? ? J DA -43  I DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog643 hydrog ? ? A DA 270 N6 ? ? ? 1_555 J DT 43  O4 ? ? J DA -43  I DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog644 hydrog ? ? A DC 271 N3 ? ? ? 1_555 J DG 42  N1 ? ? J DC -42  I DG 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog645 hydrog ? ? A DC 271 N4 ? ? ? 1_555 J DG 42  O6 ? ? J DC -42  I DG 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog646 hydrog ? ? A DC 271 O2 ? ? ? 1_555 J DG 42  N2 ? ? J DC -42  I DG 42  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog647 hydrog ? ? A DG 272 N1 ? ? ? 1_555 J DC 41  N3 ? ? J DG -41  I DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog648 hydrog ? ? A DG 272 N2 ? ? ? 1_555 J DC 41  O2 ? ? J DG -41  I DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog649 hydrog ? ? A DG 272 O6 ? ? ? 1_555 J DC 41  N4 ? ? J DG -41  I DC 41  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog650 hydrog ? ? A DA 273 N1 ? ? ? 1_555 J DT 40  N3 ? ? J DA -40  I DT 40  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog651 hydrog ? ? A DA 273 N6 ? ? ? 1_555 J DT 40  O4 ? ? J DA -40  I DT 40  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog652 hydrog ? ? A DC 274 N3 ? ? ? 1_555 J DG 39  N1 ? ? J DC -39  I DG 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog653 hydrog ? ? A DC 274 N4 ? ? ? 1_555 J DG 39  O6 ? ? J DC -39  I DG 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog654 hydrog ? ? A DC 274 O2 ? ? ? 1_555 J DG 39  N2 ? ? J DC -39  I DG 39  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog655 hydrog ? ? A DC 275 O2 ? ? ? 1_555 J DG 38  N2 ? ? J DC -38  I DG 38  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog656 hydrog ? ? A DA 276 N1 ? ? ? 1_555 J DT 37  N3 ? ? J DA -37  I DT 37  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog657 hydrog ? ? A DA 276 N6 ? ? ? 1_555 J DT 37  O4 ? ? J DA -37  I DT 37  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog658 hydrog ? ? A DA 277 N1 ? ? ? 1_555 J DT 36  N3 ? ? J DA -36  I DT 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog659 hydrog ? ? A DA 277 N6 ? ? ? 1_555 J DT 36  O4 ? ? J DA -36  I DT 36  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog660 hydrog ? ? A DT 278 N3 ? ? ? 1_555 J DA 35  N1 ? ? J DT -35  I DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog661 hydrog ? ? A DT 278 O4 ? ? ? 1_555 J DA 35  N6 ? ? J DT -35  I DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog662 hydrog ? ? A DT 279 N3 ? ? ? 1_555 J DA 34  N1 ? ? J DT -34  I DA 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog663 hydrog ? ? A DT 279 O4 ? ? ? 1_555 J DA 34  N6 ? ? J DT -34  I DA 34  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog664 hydrog ? ? A DG 280 N1 ? ? ? 1_555 J DC 33  N3 ? ? J DG -33  I DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog665 hydrog ? ? A DG 280 N2 ? ? ? 1_555 J DC 33  O2 ? ? J DG -33  I DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog666 hydrog ? ? A DG 280 O6 ? ? ? 1_555 J DC 33  N4 ? ? J DG -33  I DC 33  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog667 hydrog ? ? A DA 281 N1 ? ? ? 1_555 J DT 32  N3 ? ? J DA -32  I DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog668 hydrog ? ? A DA 281 N6 ? ? ? 1_555 J DT 32  O4 ? ? J DA -32  I DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog669 hydrog ? ? A DG 282 N1 ? ? ? 1_555 J DC 31  N3 ? ? J DG -31  I DC 31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog670 hydrog ? ? A DG 282 N2 ? ? ? 1_555 J DC 31  O2 ? ? J DG -31  I DC 31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog671 hydrog ? ? A DG 282 O6 ? ? ? 1_555 J DC 31  N4 ? ? J DG -31  I DC 31  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog672 hydrog ? ? A DC 283 N3 ? ? ? 1_555 J DG 30  N1 ? ? J DC -30  I DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog673 hydrog ? ? A DC 283 N4 ? ? ? 1_555 J DG 30  O6 ? ? J DC -30  I DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog674 hydrog ? ? A DC 283 O2 ? ? ? 1_555 J DG 30  N2 ? ? J DC -30  I DG 30  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog675 hydrog ? ? A DG 284 N1 ? ? ? 1_555 J DC 29  N3 ? ? J DG -29  I DC 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog676 hydrog ? ? A DG 284 N2 ? ? ? 1_555 J DC 29  O2 ? ? J DG -29  I DC 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog677 hydrog ? ? A DG 284 O6 ? ? ? 1_555 J DC 29  N4 ? ? J DG -29  I DC 29  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog678 hydrog ? ? A DG 285 N1 ? ? ? 1_555 J DC 28  N3 ? ? J DG -28  I DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog679 hydrog ? ? A DG 285 N2 ? ? ? 1_555 J DC 28  O2 ? ? J DG -28  I DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog680 hydrog ? ? A DG 285 O6 ? ? ? 1_555 J DC 28  N4 ? ? J DG -28  I DC 28  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog681 hydrog ? ? A DC 286 N3 ? ? ? 1_555 J DG 27  N1 ? ? J DC -27  I DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog682 hydrog ? ? A DC 286 N4 ? ? ? 1_555 J DG 27  O6 ? ? J DC -27  I DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog683 hydrog ? ? A DC 286 O2 ? ? ? 1_555 J DG 27  N2 ? ? J DC -27  I DG 27  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog684 hydrog ? ? A DC 287 N3 ? ? ? 1_555 J DG 26  N2 ? ? J DC -26  I DG 26  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog685 hydrog ? ? A DT 288 N3 ? ? ? 1_555 J DA 25  N1 ? ? J DT -25  I DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog686 hydrog ? ? A DT 288 O4 ? ? ? 1_555 J DA 25  N6 ? ? J DT -25  I DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog687 hydrog ? ? A DC 289 O2 ? ? ? 1_555 J DG 24  N2 ? ? J DC -24  I DG 24  1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog688 hydrog ? ? A DG 290 N1 ? ? ? 1_555 J DC 23  N3 ? ? J DG -23  I DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog689 hydrog ? ? A DG 290 N2 ? ? ? 1_555 J DC 23  O2 ? ? J DG -23  I DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog690 hydrog ? ? A DG 290 O6 ? ? ? 1_555 J DC 23  N4 ? ? J DG -23  I DC 23  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog691 hydrog ? ? A DG 291 N1 ? ? ? 1_555 J DC 22  N3 ? ? J DG -22  I DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog692 hydrog ? ? A DG 291 N2 ? ? ? 1_555 J DC 22  O2 ? ? J DG -22  I DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog693 hydrog ? ? A DG 291 O6 ? ? ? 1_555 J DC 22  N4 ? ? J DG -22  I DC 22  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog694 hydrog ? ? A DC 292 N3 ? ? ? 1_555 J DG 21  N1 ? ? J DC -21  I DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog695 hydrog ? ? A DC 292 N4 ? ? ? 1_555 J DG 21  O6 ? ? J DC -21  I DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog696 hydrog ? ? A DC 292 O2 ? ? ? 1_555 J DG 21  N2 ? ? J DC -21  I DG 21  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog697 hydrog ? ? A DC 294 N3 ? ? ? 1_555 J DG 19  N1 ? ? J DC -19  I DG 19  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog698 hydrog ? ? A DC 294 N4 ? ? ? 1_555 J DG 19  O6 ? ? J DC -19  I DG 19  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog699 hydrog ? ? A DC 294 O2 ? ? ? 1_555 J DG 19  N2 ? ? J DC -19  I DG 19  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog700 hydrog ? ? A DC 295 N3 ? ? ? 1_555 J DG 18  N1 ? ? J DC -18  I DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog701 hydrog ? ? A DC 295 N4 ? ? ? 1_555 J DG 18  O6 ? ? J DC -18  I DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog702 hydrog ? ? A DC 295 O2 ? ? ? 1_555 J DG 18  N2 ? ? J DC -18  I DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog703 hydrog ? ? A DG 296 N2 ? ? ? 1_555 J DC 17  N3 ? ? J DG -17  I DC 17  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog704 hydrog ? ? A DG 297 O6 ? ? ? 1_555 J DC 15  N4 ? ? J DG -16  I DC 15  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog705 hydrog ? ? A DG 297 N2 ? ? ? 1_555 J DC 16  O2 ? ? J DG -16  I DC 16  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog706 hydrog ? ? A DG 298 N2 ? ? ? 1_555 J DC 15  O2 ? ? J DG -15  I DC 15  1_555 ? ? ? ? ? ? 'DG-DC PAIR'            ? ? 
hydrog707 hydrog ? ? A DA 299 N1 ? ? ? 1_555 J DT 14  N3 ? ? J DA -14  I DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog708 hydrog ? ? A DA 299 N6 ? ? ? 1_555 J DT 14  O4 ? ? J DA -14  I DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog709 hydrog ? ? A DT 300 N3 ? ? ? 1_555 J DA 13  N1 ? ? J DT -13  I DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog710 hydrog ? ? A DT 300 O4 ? ? ? 1_555 J DA 13  N6 ? ? J DT -13  I DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog711 hydrog ? ? A DT 301 N3 ? ? ? 1_555 J DA 12  N1 ? ? J DT -12  I DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog712 hydrog ? ? A DT 301 O4 ? ? ? 1_555 J DA 12  N6 ? ? J DT -12  I DA 12  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog713 hydrog ? ? A DC 302 N3 ? ? ? 1_555 J DG 11  N1 ? ? J DC -11  I DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog714 hydrog ? ? A DC 302 N4 ? ? ? 1_555 J DG 11  O6 ? ? J DC -11  I DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog715 hydrog ? ? A DC 302 O2 ? ? ? 1_555 J DG 11  N2 ? ? J DC -11  I DG 11  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog716 hydrog ? ? A DT 303 N3 ? ? ? 1_555 J DA 10  N1 ? ? J DT -10  I DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog717 hydrog ? ? A DT 303 O4 ? ? ? 1_555 J DA 10  N6 ? ? J DT -10  I DA 10  1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog718 hydrog ? ? A DC 304 O2 ? ? ? 1_555 J DG 9   N2 ? ? J DC -9   I DG 9   1_555 ? ? ? ? ? ? 'DC-DG PAIR'            ? ? 
hydrog719 hydrog ? ? A DC 305 N3 ? ? ? 1_555 J DG 8   N1 ? ? J DC -8   I DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog720 hydrog ? ? A DC 305 N4 ? ? ? 1_555 J DG 8   O6 ? ? J DC -8   I DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog721 hydrog ? ? A DC 305 O2 ? ? ? 1_555 J DG 8   N2 ? ? J DC -8   I DG 8   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog722 hydrog ? ? A DA 306 N1 ? ? ? 1_555 J DC 6   N4 ? ? J DA -7   I DC 6   1_555 ? ? ? ? ? ? 'DA-DC MISPAIR'         ? ? 
hydrog723 hydrog ? ? A DG 307 N1 ? ? ? 1_555 J DC 6   N3 ? ? J DG -6   I DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog724 hydrog ? ? A DG 307 N2 ? ? ? 1_555 J DC 6   O2 ? ? J DG -6   I DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog725 hydrog ? ? A DG 307 O6 ? ? ? 1_555 J DC 6   N4 ? ? J DG -6   I DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog726 hydrog ? ? A DG 308 N1 ? ? ? 1_555 J DC 5   N3 ? ? J DG -5   I DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog727 hydrog ? ? A DG 308 N2 ? ? ? 1_555 J DC 5   O2 ? ? J DG -5   I DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog728 hydrog ? ? A DG 308 O6 ? ? ? 1_555 J DC 5   N4 ? ? J DG -5   I DC 5   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog729 hydrog ? ? A DG 309 N1 ? ? ? 1_555 J DC 4   N3 ? ? J DG -4   I DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog730 hydrog ? ? A DG 309 N2 ? ? ? 1_555 J DC 4   O2 ? ? J DG -4   I DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
hydrog731 hydrog ? ? A DG 309 O6 ? ? ? 1_555 J DC 4   N4 ? ? J DG -4   I DC 4   1_555 ? ? ? ? ? ? WATSON-CRICK            ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 2 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 2 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
AB2 1 2 ? parallel 
AB3 1 2 ? parallel 
AB4 1 2 ? parallel 
AB5 1 2 ? parallel 
AB6 1 2 ? parallel 
AB7 1 2 ? parallel 
AB8 1 2 ? parallel 
AB9 1 2 ? parallel 
AC1 1 2 ? parallel 
AC2 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY B 54  ? ILE B 55  ? GLY R 50  ILE R 51  
AA1 2 ARG C 78  ? ILE C 79  ? ARG Q 77  ILE Q 78  
AA2 1 THR B 89  ? ILE B 90  ? THR R 85  ILE R 86  
AA2 2 ARG C 43  ? VAL C 44  ? ARG Q 42  VAL Q 43  
AA3 1 VAL C 101 ? ILE C 103 ? VAL Q 100 ILE Q 102 
AA3 2 THR H 96  ? TYR H 98  ? THR L 96  TYR L 98  
AA4 1 ARG D 45  ? ILE D 46  ? ARG P 45  ILE P 46  
AA4 2 THR E 118 ? ILE E 119 ? THR O 118 ILE O 119 
AA5 1 THR D 80  ? VAL D 81  ? THR P 80  VAL P 81  
AA5 2 ARG E 83  ? PHE E 84  ? ARG O 83  PHE O 84  
AA6 1 LEU D 97  ? TYR D 98  ? LEU P 97  TYR P 98  
AA6 2 THR G 102 ? ILE G 103 ? THR M 101 ILE M 102 
AA7 1 GLY F 54  ? ILE F 55  ? GLY N 50  ILE N 51  
AA7 2 ARG G 78  ? ILE G 79  ? ARG M 77  ILE M 78  
AA8 1 THR F 89  ? ILE F 90  ? THR N 85  ILE N 86  
AA8 2 ARG G 43  ? VAL G 44  ? ARG M 42  VAL M 43  
AA9 1 ARG H 45  ? ILE H 46  ? ARG L 45  ILE L 46  
AA9 2 THR I 118 ? ILE I 119 ? THR K 118 ILE K 119 
AB1 1 THR H 80  ? VAL H 81  ? THR L 80  VAL L 81  
AB1 2 ARG I 83  ? PHE I 84  ? ARG K 83  PHE K 84  
AB2 1 GLY K 54  ? ILE K 55  ? GLY H 50  ILE H 51  
AB2 2 ARG L 78  ? ILE L 79  ? ARG G 77  ILE G 78  
AB3 1 THR K 89  ? ILE K 90  ? THR H 85  ILE H 86  
AB3 2 ARG L 43  ? VAL L 44  ? ARG G 42  VAL G 43  
AB4 1 VAL L 101 ? ILE L 103 ? VAL G 100 ILE G 102 
AB4 2 THR Q 96  ? TYR Q 98  ? THR B 96  TYR B 98  
AB5 1 ARG M 45  ? ILE M 46  ? ARG F 45  ILE F 46  
AB5 2 THR N 118 ? ILE N 119 ? THR E 118 ILE E 119 
AB6 1 THR M 80  ? VAL M 81  ? THR F 80  VAL F 81  
AB6 2 ARG N 83  ? PHE N 84  ? ARG E 83  PHE E 84  
AB7 1 LEU M 97  ? TYR M 98  ? LEU F 97  TYR F 98  
AB7 2 THR P 102 ? ILE P 103 ? THR C 101 ILE C 102 
AB8 1 GLY O 54  ? ILE O 55  ? GLY D 50  ILE D 51  
AB8 2 ARG P 78  ? ILE P 79  ? ARG C 77  ILE C 78  
AB9 1 THR O 89  ? ILE O 90  ? THR D 85  ILE D 86  
AB9 2 ARG P 43  ? VAL P 44  ? ARG C 42  VAL C 43  
AC1 1 ARG Q 45  ? ILE Q 46  ? ARG B 45  ILE B 46  
AC1 2 THR R 118 ? ILE R 119 ? THR A 118 ILE A 119 
AC2 1 THR Q 80  ? VAL Q 81  ? THR B 80  VAL B 81  
AC2 2 ARG R 83  ? PHE R 84  ? ARG A 83  PHE A 84  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY B 54  ? N GLY R 50  O ILE C 79  ? O ILE Q 78  
AA2 1 2 N ILE B 90  ? N ILE R 86  O ARG C 43  ? O ARG Q 42  
AA3 1 2 N THR C 102 ? N THR Q 101 O TYR H 98  ? O TYR L 98  
AA4 1 2 N ARG D 45  ? N ARG P 45  O ILE E 119 ? O ILE O 119 
AA5 1 2 N VAL D 81  ? N VAL P 81  O ARG E 83  ? O ARG O 83  
AA6 1 2 N TYR D 98  ? N TYR P 98  O THR G 102 ? O THR M 101 
AA7 1 2 N GLY F 54  ? N GLY N 50  O ILE G 79  ? O ILE M 78  
AA8 1 2 N ILE F 90  ? N ILE N 86  O ARG G 43  ? O ARG M 42  
AA9 1 2 N ARG H 45  ? N ARG L 45  O ILE I 119 ? O ILE K 119 
AB1 1 2 N VAL H 81  ? N VAL L 81  O ARG I 83  ? O ARG K 83  
AB2 1 2 N GLY K 54  ? N GLY H 50  O ILE L 79  ? O ILE G 78  
AB3 1 2 N ILE K 90  ? N ILE H 86  O ARG L 43  ? O ARG G 42  
AB4 1 2 N THR L 102 ? N THR G 101 O TYR Q 98  ? O TYR B 98  
AB5 1 2 N ARG M 45  ? N ARG F 45  O ILE N 119 ? O ILE E 119 
AB6 1 2 N VAL M 81  ? N VAL F 81  O ARG N 83  ? O ARG E 83  
AB7 1 2 N TYR M 98  ? N TYR F 98  O THR P 102 ? O THR C 101 
AB8 1 2 N GLY O 54  ? N GLY D 50  O ILE P 79  ? O ILE C 78  
AB9 1 2 N ILE O 90  ? N ILE D 86  O ARG P 43  ? O ARG C 42  
AC1 1 2 N ARG Q 45  ? N ARG B 45  O ILE R 119 ? O ILE A 119 
AC2 1 2 N VAL Q 81  ? N VAL B 81  O ARG R 83  ? O ARG A 83  
# 
_atom_sites.entry_id                    5OXV 
_atom_sites.fract_transf_matrix[1][1]   0.002867 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001988 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015804 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004484 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     P P     . DC  A 1 1   ? 104.052 0.516   108.277 1.00 629.05 ?  -312 DC  J P     1 
ATOM 2     O OP1   . DC  A 1 1   ? 104.767 -0.649  108.850 1.00 629.05 ?  -312 DC  J OP1   1 
ATOM 3     O OP2   . DC  A 1 1   ? 104.338 0.950   106.893 1.00 629.05 -1 -312 DC  J OP2   1 
ATOM 4     O "O5'" . DC  A 1 1   ? 102.472 0.289   108.402 1.00 629.05 ?  -312 DC  J "O5'" 1 
ATOM 5     C "C5'" . DC  A 1 1   ? 101.865 0.240   109.686 1.00 629.05 ?  -312 DC  J "C5'" 1 
ATOM 6     C "C4'" . DC  A 1 1   ? 100.351 0.176   109.578 1.00 629.05 ?  -312 DC  J "C4'" 1 
ATOM 7     O "O4'" . DC  A 1 1   ? 99.796  1.518   109.582 1.00 629.05 ?  -312 DC  J "O4'" 1 
ATOM 8     C "C3'" . DC  A 1 1   ? 99.811  -0.503  108.313 1.00 629.05 ?  -312 DC  J "C3'" 1 
ATOM 9     O "O3'" . DC  A 1 1   ? 98.786  -1.423  108.664 1.00 629.05 ?  -312 DC  J "O3'" 1 
ATOM 10    C "C2'" . DC  A 1 1   ? 99.254  0.665   107.501 1.00 629.05 ?  -312 DC  J "C2'" 1 
ATOM 11    C "C1'" . DC  A 1 1   ? 98.783  1.582   108.611 1.00 629.05 ?  -312 DC  J "C1'" 1 
ATOM 12    N N1    . DC  A 1 1   ? 98.612  3.048   108.156 1.00 20.00  ?  -312 DC  J N1    1 
ATOM 13    C C2    . DC  A 1 1   ? 97.495  3.771   108.564 1.00 20.00  ?  -312 DC  J C2    1 
ATOM 14    O O2    . DC  A 1 1   ? 96.654  3.219   109.284 1.00 20.00  ?  -312 DC  J O2    1 
ATOM 15    N N3    . DC  A 1 1   ? 97.363  5.057   108.151 1.00 20.00  ?  -312 DC  J N3    1 
ATOM 16    C C4    . DC  A 1 1   ? 98.291  5.626   107.372 1.00 20.00  ?  -312 DC  J C4    1 
ATOM 17    N N4    . DC  A 1 1   ? 98.115  6.884   107.002 1.00 20.00  ?  -312 DC  J N4    1 
ATOM 18    C C5    . DC  A 1 1   ? 99.445  4.902   106.936 1.00 20.00  ?  -312 DC  J C5    1 
ATOM 19    C C6    . DC  A 1 1   ? 99.558  3.615   107.364 1.00 20.00  ?  -312 DC  J C6    1 
ATOM 20    P P     . DT  A 1 2   ? 98.041  -2.285  107.529 1.00 650.83 ?  -311 DT  J P     1 
ATOM 21    O OP1   . DT  A 1 2   ? 97.785  -3.629  108.091 1.00 650.83 ?  -311 DT  J OP1   1 
ATOM 22    O OP2   . DT  A 1 2   ? 98.797  -2.156  106.264 1.00 650.83 -1 -311 DT  J OP2   1 
ATOM 23    O "O5'" . DT  A 1 2   ? 96.630  -1.551  107.346 1.00 650.83 ?  -311 DT  J "O5'" 1 
ATOM 24    C "C5'" . DT  A 1 2   ? 95.486  -2.018  108.067 1.00 650.83 ?  -311 DT  J "C5'" 1 
ATOM 25    C "C4'" . DT  A 1 2   ? 94.275  -1.138  107.801 1.00 650.83 ?  -311 DT  J "C4'" 1 
ATOM 26    O "O4'" . DT  A 1 2   ? 94.714  0.229   107.580 1.00 650.83 ?  -311 DT  J "O4'" 1 
ATOM 27    C "C3'" . DT  A 1 2   ? 93.440  -1.529  106.570 1.00 650.83 ?  -311 DT  J "C3'" 1 
ATOM 28    O "O3'" . DT  A 1 2   ? 92.047  -1.588  106.902 1.00 650.83 ?  -311 DT  J "O3'" 1 
ATOM 29    C "C2'" . DT  A 1 2   ? 93.727  -0.411  105.570 1.00 650.83 ?  -311 DT  J "C2'" 1 
ATOM 30    C "C1'" . DT  A 1 2   ? 94.005  0.765   106.491 1.00 650.83 ?  -311 DT  J "C1'" 1 
ATOM 31    N N1    . DT  A 1 2   ? 94.827  1.819   105.853 1.00 20.00  ?  -311 DT  J N1    1 
ATOM 32    C C2    . DT  A 1 2   ? 94.413  3.141   105.937 1.00 20.00  ?  -311 DT  J C2    1 
ATOM 33    O O2    . DT  A 1 2   ? 93.397  3.502   106.533 1.00 20.00  ?  -311 DT  J O2    1 
ATOM 34    N N3    . DT  A 1 2   ? 95.237  4.033   105.296 1.00 20.00  ?  -311 DT  J N3    1 
ATOM 35    C C4    . DT  A 1 2   ? 96.387  3.764   104.598 1.00 20.00  ?  -311 DT  J C4    1 
ATOM 36    O O4    . DT  A 1 2   ? 97.019  4.689   104.089 1.00 20.00  ?  -311 DT  J O4    1 
ATOM 37    C C5    . DT  A 1 2   ? 96.755  2.364   104.532 1.00 20.00  ?  -311 DT  J C5    1 
ATOM 38    C C7    . DT  A 1 2   ? 97.992  1.973   103.791 1.00 20.00  ?  -311 DT  J C7    1 
ATOM 39    C C6    . DT  A 1 2   ? 95.960  1.472   105.150 1.00 20.00  ?  -311 DT  J C6    1 
ATOM 40    P P     . DG  A 1 3   ? 91.080  -2.649  106.171 1.00 661.57 ?  -310 DG  J P     1 
ATOM 41    O OP1   . DG  A 1 3   ? 90.703  -3.658  107.181 1.00 661.57 ?  -310 DG  J OP1   1 
ATOM 42    O OP2   . DG  A 1 3   ? 91.713  -3.072  104.903 1.00 661.57 -1 -310 DG  J OP2   1 
ATOM 43    O "O5'" . DG  A 1 3   ? 89.778  -1.804  105.806 1.00 661.57 ?  -310 DG  J "O5'" 1 
ATOM 44    C "C5'" . DG  A 1 3   ? 89.015  -1.216  106.837 1.00 661.57 ?  -310 DG  J "C5'" 1 
ATOM 45    C "C4'" . DG  A 1 3   ? 88.230  -0.044  106.302 1.00 661.57 ?  -310 DG  J "C4'" 1 
ATOM 46    O "O4'" . DG  A 1 3   ? 89.146  0.984   105.842 1.00 661.57 ?  -310 DG  J "O4'" 1 
ATOM 47    C "C3'" . DG  A 1 3   ? 87.339  -0.373  105.112 1.00 661.57 ?  -310 DG  J "C3'" 1 
ATOM 48    O "O3'" . DG  A 1 3   ? 86.145  0.337   105.229 1.00 661.57 ?  -310 DG  J "O3'" 1 
ATOM 49    C "C2'" . DG  A 1 3   ? 88.157  0.117   103.924 1.00 661.57 ?  -310 DG  J "C2'" 1 
ATOM 50    C "C1'" . DG  A 1 3   ? 88.815  1.345   104.522 1.00 661.57 ?  -310 DG  J "C1'" 1 
ATOM 51    N N9    . DG  A 1 3   ? 89.966  1.737   103.869 1.00 20.00  ?  -310 DG  J N9    1 
ATOM 52    C C8    . DG  A 1 3   ? 90.908  0.932   103.270 1.00 20.00  ?  -310 DG  J C8    1 
ATOM 53    N N7    . DG  A 1 3   ? 91.895  1.595   102.723 1.00 20.00  ?  -310 DG  J N7    1 
ATOM 54    C C5    . DG  A 1 3   ? 91.601  2.932   102.969 1.00 20.00  ?  -310 DG  J C5    1 
ATOM 55    C C6    . DG  A 1 3   ? 92.291  4.119   102.625 1.00 20.00  ?  -310 DG  J C6    1 
ATOM 56    O O6    . DG  A 1 3   ? 93.357  4.234   102.003 1.00 20.00  ?  -310 DG  J O6    1 
ATOM 57    N N1    . DG  A 1 3   ? 91.624  5.257   103.080 1.00 20.00  ?  -310 DG  J N1    1 
ATOM 58    C C2    . DG  A 1 3   ? 90.437  5.253   103.780 1.00 20.00  ?  -310 DG  J C2    1 
ATOM 59    N N2    . DG  A 1 3   ? 89.938  6.449   104.138 1.00 20.00  ?  -310 DG  J N2    1 
ATOM 60    N N3    . DG  A 1 3   ? 89.783  4.148   104.106 1.00 20.00  ?  -310 DG  J N3    1 
ATOM 61    C C4    . DG  A 1 3   ? 90.415  3.029   103.673 1.00 20.00  ?  -310 DG  J C4    1 
ATOM 62    P P     . DC  A 1 4   ? 84.821  -0.192  104.503 1.00 668.86 ?  -309 DC  J P     1 
ATOM 63    O OP1   . DC  A 1 4   ? 83.928  -0.703  105.565 1.00 668.86 ?  -309 DC  J OP1   1 
ATOM 64    O OP2   . DC  A 1 4   ? 85.235  -1.091  103.400 1.00 668.86 -1 -309 DC  J OP2   1 
ATOM 65    O "O5'" . DC  A 1 4   ? 84.194  1.141   103.874 1.00 668.86 ?  -309 DC  J "O5'" 1 
ATOM 66    C "C5'" . DC  A 1 4   ? 84.052  2.314   104.687 1.00 668.86 ?  -309 DC  J "C5'" 1 
ATOM 67    C "C4'" . DC  A 1 4   ? 84.247  3.586   103.870 1.00 668.86 ?  -309 DC  J "C4'" 1 
ATOM 68    O "O4'" . DC  A 1 4   ? 85.661  3.764   103.562 1.00 668.86 ?  -309 DC  J "O4'" 1 
ATOM 69    C "C3'" . DC  A 1 4   ? 83.512  3.616   102.519 1.00 668.86 ?  -309 DC  J "C3'" 1 
ATOM 70    O "O3'" . DC  A 1 4   ? 82.856  4.872   102.331 1.00 668.86 ?  -309 DC  J "O3'" 1 
ATOM 71    C "C2'" . DC  A 1 4   ? 84.639  3.431   101.512 1.00 668.86 ?  -309 DC  J "C2'" 1 
ATOM 72    C "C1'" . DC  A 1 4   ? 85.773  4.150   102.214 1.00 668.86 ?  -309 DC  J "C1'" 1 
ATOM 73    N N1    . DC  A 1 4   ? 87.157  3.742   101.659 1.00 20.00  ?  -309 DC  J N1    1 
ATOM 74    C C2    . DC  A 1 4   ? 88.078  4.724   101.300 1.00 20.00  ?  -309 DC  J C2    1 
ATOM 75    O O2    . DC  A 1 4   ? 87.772  5.914   101.448 1.00 20.00  ?  -309 DC  J O2    1 
ATOM 76    N N3    . DC  A 1 4   ? 89.276  4.341   100.794 1.00 20.00  ?  -309 DC  J N3    1 
ATOM 77    C C4    . DC  A 1 4   ? 89.576  3.044   100.646 1.00 20.00  ?  -309 DC  J C4    1 
ATOM 78    N N4    . DC  A 1 4   ? 90.762  2.726   100.152 1.00 20.00  ?  -309 DC  J N4    1 
ATOM 79    C C5    . DC  A 1 4   ? 88.646  2.018   101.003 1.00 20.00  ?  -309 DC  J C5    1 
ATOM 80    C C6    . DC  A 1 4   ? 87.451  2.425   101.511 1.00 20.00  ?  -309 DC  J C6    1 
ATOM 81    P P     . DG  A 1 5   ? 81.788  5.067   101.140 1.00 681.11 ?  -308 DG  J P     1 
ATOM 82    O OP1   . DG  A 1 5   ? 80.536  4.401   101.556 1.00 681.11 ?  -308 DG  J OP1   1 
ATOM 83    O OP2   . DG  A 1 5   ? 82.404  4.701   99.843  1.00 681.11 -1 -308 DG  J OP2   1 
ATOM 84    O "O5'" . DG  A 1 5   ? 81.533  6.642   101.126 1.00 681.11 ?  -308 DG  J "O5'" 1 
ATOM 85    C "C5'" . DG  A 1 5   ? 82.501  7.517   101.687 1.00 681.11 ?  -308 DG  J "C5'" 1 
ATOM 86    C "C4'" . DG  A 1 5   ? 83.388  8.109   100.606 1.00 681.11 ?  -308 DG  J "C4'" 1 
ATOM 87    O "O4'" . DG  A 1 5   ? 84.498  7.231   100.344 1.00 681.11 ?  -308 DG  J "O4'" 1 
ATOM 88    C "C3'" . DG  A 1 5   ? 82.715  8.308   99.248  1.00 681.11 ?  -308 DG  J "C3'" 1 
ATOM 89    O "O3'" . DG  A 1 5   ? 82.277  9.660   99.106  1.00 681.11 ?  -308 DG  J "O3'" 1 
ATOM 90    C "C2'" . DG  A 1 5   ? 83.813  7.960   98.225  1.00 681.11 ?  -308 DG  J "C2'" 1 
ATOM 91    C "C1'" . DG  A 1 5   ? 85.017  7.582   99.089  1.00 681.11 ?  -308 DG  J "C1'" 1 
ATOM 92    N N9    . DG  A 1 5   ? 85.756  6.500   98.571  1.00 20.00  ?  -308 DG  J N9    1 
ATOM 93    C C8    . DG  A 1 5   ? 85.292  5.251   98.224  1.00 20.00  ?  -308 DG  J C8    1 
ATOM 94    N N7    . DG  A 1 5   ? 86.221  4.456   97.758  1.00 20.00  ?  -308 DG  J N7    1 
ATOM 95    C C5    . DG  A 1 5   ? 87.385  5.217   97.793  1.00 20.00  ?  -308 DG  J C5    1 
ATOM 96    C C6    . DG  A 1 5   ? 88.715  4.907   97.417  1.00 20.00  ?  -308 DG  J C6    1 
ATOM 97    O O6    . DG  A 1 5   ? 89.154  3.844   96.956  1.00 20.00  ?  -308 DG  J O6    1 
ATOM 98    N N1    . DG  A 1 5   ? 89.576  5.985   97.624  1.00 20.00  ?  -308 DG  J N1    1 
ATOM 99    C C2    . DG  A 1 5   ? 89.204  7.211   98.131  1.00 20.00  ?  -308 DG  J C2    1 
ATOM 100   N N2    . DG  A 1 5   ? 90.172  8.134   98.262  1.00 20.00  ?  -308 DG  J N2    1 
ATOM 101   N N3    . DG  A 1 5   ? 87.962  7.511   98.485  1.00 20.00  ?  -308 DG  J N3    1 
ATOM 102   C C4    . DG  A 1 5   ? 87.109  6.476   98.292  1.00 20.00  ?  -308 DG  J C4    1 
ATOM 103   P P     . DC  A 1 6   ? 81.480  10.124  97.788  1.00 684.61 ?  -307 DC  J P     1 
ATOM 104   O OP1   . DC  A 1 6   ? 80.538  11.186  98.207  1.00 684.61 ?  -307 DC  J OP1   1 
ATOM 105   O OP2   . DC  A 1 6   ? 80.972  8.902   97.118  1.00 684.61 -1 -307 DC  J OP2   1 
ATOM 106   O "O5'" . DC  A 1 6   ? 82.612  10.783  96.860  1.00 684.61 ?  -307 DC  J "O5'" 1 
ATOM 107   C "C5'" . DC  A 1 6   ? 83.392  11.882  97.348  1.00 684.61 ?  -307 DC  J "C5'" 1 
ATOM 108   C "C4'" . DC  A 1 6   ? 84.802  11.853  96.774  1.00 684.61 ?  -307 DC  J "C4'" 1 
ATOM 109   O "O4'" . DC  A 1 6   ? 85.346  10.525  96.917  1.00 684.61 ?  -307 DC  J "O4'" 1 
ATOM 110   C "C3'" . DC  A 1 6   ? 84.900  12.191  95.294  1.00 684.61 ?  -307 DC  J "C3'" 1 
ATOM 111   O "O3'" . DC  A 1 6   ? 85.171  13.587  95.149  1.00 684.61 ?  -307 DC  J "O3'" 1 
ATOM 112   C "C2'" . DC  A 1 6   ? 86.073  11.337  94.793  1.00 684.61 ?  -307 DC  J "C2'" 1 
ATOM 113   C "C1'" . DC  A 1 6   ? 86.201  10.218  95.835  1.00 684.61 ?  -307 DC  J "C1'" 1 
ATOM 114   N N1    . DC  A 1 6   ? 85.806  8.853   95.324  1.00 20.00  ?  -307 DC  J N1    1 
ATOM 115   C C2    . DC  A 1 6   ? 86.771  7.860   95.171  1.00 20.00  ?  -307 DC  J C2    1 
ATOM 116   O O2    . DC  A 1 6   ? 87.949  8.123   95.441  1.00 20.00  ?  -307 DC  J O2    1 
ATOM 117   N N3    . DC  A 1 6   ? 86.385  6.639   94.723  1.00 20.00  ?  -307 DC  J N3    1 
ATOM 118   C C4    . DC  A 1 6   ? 85.102  6.386   94.439  1.00 20.00  ?  -307 DC  J C4    1 
ATOM 119   N N4    . DC  A 1 6   ? 84.780  5.176   94.009  1.00 20.00  ?  -307 DC  J N4    1 
ATOM 120   C C5    . DC  A 1 6   ? 84.094  7.390   94.584  1.00 20.00  ?  -307 DC  J C5    1 
ATOM 121   C C6    . DC  A 1 6   ? 84.503  8.606   95.037  1.00 20.00  ?  -307 DC  J C6    1 
ATOM 122   P P     . DA  A 1 7   ? 85.030  14.309  93.719  1.00 680.07 ?  -306 DA  J P     1 
ATOM 123   O OP1   . DA  A 1 7   ? 84.221  15.530  93.932  1.00 680.07 ?  -306 DA  J OP1   1 
ATOM 124   O OP2   . DA  A 1 7   ? 84.585  13.300  92.735  1.00 680.07 -1 -306 DA  J OP2   1 
ATOM 125   O "O5'" . DA  A 1 7   ? 86.535  14.727  93.348  1.00 680.07 ?  -306 DA  J "O5'" 1 
ATOM 126   C "C5'" . DA  A 1 7   ? 86.947  14.816  91.973  1.00 680.07 ?  -306 DA  J "C5'" 1 
ATOM 127   C "C4'" . DA  A 1 7   ? 87.892  13.676  91.617  1.00 680.07 ?  -306 DA  J "C4'" 1 
ATOM 128   O "O4'" . DA  A 1 7   ? 87.339  12.446  92.113  1.00 680.07 ?  -306 DA  J "O4'" 1 
ATOM 129   C "C3'" . DA  A 1 7   ? 88.114  13.447  90.118  1.00 680.07 ?  -306 DA  J "C3'" 1 
ATOM 130   O "O3'" . DA  A 1 7   ? 89.344  14.061  89.686  1.00 680.07 ?  -306 DA  J "O3'" 1 
ATOM 131   C "C2'" . DA  A 1 7   ? 88.172  11.914  89.966  1.00 680.07 ?  -306 DA  J "C2'" 1 
ATOM 132   C "C1'" . DA  A 1 7   ? 87.855  11.376  91.365  1.00 680.07 ?  -306 DA  J "C1'" 1 
ATOM 133   N N9    . DA  A 1 7   ? 86.901  10.342  91.363  1.00 20.00  ?  -306 DA  J N9    1 
ATOM 134   C C8    . DA  A 1 7   ? 85.542  10.459  91.206  1.00 20.00  ?  -306 DA  J C8    1 
ATOM 135   N N7    . DA  A 1 7   ? 84.907  9.317   91.248  1.00 20.00  ?  -306 DA  J N7    1 
ATOM 136   C C5    . DA  A 1 7   ? 85.907  8.373   91.441  1.00 20.00  ?  -306 DA  J C5    1 
ATOM 137   C C6    . DA  A 1 7   ? 85.876  6.960   91.580  1.00 20.00  ?  -306 DA  J C6    1 
ATOM 138   N N6    . DA  A 1 7   ? 84.750  6.239   91.552  1.00 20.00  ?  -306 DA  J N6    1 
ATOM 139   N N1    . DA  A 1 7   ? 87.051  6.316   91.760  1.00 20.00  ?  -306 DA  J N1    1 
ATOM 140   C C2    . DA  A 1 7   ? 88.177  7.041   91.804  1.00 20.00  ?  -306 DA  J C2    1 
ATOM 141   N N3    . DA  A 1 7   ? 88.334  8.373   91.694  1.00 20.00  ?  -306 DA  J N3    1 
ATOM 142   C C4    . DA  A 1 7   ? 87.145  8.986   91.511  1.00 20.00  ?  -306 DA  J C4    1 
ATOM 143   P P     . DG  A 1 8   ? 89.602  14.390  88.128  1.00 679.56 ?  -305 DG  J P     1 
ATOM 144   O OP1   . DG  A 1 8   ? 90.908  15.084  88.039  1.00 679.56 ?  -305 DG  J OP1   1 
ATOM 145   O OP2   . DG  A 1 8   ? 88.390  15.045  87.586  1.00 679.56 -1 -305 DG  J OP2   1 
ATOM 146   O "O5'" . DG  A 1 8   ? 89.766  12.951  87.431  1.00 679.56 ?  -305 DG  J "O5'" 1 
ATOM 147   C "C5'" . DG  A 1 8   ? 91.025  12.259  87.500  1.00 679.56 ?  -305 DG  J "C5'" 1 
ATOM 148   C "C4'" . DG  A 1 8   ? 90.978  10.907  86.788  1.00 679.56 ?  -305 DG  J "C4'" 1 
ATOM 149   O "O4'" . DG  A 1 8   ? 89.893  10.100  87.322  1.00 679.56 ?  -305 DG  J "O4'" 1 
ATOM 150   C "C3'" . DG  A 1 8   ? 90.762  10.957  85.270  1.00 679.56 ?  -305 DG  J "C3'" 1 
ATOM 151   O "O3'" . DG  A 1 8   ? 91.591  9.982   84.623  1.00 679.56 ?  -305 DG  J "O3'" 1 
ATOM 152   C "C2'" . DG  A 1 8   ? 89.286  10.607  85.128  1.00 679.56 ?  -305 DG  J "C2'" 1 
ATOM 153   C "C1'" . DG  A 1 8   ? 89.110  9.606   86.257  1.00 679.56 ?  -305 DG  J "C1'" 1 
ATOM 154   N N9    . DG  A 1 8   ? 87.794  9.473   86.686  1.00 20.00  ?  -305 DG  J N9    1 
ATOM 155   C C8    . DG  A 1 8   ? 86.892  10.480  86.944  1.00 20.00  ?  -305 DG  J C8    1 
ATOM 156   N N7    . DG  A 1 8   ? 85.720  10.049  87.333  1.00 20.00  ?  -305 DG  J N7    1 
ATOM 157   C C5    . DG  A 1 8   ? 85.838  8.664   87.338  1.00 20.00  ?  -305 DG  J C5    1 
ATOM 158   C C6    . DG  A 1 8   ? 84.908  7.648   87.668  1.00 20.00  ?  -305 DG  J C6    1 
ATOM 159   O O6    . DG  A 1 8   ? 83.733  7.775   88.040  1.00 20.00  ?  -305 DG  J O6    1 
ATOM 160   N N1    . DG  A 1 8   ? 85.461  6.375   87.530  1.00 20.00  ?  -305 DG  J N1    1 
ATOM 161   C C2    . DG  A 1 8   ? 86.751  6.110   87.126  1.00 20.00  ?  -305 DG  J C2    1 
ATOM 162   N N2    . DG  A 1 8   ? 87.112  4.818   87.050  1.00 20.00  ?  -305 DG  J N2    1 
ATOM 163   N N3    . DG  A 1 8   ? 87.629  7.053   86.815  1.00 20.00  ?  -305 DG  J N3    1 
ATOM 164   C C4    . DG  A 1 8   ? 87.111  8.300   86.942  1.00 20.00  ?  -305 DG  J C4    1 
ATOM 165   P P     . DG  A 1 9   ? 91.792  10.006  83.025  1.00 680.94 ?  -304 DG  J P     1 
ATOM 166   O OP1   . DG  A 1 9   ? 93.246  10.061  82.769  1.00 680.94 ?  -304 DG  J OP1   1 
ATOM 167   O OP2   . DG  A 1 9   ? 90.897  11.029  82.440  1.00 680.94 -1 -304 DG  J OP2   1 
ATOM 168   O "O5'" . DG  A 1 9   ? 91.259  8.580   82.547  1.00 680.94 ?  -304 DG  J "O5'" 1 
ATOM 169   C "C5'" . DG  A 1 9   ? 92.142  7.465   82.487  1.00 680.94 ?  -304 DG  J "C5'" 1 
ATOM 170   C "C4'" . DG  A 1 9   ? 91.394  6.209   82.069  1.00 680.94 ?  -304 DG  J "C4'" 1 
ATOM 171   O "O4'" . DG  A 1 9   ? 90.112  6.167   82.745  1.00 680.94 ?  -304 DG  J "O4'" 1 
ATOM 172   C "C3'" . DG  A 1 9   ? 91.048  6.120   80.591  1.00 680.94 ?  -304 DG  J "C3'" 1 
ATOM 173   O "O3'" . DG  A 1 9   ? 90.820  4.769   80.251  1.00 680.94 ?  -304 DG  J "O3'" 1 
ATOM 174   C "C2'" . DG  A 1 9   ? 89.749  6.902   80.538  1.00 680.94 ?  -304 DG  J "C2'" 1 
ATOM 175   C "C1'" . DG  A 1 9   ? 89.074  6.391   81.804  1.00 680.94 ?  -304 DG  J "C1'" 1 
ATOM 176   N N9    . DG  A 1 9   ? 88.125  7.333   82.380  1.00 680.94 ?  -304 DG  J N9    1 
ATOM 177   C C8    . DG  A 1 9   ? 88.229  8.702   82.417  1.00 680.94 ?  -304 DG  J C8    1 
ATOM 178   N N7    . DG  A 1 9   ? 87.219  9.283   83.005  1.00 680.94 ?  -304 DG  J N7    1 
ATOM 179   C C5    . DG  A 1 9   ? 86.396  8.231   83.383  1.00 680.94 ?  -304 DG  J C5    1 
ATOM 180   C C6    . DG  A 1 9   ? 85.153  8.241   84.061  1.00 680.94 ?  -304 DG  J C6    1 
ATOM 181   O O6    . DG  A 1 9   ? 84.511  9.222   84.477  1.00 680.94 ?  -304 DG  J O6    1 
ATOM 182   N N1    . DG  A 1 9   ? 84.657  6.947   84.243  1.00 680.94 ?  -304 DG  J N1    1 
ATOM 183   C C2    . DG  A 1 9   ? 85.285  5.792   83.818  1.00 680.94 ?  -304 DG  J C2    1 
ATOM 184   N N2    . DG  A 1 9   ? 84.657  4.634   84.084  1.00 680.94 ?  -304 DG  J N2    1 
ATOM 185   N N3    . DG  A 1 9   ? 86.450  5.773   83.188  1.00 680.94 ?  -304 DG  J N3    1 
ATOM 186   C C4    . DG  A 1 9   ? 86.943  7.022   83.004  1.00 680.94 ?  -304 DG  J C4    1 
ATOM 187   P P     . DA  A 1 10  ? 91.694  4.058   79.112  1.00 675.96 ?  -303 DA  J P     1 
ATOM 188   O OP1   . DA  A 1 10  ? 92.844  3.419   79.792  1.00 675.96 ?  -303 DA  J OP1   1 
ATOM 189   O OP2   . DA  A 1 10  ? 91.923  5.062   78.046  1.00 675.96 -1 -303 DA  J OP2   1 
ATOM 190   O "O5'" . DA  A 1 10  ? 90.716  2.927   78.534  1.00 675.96 ?  -303 DA  J "O5'" 1 
ATOM 191   C "C5'" . DA  A 1 10  ? 89.870  2.184   79.417  1.00 675.96 ?  -303 DA  J "C5'" 1 
ATOM 192   C "C4'" . DA  A 1 10  ? 88.485  1.986   78.813  1.00 675.96 ?  -303 DA  J "C4'" 1 
ATOM 193   O "O4'" . DA  A 1 10  ? 87.561  2.966   79.367  1.00 675.96 ?  -303 DA  J "O4'" 1 
ATOM 194   C "C3'" . DA  A 1 10  ? 88.400  2.156   77.292  1.00 675.96 ?  -303 DA  J "C3'" 1 
ATOM 195   O "O3'" . DA  A 1 10  ? 87.412  1.283   76.766  1.00 675.96 ?  -303 DA  J "O3'" 1 
ATOM 196   C "C2'" . DA  A 1 10  ? 87.942  3.604   77.164  1.00 675.96 ?  -303 DA  J "C2'" 1 
ATOM 197   C "C1'" . DA  A 1 10  ? 86.941  3.659   78.305  1.00 675.96 ?  -303 DA  J "C1'" 1 
ATOM 198   N N9    . DA  A 1 10  ? 86.595  5.013   78.744  1.00 675.96 ?  -303 DA  J N9    1 
ATOM 199   C C8    . DA  A 1 10  ? 87.229  6.182   78.416  1.00 675.96 ?  -303 DA  J C8    1 
ATOM 200   N N7    . DA  A 1 10  ? 86.688  7.250   78.959  1.00 675.96 ?  -303 DA  J N7    1 
ATOM 201   C C5    . DA  A 1 10  ? 85.620  6.748   79.687  1.00 675.96 ?  -303 DA  J C5    1 
ATOM 202   C C6    . DA  A 1 10  ? 84.642  7.367   80.494  1.00 675.96 ?  -303 DA  J C6    1 
ATOM 203   N N6    . DA  A 1 10  ? 84.589  8.689   80.705  1.00 675.96 ?  -303 DA  J N6    1 
ATOM 204   N N1    . DA  A 1 10  ? 83.717  6.571   81.076  1.00 675.96 ?  -303 DA  J N1    1 
ATOM 205   C C2    . DA  A 1 10  ? 83.774  5.249   80.862  1.00 675.96 ?  -303 DA  J C2    1 
ATOM 206   N N3    . DA  A 1 10  ? 84.643  4.555   80.130  1.00 675.96 ?  -303 DA  J N3    1 
ATOM 207   C C4    . DA  A 1 10  ? 85.547  5.370   79.562  1.00 675.96 ?  -303 DA  J C4    1 
ATOM 208   P P     . DT  A 1 11  ? 87.795  -0.168  76.194  1.00 669.27 ?  -302 DT  J P     1 
ATOM 209   O OP1   . DT  A 1 11  ? 88.764  -0.799  77.117  1.00 669.27 ?  -302 DT  J OP1   1 
ATOM 210   O OP2   . DT  A 1 11  ? 88.115  -0.027  74.756  1.00 669.27 -1 -302 DT  J OP2   1 
ATOM 211   O "O5'" . DT  A 1 11  ? 86.416  -0.962  76.292  1.00 669.27 ?  -302 DT  J "O5'" 1 
ATOM 212   C "C5'" . DT  A 1 11  ? 85.624  -0.832  77.461  1.00 669.27 ?  -302 DT  J "C5'" 1 
ATOM 213   C "C4'" . DT  A 1 11  ? 84.317  -0.110  77.166  1.00 669.27 ?  -302 DT  J "C4'" 1 
ATOM 214   O "O4'" . DT  A 1 11  ? 84.421  1.289   77.486  1.00 669.27 ?  -302 DT  J "O4'" 1 
ATOM 215   C "C3'" . DT  A 1 11  ? 83.851  -0.137  75.706  1.00 669.27 ?  -302 DT  J "C3'" 1 
ATOM 216   O "O3'" . DT  A 1 11  ? 82.916  -1.176  75.527  1.00 669.27 ?  -302 DT  J "O3'" 1 
ATOM 217   C "C2'" . DT  A 1 11  ? 83.190  1.239   75.502  1.00 669.27 ?  -302 DT  J "C2'" 1 
ATOM 218   C "C1'" . DT  A 1 11  ? 83.319  1.903   76.873  1.00 669.27 ?  -302 DT  J "C1'" 1 
ATOM 219   N N1    . DT  A 1 11  ? 83.517  3.374   76.789  1.00 669.27 ?  -302 DT  J N1    1 
ATOM 220   C C2    . DT  A 1 11  ? 82.850  4.192   77.671  1.00 669.27 ?  -302 DT  J C2    1 
ATOM 221   O O2    . DT  A 1 11  ? 82.131  3.770   78.561  1.00 669.27 ?  -302 DT  J O2    1 
ATOM 222   N N3    . DT  A 1 11  ? 83.076  5.530   77.489  1.00 669.27 ?  -302 DT  J N3    1 
ATOM 223   C C4    . DT  A 1 11  ? 83.870  6.120   76.520  1.00 669.27 ?  -302 DT  J C4    1 
ATOM 224   O O4    . DT  A 1 11  ? 84.009  7.335   76.436  1.00 669.27 ?  -302 DT  J O4    1 
ATOM 225   C C5    . DT  A 1 11  ? 84.522  5.204   75.614  1.00 669.27 ?  -302 DT  J C5    1 
ATOM 226   C C7    . DT  A 1 11  ? 85.408  5.725   74.521  1.00 669.27 ?  -302 DT  J C7    1 
ATOM 227   C C6    . DT  A 1 11  ? 84.309  3.892   75.784  1.00 669.27 ?  -302 DT  J C6    1 
ATOM 228   P P     . DG  A 1 12  ? 82.143  -1.387  74.130  1.00 666.45 ?  -301 DG  J P     1 
ATOM 229   O OP1   . DG  A 1 12  ? 81.892  -2.844  74.193  1.00 666.45 ?  -301 DG  J OP1   1 
ATOM 230   O OP2   . DG  A 1 12  ? 82.827  -0.797  72.956  1.00 666.45 -1 -301 DG  J OP2   1 
ATOM 231   O "O5'" . DG  A 1 12  ? 80.761  -0.629  74.314  1.00 666.45 ?  -301 DG  J "O5'" 1 
ATOM 232   C "C5'" . DG  A 1 12  ? 80.037  -0.785  75.520  1.00 666.45 ?  -301 DG  J "C5'" 1 
ATOM 233   C "C4'" . DG  A 1 12  ? 78.749  0.003   75.435  1.00 666.45 ?  -301 DG  J "C4'" 1 
ATOM 234   O "O4'" . DG  A 1 12  ? 79.026  1.415   75.615  1.00 666.45 ?  -301 DG  J "O4'" 1 
ATOM 235   C "C3'" . DG  A 1 12  ? 78.042  -0.143  74.097  1.00 666.45 ?  -301 DG  J "C3'" 1 
ATOM 236   O "O3'" . DG  A 1 12  ? 76.667  -0.331  74.335  1.00 666.45 ?  -301 DG  J "O3'" 1 
ATOM 237   C "C2'" . DG  A 1 12  ? 78.351  1.158   73.359  1.00 666.45 ?  -301 DG  J "C2'" 1 
ATOM 238   C "C1'" . DG  A 1 12  ? 78.622  2.151   74.481  1.00 666.45 ?  -301 DG  J "C1'" 1 
ATOM 239   N N9    . DG  A 1 12  ? 79.673  3.108   74.148  1.00 666.45 ?  -301 DG  J N9    1 
ATOM 240   C C8    . DG  A 1 12  ? 80.772  2.896   73.344  1.00 666.45 ?  -301 DG  J C8    1 
ATOM 241   N N7    . DG  A 1 12  ? 81.543  3.938   73.232  1.00 666.45 ?  -301 DG  J N7    1 
ATOM 242   C C5    . DG  A 1 12  ? 80.912  4.901   74.004  1.00 666.45 ?  -301 DG  J C5    1 
ATOM 243   C C6    . DG  A 1 12  ? 81.280  6.241   74.257  1.00 666.45 ?  -301 DG  J C6    1 
ATOM 244   O O6    . DG  A 1 12  ? 82.273  6.841   73.827  1.00 666.45 ?  -301 DG  J O6    1 
ATOM 245   N N1    . DG  A 1 12  ? 80.374  6.895   75.093  1.00 666.45 ?  -301 DG  J N1    1 
ATOM 246   C C2    . DG  A 1 12  ? 79.242  6.316   75.622  1.00 666.45 ?  -301 DG  J C2    1 
ATOM 247   N N2    . DG  A 1 12  ? 78.487  7.095   76.409  1.00 666.45 ?  -301 DG  J N2    1 
ATOM 248   N N3    . DG  A 1 12  ? 78.880  5.055   75.392  1.00 666.45 ?  -301 DG  J N3    1 
ATOM 249   C C4    . DG  A 1 12  ? 79.759  4.413   74.576  1.00 666.45 ?  -301 DG  J C4    1 
ATOM 250   P P     . DT  A 1 13  ? 75.593  -0.270  73.153  1.00 661.47 ?  -300 DT  J P     1 
ATOM 251   O OP1   . DT  A 1 13  ? 74.517  -1.232  73.474  1.00 661.47 ?  -300 DT  J OP1   1 
ATOM 252   O OP2   . DT  A 1 13  ? 76.293  -0.355  71.849  1.00 661.47 -1 -300 DT  J OP2   1 
ATOM 253   O "O5'" . DT  A 1 13  ? 75.011  1.213   73.319  1.00 661.47 ?  -300 DT  J "O5'" 1 
ATOM 254   C "C5'" . DT  A 1 13  ? 74.702  1.733   74.620  1.00 661.47 ?  -300 DT  J "C5'" 1 
ATOM 255   C "C4'" . DT  A 1 13  ? 74.203  3.174   74.562  1.00 661.47 ?  -300 DT  J "C4'" 1 
ATOM 256   O "O4'" . DT  A 1 13  ? 75.308  4.111   74.421  1.00 661.47 ?  -300 DT  J "O4'" 1 
ATOM 257   C "C3'" . DT  A 1 13  ? 73.223  3.489   73.434  1.00 661.47 ?  -300 DT  J "C3'" 1 
ATOM 258   O "O3'" . DT  A 1 13  ? 72.194  4.310   73.971  1.00 661.47 ?  -300 DT  J "O3'" 1 
ATOM 259   C "C2'" . DT  A 1 13  ? 74.080  4.223   72.407  1.00 661.47 ?  -300 DT  J "C2'" 1 
ATOM 260   C "C1'" . DT  A 1 13  ? 75.109  4.928   73.289  1.00 661.47 ?  -300 DT  J "C1'" 1 
ATOM 261   N N1    . DT  A 1 13  ? 76.435  5.165   72.637  1.00 661.47 ?  -300 DT  J N1    1 
ATOM 262   C C2    . DT  A 1 13  ? 77.090  6.355   72.873  1.00 661.47 ?  -300 DT  J C2    1 
ATOM 263   O O2    . DT  A 1 13  ? 76.644  7.236   73.586  1.00 661.47 ?  -300 DT  J O2    1 
ATOM 264   N N3    . DT  A 1 13  ? 78.299  6.479   72.231  1.00 661.47 ?  -300 DT  J N3    1 
ATOM 265   C C4    . DT  A 1 13  ? 78.908  5.551   71.395  1.00 661.47 ?  -300 DT  J C4    1 
ATOM 266   O O4    . DT  A 1 13  ? 80.001  5.764   70.869  1.00 661.47 ?  -300 DT  J O4    1 
ATOM 267   C C5    . DT  A 1 13  ? 78.170  4.326   71.193  1.00 661.47 ?  -300 DT  J C5    1 
ATOM 268   C C7    . DT  A 1 13  ? 78.718  3.241   70.311  1.00 661.47 ?  -300 DT  J C7    1 
ATOM 269   C C6    . DT  A 1 13  ? 76.989  4.197   71.815  1.00 661.47 ?  -300 DT  J C6    1 
ATOM 270   P P     . DA  A 1 14  ? 70.804  4.575   73.222  1.00 661.83 ?  -299 DA  J P     1 
ATOM 271   O OP1   . DA  A 1 14  ? 69.731  4.113   74.130  1.00 661.83 ?  -299 DA  J OP1   1 
ATOM 272   O OP2   . DA  A 1 14  ? 70.881  4.050   71.837  1.00 661.83 -1 -299 DA  J OP2   1 
ATOM 273   O "O5'" . DA  A 1 14  ? 70.755  6.180   73.133  1.00 661.83 ?  -299 DA  J "O5'" 1 
ATOM 274   C "C5'" . DA  A 1 14  ? 71.445  7.043   74.056  1.00 661.83 ?  -299 DA  J "C5'" 1 
ATOM 275   C "C4'" . DA  A 1 14  ? 72.103  8.229   73.362  1.00 661.83 ?  -299 DA  J "C4'" 1 
ATOM 276   O "O4'" . DA  A 1 14  ? 73.399  7.866   72.811  1.00 661.83 ?  -299 DA  J "O4'" 1 
ATOM 277   C "C3'" . DA  A 1 14  ? 71.313  8.858   72.208  1.00 661.83 ?  -299 DA  J "C3'" 1 
ATOM 278   O "O3'" . DA  A 1 14  ? 71.071  10.251  72.472  1.00 661.83 ?  -299 DA  J "O3'" 1 
ATOM 279   C "C2'" . DA  A 1 14  ? 72.224  8.659   70.999  1.00 661.83 ?  -299 DA  J "C2'" 1 
ATOM 280   C "C1'" . DA  A 1 14  ? 73.594  8.660   71.664  1.00 661.83 ?  -299 DA  J "C1'" 1 
ATOM 281   N N9    . DA  A 1 14  ? 74.673  8.122   70.835  1.00 661.83 ?  -299 DA  J N9    1 
ATOM 282   C C8    . DA  A 1 14  ? 74.818  6.835   70.409  1.00 661.83 ?  -299 DA  J C8    1 
ATOM 283   N N7    . DA  A 1 14  ? 75.884  6.626   69.676  1.00 661.83 ?  -299 DA  J N7    1 
ATOM 284   C C5    . DA  A 1 14  ? 76.490  7.869   69.604  1.00 661.83 ?  -299 DA  J C5    1 
ATOM 285   C C6    . DA  A 1 14  ? 77.671  8.330   68.964  1.00 661.83 ?  -299 DA  J C6    1 
ATOM 286   N N6    . DA  A 1 14  ? 78.477  7.541   68.244  1.00 661.83 ?  -299 DA  J N6    1 
ATOM 287   N N1    . DA  A 1 14  ? 77.997  9.638   69.088  1.00 661.83 ?  -299 DA  J N1    1 
ATOM 288   C C2    . DA  A 1 14  ? 77.192  10.435  69.807  1.00 661.83 ?  -299 DA  J C2    1 
ATOM 289   N N3    . DA  A 1 14  ? 76.062  10.115  70.453  1.00 661.83 ?  -299 DA  J N3    1 
ATOM 290   C C4    . DA  A 1 14  ? 75.757  8.807   70.315  1.00 661.83 ?  -299 DA  J C4    1 
ATOM 291   P P     . DT  A 1 15  ? 69.830  11.075  71.861  1.00 657.15 ?  -298 DT  J P     1 
ATOM 292   O OP1   . DT  A 1 15  ? 69.513  12.133  72.846  1.00 657.15 ?  -298 DT  J OP1   1 
ATOM 293   O OP2   . DT  A 1 15  ? 68.757  10.141  71.452  1.00 657.15 -1 -298 DT  J OP2   1 
ATOM 294   O "O5'" . DT  A 1 15  ? 70.456  11.729  70.536  1.00 657.15 ?  -298 DT  J "O5'" 1 
ATOM 295   C "C5'" . DT  A 1 15  ? 71.346  12.834  70.653  1.00 657.15 ?  -298 DT  J "C5'" 1 
ATOM 296   C "C4'" . DT  A 1 15  ? 72.327  12.928  69.495  1.00 657.15 ?  -298 DT  J "C4'" 1 
ATOM 297   O "O4'" . DT  A 1 15  ? 73.032  11.679  69.271  1.00 657.15 ?  -298 DT  J "O4'" 1 
ATOM 298   C "C3'" . DT  A 1 15  ? 71.729  13.322  68.141  1.00 657.15 ?  -298 DT  J "C3'" 1 
ATOM 299   O "O3'" . DT  A 1 15  ? 72.363  14.523  67.697  1.00 657.15 ?  -298 DT  J "O3'" 1 
ATOM 300   C "C2'" . DT  A 1 15  ? 72.096  12.151  67.231  1.00 657.15 ?  -298 DT  J "C2'" 1 
ATOM 301   C "C1'" . DT  A 1 15  ? 73.395  11.724  67.905  1.00 657.15 ?  -298 DT  J "C1'" 1 
ATOM 302   N N1    . DT  A 1 15  ? 73.983  10.429  67.417  1.00 657.15 ?  -298 DT  J N1    1 
ATOM 303   C C2    . DT  A 1 15  ? 75.177  10.451  66.704  1.00 657.15 ?  -298 DT  J C2    1 
ATOM 304   O O2    . DT  A 1 15  ? 75.805  11.463  66.432  1.00 657.15 ?  -298 DT  J O2    1 
ATOM 305   N N3    . DT  A 1 15  ? 75.623  9.213   66.304  1.00 657.15 ?  -298 DT  J N3    1 
ATOM 306   C C4    . DT  A 1 15  ? 75.017  7.989   66.537  1.00 657.15 ?  -298 DT  J C4    1 
ATOM 307   O O4    . DT  A 1 15  ? 75.516  6.946   66.129  1.00 657.15 ?  -298 DT  J O4    1 
ATOM 308   C C5    . DT  A 1 15  ? 73.780  8.033   67.289  1.00 657.15 ?  -298 DT  J C5    1 
ATOM 309   C C7    . DT  A 1 15  ? 73.018  6.781   67.613  1.00 657.15 ?  -298 DT  J C7    1 
ATOM 310   C C6    . DT  A 1 15  ? 73.331  9.234   67.682  1.00 657.15 ?  -298 DT  J C6    1 
ATOM 311   P P     . DA  A 1 16  ? 71.629  15.575  66.734  1.00 662.11 ?  -297 DA  J P     1 
ATOM 312   O OP1   . DA  A 1 16  ? 70.471  16.118  67.486  1.00 662.11 ?  -297 DA  J OP1   1 
ATOM 313   O OP2   . DA  A 1 16  ? 71.398  14.950  65.411  1.00 662.11 -1 -297 DA  J OP2   1 
ATOM 314   O "O5'" . DA  A 1 16  ? 72.749  16.712  66.548  1.00 662.11 ?  -297 DA  J "O5'" 1 
ATOM 315   C "C5'" . DA  A 1 16  ? 74.150  16.406  66.462  1.00 662.11 ?  -297 DA  J "C5'" 1 
ATOM 316   C "C4'" . DA  A 1 16  ? 74.712  16.557  65.051  1.00 662.11 ?  -297 DA  J "C4'" 1 
ATOM 317   O "O4'" . DA  A 1 16  ? 75.475  15.365  64.711  1.00 662.11 ?  -297 DA  J "O4'" 1 
ATOM 318   C "C3'" . DA  A 1 16  ? 73.670  16.760  63.947  1.00 662.11 ?  -297 DA  J "C3'" 1 
ATOM 319   O "O3'" . DA  A 1 16  ? 73.948  17.936  63.169  1.00 662.11 ?  -297 DA  J "O3'" 1 
ATOM 320   C "C2'" . DA  A 1 16  ? 73.725  15.473  63.126  1.00 662.11 ?  -297 DA  J "C2'" 1 
ATOM 321   C "C1'" . DA  A 1 16  ? 75.079  14.857  63.449  1.00 662.11 ?  -297 DA  J "C1'" 1 
ATOM 322   N N9    . DA  A 1 16  ? 75.024  13.389  63.455  1.00 662.11 ?  -297 DA  J N9    1 
ATOM 323   C C8    . DA  A 1 16  ? 74.024  12.599  63.961  1.00 662.11 ?  -297 DA  J C8    1 
ATOM 324   N N7    . DA  A 1 16  ? 74.229  11.312  63.816  1.00 662.11 ?  -297 DA  J N7    1 
ATOM 325   C C5    . DA  A 1 16  ? 75.452  11.244  63.168  1.00 662.11 ?  -297 DA  J C5    1 
ATOM 326   C C6    . DA  A 1 16  ? 76.244  10.159  62.722  1.00 662.11 ?  -297 DA  J C6    1 
ATOM 327   N N6    . DA  A 1 16  ? 75.903  8.876   62.873  1.00 662.11 ?  -297 DA  J N6    1 
ATOM 328   N N1    . DA  A 1 16  ? 77.412  10.439  62.108  1.00 662.11 ?  -297 DA  J N1    1 
ATOM 329   C C2    . DA  A 1 16  ? 77.772  11.720  61.950  1.00 662.11 ?  -297 DA  J C2    1 
ATOM 330   N N3    . DA  A 1 16  ? 77.115  12.819  62.323  1.00 662.11 ?  -297 DA  J N3    1 
ATOM 331   C C4    . DA  A 1 16  ? 75.953  12.515  62.933  1.00 662.11 ?  -297 DA  J C4    1 
ATOM 332   P P     . DT  A 1 17  ? 73.201  18.281  61.781  1.00 659.94 ?  -296 DT  J P     1 
ATOM 333   O OP1   . DT  A 1 17  ? 73.207  19.754  61.646  1.00 659.94 ?  -296 DT  J OP1   1 
ATOM 334   O OP2   . DT  A 1 17  ? 71.907  17.557  61.698  1.00 659.94 -1 -296 DT  J OP2   1 
ATOM 335   O "O5'" . DT  A 1 17  ? 74.219  17.677  60.694  1.00 659.94 ?  -296 DT  J "O5'" 1 
ATOM 336   C "C5'" . DT  A 1 17  ? 75.638  17.883  60.833  1.00 659.94 ?  -296 DT  J "C5'" 1 
ATOM 337   C "C4'" . DT  A 1 17  ? 76.438  16.949  59.940  1.00 659.94 ?  -296 DT  J "C4'" 1 
ATOM 338   O "O4'" . DT  A 1 17  ? 76.360  15.592  60.442  1.00 659.94 ?  -296 DT  J "O4'" 1 
ATOM 339   C "C3'" . DT  A 1 17  ? 75.927  16.892  58.510  1.00 659.94 ?  -296 DT  J "C3'" 1 
ATOM 340   O "O3'" . DT  A 1 17  ? 76.688  17.752  57.674  1.00 659.94 ?  -296 DT  J "O3'" 1 
ATOM 341   C "C2'" . DT  A 1 17  ? 76.092  15.438  58.081  1.00 659.94 ?  -296 DT  J "C2'" 1 
ATOM 342   C "C1'" . DT  A 1 17  ? 76.344  14.665  59.367  1.00 659.94 ?  -296 DT  J "C1'" 1 
ATOM 343   N N1    . DT  A 1 17  ? 75.328  13.572  59.606  1.00 659.94 ?  -296 DT  J N1    1 
ATOM 344   C C2    . DT  A 1 17  ? 75.692  12.252  59.394  1.00 659.94 ?  -296 DT  J C2    1 
ATOM 345   O O2    . DT  A 1 17  ? 76.801  11.899  59.022  1.00 659.94 ?  -296 DT  J O2    1 
ATOM 346   N N3    . DT  A 1 17  ? 74.698  11.340  59.643  1.00 659.94 ?  -296 DT  J N3    1 
ATOM 347   C C4    . DT  A 1 17  ? 73.408  11.607  60.066  1.00 659.94 ?  -296 DT  J C4    1 
ATOM 348   O O4    . DT  A 1 17  ? 72.597  10.706  60.258  1.00 659.94 ?  -296 DT  J O4    1 
ATOM 349   C C5    . DT  A 1 17  ? 73.083  13.002  60.264  1.00 659.94 ?  -296 DT  J C5    1 
ATOM 350   C C7    . DT  A 1 17  ? 71.710  13.418  60.722  1.00 659.94 ?  -296 DT  J C7    1 
ATOM 351   C C6    . DT  A 1 17  ? 74.048  13.902  60.023  1.00 659.94 ?  -296 DT  J C6    1 
ATOM 352   P P     . DA  A 1 18  ? 76.055  18.293  56.302  1.00 660.29 ?  -295 DA  J P     1 
ATOM 353   O OP1   . DA  A 1 18  ? 76.512  19.696  56.158  1.00 660.29 ?  -295 DA  J OP1   1 
ATOM 354   O OP2   . DA  A 1 18  ? 74.599  18.000  56.299  1.00 660.29 -1 -295 DA  J OP2   1 
ATOM 355   O "O5'" . DA  A 1 18  ? 76.733  17.400  55.147  1.00 660.29 ?  -295 DA  J "O5'" 1 
ATOM 356   C "C5'" . DA  A 1 18  ? 77.969  16.670  55.321  1.00 660.29 ?  -295 DA  J "C5'" 1 
ATOM 357   C "C4'" . DA  A 1 18  ? 77.942  15.324  54.600  1.00 660.29 ?  -295 DA  J "C4'" 1 
ATOM 358   O "O4'" . DA  A 1 18  ? 77.184  14.340  55.360  1.00 660.29 ?  -295 DA  J "O4'" 1 
ATOM 359   C "C3'" . DA  A 1 18  ? 77.346  15.331  53.189  1.00 660.29 ?  -295 DA  J "C3'" 1 
ATOM 360   O "O3'" . DA  A 1 18  ? 78.245  14.636  52.324  1.00 660.29 ?  -295 DA  J "O3'" 1 
ATOM 361   C "C2'" . DA  A 1 18  ? 75.997  14.635  53.370  1.00 660.29 ?  -295 DA  J "C2'" 1 
ATOM 362   C "C1'" . DA  A 1 18  ? 76.307  13.649  54.491  1.00 660.29 ?  -295 DA  J "C1'" 1 
ATOM 363   N N9    . DA  A 1 18  ? 75.126  13.186  55.219  1.00 660.29 ?  -295 DA  J N9    1 
ATOM 364   C C8    . DA  A 1 18  ? 74.124  13.960  55.742  1.00 660.29 ?  -295 DA  J C8    1 
ATOM 365   N N7    . DA  A 1 18  ? 73.178  13.280  56.345  1.00 660.29 ?  -295 DA  J N7    1 
ATOM 366   C C5    . DA  A 1 18  ? 73.584  11.965  56.204  1.00 660.29 ?  -295 DA  J C5    1 
ATOM 367   C C6    . DA  A 1 18  ? 73.009  10.750  56.625  1.00 660.29 ?  -295 DA  J C6    1 
ATOM 368   N N6    . DA  A 1 18  ? 71.860  10.704  57.300  1.00 660.29 ?  -295 DA  J N6    1 
ATOM 369   N N1    . DA  A 1 18  ? 73.655  9.597   56.331  1.00 660.29 ?  -295 DA  J N1    1 
ATOM 370   C C2    . DA  A 1 18  ? 74.812  9.661   55.655  1.00 660.29 ?  -295 DA  J C2    1 
ATOM 371   N N3    . DA  A 1 18  ? 75.446  10.747  55.204  1.00 660.29 ?  -295 DA  J N3    1 
ATOM 372   C C4    . DA  A 1 18  ? 74.778  11.881  55.512  1.00 660.29 ?  -295 DA  J C4    1 
ATOM 373   P P     . DT  A 1 19  ? 77.950  14.254  50.793  1.00 660.03 ?  -294 DT  J P     1 
ATOM 374   O OP1   . DT  A 1 19  ? 78.813  15.107  49.949  1.00 660.03 ?  -294 DT  J OP1   1 
ATOM 375   O OP2   . DT  A 1 19  ? 76.490  14.218  50.543  1.00 660.03 -1 -294 DT  J OP2   1 
ATOM 376   O "O5'" . DT  A 1 19  ? 78.521  12.757  50.715  1.00 660.03 ?  -294 DT  J "O5'" 1 
ATOM 377   C "C5'" . DT  A 1 19  ? 78.234  11.781  51.725  1.00 660.03 ?  -294 DT  J "C5'" 1 
ATOM 378   C "C4'" . DT  A 1 19  ? 77.470  10.592  51.161  1.00 660.03 ?  -294 DT  J "C4'" 1 
ATOM 379   O "O4'" . DT  A 1 19  ? 76.318  10.296  51.997  1.00 660.03 ?  -294 DT  J "O4'" 1 
ATOM 380   C "C3'" . DT  A 1 19  ? 76.925  10.764  49.746  1.00 659.97 ?  -294 DT  J "C3'" 1 
ATOM 381   O "O3'" . DT  A 1 19  ? 77.082  9.554   49.031  1.00 659.37 ?  -294 DT  J "O3'" 1 
ATOM 382   C "C2'" . DT  A 1 19  ? 75.451  11.084  49.969  1.00 660.03 ?  -294 DT  J "C2'" 1 
ATOM 383   C "C1'" . DT  A 1 19  ? 75.162  10.215  51.186  1.00 660.02 ?  -294 DT  J "C1'" 1 
ATOM 384   N N1    . DT  A 1 19  ? 73.980  10.629  51.998  1.00 659.93 ?  -294 DT  J N1    1 
ATOM 385   C C2    . DT  A 1 19  ? 73.308  9.661   52.722  1.00 660.03 ?  -294 DT  J C2    1 
ATOM 386   O O2    . DT  A 1 19  ? 73.625  8.482   52.740  1.00 660.03 ?  -294 DT  J O2    1 
ATOM 387   N N3    . DT  A 1 19  ? 72.238  10.129  53.445  1.00 659.95 ?  -294 DT  J N3    1 
ATOM 388   C C4    . DT  A 1 19  ? 71.779  11.431  53.510  1.00 659.97 ?  -294 DT  J C4    1 
ATOM 389   O O4    . DT  A 1 19  ? 70.804  11.729  54.195  1.00 659.96 ?  -294 DT  J O4    1 
ATOM 390   C C5    . DT  A 1 19  ? 72.525  12.395  52.730  1.00 660.03 ?  -294 DT  J C5    1 
ATOM 391   C C7    . DT  A 1 19  ? 72.132  13.846  52.712  1.00 660.03 ?  -294 DT  J C7    1 
ATOM 392   C C6    . DT  A 1 19  ? 73.576  11.952  52.023  1.00 659.86 ?  -294 DT  J C6    1 
ATOM 393   P P     . DC  A 1 20  ? 77.189  9.570   47.433  1.00 660.01 ?  -293 DC  J P     1 
ATOM 394   O OP1   . DC  A 1 20  ? 78.612  9.837   47.131  1.00 660.01 ?  -293 DC  J OP1   1 
ATOM 395   O OP2   . DC  A 1 20  ? 76.119  10.450  46.897  1.00 660.01 -1 -293 DC  J OP2   1 
ATOM 396   O "O5'" . DC  A 1 20  ? 76.857  8.066   46.978  1.00 660.01 ?  -293 DC  J "O5'" 1 
ATOM 397   C "C5'" . DC  A 1 20  ? 76.732  7.002   47.928  1.00 660.01 ?  -293 DC  J "C5'" 1 
ATOM 398   C "C4'" . DC  A 1 20  ? 75.374  6.338   47.820  1.00 660.01 ?  -293 DC  J "C4'" 1 
ATOM 399   O "O4'" . DC  A 1 20  ? 74.473  6.966   48.764  1.00 660.01 ?  -293 DC  J "O4'" 1 
ATOM 400   C "C3'" . DC  A 1 20  ? 74.715  6.419   46.439  1.00 660.01 ?  -293 DC  J "C3'" 1 
ATOM 401   O "O3'" . DC  A 1 20  ? 74.728  5.116   45.784  1.00 660.01 ?  -293 DC  J "O3'" 1 
ATOM 402   C "C2'" . DC  A 1 20  ? 73.337  7.037   46.719  1.00 660.01 ?  -293 DC  J "C2'" 1 
ATOM 403   C "C1'" . DC  A 1 20  ? 73.168  6.927   48.233  1.00 660.01 ?  -293 DC  J "C1'" 1 
ATOM 404   N N1    . DC  A 1 20  ? 72.327  8.023   48.846  1.00 660.01 ?  -293 DC  J N1    1 
ATOM 405   C C2    . DC  A 1 20  ? 71.259  7.707   49.716  1.00 660.01 ?  -293 DC  J C2    1 
ATOM 406   O O2    . DC  A 1 20  ? 71.003  6.528   49.991  1.00 660.01 ?  -293 DC  J O2    1 
ATOM 407   N N3    . DC  A 1 20  ? 70.517  8.715   50.250  1.00 660.01 ?  -293 DC  J N3    1 
ATOM 408   C C4    . DC  A 1 20  ? 70.799  9.987   49.952  1.00 660.01 ?  -293 DC  J C4    1 
ATOM 409   N N4    . DC  A 1 20  ? 70.041  10.937  50.502  1.00 660.01 ?  -293 DC  J N4    1 
ATOM 410   C C5    . DC  A 1 20  ? 71.873  10.336  49.075  1.00 660.01 ?  -293 DC  J C5    1 
ATOM 411   C C6    . DC  A 1 20  ? 72.601  9.336   48.551  1.00 660.01 ?  -293 DC  J C6    1 
ATOM 412   P P     . DT  A 1 21  ? 73.450  4.316   45.217  1.00 658.81 ?  -292 DT  J P     1 
ATOM 413   O OP1   . DT  A 1 21  ? 73.943  3.084   44.558  1.00 658.81 ?  -292 DT  J OP1   1 
ATOM 414   O OP2   . DT  A 1 21  ? 72.579  5.240   44.443  1.00 658.81 -1 -292 DT  J OP2   1 
ATOM 415   O "O5'" . DT  A 1 21  ? 72.722  3.919   46.588  1.00 658.81 ?  -292 DT  J "O5'" 1 
ATOM 416   C "C5'" . DT  A 1 21  ? 72.365  2.578   46.898  1.00 658.81 ?  -292 DT  J "C5'" 1 
ATOM 417   C "C4'" . DT  A 1 21  ? 70.868  2.526   47.141  1.00 658.81 ?  -292 DT  J "C4'" 1 
ATOM 418   O "O4'" . DT  A 1 21  ? 70.387  3.795   47.662  1.00 658.81 ?  -292 DT  J "O4'" 1 
ATOM 419   C "C3'" . DT  A 1 21  ? 70.018  2.248   45.908  1.00 658.81 ?  -292 DT  J "C3'" 1 
ATOM 420   O "O3'" . DT  A 1 21  ? 68.957  1.393   46.295  1.00 658.81 ?  -292 DT  J "O3'" 1 
ATOM 421   C "C2'" . DT  A 1 21  ? 69.489  3.629   45.527  1.00 658.81 ?  -292 DT  J "C2'" 1 
ATOM 422   C "C1'" . DT  A 1 21  ? 69.244  4.190   46.924  1.00 658.81 ?  -292 DT  J "C1'" 1 
ATOM 423   N N1    . DT  A 1 21  ? 69.033  5.684   47.040  1.00 658.81 ?  -292 DT  J N1    1 
ATOM 424   C C2    . DT  A 1 21  ? 68.104  6.161   47.957  1.00 658.81 ?  -292 DT  J C2    1 
ATOM 425   O O2    . DT  A 1 21  ? 67.431  5.441   48.688  1.00 658.81 ?  -292 DT  J O2    1 
ATOM 426   N N3    . DT  A 1 21  ? 67.984  7.534   47.995  1.00 658.81 ?  -292 DT  J N3    1 
ATOM 427   C C4    . DT  A 1 21  ? 68.678  8.461   47.231  1.00 658.81 ?  -292 DT  J C4    1 
ATOM 428   O O4    . DT  A 1 21  ? 68.485  9.667   47.352  1.00 658.81 ?  -292 DT  J O4    1 
ATOM 429   C C5    . DT  A 1 21  ? 69.636  7.905   46.295  1.00 658.81 ?  -292 DT  J C5    1 
ATOM 430   C C7    . DT  A 1 21  ? 70.453  8.804   45.408  1.00 658.81 ?  -292 DT  J C7    1 
ATOM 431   C C6    . DT  A 1 21  ? 69.764  6.565   46.248  1.00 658.81 ?  -292 DT  J C6    1 
ATOM 432   P P     . DG  A 1 22  ? 68.565  0.119   45.407  1.00 652.88 ?  -291 DG  J P     1 
ATOM 433   O OP1   . DG  A 1 22  ? 69.759  -0.754  45.363  1.00 652.88 ?  -291 DG  J OP1   1 
ATOM 434   O OP2   . DG  A 1 22  ? 67.958  0.616   44.146  1.00 652.88 -1 -291 DG  J OP2   1 
ATOM 435   O "O5'" . DG  A 1 22  ? 67.407  -0.602  46.262  1.00 652.88 ?  -291 DG  J "O5'" 1 
ATOM 436   C "C5'" . DG  A 1 22  ? 66.843  -0.028  47.459  1.00 652.88 ?  -291 DG  J "C5'" 1 
ATOM 437   C "C4'" . DG  A 1 22  ? 65.369  0.372   47.335  1.00 652.88 ?  -291 DG  J "C4'" 1 
ATOM 438   O "O4'" . DG  A 1 22  ? 65.228  1.806   47.169  1.00 652.88 ?  -291 DG  J "O4'" 1 
ATOM 439   C "C3'" . DG  A 1 22  ? 64.554  -0.213  46.187  1.00 652.88 ?  -291 DG  J "C3'" 1 
ATOM 440   O "O3'" . DG  A 1 22  ? 63.204  -0.278  46.600  1.00 651.24 ?  -291 DG  J "O3'" 1 
ATOM 441   C "C2'" . DG  A 1 22  ? 64.701  0.848   45.098  1.00 652.88 ?  -291 DG  J "C2'" 1 
ATOM 442   C "C1'" . DG  A 1 22  ? 64.562  2.104   45.950  1.00 652.88 ?  -291 DG  J "C1'" 1 
ATOM 443   N N9    . DG  A 1 22  ? 65.205  3.309   45.452  1.00 652.88 ?  -291 DG  J N9    1 
ATOM 444   C C8    . DG  A 1 22  ? 66.180  3.424   44.488  1.00 652.88 ?  -291 DG  J C8    1 
ATOM 445   N N7    . DG  A 1 22  ? 66.570  4.653   44.292  1.00 652.88 ?  -291 DG  J N7    1 
ATOM 446   C C5    . DG  A 1 22  ? 65.815  5.396   45.190  1.00 652.88 ?  -291 DG  J C5    1 
ATOM 447   C C6    . DG  A 1 22  ? 65.798  6.792   45.440  1.00 652.88 ?  -291 DG  J C6    1 
ATOM 448   O O6    . DG  A 1 22  ? 66.471  7.676   44.898  1.00 652.88 ?  -291 DG  J O6    1 
ATOM 449   N N1    . DG  A 1 22  ? 64.880  7.135   46.434  1.00 652.88 ?  -291 DG  J N1    1 
ATOM 450   C C2    . DG  A 1 22  ? 64.078  6.237   47.112  1.00 652.88 ?  -291 DG  J C2    1 
ATOM 451   N N2    . DG  A 1 22  ? 63.252  6.752   48.037  1.00 652.88 ?  -291 DG  J N2    1 
ATOM 452   N N3    . DG  A 1 22  ? 64.085  4.925   46.886  1.00 652.88 ?  -291 DG  J N3    1 
ATOM 453   C C4    . DG  A 1 22  ? 64.971  4.580   45.915  1.00 652.88 ?  -291 DG  J C4    1 
ATOM 454   P P     . DA  A 1 23  ? 62.581  -1.575  47.285  1.00 650.78 ?  -290 DA  J P     1 
ATOM 455   O OP1   . DA  A 1 23  ? 63.642  -2.269  48.055  1.00 650.78 ?  -290 DA  J OP1   1 
ATOM 456   O OP2   . DA  A 1 23  ? 61.809  -2.243  46.214  1.00 650.78 -1 -290 DA  J OP2   1 
ATOM 457   O "O5'" . DA  A 1 23  ? 61.537  -1.012  48.359  1.00 650.78 ?  -290 DA  J "O5'" 1 
ATOM 458   C "C5'" . DA  A 1 23  ? 61.887  0.004   49.312  1.00 650.78 ?  -290 DA  J "C5'" 1 
ATOM 459   C "C4'" . DA  A 1 23  ? 60.779  1.050   49.464  1.00 650.78 ?  -290 DA  J "C4'" 1 
ATOM 460   O "O4'" . DA  A 1 23  ? 60.979  2.153   48.542  1.00 650.78 ?  -290 DA  J "O4'" 1 
ATOM 461   C "C3'" . DA  A 1 23  ? 59.346  0.585   49.210  1.00 650.78 ?  -290 DA  J "C3'" 1 
ATOM 462   O "O3'" . DA  A 1 23  ? 58.480  1.326   50.071  1.00 650.78 ?  -290 DA  J "O3'" 1 
ATOM 463   C "C2'" . DA  A 1 23  ? 59.123  0.912   47.733  1.00 650.78 ?  -290 DA  J "C2'" 1 
ATOM 464   C "C1'" . DA  A 1 23  ? 59.908  2.214   47.614  1.00 650.78 ?  -290 DA  J "C1'" 1 
ATOM 465   N N9    . DA  A 1 23  ? 60.527  2.461   46.319  1.00 650.78 ?  -290 DA  J N9    1 
ATOM 466   C C8    . DA  A 1 23  ? 60.884  1.549   45.364  1.00 650.78 ?  -290 DA  J C8    1 
ATOM 467   N N7    . DA  A 1 23  ? 61.441  2.084   44.306  1.00 650.78 ?  -290 DA  J N7    1 
ATOM 468   C C5    . DA  A 1 23  ? 61.452  3.435   44.594  1.00 650.78 ?  -290 DA  J C5    1 
ATOM 469   C C6    . DA  A 1 23  ? 61.916  4.548   43.873  1.00 650.78 ?  -290 DA  J C6    1 
ATOM 470   N N6    . DA  A 1 23  ? 62.472  4.441   42.663  1.00 650.78 ?  -290 DA  J N6    1 
ATOM 471   N N1    . DA  A 1 23  ? 61.778  5.768   44.441  1.00 650.78 ?  -290 DA  J N1    1 
ATOM 472   C C2    . DA  A 1 23  ? 61.209  5.861   45.658  1.00 650.78 ?  -290 DA  J C2    1 
ATOM 473   N N3    . DA  A 1 23  ? 60.742  4.883   46.436  1.00 650.78 ?  -290 DA  J N3    1 
ATOM 474   C C4    . DA  A 1 23  ? 60.895  3.689   45.836  1.00 650.78 ?  -290 DA  J C4    1 
ATOM 475   P P     . DC  A 1 24  ? 56.977  0.875   50.396  1.00 631.07 ?  -289 DC  J P     1 
ATOM 476   O OP1   . DC  A 1 24  ? 56.928  0.487   51.828  1.00 631.07 ?  -289 DC  J OP1   1 
ATOM 477   O OP2   . DC  A 1 24  ? 56.497  -0.043  49.336  1.00 631.07 -1 -289 DC  J OP2   1 
ATOM 478   O "O5'" . DC  A 1 24  ? 56.190  2.257   50.195  1.00 631.07 ?  -289 DC  J "O5'" 1 
ATOM 479   C "C5'" . DC  A 1 24  ? 56.484  3.441   50.960  1.00 631.07 ?  -289 DC  J "C5'" 1 
ATOM 480   C "C4'" . DC  A 1 24  ? 55.927  4.691   50.292  1.00 631.07 ?  -289 DC  J "C4'" 1 
ATOM 481   O "O4'" . DC  A 1 24  ? 56.583  4.900   49.011  1.00 631.07 ?  -289 DC  J "O4'" 1 
ATOM 482   C "C3'" . DC  A 1 24  ? 54.432  4.677   49.976  1.00 631.07 ?  -289 DC  J "C3'" 1 
ATOM 483   O "O3'" . DC  A 1 24  ? 53.991  6.022   49.885  1.00 631.07 ?  -289 DC  J "O3'" 1 
ATOM 484   C "C2'" . DC  A 1 24  ? 54.432  4.098   48.564  1.00 631.07 ?  -289 DC  J "C2'" 1 
ATOM 485   C "C1'" . DC  A 1 24  ? 55.602  4.899   47.986  1.00 631.07 ?  -289 DC  J "C1'" 1 
ATOM 486   N N1    . DC  A 1 24  ? 56.211  4.391   46.712  1.00 631.07 ?  -289 DC  J N1    1 
ATOM 487   C C2    . DC  A 1 24  ? 56.990  5.250   45.904  1.00 631.07 ?  -289 DC  J C2    1 
ATOM 488   O O2    . DC  A 1 24  ? 57.177  6.429   46.236  1.00 631.07 ?  -289 DC  J O2    1 
ATOM 489   N N3    . DC  A 1 24  ? 57.531  4.763   44.757  1.00 631.07 ?  -289 DC  J N3    1 
ATOM 490   C C4    . DC  A 1 24  ? 57.323  3.494   44.408  1.00 631.07 ?  -289 DC  J C4    1 
ATOM 491   N N4    . DC  A 1 24  ? 57.874  3.059   43.273  1.00 631.07 ?  -289 DC  J N4    1 
ATOM 492   C C5    . DC  A 1 24  ? 56.540  2.606   45.207  1.00 631.07 ?  -289 DC  J C5    1 
ATOM 493   C C6    . DC  A 1 24  ? 56.010  3.091   46.336  1.00 631.07 ?  -289 DC  J C6    1 
ATOM 494   P P     . DA  A 1 25  ? 53.297  6.896   51.034  1.00 643.73 ?  -288 DA  J P     1 
ATOM 495   O OP1   . DA  A 1 25  ? 54.312  7.334   52.023  1.00 643.73 ?  -288 DA  J OP1   1 
ATOM 496   O OP2   . DA  A 1 25  ? 52.046  6.247   51.472  1.00 643.73 -1 -288 DA  J OP2   1 
ATOM 497   O "O5'" . DA  A 1 25  ? 52.907  8.132   50.107  1.00 643.73 ?  -288 DA  J "O5'" 1 
ATOM 498   C "C5'" . DA  A 1 25  ? 53.897  8.700   49.241  1.00 643.73 ?  -288 DA  J "C5'" 1 
ATOM 499   C "C4'" . DA  A 1 25  ? 53.394  8.830   47.813  1.00 643.73 ?  -288 DA  J "C4'" 1 
ATOM 500   O "O4'" . DA  A 1 25  ? 53.895  7.763   46.963  1.00 643.73 ?  -288 DA  J "O4'" 1 
ATOM 501   C "C3'" . DA  A 1 25  ? 51.870  8.833   47.660  1.00 643.73 ?  -288 DA  J "C3'" 1 
ATOM 502   O "O3'" . DA  A 1 25  ? 51.524  10.062  47.008  1.00 643.73 ?  -288 DA  J "O3'" 1 
ATOM 503   C "C2'" . DA  A 1 25  ? 51.610  7.573   46.833  1.00 643.73 ?  -288 DA  J "C2'" 1 
ATOM 504   C "C1'" . DA  A 1 25  ? 52.886  7.538   46.003  1.00 643.73 ?  -288 DA  J "C1'" 1 
ATOM 505   N N9    . DA  A 1 25  ? 53.120  6.310   45.239  1.00 643.73 ?  -288 DA  J N9    1 
ATOM 506   C C8    . DA  A 1 25  ? 52.547  5.080   45.426  1.00 643.73 ?  -288 DA  J C8    1 
ATOM 507   N N7    . DA  A 1 25  ? 52.944  4.166   44.573  1.00 643.73 ?  -288 DA  J N7    1 
ATOM 508   C C5    . DA  A 1 25  ? 53.842  4.844   43.768  1.00 643.73 ?  -288 DA  J C5    1 
ATOM 509   C C6    . DA  A 1 25  ? 54.618  4.442   42.664  1.00 643.73 ?  -288 DA  J C6    1 
ATOM 510   N N6    . DA  A 1 25  ? 54.598  3.192   42.188  1.00 643.73 ?  -288 DA  J N6    1 
ATOM 511   N N1    . DA  A 1 25  ? 55.415  5.366   42.073  1.00 643.73 ?  -288 DA  J N1    1 
ATOM 512   C C2    . DA  A 1 25  ? 55.434  6.612   42.556  1.00 643.73 ?  -288 DA  J C2    1 
ATOM 513   N N3    . DA  A 1 25  ? 54.746  7.106   43.586  1.00 643.73 ?  -288 DA  J N3    1 
ATOM 514   C C4    . DA  A 1 25  ? 53.961  6.168   44.155  1.00 643.73 ?  -288 DA  J C4    1 
ATOM 515   P P     . DC  A 1 26  ? 50.113  10.399  46.315  1.00 646.94 ?  -287 DC  J P     1 
ATOM 516   O OP1   . DC  A 1 26  ? 49.319  11.101  47.351  1.00 646.94 ?  -287 DC  J OP1   1 
ATOM 517   O OP2   . DC  A 1 26  ? 49.547  9.199   45.655  1.00 646.94 -1 -287 DC  J OP2   1 
ATOM 518   O "O5'" . DC  A 1 26  ? 50.522  11.436  45.149  1.00 646.94 ?  -287 DC  J "O5'" 1 
ATOM 519   C "C5'" . DC  A 1 26  ? 51.782  11.375  44.432  1.00 646.94 ?  -287 DC  J "C5'" 1 
ATOM 520   C "C4'" . DC  A 1 26  ? 51.650  11.378  42.907  1.00 646.94 ?  -287 DC  J "C4'" 1 
ATOM 521   O "O4'" . DC  A 1 26  ? 52.115  10.101  42.383  1.00 646.94 ?  -287 DC  J "O4'" 1 
ATOM 522   C "C3'" . DC  A 1 26  ? 50.248  11.579  42.313  1.00 646.94 ?  -287 DC  J "C3'" 1 
ATOM 523   O "O3'" . DC  A 1 26  ? 50.270  12.282  41.050  1.00 646.94 ?  -287 DC  J "O3'" 1 
ATOM 524   C "C2'" . DC  A 1 26  ? 49.783  10.142  42.129  1.00 646.94 ?  -287 DC  J "C2'" 1 
ATOM 525   C "C1'" . DC  A 1 26  ? 51.075  9.501   41.626  1.00 646.94 ?  -287 DC  J "C1'" 1 
ATOM 526   N N1    . DC  A 1 26  ? 51.087  8.005   41.773  1.00 646.94 ?  -287 DC  J N1    1 
ATOM 527   C C2    . DC  A 1 26  ? 51.549  7.178   40.733  1.00 646.94 ?  -287 DC  J C2    1 
ATOM 528   O O2    . DC  A 1 26  ? 51.961  7.666   39.675  1.00 646.94 ?  -287 DC  J O2    1 
ATOM 529   N N3    . DC  A 1 26  ? 51.531  5.835   40.912  1.00 646.94 ?  -287 DC  J N3    1 
ATOM 530   C C4    . DC  A 1 26  ? 51.082  5.309   42.055  1.00 646.94 ?  -287 DC  J C4    1 
ATOM 531   N N4    . DC  A 1 26  ? 51.090  3.979   42.182  1.00 646.94 ?  -287 DC  J N4    1 
ATOM 532   C C5    . DC  A 1 26  ? 50.602  6.125   43.123  1.00 646.94 ?  -287 DC  J C5    1 
ATOM 533   C C6    . DC  A 1 26  ? 50.626  7.449   42.940  1.00 646.94 ?  -287 DC  J C6    1 
ATOM 534   P P     . DG  A 1 27  ? 48.928  12.890  40.398  1.00 641.72 ?  -286 DG  J P     1 
ATOM 535   O OP1   . DG  A 1 27  ? 48.562  14.045  41.241  1.00 641.72 ?  -286 DG  J OP1   1 
ATOM 536   O OP2   . DG  A 1 27  ? 47.926  11.821  40.164  1.00 641.72 -1 -286 DG  J OP2   1 
ATOM 537   O "O5'" . DG  A 1 27  ? 49.400  13.432  38.961  1.00 641.72 ?  -286 DG  J "O5'" 1 
ATOM 538   C "C5'" . DG  A 1 27  ? 50.498  12.866  38.226  1.00 641.72 ?  -286 DG  J "C5'" 1 
ATOM 539   C "C4'" . DG  A 1 27  ? 50.091  12.021  37.017  1.00 641.72 ?  -286 DG  J "C4'" 1 
ATOM 540   O "O4'" . DG  A 1 27  ? 50.327  10.619  37.317  1.00 641.72 ?  -286 DG  J "O4'" 1 
ATOM 541   C "C3'" . DG  A 1 27  ? 48.646  12.128  36.514  1.00 641.72 ?  -286 DG  J "C3'" 1 
ATOM 542   O "O3'" . DG  A 1 27  ? 48.632  12.463  35.093  1.00 641.72 ?  -286 DG  J "O3'" 1 
ATOM 543   C "C2'" . DG  A 1 27  ? 48.028  10.778  36.887  1.00 641.72 ?  -286 DG  J "C2'" 1 
ATOM 544   C "C1'" . DG  A 1 27  ? 49.229  9.841   36.897  1.00 641.72 ?  -286 DG  J "C1'" 1 
ATOM 545   N N9    . DG  A 1 27  ? 49.058  8.736   37.831  1.00 641.72 ?  -286 DG  J N9    1 
ATOM 546   C C8    . DG  A 1 27  ? 48.639  8.849   39.134  1.00 641.72 ?  -286 DG  J C8    1 
ATOM 547   N N7    . DG  A 1 27  ? 48.555  7.718   39.768  1.00 641.72 ?  -286 DG  J N7    1 
ATOM 548   C C5    . DG  A 1 27  ? 48.941  6.787   38.821  1.00 641.72 ?  -286 DG  J C5    1 
ATOM 549   C C6    . DG  A 1 27  ? 49.041  5.388   38.948  1.00 641.72 ?  -286 DG  J C6    1 
ATOM 550   O O6    . DG  A 1 27  ? 48.796  4.707   39.950  1.00 641.72 ?  -286 DG  J O6    1 
ATOM 551   N N1    . DG  A 1 27  ? 49.471  4.784   37.766  1.00 641.72 ?  -286 DG  J N1    1 
ATOM 552   C C2    . DG  A 1 27  ? 49.767  5.460   36.603  1.00 641.72 ?  -286 DG  J C2    1 
ATOM 553   N N2    . DG  A 1 27  ? 50.164  4.696   35.576  1.00 641.72 ?  -286 DG  J N2    1 
ATOM 554   N N3    . DG  A 1 27  ? 49.674  6.784   36.470  1.00 641.72 ?  -286 DG  J N3    1 
ATOM 555   C C4    . DG  A 1 27  ? 49.257  7.386   37.618  1.00 641.72 ?  -286 DG  J C4    1 
ATOM 556   P P     . DT  A 1 28  ? 47.841  11.694  33.912  1.00 634.04 ?  -285 DT  J P     1 
ATOM 557   O OP1   . DT  A 1 28  ? 47.970  12.540  32.703  1.00 634.04 ?  -285 DT  J OP1   1 
ATOM 558   O OP2   . DT  A 1 28  ? 46.484  11.307  34.379  1.00 634.04 -1 -285 DT  J OP2   1 
ATOM 559   O "O5'" . DT  A 1 28  ? 48.715  10.358  33.719  1.00 634.04 ?  -285 DT  J "O5'" 1 
ATOM 560   C "C5'" . DT  A 1 28  ? 49.273  9.967   32.456  1.00 634.04 ?  -285 DT  J "C5'" 1 
ATOM 561   C "C4'" . DT  A 1 28  ? 48.647  8.679   31.933  1.00 634.04 ?  -285 DT  J "C4'" 1 
ATOM 562   O "O4'" . DT  A 1 28  ? 48.511  7.699   33.004  1.00 634.04 ?  -285 DT  J "O4'" 1 
ATOM 563   C "C3'" . DT  A 1 28  ? 47.253  8.831   31.322  1.00 634.04 ?  -285 DT  J "C3'" 1 
ATOM 564   O "O3'" . DT  A 1 28  ? 47.163  8.025   30.140  1.00 634.04 ?  -285 DT  J "O3'" 1 
ATOM 565   C "C2'" . DT  A 1 28  ? 46.349  8.312   32.437  1.00 634.04 ?  -285 DT  J "C2'" 1 
ATOM 566   C "C1'" . DT  A 1 28  ? 47.207  7.153   32.933  1.00 634.04 ?  -285 DT  J "C1'" 1 
ATOM 567   N N1    . DT  A 1 28  ? 46.785  6.557   34.250  1.00 634.04 ?  -285 DT  J N1    1 
ATOM 568   C C2    . DT  A 1 28  ? 46.959  5.203   34.475  1.00 634.04 ?  -285 DT  J C2    1 
ATOM 569   O O2    . DT  A 1 28  ? 47.447  4.430   33.668  1.00 634.04 ?  -285 DT  J O2    1 
ATOM 570   N N3    . DT  A 1 28  ? 46.534  4.767   35.706  1.00 634.04 ?  -285 DT  J N3    1 
ATOM 571   C C4    . DT  A 1 28  ? 45.962  5.525   36.714  1.00 634.04 ?  -285 DT  J C4    1 
ATOM 572   O O4    . DT  A 1 28  ? 45.618  5.017   37.777  1.00 634.04 ?  -285 DT  J O4    1 
ATOM 573   C C5    . DT  A 1 28  ? 45.802  6.934   36.417  1.00 634.04 ?  -285 DT  J C5    1 
ATOM 574   C C7    . DT  A 1 28  ? 45.198  7.879   37.415  1.00 634.04 ?  -285 DT  J C7    1 
ATOM 575   C C6    . DT  A 1 28  ? 46.217  7.371   35.219  1.00 634.04 ?  -285 DT  J C6    1 
ATOM 576   P P     . DG  A 1 29  ? 45.844  7.951   29.224  1.00 620.04 ?  -284 DG  J P     1 
ATOM 577   O OP1   . DG  A 1 29  ? 45.833  9.166   28.382  1.00 620.04 ?  -284 DG  J OP1   1 
ATOM 578   O OP2   . DG  A 1 29  ? 44.655  7.642   30.051  1.00 620.04 -1 -284 DG  J OP2   1 
ATOM 579   O "O5'" . DG  A 1 29  ? 46.144  6.670   28.308  1.00 620.04 ?  -284 DG  J "O5'" 1 
ATOM 580   C "C5'" . DG  A 1 29  ? 46.937  5.576   28.788  1.00 620.04 ?  -284 DG  J "C5'" 1 
ATOM 581   C "C4'" . DG  A 1 29  ? 46.097  4.452   29.386  1.00 620.04 ?  -284 DG  J "C4'" 1 
ATOM 582   O "O4'" . DG  A 1 29  ? 45.829  4.664   30.800  1.00 620.04 ?  -284 DG  J "O4'" 1 
ATOM 583   C "C3'" . DG  A 1 29  ? 44.732  4.200   28.748  1.00 620.04 ?  -284 DG  J "C3'" 1 
ATOM 584   O "O3'" . DG  A 1 29  ? 44.637  2.816   28.452  1.00 620.04 ?  -284 DG  J "O3'" 1 
ATOM 585   C "C2'" . DG  A 1 29  ? 43.739  4.591   29.839  1.00 620.04 ?  -284 DG  J "C2'" 1 
ATOM 586   C "C1'" . DG  A 1 29  ? 44.538  4.143   31.058  1.00 620.04 ?  -284 DG  J "C1'" 1 
ATOM 587   N N9    . DG  A 1 29  ? 44.083  4.593   32.377  1.00 620.04 ?  -284 DG  J N9    1 
ATOM 588   C C8    . DG  A 1 29  ? 43.831  5.883   32.783  1.00 620.04 ?  -284 DG  J C8    1 
ATOM 589   N N7    . DG  A 1 29  ? 43.450  5.978   34.027  1.00 620.04 ?  -284 DG  J N7    1 
ATOM 590   C C5    . DG  A 1 29  ? 43.450  4.666   34.482  1.00 620.04 ?  -284 DG  J C5    1 
ATOM 591   C C6    . DG  A 1 29  ? 43.125  4.143   35.759  1.00 620.04 ?  -284 DG  J C6    1 
ATOM 592   O O6    . DG  A 1 29  ? 42.762  4.765   36.765  1.00 620.04 ?  -284 DG  J O6    1 
ATOM 593   N N1    . DG  A 1 29  ? 43.252  2.753   35.814  1.00 620.04 ?  -284 DG  J N1    1 
ATOM 594   C C2    . DG  A 1 29  ? 43.653  1.969   34.758  1.00 620.04 ?  -284 DG  J C2    1 
ATOM 595   N N2    . DG  A 1 29  ? 43.718  0.651   34.991  1.00 620.04 ?  -284 DG  J N2    1 
ATOM 596   N N3    . DG  A 1 29  ? 43.962  2.444   33.553  1.00 620.04 ?  -284 DG  J N3    1 
ATOM 597   C C4    . DG  A 1 29  ? 43.841  3.798   33.481  1.00 620.04 ?  -284 DG  J C4    1 
ATOM 598   P P     . DC  A 1 30  ? 43.946  2.359   27.088  1.00 612.94 ?  -283 DC  J P     1 
ATOM 599   O OP1   . DC  A 1 30  ? 44.967  2.522   26.024  1.00 612.94 ?  -283 DC  J OP1   1 
ATOM 600   O OP2   . DC  A 1 30  ? 42.643  3.070   27.003  1.00 612.94 -1 -283 DC  J OP2   1 
ATOM 601   O "O5'" . DC  A 1 30  ? 43.629  0.795   27.274  1.00 612.94 ?  -283 DC  J "O5'" 1 
ATOM 602   C "C5'" . DC  A 1 30  ? 44.462  -0.088  28.029  1.00 612.94 ?  -283 DC  J "C5'" 1 
ATOM 603   C "C4'" . DC  A 1 30  ? 43.682  -0.742  29.162  1.00 612.94 ?  -283 DC  J "C4'" 1 
ATOM 604   O "O4'" . DC  A 1 30  ? 43.402  0.239   30.200  1.00 612.94 ?  -283 DC  J "O4'" 1 
ATOM 605   C "C3'" . DC  A 1 30  ? 42.333  -1.371  28.788  1.00 612.94 ?  -283 DC  J "C3'" 1 
ATOM 606   O "O3'" . DC  A 1 30  ? 42.220  -2.704  29.318  1.00 612.94 ?  -283 DC  J "O3'" 1 
ATOM 607   C "C2'" . DC  A 1 30  ? 41.326  -0.433  29.447  1.00 612.94 ?  -283 DC  J "C2'" 1 
ATOM 608   C "C1'" . DC  A 1 30  ? 42.113  -0.046  30.697  1.00 612.94 ?  -283 DC  J "C1'" 1 
ATOM 609   N N1    . DC  A 1 30  ? 41.555  1.106   31.495  1.00 612.94 ?  -283 DC  J N1    1 
ATOM 610   C C2    . DC  A 1 30  ? 41.212  0.907   32.844  1.00 612.94 ?  -283 DC  J C2    1 
ATOM 611   O O2    . DC  A 1 30  ? 41.373  -0.205  33.359  1.00 612.94 ?  -283 DC  J O2    1 
ATOM 612   N N3    . DC  A 1 30  ? 40.700  1.940   33.559  1.00 612.94 ?  -283 DC  J N3    1 
ATOM 613   C C4    . DC  A 1 30  ? 40.535  3.131   32.984  1.00 612.94 ?  -283 DC  J C4    1 
ATOM 614   N N4    . DC  A 1 30  ? 40.035  4.112   33.736  1.00 612.94 ?  -283 DC  J N4    1 
ATOM 615   C C5    . DC  A 1 30  ? 40.876  3.364   31.617  1.00 612.94 ?  -283 DC  J C5    1 
ATOM 616   C C6    . DC  A 1 30  ? 41.373  2.333   30.918  1.00 612.94 ?  -283 DC  J C6    1 
ATOM 617   P P     . DC  A 1 31  ? 41.202  -3.796  28.717  1.00 609.24 ?  -282 DC  J P     1 
ATOM 618   O OP1   . DC  A 1 31  ? 42.014  -4.969  28.324  1.00 609.24 ?  -282 DC  J OP1   1 
ATOM 619   O OP2   . DC  A 1 31  ? 40.315  -3.145  27.729  1.00 609.24 -1 -282 DC  J OP2   1 
ATOM 620   O "O5'" . DC  A 1 31  ? 40.268  -4.186  29.963  1.00 609.24 ?  -282 DC  J "O5'" 1 
ATOM 621   C "C5'" . DC  A 1 31  ? 40.610  -5.208  30.908  1.00 609.24 ?  -282 DC  J "C5'" 1 
ATOM 622   C "C4'" . DC  A 1 31  ? 39.623  -5.196  32.064  1.00 609.24 ?  -282 DC  J "C4'" 1 
ATOM 623   O "O4'" . DC  A 1 31  ? 39.443  -3.839  32.552  1.00 609.24 ?  -282 DC  J "O4'" 1 
ATOM 624   C "C3'" . DC  A 1 31  ? 38.218  -5.687  31.732  1.00 609.24 ?  -282 DC  J "C3'" 1 
ATOM 625   O "O3'" . DC  A 1 31  ? 37.707  -6.388  32.861  1.00 609.24 ?  -282 DC  J "O3'" 1 
ATOM 626   C "C2'" . DC  A 1 31  ? 37.442  -4.395  31.487  1.00 609.24 ?  -282 DC  J "C2'" 1 
ATOM 627   C "C1'" . DC  A 1 31  ? 38.057  -3.533  32.580  1.00 609.24 ?  -282 DC  J "C1'" 1 
ATOM 628   N N1    . DC  A 1 31  ? 37.848  -2.049  32.452  1.00 609.24 ?  -282 DC  J N1    1 
ATOM 629   C C2    . DC  A 1 31  ? 36.752  -1.437  33.086  1.00 609.24 ?  -282 DC  J C2    1 
ATOM 630   O O2    . DC  A 1 31  ? 35.950  -2.125  33.733  1.00 609.24 ?  -282 DC  J O2    1 
ATOM 631   N N3    . DC  A 1 31  ? 36.592  -0.089  32.965  1.00 609.24 ?  -282 DC  J N3    1 
ATOM 632   C C4    . DC  A 1 31  ? 37.469  0.638   32.261  1.00 609.24 ?  -282 DC  J C4    1 
ATOM 633   N N4    . DC  A 1 31  ? 37.278  1.958   32.166  1.00 609.24 ?  -282 DC  J N4    1 
ATOM 634   C C5    . DC  A 1 31  ? 38.582  0.033   31.612  1.00 609.24 ?  -282 DC  J C5    1 
ATOM 635   C C6    . DC  A 1 31  ? 38.736  -1.291  31.737  1.00 609.24 ?  -282 DC  J C6    1 
ATOM 636   P P     . DT  A 1 32  ? 37.682  -7.988  32.885  1.00 596.10 ?  -281 DT  J P     1 
ATOM 637   O OP1   . DT  A 1 32  ? 38.939  -8.483  32.277  1.00 596.10 ?  -281 DT  J OP1   1 
ATOM 638   O OP2   . DT  A 1 32  ? 36.347  -8.383  32.372  1.00 596.10 -1 -281 DT  J OP2   1 
ATOM 639   O "O5'" . DT  A 1 32  ? 37.738  -8.402  34.426  1.00 596.10 ?  -281 DT  J "O5'" 1 
ATOM 640   C "C5'" . DT  A 1 32  ? 38.327  -7.565  35.410  1.00 596.10 ?  -281 DT  J "C5'" 1 
ATOM 641   C "C4'" . DT  A 1 32  ? 37.247  -6.939  36.275  1.00 596.10 ?  -281 DT  J "C4'" 1 
ATOM 642   O "O4'" . DT  A 1 32  ? 36.644  -5.811  35.588  1.00 596.10 ?  -281 DT  J "O4'" 1 
ATOM 643   C "C3'" . DT  A 1 32  ? 36.092  -7.865  36.656  1.00 596.10 ?  -281 DT  J "C3'" 1 
ATOM 644   O "O3'" . DT  A 1 32  ? 35.853  -7.697  38.029  1.00 596.10 ?  -281 DT  J "O3'" 1 
ATOM 645   C "C2'" . DT  A 1 32  ? 34.909  -7.335  35.850  1.00 596.10 ?  -281 DT  J "C2'" 1 
ATOM 646   C "C1'" . DT  A 1 32  ? 35.257  -5.854  35.858  1.00 596.10 ?  -281 DT  J "C1'" 1 
ATOM 647   N N1    . DT  A 1 32  ? 34.511  -5.032  34.862  1.00 596.10 ?  -281 DT  J N1    1 
ATOM 648   C C2    . DT  A 1 32  ? 33.781  -3.941  35.302  1.00 596.10 ?  -281 DT  J C2    1 
ATOM 649   O O2    . DT  A 1 32  ? 33.705  -3.594  36.464  1.00 596.10 ?  -281 DT  J O2    1 
ATOM 650   N N3    . DT  A 1 32  ? 33.134  -3.252  34.311  1.00 596.10 ?  -281 DT  J N3    1 
ATOM 651   C C4    . DT  A 1 32  ? 33.142  -3.540  32.957  1.00 596.10 ?  -281 DT  J C4    1 
ATOM 652   O O4    . DT  A 1 32  ? 32.522  -2.847  32.162  1.00 596.10 ?  -281 DT  J O4    1 
ATOM 653   C C5    . DT  A 1 32  ? 33.929  -4.694  32.558  1.00 596.10 ?  -281 DT  J C5    1 
ATOM 654   C C7    . DT  A 1 32  ? 34.023  -5.122  31.120  1.00 596.10 ?  -281 DT  J C7    1 
ATOM 655   C C6    . DT  A 1 32  ? 34.567  -5.376  33.520  1.00 596.10 ?  -281 DT  J C6    1 
ATOM 656   P P     . DG  A 1 33  ? 35.214  -8.848  38.924  1.00 604.49 ?  -280 DG  J P     1 
ATOM 657   O OP1   . DG  A 1 33  ? 36.348  -9.665  39.404  1.00 604.49 ?  -280 DG  J OP1   1 
ATOM 658   O OP2   . DG  A 1 33  ? 34.066  -9.460  38.217  1.00 604.49 -1 -280 DG  J OP2   1 
ATOM 659   O "O5'" . DG  A 1 33  ? 34.632  -8.037  40.171  1.00 604.49 ?  -280 DG  J "O5'" 1 
ATOM 660   C "C5'" . DG  A 1 33  ? 35.212  -6.791  40.573  1.00 604.49 ?  -280 DG  J "C5'" 1 
ATOM 661   C "C4'" . DG  A 1 33  ? 34.141  -5.779  40.954  1.00 604.49 ?  -280 DG  J "C4'" 1 
ATOM 662   O "O4'" . DG  A 1 33  ? 33.483  -5.269  39.771  1.00 604.49 ?  -280 DG  J "O4'" 1 
ATOM 663   C "C3'" . DG  A 1 33  ? 33.010  -6.310  41.820  1.00 604.49 ?  -280 DG  J "C3'" 1 
ATOM 664   O "O3'" . DG  A 1 33  ? 32.538  -5.233  42.583  1.00 604.49 ?  -280 DG  J "O3'" 1 
ATOM 665   C "C2'" . DG  A 1 33  ? 31.964  -6.724  40.793  1.00 604.49 ?  -280 DG  J "C2'" 1 
ATOM 666   C "C1'" . DG  A 1 33  ? 32.093  -5.535  39.852  1.00 604.49 ?  -280 DG  J "C1'" 1 
ATOM 667   N N9    . DG  A 1 33  ? 31.644  -5.761  38.491  1.00 604.49 ?  -280 DG  J N9    1 
ATOM 668   C C8    . DG  A 1 33  ? 31.600  -6.945  37.798  1.00 604.49 ?  -280 DG  J C8    1 
ATOM 669   N N7    . DG  A 1 33  ? 31.167  -6.818  36.576  1.00 604.49 ?  -280 DG  J N7    1 
ATOM 670   C C5    . DG  A 1 33  ? 30.916  -5.459  36.451  1.00 604.49 ?  -280 DG  J C5    1 
ATOM 671   C C6    . DG  A 1 33  ? 30.430  -4.718  35.347  1.00 604.49 ?  -280 DG  J C6    1 
ATOM 672   O O6    . DG  A 1 33  ? 30.113  -5.137  34.229  1.00 604.49 ?  -280 DG  J O6    1 
ATOM 673   N N1    . DG  A 1 33  ? 30.317  -3.358  35.637  1.00 604.49 ?  -280 DG  J N1    1 
ATOM 674   C C2    . DG  A 1 33  ? 30.642  -2.785  36.846  1.00 604.49 ?  -280 DG  J C2    1 
ATOM 675   N N2    . DG  A 1 33  ? 30.467  -1.457  36.941  1.00 604.49 ?  -280 DG  J N2    1 
ATOM 676   N N3    . DG  A 1 33  ? 31.095  -3.468  37.891  1.00 604.49 ?  -280 DG  J N3    1 
ATOM 677   C C4    . DG  A 1 33  ? 31.207  -4.794  37.622  1.00 604.49 ?  -280 DG  J C4    1 
ATOM 678   P P     . DG  A 1 34  ? 31.631  -5.485  43.867  1.00 605.75 ?  -279 DG  J P     1 
ATOM 679   O OP1   . DG  A 1 34  ? 32.538  -5.347  45.026  1.00 605.75 ?  -279 DG  J OP1   1 
ATOM 680   O OP2   . DG  A 1 34  ? 30.775  -6.679  43.675  1.00 605.75 -1 -279 DG  J OP2   1 
ATOM 681   O "O5'" . DG  A 1 34  ? 30.664  -4.220  43.855  1.00 605.75 ?  -279 DG  J "O5'" 1 
ATOM 682   C "C5'" . DG  A 1 34  ? 31.207  -2.908  43.711  1.00 605.75 ?  -279 DG  J "C5'" 1 
ATOM 683   C "C4'" . DG  A 1 34  ? 30.202  -1.984  43.048  1.00 605.75 ?  -279 DG  J "C4'" 1 
ATOM 684   O "O4'" . DG  A 1 34  ? 30.017  -2.381  41.668  1.00 605.75 ?  -279 DG  J "O4'" 1 
ATOM 685   C "C3'" . DG  A 1 34  ? 28.822  -1.968  43.704  1.00 605.75 ?  -279 DG  J "C3'" 1 
ATOM 686   O "O3'" . DG  A 1 34  ? 28.492  -0.606  44.005  1.00 605.75 ?  -279 DG  J "O3'" 1 
ATOM 687   C "C2'" . DG  A 1 34  ? 27.905  -2.656  42.688  1.00 605.75 ?  -279 DG  J "C2'" 1 
ATOM 688   C "C1'" . DG  A 1 34  ? 28.638  -2.422  41.373  1.00 605.75 ?  -279 DG  J "C1'" 1 
ATOM 689   N N9    . DG  A 1 34  ? 28.444  -3.453  40.357  1.00 605.75 ?  -279 DG  J N9    1 
ATOM 690   C C8    . DG  A 1 34  ? 28.576  -4.817  40.482  1.00 605.75 ?  -279 DG  J C8    1 
ATOM 691   N N7    . DG  A 1 34  ? 28.345  -5.468  39.373  1.00 605.75 ?  -279 DG  J N7    1 
ATOM 692   C C5    . DG  A 1 34  ? 28.041  -4.472  38.453  1.00 605.75 ?  -279 DG  J C5    1 
ATOM 693   C C6    . DG  A 1 34  ? 27.700  -4.553  37.080  1.00 605.75 ?  -279 DG  J C6    1 
ATOM 694   O O6    . DG  A 1 34  ? 27.592  -5.558  36.369  1.00 605.75 ?  -279 DG  J O6    1 
ATOM 695   N N1    . DG  A 1 34  ? 27.471  -3.301  36.519  1.00 605.75 ?  -279 DG  J N1    1 
ATOM 696   C C2    . DG  A 1 34  ? 27.560  -2.111  37.204  1.00 605.75 ?  -279 DG  J C2    1 
ATOM 697   N N2    . DG  A 1 34  ? 27.307  -0.993  36.510  1.00 605.75 ?  -279 DG  J N2    1 
ATOM 698   N N3    . DG  A 1 34  ? 27.878  -2.017  38.486  1.00 605.75 ?  -279 DG  J N3    1 
ATOM 699   C C4    . DG  A 1 34  ? 28.103  -3.230  39.046  1.00 605.75 ?  -279 DG  J C4    1 
ATOM 700   P P     . DA  A 1 35  ? 27.124  -0.135  44.698  1.00 609.72 ?  -278 DA  J P     1 
ATOM 701   O OP1   . DA  A 1 35  ? 27.401  0.969   45.644  1.00 609.72 ?  -278 DA  J OP1   1 
ATOM 702   O OP2   . DA  A 1 35  ? 26.316  -1.293  45.155  1.00 609.72 -1 -278 DA  J OP2   1 
ATOM 703   O "O5'" . DA  A 1 35  ? 26.445  0.461   43.385  1.00 609.72 ?  -278 DA  J "O5'" 1 
ATOM 704   C "C5'" . DA  A 1 35  ? 27.181  1.301   42.472  1.00 609.72 ?  -278 DA  J "C5'" 1 
ATOM 705   C "C4'" . DA  A 1 35  ? 26.256  1.861   41.403  1.00 609.72 ?  -278 DA  J "C4'" 1 
ATOM 706   O "O4'" . DA  A 1 35  ? 26.159  0.909   40.317  1.00 609.72 ?  -278 DA  J "O4'" 1 
ATOM 707   C "C3'" . DA  A 1 35  ? 24.831  2.119   41.888  1.00 609.72 ?  -278 DA  J "C3'" 1 
ATOM 708   O "O3'" . DA  A 1 35  ? 24.304  3.338   41.351  1.00 609.72 ?  -278 DA  J "O3'" 1 
ATOM 709   C "C2'" . DA  A 1 35  ? 24.073  0.879   41.422  1.00 609.72 ?  -278 DA  J "C2'" 1 
ATOM 710   C "C1'" . DA  A 1 35  ? 24.817  0.499   40.150  1.00 609.72 ?  -278 DA  J "C1'" 1 
ATOM 711   N N9    . DA  A 1 35  ? 24.793  -0.932  39.852  1.00 609.72 ?  -278 DA  J N9    1 
ATOM 712   C C8    . DA  A 1 35  ? 24.905  -1.970  40.740  1.00 609.72 ?  -278 DA  J C8    1 
ATOM 713   N N7    . DA  A 1 35  ? 24.852  -3.160  40.187  1.00 609.72 ?  -278 DA  J N7    1 
ATOM 714   C C5    . DA  A 1 35  ? 24.700  -2.882  38.842  1.00 609.72 ?  -278 DA  J C5    1 
ATOM 715   C C6    . DA  A 1 35  ? 24.579  -3.718  37.714  1.00 609.72 ?  -278 DA  J C6    1 
ATOM 716   N N6    . DA  A 1 35  ? 24.603  -5.052  37.791  1.00 609.72 ?  -278 DA  J N6    1 
ATOM 717   N N1    . DA  A 1 35  ? 24.437  -3.127  36.501  1.00 609.72 ?  -278 DA  J N1    1 
ATOM 718   C C2    . DA  A 1 35  ? 24.409  -1.785  36.423  1.00 609.72 ?  -278 DA  J C2    1 
ATOM 719   N N3    . DA  A 1 35  ? 24.518  -0.899  37.418  1.00 609.72 ?  -278 DA  J N3    1 
ATOM 720   C C4    . DA  A 1 35  ? 24.658  -1.515  38.611  1.00 609.72 ?  -278 DA  J C4    1 
ATOM 721   P P     . DG  A 1 36  ? 22.876  3.927   41.803  1.00 603.31 ?  -277 DG  J P     1 
ATOM 722   O OP1   . DG  A 1 36  ? 22.957  5.401   41.731  1.00 603.36 ?  -277 DG  J OP1   1 
ATOM 723   O OP2   . DG  A 1 36  ? 22.414  3.283   43.055  1.00 602.94 -1 -277 DG  J OP2   1 
ATOM 724   O "O5'" . DG  A 1 36  ? 21.940  3.406   40.620  1.00 604.63 ?  -277 DG  J "O5'" 1 
ATOM 725   C "C5'" . DG  A 1 36  ? 22.270  3.693   39.256  1.00 606.65 ?  -277 DG  J "C5'" 1 
ATOM 726   C "C4'" . DG  A 1 36  ? 21.224  3.120   38.316  1.00 607.97 ?  -277 DG  J "C4'" 1 
ATOM 727   O "O4'" . DG  A 1 36  ? 21.553  1.739   38.015  1.00 608.07 ?  -277 DG  J "O4'" 1 
ATOM 728   C "C3'" . DG  A 1 36  ? 19.792  3.135   38.855  1.00 608.51 ?  -277 DG  J "C3'" 1 
ATOM 729   O "O3'" . DG  A 1 36  ? 18.890  3.601   37.859  1.00 608.51 ?  -277 DG  J "O3'" 1 
ATOM 730   C "C2'" . DG  A 1 36  ? 19.514  1.681   39.217  1.00 608.51 ?  -277 DG  J "C2'" 1 
ATOM 731   C "C1'" . DG  A 1 36  ? 20.437  0.914   38.275  1.00 608.51 ?  -277 DG  J "C1'" 1 
ATOM 732   N N9    . DG  A 1 36  ? 20.915  -0.339  38.846  1.00 608.51 ?  -277 DG  J N9    1 
ATOM 733   C C8    . DG  A 1 36  ? 21.504  -0.525  40.076  1.00 608.51 ?  -277 DG  J C8    1 
ATOM 734   N N7    . DG  A 1 36  ? 21.828  -1.760  40.326  1.00 608.51 ?  -277 DG  J N7    1 
ATOM 735   C C5    . DG  A 1 36  ? 21.419  -2.441  39.184  1.00 608.51 ?  -277 DG  J C5    1 
ATOM 736   C C6    . DG  A 1 36  ? 21.508  -3.819  38.865  1.00 608.51 ?  -277 DG  J C6    1 
ATOM 737   O O6    . DG  A 1 36  ? 21.980  -4.731  39.553  1.00 608.51 ?  -277 DG  J O6    1 
ATOM 738   N N1    . DG  A 1 36  ? 20.977  -4.101  37.607  1.00 608.51 ?  -277 DG  J N1    1 
ATOM 739   C C2    . DG  A 1 36  ? 20.431  -3.159  36.762  1.00 608.51 ?  -277 DG  J C2    1 
ATOM 740   N N2    . DG  A 1 36  ? 19.969  -3.612  35.592  1.00 608.51 ?  -277 DG  J N2    1 
ATOM 741   N N3    . DG  A 1 36  ? 20.344  -1.864  37.042  1.00 608.51 ?  -277 DG  J N3    1 
ATOM 742   C C4    . DG  A 1 36  ? 20.857  -1.580  38.264  1.00 608.51 ?  -277 DG  J C4    1 
ATOM 743   P P     . DA  A 1 37  ? 17.479  4.261   38.241  1.00 609.47 ?  -276 DA  J P     1 
ATOM 744   O OP1   . DA  A 1 37  ? 17.539  5.657   37.723  1.00 609.81 ?  -276 DA  J OP1   1 
ATOM 745   O OP2   . DA  A 1 37  ? 17.171  4.011   39.677  1.00 609.23 -1 -276 DA  J OP2   1 
ATOM 746   O "O5'" . DA  A 1 37  ? 16.402  3.409   37.398  1.00 610.03 ?  -276 DA  J "O5'" 1 
ATOM 747   C "C5'" . DA  A 1 37  ? 16.808  2.550   36.307  1.00 610.95 ?  -276 DA  J "C5'" 1 
ATOM 748   C "C4'" . DA  A 1 37  ? 15.892  1.336   36.165  1.00 611.71 ?  -276 DA  J "C4'" 1 
ATOM 749   O "O4'" . DA  A 1 37  ? 16.612  0.140   36.566  1.00 611.96 ?  -276 DA  J "O4'" 1 
ATOM 750   C "C3'" . DA  A 1 37  ? 14.589  1.356   36.972  1.00 612.26 ?  -276 DA  J "C3'" 1 
ATOM 751   O "O3'" . DA  A 1 37  ? 13.480  0.999   36.116  1.00 612.86 ?  -276 DA  J "O3'" 1 
ATOM 752   C "C2'" . DA  A 1 37  ? 14.854  0.354   38.097  1.00 612.39 ?  -276 DA  J "C2'" 1 
ATOM 753   C "C1'" . DA  A 1 37  ? 15.797  -0.637  37.421  1.00 612.84 ?  -276 DA  J "C1'" 1 
ATOM 754   N N9    . DA  A 1 37  ? 16.640  -1.399  38.351  1.00 613.13 ?  -276 DA  J N9    1 
ATOM 755   C C8    . DA  A 1 37  ? 17.256  -0.930  39.480  1.00 613.13 ?  -276 DA  J C8    1 
ATOM 756   N N7    . DA  A 1 37  ? 17.949  -1.835  40.125  1.00 613.22 ?  -276 DA  J N7    1 
ATOM 757   C C5    . DA  A 1 37  ? 17.781  -2.984  39.371  1.00 613.20 ?  -276 DA  J C5    1 
ATOM 758   C C6    . DA  A 1 37  ? 18.265  -4.305  39.517  1.00 613.13 ?  -276 DA  J C6    1 
ATOM 759   N N6    . DA  A 1 37  ? 19.050  -4.689  40.527  1.00 613.10 ?  -276 DA  J N6    1 
ATOM 760   N N1    . DA  A 1 37  ? 17.911  -5.223  38.587  1.00 613.26 ?  -276 DA  J N1    1 
ATOM 761   C C2    . DA  A 1 37  ? 17.122  -4.843  37.573  1.00 613.22 ?  -276 DA  J C2    1 
ATOM 762   N N3    . DA  A 1 37  ? 16.608  -3.633  37.335  1.00 613.50 ?  -276 DA  J N3    1 
ATOM 763   C C4    . DA  A 1 37  ? 16.977  -2.736  38.272  1.00 613.27 ?  -276 DA  J C4    1 
ATOM 764   P P     . DC  A 1 38  ? 12.017  0.580   36.641  1.00 627.49 ?  -275 DC  J P     1 
ATOM 765   O OP1   . DC  A 1 38  ? 11.041  0.946   35.589  1.00 627.53 ?  -275 DC  J OP1   1 
ATOM 766   O OP2   . DC  A 1 38  ? 11.818  1.077   38.025  1.00 627.56 -1 -275 DC  J OP2   1 
ATOM 767   O "O5'" . DC  A 1 38  ? 12.118  -1.014  36.681  1.00 627.19 ?  -275 DC  J "O5'" 1 
ATOM 768   C "C5'" . DC  A 1 38  ? 12.098  -1.784  35.476  1.00 626.82 ?  -275 DC  J "C5'" 1 
ATOM 769   C "C4'" . DC  A 1 38  ? 11.731  -3.211  35.815  1.00 626.74 ?  -275 DC  J "C4'" 1 
ATOM 770   O "O4'" . DC  A 1 38  ? 12.807  -3.768  36.610  1.00 626.73 ?  -275 DC  J "O4'" 1 
ATOM 771   C "C3'" . DC  A 1 38  ? 10.457  -3.307  36.651  1.00 626.87 ?  -275 DC  J "C3'" 1 
ATOM 772   O "O3'" . DC  A 1 38  ? 9.497   -4.156  36.027  1.00 626.95 ?  -275 DC  J "O3'" 1 
ATOM 773   C "C2'" . DC  A 1 38  ? 10.919  -3.839  38.007  1.00 626.81 ?  -275 DC  J "C2'" 1 
ATOM 774   C "C1'" . DC  A 1 38  ? 12.271  -4.474  37.712  1.00 626.87 ?  -275 DC  J "C1'" 1 
ATOM 775   N N1    . DC  A 1 38  ? 13.195  -4.413  38.905  1.00 626.86 ?  -275 DC  J N1    1 
ATOM 776   C C2    . DC  A 1 38  ? 13.697  -5.593  39.495  1.00 626.62 ?  -275 DC  J C2    1 
ATOM 777   O O2    . DC  A 1 38  ? 13.395  -6.705  39.037  1.00 626.17 ?  -275 DC  J O2    1 
ATOM 778   N N3    . DC  A 1 38  ? 14.518  -5.474  40.577  1.00 626.65 ?  -275 DC  J N3    1 
ATOM 779   C C4    . DC  A 1 38  ? 14.832  -4.264  41.066  1.00 626.73 ?  -275 DC  J C4    1 
ATOM 780   N N4    . DC  A 1 38  ? 15.640  -4.194  42.125  1.00 626.56 ?  -275 DC  J N4    1 
ATOM 781   C C5    . DC  A 1 38  ? 14.333  -3.058  40.487  1.00 626.70 ?  -275 DC  J C5    1 
ATOM 782   C C6    . DC  A 1 38  ? 13.528  -3.184  39.423  1.00 627.02 ?  -275 DC  J C6    1 
ATOM 783   P P     . DT  A 1 39  ? 8.187   -4.664  36.812  1.00 633.09 ?  -274 DT  J P     1 
ATOM 784   O OP1   . DT  A 1 39  ? 7.108   -4.852  35.814  1.00 633.02 ?  -274 DT  J OP1   1 
ATOM 785   O OP2   . DT  A 1 39  ? 7.951   -3.818  38.009  1.00 632.51 -1 -274 DT  J OP2   1 
ATOM 786   O "O5'" . DT  A 1 39  ? 8.662   -6.098  37.330  1.00 632.84 ?  -274 DT  J "O5'" 1 
ATOM 787   C "C5'" . DT  A 1 39  ? 9.272   -7.042  36.443  1.00 632.24 ?  -274 DT  J "C5'" 1 
ATOM 788   C "C4'" . DT  A 1 39  ? 9.379   -8.403  37.114  1.00 631.70 ?  -274 DT  J "C4'" 1 
ATOM 789   O "O4'" . DT  A 1 39  ? 10.409  -8.379  38.139  1.00 631.30 ?  -274 DT  J "O4'" 1 
ATOM 790   C "C3'" . DT  A 1 39  ? 8.114   -8.872  37.819  1.00 631.46 ?  -274 DT  J "C3'" 1 
ATOM 791   O "O3'" . DT  A 1 39  ? 8.042   -10.285 37.709  1.00 631.42 ?  -274 DT  J "O3'" 1 
ATOM 792   C "C2'" . DT  A 1 39  ? 8.342   -8.414  39.259  1.00 631.19 ?  -274 DT  J "C2'" 1 
ATOM 793   C "C1'" . DT  A 1 39  ? 9.837   -8.689  39.397  1.00 631.12 ?  -274 DT  J "C1'" 1 
ATOM 794   N N1    . DT  A 1 39  ? 10.581  -7.909  40.435  1.00 631.12 ?  -274 DT  J N1    1 
ATOM 795   C C2    . DT  A 1 39  ? 11.512  -8.569  41.217  1.00 631.10 ?  -274 DT  J C2    1 
ATOM 796   O O2    . DT  A 1 39  ? 11.751  -9.762  41.126  1.00 631.09 ?  -274 DT  J O2    1 
ATOM 797   N N3    . DT  A 1 39  ? 12.154  -7.769  42.134  1.00 630.93 ?  -274 DT  J N3    1 
ATOM 798   C C4    . DT  A 1 39  ? 11.970  -6.412  42.336  1.00 630.90 ?  -274 DT  J C4    1 
ATOM 799   O O4    . DT  A 1 39  ? 12.597  -5.786  43.181  1.00 630.91 ?  -274 DT  J O4    1 
ATOM 800   C C5    . DT  A 1 39  ? 10.990  -5.781  41.485  1.00 631.05 ?  -274 DT  J C5    1 
ATOM 801   C C7    . DT  A 1 39  ? 10.710  -4.313  41.618  1.00 631.02 ?  -274 DT  J C7    1 
ATOM 802   C C6    . DT  A 1 39  ? 10.354  -6.550  40.585  1.00 631.32 ?  -274 DT  J C6    1 
ATOM 803   P P     . DA  A 1 40  ? 6.661   -11.056 37.955  1.00 626.44 ?  -273 DA  J P     1 
ATOM 804   O OP1   . DA  A 1 40  ? 5.811   -10.754 36.780  1.00 626.42 ?  -273 DA  J OP1   1 
ATOM 805   O OP2   . DA  A 1 40  ? 6.166   -10.746 39.325  1.00 626.27 -1 -273 DA  J OP2   1 
ATOM 806   O "O5'" . DA  A 1 40  ? 7.084   -12.604 37.910  1.00 625.19 ?  -273 DA  J "O5'" 1 
ATOM 807   C "C5'" . DA  A 1 40  ? 8.347   -13.068 38.415  1.00 623.49 ?  -273 DA  J "C5'" 1 
ATOM 808   C "C4'" . DA  A 1 40  ? 8.316   -13.487 39.881  1.00 622.07 ?  -273 DA  J "C4'" 1 
ATOM 809   O "O4'" . DA  A 1 40  ? 8.895   -12.432 40.683  1.00 621.76 ?  -273 DA  J "O4'" 1 
ATOM 810   C "C3'" . DA  A 1 40  ? 6.942   -13.793 40.483  1.00 621.12 ?  -273 DA  J "C3'" 1 
ATOM 811   O "O3'" . DA  A 1 40  ? 6.838   -15.219 40.716  1.00 619.50 ?  -273 DA  J "O3'" 1 
ATOM 812   C "C2'" . DA  A 1 40  ? 6.817   -12.871 41.705  1.00 621.44 ?  -273 DA  J "C2'" 1 
ATOM 813   C "C1'" . DA  A 1 40  ? 8.245   -12.379 41.933  1.00 621.95 ?  -273 DA  J "C1'" 1 
ATOM 814   N N9    . DA  A 1 40  ? 8.379   -11.003 42.407  1.00 622.05 ?  -273 DA  J N9    1 
ATOM 815   C C8    . DA  A 1 40  ? 7.599   -9.931  42.067  1.00 622.21 ?  -273 DA  J C8    1 
ATOM 816   N N7    . DA  A 1 40  ? 7.964   -8.806  42.635  1.00 622.30 ?  -273 DA  J N7    1 
ATOM 817   C C5    . DA  A 1 40  ? 9.063   -9.161  43.398  1.00 622.19 ?  -273 DA  J C5    1 
ATOM 818   C C6    . DA  A 1 40  ? 9.915   -8.421  44.252  1.00 622.03 ?  -273 DA  J C6    1 
ATOM 819   N N6    . DA  A 1 40  ? 9.764   -7.113  44.467  1.00 622.03 ?  -273 DA  J N6    1 
ATOM 820   N N1    . DA  A 1 40  ? 10.924  -9.073  44.876  1.00 622.02 ?  -273 DA  J N1    1 
ATOM 821   C C2    . DA  A 1 40  ? 11.073  -10.385 44.653  1.00 622.11 ?  -273 DA  J C2    1 
ATOM 822   N N3    . DA  A 1 40  ? 10.333  -11.184 43.877  1.00 622.25 ?  -273 DA  J N3    1 
ATOM 823   C C4    . DA  A 1 40  ? 9.337   -10.510 43.268  1.00 622.17 ?  -273 DA  J C4    1 
ATOM 824   P P     . DG  A 1 41  ? 6.831   -15.995 42.123  1.00 629.09 ?  -272 DG  J P     1 
ATOM 825   O OP1   . DG  A 1 41  ? 6.811   -17.440 41.803  1.00 628.96 ?  -272 DG  J OP1   1 
ATOM 826   O OP2   . DG  A 1 41  ? 5.754   -15.440 42.981  1.00 628.76 -1 -272 DG  J OP2   1 
ATOM 827   O "O5'" . DG  A 1 41  ? 8.262   -15.667 42.766  1.00 628.47 ?  -272 DG  J "O5'" 1 
ATOM 828   C "C5'" . DG  A 1 41  ? 9.073   -16.711 43.344  1.00 626.83 ?  -272 DG  J "C5'" 1 
ATOM 829   C "C4'" . DG  A 1 41  ? 9.189   -16.581 44.859  1.00 625.24 ?  -272 DG  J "C4'" 1 
ATOM 830   O "O4'" . DG  A 1 41  ? 9.229   -15.176 45.231  1.00 624.97 ?  -272 DG  J "O4'" 1 
ATOM 831   C "C3'" . DG  A 1 41  ? 8.055   -17.185 45.687  1.00 624.08 ?  -272 DG  J "C3'" 1 
ATOM 832   O "O3'" . DG  A 1 41  ? 8.566   -17.637 46.929  1.00 622.37 ?  -272 DG  J "O3'" 1 
ATOM 833   C "C2'" . DG  A 1 41  ? 7.135   -15.995 45.926  1.00 624.49 ?  -272 DG  J "C2'" 1 
ATOM 834   C "C1'" . DG  A 1 41  ? 8.180   -14.903 46.143  1.00 624.89 ?  -272 DG  J "C1'" 1 
ATOM 835   N N9    . DG  A 1 41  ? 7.720   -13.534 45.927  1.00 625.05 ?  -272 DG  J N9    1 
ATOM 836   C C8    . DG  A 1 41  ? 6.637   -13.100 45.198  1.00 625.08 ?  -272 DG  J C8    1 
ATOM 837   N N7    . DG  A 1 41  ? 6.492   -11.804 45.192  1.00 625.05 ?  -272 DG  J N7    1 
ATOM 838   C C5    . DG  A 1 41  ? 7.549   -11.349 45.971  1.00 625.16 ?  -272 DG  J C5    1 
ATOM 839   C C6    . DG  A 1 41  ? 7.918   -10.034 46.338  1.00 625.05 ?  -272 DG  J C6    1 
ATOM 840   O O6    . DG  A 1 41  ? 7.357   -8.979  46.024  1.00 625.17 ?  -272 DG  J O6    1 
ATOM 841   N N1    . DG  A 1 41  ? 9.059   -9.999  47.140  1.00 624.95 ?  -272 DG  J N1    1 
ATOM 842   C C2    . DG  A 1 41  ? 9.763   -11.108 47.548  1.00 624.90 ?  -272 DG  J C2    1 
ATOM 843   N N2    . DG  A 1 41  ? 10.835  -10.897 48.318  1.00 624.91 ?  -272 DG  J N2    1 
ATOM 844   N N3    . DG  A 1 41  ? 9.425   -12.347 47.216  1.00 625.21 ?  -272 DG  J N3    1 
ATOM 845   C C4    . DG  A 1 41  ? 8.315   -12.398 46.428  1.00 625.28 ?  -272 DG  J C4    1 
ATOM 846   P P     . DG  A 1 42  ? 8.830   -19.190 47.198  1.00 630.07 ?  -271 DG  J P     1 
ATOM 847   O OP1   . DG  A 1 42  ? 9.805   -19.657 46.185  1.00 629.81 ?  -271 DG  J OP1   1 
ATOM 848   O OP2   . DG  A 1 42  ? 7.496   -19.814 47.327  1.00 630.20 -1 -271 DG  J OP2   1 
ATOM 849   O "O5'" . DG  A 1 42  ? 9.513   -19.264 48.654  1.00 628.30 ?  -271 DG  J "O5'" 1 
ATOM 850   C "C5'" . DG  A 1 42  ? 10.642  -18.452 49.022  1.00 625.26 ?  -271 DG  J "C5'" 1 
ATOM 851   C "C4'" . DG  A 1 42  ? 10.421  -17.636 50.297  1.00 623.06 ?  -271 DG  J "C4'" 1 
ATOM 852   O "O4'" . DG  A 1 42  ? 9.844   -16.340 49.973  1.00 622.89 ?  -271 DG  J "O4'" 1 
ATOM 853   C "C3'" . DG  A 1 42  ? 9.524   -18.239 51.387  1.00 621.18 ?  -271 DG  J "C3'" 1 
ATOM 854   O "O3'" . DG  A 1 42  ? 10.028  -17.947 52.689  1.00 618.34 ?  -271 DG  J "O3'" 1 
ATOM 855   C "C2'" . DG  A 1 42  ? 8.216   -17.479 51.189  1.00 622.16 ?  -271 DG  J "C2'" 1 
ATOM 856   C "C1'" . DG  A 1 42  ? 8.756   -16.093 50.839  1.00 623.57 ?  -271 DG  J "C1'" 1 
ATOM 857   N N9    . DG  A 1 42  ? 7.823   -15.196 50.157  1.00 624.13 ?  -271 DG  J N9    1 
ATOM 858   C C8    . DG  A 1 42  ? 6.737   -15.542 49.382  1.00 624.40 ?  -271 DG  J C8    1 
ATOM 859   N N7    . DG  A 1 42  ? 6.090   -14.519 48.888  1.00 624.41 ?  -271 DG  J N7    1 
ATOM 860   C C5    . DG  A 1 42  ? 6.791   -13.418 49.368  1.00 624.45 ?  -271 DG  J C5    1 
ATOM 861   C C6    . DG  A 1 42  ? 6.562   -12.032 49.170  1.00 624.31 ?  -271 DG  J C6    1 
ATOM 862   O O6    . DG  A 1 42  ? 5.667   -11.486 48.513  1.00 624.32 ?  -271 DG  J O6    1 
ATOM 863   N N1    . DG  A 1 42  ? 7.504   -11.241 49.831  1.00 624.36 ?  -271 DG  J N1    1 
ATOM 864   C C2    . DG  A 1 42  ? 8.544   -11.729 50.589  1.00 624.28 ?  -271 DG  J C2    1 
ATOM 865   N N2    . DG  A 1 42  ? 9.348   -10.808 51.146  1.00 624.24 ?  -271 DG  J N2    1 
ATOM 866   N N3    . DG  A 1 42  ? 8.771   -13.028 50.785  1.00 624.35 ?  -271 DG  J N3    1 
ATOM 867   C C4    . DG  A 1 42  ? 7.862   -13.816 50.147  1.00 624.40 ?  -271 DG  J C4    1 
ATOM 868   P P     . DG  A 1 43  ? 11.212  -18.728 53.438  1.00 630.80 ?  -270 DG  J P     1 
ATOM 869   O OP1   . DG  A 1 43  ? 12.150  -19.266 52.433  1.00 630.80 ?  -270 DG  J OP1   1 
ATOM 870   O OP2   . DG  A 1 43  ? 10.579  -19.595 54.463  1.00 630.80 -1 -270 DG  J OP2   1 
ATOM 871   O "O5'" . DG  A 1 43  ? 11.987  -17.577 54.241  1.00 630.80 ?  -270 DG  J "O5'" 1 
ATOM 872   C "C5'" . DG  A 1 43  ? 12.413  -16.355 53.627  1.00 630.80 ?  -270 DG  J "C5'" 1 
ATOM 873   C "C4'" . DG  A 1 43  ? 12.513  -15.197 54.619  1.00 630.80 ?  -270 DG  J "C4'" 1 
ATOM 874   O "O4'" . DG  A 1 43  ? 11.452  -14.234 54.391  1.00 630.80 ?  -270 DG  J "O4'" 1 
ATOM 875   C "C3'" . DG  A 1 43  ? 12.435  -15.493 56.113  1.00 630.80 ?  -270 DG  J "C3'" 1 
ATOM 876   O "O3'" . DG  A 1 43  ? 13.230  -14.509 56.775  1.00 630.80 ?  -270 DG  J "O3'" 1 
ATOM 877   C "C2'" . DG  A 1 43  ? 10.936  -15.351 56.394  1.00 630.80 ?  -270 DG  J "C2'" 1 
ATOM 878   C "C1'" . DG  A 1 43  ? 10.513  -14.228 55.449  1.00 630.80 ?  -270 DG  J "C1'" 1 
ATOM 879   N N9    . DG  A 1 43  ? 9.241   -14.386 54.760  1.00 630.80 ?  -270 DG  J N9    1 
ATOM 880   C C8    . DG  A 1 43  ? 8.639   -15.568 54.428  1.00 630.80 ?  -270 DG  J C8    1 
ATOM 881   N N7    . DG  A 1 43  ? 7.513   -15.424 53.784  1.00 630.80 ?  -270 DG  J N7    1 
ATOM 882   C C5    . DG  A 1 43  ? 7.360   -14.052 53.659  1.00 630.80 ?  -270 DG  J C5    1 
ATOM 883   C C6    . DG  A 1 43  ? 6.315   -13.304 53.048  1.00 630.80 ?  -270 DG  J C6    1 
ATOM 884   O O6    . DG  A 1 43  ? 5.305   -13.722 52.470  1.00 630.80 ?  -270 DG  J O6    1 
ATOM 885   N N1    . DG  A 1 43  ? 6.526   -11.930 53.143  1.00 630.80 ?  -270 DG  J N1    1 
ATOM 886   C C2    . DG  A 1 43  ? 7.616   -11.354 53.757  1.00 630.80 ?  -270 DG  J C2    1 
ATOM 887   N N2    . DG  A 1 43  ? 7.643   -10.012 53.749  1.00 630.80 ?  -270 DG  J N2    1 
ATOM 888   N N3    . DG  A 1 43  ? 8.603   -12.048 54.334  1.00 630.80 ?  -270 DG  J N3    1 
ATOM 889   C C4    . DG  A 1 43  ? 8.420   -13.394 54.253  1.00 630.80 ?  -270 DG  J C4    1 
ATOM 890   P P     . DA  A 1 44  ? 13.627  -14.565 58.327  1.00 628.75 ?  -269 DA  J P     1 
ATOM 891   O OP1   . DA  A 1 44  ? 15.092  -14.505 58.363  1.00 628.75 ?  -269 DA  J OP1   1 
ATOM 892   O OP2   . DA  A 1 44  ? 12.901  -15.645 59.022  1.00 628.75 -1 -269 DA  J OP2   1 
ATOM 893   O "O5'" . DA  A 1 44  ? 13.065  -13.204 58.944  1.00 628.75 ?  -269 DA  J "O5'" 1 
ATOM 894   C "C5'" . DA  A 1 44  ? 12.769  -12.057 58.137  1.00 628.75 ?  -269 DA  J "C5'" 1 
ATOM 895   C "C4'" . DA  A 1 44  ? 11.596  -11.251 58.675  1.00 628.75 ?  -269 DA  J "C4'" 1 
ATOM 896   O "O4'" . DA  A 1 44  ? 10.383  -11.664 58.010  1.00 628.75 ?  -269 DA  J "O4'" 1 
ATOM 897   C "C3'" . DA  A 1 44  ? 11.271  -11.389 60.162  1.00 628.75 ?  -269 DA  J "C3'" 1 
ATOM 898   O "O3'" . DA  A 1 44  ? 10.719  -10.152 60.592  1.00 628.75 ?  -269 DA  J "O3'" 1 
ATOM 899   C "C2'" . DA  A 1 44  ? 10.226  -12.499 60.196  1.00 628.75 ?  -269 DA  J "C2'" 1 
ATOM 900   C "C1'" . DA  A 1 44  ? 9.427   -12.026 58.992  1.00 628.75 ?  -269 DA  J "C1'" 1 
ATOM 901   N N9    . DA  A 1 44  ? 8.519   -12.967 58.364  1.00 628.75 ?  -269 DA  J N9    1 
ATOM 902   C C8    . DA  A 1 44  ? 8.533   -14.336 58.380  1.00 628.75 ?  -269 DA  J C8    1 
ATOM 903   N N7    . DA  A 1 44  ? 7.569   -14.880 57.672  1.00 628.75 ?  -269 DA  J N7    1 
ATOM 904   C C5    . DA  A 1 44  ? 6.882   -13.784 57.173  1.00 628.75 ?  -269 DA  J C5    1 
ATOM 905   C C6    . DA  A 1 44  ? 5.744   -13.660 56.355  1.00 628.75 ?  -269 DA  J C6    1 
ATOM 906   N N6    . DA  A 1 44  ? 5.084   -14.714 55.877  1.00 628.75 ?  -269 DA  J N6    1 
ATOM 907   N N1    . DA  A 1 44  ? 5.321   -12.413 56.038  1.00 628.75 ?  -269 DA  J N1    1 
ATOM 908   C C2    . DA  A 1 44  ? 5.983   -11.349 56.517  1.00 628.75 ?  -269 DA  J C2    1 
ATOM 909   N N3    . DA  A 1 44  ? 7.062   -11.339 57.296  1.00 628.75 ?  -269 DA  J N3    1 
ATOM 910   C C4    . DA  A 1 44  ? 7.458   -12.596 57.586  1.00 628.75 ?  -269 DA  J C4    1 
ATOM 911   P P     . DG  A 1 45  ? 11.267  -9.393  61.888  1.00 646.21 ?  -268 DG  J P     1 
ATOM 912   O OP1   . DG  A 1 45  ? 12.730  -9.208  61.761  1.00 646.21 ?  -268 DG  J OP1   1 
ATOM 913   O OP2   . DG  A 1 45  ? 10.696  -10.094 63.064  1.00 646.21 -1 -268 DG  J OP2   1 
ATOM 914   O "O5'" . DG  A 1 45  ? 10.595  -7.948  61.765  1.00 646.21 ?  -268 DG  J "O5'" 1 
ATOM 915   C "C5'" . DG  A 1 45  ? 9.655   -7.644  60.732  1.00 646.21 ?  -268 DG  J "C5'" 1 
ATOM 916   C "C4'" . DG  A 1 45  ? 8.233   -7.466  61.258  1.00 646.21 ?  -268 DG  J "C4'" 1 
ATOM 917   O "O4'" . DG  A 1 45  ? 7.396   -8.484  60.657  1.00 646.21 ?  -268 DG  J "O4'" 1 
ATOM 918   C "C3'" . DG  A 1 45  ? 8.032   -7.542  62.778  1.00 646.21 ?  -268 DG  J "C3'" 1 
ATOM 919   O "O3'" . DG  A 1 45  ? 7.654   -6.228  63.290  1.00 646.21 ?  -268 DG  J "O3'" 1 
ATOM 920   C "C2'" . DG  A 1 45  ? 7.029   -8.686  62.986  1.00 646.21 ?  -268 DG  J "C2'" 1 
ATOM 921   C "C1'" . DG  A 1 45  ? 6.468   -8.974  61.593  1.00 646.21 ?  -268 DG  J "C1'" 1 
ATOM 922   N N9    . DG  A 1 45  ? 6.312   -10.385 61.261  1.00 646.21 ?  -268 DG  J N9    1 
ATOM 923   C C8    . DG  A 1 45  ? 7.226   -11.378 61.481  1.00 646.21 ?  -268 DG  J C8    1 
ATOM 924   N N7    . DG  A 1 45  ? 6.837   -12.552 61.074  1.00 646.21 ?  -268 DG  J N7    1 
ATOM 925   C C5    . DG  A 1 45  ? 5.585   -12.320 60.535  1.00 646.21 ?  -268 DG  J C5    1 
ATOM 926   C C6    . DG  A 1 45  ? 4.677   -13.226 59.939  1.00 646.21 ?  -268 DG  J C6    1 
ATOM 927   O O6    . DG  A 1 45  ? 4.817   -14.444 59.767  1.00 646.21 ?  -268 DG  J O6    1 
ATOM 928   N N1    . DG  A 1 45  ? 3.506   -12.592 59.521  1.00 646.21 ?  -268 DG  J N1    1 
ATOM 929   C C2    . DG  A 1 45  ? 3.247   -11.243 59.666  1.00 646.21 ?  -268 DG  J C2    1 
ATOM 930   N N2    . DG  A 1 45  ? 2.064   -10.807 59.203  1.00 646.21 ?  -268 DG  J N2    1 
ATOM 931   N N3    . DG  A 1 45  ? 4.099   -10.384 60.228  1.00 646.21 ?  -268 DG  J N3    1 
ATOM 932   C C4    . DG  A 1 45  ? 5.245   -10.988 60.639  1.00 646.21 ?  -268 DG  J C4    1 
ATOM 933   P P     . DT  A 1 46  ? 6.338   -5.839  64.137  1.00 664.00 ?  -267 DT  J P     1 
ATOM 934   O OP1   . DT  A 1 46  ? 6.341   -4.363  64.199  1.00 664.00 ?  -267 DT  J OP1   1 
ATOM 935   O OP2   . DT  A 1 46  ? 6.287   -6.630  65.390  1.00 664.00 -1 -267 DT  J OP2   1 
ATOM 936   O "O5'" . DT  A 1 46  ? 5.143   -6.337  63.196  1.00 664.00 ?  -267 DT  J "O5'" 1 
ATOM 937   C "C5'" . DT  A 1 46  ? 4.038   -5.515  62.848  1.00 664.00 ?  -267 DT  J "C5'" 1 
ATOM 938   C "C4'" . DT  A 1 46  ? 2.759   -6.276  63.137  1.00 664.00 ?  -267 DT  J "C4'" 1 
ATOM 939   O "O4'" . DT  A 1 46  ? 2.895   -7.658  62.696  1.00 664.00 ?  -267 DT  J "O4'" 1 
ATOM 940   C "C3'" . DT  A 1 46  ? 2.404   -6.343  64.620  1.00 664.00 ?  -267 DT  J "C3'" 1 
ATOM 941   O "O3'" . DT  A 1 46  ? 1.013   -6.083  64.791  1.00 664.00 ?  -267 DT  J "O3'" 1 
ATOM 942   C "C2'" . DT  A 1 46  ? 2.766   -7.778  64.993  1.00 664.00 ?  -267 DT  J "C2'" 1 
ATOM 943   C "C1'" . DT  A 1 46  ? 2.353   -8.484  63.707  1.00 664.00 ?  -267 DT  J "C1'" 1 
ATOM 944   N N1    . DT  A 1 46  ? 2.810   -9.914  63.558  1.00 664.00 ?  -267 DT  J N1    1 
ATOM 945   C C2    . DT  A 1 46  ? 1.975   -10.838 62.949  1.00 664.00 ?  -267 DT  J C2    1 
ATOM 946   O O2    . DT  A 1 46  ? 0.868   -10.579 62.508  1.00 664.00 ?  -267 DT  J O2    1 
ATOM 947   N N3    . DT  A 1 46  ? 2.480   -12.109 62.866  1.00 664.00 ?  -267 DT  J N3    1 
ATOM 948   C C4    . DT  A 1 46  ? 3.709   -12.544 63.323  1.00 664.00 ?  -267 DT  J C4    1 
ATOM 949   O O4    . DT  A 1 46  ? 4.059   -13.711 63.195  1.00 664.00 ?  -267 DT  J O4    1 
ATOM 950   C C5    . DT  A 1 46  ? 4.535   -11.539 63.950  1.00 664.00 ?  -267 DT  J C5    1 
ATOM 951   C C7    . DT  A 1 46  ? 5.889   -11.881 64.489  1.00 664.00 ?  -267 DT  J C7    1 
ATOM 952   C C6    . DT  A 1 46  ? 4.051   -10.293 64.038  1.00 664.00 ?  -267 DT  J C6    1 
ATOM 953   P P     . DA  A 1 47  ? 0.404   -5.776  66.242  1.00 670.06 ?  -266 DA  J P     1 
ATOM 954   O OP1   . DA  A 1 47  ? 0.883   -4.434  66.640  1.00 670.06 ?  -266 DA  J OP1   1 
ATOM 955   O OP2   . DA  A 1 47  ? 0.651   -6.933  67.129  1.00 670.06 -1 -266 DA  J OP2   1 
ATOM 956   O "O5'" . DA  A 1 47  ? -1.174  -5.721  65.978  1.00 670.06 ?  -266 DA  J "O5'" 1 
ATOM 957   C "C5'" . DA  A 1 47  ? -1.761  -6.294  64.803  1.00 670.06 ?  -266 DA  J "C5'" 1 
ATOM 958   C "C4'" . DA  A 1 47  ? -2.329  -7.678  65.067  1.00 670.06 ?  -266 DA  J "C4'" 1 
ATOM 959   O "O4'" . DA  A 1 47  ? -1.255  -8.644  64.953  1.00 670.06 ?  -266 DA  J "O4'" 1 
ATOM 960   C "C3'" . DA  A 1 47  ? -2.961  -7.913  66.446  1.00 670.06 ?  -266 DA  J "C3'" 1 
ATOM 961   O "O3'" . DA  A 1 47  ? -4.221  -8.610  66.326  1.00 670.06 ?  -266 DA  J "O3'" 1 
ATOM 962   C "C2'" . DA  A 1 47  ? -1.905  -8.760  67.158  1.00 670.06 ?  -266 DA  J "C2'" 1 
ATOM 963   C "C1'" . DA  A 1 47  ? -1.470  -9.599  65.968  1.00 670.06 ?  -266 DA  J "C1'" 1 
ATOM 964   N N9    . DA  A 1 47  ? -0.269  -10.404 66.149  1.00 670.06 ?  -266 DA  J N9    1 
ATOM 965   C C8    . DA  A 1 47  ? 0.933   -10.019 66.670  1.00 670.06 ?  -266 DA  J C8    1 
ATOM 966   N N7    . DA  A 1 47  ? 1.828   -10.976 66.694  1.00 670.06 ?  -266 DA  J N7    1 
ATOM 967   C C5    . DA  A 1 47  ? 1.163   -12.065 66.154  1.00 670.06 ?  -266 DA  J C5    1 
ATOM 968   C C6    . DA  A 1 47  ? 1.557   -13.398 65.902  1.00 670.06 ?  -266 DA  J C6    1 
ATOM 969   N N6    . DA  A 1 47  ? 2.777   -13.863 66.183  1.00 670.06 ?  -266 DA  J N6    1 
ATOM 970   N N1    . DA  A 1 47  ? 0.643   -14.234 65.351  1.00 670.06 ?  -266 DA  J N1    1 
ATOM 971   C C2    . DA  A 1 47  ? -0.582  -13.764 65.069  1.00 670.06 ?  -266 DA  J C2    1 
ATOM 972   N N3    . DA  A 1 47  ? -1.066  -12.535 65.261  1.00 670.06 ?  -266 DA  J N3    1 
ATOM 973   C C4    . DA  A 1 47  ? -0.134  -11.729 65.810  1.00 670.06 ?  -266 DA  J C4    1 
ATOM 974   P P     . DA  A 1 48  ? -5.138  -8.879  67.622  1.00 670.76 ?  -265 DA  J P     1 
ATOM 975   O OP1   . DA  A 1 48  ? -5.597  -7.558  68.099  1.00 670.76 ?  -265 DA  J OP1   1 
ATOM 976   O OP2   . DA  A 1 48  ? -4.373  -9.753  68.537  1.00 670.76 -1 -265 DA  J OP2   1 
ATOM 977   O "O5'" . DA  A 1 48  ? -6.410  -9.714  67.105  1.00 670.76 ?  -265 DA  J "O5'" 1 
ATOM 978   C "C5'" . DA  A 1 48  ? -6.304  -10.882 66.272  1.00 670.76 ?  -265 DA  J "C5'" 1 
ATOM 979   C "C4'" . DA  A 1 48  ? -6.138  -12.199 67.024  1.00 670.76 ?  -265 DA  J "C4'" 1 
ATOM 980   O "O4'" . DA  A 1 48  ? -4.732  -12.561 66.993  1.00 670.76 ?  -265 DA  J "O4'" 1 
ATOM 981   C "C3'" . DA  A 1 48  ? -6.570  -12.257 68.496  1.00 670.76 ?  -265 DA  J "C3'" 1 
ATOM 982   O "O3'" . DA  A 1 48  ? -7.529  -13.304 68.698  1.00 670.76 ?  -265 DA  J "O3'" 1 
ATOM 983   C "C2'" . DA  A 1 48  ? -5.276  -12.529 69.264  1.00 670.76 ?  -265 DA  J "C2'" 1 
ATOM 984   C "C1'" . DA  A 1 48  ? -4.408  -13.202 68.207  1.00 670.76 ?  -265 DA  J "C1'" 1 
ATOM 985   N N9    . DA  A 1 48  ? -2.968  -13.115 68.469  1.00 670.76 ?  -265 DA  J N9    1 
ATOM 986   C C8    . DA  A 1 48  ? -2.236  -11.991 68.738  1.00 670.76 ?  -265 DA  J C8    1 
ATOM 987   N N7    . DA  A 1 48  ? -0.962  -12.224 68.941  1.00 670.76 ?  -265 DA  J N7    1 
ATOM 988   C C5    . DA  A 1 48  ? -0.844  -13.597 68.790  1.00 670.76 ?  -265 DA  J C5    1 
ATOM 989   C C6    . DA  A 1 48  ? 0.256   -14.480 68.876  1.00 670.76 ?  -265 DA  J C6    1 
ATOM 990   N N6    . DA  A 1 48  ? 1.498   -14.080 69.148  1.00 670.76 ?  -265 DA  J N6    1 
ATOM 991   N N1    . DA  A 1 48  ? 0.033   -15.798 68.671  1.00 670.76 ?  -265 DA  J N1    1 
ATOM 992   C C2    . DA  A 1 48  ? -1.210  -16.207 68.397  1.00 670.76 ?  -265 DA  J C2    1 
ATOM 993   N N3    . DA  A 1 48  ? -2.319  -15.472 68.293  1.00 670.76 ?  -265 DA  J N3    1 
ATOM 994   C C4    . DA  A 1 48  ? -2.070  -14.164 68.502  1.00 670.76 ?  -265 DA  J C4    1 
ATOM 995   P P     . DT  A 1 49  ? -8.143  -13.674 70.139  1.00 659.90 ?  -264 DT  J P     1 
ATOM 996   O OP1   . DT  A 1 49  ? -9.555  -14.057 69.919  1.00 659.90 ?  -264 DT  J OP1   1 
ATOM 997   O OP2   . DT  A 1 49  ? -7.831  -12.597 71.107  1.00 659.90 -1 -264 DT  J OP2   1 
ATOM 998   O "O5'" . DT  A 1 49  ? -7.298  -14.974 70.561  1.00 659.90 ?  -264 DT  J "O5'" 1 
ATOM 999   C "C5'" . DT  A 1 49  ? -7.600  -16.271 70.017  1.00 659.90 ?  -264 DT  J "C5'" 1 
ATOM 1000  C "C4'" . DT  A 1 49  ? -6.800  -17.400 70.662  1.00 659.90 ?  -264 DT  J "C4'" 1 
ATOM 1001  O "O4'" . DT  A 1 49  ? -5.374  -17.177 70.488  1.00 659.90 ?  -264 DT  J "O4'" 1 
ATOM 1002  C "C3'" . DT  A 1 49  ? -7.030  -17.634 72.157  1.00 659.90 ?  -264 DT  J "C3'" 1 
ATOM 1003  O "O3'" . DT  A 1 49  ? -7.370  -19.013 72.362  1.00 659.90 ?  -264 DT  J "O3'" 1 
ATOM 1004  C "C2'" . DT  A 1 49  ? -5.702  -17.235 72.803  1.00 659.90 ?  -264 DT  J "C2'" 1 
ATOM 1005  C "C1'" . DT  A 1 49  ? -4.693  -17.490 71.688  1.00 659.90 ?  -264 DT  J "C1'" 1 
ATOM 1006  N N1    . DT  A 1 49  ? -3.419  -16.670 71.784  1.00 659.90 ?  -264 DT  J N1    1 
ATOM 1007  C C2    . DT  A 1 49  ? -2.186  -17.304 71.813  1.00 659.90 ?  -264 DT  J C2    1 
ATOM 1008  O O2    . DT  A 1 49  ? -2.038  -18.513 71.768  1.00 659.90 ?  -264 DT  J O2    1 
ATOM 1009  N N3    . DT  A 1 49  ? -1.104  -16.458 71.899  1.00 659.90 ?  -264 DT  J N3    1 
ATOM 1010  C C4    . DT  A 1 49  ? -1.117  -15.073 71.957  1.00 659.90 ?  -264 DT  J C4    1 
ATOM 1011  O O4    . DT  A 1 49  ? -0.080  -14.419 72.032  1.00 659.90 ?  -264 DT  J O4    1 
ATOM 1012  C C5    . DT  A 1 49  ? -2.430  -14.468 71.923  1.00 659.90 ?  -264 DT  J C5    1 
ATOM 1013  C C7    . DT  A 1 49  ? -2.600  -12.978 71.983  1.00 659.90 ?  -264 DT  J C7    1 
ATOM 1014  C C6    . DT  A 1 49  ? -3.495  -15.284 71.838  1.00 659.90 ?  -264 DT  J C6    1 
ATOM 1015  P P     . DC  A 1 50  ? -7.281  -19.764 73.780  1.00 676.44 ?  -263 DC  J P     1 
ATOM 1016  O OP1   . DC  A 1 50  ? -8.111  -20.986 73.683  1.00 676.44 ?  -263 DC  J OP1   1 
ATOM 1017  O OP2   . DC  A 1 50  ? -7.529  -18.796 74.876  1.00 676.44 -1 -263 DC  J OP2   1 
ATOM 1018  O "O5'" . DC  A 1 50  ? -5.744  -20.190 73.833  1.00 676.44 ?  -263 DC  J "O5'" 1 
ATOM 1019  C "C5'" . DC  A 1 50  ? -5.227  -21.122 72.889  1.00 676.44 ?  -263 DC  J "C5'" 1 
ATOM 1020  C "C4'" . DC  A 1 50  ? -3.941  -21.728 73.423  1.00 676.44 ?  -263 DC  J "C4'" 1 
ATOM 1021  O "O4'" . DC  A 1 50  ? -2.970  -20.666 73.599  1.00 676.44 ?  -263 DC  J "O4'" 1 
ATOM 1022  C "C3'" . DC  A 1 50  ? -4.066  -22.435 74.771  1.00 676.44 ?  -263 DC  J "C3'" 1 
ATOM 1023  O "O3'" . DC  A 1 50  ? -3.359  -23.675 74.733  1.00 676.44 ?  -263 DC  J "O3'" 1 
ATOM 1024  C "C2'" . DC  A 1 50  ? -3.458  -21.465 75.784  1.00 676.44 ?  -263 DC  J "C2'" 1 
ATOM 1025  C "C1'" . DC  A 1 50  ? -2.499  -20.631 74.932  1.00 676.44 ?  -263 DC  J "C1'" 1 
ATOM 1026  N N1    . DC  A 1 50  ? -2.362  -19.187 75.343  1.00 676.44 ?  -263 DC  J N1    1 
ATOM 1027  C C2    . DC  A 1 50  ? -1.139  -18.515 75.141  1.00 676.44 ?  -263 DC  J C2    1 
ATOM 1028  O O2    . DC  A 1 50  ? -0.178  -19.111 74.635  1.00 676.44 ?  -263 DC  J O2    1 
ATOM 1029  N N3    . DC  A 1 50  ? -1.034  -17.214 75.518  1.00 676.44 ?  -263 DC  J N3    1 
ATOM 1030  C C4    . DC  A 1 50  ? -2.082  -16.589 76.066  1.00 676.44 ?  -263 DC  J C4    1 
ATOM 1031  N N4    . DC  A 1 50  ? -1.923  -15.309 76.416  1.00 676.44 ?  -263 DC  J N4    1 
ATOM 1032  C C5    . DC  A 1 50  ? -3.335  -17.243 76.275  1.00 676.44 ?  -263 DC  J C5    1 
ATOM 1033  C C6    . DC  A 1 50  ? -3.428  -18.527 75.903  1.00 676.44 ?  -263 DC  J C6    1 
ATOM 1034  P P     . DC  A 1 51  ? -3.934  -24.993 75.448  1.00 685.73 ?  -262 DC  J P     1 
ATOM 1035  O OP1   . DC  A 1 51  ? -3.858  -26.100 74.466  1.00 685.73 ?  -262 DC  J OP1   1 
ATOM 1036  O OP2   . DC  A 1 51  ? -5.234  -24.663 76.081  1.00 685.73 -1 -262 DC  J OP2   1 
ATOM 1037  O "O5'" . DC  A 1 51  ? -2.873  -25.271 76.623  1.00 685.73 ?  -262 DC  J "O5'" 1 
ATOM 1038  C "C5'" . DC  A 1 51  ? -1.487  -25.495 76.336  1.00 685.73 ?  -262 DC  J "C5'" 1 
ATOM 1039  C "C4'" . DC  A 1 51  ? -0.576  -24.813 77.345  1.00 685.73 ?  -262 DC  J "C4'" 1 
ATOM 1040  O "O4'" . DC  A 1 51  ? -0.802  -23.379 77.349  1.00 685.73 ?  -262 DC  J "O4'" 1 
ATOM 1041  C "C3'" . DC  A 1 51  ? -0.743  -25.265 78.796  1.00 685.73 ?  -262 DC  J "C3'" 1 
ATOM 1042  O "O3'" . DC  A 1 51  ? 0.521   -25.651 79.314  1.00 685.73 ?  -262 DC  J "O3'" 1 
ATOM 1043  C "C2'" . DC  A 1 51  ? -1.259  -24.022 79.517  1.00 685.73 ?  -262 DC  J "C2'" 1 
ATOM 1044  C "C1'" . DC  A 1 51  ? -0.593  -22.935 78.677  1.00 685.73 ?  -262 DC  J "C1'" 1 
ATOM 1045  N N1    . DC  A 1 51  ? -1.093  -21.521 78.872  1.00 685.73 ?  -262 DC  J N1    1 
ATOM 1046  C C2    . DC  A 1 51  ? -0.690  -20.506 77.975  1.00 685.73 ?  -262 DC  J C2    1 
ATOM 1047  O O2    . DC  A 1 51  ? 0.069   -20.770 77.014  1.00 685.73 ?  -262 DC  J O2    1 
ATOM 1048  N N3    . DC  A 1 51  ? -1.146  -19.241 78.170  1.00 685.73 ?  -262 DC  J N3    1 
ATOM 1049  C C4    . DC  A 1 51  ? -1.960  -18.966 79.199  1.00 685.73 ?  -262 DC  J C4    1 
ATOM 1050  N N4    . DC  A 1 51  ? -2.371  -17.704 79.340  1.00 685.73 ?  -262 DC  J N4    1 
ATOM 1051  C C5    . DC  A 1 51  ? -2.379  -19.974 80.132  1.00 685.73 ?  -262 DC  J C5    1 
ATOM 1052  C C6    . DC  A 1 51  ? -1.924  -21.219 79.932  1.00 685.73 ?  -262 DC  J C6    1 
ATOM 1053  P P     . DC  A 1 52  ? 0.968   -27.188 79.378  1.00 705.35 ?  -261 DC  J P     1 
ATOM 1054  O OP1   . DC  A 1 52  ? 0.113   -27.965 78.454  1.00 705.35 ?  -261 DC  J OP1   1 
ATOM 1055  O OP2   . DC  A 1 52  ? 1.036   -27.556 80.809  1.00 705.35 -1 -261 DC  J OP2   1 
ATOM 1056  O "O5'" . DC  A 1 52  ? 2.461   -27.179 78.797  1.00 705.35 ?  -261 DC  J "O5'" 1 
ATOM 1057  C "C5'" . DC  A 1 52  ? 2.972   -26.091 78.022  1.00 705.35 ?  -261 DC  J "C5'" 1 
ATOM 1058  C "C4'" . DC  A 1 52  ? 3.994   -25.256 78.785  1.00 705.35 ?  -261 DC  J "C4'" 1 
ATOM 1059  O "O4'" . DC  A 1 52  ? 3.332   -24.093 79.345  1.00 705.35 ?  -261 DC  J "O4'" 1 
ATOM 1060  C "C3'" . DC  A 1 52  ? 4.738   -25.928 79.945  1.00 705.35 ?  -261 DC  J "C3'" 1 
ATOM 1061  O "O3'" . DC  A 1 52  ? 6.130   -25.570 79.913  1.00 705.35 ?  -261 DC  J "O3'" 1 
ATOM 1062  C "C2'" . DC  A 1 52  ? 4.031   -25.364 81.176  1.00 705.35 ?  -261 DC  J "C2'" 1 
ATOM 1063  C "C1'" . DC  A 1 52  ? 3.750   -23.946 80.687  1.00 705.35 ?  -261 DC  J "C1'" 1 
ATOM 1064  N N1    . DC  A 1 52  ? 2.723   -23.146 81.446  1.00 705.35 ?  -261 DC  J N1    1 
ATOM 1065  C C2    . DC  A 1 52  ? 2.797   -21.744 81.392  1.00 705.35 ?  -261 DC  J C2    1 
ATOM 1066  O O2    . DC  A 1 52  ? 3.691   -21.203 80.733  1.00 705.35 ?  -261 DC  J O2    1 
ATOM 1067  N N3    . DC  A 1 52  ? 1.882   -21.009 82.069  1.00 705.35 ?  -261 DC  J N3    1 
ATOM 1068  C C4    . DC  A 1 52  ? 0.926   -21.619 82.774  1.00 705.35 ?  -261 DC  J C4    1 
ATOM 1069  N N4    . DC  A 1 52  ? 0.057   -20.837 83.415  1.00 705.35 ?  -261 DC  J N4    1 
ATOM 1070  C C5    . DC  A 1 52  ? 0.825   -23.046 82.850  1.00 705.35 ?  -261 DC  J C5    1 
ATOM 1071  C C6    . DC  A 1 52  ? 1.734   -23.761 82.176  1.00 705.35 ?  -261 DC  J C6    1 
ATOM 1072  P P     . DC  A 1 53  ? 7.288   -26.426 80.627  1.00 718.39 ?  -260 DC  J P     1 
ATOM 1073  O OP1   . DC  A 1 53  ? 7.888   -27.305 79.603  1.00 718.39 ?  -260 DC  J OP1   1 
ATOM 1074  O OP2   . DC  A 1 53  ? 6.776   -27.023 81.883  1.00 718.39 -1 -260 DC  J OP2   1 
ATOM 1075  O "O5'" . DC  A 1 53  ? 8.373   -25.325 81.056  1.00 718.39 ?  -260 DC  J "O5'" 1 
ATOM 1076  C "C5'" . DC  A 1 53  ? 8.404   -24.005 80.492  1.00 718.39 ?  -260 DC  J "C5'" 1 
ATOM 1077  C "C4'" . DC  A 1 53  ? 8.447   -22.924 81.562  1.00 718.39 ?  -260 DC  J "C4'" 1 
ATOM 1078  O "O4'" . DC  A 1 53  ? 7.106   -22.707 82.086  1.00 718.39 ?  -260 DC  J "O4'" 1 
ATOM 1079  C "C3'" . DC  A 1 53  ? 9.344   -23.196 82.776  1.00 718.39 ?  -260 DC  J "C3'" 1 
ATOM 1080  O "O3'" . DC  A 1 53  ? 10.175  -22.058 83.041  1.00 718.39 ?  -260 DC  J "O3'" 1 
ATOM 1081  C "C2'" . DC  A 1 53  ? 8.330   -23.430 83.895  1.00 718.39 ?  -260 DC  J "C2'" 1 
ATOM 1082  C "C1'" . DC  A 1 53  ? 7.249   -22.445 83.467  1.00 718.39 ?  -260 DC  J "C1'" 1 
ATOM 1083  N N1    . DC  A 1 53  ? 5.929   -22.520 84.196  1.00 718.39 ?  -260 DC  J N1    1 
ATOM 1084  C C2    . DC  A 1 53  ? 5.415   -21.366 84.823  1.00 718.39 ?  -260 DC  J C2    1 
ATOM 1085  O O2    . DC  A 1 53  ? 6.037   -20.300 84.782  1.00 718.39 ?  -260 DC  J O2    1 
ATOM 1086  N N3    . DC  A 1 53  ? 4.231   -21.439 85.479  1.00 718.39 ?  -260 DC  J N3    1 
ATOM 1087  C C4    . DC  A 1 53  ? 3.562   -22.593 85.522  1.00 718.39 ?  -260 DC  J C4    1 
ATOM 1088  N N4    . DC  A 1 53  ? 2.398   -22.606 86.177  1.00 718.39 ?  -260 DC  J N4    1 
ATOM 1089  C C5    . DC  A 1 53  ? 4.060   -23.780 84.891  1.00 718.39 ?  -260 DC  J C5    1 
ATOM 1090  C C6    . DC  A 1 53  ? 5.233   -23.700 84.246  1.00 718.39 ?  -260 DC  J C6    1 
ATOM 1091  P P     . DT  A 1 54  ? 11.494  -22.130 83.962  1.00 720.59 ?  -259 DT  J P     1 
ATOM 1092  O OP1   . DT  A 1 54  ? 12.590  -22.551 83.067  1.00 720.59 ?  -259 DT  J OP1   1 
ATOM 1093  O OP2   . DT  A 1 54  ? 11.218  -22.902 85.194  1.00 720.59 -1 -259 DT  J OP2   1 
ATOM 1094  O "O5'" . DT  A 1 54  ? 11.746  -20.616 84.404  1.00 720.59 ?  -259 DT  J "O5'" 1 
ATOM 1095  C "C5'" . DT  A 1 54  ? 10.903  -19.555 83.951  1.00 720.59 ?  -259 DT  J "C5'" 1 
ATOM 1096  C "C4'" . DT  A 1 54  ? 10.178  -18.903 85.112  1.00 720.59 ?  -259 DT  J "C4'" 1 
ATOM 1097  O "O4'" . DT  A 1 54  ? 8.972   -19.636 85.430  1.00 720.59 ?  -259 DT  J "O4'" 1 
ATOM 1098  C "C3'" . DT  A 1 54  ? 10.976  -18.853 86.408  1.00 720.59 ?  -259 DT  J "C3'" 1 
ATOM 1099  O "O3'" . DT  A 1 54  ? 11.373  -17.520 86.632  1.00 720.59 ?  -259 DT  J "O3'" 1 
ATOM 1100  C "C2'" . DT  A 1 54  ? 10.018  -19.350 87.490  1.00 720.59 ?  -259 DT  J "C2'" 1 
ATOM 1101  C "C1'" . DT  A 1 54  ? 8.674   -19.359 86.779  1.00 720.59 ?  -259 DT  J "C1'" 1 
ATOM 1102  N N1    . DT  A 1 54  ? 7.710   -20.371 87.325  1.00 720.59 ?  -259 DT  J N1    1 
ATOM 1103  C C2    . DT  A 1 54  ? 6.647   -19.930 88.097  1.00 720.59 ?  -259 DT  J C2    1 
ATOM 1104  O O2    . DT  A 1 54  ? 6.434   -18.754 88.362  1.00 720.59 ?  -259 DT  J O2    1 
ATOM 1105  N N3    . DT  A 1 54  ? 5.820   -20.930 88.552  1.00 720.59 ?  -259 DT  J N3    1 
ATOM 1106  C C4    . DT  A 1 54  ? 5.942   -22.291 88.322  1.00 720.59 ?  -259 DT  J C4    1 
ATOM 1107  O O4    . DT  A 1 54  ? 5.138   -23.098 88.782  1.00 720.59 ?  -259 DT  J O4    1 
ATOM 1108  C C5    . DT  A 1 54  ? 7.075   -22.680 87.511  1.00 720.59 ?  -259 DT  J C5    1 
ATOM 1109  C C7    . DT  A 1 54  ? 7.320   -24.126 87.194  1.00 720.59 ?  -259 DT  J C7    1 
ATOM 1110  C C6    . DT  A 1 54  ? 7.894   -21.718 87.060  1.00 720.59 ?  -259 DT  J C6    1 
ATOM 1111  P P     . DT  A 1 55  ? 12.463  -17.152 87.740  1.00 723.83 ?  -258 DT  J P     1 
ATOM 1112  O OP1   . DT  A 1 55  ? 13.463  -16.287 87.083  1.00 723.83 ?  -258 DT  J OP1   1 
ATOM 1113  O OP2   . DT  A 1 55  ? 12.894  -18.381 88.441  1.00 723.83 -1 -258 DT  J OP2   1 
ATOM 1114  O "O5'" . DT  A 1 55  ? 11.642  -16.285 88.804  1.00 723.83 ?  -258 DT  J "O5'" 1 
ATOM 1115  C "C5'" . DT  A 1 55  ? 10.516  -15.510 88.410  1.00 723.83 ?  -258 DT  J "C5'" 1 
ATOM 1116  C "C4'" . DT  A 1 55  ? 9.411   -15.609 89.449  1.00 723.83 ?  -258 DT  J "C4'" 1 
ATOM 1117  O "O4'" . DT  A 1 55  ? 8.832   -16.943 89.471  1.00 723.83 ?  -258 DT  J "O4'" 1 
ATOM 1118  C "C3'" . DT  A 1 55  ? 9.860   -15.313 90.881  1.00 723.83 ?  -258 DT  J "C3'" 1 
ATOM 1119  O "O3'" . DT  A 1 55  ? 9.257   -14.089 91.316  1.00 723.83 ?  -258 DT  J "O3'" 1 
ATOM 1120  C "C2'" . DT  A 1 55  ? 9.379   -16.533 91.672  1.00 723.83 ?  -258 DT  J "C2'" 1 
ATOM 1121  C "C1'" . DT  A 1 55  ? 8.287   -17.091 90.762  1.00 723.83 ?  -258 DT  J "C1'" 1 
ATOM 1122  N N1    . DT  A 1 55  ? 7.837   -18.511 91.060  1.00 723.83 ?  -258 DT  J N1    1 
ATOM 1123  C C2    . DT  A 1 55  ? 6.522   -18.733 91.450  1.00 723.83 ?  -258 DT  J C2    1 
ATOM 1124  O O2    . DT  A 1 55  ? 5.683   -17.858 91.561  1.00 723.83 ?  -258 DT  J O2    1 
ATOM 1125  N N3    . DT  A 1 55  ? 6.205   -20.043 91.706  1.00 723.83 ?  -258 DT  J N3    1 
ATOM 1126  C C4    . DT  A 1 55  ? 7.043   -21.136 91.623  1.00 723.83 ?  -258 DT  J C4    1 
ATOM 1127  O O4    . DT  A 1 55  ? 6.649   -22.267 91.877  1.00 723.83 ?  -258 DT  J O4    1 
ATOM 1128  C C5    . DT  A 1 55  ? 8.400   -20.851 91.219  1.00 723.83 ?  -258 DT  J C5    1 
ATOM 1129  C C7    . DT  A 1 55  ? 9.399   -21.963 91.095  1.00 723.83 ?  -258 DT  J C7    1 
ATOM 1130  C C6    . DT  A 1 55  ? 8.727   -19.570 90.961  1.00 723.83 ?  -258 DT  J C6    1 
ATOM 1131  P P     . DG  A 1 56  ? 9.707   -13.310 92.645  1.00 730.11 ?  -257 DG  J P     1 
ATOM 1132  O OP1   . DG  A 1 56  ? 10.070  -11.940 92.227  1.00 730.11 ?  -257 DG  J OP1   1 
ATOM 1133  O OP2   . DG  A 1 56  ? 10.677  -14.136 93.398  1.00 730.11 -1 -257 DG  J OP2   1 
ATOM 1134  O "O5'" . DG  A 1 56  ? 8.372   -13.232 93.530  1.00 730.11 ?  -257 DG  J "O5'" 1 
ATOM 1135  C "C5'" . DG  A 1 56  ? 7.239   -14.065 93.259  1.00 730.11 ?  -257 DG  J "C5'" 1 
ATOM 1136  C "C4'" . DG  A 1 56  ? 6.583   -14.608 94.519  1.00 730.11 ?  -257 DG  J "C4'" 1 
ATOM 1137  O "O4'" . DG  A 1 56  ? 6.276   -16.017 94.361  1.00 730.11 ?  -257 DG  J "O4'" 1 
ATOM 1138  C "C3'" . DG  A 1 56  ? 7.394   -14.514 95.803  1.00 730.11 ?  -257 DG  J "C3'" 1 
ATOM 1139  O "O3'" . DG  A 1 56  ? 6.525   -14.096 96.828  1.00 730.11 ?  -257 DG  J "O3'" 1 
ATOM 1140  C "C2'" . DG  A 1 56  ? 7.846   -15.947 96.049  1.00 730.11 ?  -257 DG  J "C2'" 1 
ATOM 1141  C "C1'" . DG  A 1 56  ? 6.614   -16.693 95.556  1.00 730.11 ?  -257 DG  J "C1'" 1 
ATOM 1142  N N9    . DG  A 1 56  ? 6.813   -18.113 95.270  1.00 730.11 ?  -257 DG  J N9    1 
ATOM 1143  C C8    . DG  A 1 56  ? 7.981   -18.729 94.885  1.00 730.11 ?  -257 DG  J C8    1 
ATOM 1144  N N7    . DG  A 1 56  ? 7.858   -20.014 94.693  1.00 730.11 ?  -257 DG  J N7    1 
ATOM 1145  C C5    . DG  A 1 56  ? 6.520   -20.276 94.962  1.00 730.11 ?  -257 DG  J C5    1 
ATOM 1146  C C6    . DG  A 1 56  ? 5.796   -21.501 94.917  1.00 730.11 ?  -257 DG  J C6    1 
ATOM 1147  O O6    . DG  A 1 56  ? 6.207   -22.637 94.633  1.00 730.11 ?  -257 DG  J O6    1 
ATOM 1148  N N1    . DG  A 1 56  ? 4.460   -21.327 95.272  1.00 730.11 ?  -257 DG  J N1    1 
ATOM 1149  C C2    . DG  A 1 56  ? 3.890   -20.118 95.614  1.00 730.11 ?  -257 DG  J C2    1 
ATOM 1150  N N2    . DG  A 1 56  ? 2.583   -20.145 95.913  1.00 730.11 ?  -257 DG  J N2    1 
ATOM 1151  N N3    . DG  A 1 56  ? 4.555   -18.965 95.653  1.00 730.11 ?  -257 DG  J N3    1 
ATOM 1152  C C4    . DG  A 1 56  ? 5.864   -19.113 95.318  1.00 730.11 ?  -257 DG  J C4    1 
ATOM 1153  P P     . DG  A 1 57  ? 7.070   -13.138 97.978  1.00 724.99 ?  -256 DG  J P     1 
ATOM 1154  O OP1   . DG  A 1 57  ? 7.286   -11.799 97.373  1.00 724.99 ?  -256 DG  J OP1   1 
ATOM 1155  O OP2   . DG  A 1 57  ? 8.181   -13.843 98.660  1.00 724.99 -1 -256 DG  J OP2   1 
ATOM 1156  O "O5'" . DG  A 1 57  ? 5.851   -13.052 99.010  1.00 724.99 ?  -256 DG  J "O5'" 1 
ATOM 1157  C "C5'" . DG  A 1 57  ? 4.683   -13.838 98.823  1.00 724.99 ?  -256 DG  J "C5'" 1 
ATOM 1158  C "C4'" . DG  A 1 57  ? 4.683   -15.086 99.688  1.00 724.99 ?  -256 DG  J "C4'" 1 
ATOM 1159  O "O4'" . DG  A 1 57  ? 5.057   -16.231 98.884  1.00 724.99 ?  -256 DG  J "O4'" 1 
ATOM 1160  C "C3'" . DG  A 1 57  ? 5.636   -15.110 100.888 1.00 724.99 ?  -256 DG  J "C3'" 1 
ATOM 1161  O "O3'" . DG  A 1 57  ? 4.924   -14.740 102.104 1.00 724.99 ?  -256 DG  J "O3'" 1 
ATOM 1162  C "C2'" . DG  A 1 57  ? 6.220   -16.527 100.865 1.00 724.99 ?  -256 DG  J "C2'" 1 
ATOM 1163  C "C1'" . DG  A 1 57  ? 5.369   -17.235 99.817  1.00 724.99 ?  -256 DG  J "C1'" 1 
ATOM 1164  N N9    . DG  A 1 57  ? 6.058   -18.353 99.175  1.00 724.99 ?  -256 DG  J N9    1 
ATOM 1165  C C8    . DG  A 1 57  ? 7.327   -18.356 98.643  1.00 724.99 ?  -256 DG  J C8    1 
ATOM 1166  N N7    . DG  A 1 57  ? 7.681   -19.506 98.143  1.00 724.99 ?  -256 DG  J N7    1 
ATOM 1167  C C5    . DG  A 1 57  ? 6.579   -20.321 98.361  1.00 724.99 ?  -256 DG  J C5    1 
ATOM 1168  C C6    . DG  A 1 57  ? 6.378   -21.687 98.035  1.00 724.99 ?  -256 DG  J C6    1 
ATOM 1169  O O6    . DG  A 1 57  ? 7.165   -22.459 97.469  1.00 724.99 ?  -256 DG  J O6    1 
ATOM 1170  N N1    . DG  A 1 57  ? 5.114   -22.141 98.425  1.00 724.99 ?  -256 DG  J N1    1 
ATOM 1171  C C2    . DG  A 1 57  ? 4.166   -21.366 99.059  1.00 724.99 ?  -256 DG  J C2    1 
ATOM 1172  N N2    . DG  A 1 57  ? 3.007   -21.967 99.362  1.00 724.99 ?  -256 DG  J N2    1 
ATOM 1173  N N3    . DG  A 1 57  ? 4.346   -20.084 99.375  1.00 724.99 ?  -256 DG  J N3    1 
ATOM 1174  C C4    . DG  A 1 57  ? 5.571   -19.628 98.998  1.00 724.99 ?  -256 DG  J C4    1 
ATOM 1175  P P     . DC  A 1 58  ? 4.791   -15.599 103.465 1.00 716.81 ?  -255 DC  J P     1 
ATOM 1176  O OP1   . DC  A 1 58  ? 4.007   -14.773 104.414 1.00 716.81 ?  -255 DC  J OP1   1 
ATOM 1177  O OP2   . DC  A 1 58  ? 6.134   -16.074 103.879 1.00 716.81 -1 -255 DC  J OP2   1 
ATOM 1178  O "O5'" . DC  A 1 58  ? 3.922   -16.880 103.036 1.00 716.81 ?  -255 DC  J "O5'" 1 
ATOM 1179  C "C5'" . DC  A 1 58  ? 3.006   -17.498 103.947 1.00 716.81 ?  -255 DC  J "C5'" 1 
ATOM 1180  C "C4'" . DC  A 1 58  ? 3.435   -18.908 104.311 1.00 716.81 ?  -255 DC  J "C4'" 1 
ATOM 1181  O "O4'" . DC  A 1 58  ? 4.179   -19.505 103.212 1.00 716.81 ?  -255 DC  J "O4'" 1 
ATOM 1182  C "C3'" . DC  A 1 58  ? 4.336   -19.020 105.544 1.00 716.81 ?  -255 DC  J "C3'" 1 
ATOM 1183  O "O3'" . DC  A 1 58  ? 3.838   -20.025 106.438 1.00 716.81 ?  -255 DC  J "O3'" 1 
ATOM 1184  C "C2'" . DC  A 1 58  ? 5.688   -19.427 104.957 1.00 716.81 ?  -255 DC  J "C2'" 1 
ATOM 1185  C "C1'" . DC  A 1 58  ? 5.205   -20.281 103.790 1.00 716.81 ?  -255 DC  J "C1'" 1 
ATOM 1186  N N1    . DC  A 1 58  ? 6.247   -20.661 102.777 1.00 716.81 ?  -255 DC  J N1    1 
ATOM 1187  C C2    . DC  A 1 58  ? 6.238   -21.960 102.236 1.00 716.81 ?  -255 DC  J C2    1 
ATOM 1188  O O2    . DC  A 1 58  ? 5.370   -22.767 102.593 1.00 716.81 ?  -255 DC  J O2    1 
ATOM 1189  N N3    . DC  A 1 58  ? 7.185   -22.305 101.327 1.00 716.81 ?  -255 DC  J N3    1 
ATOM 1190  C C4    . DC  A 1 58  ? 8.111   -21.415 100.962 1.00 716.81 ?  -255 DC  J C4    1 
ATOM 1191  N N4    . DC  A 1 58  ? 9.019   -21.801 100.060 1.00 716.81 ?  -255 DC  J N4    1 
ATOM 1192  C C5    . DC  A 1 58  ? 8.143   -20.089 101.497 1.00 716.81 ?  -255 DC  J C5    1 
ATOM 1193  C C6    . DC  A 1 58  ? 7.203   -19.760 102.392 1.00 716.81 ?  -255 DC  J C6    1 
ATOM 1194  P P     . DG  A 1 59  ? 4.204   -19.988 108.001 1.00 710.85 ?  -254 DG  J P     1 
ATOM 1195  O OP1   . DG  A 1 59  ? 3.359   -18.929 108.600 1.00 710.85 ?  -254 DG  J OP1   1 
ATOM 1196  O OP2   . DG  A 1 59  ? 5.677   -19.908 108.137 1.00 710.85 -1 -254 DG  J OP2   1 
ATOM 1197  O "O5'" . DG  A 1 59  ? 3.751   -21.415 108.585 1.00 710.85 ?  -254 DG  J "O5'" 1 
ATOM 1198  C "C5'" . DG  A 1 59  ? 3.675   -22.617 107.797 1.00 710.85 ?  -254 DG  J "C5'" 1 
ATOM 1199  C "C4'" . DG  A 1 59  ? 4.870   -23.561 107.951 1.00 710.85 ?  -254 DG  J "C4'" 1 
ATOM 1200  O "O4'" . DG  A 1 59  ? 5.973   -23.111 107.121 1.00 710.85 ?  -254 DG  J "O4'" 1 
ATOM 1201  C "C3'" . DG  A 1 59  ? 5.480   -23.809 109.337 1.00 710.85 ?  -254 DG  J "C3'" 1 
ATOM 1202  O "O3'" . DG  A 1 59  ? 5.761   -25.226 109.451 1.00 710.85 ?  -254 DG  J "O3'" 1 
ATOM 1203  C "C2'" . DG  A 1 59  ? 6.753   -22.954 109.295 1.00 710.85 ?  -254 DG  J "C2'" 1 
ATOM 1204  C "C1'" . DG  A 1 59  ? 7.179   -23.224 107.854 1.00 710.85 ?  -254 DG  J "C1'" 1 
ATOM 1205  N N9    . DG  A 1 59  ? 8.160   -22.346 107.207 1.00 710.85 ?  -254 DG  J N9    1 
ATOM 1206  C C8    . DG  A 1 59  ? 8.644   -21.119 107.603 1.00 710.85 ?  -254 DG  J C8    1 
ATOM 1207  N N7    . DG  A 1 59  ? 9.509   -20.605 106.767 1.00 710.85 ?  -254 DG  J N7    1 
ATOM 1208  C C5    . DG  A 1 59  ? 9.604   -21.547 105.749 1.00 710.85 ?  -254 DG  J C5    1 
ATOM 1209  C C6    . DG  A 1 59  ? 10.381  -21.556 104.561 1.00 710.85 ?  -254 DG  J C6    1 
ATOM 1210  O O6    . DG  A 1 59  ? 11.174  -20.694 104.159 1.00 710.85 ?  -254 DG  J O6    1 
ATOM 1211  N N1    . DG  A 1 59  ? 10.177  -22.711 103.800 1.00 710.85 ?  -254 DG  J N1    1 
ATOM 1212  C C2    . DG  A 1 59  ? 9.321   -23.735 104.146 1.00 710.85 ?  -254 DG  J C2    1 
ATOM 1213  N N2    . DG  A 1 59  ? 9.237   -24.775 103.307 1.00 710.85 ?  -254 DG  J N2    1 
ATOM 1214  N N3    . DG  A 1 59  ? 8.591   -23.735 105.254 1.00 710.85 ?  -254 DG  J N3    1 
ATOM 1215  C C4    . DG  A 1 59  ? 8.779   -22.619 106.006 1.00 710.85 ?  -254 DG  J C4    1 
ATOM 1216  P P     . DG  A 1 60  ? 5.969   -26.003 110.848 1.00 702.15 ?  -253 DG  J P     1 
ATOM 1217  O OP1   . DG  A 1 60  ? 4.739   -25.794 111.645 1.00 702.15 ?  -253 DG  J OP1   1 
ATOM 1218  O OP2   . DG  A 1 60  ? 7.286   -25.608 111.400 1.00 702.15 -1 -253 DG  J OP2   1 
ATOM 1219  O "O5'" . DG  A 1 60  ? 6.048   -27.562 110.458 1.00 702.15 ?  -253 DG  J "O5'" 1 
ATOM 1220  C "C5'" . DG  A 1 60  ? 6.907   -28.050 109.423 1.00 702.15 ?  -253 DG  J "C5'" 1 
ATOM 1221  C "C4'" . DG  A 1 60  ? 8.004   -28.982 109.931 1.00 702.15 ?  -253 DG  J "C4'" 1 
ATOM 1222  O "O4'" . DG  A 1 60  ? 9.183   -28.811 109.103 1.00 702.15 ?  -253 DG  J "O4'" 1 
ATOM 1223  C "C3'" . DG  A 1 60  ? 8.495   -28.790 111.365 1.00 702.15 ?  -253 DG  J "C3'" 1 
ATOM 1224  O "O3'" . DG  A 1 60  ? 8.926   -30.047 111.908 1.00 702.15 ?  -253 DG  J "O3'" 1 
ATOM 1225  C "C2'" . DG  A 1 60  ? 9.651   -27.810 111.192 1.00 702.15 ?  -253 DG  J "C2'" 1 
ATOM 1226  C "C1'" . DG  A 1 60  ? 10.237  -28.221 109.847 1.00 702.15 ?  -253 DG  J "C1'" 1 
ATOM 1227  N N9    . DG  A 1 60  ? 10.783  -27.090 109.097 1.00 702.15 ?  -253 DG  J N9    1 
ATOM 1228  C C8    . DG  A 1 60  ? 10.942  -25.803 109.557 1.00 702.15 ?  -253 DG  J C8    1 
ATOM 1229  N N7    . DG  A 1 60  ? 11.454  -24.992 108.679 1.00 702.15 ?  -253 DG  J N7    1 
ATOM 1230  C C5    . DG  A 1 60  ? 11.652  -25.789 107.562 1.00 702.15 ?  -253 DG  J C5    1 
ATOM 1231  C C6    . DG  A 1 60  ? 12.183  -25.454 106.292 1.00 702.15 ?  -253 DG  J C6    1 
ATOM 1232  O O6    . DG  A 1 60  ? 12.592  -24.349 105.912 1.00 702.15 ?  -253 DG  J O6    1 
ATOM 1233  N N1    . DG  A 1 60  ? 12.218  -26.548 105.425 1.00 702.15 ?  -253 DG  J N1    1 
ATOM 1234  C C2    . DG  A 1 60  ? 11.786  -27.814 105.753 1.00 702.15 ?  -253 DG  J C2    1 
ATOM 1235  N N2    . DG  A 1 60  ? 11.897  -28.746 104.794 1.00 702.15 ?  -253 DG  J N2    1 
ATOM 1236  N N3    . DG  A 1 60  ? 11.285  -28.141 106.941 1.00 702.15 ?  -253 DG  J N3    1 
ATOM 1237  C C4    . DG  A 1 60  ? 11.245  -27.084 107.798 1.00 702.15 ?  -253 DG  J C4    1 
ATOM 1238  P P     . DT  A 1 61  ? 9.629   -30.210 113.350 1.00 709.00 ?  -252 DT  J P     1 
ATOM 1239  O OP1   . DT  A 1 61  ? 8.741   -31.049 114.185 1.00 709.00 ?  -252 DT  J OP1   1 
ATOM 1240  O OP2   . DT  A 1 61  ? 10.063  -28.888 113.862 1.00 709.00 -1 -252 DT  J OP2   1 
ATOM 1241  O "O5'" . DT  A 1 61  ? 10.946  -31.054 113.006 1.00 709.00 ?  -252 DT  J "O5'" 1 
ATOM 1242  C "C5'" . DT  A 1 61  ? 10.915  -32.150 112.085 1.00 709.00 ?  -252 DT  J "C5'" 1 
ATOM 1243  C "C4'" . DT  A 1 61  ? 12.160  -32.165 111.206 1.00 709.00 ?  -252 DT  J "C4'" 1 
ATOM 1244  O "O4'" . DT  A 1 61  ? 12.326  -30.875 110.569 1.00 709.00 ?  -252 DT  J "O4'" 1 
ATOM 1245  C "C3'" . DT  A 1 61  ? 13.472  -32.455 111.940 1.00 709.00 ?  -252 DT  J "C3'" 1 
ATOM 1246  O "O3'" . DT  A 1 61  ? 13.970  -33.786 111.642 1.00 709.00 ?  -252 DT  J "O3'" 1 
ATOM 1247  C "C2'" . DT  A 1 61  ? 14.433  -31.323 111.556 1.00 709.00 ?  -252 DT  J "C2'" 1 
ATOM 1248  C "C1'" . DT  A 1 61  ? 13.702  -30.572 110.444 1.00 709.00 ?  -252 DT  J "C1'" 1 
ATOM 1249  N N1    . DT  A 1 61  ? 13.863  -29.070 110.467 1.00 709.00 ?  -252 DT  J N1    1 
ATOM 1250  C C2    . DT  A 1 61  ? 14.207  -28.391 109.305 1.00 709.00 ?  -252 DT  J C2    1 
ATOM 1251  O O2    . DT  A 1 61  ? 14.403  -28.926 108.222 1.00 709.00 ?  -252 DT  J O2    1 
ATOM 1252  N N3    . DT  A 1 61  ? 14.319  -27.025 109.455 1.00 709.00 ?  -252 DT  J N3    1 
ATOM 1253  C C4    . DT  A 1 61  ? 14.128  -26.283 110.612 1.00 709.00 ?  -252 DT  J C4    1 
ATOM 1254  O O4    . DT  A 1 61  ? 14.259  -25.062 110.624 1.00 709.00 ?  -252 DT  J O4    1 
ATOM 1255  C C5    . DT  A 1 61  ? 13.771  -27.051 111.784 1.00 709.00 ?  -252 DT  J C5    1 
ATOM 1256  C C7    . DT  A 1 61  ? 13.533  -26.377 113.107 1.00 709.00 ?  -252 DT  J C7    1 
ATOM 1257  C C6    . DT  A 1 61  ? 13.656  -28.384 111.654 1.00 709.00 ?  -252 DT  J C6    1 
ATOM 1258  P P     . DT  A 1 62  ? 14.390  -34.339 110.189 1.00 703.68 ?  -251 DT  J P     1 
ATOM 1259  O OP1   . DT  A 1 62  ? 13.473  -33.800 109.157 1.00 703.68 ?  -251 DT  J OP1   1 
ATOM 1260  O OP2   . DT  A 1 62  ? 14.540  -35.806 110.318 1.00 703.68 -1 -251 DT  J OP2   1 
ATOM 1261  O "O5'" . DT  A 1 62  ? 15.859  -33.723 109.999 1.00 703.68 ?  -251 DT  J "O5'" 1 
ATOM 1262  C "C5'" . DT  A 1 62  ? 16.366  -33.393 108.701 1.00 703.68 ?  -251 DT  J "C5'" 1 
ATOM 1263  C "C4'" . DT  A 1 62  ? 17.641  -32.561 108.762 1.00 703.68 ?  -251 DT  J "C4'" 1 
ATOM 1264  O "O4'" . DT  A 1 62  ? 17.329  -31.179 109.079 1.00 703.68 ?  -251 DT  J "O4'" 1 
ATOM 1265  C "C3'" . DT  A 1 62  ? 18.712  -32.991 109.772 1.00 703.68 ?  -251 DT  J "C3'" 1 
ATOM 1266  O "O3'" . DT  A 1 62  ? 19.959  -33.054 109.090 1.00 703.68 ?  -251 DT  J "O3'" 1 
ATOM 1267  C "C2'" . DT  A 1 62  ? 18.712  -31.855 110.793 1.00 703.68 ?  -251 DT  J "C2'" 1 
ATOM 1268  C "C1'" . DT  A 1 62  ? 18.396  -30.690 109.864 1.00 703.68 ?  -251 DT  J "C1'" 1 
ATOM 1269  N N1    . DT  A 1 62  ? 18.017  -29.385 110.506 1.00 703.68 ?  -251 DT  J N1    1 
ATOM 1270  C C2    . DT  A 1 62  ? 18.089  -28.216 109.758 1.00 703.68 ?  -251 DT  J C2    1 
ATOM 1271  O O2    . DT  A 1 62  ? 18.444  -28.168 108.591 1.00 703.68 ?  -251 DT  J O2    1 
ATOM 1272  N N3    . DT  A 1 62  ? 17.723  -27.080 110.440 1.00 703.68 ?  -251 DT  J N3    1 
ATOM 1273  C C4    . DT  A 1 62  ? 17.302  -26.991 111.756 1.00 703.68 ?  -251 DT  J C4    1 
ATOM 1274  O O4    . DT  A 1 62  ? 16.998  -25.914 112.258 1.00 703.68 ?  -251 DT  J O4    1 
ATOM 1275  C C5    . DT  A 1 62  ? 17.251  -28.242 112.479 1.00 703.68 ?  -251 DT  J C5    1 
ATOM 1276  C C7    . DT  A 1 62  ? 16.812  -28.292 113.915 1.00 703.68 ?  -251 DT  J C7    1 
ATOM 1277  C C6    . DT  A 1 62  ? 17.605  -29.361 111.828 1.00 703.68 ?  -251 DT  J C6    1 
ATOM 1278  P P     . DA  A 1 63  ? 21.193  -33.929 109.613 1.00 706.07 ?  -250 DA  J P     1 
ATOM 1279  O OP1   . DA  A 1 63  ? 20.755  -35.341 109.691 1.00 706.07 ?  -250 DA  J OP1   1 
ATOM 1280  O OP2   . DA  A 1 63  ? 21.766  -33.260 110.805 1.00 706.07 -1 -250 DA  J OP2   1 
ATOM 1281  O "O5'" . DA  A 1 63  ? 22.243  -33.790 108.411 1.00 706.07 ?  -250 DA  J "O5'" 1 
ATOM 1282  C "C5'" . DA  A 1 63  ? 21.831  -33.415 107.088 1.00 706.07 ?  -250 DA  J "C5'" 1 
ATOM 1283  C "C4'" . DA  A 1 63  ? 22.385  -32.055 106.676 1.00 706.07 ?  -250 DA  J "C4'" 1 
ATOM 1284  O "O4'" . DA  A 1 63  ? 21.707  -30.995 107.411 1.00 706.07 ?  -250 DA  J "O4'" 1 
ATOM 1285  C "C3'" . DA  A 1 63  ? 23.886  -31.831 106.891 1.00 706.07 ?  -250 DA  J "C3'" 1 
ATOM 1286  O "O3'" . DA  A 1 63  ? 24.437  -31.171 105.742 1.00 706.07 ?  -250 DA  J "O3'" 1 
ATOM 1287  C "C2'" . DA  A 1 63  ? 23.916  -30.946 108.137 1.00 706.07 ?  -250 DA  J "C2'" 1 
ATOM 1288  C "C1'" . DA  A 1 63  ? 22.667  -30.095 107.928 1.00 706.07 ?  -250 DA  J "C1'" 1 
ATOM 1289  N N9    . DA  A 1 63  ? 22.142  -29.461 109.138 1.00 706.07 ?  -250 DA  J N9    1 
ATOM 1290  C C8    . DA  A 1 63  ? 21.839  -30.066 110.328 1.00 706.07 ?  -250 DA  J C8    1 
ATOM 1291  N N7    . DA  A 1 63  ? 21.377  -29.245 111.242 1.00 706.07 ?  -250 DA  J N7    1 
ATOM 1292  C C5    . DA  A 1 63  ? 21.378  -28.009 110.613 1.00 706.07 ?  -250 DA  J C5    1 
ATOM 1293  C C6    . DA  A 1 63  ? 21.003  -26.712 111.040 1.00 706.07 ?  -250 DA  J C6    1 
ATOM 1294  N N6    . DA  A 1 63  ? 20.535  -26.449 112.265 1.00 706.07 ?  -250 DA  J N6    1 
ATOM 1295  N N1    . DA  A 1 63  ? 21.125  -25.689 110.164 1.00 706.07 ?  -250 DA  J N1    1 
ATOM 1296  C C2    . DA  A 1 63  ? 21.593  -25.952 108.934 1.00 706.07 ?  -250 DA  J C2    1 
ATOM 1297  N N3    . DA  A 1 63  ? 21.974  -27.124 108.419 1.00 706.07 ?  -250 DA  J N3    1 
ATOM 1298  C C4    . DA  A 1 63  ? 21.845  -28.123 109.312 1.00 706.07 ?  -250 DA  J C4    1 
ATOM 1299  P P     . DA  A 1 64  ? 26.012  -31.097 105.424 1.00 704.62 ?  -249 DA  J P     1 
ATOM 1300  O OP1   . DA  A 1 64  ? 26.339  -32.262 104.576 1.00 704.62 ?  -249 DA  J OP1   1 
ATOM 1301  O OP2   . DA  A 1 64  ? 26.762  -30.866 106.680 1.00 704.62 -1 -249 DA  J OP2   1 
ATOM 1302  O "O5'" . DA  A 1 64  ? 26.155  -29.776 104.528 1.00 704.62 ?  -249 DA  J "O5'" 1 
ATOM 1303  C "C5'" . DA  A 1 64  ? 25.087  -28.831 104.386 1.00 704.62 ?  -249 DA  J "C5'" 1 
ATOM 1304  C "C4'" . DA  A 1 64  ? 25.376  -27.486 105.046 1.00 704.62 ?  -249 DA  J "C4'" 1 
ATOM 1305  O "O4'" . DA  A 1 64  ? 24.806  -27.446 106.383 1.00 704.62 ?  -249 DA  J "O4'" 1 
ATOM 1306  C "C3'" . DA  A 1 64  ? 26.843  -27.073 105.199 1.00 704.62 ?  -249 DA  J "C3'" 1 
ATOM 1307  O "O3'" . DA  A 1 64  ? 27.013  -25.791 104.573 1.00 704.62 ?  -249 DA  J "O3'" 1 
ATOM 1308  C "C2'" . DA  A 1 64  ? 27.054  -27.057 106.720 1.00 704.62 ?  -249 DA  J "C2'" 1 
ATOM 1309  C "C1'" . DA  A 1 64  ? 25.660  -26.666 107.195 1.00 704.62 ?  -249 DA  J "C1'" 1 
ATOM 1310  N N9    . DA  A 1 64  ? 25.341  -26.916 108.604 1.00 704.62 ?  -249 DA  J N9    1 
ATOM 1311  C C8    . DA  A 1 64  ? 25.368  -28.113 109.268 1.00 704.62 ?  -249 DA  J C8    1 
ATOM 1312  N N7    . DA  A 1 64  ? 25.018  -28.042 110.532 1.00 704.62 ?  -249 DA  J N7    1 
ATOM 1313  C C5    . DA  A 1 64  ? 24.737  -26.698 110.713 1.00 704.62 ?  -249 DA  J C5    1 
ATOM 1314  C C6    . DA  A 1 64  ? 24.309  -25.962 111.837 1.00 704.62 ?  -249 DA  J C6    1 
ATOM 1315  N N6    . DA  A 1 64  ? 24.089  -26.515 113.031 1.00 704.62 ?  -249 DA  J N6    1 
ATOM 1316  N N1    . DA  A 1 64  ? 24.119  -24.632 111.687 1.00 704.62 ?  -249 DA  J N1    1 
ATOM 1317  C C2    . DA  A 1 64  ? 24.342  -24.079 110.485 1.00 704.62 ?  -249 DA  J C2    1 
ATOM 1318  N N3    . DA  A 1 64  ? 24.747  -24.664 109.355 1.00 704.62 ?  -249 DA  J N3    1 
ATOM 1319  C C4    . DA  A 1 64  ? 24.930  -25.987 109.536 1.00 704.62 ?  -249 DA  J C4    1 
ATOM 1320  P P     . DA  A 1 65  ? 28.385  -24.963 104.599 1.00 708.82 ?  -248 DA  J P     1 
ATOM 1321  O OP1   . DA  A 1 65  ? 28.603  -24.369 103.262 1.00 708.82 ?  -248 DA  J OP1   1 
ATOM 1322  O OP2   . DA  A 1 65  ? 29.444  -25.802 105.203 1.00 708.82 -1 -248 DA  J OP2   1 
ATOM 1323  O "O5'" . DA  A 1 65  ? 28.053  -23.792 105.630 1.00 708.82 ?  -248 DA  J "O5'" 1 
ATOM 1324  C "C5'" . DA  A 1 65  ? 27.156  -22.738 105.292 1.00 708.82 ?  -248 DA  J "C5'" 1 
ATOM 1325  C "C4'" . DA  A 1 65  ? 27.185  -21.669 106.370 1.00 708.82 ?  -248 DA  J "C4'" 1 
ATOM 1326  O "O4'" . DA  A 1 65  ? 26.791  -22.233 107.646 1.00 708.82 ?  -248 DA  J "O4'" 1 
ATOM 1327  C "C3'" . DA  A 1 65  ? 28.539  -21.011 106.598 1.00 708.82 ?  -248 DA  J "C3'" 1 
ATOM 1328  O "O3'" . DA  A 1 65  ? 28.309  -19.618 106.724 1.00 708.82 ?  -248 DA  J "O3'" 1 
ATOM 1329  C "C2'" . DA  A 1 65  ? 29.069  -21.670 107.872 1.00 708.82 ?  -248 DA  J "C2'" 1 
ATOM 1330  C "C1'" . DA  A 1 65  ? 27.792  -22.034 108.623 1.00 708.82 ?  -248 DA  J "C1'" 1 
ATOM 1331  N N9    . DA  A 1 65  ? 27.864  -23.261 109.416 1.00 708.82 ?  -248 DA  J N9    1 
ATOM 1332  C C8    . DA  A 1 65  ? 28.233  -24.502 108.978 1.00 708.82 ?  -248 DA  J C8    1 
ATOM 1333  N N7    . DA  A 1 65  ? 28.199  -25.430 109.900 1.00 708.82 ?  -248 DA  J N7    1 
ATOM 1334  C C5    . DA  A 1 65  ? 27.777  -24.757 111.028 1.00 708.82 ?  -248 DA  J C5    1 
ATOM 1335  C C6    . DA  A 1 65  ? 27.539  -25.185 112.352 1.00 708.82 ?  -248 DA  J C6    1 
ATOM 1336  N N6    . DA  A 1 65  ? 27.706  -26.450 112.753 1.00 708.82 ?  -248 DA  J N6    1 
ATOM 1337  N N1    . DA  A 1 65  ? 27.117  -24.263 113.246 1.00 708.82 ?  -248 DA  J N1    1 
ATOM 1338  C C2    . DA  A 1 65  ? 26.950  -22.996 112.835 1.00 708.82 ?  -248 DA  J C2    1 
ATOM 1339  N N3    . DA  A 1 65  ? 27.144  -22.474 111.621 1.00 708.82 ?  -248 DA  J N3    1 
ATOM 1340  C C4    . DA  A 1 65  ? 27.564  -23.416 110.752 1.00 708.82 ?  -248 DA  J C4    1 
ATOM 1341  P P     . DA  A 1 66  ? 29.487  -18.570 106.978 1.00 717.39 ?  -247 DA  J P     1 
ATOM 1342  O OP1   . DA  A 1 66  ? 29.006  -17.231 106.580 1.00 717.39 ?  -247 DA  J OP1   1 
ATOM 1343  O OP2   . DA  A 1 66  ? 30.740  -19.097 106.396 1.00 717.39 -1 -247 DA  J OP2   1 
ATOM 1344  O "O5'" . DA  A 1 66  ? 29.608  -18.614 108.569 1.00 717.39 ?  -247 DA  J "O5'" 1 
ATOM 1345  C "C5'" . DA  A 1 66  ? 28.454  -18.343 109.358 1.00 717.39 ?  -247 DA  J "C5'" 1 
ATOM 1346  C "C4'" . DA  A 1 66  ? 28.743  -18.400 110.846 1.00 717.39 ?  -247 DA  J "C4'" 1 
ATOM 1347  O "O4'" . DA  A 1 66  ? 28.761  -19.780 111.280 1.00 717.39 ?  -247 DA  J "O4'" 1 
ATOM 1348  C "C3'" . DA  A 1 66  ? 30.068  -17.776 111.276 1.00 717.39 ?  -247 DA  J "C3'" 1 
ATOM 1349  O "O3'" . DA  A 1 66  ? 29.789  -16.772 112.238 1.00 717.39 ?  -247 DA  J "O3'" 1 
ATOM 1350  C "C2'" . DA  A 1 66  ? 30.856  -18.935 111.876 1.00 717.39 ?  -247 DA  J "C2'" 1 
ATOM 1351  C "C1'" . DA  A 1 66  ? 29.756  -19.915 112.266 1.00 717.39 ?  -247 DA  J "C1'" 1 
ATOM 1352  N N9    . DA  A 1 66  ? 30.188  -21.307 112.282 1.00 717.39 ?  -247 DA  J N9    1 
ATOM 1353  C C8    . DA  A 1 66  ? 30.704  -22.022 111.239 1.00 717.39 ?  -247 DA  J C8    1 
ATOM 1354  N N7    . DA  A 1 66  ? 31.008  -23.260 111.541 1.00 717.39 ?  -247 DA  J N7    1 
ATOM 1355  C C5    . DA  A 1 66  ? 30.666  -23.366 112.873 1.00 717.39 ?  -247 DA  J C5    1 
ATOM 1356  C C6    . DA  A 1 66  ? 30.747  -24.432 113.791 1.00 717.39 ?  -247 DA  J C6    1 
ATOM 1357  N N6    . DA  A 1 66  ? 31.219  -25.639 113.470 1.00 717.39 ?  -247 DA  J N6    1 
ATOM 1358  N N1    . DA  A 1 66  ? 30.324  -24.213 115.055 1.00 717.39 ?  -247 DA  J N1    1 
ATOM 1359  C C2    . DA  A 1 66  ? 29.851  -22.999 115.371 1.00 717.39 ?  -247 DA  J C2    1 
ATOM 1360  N N3    . DA  A 1 66  ? 29.728  -21.920 114.593 1.00 717.39 ?  -247 DA  J N3    1 
ATOM 1361  C C4    . DA  A 1 66  ? 30.159  -22.171 113.346 1.00 717.39 ?  -247 DA  J C4    1 
ATOM 1362  P P     . DC  A 1 67  ? 30.673  -15.444 112.385 1.00 714.52 ?  -246 DC  J P     1 
ATOM 1363  O OP1   . DC  A 1 67  ? 29.762  -14.290 112.235 1.00 714.52 ?  -246 DC  J OP1   1 
ATOM 1364  O OP2   . DC  A 1 67  ? 31.882  -15.546 111.535 1.00 714.52 -1 -246 DC  J OP2   1 
ATOM 1365  O "O5'" . DC  A 1 67  ? 31.147  -15.516 113.910 1.00 714.52 ?  -246 DC  J "O5'" 1 
ATOM 1366  C "C5'" . DC  A 1 67  ? 30.460  -16.363 114.832 1.00 714.52 ?  -246 DC  J "C5'" 1 
ATOM 1367  C "C4'" . DC  A 1 67  ? 31.415  -17.159 115.706 1.00 714.52 ?  -246 DC  J "C4'" 1 
ATOM 1368  O "O4'" . DC  A 1 67  ? 31.551  -18.510 115.214 1.00 714.52 ?  -246 DC  J "O4'" 1 
ATOM 1369  C "C3'" . DC  A 1 67  ? 32.846  -16.630 115.797 1.00 714.52 ?  -246 DC  J "C3'" 1 
ATOM 1370  O "O3'" . DC  A 1 67  ? 32.940  -15.832 116.983 1.00 714.52 ?  -246 DC  J "O3'" 1 
ATOM 1371  C "C2'" . DC  A 1 67  ? 33.717  -17.897 115.815 1.00 714.52 ?  -246 DC  J "C2'" 1 
ATOM 1372  C "C1'" . DC  A 1 67  ? 32.698  -19.036 115.844 1.00 714.52 ?  -246 DC  J "C1'" 1 
ATOM 1373  N N1    . DC  A 1 67  ? 33.080  -20.319 115.156 1.00 714.52 ?  -246 DC  J N1    1 
ATOM 1374  C C2    . DC  A 1 67  ? 32.990  -21.544 115.851 1.00 714.52 ?  -246 DC  J C2    1 
ATOM 1375  O O2    . DC  A 1 67  ? 32.609  -21.577 117.028 1.00 714.52 ?  -246 DC  J O2    1 
ATOM 1376  N N3    . DC  A 1 67  ? 33.326  -22.690 115.209 1.00 714.52 ?  -246 DC  J N3    1 
ATOM 1377  C C4    . DC  A 1 67  ? 33.737  -22.657 113.941 1.00 714.52 ?  -246 DC  J C4    1 
ATOM 1378  N N4    . DC  A 1 67  ? 34.052  -23.822 113.371 1.00 714.52 ?  -246 DC  J N4    1 
ATOM 1379  C C5    . DC  A 1 67  ? 33.834  -21.429 113.211 1.00 714.52 ?  -246 DC  J C5    1 
ATOM 1380  C C6    . DC  A 1 67  ? 33.499  -20.301 113.851 1.00 714.52 ?  -246 DC  J C6    1 
ATOM 1381  P P     . DG  A 1 68  ? 34.264  -15.059 117.449 1.00 721.81 ?  -245 DG  J P     1 
ATOM 1382  O OP1   . DG  A 1 68  ? 33.823  -13.859 118.187 1.00 721.81 ?  -245 DG  J OP1   1 
ATOM 1383  O OP2   . DG  A 1 68  ? 35.171  -14.910 116.289 1.00 721.81 -1 -245 DG  J OP2   1 
ATOM 1384  O "O5'" . DG  A 1 68  ? 34.921  -16.082 118.493 1.00 721.81 ?  -245 DG  J "O5'" 1 
ATOM 1385  C "C5'" . DG  A 1 68  ? 34.107  -16.858 119.389 1.00 721.81 ?  -245 DG  J "C5'" 1 
ATOM 1386  C "C4'" . DG  A 1 68  ? 34.877  -18.035 119.975 1.00 721.81 ?  -245 DG  J "C4'" 1 
ATOM 1387  O "O4'" . DG  A 1 68  ? 34.903  -19.148 119.038 1.00 721.81 ?  -245 DG  J "O4'" 1 
ATOM 1388  C "C3'" . DG  A 1 68  ? 36.333  -17.739 120.345 1.00 721.81 ?  -245 DG  J "C3'" 1 
ATOM 1389  O "O3'" . DG  A 1 68  ? 36.569  -18.095 121.723 1.00 721.81 ?  -245 DG  J "O3'" 1 
ATOM 1390  C "C2'" . DG  A 1 68  ? 37.144  -18.556 119.333 1.00 721.81 ?  -245 DG  J "C2'" 1 
ATOM 1391  C "C1'" . DG  A 1 68  ? 36.204  -19.707 119.004 1.00 721.81 ?  -245 DG  J "C1'" 1 
ATOM 1392  N N9    . DG  A 1 68  ? 36.453  -20.300 117.687 1.00 721.81 ?  -245 DG  J N9    1 
ATOM 1393  C C8    . DG  A 1 68  ? 36.635  -19.627 116.500 1.00 721.81 ?  -245 DG  J C8    1 
ATOM 1394  N N7    . DG  A 1 68  ? 36.836  -20.405 115.475 1.00 721.81 ?  -245 DG  J N7    1 
ATOM 1395  C C5    . DG  A 1 68  ? 36.788  -21.686 116.011 1.00 721.81 ?  -245 DG  J C5    1 
ATOM 1396  C C6    . DG  A 1 68  ? 36.939  -22.944 115.374 1.00 721.81 ?  -245 DG  J C6    1 
ATOM 1397  O O6    . DG  A 1 68  ? 37.152  -23.169 114.177 1.00 721.81 ?  -245 DG  J O6    1 
ATOM 1398  N N1    . DG  A 1 68  ? 36.820  -24.007 116.271 1.00 721.81 ?  -245 DG  J N1    1 
ATOM 1399  C C2    . DG  A 1 68  ? 36.585  -23.867 117.623 1.00 721.81 ?  -245 DG  J C2    1 
ATOM 1400  N N2    . DG  A 1 68  ? 36.500  -25.005 118.331 1.00 721.81 ?  -245 DG  J N2    1 
ATOM 1401  N N3    . DG  A 1 68  ? 36.441  -22.691 118.234 1.00 721.81 ?  -245 DG  J N3    1 
ATOM 1402  C C4    . DG  A 1 68  ? 36.554  -21.642 117.373 1.00 721.81 ?  -245 DG  J C4    1 
ATOM 1403  P P     . DC  A 1 69  ? 38.035  -18.279 122.371 1.00 735.22 ?  -244 DC  J P     1 
ATOM 1404  O OP1   . DC  A 1 69  ? 37.908  -18.083 123.831 1.00 735.22 ?  -244 DC  J OP1   1 
ATOM 1405  O OP2   . DC  A 1 69  ? 39.046  -17.482 121.627 1.00 735.22 -1 -244 DC  J OP2   1 
ATOM 1406  O "O5'" . DC  A 1 69  ? 38.292  -19.835 122.065 1.00 735.22 ?  -244 DC  J "O5'" 1 
ATOM 1407  C "C5'" . DC  A 1 69  ? 37.962  -20.863 123.005 1.00 735.22 ?  -244 DC  J "C5'" 1 
ATOM 1408  C "C4'" . DC  A 1 69  ? 39.077  -21.897 123.016 1.00 735.22 ?  -244 DC  J "C4'" 1 
ATOM 1409  O "O4'" . DC  A 1 69  ? 39.233  -22.465 121.686 1.00 735.22 ?  -244 DC  J "O4'" 1 
ATOM 1410  C "C3'" . DC  A 1 69  ? 40.449  -21.359 123.412 1.00 735.22 ?  -244 DC  J "C3'" 1 
ATOM 1411  O "O3'" . DC  A 1 69  ? 41.123  -22.328 124.210 1.00 735.22 ?  -244 DC  J "O3'" 1 
ATOM 1412  C "C2'" . DC  A 1 69  ? 41.152  -21.128 122.074 1.00 735.22 ?  -244 DC  J "C2'" 1 
ATOM 1413  C "C1'" . DC  A 1 69  ? 40.513  -22.165 121.152 1.00 735.22 ?  -244 DC  J "C1'" 1 
ATOM 1414  N N1    . DC  A 1 69  ? 40.360  -21.705 119.719 1.00 735.22 ?  -244 DC  J N1    1 
ATOM 1415  C C2    . DC  A 1 69  ? 40.163  -22.649 118.694 1.00 735.22 ?  -244 DC  J C2    1 
ATOM 1416  O O2    . DC  A 1 69  ? 40.115  -23.853 118.967 1.00 735.22 ?  -244 DC  J O2    1 
ATOM 1417  N N3    . DC  A 1 69  ? 40.027  -22.209 117.415 1.00 735.22 ?  -244 DC  J N3    1 
ATOM 1418  C C4    . DC  A 1 69  ? 40.083  -20.901 117.142 1.00 735.22 ?  -244 DC  J C4    1 
ATOM 1419  N N4    . DC  A 1 69  ? 39.943  -20.521 115.870 1.00 735.22 ?  -244 DC  J N4    1 
ATOM 1420  C C5    . DC  A 1 69  ? 40.283  -19.923 118.161 1.00 735.22 ?  -244 DC  J C5    1 
ATOM 1421  C C6    . DC  A 1 69  ? 40.412  -20.366 119.419 1.00 735.22 ?  -244 DC  J C6    1 
ATOM 1422  P P     . DG  A 1 70  ? 42.565  -22.066 124.869 1.00 740.94 ?  -243 DG  J P     1 
ATOM 1423  O OP1   . DG  A 1 70  ? 42.311  -21.603 126.251 1.00 740.94 ?  -243 DG  J OP1   1 
ATOM 1424  O OP2   . DG  A 1 70  ? 43.422  -21.245 123.976 1.00 740.94 -1 -243 DG  J OP2   1 
ATOM 1425  O "O5'" . DG  A 1 70  ? 43.182  -23.549 124.905 1.00 740.94 ?  -243 DG  J "O5'" 1 
ATOM 1426  C "C5'" . DG  A 1 70  ? 42.757  -24.584 123.993 1.00 740.94 ?  -243 DG  J "C5'" 1 
ATOM 1427  C "C4'" . DG  A 1 70  ? 43.848  -24.990 123.006 1.00 740.94 ?  -243 DG  J "C4'" 1 
ATOM 1428  O "O4'" . DG  A 1 70  ? 43.541  -24.480 121.679 1.00 740.94 ?  -243 DG  J "O4'" 1 
ATOM 1429  C "C3'" . DG  A 1 70  ? 45.262  -24.501 123.320 1.00 740.94 ?  -243 DG  J "C3'" 1 
ATOM 1430  O "O3'" . DG  A 1 70  ? 46.200  -25.533 123.036 1.00 740.94 ?  -243 DG  J "O3'" 1 
ATOM 1431  C "C2'" . DG  A 1 70  ? 45.441  -23.314 122.376 1.00 740.94 ?  -243 DG  J "C2'" 1 
ATOM 1432  C "C1'" . DG  A 1 70  ? 44.700  -23.854 121.159 1.00 740.94 ?  -243 DG  J "C1'" 1 
ATOM 1433  N N9    . DG  A 1 70  ? 44.320  -22.865 120.148 1.00 740.94 ?  -243 DG  J N9    1 
ATOM 1434  C C8    . DG  A 1 70  ? 43.945  -21.554 120.335 1.00 740.94 ?  -243 DG  J C8    1 
ATOM 1435  N N7    . DG  A 1 70  ? 43.665  -20.926 119.227 1.00 740.94 ?  -243 DG  J N7    1 
ATOM 1436  C C5    . DG  A 1 70  ? 43.869  -21.881 118.237 1.00 740.94 ?  -243 DG  J C5    1 
ATOM 1437  C C6    . DG  A 1 70  ? 43.729  -21.789 116.828 1.00 740.94 ?  -243 DG  J C6    1 
ATOM 1438  O O6    . DG  A 1 70  ? 43.378  -20.806 116.160 1.00 740.94 ?  -243 DG  J O6    1 
ATOM 1439  N N1    . DG  A 1 70  ? 44.041  -22.991 116.185 1.00 740.94 ?  -243 DG  J N1    1 
ATOM 1440  C C2    . DG  A 1 70  ? 44.439  -24.146 116.828 1.00 740.94 ?  -243 DG  J C2    1 
ATOM 1441  N N2    . DG  A 1 70  ? 44.698  -25.213 116.053 1.00 740.94 ?  -243 DG  J N2    1 
ATOM 1442  N N3    . DG  A 1 70  ? 44.575  -24.244 118.149 1.00 740.94 ?  -243 DG  J N3    1 
ATOM 1443  C C4    . DG  A 1 70  ? 44.276  -23.079 118.788 1.00 740.94 ?  -243 DG  J C4    1 
ATOM 1444  P P     . DG  A 1 71  ? 47.540  -25.646 123.904 1.00 734.52 ?  -242 DG  J P     1 
ATOM 1445  O OP1   . DG  A 1 71  ? 47.141  -26.315 125.160 1.00 734.52 ?  -242 DG  J OP1   1 
ATOM 1446  O OP2   . DG  A 1 71  ? 48.192  -24.315 123.944 1.00 734.52 -1 -242 DG  J OP2   1 
ATOM 1447  O "O5'" . DG  A 1 71  ? 48.506  -26.613 123.065 1.00 734.52 ?  -242 DG  J "O5'" 1 
ATOM 1448  C "C5'" . DG  A 1 71  ? 48.021  -27.442 122.004 1.00 734.52 ?  -242 DG  J "C5'" 1 
ATOM 1449  C "C4'" . DG  A 1 71  ? 48.685  -27.129 120.668 1.00 734.52 ?  -242 DG  J "C4'" 1 
ATOM 1450  O "O4'" . DG  A 1 71  ? 48.045  -25.986 120.047 1.00 734.52 ?  -242 DG  J "O4'" 1 
ATOM 1451  C "C3'" . DG  A 1 71  ? 50.181  -26.808 120.693 1.00 734.52 ?  -242 DG  J "C3'" 1 
ATOM 1452  O "O3'" . DG  A 1 71  ? 50.832  -27.518 119.646 1.00 734.52 ?  -242 DG  J "O3'" 1 
ATOM 1453  C "C2'" . DG  A 1 71  ? 50.226  -25.305 120.436 1.00 734.52 ?  -242 DG  J "C2'" 1 
ATOM 1454  C "C1'" . DG  A 1 71  ? 49.053  -25.189 119.473 1.00 734.52 ?  -242 DG  J "C1'" 1 
ATOM 1455  N N9    . DG  A 1 71  ? 48.503  -23.855 119.276 1.00 734.52 ?  -242 DG  J N9    1 
ATOM 1456  C C8    . DG  A 1 71  ? 48.365  -22.844 120.197 1.00 734.52 ?  -242 DG  J C8    1 
ATOM 1457  N N7    . DG  A 1 71  ? 47.825  -21.763 119.703 1.00 734.52 ?  -242 DG  J N7    1 
ATOM 1458  C C5    . DG  A 1 71  ? 47.586  -22.078 118.371 1.00 734.52 ?  -242 DG  J C5    1 
ATOM 1459  C C6    . DG  A 1 71  ? 47.014  -21.306 117.327 1.00 734.52 ?  -242 DG  J C6    1 
ATOM 1460  O O6    . DG  A 1 71  ? 46.590  -20.145 117.374 1.00 734.52 ?  -242 DG  J O6    1 
ATOM 1461  N N1    . DG  A 1 71  ? 46.958  -22.009 116.123 1.00 734.52 ?  -242 DG  J N1    1 
ATOM 1462  C C2    . DG  A 1 71  ? 47.402  -23.302 115.950 1.00 734.52 ?  -242 DG  J C2    1 
ATOM 1463  N N2    . DG  A 1 71  ? 47.267  -23.830 114.726 1.00 734.52 ?  -242 DG  J N2    1 
ATOM 1464  N N3    . DG  A 1 71  ? 47.935  -24.036 116.919 1.00 734.52 ?  -242 DG  J N3    1 
ATOM 1465  C C4    . DG  A 1 71  ? 47.998  -23.366 118.097 1.00 734.52 ?  -242 DG  J C4    1 
ATOM 1466  P P     . DG  A 1 72  ? 51.319  -29.025 119.865 1.00 718.34 ?  -241 DG  J P     1 
ATOM 1467  O OP1   . DG  A 1 72  ? 50.182  -29.816 120.396 1.00 718.34 ?  -241 DG  J OP1   1 
ATOM 1468  O OP2   . DG  A 1 72  ? 52.600  -28.973 120.606 1.00 718.34 -1 -241 DG  J OP2   1 
ATOM 1469  O "O5'" . DG  A 1 72  ? 51.653  -29.521 118.382 1.00 718.34 ?  -241 DG  J "O5'" 1 
ATOM 1470  C "C5'" . DG  A 1 72  ? 50.617  -29.764 117.432 1.00 718.34 ?  -241 DG  J "C5'" 1 
ATOM 1471  C "C4'" . DG  A 1 72  ? 50.945  -29.154 116.073 1.00 718.34 ?  -241 DG  J "C4'" 1 
ATOM 1472  O "O4'" . DG  A 1 72  ? 50.697  -27.725 116.105 1.00 718.34 ?  -241 DG  J "O4'" 1 
ATOM 1473  C "C3'" . DG  A 1 72  ? 52.381  -29.301 115.567 1.00 718.34 ?  -241 DG  J "C3'" 1 
ATOM 1474  O "O3'" . DG  A 1 72  ? 52.334  -29.502 114.163 1.00 718.34 ?  -241 DG  J "O3'" 1 
ATOM 1475  C "C2'" . DG  A 1 72  ? 53.013  -27.952 115.895 1.00 718.34 ?  -241 DG  J "C2'" 1 
ATOM 1476  C "C1'" . DG  A 1 72  ? 51.826  -27.049 115.588 1.00 718.34 ?  -241 DG  J "C1'" 1 
ATOM 1477  N N9    . DG  A 1 72  ? 51.820  -25.740 116.220 1.00 718.34 ?  -241 DG  J N9    1 
ATOM 1478  C C8    . DG  A 1 72  ? 52.301  -25.404 117.461 1.00 718.34 ?  -241 DG  J C8    1 
ATOM 1479  N N7    . DG  A 1 72  ? 52.132  -24.143 117.752 1.00 718.34 ?  -241 DG  J N7    1 
ATOM 1480  C C5    . DG  A 1 72  ? 51.490  -23.614 116.638 1.00 718.34 ?  -241 DG  J C5    1 
ATOM 1481  C C6    . DG  A 1 72  ? 51.049  -22.294 116.375 1.00 718.34 ?  -241 DG  J C6    1 
ATOM 1482  O O6    . DG  A 1 72  ? 51.139  -21.297 117.104 1.00 718.34 ?  -241 DG  J O6    1 
ATOM 1483  N N1    . DG  A 1 72  ? 50.444  -22.181 115.122 1.00 718.34 ?  -241 DG  J N1    1 
ATOM 1484  C C2    . DG  A 1 72  ? 50.287  -23.222 114.230 1.00 718.34 ?  -241 DG  J C2    1 
ATOM 1485  N N2    . DG  A 1 72  ? 49.681  -22.932 113.068 1.00 718.34 ?  -241 DG  J N2    1 
ATOM 1486  N N3    . DG  A 1 72  ? 50.695  -24.465 114.469 1.00 718.34 ?  -241 DG  J N3    1 
ATOM 1487  C C4    . DG  A 1 72  ? 51.287  -24.588 115.686 1.00 718.34 ?  -241 DG  J C4    1 
ATOM 1488  P P     . DG  A 1 73  ? 53.118  -30.700 113.438 1.00 708.43 ?  -240 DG  J P     1 
ATOM 1489  O OP1   . DG  A 1 73  ? 52.184  -31.848 113.325 1.00 708.43 ?  -240 DG  J OP1   1 
ATOM 1490  O OP2   . DG  A 1 73  ? 54.449  -30.869 114.074 1.00 708.43 -1 -240 DG  J OP2   1 
ATOM 1491  O "O5'" . DG  A 1 73  ? 53.380  -30.105 111.976 1.00 708.43 ?  -240 DG  J "O5'" 1 
ATOM 1492  C "C5'" . DG  A 1 73  ? 52.379  -29.341 111.318 1.00 708.43 ?  -240 DG  J "C5'" 1 
ATOM 1493  C "C4'" . DG  A 1 73  ? 52.995  -28.184 110.554 1.00 708.43 ?  -240 DG  J "C4'" 1 
ATOM 1494  O "O4'" . DG  A 1 73  ? 53.094  -27.031 111.421 1.00 708.43 ?  -240 DG  J "O4'" 1 
ATOM 1495  C "C3'" . DG  A 1 73  ? 54.394  -28.424 109.978 1.00 708.43 ?  -240 DG  J "C3'" 1 
ATOM 1496  O "O3'" . DG  A 1 73  ? 54.472  -27.915 108.651 1.00 708.43 ?  -240 DG  J "O3'" 1 
ATOM 1497  C "C2'" . DG  A 1 73  ? 55.306  -27.624 110.905 1.00 708.43 ?  -240 DG  J "C2'" 1 
ATOM 1498  C "C1'" . DG  A 1 73  ? 54.385  -26.475 111.296 1.00 708.43 ?  -240 DG  J "C1'" 1 
ATOM 1499  N N9    . DG  A 1 73  ? 54.671  -25.848 112.575 1.00 708.43 ?  -240 DG  J N9    1 
ATOM 1500  C C8    . DG  A 1 73  ? 55.370  -26.370 113.637 1.00 708.43 ?  -240 DG  J C8    1 
ATOM 1501  N N7    . DG  A 1 73  ? 55.442  -25.556 114.654 1.00 708.43 ?  -240 DG  J N7    1 
ATOM 1502  C C5    . DG  A 1 73  ? 54.741  -24.431 114.243 1.00 708.43 ?  -240 DG  J C5    1 
ATOM 1503  C C6    . DG  A 1 73  ? 54.476  -23.217 114.922 1.00 708.43 ?  -240 DG  J C6    1 
ATOM 1504  O O6    . DG  A 1 73  ? 54.828  -22.889 116.065 1.00 708.43 ?  -240 DG  J O6    1 
ATOM 1505  N N1    . DG  A 1 73  ? 53.722  -22.337 114.138 1.00 708.43 ?  -240 DG  J N1    1 
ATOM 1506  C C2    . DG  A 1 73  ? 53.283  -22.602 112.861 1.00 708.43 ?  -240 DG  J C2    1 
ATOM 1507  N N2    . DG  A 1 73  ? 52.569  -21.646 112.253 1.00 708.43 ?  -240 DG  J N2    1 
ATOM 1508  N N3    . DG  A 1 73  ? 53.525  -23.737 112.218 1.00 708.43 ?  -240 DG  J N3    1 
ATOM 1509  C C4    . DG  A 1 73  ? 54.255  -24.601 112.965 1.00 708.43 ?  -240 DG  J C4    1 
ATOM 1510  P P     . DG  A 1 74  ? 53.757  -28.610 107.396 1.00 712.04 ?  -239 DG  J P     1 
ATOM 1511  O OP1   . DG  A 1 74  ? 52.397  -29.076 107.751 1.00 712.04 ?  -239 DG  J OP1   1 
ATOM 1512  O OP2   . DG  A 1 74  ? 54.735  -29.558 106.816 1.00 712.04 -1 -239 DG  J OP2   1 
ATOM 1513  O "O5'" . DG  A 1 74  ? 53.602  -27.360 106.409 1.00 712.04 ?  -239 DG  J "O5'" 1 
ATOM 1514  C "C5'" . DG  A 1 74  ? 52.595  -26.370 106.633 1.00 712.04 ?  -239 DG  J "C5'" 1 
ATOM 1515  C "C4'" . DG  A 1 74  ? 53.159  -24.956 106.586 1.00 712.04 ?  -239 DG  J "C4'" 1 
ATOM 1516  O "O4'" . DG  A 1 74  ? 53.797  -24.637 107.851 1.00 712.04 ?  -239 DG  J "O4'" 1 
ATOM 1517  C "C3'" . DG  A 1 74  ? 54.207  -24.682 105.503 1.00 712.04 ?  -239 DG  J "C3'" 1 
ATOM 1518  O "O3'" . DG  A 1 74  ? 53.738  -23.628 104.651 1.00 712.04 ?  -239 DG  J "O3'" 1 
ATOM 1519  C "C2'" . DG  A 1 74  ? 55.461  -24.314 106.302 1.00 712.04 ?  -239 DG  J "C2'" 1 
ATOM 1520  C "C1'" . DG  A 1 74  ? 54.848  -23.744 107.572 1.00 712.04 ?  -239 DG  J "C1'" 1 
ATOM 1521  N N9    . DG  A 1 74  ? 55.732  -23.668 108.733 1.00 712.04 ?  -239 DG  J N9    1 
ATOM 1522  C C8    . DG  A 1 74  ? 56.670  -24.585 109.146 1.00 712.04 ?  -239 DG  J C8    1 
ATOM 1523  N N7    . DG  A 1 74  ? 57.306  -24.234 110.230 1.00 712.04 ?  -239 DG  J N7    1 
ATOM 1524  C C5    . DG  A 1 74  ? 56.753  -23.007 110.559 1.00 712.04 ?  -239 DG  J C5    1 
ATOM 1525  C C6    . DG  A 1 74  ? 57.040  -22.139 111.638 1.00 712.04 ?  -239 DG  J C6    1 
ATOM 1526  O O6    . DG  A 1 74  ? 57.870  -22.299 112.540 1.00 712.04 ?  -239 DG  J O6    1 
ATOM 1527  N N1    . DG  A 1 74  ? 56.257  -20.986 111.613 1.00 712.04 ?  -239 DG  J N1    1 
ATOM 1528  C C2    . DG  A 1 74  ? 55.308  -20.709 110.657 1.00 712.04 ?  -239 DG  J C2    1 
ATOM 1529  N N2    . DG  A 1 74  ? 54.649  -19.553 110.793 1.00 712.04 ?  -239 DG  J N2    1 
ATOM 1530  N N3    . DG  A 1 74  ? 55.026  -21.514 109.639 1.00 712.04 ?  -239 DG  J N3    1 
ATOM 1531  C C4    . DG  A 1 74  ? 55.783  -22.642 109.651 1.00 712.04 ?  -239 DG  J C4    1 
ATOM 1532  P P     . DA  A 1 75  ? 54.506  -23.109 103.333 1.00 707.32 ?  -238 DA  J P     1 
ATOM 1533  O OP1   . DA  A 1 75  ? 53.532  -23.124 102.221 1.00 707.32 ?  -238 DA  J OP1   1 
ATOM 1534  O OP2   . DA  A 1 75  ? 55.817  -23.776 103.152 1.00 707.32 -1 -238 DA  J OP2   1 
ATOM 1535  O "O5'" . DA  A 1 75  ? 54.748  -21.592 103.754 1.00 707.32 ?  -238 DA  J "O5'" 1 
ATOM 1536  C "C5'" . DA  A 1 75  ? 53.655  -20.870 104.334 1.00 707.32 ?  -238 DA  J "C5'" 1 
ATOM 1537  C "C4'" . DA  A 1 75  ? 54.059  -19.479 104.794 1.00 707.32 ?  -238 DA  J "C4'" 1 
ATOM 1538  O "O4'" . DA  A 1 75  ? 54.774  -19.555 106.054 1.00 707.32 ?  -238 DA  J "O4'" 1 
ATOM 1539  C "C3'" . DA  A 1 75  ? 54.979  -18.728 103.844 1.00 707.32 ?  -238 DA  J "C3'" 1 
ATOM 1540  O "O3'" . DA  A 1 75  ? 54.633  -17.362 103.898 1.00 707.32 ?  -238 DA  J "O3'" 1 
ATOM 1541  C "C2'" . DA  A 1 75  ? 56.376  -18.988 104.402 1.00 707.32 ?  -238 DA  J "C2'" 1 
ATOM 1542  C "C1'" . DA  A 1 75  ? 56.091  -19.063 105.899 1.00 707.32 ?  -238 DA  J "C1'" 1 
ATOM 1543  N N9    . DA  A 1 75  ? 56.956  -19.965 106.641 1.00 707.32 ?  -238 DA  J N9    1 
ATOM 1544  C C8    . DA  A 1 75  ? 57.313  -21.242 106.313 1.00 707.32 ?  -238 DA  J C8    1 
ATOM 1545  N N7    . DA  A 1 75  ? 58.102  -21.817 107.189 1.00 707.32 ?  -238 DA  J N7    1 
ATOM 1546  C C5    . DA  A 1 75  ? 58.261  -20.844 108.156 1.00 707.32 ?  -238 DA  J C5    1 
ATOM 1547  C C6    . DA  A 1 75  ? 58.988  -20.816 109.354 1.00 707.32 ?  -238 DA  J C6    1 
ATOM 1548  N N6    . DA  A 1 75  ? 59.701  -21.857 109.777 1.00 707.32 ?  -238 DA  J N6    1 
ATOM 1549  N N1    . DA  A 1 75  ? 58.948  -19.691 110.102 1.00 707.32 ?  -238 DA  J N1    1 
ATOM 1550  C C2    . DA  A 1 75  ? 58.222  -18.651 109.670 1.00 707.32 ?  -238 DA  J C2    1 
ATOM 1551  N N3    . DA  A 1 75  ? 57.498  -18.556 108.555 1.00 707.32 ?  -238 DA  J N3    1 
ATOM 1552  C C4    . DA  A 1 75  ? 57.562  -19.695 107.838 1.00 707.32 ?  -238 DA  J C4    1 
ATOM 1553  P P     . DC  A 1 76  ? 55.211  -16.359 102.801 1.00 698.86 ?  -237 DC  J P     1 
ATOM 1554  O OP1   . DC  A 1 76  ? 54.191  -15.302 102.621 1.00 698.86 ?  -237 DC  J OP1   1 
ATOM 1555  O OP2   . DC  A 1 76  ? 55.723  -17.151 101.662 1.00 698.86 -1 -237 DC  J OP2   1 
ATOM 1556  O "O5'" . DC  A 1 76  ? 56.483  -15.704 103.503 1.00 698.86 ?  -237 DC  J "O5'" 1 
ATOM 1557  C "C5'" . DC  A 1 76  ? 56.329  -14.866 104.643 1.00 698.86 ?  -237 DC  J "C5'" 1 
ATOM 1558  C "C4'" . DC  A 1 76  ? 57.651  -14.786 105.368 1.00 698.86 ?  -237 DC  J "C4'" 1 
ATOM 1559  O "O4'" . DC  A 1 76  ? 58.026  -16.109 105.829 1.00 698.86 ?  -237 DC  J "O4'" 1 
ATOM 1560  C "C3'" . DC  A 1 76  ? 58.791  -14.298 104.478 1.00 698.86 ?  -237 DC  J "C3'" 1 
ATOM 1561  O "O3'" . DC  A 1 76  ? 59.429  -13.197 105.097 1.00 698.86 ?  -237 DC  J "O3'" 1 
ATOM 1562  C "C2'" . DC  A 1 76  ? 59.714  -15.509 104.376 1.00 698.86 ?  -237 DC  J "C2'" 1 
ATOM 1563  C "C1'" . DC  A 1 76  ? 59.429  -16.177 105.717 1.00 698.86 ?  -237 DC  J "C1'" 1 
ATOM 1564  N N1    . DC  A 1 76  ? 59.910  -17.589 105.872 1.00 698.86 ?  -237 DC  J N1    1 
ATOM 1565  C C2    . DC  A 1 76  ? 60.501  -17.985 107.083 1.00 698.86 ?  -237 DC  J C2    1 
ATOM 1566  O O2    . DC  A 1 76  ? 60.613  -17.173 108.009 1.00 698.86 ?  -237 DC  J O2    1 
ATOM 1567  N N3    . DC  A 1 76  ? 60.938  -19.263 107.216 1.00 698.86 ?  -237 DC  J N3    1 
ATOM 1568  C C4    . DC  A 1 76  ? 60.807  -20.123 106.205 1.00 698.86 ?  -237 DC  J C4    1 
ATOM 1569  N N4    . DC  A 1 76  ? 61.250  -21.370 106.387 1.00 698.86 ?  -237 DC  J N4    1 
ATOM 1570  C C5    . DC  A 1 76  ? 60.208  -19.741 104.966 1.00 698.86 ?  -237 DC  J C5    1 
ATOM 1571  C C6    . DC  A 1 76  ? 59.782  -18.478 104.844 1.00 698.86 ?  -237 DC  J C6    1 
ATOM 1572  P P     . DA  A 1 77  ? 60.124  -12.054 104.215 1.00 687.13 ?  -236 DA  J P     1 
ATOM 1573  O OP1   . DA  A 1 77  ? 59.052  -11.168 103.711 1.00 687.13 ?  -236 DA  J OP1   1 
ATOM 1574  O OP2   . DA  A 1 77  ? 61.079  -12.695 103.282 1.00 687.13 -1 -236 DA  J OP2   1 
ATOM 1575  O "O5'" . DA  A 1 77  ? 60.979  -11.226 105.290 1.00 687.13 ?  -236 DA  J "O5'" 1 
ATOM 1576  C "C5'" . DA  A 1 77  ? 60.992  -11.591 106.682 1.00 687.13 ?  -236 DA  J "C5'" 1 
ATOM 1577  C "C4'" . DA  A 1 77  ? 62.368  -12.039 107.164 1.00 687.13 ?  -236 DA  J "C4'" 1 
ATOM 1578  O "O4'" . DA  A 1 77  ? 62.458  -13.492 107.155 1.00 687.13 ?  -236 DA  J "O4'" 1 
ATOM 1579  C "C3'" . DA  A 1 77  ? 63.564  -11.515 106.361 1.00 687.13 ?  -236 DA  J "C3'" 1 
ATOM 1580  O "O3'" . DA  A 1 77  ? 64.482  -10.860 107.245 1.00 687.13 ?  -236 DA  J "O3'" 1 
ATOM 1581  C "C2'" . DA  A 1 77  ? 64.147  -12.779 105.727 1.00 687.13 ?  -236 DA  J "C2'" 1 
ATOM 1582  C "C1'" . DA  A 1 77  ? 63.763  -13.841 106.747 1.00 687.13 ?  -236 DA  J "C1'" 1 
ATOM 1583  N N9    . DA  A 1 77  ? 63.761  -15.188 106.196 1.00 687.13 ?  -236 DA  J N9    1 
ATOM 1584  C C8    . DA  A 1 77  ? 63.061  -15.634 105.113 1.00 687.13 ?  -236 DA  J C8    1 
ATOM 1585  N N7    . DA  A 1 77  ? 63.249  -16.902 104.838 1.00 687.13 ?  -236 DA  J N7    1 
ATOM 1586  C C5    . DA  A 1 77  ? 64.139  -17.315 105.810 1.00 687.13 ?  -236 DA  J C5    1 
ATOM 1587  C C6    . DA  A 1 77  ? 64.742  -18.562 106.077 1.00 687.13 ?  -236 DA  J C6    1 
ATOM 1588  N N6    . DA  A 1 77  ? 64.517  -19.652 105.342 1.00 687.13 ?  -236 DA  J N6    1 
ATOM 1589  N N1    . DA  A 1 77  ? 65.591  -18.642 107.127 1.00 687.13 ?  -236 DA  J N1    1 
ATOM 1590  C C2    . DA  A 1 77  ? 65.815  -17.546 107.871 1.00 687.13 ?  -236 DA  J C2    1 
ATOM 1591  N N3    . DA  A 1 77  ? 65.307  -16.319 107.716 1.00 687.13 ?  -236 DA  J N3    1 
ATOM 1592  C C4    . DA  A 1 77  ? 64.466  -16.272 106.661 1.00 687.13 ?  -236 DA  J C4    1 
ATOM 1593  P P     . DG  A 1 78  ? 65.838  -10.142 106.760 1.00 687.27 ?  -235 DG  J P     1 
ATOM 1594  O OP1   . DG  A 1 78  ? 65.558  -8.688  106.721 1.00 687.27 ?  -235 DG  J OP1   1 
ATOM 1595  O OP2   . DG  A 1 78  ? 66.376  -10.806 105.549 1.00 687.27 -1 -235 DG  J OP2   1 
ATOM 1596  O "O5'" . DG  A 1 78  ? 66.837  -10.477 107.971 1.00 687.27 ?  -235 DG  J "O5'" 1 
ATOM 1597  C "C5'" . DG  A 1 78  ? 66.733  -11.720 108.674 1.00 687.27 ?  -235 DG  J "C5'" 1 
ATOM 1598  C "C4'" . DG  A 1 78  ? 68.069  -12.416 108.921 1.00 687.27 ?  -235 DG  J "C4'" 1 
ATOM 1599  O "O4'" . DG  A 1 78  ? 67.950  -13.821 108.570 1.00 687.27 ?  -235 DG  J "O4'" 1 
ATOM 1600  C "C3'" . DG  A 1 78  ? 69.301  -11.904 108.177 1.00 687.27 ?  -235 DG  J "C3'" 1 
ATOM 1601  O "O3'" . DG  A 1 78  ? 70.442  -11.965 109.048 1.00 687.27 ?  -235 DG  J "O3'" 1 
ATOM 1602  C "C2'" . DG  A 1 78  ? 69.419  -12.861 106.993 1.00 687.27 ?  -235 DG  J "C2'" 1 
ATOM 1603  C "C1'" . DG  A 1 78  ? 68.905  -14.168 107.587 1.00 687.27 ?  -235 DG  J "C1'" 1 
ATOM 1604  N N9    . DG  A 1 78  ? 68.270  -15.017 106.584 1.00 687.27 ?  -235 DG  J N9    1 
ATOM 1605  C C8    . DG  A 1 78  ? 67.254  -14.661 105.728 1.00 687.27 ?  -235 DG  J C8    1 
ATOM 1606  N N7    . DG  A 1 78  ? 66.890  -15.621 104.929 1.00 687.27 ?  -235 DG  J N7    1 
ATOM 1607  C C5    . DG  A 1 78  ? 67.718  -16.680 105.273 1.00 687.27 ?  -235 DG  J C5    1 
ATOM 1608  C C6    . DG  A 1 78  ? 67.786  -17.991 104.744 1.00 687.27 ?  -235 DG  J C6    1 
ATOM 1609  O O6    . DG  A 1 78  ? 67.097  -18.480 103.839 1.00 687.27 ?  -235 DG  J O6    1 
ATOM 1610  N N1    . DG  A 1 78  ? 68.767  -18.765 105.370 1.00 687.27 ?  -235 DG  J N1    1 
ATOM 1611  C C2    . DG  A 1 78  ? 69.582  -18.320 106.386 1.00 687.27 ?  -235 DG  J C2    1 
ATOM 1612  N N2    . DG  A 1 78  ? 70.472  -19.197 106.866 1.00 687.27 ?  -235 DG  J N2    1 
ATOM 1613  N N3    . DG  A 1 78  ? 69.528  -17.091 106.890 1.00 687.27 ?  -235 DG  J N3    1 
ATOM 1614  C C4    . DG  A 1 78  ? 68.576  -16.328 106.291 1.00 687.27 ?  -235 DG  J C4    1 
ATOM 1615  P P     . DC  A 1 79  ? 71.940  -11.627 108.572 1.00 688.20 ?  -234 DC  J P     1 
ATOM 1616  O OP1   . DC  A 1 79  ? 72.676  -11.158 109.765 1.00 688.20 ?  -234 DC  J OP1   1 
ATOM 1617  O OP2   . DC  A 1 79  ? 71.909  -10.777 107.356 1.00 688.20 -1 -234 DC  J OP2   1 
ATOM 1618  O "O5'" . DC  A 1 79  ? 72.495  -13.065 108.141 1.00 688.20 ?  -234 DC  J "O5'" 1 
ATOM 1619  C "C5'" . DC  A 1 79  ? 72.726  -14.087 109.110 1.00 688.20 ?  -234 DC  J "C5'" 1 
ATOM 1620  C "C4'" . DC  A 1 79  ? 73.411  -15.279 108.462 1.00 688.20 ?  -234 DC  J "C4'" 1 
ATOM 1621  O "O4'" . DC  A 1 79  ? 72.476  -15.927 107.559 1.00 688.20 ?  -234 DC  J "O4'" 1 
ATOM 1622  C "C3'" . DC  A 1 79  ? 74.658  -14.941 107.639 1.00 688.20 ?  -234 DC  J "C3'" 1 
ATOM 1623  O "O3'" . DC  A 1 79  ? 75.742  -15.770 108.035 1.00 688.20 ?  -234 DC  J "O3'" 1 
ATOM 1624  C "C2'" . DC  A 1 79  ? 74.235  -15.232 106.199 1.00 688.20 ?  -234 DC  J "C2'" 1 
ATOM 1625  C "C1'" . DC  A 1 79  ? 73.176  -16.309 106.393 1.00 688.20 ?  -234 DC  J "C1'" 1 
ATOM 1626  N N1    . DC  A 1 79  ? 72.249  -16.437 105.208 1.00 688.20 ?  -234 DC  J N1    1 
ATOM 1627  C C2    . DC  A 1 79  ? 72.181  -17.666 104.527 1.00 688.20 ?  -234 DC  J C2    1 
ATOM 1628  O O2    . DC  A 1 79  ? 72.864  -18.623 104.915 1.00 688.20 ?  -234 DC  J O2    1 
ATOM 1629  N N3    . DC  A 1 79  ? 71.355  -17.779 103.454 1.00 688.20 ?  -234 DC  J N3    1 
ATOM 1630  C C4    . DC  A 1 79  ? 70.630  -16.730 103.060 1.00 688.20 ?  -234 DC  J C4    1 
ATOM 1631  N N4    . DC  A 1 79  ? 69.838  -16.902 102.000 1.00 688.20 ?  -234 DC  J N4    1 
ATOM 1632  C C5    . DC  A 1 79  ? 70.684  -15.468 103.728 1.00 688.20 ?  -234 DC  J C5    1 
ATOM 1633  C C6    . DC  A 1 79  ? 71.501  -15.367 104.785 1.00 688.20 ?  -234 DC  J C6    1 
ATOM 1634  P P     . DG  A 1 80  ? 77.232  -15.540 107.492 1.00 687.55 ?  -233 DG  J P     1 
ATOM 1635  O OP1   . DG  A 1 80  ? 77.841  -14.467 108.306 1.00 687.55 ?  -233 DG  J OP1   1 
ATOM 1636  O OP2   . DG  A 1 80  ? 77.242  -15.424 106.017 1.00 687.55 -1 -233 DG  J OP2   1 
ATOM 1637  O "O5'" . DG  A 1 80  ? 77.909  -16.940 107.856 1.00 687.55 ?  -233 DG  J "O5'" 1 
ATOM 1638  C "C5'" . DG  A 1 80  ? 77.128  -18.137 107.856 1.00 687.55 ?  -233 DG  J "C5'" 1 
ATOM 1639  C "C4'" . DG  A 1 80  ? 77.197  -18.874 106.525 1.00 687.55 ?  -233 DG  J "C4'" 1 
ATOM 1640  O "O4'" . DG  A 1 80  ? 76.115  -18.458 105.654 1.00 687.55 ?  -233 DG  J "O4'" 1 
ATOM 1641  C "C3'" . DG  A 1 80  ? 78.480  -18.678 105.716 1.00 687.55 ?  -233 DG  J "C3'" 1 
ATOM 1642  O "O3'" . DG  A 1 80  ? 79.161  -19.923 105.657 1.00 687.55 ?  -233 DG  J "O3'" 1 
ATOM 1643  C "C2'" . DG  A 1 80  ? 77.998  -18.217 104.337 1.00 687.55 ?  -233 DG  J "C2'" 1 
ATOM 1644  C "C1'" . DG  A 1 80  ? 76.550  -18.684 104.333 1.00 687.55 ?  -233 DG  J "C1'" 1 
ATOM 1645  N N9    . DG  A 1 80  ? 75.677  -17.962 103.414 1.00 687.55 ?  -233 DG  J N9    1 
ATOM 1646  C C8    . DG  A 1 80  ? 75.467  -16.606 103.368 1.00 687.55 ?  -233 DG  J C8    1 
ATOM 1647  N N7    . DG  A 1 80  ? 74.626  -16.241 102.443 1.00 687.55 ?  -233 DG  J N7    1 
ATOM 1648  C C5    . DG  A 1 80  ? 74.252  -17.433 101.829 1.00 687.55 ?  -233 DG  J C5    1 
ATOM 1649  C C6    . DG  A 1 80  ? 73.357  -17.668 100.752 1.00 687.55 ?  -233 DG  J C6    1 
ATOM 1650  O O6    . DG  A 1 80  ? 72.701  -16.836 100.108 1.00 687.55 ?  -233 DG  J O6    1 
ATOM 1651  N N1    . DG  A 1 80  ? 73.261  -19.025 100.437 1.00 687.55 ?  -233 DG  J N1    1 
ATOM 1652  C C2    . DG  A 1 80  ? 73.946  -20.030 101.086 1.00 687.55 ?  -233 DG  J C2    1 
ATOM 1653  N N2    . DG  A 1 80  ? 73.734  -21.281 100.649 1.00 687.55 ?  -233 DG  J N2    1 
ATOM 1654  N N3    . DG  A 1 80  ? 74.784  -19.822 102.096 1.00 687.55 ?  -233 DG  J N3    1 
ATOM 1655  C C4    . DG  A 1 80  ? 74.892  -18.505 102.416 1.00 687.55 ?  -233 DG  J C4    1 
ATOM 1656  P P     . DC  A 1 81  ? 80.626  -20.081 105.019 1.00 680.36 ?  -232 DC  J P     1 
ATOM 1657  O OP1   . DC  A 1 81  ? 81.501  -20.617 106.085 1.00 680.36 ?  -232 DC  J OP1   1 
ATOM 1658  O OP2   . DC  A 1 81  ? 81.006  -18.851 104.282 1.00 680.36 -1 -232 DC  J OP2   1 
ATOM 1659  O "O5'" . DC  A 1 81  ? 80.410  -21.238 103.937 1.00 680.36 ?  -232 DC  J "O5'" 1 
ATOM 1660  C "C5'" . DC  A 1 81  ? 79.562  -22.358 104.215 1.00 680.36 ?  -232 DC  J "C5'" 1 
ATOM 1661  C "C4'" . DC  A 1 81  ? 79.189  -23.071 102.927 1.00 680.36 ?  -232 DC  J "C4'" 1 
ATOM 1662  O "O4'" . DC  A 1 81  ? 78.178  -22.301 102.220 1.00 680.36 ?  -232 DC  J "O4'" 1 
ATOM 1663  C "C3'" . DC  A 1 81  ? 80.354  -23.259 101.957 1.00 680.36 ?  -232 DC  J "C3'" 1 
ATOM 1664  O "O3'" . DC  A 1 81  ? 80.282  -24.545 101.349 1.00 680.36 ?  -232 DC  J "O3'" 1 
ATOM 1665  C "C2'" . DC  A 1 81  ? 80.136  -22.138 100.943 1.00 680.36 ?  -232 DC  J "C2'" 1 
ATOM 1666  C "C1'" . DC  A 1 81  ? 78.614  -22.053 100.897 1.00 680.36 ?  -232 DC  J "C1'" 1 
ATOM 1667  N N1    . DC  A 1 81  ? 78.077  -20.732 100.427 1.00 680.36 ?  -232 DC  J N1    1 
ATOM 1668  C C2    . DC  A 1 81  ? 77.010  -20.705 99.513  1.00 680.36 ?  -232 DC  J C2    1 
ATOM 1669  O O2    . DC  A 1 81  ? 76.523  -21.771 99.109  1.00 680.36 ?  -232 DC  J O2    1 
ATOM 1670  N N3    . DC  A 1 81  ? 76.538  -19.499 99.096  1.00 680.36 ?  -232 DC  J N3    1 
ATOM 1671  C C4    . DC  A 1 81  ? 77.082  -18.364 99.549  1.00 680.36 ?  -232 DC  J C4    1 
ATOM 1672  N N4    . DC  A 1 81  ? 76.581  -17.208 99.110  1.00 680.36 ?  -232 DC  J N4    1 
ATOM 1673  C C5    . DC  A 1 81  ? 78.168  -18.368 100.476 1.00 680.36 ?  -232 DC  J C5    1 
ATOM 1674  C C6    . DC  A 1 81  ? 78.626  -19.562 100.881 1.00 680.36 ?  -232 DC  J C6    1 
ATOM 1675  P P     . DG  A 1 82  ? 81.542  -25.220 100.613 1.00 663.42 ?  -231 DG  J P     1 
ATOM 1676  O OP1   . DG  A 1 82  ? 82.115  -26.186 101.570 1.00 663.42 ?  -231 DG  J OP1   1 
ATOM 1677  O OP2   . DG  A 1 82  ? 82.417  -24.167 100.036 1.00 663.42 -1 -231 DG  J OP2   1 
ATOM 1678  O "O5'" . DG  A 1 82  ? 80.880  -26.064 99.416  1.00 663.42 ?  -231 DG  J "O5'" 1 
ATOM 1679  C "C5'" . DG  A 1 82  ? 79.474  -26.019 99.112  1.00 663.42 ?  -231 DG  J "C5'" 1 
ATOM 1680  C "C4'" . DG  A 1 82  ? 79.219  -25.670 97.652  1.00 663.42 ?  -231 DG  J "C4'" 1 
ATOM 1681  O "O4'" . DG  A 1 82  ? 78.756  -24.296 97.552  1.00 663.42 ?  -231 DG  J "O4'" 1 
ATOM 1682  C "C3'" . DG  A 1 82  ? 80.428  -25.782 96.721  1.00 663.42 ?  -231 DG  J "C3'" 1 
ATOM 1683  O "O3'" . DG  A 1 82  ? 80.037  -26.502 95.558  1.00 663.42 ?  -231 DG  J "O3'" 1 
ATOM 1684  C "C2'" . DG  A 1 82  ? 80.806  -24.329 96.444  1.00 663.42 ?  -231 DG  J "C2'" 1 
ATOM 1685  C "C1'" . DG  A 1 82  ? 79.452  -23.641 96.509  1.00 663.42 ?  -231 DG  J "C1'" 1 
ATOM 1686  N N9    . DG  A 1 82  ? 79.540  -22.215 96.814  1.00 663.42 ?  -231 DG  J N9    1 
ATOM 1687  C C8    . DG  A 1 82  ? 80.365  -21.628 97.739  1.00 663.42 ?  -231 DG  J C8    1 
ATOM 1688  N N7    . DG  A 1 82  ? 80.241  -20.333 97.815  1.00 663.42 ?  -231 DG  J N7    1 
ATOM 1689  C C5    . DG  A 1 82  ? 79.270  -20.034 96.872  1.00 663.42 ?  -231 DG  J C5    1 
ATOM 1690  C C6    . DG  A 1 82  ? 78.723  -18.782 96.507  1.00 663.42 ?  -231 DG  J C6    1 
ATOM 1691  O O6    . DG  A 1 82  ? 79.008  -17.668 96.967  1.00 663.42 ?  -231 DG  J O6    1 
ATOM 1692  N N1    . DG  A 1 82  ? 77.757  -18.907 95.508  1.00 663.42 ?  -231 DG  J N1    1 
ATOM 1693  C C2    . DG  A 1 82  ? 77.373  -20.101 94.938  1.00 663.42 ?  -231 DG  J C2    1 
ATOM 1694  N N2    . DG  A 1 82  ? 76.429  -20.033 93.992  1.00 663.42 ?  -231 DG  J N2    1 
ATOM 1695  N N3    . DG  A 1 82  ? 77.880  -21.283 95.273  1.00 663.42 ?  -231 DG  J N3    1 
ATOM 1696  C C4    . DG  A 1 82  ? 78.824  -21.180 96.244  1.00 663.42 ?  -231 DG  J C4    1 
ATOM 1697  P P     . DT  A 1 83  ? 80.929  -26.693 94.234  1.00 656.62 ?  -230 DT  J P     1 
ATOM 1698  O OP1   . DT  A 1 83  ? 81.611  -27.999 94.309  1.00 656.62 ?  -230 DT  J OP1   1 
ATOM 1699  O OP2   . DT  A 1 83  ? 81.743  -25.498 93.922  1.00 656.62 -1 -230 DT  J OP2   1 
ATOM 1700  O "O5'" . DT  A 1 83  ? 79.749  -26.788 93.160  1.00 656.62 ?  -230 DT  J "O5'" 1 
ATOM 1701  C "C5'" . DT  A 1 83  ? 78.473  -26.171 93.414  1.00 656.62 ?  -230 DT  J "C5'" 1 
ATOM 1702  C "C4'" . DT  A 1 83  ? 78.231  -25.051 92.423  1.00 656.62 ?  -230 DT  J "C4'" 1 
ATOM 1703  O "O4'" . DT  A 1 83  ? 78.677  -23.798 93.000  1.00 656.62 ?  -230 DT  J "O4'" 1 
ATOM 1704  C "C3'" . DT  A 1 83  ? 78.986  -25.228 91.101  1.00 656.62 ?  -230 DT  J "C3'" 1 
ATOM 1705  O "O3'" . DT  A 1 83  ? 78.108  -25.040 90.004  1.00 656.62 ?  -230 DT  J "O3'" 1 
ATOM 1706  C "C2'" . DT  A 1 83  ? 80.059  -24.146 91.134  1.00 656.62 ?  -230 DT  J "C2'" 1 
ATOM 1707  C "C1'" . DT  A 1 83  ? 79.368  -23.086 91.989  1.00 656.62 ?  -230 DT  J "C1'" 1 
ATOM 1708  N N1    . DT  A 1 83  ? 80.330  -22.055 92.531  1.00 656.62 ?  -230 DT  J N1    1 
ATOM 1709  C C2    . DT  A 1 83  ? 80.275  -20.765 92.032  1.00 656.62 ?  -230 DT  J C2    1 
ATOM 1710  O O2    . DT  A 1 83  ? 79.471  -20.403 91.190  1.00 656.62 ?  -230 DT  J O2    1 
ATOM 1711  N N3    . DT  A 1 83  ? 81.196  -19.901 92.578  1.00 656.62 ?  -230 DT  J N3    1 
ATOM 1712  C C4    . DT  A 1 83  ? 82.154  -20.189 93.542  1.00 656.62 ?  -230 DT  J C4    1 
ATOM 1713  O O4    . DT  A 1 83  ? 82.937  -19.338 93.958  1.00 656.62 ?  -230 DT  J O4    1 
ATOM 1714  C C5    . DT  A 1 83  ? 82.165  -21.558 94.016  1.00 656.62 ?  -230 DT  J C5    1 
ATOM 1715  C C7    . DT  A 1 83  ? 83.150  -22.009 95.055  1.00 656.62 ?  -230 DT  J C7    1 
ATOM 1716  C C6    . DT  A 1 83  ? 81.267  -22.408 93.491  1.00 656.62 ?  -230 DT  J C6    1 
ATOM 1717  P P     . DA  A 1 84  ? 77.895  -26.158 88.877  1.00 656.47 ?  -229 DA  J P     1 
ATOM 1718  O OP1   . DA  A 1 84  ? 77.719  -27.458 89.554  1.00 656.47 ?  -229 DA  J OP1   1 
ATOM 1719  O OP2   . DA  A 1 84  ? 78.968  -25.978 87.864  1.00 656.47 -1 -229 DA  J OP2   1 
ATOM 1720  O "O5'" . DA  A 1 84  ? 76.469  -25.767 88.247  1.00 656.47 ?  -229 DA  J "O5'" 1 
ATOM 1721  C "C5'" . DA  A 1 84  ? 75.594  -24.792 88.873  1.00 656.47 ?  -229 DA  J "C5'" 1 
ATOM 1722  C "C4'" . DA  A 1 84  ? 75.571  -23.427 88.177  1.00 656.47 ?  -229 DA  J "C4'" 1 
ATOM 1723  O "O4'" . DA  A 1 84  ? 76.668  -22.579 88.603  1.00 656.47 ?  -229 DA  J "O4'" 1 
ATOM 1724  C "C3'" . DA  A 1 84  ? 75.669  -23.396 86.652  1.00 656.47 ?  -229 DA  J "C3'" 1 
ATOM 1725  O "O3'" . DA  A 1 84  ? 74.943  -22.290 86.199  1.00 656.47 ?  -229 DA  J "O3'" 1 
ATOM 1726  C "C2'" . DA  A 1 84  ? 77.132  -23.084 86.387  1.00 656.47 ?  -229 DA  J "C2'" 1 
ATOM 1727  C "C1'" . DA  A 1 84  ? 77.273  -22.018 87.451  1.00 656.47 ?  -229 DA  J "C1'" 1 
ATOM 1728  N N9    . DA  A 1 84  ? 78.628  -21.682 87.816  1.00 656.47 ?  -229 DA  J N9    1 
ATOM 1729  C C8    . DA  A 1 84  ? 79.690  -22.521 87.975  1.00 656.47 ?  -229 DA  J C8    1 
ATOM 1730  N N7    . DA  A 1 84  ? 80.787  -21.915 88.344  1.00 656.47 ?  -229 DA  J N7    1 
ATOM 1731  C C5    . DA  A 1 84  ? 80.408  -20.590 88.433  1.00 656.47 ?  -229 DA  J C5    1 
ATOM 1732  C C6    . DA  A 1 84  ? 81.111  -19.418 88.780  1.00 656.47 ?  -229 DA  J C6    1 
ATOM 1733  N N6    . DA  A 1 84  ? 82.404  -19.424 89.118  1.00 656.47 ?  -229 DA  J N6    1 
ATOM 1734  N N1    . DA  A 1 84  ? 80.429  -18.245 88.774  1.00 656.47 ?  -229 DA  J N1    1 
ATOM 1735  C C2    . DA  A 1 84  ? 79.125  -18.243 88.445  1.00 656.47 ?  -229 DA  J C2    1 
ATOM 1736  N N3    . DA  A 1 84  ? 78.361  -19.280 88.103  1.00 656.47 ?  -229 DA  J N3    1 
ATOM 1737  C C4    . DA  A 1 84  ? 79.073  -20.428 88.117  1.00 656.47 ?  -229 DA  J C4    1 
ATOM 1738  P P     . DC  A 1 85  ? 73.895  -22.400 85.015  1.00 653.15 ?  -228 DC  J P     1 
ATOM 1739  O OP1   . DC  A 1 85  ? 72.657  -22.922 85.656  1.00 653.15 ?  -228 DC  J OP1   1 
ATOM 1740  O OP2   . DC  A 1 85  ? 74.546  -23.003 83.822  1.00 653.15 -1 -228 DC  J OP2   1 
ATOM 1741  O "O5'" . DC  A 1 85  ? 73.692  -20.862 84.613  1.00 653.15 ?  -228 DC  J "O5'" 1 
ATOM 1742  C "C5'" . DC  A 1 85  ? 73.706  -19.785 85.554  1.00 653.15 ?  -228 DC  J "C5'" 1 
ATOM 1743  C "C4'" . DC  A 1 85  ? 74.537  -18.643 85.000  1.00 653.15 ?  -228 DC  J "C4'" 1 
ATOM 1744  O "O4'" . DC  A 1 85  ? 75.948  -18.843 85.283  1.00 653.15 ?  -228 DC  J "O4'" 1 
ATOM 1745  C "C3'" . DC  A 1 85  ? 74.462  -18.405 83.497  1.00 653.15 ?  -228 DC  J "C3'" 1 
ATOM 1746  O "O3'" . DC  A 1 85  ? 74.360  -17.009 83.363  1.00 653.15 ?  -228 DC  J "O3'" 1 
ATOM 1747  C "C2'" . DC  A 1 85  ? 75.793  -18.961 82.976  1.00 653.15 ?  -228 DC  J "C2'" 1 
ATOM 1748  C "C1'" . DC  A 1 85  ? 76.704  -18.549 84.121  1.00 653.15 ?  -228 DC  J "C1'" 1 
ATOM 1749  N N1    . DC  A 1 85  ? 78.015  -19.253 84.281  1.00 653.15 ?  -228 DC  J N1    1 
ATOM 1750  C C2    . DC  A 1 85  ? 79.110  -18.529 84.780  1.00 653.15 ?  -228 DC  J C2    1 
ATOM 1751  O O2    . DC  A 1 85  ? 78.981  -17.325 85.040  1.00 653.15 ?  -228 DC  J O2    1 
ATOM 1752  N N3    . DC  A 1 85  ? 80.294  -19.176 84.950  1.00 653.15 ?  -228 DC  J N3    1 
ATOM 1753  C C4    . DC  A 1 85  ? 80.406  -20.473 84.653  1.00 653.15 ?  -228 DC  J C4    1 
ATOM 1754  N N4    . DC  A 1 85  ? 81.591  -21.046 84.843  1.00 653.15 ?  -228 DC  J N4    1 
ATOM 1755  C C5    . DC  A 1 85  ? 79.309  -21.236 84.153  1.00 653.15 ?  -228 DC  J C5    1 
ATOM 1756  C C6    . DC  A 1 85  ? 78.144  -20.590 83.993  1.00 653.15 ?  -228 DC  J C6    1 
ATOM 1757  P P     . DG  A 1 86  ? 74.081  -16.256 81.993  1.00 656.89 ?  -227 DG  J P     1 
ATOM 1758  O OP1   . DG  A 1 86  ? 72.657  -15.876 82.048  1.00 656.89 ?  -227 DG  J OP1   1 
ATOM 1759  O OP2   . DG  A 1 86  ? 74.648  -16.984 80.840  1.00 656.89 -1 -227 DG  J OP2   1 
ATOM 1760  O "O5'" . DG  A 1 86  ? 74.941  -14.928 82.137  1.00 656.89 ?  -227 DG  J "O5'" 1 
ATOM 1761  C "C5'" . DG  A 1 86  ? 74.959  -14.193 83.356  1.00 656.89 ?  -227 DG  J "C5'" 1 
ATOM 1762  C "C4'" . DG  A 1 86  ? 76.111  -13.203 83.309  1.00 656.89 ?  -227 DG  J "C4'" 1 
ATOM 1763  O "O4'" . DG  A 1 86  ? 77.370  -13.889 83.496  1.00 656.89 ?  -227 DG  J "O4'" 1 
ATOM 1764  C "C3'" . DG  A 1 86  ? 76.263  -12.431 82.002  1.00 656.89 ?  -227 DG  J "C3'" 1 
ATOM 1765  O "O3'" . DG  A 1 86  ? 76.717  -11.102 82.277  1.00 656.89 ?  -227 DG  J "O3'" 1 
ATOM 1766  C "C2'" . DG  A 1 86  ? 77.292  -13.247 81.222  1.00 656.89 ?  -227 DG  J "C2'" 1 
ATOM 1767  C "C1'" . DG  A 1 86  ? 78.175  -13.784 82.337  1.00 656.89 ?  -227 DG  J "C1'" 1 
ATOM 1768  N N9    . DG  A 1 86  ? 78.679  -15.128 82.105  1.00 656.89 ?  -227 DG  J N9    1 
ATOM 1769  C C8    . DG  A 1 86  ? 78.014  -16.185 81.521  1.00 656.89 ?  -227 DG  J C8    1 
ATOM 1770  N N7    . DG  A 1 86  ? 78.713  -17.281 81.470  1.00 656.89 ?  -227 DG  J N7    1 
ATOM 1771  C C5    . DG  A 1 86  ? 79.913  -16.926 82.064  1.00 656.89 ?  -227 DG  J C5    1 
ATOM 1772  C C6    . DG  A 1 86  ? 81.065  -17.704 82.284  1.00 656.89 ?  -227 DG  J C6    1 
ATOM 1773  O O6    . DG  A 1 86  ? 81.238  -18.896 81.993  1.00 656.89 ?  -227 DG  J O6    1 
ATOM 1774  N N1    . DG  A 1 86  ? 82.071  -16.969 82.913  1.00 656.89 ?  -227 DG  J N1    1 
ATOM 1775  C C2    . DG  A 1 86  ? 81.976  -15.642 83.289  1.00 656.89 ?  -227 DG  J C2    1 
ATOM 1776  N N2    . DG  A 1 86  ? 83.052  -15.107 83.895  1.00 656.89 ?  -227 DG  J N2    1 
ATOM 1777  N N3    . DG  A 1 86  ? 80.891  -14.902 83.079  1.00 656.89 ?  -227 DG  J N3    1 
ATOM 1778  C C4    . DG  A 1 86  ? 79.909  -15.610 82.466  1.00 656.89 ?  -227 DG  J C4    1 
ATOM 1779  P P     . DT  A 1 87  ? 76.756  -9.982  81.137  1.00 647.55 ?  -226 DT  J P     1 
ATOM 1780  O OP1   . DT  A 1 87  ? 76.182  -8.780  81.781  1.00 647.55 ?  -226 DT  J OP1   1 
ATOM 1781  O OP2   . DT  A 1 87  ? 76.160  -10.484 79.884  1.00 647.55 -1 -226 DT  J OP2   1 
ATOM 1782  O "O5'" . DT  A 1 87  ? 78.308  -9.817  80.802  1.00 647.55 ?  -226 DT  J "O5'" 1 
ATOM 1783  C "C5'" . DT  A 1 87  ? 79.229  -9.656  81.865  1.00 647.55 ?  -226 DT  J "C5'" 1 
ATOM 1784  C "C4'" . DT  A 1 87  ? 80.652  -9.918  81.418  1.00 647.55 ?  -226 DT  J "C4'" 1 
ATOM 1785  O "O4'" . DT  A 1 87  ? 80.885  -11.350 81.422  1.00 647.55 ?  -226 DT  J "O4'" 1 
ATOM 1786  C "C3'" . DT  A 1 87  ? 81.020  -9.404  80.028  1.00 647.55 ?  -226 DT  J "C3'" 1 
ATOM 1787  O "O3'" . DT  A 1 87  ? 82.074  -8.451  80.180  1.00 647.55 ?  -226 DT  J "O3'" 1 
ATOM 1788  C "C2'" . DT  A 1 87  ? 81.453  -10.666 79.272  1.00 647.55 ?  -226 DT  J "C2'" 1 
ATOM 1789  C "C1'" . DT  A 1 87  ? 81.798  -11.664 80.386  1.00 647.55 ?  -226 DT  J "C1'" 1 
ATOM 1790  N N1    . DT  A 1 87  ? 81.732  -13.172 80.080  1.00 647.55 ?  -226 DT  J N1    1 
ATOM 1791  C C2    . DT  A 1 87  ? 82.718  -14.050 80.556  1.00 647.55 ?  -226 DT  J C2    1 
ATOM 1792  O O2    . DT  A 1 87  ? 83.684  -13.732 81.223  1.00 647.55 ?  -226 DT  J O2    1 
ATOM 1793  N N3    . DT  A 1 87  ? 82.545  -15.376 80.235  1.00 647.55 ?  -226 DT  J N3    1 
ATOM 1794  C C4    . DT  A 1 87  ? 81.515  -15.929 79.491  1.00 647.55 ?  -226 DT  J C4    1 
ATOM 1795  O O4    . DT  A 1 87  ? 81.469  -17.143 79.262  1.00 647.55 ?  -226 DT  J O4    1 
ATOM 1796  C C5    . DT  A 1 87  ? 80.516  -14.971 79.030  1.00 647.55 ?  -226 DT  J C5    1 
ATOM 1797  C C7    . DT  A 1 87  ? 79.334  -15.425 78.217  1.00 647.55 ?  -226 DT  J C7    1 
ATOM 1798  C C6    . DT  A 1 87  ? 80.668  -13.671 79.343  1.00 647.55 ?  -226 DT  J C6    1 
ATOM 1799  P P     . DG  A 1 88  ? 82.464  -7.355  79.073  1.00 645.46 ?  -225 DG  J P     1 
ATOM 1800  O OP1   . DG  A 1 88  ? 82.797  -6.109  79.793  1.00 645.46 ?  -225 DG  J OP1   1 
ATOM 1801  O OP2   . DG  A 1 88  ? 81.475  -7.387  77.975  1.00 645.46 -1 -225 DG  J OP2   1 
ATOM 1802  O "O5'" . DG  A 1 88  ? 83.815  -7.898  78.439  1.00 645.46 ?  -225 DG  J "O5'" 1 
ATOM 1803  C "C5'" . DG  A 1 88  ? 84.975  -8.073  79.231  1.00 645.46 ?  -225 DG  J "C5'" 1 
ATOM 1804  C "C4'" . DG  A 1 88  ? 85.871  -9.060  78.518  1.00 645.46 ?  -225 DG  J "C4'" 1 
ATOM 1805  O "O4'" . DG  A 1 88  ? 85.247  -10.364 78.562  1.00 645.46 ?  -225 DG  J "O4'" 1 
ATOM 1806  C "C3'" . DG  A 1 88  ? 86.095  -8.745  77.042  1.00 645.46 ?  -225 DG  J "C3'" 1 
ATOM 1807  O "O3'" . DG  A 1 88  ? 87.463  -8.368  76.879  1.00 645.46 ?  -225 DG  J "O3'" 1 
ATOM 1808  C "C2'" . DG  A 1 88  ? 85.660  -10.016 76.300  1.00 645.46 ?  -225 DG  J "C2'" 1 
ATOM 1809  C "C1'" . DG  A 1 88  ? 85.642  -11.065 77.408  1.00 645.46 ?  -225 DG  J "C1'" 1 
ATOM 1810  N N9    . DG  A 1 88  ? 84.705  -12.169 77.206  1.00 645.46 ?  -225 DG  J N9    1 
ATOM 1811  C C8    . DG  A 1 88  ? 83.337  -12.078 77.160  1.00 645.46 ?  -225 DG  J C8    1 
ATOM 1812  N N7    . DG  A 1 88  ? 82.731  -13.217 76.973  1.00 645.46 ?  -225 DG  J N7    1 
ATOM 1813  C C5    . DG  A 1 88  ? 83.767  -14.137 76.885  1.00 645.46 ?  -225 DG  J C5    1 
ATOM 1814  C C6    . DG  A 1 88  ? 83.726  -15.543 76.677  1.00 645.46 ?  -225 DG  J C6    1 
ATOM 1815  O O6    . DG  A 1 88  ? 82.733  -16.273 76.529  1.00 645.46 ?  -225 DG  J O6    1 
ATOM 1816  N N1    . DG  A 1 88  ? 85.002  -16.108 76.644  1.00 645.46 ?  -225 DG  J N1    1 
ATOM 1817  C C2    . DG  A 1 88  ? 86.169  -15.399 76.800  1.00 645.46 ?  -225 DG  J C2    1 
ATOM 1818  N N2    . DG  A 1 88  ? 87.298  -16.116 76.743  1.00 645.46 ?  -225 DG  J N2    1 
ATOM 1819  N N3    . DG  A 1 88  ? 86.224  -14.080 76.993  1.00 645.46 ?  -225 DG  J N3    1 
ATOM 1820  C C4    . DG  A 1 88  ? 84.991  -13.507 77.027  1.00 645.46 ?  -225 DG  J C4    1 
ATOM 1821  P P     . DC  A 1 89  ? 88.139  -8.146  75.442  1.00 645.44 ?  -224 DC  J P     1 
ATOM 1822  O OP1   . DC  A 1 89  ? 89.258  -7.186  75.580  1.00 645.44 ?  -224 DC  J OP1   1 
ATOM 1823  O OP2   . DC  A 1 89  ? 87.110  -7.963  74.393  1.00 645.44 -1 -224 DC  J OP2   1 
ATOM 1824  O "O5'" . DC  A 1 89  ? 88.730  -9.595  75.191  1.00 645.44 ?  -224 DC  J "O5'" 1 
ATOM 1825  C "C5'" . DC  A 1 89  ? 89.766  -10.167 75.974  1.00 645.44 ?  -224 DC  J "C5'" 1 
ATOM 1826  C "C4'" . DC  A 1 89  ? 90.323  -11.289 75.128  1.00 645.44 ?  -224 DC  J "C4'" 1 
ATOM 1827  O "O4'" . DC  A 1 89  ? 89.302  -12.315 75.024  1.00 645.44 ?  -224 DC  J "O4'" 1 
ATOM 1828  C "C3'" . DC  A 1 89  ? 90.650  -10.853 73.700  1.00 645.44 ?  -224 DC  J "C3'" 1 
ATOM 1829  O "O3'" . DC  A 1 89  ? 91.920  -11.360 73.298  1.00 645.44 ?  -224 DC  J "O3'" 1 
ATOM 1830  C "C2'" . DC  A 1 89  ? 89.483  -11.390 72.866  1.00 645.44 ?  -224 DC  J "C2'" 1 
ATOM 1831  C "C1'" . DC  A 1 89  ? 89.074  -12.624 73.659  1.00 645.44 ?  -224 DC  J "C1'" 1 
ATOM 1832  N N1    . DC  A 1 89  ? 87.657  -13.092 73.476  1.00 645.44 ?  -224 DC  J N1    1 
ATOM 1833  C C2    . DC  A 1 89  ? 87.319  -14.387 73.907  1.00 645.44 ?  -224 DC  J C2    1 
ATOM 1834  O O2    . DC  A 1 89  ? 88.176  -15.116 74.425  1.00 645.44 ?  -224 DC  J O2    1 
ATOM 1835  N N3    . DC  A 1 89  ? 86.043  -14.819 73.750  1.00 645.44 ?  -224 DC  J N3    1 
ATOM 1836  C C4    . DC  A 1 89  ? 85.131  -14.023 73.192  1.00 645.44 ?  -224 DC  J C4    1 
ATOM 1837  N N4    . DC  A 1 89  ? 83.894  -14.518 73.067  1.00 645.44 ?  -224 DC  J N4    1 
ATOM 1838  C C5    . DC  A 1 89  ? 85.450  -12.702 72.743  1.00 645.44 ?  -224 DC  J C5    1 
ATOM 1839  C C6    . DC  A 1 89  ? 86.711  -12.283 72.905  1.00 645.44 ?  -224 DC  J C6    1 
ATOM 1840  P P     . DG  A 1 90  ? 92.625  -10.930 71.917  1.00 661.58 ?  -223 DG  J P     1 
ATOM 1841  O OP1   . DG  A 1 90  ? 93.531  -9.792  72.196  1.00 661.58 ?  -223 DG  J OP1   1 
ATOM 1842  O OP2   . DG  A 1 90  ? 91.613  -10.787 70.847  1.00 661.58 -1 -223 DG  J OP2   1 
ATOM 1843  O "O5'" . DG  A 1 90  ? 93.494  -12.243 71.590  1.00 661.58 ?  -223 DG  J "O5'" 1 
ATOM 1844  C "C5'" . DG  A 1 90  ? 93.404  -13.428 72.405  1.00 661.58 ?  -223 DG  J "C5'" 1 
ATOM 1845  C "C4'" . DG  A 1 90  ? 92.908  -14.648 71.637  1.00 661.58 ?  -223 DG  J "C4'" 1 
ATOM 1846  O "O4'" . DG  A 1 90  ? 91.461  -14.756 71.731  1.00 661.58 ?  -223 DG  J "O4'" 1 
ATOM 1847  C "C3'" . DG  A 1 90  ? 93.250  -14.695 70.145  1.00 661.58 ?  -223 DG  J "C3'" 1 
ATOM 1848  O "O3'" . DG  A 1 90  ? 93.794  -15.980 69.826  1.00 661.58 ?  -223 DG  J "O3'" 1 
ATOM 1849  C "C2'" . DG  A 1 90  ? 91.902  -14.454 69.473  1.00 661.58 ?  -223 DG  J "C2'" 1 
ATOM 1850  C "C1'" . DG  A 1 90  ? 90.966  -15.136 70.463  1.00 661.58 ?  -223 DG  J "C1'" 1 
ATOM 1851  N N9    . DG  A 1 90  ? 89.562  -14.746 70.315  1.00 661.58 ?  -223 DG  J N9    1 
ATOM 1852  C C8    . DG  A 1 90  ? 89.075  -13.472 70.126  1.00 661.58 ?  -223 DG  J C8    1 
ATOM 1853  N N7    . DG  A 1 90  ? 87.779  -13.412 70.023  1.00 661.58 ?  -223 DG  J N7    1 
ATOM 1854  C C5    . DG  A 1 90  ? 87.374  -14.732 70.150  1.00 661.58 ?  -223 DG  J C5    1 
ATOM 1855  C C6    . DG  A 1 90  ? 86.068  -15.286 70.118  1.00 661.58 ?  -223 DG  J C6    1 
ATOM 1856  O O6    . DG  A 1 90  ? 85.000  -14.682 69.968  1.00 661.58 ?  -223 DG  J O6    1 
ATOM 1857  N N1    . DG  A 1 90  ? 86.072  -16.677 70.283  1.00 661.58 ?  -223 DG  J N1    1 
ATOM 1858  C C2    . DG  A 1 90  ? 87.207  -17.438 70.459  1.00 661.58 ?  -223 DG  J C2    1 
ATOM 1859  N N2    . DG  A 1 90  ? 87.014  -18.758 70.601  1.00 661.58 ?  -223 DG  J N2    1 
ATOM 1860  N N3    . DG  A 1 90  ? 88.440  -16.932 70.487  1.00 661.58 ?  -223 DG  J N3    1 
ATOM 1861  C C4    . DG  A 1 90  ? 88.455  -15.574 70.326  1.00 661.58 ?  -223 DG  J C4    1 
ATOM 1862  P P     . DT  A 1 91  ? 94.181  -16.443 68.336  1.00 660.26 ?  -222 DT  J P     1 
ATOM 1863  O OP1   . DT  A 1 91  ? 95.460  -17.180 68.435  1.00 660.26 ?  -222 DT  J OP1   1 
ATOM 1864  O OP2   . DT  A 1 91  ? 94.066  -15.309 67.389  1.00 660.26 -1 -222 DT  J OP2   1 
ATOM 1865  O "O5'" . DT  A 1 91  ? 93.007  -17.474 68.011  1.00 660.26 ?  -222 DT  J "O5'" 1 
ATOM 1866  C "C5'" . DT  A 1 91  ? 92.813  -18.641 68.814  1.00 660.26 ?  -222 DT  J "C5'" 1 
ATOM 1867  C "C4'" . DT  A 1 91  ? 91.732  -19.511 68.199  1.00 660.26 ?  -222 DT  J "C4'" 1 
ATOM 1868  O "O4'" . DT  A 1 91  ? 90.447  -18.853 68.350  1.00 660.26 ?  -222 DT  J "O4'" 1 
ATOM 1869  C "C3'" . DT  A 1 91  ? 91.906  -19.796 66.706  1.00 660.26 ?  -222 DT  J "C3'" 1 
ATOM 1870  O "O3'" . DT  A 1 91  ? 91.720  -21.200 66.463  1.00 660.26 ?  -222 DT  J "O3'" 1 
ATOM 1871  C "C2'" . DT  A 1 91  ? 90.866  -18.895 66.033  1.00 660.26 ?  -222 DT  J "C2'" 1 
ATOM 1872  C "C1'" . DT  A 1 91  ? 89.779  -18.800 67.103  1.00 660.26 ?  -222 DT  J "C1'" 1 
ATOM 1873  N N1    . DT  A 1 91  ? 88.936  -17.549 67.029  1.00 660.26 ?  -222 DT  J N1    1 
ATOM 1874  C C2    . DT  A 1 91  ? 87.557  -17.610 67.182  1.00 660.26 ?  -222 DT  J C2    1 
ATOM 1875  O O2    . DT  A 1 91  ? 86.927  -18.632 67.387  1.00 660.26 ?  -222 DT  J O2    1 
ATOM 1876  N N3    . DT  A 1 91  ? 86.917  -16.402 67.092  1.00 660.26 ?  -222 DT  J N3    1 
ATOM 1877  C C4    . DT  A 1 91  ? 87.496  -15.164 66.865  1.00 660.26 ?  -222 DT  J C4    1 
ATOM 1878  O O4    . DT  A 1 91  ? 86.825  -14.140 66.802  1.00 660.26 ?  -222 DT  J O4    1 
ATOM 1879  C C5    . DT  A 1 91  ? 88.932  -15.166 66.713  1.00 660.26 ?  -222 DT  J C5    1 
ATOM 1880  C C7    . DT  A 1 91  ? 89.685  -13.893 66.462  1.00 660.26 ?  -222 DT  J C7    1 
ATOM 1881  C C6    . DT  A 1 91  ? 89.571  -16.340 66.801  1.00 660.26 ?  -222 DT  J C6    1 
ATOM 1882  P P     . DT  A 1 92  ? 91.469  -21.820 65.001  1.00 659.01 ?  -221 DT  J P     1 
ATOM 1883  O OP1   . DT  A 1 92  ? 91.849  -23.251 65.042  1.00 659.01 ?  -221 DT  J OP1   1 
ATOM 1884  O OP2   . DT  A 1 92  ? 92.032  -20.928 63.954  1.00 659.01 -1 -221 DT  J OP2   1 
ATOM 1885  O "O5'" . DT  A 1 92  ? 89.878  -21.713 64.904  1.00 659.01 ?  -221 DT  J "O5'" 1 
ATOM 1886  C "C5'" . DT  A 1 92  ? 88.982  -22.324 65.847  1.00 659.01 ?  -221 DT  J "C5'" 1 
ATOM 1887  C "C4'" . DT  A 1 92  ? 87.593  -22.340 65.230  1.00 659.01 ?  -221 DT  J "C4'" 1 
ATOM 1888  O "O4'" . DT  A 1 92  ? 87.046  -20.988 65.203  1.00 659.01 ?  -221 DT  J "O4'" 1 
ATOM 1889  C "C3'" . DT  A 1 92  ? 87.592  -22.824 63.782  1.00 659.01 ?  -221 DT  J "C3'" 1 
ATOM 1890  O "O3'" . DT  A 1 92  ? 86.461  -23.610 63.551  1.00 659.01 ?  -221 DT  J "O3'" 1 
ATOM 1891  C "C2'" . DT  A 1 92  ? 87.492  -21.538 62.973  1.00 659.01 ?  -221 DT  J "C2'" 1 
ATOM 1892  C "C1'" . DT  A 1 92  ? 86.606  -20.696 63.887  1.00 659.01 ?  -221 DT  J "C1'" 1 
ATOM 1893  N N1    . DT  A 1 92  ? 86.668  -19.236 63.525  1.00 659.01 ?  -221 DT  J N1    1 
ATOM 1894  C C2    . DT  A 1 92  ? 85.500  -18.509 63.325  1.00 659.01 ?  -221 DT  J C2    1 
ATOM 1895  O O2    . DT  A 1 92  ? 84.375  -18.964 63.444  1.00 659.01 ?  -221 DT  J O2    1 
ATOM 1896  N N3    . DT  A 1 92  ? 85.696  -17.196 62.969  1.00 659.01 ?  -221 DT  J N3    1 
ATOM 1897  C C4    . DT  A 1 92  ? 86.908  -16.551 62.792  1.00 659.01 ?  -221 DT  J C4    1 
ATOM 1898  O O4    . DT  A 1 92  ? 86.967  -15.368 62.474  1.00 659.01 ?  -221 DT  J O4    1 
ATOM 1899  C C5    . DT  A 1 92  ? 88.085  -17.364 63.008  1.00 659.01 ?  -221 DT  J C5    1 
ATOM 1900  C C7    . DT  A 1 92  ? 89.463  -16.792 62.853  1.00 659.01 ?  -221 DT  J C7    1 
ATOM 1901  C C6    . DT  A 1 92  ? 87.910  -18.647 63.355  1.00 659.01 ?  -221 DT  J C6    1 
ATOM 1902  P P     . DT  A 1 93  ? 86.367  -24.559 62.265  1.00 647.55 ?  -220 DT  J P     1 
ATOM 1903  O OP1   . DT  A 1 93  ? 86.829  -25.862 62.785  1.00 647.55 ?  -220 DT  J OP1   1 
ATOM 1904  O OP2   . DT  A 1 93  ? 86.988  -23.940 61.059  1.00 647.55 -1 -220 DT  J OP2   1 
ATOM 1905  O "O5'" . DT  A 1 93  ? 84.791  -24.657 62.011  1.00 647.55 ?  -220 DT  J "O5'" 1 
ATOM 1906  C "C5'" . DT  A 1 93  ? 83.890  -24.204 63.034  1.00 647.55 ?  -220 DT  J "C5'" 1 
ATOM 1907  C "C4'" . DT  A 1 93  ? 82.849  -23.239 62.492  1.00 647.55 ?  -220 DT  J "C4'" 1 
ATOM 1908  O "O4'" . DT  A 1 93  ? 83.406  -21.918 62.293  1.00 647.55 ?  -220 DT  J "O4'" 1 
ATOM 1909  C "C3'" . DT  A 1 93  ? 82.266  -23.649 61.145  1.00 647.55 ?  -220 DT  J "C3'" 1 
ATOM 1910  O "O3'" . DT  A 1 93  ? 80.878  -23.742 61.316  1.00 647.55 ?  -220 DT  J "O3'" 1 
ATOM 1911  C "C2'" . DT  A 1 93  ? 82.677  -22.549 60.164  1.00 647.55 ?  -220 DT  J "C2'" 1 
ATOM 1912  C "C1'" . DT  A 1 93  ? 82.788  -21.391 61.141  1.00 647.55 ?  -220 DT  J "C1'" 1 
ATOM 1913  N N1    . DT  A 1 93  ? 83.556  -20.210 60.675  1.00 647.55 ?  -220 DT  J N1    1 
ATOM 1914  C C2    . DT  A 1 93  ? 82.866  -19.025 60.471  1.00 647.55 ?  -220 DT  J C2    1 
ATOM 1915  O O2    . DT  A 1 93  ? 81.662  -18.891 60.632  1.00 647.55 ?  -220 DT  J O2    1 
ATOM 1916  N N3    . DT  A 1 93  ? 83.650  -17.984 60.057  1.00 647.55 ?  -220 DT  J N3    1 
ATOM 1917  C C4    . DT  A 1 93  ? 85.013  -17.999 59.836  1.00 647.55 ?  -220 DT  J C4    1 
ATOM 1918  O O4    . DT  A 1 93  ? 85.595  -16.988 59.459  1.00 647.55 ?  -220 DT  J O4    1 
ATOM 1919  C C5    . DT  A 1 93  ? 85.680  -19.267 60.068  1.00 647.55 ?  -220 DT  J C5    1 
ATOM 1920  C C7    . DT  A 1 93  ? 87.160  -19.417 59.866  1.00 647.55 ?  -220 DT  J C7    1 
ATOM 1921  C C6    . DT  A 1 93  ? 84.927  -20.300 60.476  1.00 647.55 ?  -220 DT  J C6    1 
ATOM 1922  P P     . DA  A 1 94  ? 80.000  -24.517 60.244  1.00 627.65 ?  -219 DA  J P     1 
ATOM 1923  O OP1   . DA  A 1 94  ? 79.101  -25.441 60.977  1.00 627.65 ?  -219 DA  J OP1   1 
ATOM 1924  O OP2   . DA  A 1 94  ? 80.859  -24.965 59.117  1.00 627.65 -1 -219 DA  J OP2   1 
ATOM 1925  O "O5'" . DA  A 1 94  ? 79.161  -23.330 59.616  1.00 627.65 ?  -219 DA  J "O5'" 1 
ATOM 1926  C "C5'" . DA  A 1 94  ? 78.085  -22.722 60.295  1.00 627.65 ?  -219 DA  J "C5'" 1 
ATOM 1927  C "C4'" . DA  A 1 94  ? 77.681  -21.563 59.426  1.00 627.65 ?  -219 DA  J "C4'" 1 
ATOM 1928  O "O4'" . DA  A 1 94  ? 78.858  -20.749 59.270  1.00 627.65 ?  -219 DA  J "O4'" 1 
ATOM 1929  C "C3'" . DA  A 1 94  ? 77.245  -21.962 58.012  1.00 627.65 ?  -219 DA  J "C3'" 1 
ATOM 1930  O "O3'" . DA  A 1 94  ? 76.140  -21.189 57.585  1.00 627.65 ?  -219 DA  J "O3'" 1 
ATOM 1931  C "C2'" . DA  A 1 94  ? 78.451  -21.627 57.143  1.00 627.65 ?  -219 DA  J "C2'" 1 
ATOM 1932  C "C1'" . DA  A 1 94  ? 78.947  -20.412 57.907  1.00 627.65 ?  -219 DA  J "C1'" 1 
ATOM 1933  N N9    . DA  A 1 94  ? 80.312  -20.017 57.632  1.00 627.65 ?  -219 DA  J N9    1 
ATOM 1934  C C8    . DA  A 1 94  ? 81.405  -20.820 57.451  1.00 627.65 ?  -219 DA  J C8    1 
ATOM 1935  N N7    . DA  A 1 94  ? 82.507  -20.144 57.228  1.00 627.65 ?  -219 DA  J N7    1 
ATOM 1936  C C5    . DA  A 1 94  ? 82.098  -18.816 57.267  1.00 627.65 ?  -219 DA  J C5    1 
ATOM 1937  C C6    . DA  A 1 94  ? 82.786  -17.594 57.104  1.00 627.65 ?  -219 DA  J C6    1 
ATOM 1938  N N6    . DA  A 1 94  ? 84.100  -17.523 56.858  1.00 627.65 ?  -219 DA  J N6    1 
ATOM 1939  N N1    . DA  A 1 94  ? 82.069  -16.443 57.207  1.00 627.65 ?  -219 DA  J N1    1 
ATOM 1940  C C2    . DA  A 1 94  ? 80.755  -16.508 57.467  1.00 627.65 ?  -219 DA  J C2    1 
ATOM 1941  N N3    . DA  A 1 94  ? 80.003  -17.596 57.635  1.00 627.65 ?  -219 DA  J N3    1 
ATOM 1942  C C4    . DA  A 1 94  ? 80.741  -18.720 57.522  1.00 627.65 ?  -219 DA  J C4    1 
ATOM 1943  P P     . DA  A 1 95  ? 74.639  -21.509 58.016  1.00 614.65 ?  -218 DA  J P     1 
ATOM 1944  O OP1   . DA  A 1 95  ? 74.585  -22.141 59.360  1.00 613.46 ?  -218 DA  J OP1   1 
ATOM 1945  O OP2   . DA  A 1 95  ? 73.960  -22.147 56.863  1.00 613.53 -1 -218 DA  J OP2   1 
ATOM 1946  O "O5'" . DA  A 1 95  ? 74.104  -20.006 58.149  1.00 616.59 ?  -218 DA  J "O5'" 1 
ATOM 1947  C "C5'" . DA  A 1 95  ? 74.416  -19.195 59.291  1.00 617.66 ?  -218 DA  J "C5'" 1 
ATOM 1948  C "C4'" . DA  A 1 95  ? 74.359  -17.710 58.975  1.00 618.25 ?  -218 DA  J "C4'" 1 
ATOM 1949  O "O4'" . DA  A 1 95  ? 75.639  -17.296 58.447  1.00 619.16 ?  -218 DA  J "O4'" 1 
ATOM 1950  C "C3'" . DA  A 1 95  ? 73.308  -17.290 57.953  1.00 618.55 ?  -218 DA  J "C3'" 1 
ATOM 1951  O "O3'" . DA  A 1 95  ? 72.661  -16.105 58.401  1.00 617.97 ?  -218 DA  J "O3'" 1 
ATOM 1952  C "C2'" . DA  A 1 95  ? 74.106  -17.062 56.671  1.00 619.62 ?  -218 DA  J "C2'" 1 
ATOM 1953  C "C1'" . DA  A 1 95  ? 75.470  -16.649 57.203  1.00 621.69 ?  -218 DA  J "C1'" 1 
ATOM 1954  N N9    . DA  A 1 95  ? 76.616  -17.033 56.381  1.00 622.59 ?  -218 DA  J N9    1 
ATOM 1955  C C8    . DA  A 1 95  ? 76.946  -18.290 55.955  1.00 623.11 ?  -218 DA  J C8    1 
ATOM 1956  N N7    . DA  A 1 95  ? 78.044  -18.347 55.240  1.00 622.95 ?  -218 DA  J N7    1 
ATOM 1957  C C5    . DA  A 1 95  ? 78.471  -17.031 55.194  1.00 623.36 ?  -218 DA  J C5    1 
ATOM 1958  C C6    . DA  A 1 95  ? 79.588  -16.404 54.589  1.00 623.09 ?  -218 DA  J C6    1 
ATOM 1959  N N6    . DA  A 1 95  ? 80.507  -17.066 53.884  1.00 623.22 ?  -218 DA  J N6    1 
ATOM 1960  N N1    . DA  A 1 95  ? 79.729  -15.065 54.729  1.00 622.93 ?  -218 DA  J N1    1 
ATOM 1961  C C2    . DA  A 1 95  ? 78.807  -14.398 55.434  1.00 623.08 ?  -218 DA  J C2    1 
ATOM 1962  N N3    . DA  A 1 95  ? 77.720  -14.874 56.048  1.00 623.65 ?  -218 DA  J N3    1 
ATOM 1963  C C4    . DA  A 1 95  ? 77.606  -16.208 55.895  1.00 623.28 ?  -218 DA  J C4    1 
ATOM 1964  P P     . DG  A 1 96  ? 71.378  -15.496 57.663  1.00 608.91 ?  -217 DG  J P     1 
ATOM 1965  O OP1   . DG  A 1 96  ? 70.592  -14.891 58.747  1.00 609.31 ?  -217 DG  J OP1   1 
ATOM 1966  O OP2   . DG  A 1 96  ? 70.741  -16.454 56.743  1.00 608.44 -1 -217 DG  J OP2   1 
ATOM 1967  O "O5'" . DG  A 1 96  ? 72.018  -14.405 56.700  1.00 610.84 ?  -217 DG  J "O5'" 1 
ATOM 1968  C "C5'" . DG  A 1 96  ? 72.746  -13.311 57.204  1.00 614.97 ?  -217 DG  J "C5'" 1 
ATOM 1969  C "C4'" . DG  A 1 96  ? 73.278  -12.475 56.055  1.00 618.58 ?  -217 DG  J "C4'" 1 
ATOM 1970  O "O4'" . DG  A 1 96  ? 74.480  -13.066 55.506  1.00 620.68 ?  -217 DG  J "O4'" 1 
ATOM 1971  C "C3'" . DG  A 1 96  ? 72.331  -12.266 54.877  1.00 619.99 ?  -217 DG  J "C3'" 1 
ATOM 1972  O "O3'" . DG  A 1 96  ? 72.473  -10.930 54.464  1.00 621.59 ?  -217 DG  J "O3'" 1 
ATOM 1973  C "C2'" . DG  A 1 96  ? 72.865  -13.207 53.810  1.00 621.24 ?  -217 DG  J "C2'" 1 
ATOM 1974  C "C1'" . DG  A 1 96  ? 74.358  -13.176 54.104  1.00 623.03 ?  -217 DG  J "C1'" 1 
ATOM 1975  N N9    . DG  A 1 96  ? 75.031  -14.402 53.702  1.00 623.70 ?  -217 DG  J N9    1 
ATOM 1976  C C8    . DG  A 1 96  ? 74.585  -15.682 53.925  1.00 624.16 ?  -217 DG  J C8    1 
ATOM 1977  N N7    . DG  A 1 96  ? 75.380  -16.604 53.468  1.00 624.37 ?  -217 DG  J N7    1 
ATOM 1978  C C5    . DG  A 1 96  ? 76.419  -15.881 52.898  1.00 624.31 ?  -217 DG  J C5    1 
ATOM 1979  C C6    . DG  A 1 96  ? 77.578  -16.343 52.235  1.00 624.16 ?  -217 DG  J C6    1 
ATOM 1980  O O6    . DG  A 1 96  ? 77.915  -17.516 52.031  1.00 624.14 ?  -217 DG  J O6    1 
ATOM 1981  N N1    . DG  A 1 96  ? 78.393  -15.293 51.806  1.00 624.13 ?  -217 DG  J N1    1 
ATOM 1982  C C2    . DG  A 1 96  ? 78.112  -13.959 51.986  1.00 624.01 ?  -217 DG  J C2    1 
ATOM 1983  N N2    . DG  A 1 96  ? 79.016  -13.095 51.496  1.00 623.97 ?  -217 DG  J N2    1 
ATOM 1984  N N3    . DG  A 1 96  ? 77.022  -13.513 52.605  1.00 624.09 ?  -217 DG  J N3    1 
ATOM 1985  C C4    . DG  A 1 96  ? 76.225  -14.523 53.036  1.00 623.95 ?  -217 DG  J C4    1 
ATOM 1986  P P     . DC  A 1 97  ? 71.509  -10.246 53.396  1.00 621.46 ?  -216 DC  J P     1 
ATOM 1987  O OP1   . DC  A 1 97  ? 71.002  -9.011  54.033  1.00 621.53 ?  -216 DC  J OP1   1 
ATOM 1988  O OP2   . DC  A 1 97  ? 70.546  -11.246 52.883  1.00 621.26 -1 -216 DC  J OP2   1 
ATOM 1989  O "O5'" . DC  A 1 97  ? 72.525  -9.872  52.216  1.00 623.06 ?  -216 DC  J "O5'" 1 
ATOM 1990  C "C5'" . DC  A 1 97  ? 73.915  -9.700  52.483  1.00 626.65 ?  -216 DC  J "C5'" 1 
ATOM 1991  C "C4'" . DC  A 1 97  ? 74.705  -9.461  51.204  1.00 629.69 ?  -216 DC  J "C4'" 1 
ATOM 1992  O "O4'" . DC  A 1 97  ? 75.544  -10.601 50.890  1.00 630.48 ?  -216 DC  J "O4'" 1 
ATOM 1993  C "C3'" . DC  A 1 97  ? 73.857  -9.199  49.968  1.00 631.38 ?  -216 DC  J "C3'" 1 
ATOM 1994  O "O3'" . DC  A 1 97  ? 74.390  -8.107  49.249  1.00 633.62 ?  -216 DC  J "O3'" 1 
ATOM 1995  C "C2'" . DC  A 1 97  ? 73.927  -10.484 49.150  1.00 631.54 ?  -216 DC  J "C2'" 1 
ATOM 1996  C "C1'" . DC  A 1 97  ? 75.236  -11.116 49.605  1.00 631.60 ?  -216 DC  J "C1'" 1 
ATOM 1997  N N1    . DC  A 1 97  ? 75.144  -12.599 49.728  1.00 632.18 ?  -216 DC  J N1    1 
ATOM 1998  C C2    . DC  A 1 97  ? 76.158  -13.432 49.213  1.00 631.98 ?  -216 DC  J C2    1 
ATOM 1999  O O2    . DC  A 1 97  ? 77.141  -12.945 48.639  1.00 631.98 ?  -216 DC  J O2    1 
ATOM 2000  N N3    . DC  A 1 97  ? 76.020  -14.776 49.361  1.00 631.93 ?  -216 DC  J N3    1 
ATOM 2001  C C4    . DC  A 1 97  ? 74.949  -15.289 49.980  1.00 631.96 ?  -216 DC  J C4    1 
ATOM 2002  N N4    . DC  A 1 97  ? 74.864  -16.616 50.100  1.00 631.99 ?  -216 DC  J N4    1 
ATOM 2003  C C5    . DC  A 1 97  ? 73.911  -14.464 50.512  1.00 632.33 ?  -216 DC  J C5    1 
ATOM 2004  C C6    . DC  A 1 97  ? 74.052  -13.141 50.363  1.00 632.63 ?  -216 DC  J C6    1 
ATOM 2005  P P     . DG  A 1 98  ? 73.433  -7.260  48.288  1.00 618.41 ?  -215 DG  J P     1 
ATOM 2006  O OP1   . DG  A 1 98  ? 73.902  -5.856  48.345  1.00 618.07 ?  -215 DG  J OP1   1 
ATOM 2007  O OP2   . DG  A 1 98  ? 72.021  -7.581  48.620  1.00 617.78 -1 -215 DG  J OP2   1 
ATOM 2008  O "O5'" . DG  A 1 98  ? 73.733  -7.870  46.837  1.00 620.07 ?  -215 DG  J "O5'" 1 
ATOM 2009  C "C5'" . DG  A 1 98  ? 75.050  -7.898  46.282  1.00 623.16 ?  -215 DG  J "C5'" 1 
ATOM 2010  C "C4'" . DG  A 1 98  ? 75.121  -8.800  45.050  1.00 625.82 ?  -215 DG  J "C4'" 1 
ATOM 2011  O "O4'" . DG  A 1 98  ? 74.966  -10.195 45.407  1.00 626.42 ?  -215 DG  J "O4'" 1 
ATOM 2012  C "C3'" . DG  A 1 98  ? 74.072  -8.592  43.955  1.00 627.34 ?  -215 DG  J "C3'" 1 
ATOM 2013  O "O3'" . DG  A 1 98  ? 74.613  -9.108  42.736  1.00 629.20 ?  -215 DG  J "O3'" 1 
ATOM 2014  C "C2'" . DG  A 1 98  ? 72.958  -9.531  44.411  1.00 626.96 ?  -215 DG  J "C2'" 1 
ATOM 2015  C "C1'" . DG  A 1 98  ? 73.876  -10.720 44.667  1.00 626.92 ?  -215 DG  J "C1'" 1 
ATOM 2016  N N9    . DG  A 1 98  ? 73.366  -11.861 45.412  1.00 627.11 ?  -215 DG  J N9    1 
ATOM 2017  C C8    . DG  A 1 98  ? 72.213  -11.999 46.155  1.00 627.16 ?  -215 DG  J C8    1 
ATOM 2018  N N7    . DG  A 1 98  ? 72.091  -13.182 46.698  1.00 627.03 ?  -215 DG  J N7    1 
ATOM 2019  C C5    . DG  A 1 98  ? 73.238  -13.857 46.292  1.00 627.18 ?  -215 DG  J C5    1 
ATOM 2020  C C6    . DG  A 1 98  ? 73.675  -15.178 46.560  1.00 627.17 ?  -215 DG  J C6    1 
ATOM 2021  O O6    . DG  A 1 98  ? 73.099  -16.037 47.244  1.00 626.99 ?  -215 DG  J O6    1 
ATOM 2022  N N1    . DG  A 1 98  ? 74.909  -15.459 45.951  1.00 627.13 ?  -215 DG  J N1    1 
ATOM 2023  C C2    . DG  A 1 98  ? 75.632  -14.576 45.173  1.00 626.92 ?  -215 DG  J C2    1 
ATOM 2024  N N2    . DG  A 1 98  ? 76.789  -15.013 44.662  1.00 626.96 ?  -215 DG  J N2    1 
ATOM 2025  N N3    . DG  A 1 98  ? 75.230  -13.341 44.911  1.00 626.97 ?  -215 DG  J N3    1 
ATOM 2026  C C4    . DG  A 1 98  ? 74.035  -13.055 45.502  1.00 627.29 ?  -215 DG  J C4    1 
ATOM 2027  P P     . DG  A 1 99  ? 75.406  -8.292  41.606  1.00 621.73 ?  -214 DG  J P     1 
ATOM 2028  O OP1   . DG  A 1 99  ? 75.965  -7.342  42.607  1.00 621.45 ?  -214 DG  J OP1   1 
ATOM 2029  O OP2   . DG  A 1 99  ? 74.063  -8.236  40.955  1.00 621.70 -1 -214 DG  J OP2   1 
ATOM 2030  O "O5'" . DG  A 1 99  ? 76.229  -9.673  41.535  1.00 622.88 ?  -214 DG  J "O5'" 1 
ATOM 2031  C "C5'" . DG  A 1 99  ? 76.896  -10.083 40.348  1.00 624.61 ?  -214 DG  J "C5'" 1 
ATOM 2032  C "C4'" . DG  A 1 99  ? 76.190  -11.293 39.775  1.00 625.87 ?  -214 DG  J "C4'" 1 
ATOM 2033  O "O4'" . DG  A 1 99  ? 75.854  -12.203 40.852  1.00 626.20 ?  -214 DG  J "O4'" 1 
ATOM 2034  C "C3'" . DG  A 1 99  ? 74.864  -10.964 39.079  1.00 626.77 ?  -214 DG  J "C3'" 1 
ATOM 2035  O "O3'" . DG  A 1 99  ? 74.984  -11.067 37.638  1.00 628.07 ?  -214 DG  J "O3'" 1 
ATOM 2036  C "C2'" . DG  A 1 99  ? 73.835  -11.888 39.736  1.00 626.74 ?  -214 DG  J "C2'" 1 
ATOM 2037  C "C1'" . DG  A 1 99  ? 74.749  -12.932 40.370  1.00 627.07 ?  -214 DG  J "C1'" 1 
ATOM 2038  N N9    . DG  A 1 99  ? 74.110  -13.781 41.382  1.00 627.26 ?  -214 DG  J N9    1 
ATOM 2039  C C8    . DG  A 1 99  ? 72.979  -13.505 42.117  1.00 627.24 ?  -214 DG  J C8    1 
ATOM 2040  N N7    . DG  A 1 99  ? 72.632  -14.469 42.923  1.00 627.20 ?  -214 DG  J N7    1 
ATOM 2041  C C5    . DG  A 1 99  ? 73.586  -15.455 42.705  1.00 627.28 ?  -214 DG  J C5    1 
ATOM 2042  C C6    . DG  A 1 99  ? 73.731  -16.739 43.295  1.00 627.34 ?  -214 DG  J C6    1 
ATOM 2043  O O6    . DG  A 1 99  ? 73.013  -17.263 44.157  1.00 627.27 ?  -214 DG  J O6    1 
ATOM 2044  N N1    . DG  A 1 99  ? 74.838  -17.434 42.800  1.00 627.27 ?  -214 DG  J N1    1 
ATOM 2045  C C2    . DG  A 1 99  ? 75.698  -16.945 41.844  1.00 627.21 ?  -214 DG  J C2    1 
ATOM 2046  N N2    . DG  A 1 99  ? 76.707  -17.750 41.482  1.00 627.18 ?  -214 DG  J N2    1 
ATOM 2047  N N3    . DG  A 1 99  ? 75.574  -15.745 41.281  1.00 627.36 ?  -214 DG  J N3    1 
ATOM 2048  C C4    . DG  A 1 99  ? 74.502  -15.052 41.756  1.00 627.34 ?  -214 DG  J C4    1 
ATOM 2049  P P     . DT  A 1 100 ? 74.608  -12.321 36.703  1.00 615.90 ?  -213 DT  J P     1 
ATOM 2050  O OP1   . DT  A 1 100 ? 75.059  -11.968 35.336  1.00 615.96 ?  -213 DT  J OP1   1 
ATOM 2051  O OP2   . DT  A 1 100 ? 73.181  -12.664 36.919  1.00 615.69 -1 -213 DT  J OP2   1 
ATOM 2052  O "O5'" . DT  A 1 100 ? 75.533  -13.508 37.260  1.00 616.38 ?  -213 DT  J "O5'" 1 
ATOM 2053  C "C5'" . DT  A 1 100 ? 76.283  -14.360 36.383  1.00 616.83 ?  -213 DT  J "C5'" 1 
ATOM 2054  C "C4'" . DT  A 1 100 ? 75.598  -15.704 36.172  1.00 617.26 ?  -213 DT  J "C4'" 1 
ATOM 2055  O "O4'" . DT  A 1 100 ? 74.935  -16.149 37.390  1.00 617.00 ?  -213 DT  J "O4'" 1 
ATOM 2056  C "C3'" . DT  A 1 100 ? 74.536  -15.756 35.072  1.00 617.77 ?  -213 DT  J "C3'" 1 
ATOM 2057  O "O3'" . DT  A 1 100 ? 74.703  -16.963 34.306  1.00 618.85 ?  -213 DT  J "O3'" 1 
ATOM 2058  C "C2'" . DT  A 1 100 ? 73.238  -15.767 35.876  1.00 617.29 ?  -213 DT  J "C2'" 1 
ATOM 2059  C "C1'" . DT  A 1 100 ? 73.662  -16.656 37.040  1.00 616.54 ?  -213 DT  J "C1'" 1 
ATOM 2060  N N1    . DT  A 1 100 ? 72.760  -16.635 38.237  1.00 616.16 ?  -213 DT  J N1    1 
ATOM 2061  C C2    . DT  A 1 100 ? 72.900  -17.596 39.223  1.00 615.91 ?  -213 DT  J C2    1 
ATOM 2062  O O2    . DT  A 1 100 ? 73.727  -18.491 39.193  1.00 615.90 ?  -213 DT  J O2    1 
ATOM 2063  N N3    . DT  A 1 100 ? 72.019  -17.469 40.268  1.00 615.91 ?  -213 DT  J N3    1 
ATOM 2064  C C4    . DT  A 1 100 ? 71.034  -16.503 40.419  1.00 616.12 ?  -213 DT  J C4    1 
ATOM 2065  O O4    . DT  A 1 100 ? 70.297  -16.478 41.396  1.00 616.11 ?  -213 DT  J O4    1 
ATOM 2066  C C5    . DT  A 1 100 ? 70.940  -15.531 39.354  1.00 616.07 ?  -213 DT  J C5    1 
ATOM 2067  C C7    . DT  A 1 100 ? 69.918  -14.431 39.392  1.00 616.04 ?  -213 DT  J C7    1 
ATOM 2068  C C6    . DT  A 1 100 ? 71.797  -15.646 38.334  1.00 616.15 ?  -213 DT  J C6    1 
ATOM 2069  P P     . DG  A 1 101 ? 73.780  -17.347 33.041  1.00 626.45 ?  -212 DG  J P     1 
ATOM 2070  O OP1   . DG  A 1 101 ? 74.174  -16.441 31.936  1.00 626.45 ?  -212 DG  J OP1   1 
ATOM 2071  O OP2   . DG  A 1 101 ? 72.354  -17.412 33.452  1.00 626.17 -1 -212 DG  J OP2   1 
ATOM 2072  O "O5'" . DG  A 1 101 ? 74.245  -18.850 32.702  1.00 625.94 ?  -212 DG  J "O5'" 1 
ATOM 2073  C "C5'" . DG  A 1 101 ? 74.570  -19.810 33.725  1.00 625.08 ?  -212 DG  J "C5'" 1 
ATOM 2074  C "C4'" . DG  A 1 101 ? 73.383  -20.661 34.167  1.00 624.38 ?  -212 DG  J "C4'" 1 
ATOM 2075  O "O4'" . DG  A 1 101 ? 72.808  -20.125 35.390  1.00 624.67 ?  -212 DG  J "O4'" 1 
ATOM 2076  C "C3'" . DG  A 1 101 ? 72.228  -20.818 33.172  1.00 623.73 ?  -212 DG  J "C3'" 1 
ATOM 2077  O "O3'" . DG  A 1 101 ? 72.220  -22.155 32.615  1.00 622.46 ?  -212 DG  J "O3'" 1 
ATOM 2078  C "C2'" . DG  A 1 101 ? 70.988  -20.462 33.998  1.00 624.22 ?  -212 DG  J "C2'" 1 
ATOM 2079  C "C1'" . DG  A 1 101 ? 71.469  -20.573 35.445  1.00 624.54 ?  -212 DG  J "C1'" 1 
ATOM 2080  N N9    . DG  A 1 101 ? 70.645  -19.793 36.383  1.00 624.64 ?  -212 DG  J N9    1 
ATOM 2081  C C8    . DG  A 1 101 ? 70.380  -18.440 36.323  1.00 624.58 ?  -212 DG  J C8    1 
ATOM 2082  N N7    . DG  A 1 101 ? 69.601  -18.009 37.274  1.00 624.47 ?  -212 DG  J N7    1 
ATOM 2083  C C5    . DG  A 1 101 ? 69.320  -19.146 38.017  1.00 624.49 ?  -212 DG  J C5    1 
ATOM 2084  C C6    . DG  A 1 101 ? 68.521  -19.291 39.177  1.00 624.47 ?  -212 DG  J C6    1 
ATOM 2085  O O6    . DG  A 1 101 ? 67.896  -18.409 39.776  1.00 624.48 ?  -212 DG  J O6    1 
ATOM 2086  N N1    . DG  A 1 101 ? 68.486  -20.609 39.637  1.00 624.41 ?  -212 DG  J N1    1 
ATOM 2087  C C2    . DG  A 1 101 ? 69.145  -21.657 39.038  1.00 624.42 ?  -212 DG  J C2    1 
ATOM 2088  N N2    . DG  A 1 101 ? 69.001  -22.856 39.617  1.00 624.42 ?  -212 DG  J N2    1 
ATOM 2089  N N3    . DG  A 1 101 ? 69.902  -21.534 37.948  1.00 624.47 ?  -212 DG  J N3    1 
ATOM 2090  C C4    . DG  A 1 101 ? 69.949  -20.255 37.487  1.00 624.52 ?  -212 DG  J C4    1 
ATOM 2091  P P     . DC  A 1 102 ? 70.908  -22.973 32.157  1.00 615.61 ?  -211 DC  J P     1 
ATOM 2092  O OP1   . DC  A 1 102 ? 71.372  -24.111 31.335  1.00 615.88 ?  -211 DC  J OP1   1 
ATOM 2093  O OP2   . DC  A 1 102 ? 69.900  -22.050 31.582  1.00 615.65 -1 -211 DC  J OP2   1 
ATOM 2094  O "O5'" . DC  A 1 102 ? 70.348  -23.510 33.562  1.00 614.71 ?  -211 DC  J "O5'" 1 
ATOM 2095  C "C5'" . DC  A 1 102 ? 70.524  -24.857 34.012  1.00 612.98 ?  -211 DC  J "C5'" 1 
ATOM 2096  C "C4'" . DC  A 1 102 ? 69.189  -25.454 34.441  1.00 611.58 ?  -211 DC  J "C4'" 1 
ATOM 2097  O "O4'" . DC  A 1 102 ? 68.566  -24.614 35.449  1.00 611.49 ?  -211 DC  J "O4'" 1 
ATOM 2098  C "C3'" . DC  A 1 102 ? 68.161  -25.587 33.319  1.00 610.58 ?  -211 DC  J "C3'" 1 
ATOM 2099  O "O3'" . DC  A 1 102 ? 67.365  -26.757 33.500  1.00 608.28 ?  -211 DC  J "O3'" 1 
ATOM 2100  C "C2'" . DC  A 1 102 ? 67.334  -24.318 33.488  1.00 611.12 ?  -211 DC  J "C2'" 1 
ATOM 2101  C "C1'" . DC  A 1 102 ? 67.268  -24.262 35.009  1.00 611.97 ?  -211 DC  J "C1'" 1 
ATOM 2102  N N1    . DC  A 1 102 ? 66.855  -22.935 35.570  1.00 612.44 ?  -211 DC  J N1    1 
ATOM 2103  C C2    . DC  A 1 102 ? 65.851  -22.882 36.557  1.00 612.64 ?  -211 DC  J C2    1 
ATOM 2104  O O2    . DC  A 1 102 ? 65.325  -23.930 36.955  1.00 612.74 ?  -211 DC  J O2    1 
ATOM 2105  N N3    . DC  A 1 102 ? 65.479  -21.673 37.056  1.00 612.52 ?  -211 DC  J N3    1 
ATOM 2106  C C4    . DC  A 1 102 ? 66.065  -20.556 36.610  1.00 612.48 ?  -211 DC  J C4    1 
ATOM 2107  N N4    . DC  A 1 102 ? 65.671  -19.392 37.128  1.00 612.44 ?  -211 DC  J N4    1 
ATOM 2108  C C5    . DC  A 1 102 ? 67.083  -20.585 35.606  1.00 612.68 ?  -211 DC  J C5    1 
ATOM 2109  C C6    . DC  A 1 102 ? 67.443  -21.783 35.120  1.00 612.58 ?  -211 DC  J C6    1 
ATOM 2110  P P     . DT  A 1 103 ? 66.382  -27.263 32.334  1.00 635.10 ?  -210 DT  J P     1 
ATOM 2111  O OP1   . DT  A 1 103 ? 67.212  -28.066 31.412  1.00 635.48 ?  -210 DT  J OP1   1 
ATOM 2112  O OP2   . DT  A 1 103 ? 65.613  -26.109 31.800  1.00 634.85 -1 -210 DT  J OP2   1 
ATOM 2113  O "O5'" . DT  A 1 103 ? 65.357  -28.250 33.083  1.00 632.48 ?  -210 DT  J "O5'" 1 
ATOM 2114  C "C5'" . DT  A 1 103 ? 65.331  -28.394 34.511  1.00 627.81 ?  -210 DT  J "C5'" 1 
ATOM 2115  C "C4'" . DT  A 1 103 ? 63.993  -28.001 35.138  1.00 624.12 ?  -210 DT  J "C4'" 1 
ATOM 2116  O "O4'" . DT  A 1 103 ? 63.974  -26.589 35.448  1.00 623.70 ?  -210 DT  J "O4'" 1 
ATOM 2117  C "C3'" . DT  A 1 103 ? 62.725  -28.251 34.323  1.00 621.87 ?  -210 DT  J "C3'" 1 
ATOM 2118  O "O3'" . DT  A 1 103 ? 61.721  -28.669 35.222  1.00 618.51 ?  -210 DT  J "O3'" 1 
ATOM 2119  C "C2'" . DT  A 1 103 ? 62.398  -26.868 33.762  1.00 622.57 ?  -210 DT  J "C2'" 1 
ATOM 2120  C "C1'" . DT  A 1 103 ? 62.750  -26.045 34.995  1.00 623.53 ?  -210 DT  J "C1'" 1 
ATOM 2121  N N1    . DT  A 1 103 ? 62.947  -24.561 34.861  1.00 623.80 ?  -210 DT  J N1    1 
ATOM 2122  C C2    . DT  A 1 103 ? 62.370  -23.736 35.820  1.00 623.82 ?  -210 DT  J C2    1 
ATOM 2123  O O2    . DT  A 1 103 ? 61.692  -24.131 36.757  1.00 623.69 ?  -210 DT  J O2    1 
ATOM 2124  N N3    . DT  A 1 103 ? 62.614  -22.401 35.646  1.00 623.30 ?  -210 DT  J N3    1 
ATOM 2125  C C4    . DT  A 1 103 ? 63.356  -21.821 34.638  1.00 623.43 ?  -210 DT  J C4    1 
ATOM 2126  O O4    . DT  A 1 103 ? 63.503  -20.608 34.588  1.00 623.85 ?  -210 DT  J O4    1 
ATOM 2127  C C5    . DT  A 1 103 ? 63.940  -22.730 33.673  1.00 623.61 ?  -210 DT  J C5    1 
ATOM 2128  C C7    . DT  A 1 103 ? 64.767  -22.203 32.534  1.00 623.65 ?  -210 DT  J C7    1 
ATOM 2129  C C6    . DT  A 1 103 ? 63.714  -24.045 33.829  1.00 623.48 ?  -210 DT  J C6    1 
ATOM 2130  P P     . DA  A 1 104 ? 61.445  -30.208 35.554  1.00 626.37 ?  -209 DA  J P     1 
ATOM 2131  O OP1   . DA  A 1 104 ? 62.713  -30.932 35.777  1.00 626.19 ?  -209 DA  J OP1   1 
ATOM 2132  O OP2   . DA  A 1 104 ? 60.483  -30.685 34.542  1.00 626.18 -1 -209 DA  J OP2   1 
ATOM 2133  O "O5'" . DA  A 1 104 ? 60.697  -30.130 36.961  1.00 625.96 ?  -209 DA  J "O5'" 1 
ATOM 2134  C "C5'" . DA  A 1 104 ? 61.354  -29.557 38.101  1.00 624.94 ?  -209 DA  J "C5'" 1 
ATOM 2135  C "C4'" . DA  A 1 104 ? 60.383  -28.784 38.985  1.00 623.82 ?  -209 DA  J "C4'" 1 
ATOM 2136  O "O4'" . DA  A 1 104 ? 60.163  -27.460 38.435  1.00 624.73 ?  -209 DA  J "O4'" 1 
ATOM 2137  C "C3'" . DA  A 1 104 ? 58.997  -29.391 39.131  1.00 622.58 ?  -209 DA  J "C3'" 1 
ATOM 2138  O "O3'" . DA  A 1 104 ? 58.479  -29.074 40.403  1.00 619.94 ?  -209 DA  J "O3'" 1 
ATOM 2139  C "C2'" . DA  A 1 104 ? 58.196  -28.706 38.028  1.00 623.85 ?  -209 DA  J "C2'" 1 
ATOM 2140  C "C1'" . DA  A 1 104 ? 58.808  -27.307 38.041  1.00 625.87 ?  -209 DA  J "C1'" 1 
ATOM 2141  N N9    . DA  A 1 104 ? 58.755  -26.600 36.756  1.00 626.41 ?  -209 DA  J N9    1 
ATOM 2142  C C8    . DA  A 1 104 ? 58.672  -27.146 35.500  1.00 626.83 ?  -209 DA  J C8    1 
ATOM 2143  N N7    . DA  A 1 104 ? 58.636  -26.263 34.532  1.00 627.01 ?  -209 DA  J N7    1 
ATOM 2144  C C5    . DA  A 1 104 ? 58.709  -25.049 35.195  1.00 626.73 ?  -209 DA  J C5    1 
ATOM 2145  C C6    . DA  A 1 104 ? 58.716  -23.715 34.736  1.00 626.62 ?  -209 DA  J C6    1 
ATOM 2146  N N6    . DA  A 1 104 ? 58.650  -23.374 33.447  1.00 626.58 ?  -209 DA  J N6    1 
ATOM 2147  N N1    . DA  A 1 104 ? 58.786  -22.731 35.659  1.00 626.85 ?  -209 DA  J N1    1 
ATOM 2148  C C2    . DA  A 1 104 ? 58.847  -23.068 36.959  1.00 626.95 ?  -209 DA  J C2    1 
ATOM 2149  N N3    . DA  A 1 104 ? 58.851  -24.284 37.506  1.00 626.84 ?  -209 DA  J N3    1 
ATOM 2150  C C4    . DA  A 1 104 ? 58.777  -25.240 36.563  1.00 626.54 ?  -209 DA  J C4    1 
ATOM 2151  P P     . DG  A 1 105 ? 57.326  -29.985 41.029  1.00 624.45 ?  -208 DG  J P     1 
ATOM 2152  O OP1   . DG  A 1 105 ? 57.949  -30.745 42.130  1.00 624.38 ?  -208 DG  J OP1   1 
ATOM 2153  O OP2   . DG  A 1 105 ? 56.601  -30.670 39.938  1.00 624.40 -1 -208 DG  J OP2   1 
ATOM 2154  O "O5'" . DG  A 1 105 ? 56.273  -28.958 41.639  1.00 624.79 ?  -208 DG  J "O5'" 1 
ATOM 2155  C "C5'" . DG  A 1 105 ? 56.639  -27.614 41.904  1.00 624.41 ?  -208 DG  J "C5'" 1 
ATOM 2156  C "C4'" . DG  A 1 105 ? 55.681  -26.612 41.284  1.00 623.35 ?  -208 DG  J "C4'" 1 
ATOM 2157  O "O4'" . DG  A 1 105 ? 56.104  -26.343 39.925  1.00 623.26 ?  -208 DG  J "O4'" 1 
ATOM 2158  C "C3'" . DG  A 1 105 ? 54.197  -27.004 41.242  1.00 622.28 ?  -208 DG  J "C3'" 1 
ATOM 2159  O "O3'" . DG  A 1 105 ? 53.435  -25.994 41.887  1.00 620.57 ?  -208 DG  J "O3'" 1 
ATOM 2160  C "C2'" . DG  A 1 105 ? 53.884  -27.043 39.752  1.00 622.82 ?  -208 DG  J "C2'" 1 
ATOM 2161  C "C1'" . DG  A 1 105 ? 54.916  -26.045 39.229  1.00 624.61 ?  -208 DG  J "C1'" 1 
ATOM 2162  N N9    . DG  A 1 105 ? 55.157  -26.059 37.790  1.00 624.93 ?  -208 DG  J N9    1 
ATOM 2163  C C8    . DG  A 1 105 ? 55.314  -27.143 36.962  1.00 625.30 ?  -208 DG  J C8    1 
ATOM 2164  N N7    . DG  A 1 105 ? 55.514  -26.816 35.715  1.00 625.69 ?  -208 DG  J N7    1 
ATOM 2165  C C5    . DG  A 1 105 ? 55.483  -25.426 35.710  1.00 625.51 ?  -208 DG  J C5    1 
ATOM 2166  C C6    . DG  A 1 105 ? 55.635  -24.499 34.645  1.00 625.18 ?  -208 DG  J C6    1 
ATOM 2167  O O6    . DG  A 1 105 ? 55.842  -24.722 33.444  1.00 625.12 ?  -208 DG  J O6    1 
ATOM 2168  N N1    . DG  A 1 105 ? 55.537  -23.180 35.084  1.00 625.21 ?  -208 DG  J N1    1 
ATOM 2169  C C2    . DG  A 1 105 ? 55.319  -22.809 36.390  1.00 625.29 ?  -208 DG  J C2    1 
ATOM 2170  N N2    . DG  A 1 105 ? 55.249  -21.497 36.638  1.00 625.40 ?  -208 DG  J N2    1 
ATOM 2171  N N3    . DG  A 1 105 ? 55.173  -23.660 37.393  1.00 625.41 ?  -208 DG  J N3    1 
ATOM 2172  C C4    . DG  A 1 105 ? 55.266  -24.949 36.983  1.00 625.39 ?  -208 DG  J C4    1 
ATOM 2173  P P     . DA  A 1 106 ? 52.223  -26.258 42.911  1.00 615.41 ?  -207 DA  J P     1 
ATOM 2174  O OP1   . DA  A 1 106 ? 52.766  -26.580 44.237  1.00 614.33 ?  -207 DA  J OP1   1 
ATOM 2175  O OP2   . DA  A 1 106 ? 51.181  -27.120 42.322  1.00 614.50 -1 -207 DA  J OP2   1 
ATOM 2176  O "O5'" . DA  A 1 106 ? 51.641  -24.780 42.954  1.00 618.39 ?  -207 DA  J "O5'" 1 
ATOM 2177  C "C5'" . DA  A 1 106 ? 52.563  -23.690 43.032  1.00 621.91 ?  -207 DA  J "C5'" 1 
ATOM 2178  C "C4'" . DA  A 1 106 ? 52.161  -22.544 42.125  1.00 624.51 ?  -207 DA  J "C4'" 1 
ATOM 2179  O "O4'" . DA  A 1 106 ? 52.458  -22.854 40.742  1.00 624.80 ?  -207 DA  J "O4'" 1 
ATOM 2180  C "C3'" . DA  A 1 106 ? 50.684  -22.156 42.184  1.00 626.34 ?  -207 DA  J "C3'" 1 
ATOM 2181  O "O3'" . DA  A 1 106 ? 50.630  -20.728 42.371  1.00 628.54 ?  -207 DA  J "O3'" 1 
ATOM 2182  C "C2'" . DA  A 1 106 ? 50.116  -22.664 40.852  1.00 625.84 ?  -207 DA  J "C2'" 1 
ATOM 2183  C "C1'" . DA  A 1 106 ? 51.334  -22.563 39.938  1.00 625.95 ?  -207 DA  J "C1'" 1 
ATOM 2184  N N9    . DA  A 1 106 ? 51.402  -23.488 38.812  1.00 626.30 ?  -207 DA  J N9    1 
ATOM 2185  C C8    . DA  A 1 106 ? 51.218  -24.844 38.836  1.00 626.48 ?  -207 DA  J C8    1 
ATOM 2186  N N7    . DA  A 1 106 ? 51.364  -25.421 37.665  1.00 626.68 ?  -207 DA  J N7    1 
ATOM 2187  C C5    . DA  A 1 106 ? 51.676  -24.370 36.812  1.00 626.77 ?  -207 DA  J C5    1 
ATOM 2188  C C6    . DA  A 1 106 ? 51.954  -24.306 35.424  1.00 626.57 ?  -207 DA  J C6    1 
ATOM 2189  N N6    . DA  A 1 106 ? 51.959  -25.379 34.625  1.00 626.30 ?  -207 DA  J N6    1 
ATOM 2190  N N1    . DA  A 1 106 ? 52.226  -23.092 34.886  1.00 626.63 ?  -207 DA  J N1    1 
ATOM 2191  C C2    . DA  A 1 106 ? 52.220  -22.008 35.679  1.00 626.43 ?  -207 DA  J C2    1 
ATOM 2192  N N3    . DA  A 1 106 ? 51.979  -21.947 36.990  1.00 626.33 ?  -207 DA  J N3    1 
ATOM 2193  C C4    . DA  A 1 106 ? 51.710  -23.168 37.504  1.00 626.59 ?  -207 DA  J C4    1 
ATOM 2194  P P     . DG  A 1 107 ? 49.368  -19.935 42.958  1.00 622.76 ?  -206 DG  J P     1 
ATOM 2195  O OP1   . DG  A 1 107 ? 49.902  -18.842 43.792  1.00 622.70 ?  -206 DG  J OP1   1 
ATOM 2196  O OP2   . DG  A 1 107 ? 48.380  -20.877 43.524  1.00 622.83 -1 -206 DG  J OP2   1 
ATOM 2197  O "O5'" . DG  A 1 107 ? 48.762  -19.308 41.621  1.00 625.47 ?  -206 DG  J "O5'" 1 
ATOM 2198  C "C5'" . DG  A 1 107 ? 49.639  -18.615 40.718  1.00 629.81 ?  -206 DG  J "C5'" 1 
ATOM 2199  C "C4'" . DG  A 1 107 ? 49.013  -18.409 39.348  1.00 633.06 ?  -206 DG  J "C4'" 1 
ATOM 2200  O "O4'" . DG  A 1 107 ? 49.298  -19.542 38.487  1.00 633.64 ?  -206 DG  J "O4'" 1 
ATOM 2201  C "C3'" . DG  A 1 107 ? 47.493  -18.248 39.341  1.00 635.39 ?  -206 DG  J "C3'" 1 
ATOM 2202  O "O3'" . DG  A 1 107 ? 47.157  -17.229 38.400  1.00 638.87 ?  -206 DG  J "O3'" 1 
ATOM 2203  C "C2'" . DG  A 1 107 ? 47.025  -19.639 38.917  1.00 634.78 ?  -206 DG  J "C2'" 1 
ATOM 2204  C "C1'" . DG  A 1 107 ? 48.090  -19.926 37.866  1.00 634.36 ?  -206 DG  J "C1'" 1 
ATOM 2205  N N9    . DG  A 1 107 ? 48.148  -21.304 37.375  1.00 634.48 ?  -206 DG  J N9    1 
ATOM 2206  C C8    . DG  A 1 107 ? 47.839  -22.467 38.042  1.00 634.51 ?  -206 DG  J C8    1 
ATOM 2207  N N7    . DG  A 1 107 ? 47.984  -23.542 37.314  1.00 634.43 ?  -206 DG  J N7    1 
ATOM 2208  C C5    . DG  A 1 107 ? 48.414  -23.062 36.086  1.00 634.44 ?  -206 DG  J C5    1 
ATOM 2209  C C6    . DG  A 1 107 ? 48.735  -23.749 34.893  1.00 634.38 ?  -206 DG  J C6    1 
ATOM 2210  O O6    . DG  A 1 107 ? 48.705  -24.964 34.684  1.00 634.51 ?  -206 DG  J O6    1 
ATOM 2211  N N1    . DG  A 1 107 ? 49.131  -22.886 33.871  1.00 634.66 ?  -206 DG  J N1    1 
ATOM 2212  C C2    . DG  A 1 107 ? 49.203  -21.514 33.985  1.00 634.64 ?  -206 DG  J C2    1 
ATOM 2213  N N2    . DG  A 1 107 ? 49.604  -20.831 32.899  1.00 634.46 ?  -206 DG  J N2    1 
ATOM 2214  N N3    . DG  A 1 107 ? 48.902  -20.858 35.100  1.00 634.68 ?  -206 DG  J N3    1 
ATOM 2215  C C4    . DG  A 1 107 ? 48.517  -21.688 36.105  1.00 634.57 ?  -206 DG  J C4    1 
ATOM 2216  P P     . DC  A 1 108 ? 45.652  -16.724 38.184  1.00 639.98 ?  -205 DC  J P     1 
ATOM 2217  O OP1   . DC  A 1 108 ? 45.280  -15.958 39.397  1.00 639.72 ?  -205 DC  J OP1   1 
ATOM 2218  O OP2   . DC  A 1 108 ? 44.799  -17.854 37.742  1.00 639.64 -1 -205 DC  J OP2   1 
ATOM 2219  O "O5'" . DC  A 1 108 ? 45.791  -15.740 36.923  1.00 641.96 ?  -205 DC  J "O5'" 1 
ATOM 2220  C "C5'" . DC  A 1 108 ? 46.811  -15.910 35.926  1.00 644.89 ?  -205 DC  J "C5'" 1 
ATOM 2221  C "C4'" . DC  A 1 108 ? 46.342  -16.690 34.703  1.00 647.40 ?  -205 DC  J "C4'" 1 
ATOM 2222  O "O4'" . DC  A 1 108 ? 46.531  -18.123 34.881  1.00 647.84 ?  -205 DC  J "O4'" 1 
ATOM 2223  C "C3'" . DC  A 1 108 ? 44.879  -16.516 34.281  1.00 649.22 ?  -205 DC  J "C3'" 1 
ATOM 2224  O "O3'" . DC  A 1 108 ? 44.852  -16.063 32.915  1.00 652.02 ?  -205 DC  J "O3'" 1 
ATOM 2225  C "C2'" . DC  A 1 108 ? 44.295  -17.921 34.457  1.00 648.89 ?  -205 DC  J "C2'" 1 
ATOM 2226  C "C1'" . DC  A 1 108 ? 45.523  -18.761 34.124  1.00 648.21 ?  -205 DC  J "C1'" 1 
ATOM 2227  N N1    . DC  A 1 108 ? 45.445  -20.259 34.402  1.00 648.30 ?  -205 DC  J N1    1 
ATOM 2228  C C2    . DC  A 1 108 ? 45.716  -21.172 33.360  1.00 648.28 ?  -205 DC  J C2    1 
ATOM 2229  O O2    . DC  A 1 108 ? 46.011  -20.753 32.235  1.00 648.23 ?  -205 DC  J O2    1 
ATOM 2230  N N3    . DC  A 1 108 ? 45.649  -22.510 33.609  1.00 648.12 ?  -205 DC  J N3    1 
ATOM 2231  C C4    . DC  A 1 108 ? 45.331  -22.953 34.827  1.00 648.02 ?  -205 DC  J C4    1 
ATOM 2232  N N4    . DC  A 1 108 ? 45.280  -24.276 35.014  1.00 647.98 ?  -205 DC  J N4    1 
ATOM 2233  C C5    . DC  A 1 108 ? 45.049  -22.052 35.899  1.00 648.08 ?  -205 DC  J C5    1 
ATOM 2234  C C6    . DC  A 1 108 ? 45.120  -20.735 35.647  1.00 648.26 ?  -205 DC  J C6    1 
ATOM 2235  P P     . DT  A 1 109 ? 43.505  -15.836 32.063  1.00 648.16 ?  -204 DT  J P     1 
ATOM 2236  O OP1   . DT  A 1 109 ? 43.806  -14.770 31.079  1.00 647.96 ?  -204 DT  J OP1   1 
ATOM 2237  O OP2   . DT  A 1 109 ? 42.370  -15.682 33.007  1.00 647.82 -1 -204 DT  J OP2   1 
ATOM 2238  O "O5'" . DT  A 1 109 ? 43.284  -17.218 31.272  1.00 649.58 ?  -204 DT  J "O5'" 1 
ATOM 2239  C "C5'" . DT  A 1 109 ? 44.078  -17.573 30.125  1.00 651.66 ?  -204 DT  J "C5'" 1 
ATOM 2240  C "C4'" . DT  A 1 109 ? 43.636  -18.887 29.491  1.00 653.17 ?  -204 DT  J "C4'" 1 
ATOM 2241  O "O4'" . DT  A 1 109 ? 43.822  -19.993 30.422  1.00 653.55 ?  -204 DT  J "O4'" 1 
ATOM 2242  C "C3'" . DT  A 1 109 ? 42.174  -18.937 29.042  1.00 654.20 ?  -204 DT  J "C3'" 1 
ATOM 2243  O "O3'" . DT  A 1 109 ? 42.063  -19.393 27.682  1.00 655.54 ?  -204 DT  J "O3'" 1 
ATOM 2244  C "C2'" . DT  A 1 109 ? 41.538  -19.917 30.025  1.00 654.13 ?  -204 DT  J "C2'" 1 
ATOM 2245  C "C1'" . DT  A 1 109 ? 42.702  -20.852 30.340  1.00 654.16 ?  -204 DT  J "C1'" 1 
ATOM 2246  N N1    . DT  A 1 109 ? 42.532  -21.663 31.614  1.00 654.32 ?  -204 DT  J N1    1 
ATOM 2247  C C2    . DT  A 1 109 ? 42.723  -23.041 31.611  1.00 654.34 ?  -204 DT  J C2    1 
ATOM 2248  O O2    . DT  A 1 109 ? 43.038  -23.696 30.634  1.00 654.43 ?  -204 DT  J O2    1 
ATOM 2249  N N3    . DT  A 1 109 ? 42.533  -23.652 32.827  1.00 654.27 ?  -204 DT  J N3    1 
ATOM 2250  C C4    . DT  A 1 109 ? 42.176  -23.054 34.024  1.00 654.30 ?  -204 DT  J C4    1 
ATOM 2251  O O4    . DT  A 1 109 ? 42.033  -23.705 35.055  1.00 654.33 ?  -204 DT  J O4    1 
ATOM 2252  C C5    . DT  A 1 109 ? 41.992  -21.620 33.964  1.00 654.36 ?  -204 DT  J C5    1 
ATOM 2253  C C7    . DT  A 1 109 ? 41.601  -20.838 35.186  1.00 654.46 ?  -204 DT  J C7    1 
ATOM 2254  C C6    . DT  A 1 109 ? 42.174  -21.009 32.783  1.00 654.37 ?  -204 DT  J C6    1 
ATOM 2255  P P     . DG  A 1 110 ? 40.791  -19.030 26.761  1.00 644.63 ?  -203 DG  J P     1 
ATOM 2256  O OP1   . DG  A 1 110 ? 41.114  -17.763 26.068  1.00 644.56 ?  -203 DG  J OP1   1 
ATOM 2257  O OP2   . DG  A 1 110 ? 39.556  -19.141 27.580  1.00 644.42 -1 -203 DG  J OP2   1 
ATOM 2258  O "O5'" . DG  A 1 110 ? 40.731  -20.190 25.651  1.00 644.78 ?  -203 DG  J "O5'" 1 
ATOM 2259  C "C5'" . DG  A 1 110 ? 41.358  -21.468 25.833  1.00 644.97 ?  -203 DG  J "C5'" 1 
ATOM 2260  C "C4'" . DG  A 1 110 ? 40.376  -22.638 25.820  1.00 644.98 ?  -203 DG  J "C4'" 1 
ATOM 2261  O "O4'" . DG  A 1 110 ? 40.426  -23.333 27.097  1.00 645.15 ?  -203 DG  J "O4'" 1 
ATOM 2262  C "C3'" . DG  A 1 110 ? 38.893  -22.347 25.584  1.00 644.63 ?  -203 DG  J "C3'" 1 
ATOM 2263  O "O3'" . DG  A 1 110 ? 38.324  -23.452 24.881  1.00 644.03 ?  -203 DG  J "O3'" 1 
ATOM 2264  C "C2'" . DG  A 1 110 ? 38.355  -22.257 27.007  1.00 644.91 ?  -203 DG  J "C2'" 1 
ATOM 2265  C "C1'" . DG  A 1 110 ? 39.122  -23.413 27.643  1.00 645.32 ?  -203 DG  J "C1'" 1 
ATOM 2266  N N9    . DG  A 1 110 ? 39.237  -23.405 29.103  1.00 645.50 ?  -203 DG  J N9    1 
ATOM 2267  C C8    . DG  A 1 110 ? 39.374  -22.319 29.935  1.00 645.46 ?  -203 DG  J C8    1 
ATOM 2268  N N7    . DG  A 1 110 ? 39.462  -22.631 31.197  1.00 645.43 ?  -203 DG  J N7    1 
ATOM 2269  C C5    . DG  A 1 110 ? 39.380  -24.015 31.208  1.00 645.37 ?  -203 DG  J C5    1 
ATOM 2270  C C6    . DG  A 1 110 ? 39.421  -24.921 32.290  1.00 645.28 ?  -203 DG  J C6    1 
ATOM 2271  O O6    . DG  A 1 110 ? 39.537  -24.671 33.493  1.00 645.43 ?  -203 DG  J O6    1 
ATOM 2272  N N1    . DG  A 1 110 ? 39.305  -26.244 31.871  1.00 645.36 ?  -203 DG  J N1    1 
ATOM 2273  C C2    . DG  A 1 110 ? 39.174  -26.639 30.564  1.00 645.36 ?  -203 DG  J C2    1 
ATOM 2274  N N2    . DG  A 1 110 ? 39.077  -27.956 30.349  1.00 645.45 ?  -203 DG  J N2    1 
ATOM 2275  N N3    . DG  A 1 110 ? 39.135  -25.803 29.536  1.00 645.37 ?  -203 DG  J N3    1 
ATOM 2276  C C4    . DG  A 1 110 ? 39.245  -24.508 29.929  1.00 645.47 ?  -203 DG  J C4    1 
ATOM 2277  P P     . DT  A 1 111 ? 37.014  -23.302 23.971  1.00 648.24 ?  -202 DT  J P     1 
ATOM 2278  O OP1   . DT  A 1 111 ? 37.462  -23.100 22.573  1.00 648.00 ?  -202 DT  J OP1   1 
ATOM 2279  O OP2   . DT  A 1 111 ? 36.111  -22.321 24.618  1.00 648.28 -1 -202 DT  J OP2   1 
ATOM 2280  O "O5'" . DT  A 1 111 ? 36.307  -24.736 24.082  1.00 646.93 ?  -202 DT  J "O5'" 1 
ATOM 2281  C "C5'" . DT  A 1 111 ? 36.991  -25.929 23.710  1.00 645.13 ?  -202 DT  J "C5'" 1 
ATOM 2282  C "C4'" . DT  A 1 111 ? 36.479  -27.100 24.530  1.00 643.63 ?  -202 DT  J "C4'" 1 
ATOM 2283  O "O4'" . DT  A 1 111 ? 36.797  -26.911 25.934  1.00 643.48 ?  -202 DT  J "O4'" 1 
ATOM 2284  C "C3'" . DT  A 1 111 ? 34.975  -27.323 24.474  1.00 642.72 ?  -202 DT  J "C3'" 1 
ATOM 2285  O "O3'" . DT  A 1 111 ? 34.774  -28.709 24.368  1.00 641.57 ?  -202 DT  J "O3'" 1 
ATOM 2286  C "C2'" . DT  A 1 111 ? 34.492  -26.790 25.821  1.00 642.98 ?  -202 DT  J "C2'" 1 
ATOM 2287  C "C1'" . DT  A 1 111 ? 35.653  -27.233 26.702  1.00 643.23 ?  -202 DT  J "C1'" 1 
ATOM 2288  N N1    . DT  A 1 111 ? 35.764  -26.618 28.078  1.00 643.27 ?  -202 DT  J N1    1 
ATOM 2289  C C2    . DT  A 1 111 ? 35.853  -27.455 29.180  1.00 643.16 ?  -202 DT  J C2    1 
ATOM 2290  O O2    . DT  A 1 111 ? 35.828  -28.670 29.113  1.00 643.18 ?  -202 DT  J O2    1 
ATOM 2291  N N3    . DT  A 1 111 ? 35.961  -26.816 30.389  1.00 643.09 ?  -202 DT  J N3    1 
ATOM 2292  C C4    . DT  A 1 111 ? 36.001  -25.452 30.613  1.00 643.12 ?  -202 DT  J C4    1 
ATOM 2293  O O4    . DT  A 1 111 ? 36.109  -24.985 31.741  1.00 643.07 ?  -202 DT  J O4    1 
ATOM 2294  C C5    . DT  A 1 111 ? 35.910  -24.629 29.427  1.00 643.22 ?  -202 DT  J C5    1 
ATOM 2295  C C7    . DT  A 1 111 ? 35.932  -23.133 29.541  1.00 643.21 ?  -202 DT  J C7    1 
ATOM 2296  C C6    . DT  A 1 111 ? 35.801  -25.240 28.234  1.00 643.31 ?  -202 DT  J C6    1 
ATOM 2297  P P     . DC  A 1 112 ? 33.366  -29.328 23.949  1.00 648.71 ?  -201 DC  J P     1 
ATOM 2298  O OP1   . DC  A 1 112 ? 33.254  -29.187 22.481  1.00 648.77 ?  -201 DC  J OP1   1 
ATOM 2299  O OP2   . DC  A 1 112 ? 32.291  -28.814 24.826  1.00 648.58 -1 -201 DC  J OP2   1 
ATOM 2300  O "O5'" . DC  A 1 112 ? 33.584  -30.865 24.330  1.00 648.60 ?  -201 DC  J "O5'" 1 
ATOM 2301  C "C5'" . DC  A 1 112 ? 34.136  -31.224 25.600  1.00 648.02 ?  -201 DC  J "C5'" 1 
ATOM 2302  C "C4'" . DC  A 1 112 ? 33.181  -32.044 26.461  1.00 647.71 ?  -201 DC  J "C4'" 1 
ATOM 2303  O "O4'" . DC  A 1 112 ? 33.213  -31.547 27.820  1.00 648.08 ?  -201 DC  J "O4'" 1 
ATOM 2304  C "C3'" . DC  A 1 112 ? 31.707  -32.088 26.061  1.00 647.18 ?  -201 DC  J "C3'" 1 
ATOM 2305  O "O3'" . DC  A 1 112 ? 31.250  -33.477 26.021  1.00 645.99 ?  -201 DC  J "O3'" 1 
ATOM 2306  C "C2'" . DC  A 1 112 ? 30.997  -31.144 27.038  1.00 647.49 ?  -201 DC  J "C2'" 1 
ATOM 2307  C "C1'" . DC  A 1 112 ? 31.942  -31.090 28.239  1.00 648.16 ?  -201 DC  J "C1'" 1 
ATOM 2308  N N1    . DC  A 1 112 ? 32.170  -29.754 28.884  1.00 648.56 ?  -201 DC  J N1    1 
ATOM 2309  C C2    . DC  A 1 112 ? 32.343  -29.685 30.280  1.00 648.66 ?  -201 DC  J C2    1 
ATOM 2310  O O2    . DC  A 1 112 ? 32.288  -30.719 30.964  1.00 648.58 ?  -201 DC  J O2    1 
ATOM 2311  N N3    . DC  A 1 112 ? 32.562  -28.470 30.854  1.00 648.61 ?  -201 DC  J N3    1 
ATOM 2312  C C4    . DC  A 1 112 ? 32.618  -27.370 30.098  1.00 648.52 ?  -201 DC  J C4    1 
ATOM 2313  N N4    . DC  A 1 112 ? 32.837  -26.204 30.711  1.00 648.50 ?  -201 DC  J N4    1 
ATOM 2314  C C5    . DC  A 1 112 ? 32.452  -27.418 28.680  1.00 648.63 ?  -201 DC  J C5    1 
ATOM 2315  C C6    . DC  A 1 112 ? 32.239  -28.616 28.120  1.00 648.71 ?  -201 DC  J C6    1 
ATOM 2316  P P     . DT  A 1 113 ? 30.545  -34.354 27.176  1.00 639.45 ?  -200 DT  J P     1 
ATOM 2317  O OP1   . DT  A 1 113 ? 30.670  -35.766 26.743  1.00 639.50 ?  -200 DT  J OP1   1 
ATOM 2318  O OP2   . DT  A 1 113 ? 29.193  -33.800 27.405  1.00 639.36 -1 -200 DT  J OP2   1 
ATOM 2319  O "O5'" . DT  A 1 113 ? 31.424  -34.151 28.502  1.00 638.27 ?  -200 DT  J "O5'" 1 
ATOM 2320  C "C5'" . DT  A 1 113 ? 31.479  -35.164 29.510  1.00 636.52 ?  -200 DT  J "C5'" 1 
ATOM 2321  C "C4'" . DT  A 1 113 ? 30.588  -34.851 30.707  1.00 635.34 ?  -200 DT  J "C4'" 1 
ATOM 2322  O "O4'" . DT  A 1 113 ? 30.619  -33.440 31.048  1.00 635.54 ?  -200 DT  J "O4'" 1 
ATOM 2323  C "C3'" . DT  A 1 113 ? 29.106  -35.204 30.564  1.00 634.32 ?  -200 DT  J "C3'" 1 
ATOM 2324  O "O3'" . DT  A 1 113 ? 28.688  -35.899 31.731  1.00 632.69 ?  -200 DT  J "O3'" 1 
ATOM 2325  C "C2'" . DT  A 1 113 ? 28.422  -33.840 30.514  1.00 634.66 ?  -200 DT  J "C2'" 1 
ATOM 2326  C "C1'" . DT  A 1 113 ? 29.323  -33.097 31.492  1.00 635.45 ?  -200 DT  J "C1'" 1 
ATOM 2327  N N1    . DT  A 1 113 ? 29.213  -31.608 31.559  1.00 635.67 ?  -200 DT  J N1    1 
ATOM 2328  C C2    . DT  A 1 113 ? 29.319  -30.983 32.789  1.00 635.79 ?  -200 DT  J C2    1 
ATOM 2329  O O2    . DT  A 1 113 ? 29.487  -31.574 33.844  1.00 635.67 ?  -200 DT  J O2    1 
ATOM 2330  N N3    . DT  A 1 113 ? 29.217  -29.614 32.735  1.00 636.00 ?  -200 DT  J N3    1 
ATOM 2331  C C4    . DT  A 1 113 ? 29.033  -28.826 31.608  1.00 635.82 ?  -200 DT  J C4    1 
ATOM 2332  O O4    . DT  A 1 113 ? 28.953  -27.603 31.669  1.00 635.93 ?  -200 DT  J O4    1 
ATOM 2333  C C5    . DT  A 1 113 ? 28.931  -29.540 30.360  1.00 635.66 ?  -200 DT  J C5    1 
ATOM 2334  C C7    . DT  A 1 113 ? 28.728  -28.798 29.074  1.00 635.66 ?  -200 DT  J C7    1 
ATOM 2335  C C6    . DT  A 1 113 ? 29.029  -30.875 30.398  1.00 635.80 ?  -200 DT  J C6    1 
ATOM 2336  P P     . DA  A 1 114 ? 28.757  -37.487 31.880  1.00 639.38 ?  -199 DA  J P     1 
ATOM 2337  O OP1   . DA  A 1 114 ? 29.860  -37.999 31.032  1.00 639.65 ?  -199 DA  J OP1   1 
ATOM 2338  O OP2   . DA  A 1 114 ? 27.375  -37.989 31.724  1.00 639.23 -1 -199 DA  J OP2   1 
ATOM 2339  O "O5'" . DA  A 1 114 ? 29.166  -37.710 33.407  1.00 638.40 ?  -199 DA  J "O5'" 1 
ATOM 2340  C "C5'" . DA  A 1 114 ? 30.443  -37.306 33.893  1.00 636.67 ?  -199 DA  J "C5'" 1 
ATOM 2341  C "C4'" . DA  A 1 114 ? 30.295  -36.572 35.214  1.00 635.45 ?  -199 DA  J "C4'" 1 
ATOM 2342  O "O4'" . DA  A 1 114 ? 29.734  -35.256 34.971  1.00 635.63 ?  -199 DA  J "O4'" 1 
ATOM 2343  C "C3'" . DA  A 1 114 ? 29.391  -37.243 36.251  1.00 634.11 ?  -199 DA  J "C3'" 1 
ATOM 2344  O "O3'" . DA  A 1 114 ? 30.033  -37.198 37.527  1.00 631.49 ?  -199 DA  J "O3'" 1 
ATOM 2345  C "C2'" . DA  A 1 114 ? 28.094  -36.432 36.210  1.00 634.75 ?  -199 DA  J "C2'" 1 
ATOM 2346  C "C1'" . DA  A 1 114 ? 28.586  -35.056 35.773  1.00 636.21 ?  -199 DA  J "C1'" 1 
ATOM 2347  N N9    . DA  A 1 114 ? 27.642  -34.310 34.949  1.00 636.51 ?  -199 DA  J N9    1 
ATOM 2348  C C8    . DA  A 1 114 ? 27.169  -34.682 33.726  1.00 636.86 ?  -199 DA  J C8    1 
ATOM 2349  N N7    . DA  A 1 114 ? 26.342  -33.827 33.181  1.00 636.87 ?  -199 DA  J N7    1 
ATOM 2350  C C5    . DA  A 1 114 ? 26.260  -32.818 34.116  1.00 636.72 ?  -199 DA  J C5    1 
ATOM 2351  C C6    . DA  A 1 114 ? 25.533  -31.613 34.130  1.00 636.71 ?  -199 DA  J C6    1 
ATOM 2352  N N6    . DA  A 1 114 ? 24.727  -31.235 33.132  1.00 636.53 ?  -199 DA  J N6    1 
ATOM 2353  N N1    . DA  A 1 114 ? 25.671  -30.820 35.217  1.00 637.02 ?  -199 DA  J N1    1 
ATOM 2354  C C2    . DA  A 1 114 ? 26.485  -31.212 36.215  1.00 636.97 ?  -199 DA  J C2    1 
ATOM 2355  N N3    . DA  A 1 114 ? 27.219  -32.326 36.312  1.00 636.76 ?  -199 DA  J N3    1 
ATOM 2356  C C4    . DA  A 1 114 ? 27.060  -33.094 35.218  1.00 636.76 ?  -199 DA  J C4    1 
ATOM 2357  P P     . DC  A 1 115 ? 29.526  -38.078 38.768  1.00 646.61 ?  -198 DC  J P     1 
ATOM 2358  O OP1   . DC  A 1 115 ? 30.704  -38.758 39.351  1.00 646.52 ?  -198 DC  J OP1   1 
ATOM 2359  O OP2   . DC  A 1 115 ? 28.336  -38.858 38.358  1.00 645.86 -1 -198 DC  J OP2   1 
ATOM 2360  O "O5'" . DC  A 1 115 ? 29.038  -36.971 39.808  1.00 645.44 ?  -198 DC  J "O5'" 1 
ATOM 2361  C "C5'" . DC  A 1 115 ? 29.710  -35.714 39.952  1.00 642.56 ?  -198 DC  J "C5'" 1 
ATOM 2362  C "C4'" . DC  A 1 115 ? 28.784  -34.686 40.584  1.00 640.18 ?  -198 DC  J "C4'" 1 
ATOM 2363  O "O4'" . DC  A 1 115 ? 27.911  -34.158 39.555  1.00 639.94 ?  -198 DC  J "O4'" 1 
ATOM 2364  C "C3'" . DC  A 1 115 ? 27.881  -35.210 41.707  1.00 638.60 ?  -198 DC  J "C3'" 1 
ATOM 2365  O "O3'" . DC  A 1 115 ? 27.942  -34.353 42.845  1.00 635.88 ?  -198 DC  J "O3'" 1 
ATOM 2366  C "C2'" . DC  A 1 115 ? 26.485  -35.216 41.094  1.00 639.09 ?  -198 DC  J "C2'" 1 
ATOM 2367  C "C1'" . DC  A 1 115 ? 26.605  -34.083 40.087  1.00 640.56 ?  -198 DC  J "C1'" 1 
ATOM 2368  N N1    . DC  A 1 115 ? 25.579  -34.147 38.999  1.00 641.14 ?  -198 DC  J N1    1 
ATOM 2369  C C2    . DC  A 1 115 ? 24.912  -32.973 38.622  1.00 641.21 ?  -198 DC  J C2    1 
ATOM 2370  O O2    . DC  A 1 115 ? 25.171  -31.905 39.187  1.00 641.85 ?  -198 DC  J O2    1 
ATOM 2371  N N3    . DC  A 1 115 ? 23.977  -33.036 37.645  1.00 641.24 ?  -198 DC  J N3    1 
ATOM 2372  C C4    . DC  A 1 115 ? 23.703  -34.200 37.052  1.00 641.49 ?  -198 DC  J C4    1 
ATOM 2373  N N4    . DC  A 1 115 ? 22.772  -34.188 36.095  1.00 641.53 ?  -198 DC  J N4    1 
ATOM 2374  C C5    . DC  A 1 115 ? 24.369  -35.414 37.411  1.00 641.72 ?  -198 DC  J C5    1 
ATOM 2375  C C6    . DC  A 1 115 ? 25.290  -35.338 38.382  1.00 641.71 ?  -198 DC  J C6    1 
ATOM 2376  P P     . DG  A 1 116 ? 27.234  -34.714 44.239  1.00 655.89 ?  -197 DG  J P     1 
ATOM 2377  O OP1   . DG  A 1 116 ? 28.302  -34.943 45.230  1.00 656.20 ?  -197 DG  J OP1   1 
ATOM 2378  O OP2   . DG  A 1 116 ? 26.191  -35.737 44.046  1.00 655.95 -1 -197 DG  J OP2   1 
ATOM 2379  O "O5'" . DG  A 1 116 ? 26.467  -33.365 44.590  1.00 656.25 ?  -197 DG  J "O5'" 1 
ATOM 2380  C "C5'" . DG  A 1 116 ? 27.010  -32.082 44.245  1.00 655.42 ?  -197 DG  J "C5'" 1 
ATOM 2381  C "C4'" . DG  A 1 116 ? 25.910  -31.037 44.156  1.00 654.22 ?  -197 DG  J "C4'" 1 
ATOM 2382  O "O4'" . DG  A 1 116 ? 25.330  -31.076 42.826  1.00 654.07 ?  -197 DG  J "O4'" 1 
ATOM 2383  C "C3'" . DG  A 1 116 ? 24.764  -31.222 45.155  1.00 653.30 ?  -197 DG  J "C3'" 1 
ATOM 2384  O "O3'" . DG  A 1 116 ? 24.453  -29.998 45.829  1.00 651.92 ?  -197 DG  J "O3'" 1 
ATOM 2385  C "C2'" . DG  A 1 116 ? 23.623  -31.720 44.281  1.00 653.74 ?  -197 DG  J "C2'" 1 
ATOM 2386  C "C1'" . DG  A 1 116 ? 23.925  -31.072 42.940  1.00 655.47 ?  -197 DG  J "C1'" 1 
ATOM 2387  N N9    . DG  A 1 116 ? 23.325  -31.857 41.873  1.00 655.82 ?  -197 DG  J N9    1 
ATOM 2388  C C8    . DG  A 1 116 ? 23.558  -33.191 41.657  1.00 656.20 ?  -197 DG  J C8    1 
ATOM 2389  N N7    . DG  A 1 116 ? 22.889  -33.682 40.657  1.00 656.48 ?  -197 DG  J N7    1 
ATOM 2390  C C5    . DG  A 1 116 ? 22.152  -32.605 40.179  1.00 656.50 ?  -197 DG  J C5    1 
ATOM 2391  C C6    . DG  A 1 116 ? 21.239  -32.549 39.091  1.00 656.61 ?  -197 DG  J C6    1 
ATOM 2392  O O6    . DG  A 1 116 ? 20.902  -33.472 38.329  1.00 656.49 ?  -197 DG  J O6    1 
ATOM 2393  N N1    . DG  A 1 116 ? 20.698  -31.271 38.923  1.00 656.24 ?  -197 DG  J N1    1 
ATOM 2394  C C2    . DG  A 1 116 ? 21.014  -30.187 39.709  1.00 656.13 ?  -197 DG  J C2    1 
ATOM 2395  N N2    . DG  A 1 116 ? 20.386  -29.048 39.389  1.00 656.17 ?  -197 DG  J N2    1 
ATOM 2396  N N3    . DG  A 1 116 ? 21.868  -30.229 40.736  1.00 656.22 ?  -197 DG  J N3    1 
ATOM 2397  C C4    . DG  A 1 116 ? 22.406  -31.467 40.917  1.00 656.17 ?  -197 DG  J C4    1 
ATOM 2398  P P     . DA  A 1 117 ? 23.151  -29.857 46.755  1.00 663.11 ?  -196 DA  J P     1 
ATOM 2399  O OP1   . DA  A 1 117 ? 23.487  -29.132 47.992  1.00 663.11 ?  -196 DA  J OP1   1 
ATOM 2400  O OP2   . DA  A 1 117 ? 22.494  -31.170 46.866  1.00 663.11 -1 -196 DA  J OP2   1 
ATOM 2401  O "O5'" . DA  A 1 117 ? 22.244  -28.915 45.847  1.00 663.11 ?  -196 DA  J "O5'" 1 
ATOM 2402  C "C5'" . DA  A 1 117 ? 22.756  -27.776 45.142  1.00 663.11 ?  -196 DA  J "C5'" 1 
ATOM 2403  C "C4'" . DA  A 1 117 ? 21.598  -26.987 44.538  1.00 663.11 ?  -196 DA  J "C4'" 1 
ATOM 2404  O "O4'" . DA  A 1 117 ? 21.038  -27.713 43.413  1.00 663.11 ?  -196 DA  J "O4'" 1 
ATOM 2405  C "C3'" . DA  A 1 117 ? 20.404  -26.706 45.454  1.00 663.11 ?  -196 DA  J "C3'" 1 
ATOM 2406  O "O3'" . DA  A 1 117 ? 19.797  -25.457 45.069  1.00 663.11 ?  -196 DA  J "O3'" 1 
ATOM 2407  C "C2'" . DA  A 1 117 ? 19.502  -27.921 45.215  1.00 663.11 ?  -196 DA  J "C2'" 1 
ATOM 2408  C "C1'" . DA  A 1 117 ? 19.742  -28.201 43.731  1.00 663.11 ?  -196 DA  J "C1'" 1 
ATOM 2409  N N9    . DA  A 1 117 ? 19.716  -29.610 43.345  1.00 663.11 ?  -196 DA  J N9    1 
ATOM 2410  C C8    . DA  A 1 117 ? 20.370  -30.645 43.954  1.00 663.11 ?  -196 DA  J C8    1 
ATOM 2411  N N7    . DA  A 1 117 ? 20.190  -31.813 43.390  1.00 663.11 ?  -196 DA  J N7    1 
ATOM 2412  C C5    . DA  A 1 117 ? 19.357  -31.524 42.328  1.00 663.11 ?  -196 DA  J C5    1 
ATOM 2413  C C6    . DA  A 1 117 ? 18.789  -32.337 41.330  1.00 663.11 ?  -196 DA  J C6    1 
ATOM 2414  N N6    . DA  A 1 117 ? 19.005  -33.653 41.267  1.00 663.11 ?  -196 DA  J N6    1 
ATOM 2415  N N1    . DA  A 1 117 ? 17.997  -31.745 40.403  1.00 663.11 ?  -196 DA  J N1    1 
ATOM 2416  C C2    . DA  A 1 117 ? 17.782  -30.423 40.469  1.00 663.11 ?  -196 DA  J C2    1 
ATOM 2417  N N3    . DA  A 1 117 ? 18.261  -29.555 41.365  1.00 663.11 ?  -196 DA  J N3    1 
ATOM 2418  C C4    . DA  A 1 117 ? 19.050  -30.172 42.277  1.00 663.11 ?  -196 DA  J C4    1 
ATOM 2419  P P     . DC  A 1 118 ? 18.453  -24.848 45.715  1.00 675.85 ?  -195 DC  J P     1 
ATOM 2420  O OP1   . DC  A 1 118 ? 18.852  -23.578 46.355  1.00 675.85 ?  -195 DC  J OP1   1 
ATOM 2421  O OP2   . DC  A 1 118 ? 17.755  -25.889 46.513  1.00 675.85 -1 -195 DC  J OP2   1 
ATOM 2422  O "O5'" . DC  A 1 118 ? 17.529  -24.488 44.448  1.00 675.85 ?  -195 DC  J "O5'" 1 
ATOM 2423  C "C5'" . DC  A 1 118 ? 17.395  -25.362 43.316  1.00 675.85 ?  -195 DC  J "C5'" 1 
ATOM 2424  C "C4'" . DC  A 1 118 ? 15.965  -25.800 43.001  1.00 675.85 ?  -195 DC  J "C4'" 1 
ATOM 2425  O "O4'" . DC  A 1 118 ? 16.007  -27.180 42.539  1.00 675.85 ?  -195 DC  J "O4'" 1 
ATOM 2426  C "C3'" . DC  A 1 118 ? 14.919  -25.747 44.125  1.00 675.85 ?  -195 DC  J "C3'" 1 
ATOM 2427  O "O3'" . DC  A 1 118 ? 13.691  -25.161 43.627  1.00 675.85 ?  -195 DC  J "O3'" 1 
ATOM 2428  C "C2'" . DC  A 1 118 ? 14.775  -27.209 44.549  1.00 675.85 ?  -195 DC  J "C2'" 1 
ATOM 2429  C "C1'" . DC  A 1 118 ? 15.062  -27.961 43.251  1.00 675.85 ?  -195 DC  J "C1'" 1 
ATOM 2430  N N1    . DC  A 1 118 ? 15.597  -29.367 43.433  1.00 675.85 ?  -195 DC  J N1    1 
ATOM 2431  C C2    . DC  A 1 118 ? 15.280  -30.367 42.501  1.00 675.85 ?  -195 DC  J C2    1 
ATOM 2432  O O2    . DC  A 1 118 ? 14.567  -30.093 41.529  1.00 675.85 ?  -195 DC  J O2    1 
ATOM 2433  N N3    . DC  A 1 118 ? 15.773  -31.622 42.681  1.00 675.85 ?  -195 DC  J N3    1 
ATOM 2434  C C4    . DC  A 1 118 ? 16.540  -31.900 43.735  1.00 675.85 ?  -195 DC  J C4    1 
ATOM 2435  N N4    . DC  A 1 118 ? 17.000  -33.149 43.868  1.00 675.85 ?  -195 DC  J N4    1 
ATOM 2436  C C5    . DC  A 1 118 ? 16.874  -30.906 44.701  1.00 675.85 ?  -195 DC  J C5    1 
ATOM 2437  C C6    . DC  A 1 118 ? 16.386  -29.673 44.509  1.00 675.85 ?  -195 DC  J C6    1 
ATOM 2438  P P     . DC  A 1 119 ? 12.215  -25.368 44.245  1.00 685.78 ?  -194 DC  J P     1 
ATOM 2439  O OP1   . DC  A 1 119 ? 11.426  -24.178 43.863  1.00 685.78 ?  -194 DC  J OP1   1 
ATOM 2440  O OP2   . DC  A 1 119 ? 12.283  -25.760 45.672  1.00 685.78 -1 -194 DC  J OP2   1 
ATOM 2441  O "O5'" . DC  A 1 119 ? 11.695  -26.632 43.415  1.00 685.78 ?  -194 DC  J "O5'" 1 
ATOM 2442  C "C5'" . DC  A 1 119 ? 11.193  -26.523 42.076  1.00 685.78 ?  -194 DC  J "C5'" 1 
ATOM 2443  C "C4'" . DC  A 1 119 ? 10.082  -27.538 41.831  1.00 685.78 ?  -194 DC  J "C4'" 1 
ATOM 2444  O "O4'" . DC  A 1 119 ? 10.634  -28.880 41.842  1.00 685.78 ?  -194 DC  J "O4'" 1 
ATOM 2445  C "C3'" . DC  A 1 119 ? 8.939   -27.534 42.850  1.00 685.78 ?  -194 DC  J "C3'" 1 
ATOM 2446  O "O3'" . DC  A 1 119 ? 7.666   -27.613 42.173  1.00 685.78 ?  -194 DC  J "O3'" 1 
ATOM 2447  C "C2'" . DC  A 1 119 ? 9.231   -28.733 43.760  1.00 685.78 ?  -194 DC  J "C2'" 1 
ATOM 2448  C "C1'" . DC  A 1 119 ? 10.025  -29.671 42.853  1.00 685.78 ?  -194 DC  J "C1'" 1 
ATOM 2449  N N1    . DC  A 1 119 ? 11.094  -30.462 43.565  1.00 685.78 ?  -194 DC  J N1    1 
ATOM 2450  C C2    . DC  A 1 119 ? 11.185  -31.860 43.419  1.00 685.78 ?  -194 DC  J C2    1 
ATOM 2451  O O2    . DC  A 1 119 ? 10.382  -32.468 42.702  1.00 685.78 ?  -194 DC  J O2    1 
ATOM 2452  N N3    . DC  A 1 119 ? 12.170  -32.523 44.078  1.00 685.78 ?  -194 DC  J N3    1 
ATOM 2453  C C4    . DC  A 1 119 ? 13.038  -31.859 44.851  1.00 685.78 ?  -194 DC  J C4    1 
ATOM 2454  N N4    . DC  A 1 119 ? 13.989  -32.556 45.481  1.00 685.78 ?  -194 DC  J N4    1 
ATOM 2455  C C5    . DC  A 1 119 ? 12.967  -30.445 45.019  1.00 685.78 ?  -194 DC  J C5    1 
ATOM 2456  C C6    . DC  A 1 119 ? 11.994  -29.800 44.362  1.00 685.78 ?  -194 DC  J C6    1 
ATOM 2457  P P     . DA  A 1 120 ? 6.269   -27.836 42.946  1.00 688.34 ?  -193 DA  J P     1 
ATOM 2458  O OP1   . DA  A 1 120 ? 5.169   -27.361 42.082  1.00 688.34 ?  -193 DA  J OP1   1 
ATOM 2459  O OP2   . DA  A 1 120 ? 6.385   -27.303 44.323  1.00 688.34 -1 -193 DA  J OP2   1 
ATOM 2460  O "O5'" . DA  A 1 120 ? 6.178   -29.431 43.026  1.00 688.34 ?  -193 DA  J "O5'" 1 
ATOM 2461  C "C5'" . DA  A 1 120 ? 6.137   -30.237 41.841  1.00 688.34 ?  -193 DA  J "C5'" 1 
ATOM 2462  C "C4'" . DA  A 1 120 ? 5.646   -31.638 42.172  1.00 688.34 ?  -193 DA  J "C4'" 1 
ATOM 2463  O "O4'" . DA  A 1 120 ? 6.754   -32.423 42.675  1.00 688.34 ?  -193 DA  J "O4'" 1 
ATOM 2464  C "C3'" . DA  A 1 120 ? 4.537   -31.714 43.225  1.00 688.34 ?  -193 DA  J "C3'" 1 
ATOM 2465  O "O3'" . DA  A 1 120 ? 3.439   -32.494 42.698  1.00 688.34 ?  -193 DA  J "O3'" 1 
ATOM 2466  C "C2'" . DA  A 1 120 ? 5.232   -32.254 44.479  1.00 688.34 ?  -193 DA  J "C2'" 1 
ATOM 2467  C "C1'" . DA  A 1 120 ? 6.416   -33.028 43.911  1.00 688.34 ?  -193 DA  J "C1'" 1 
ATOM 2468  N N9    . DA  A 1 120 ? 7.615   -33.019 44.748  1.00 688.34 ?  -193 DA  J N9    1 
ATOM 2469  C C8    . DA  A 1 120 ? 8.206   -31.932 45.336  1.00 688.34 ?  -193 DA  J C8    1 
ATOM 2470  N N7    . DA  A 1 120 ? 9.283   -32.217 46.028  1.00 688.34 ?  -193 DA  J N7    1 
ATOM 2471  C C5    . DA  A 1 120 ? 9.413   -33.586 45.881  1.00 688.34 ?  -193 DA  J C5    1 
ATOM 2472  C C6    . DA  A 1 120 ? 10.361  -34.503 46.373  1.00 688.34 ?  -193 DA  J C6    1 
ATOM 2473  N N6    . DA  A 1 120 ? 11.386  -34.139 47.143  1.00 688.34 ?  -193 DA  J N6    1 
ATOM 2474  N N1    . DA  A 1 120 ? 10.209  -35.807 46.048  1.00 688.34 ?  -193 DA  J N1    1 
ATOM 2475  C C2    . DA  A 1 120 ? 9.174   -36.165 45.271  1.00 688.34 ?  -193 DA  J C2    1 
ATOM 2476  N N3    . DA  A 1 120 ? 8.217   -35.392 44.752  1.00 688.34 ?  -193 DA  J N3    1 
ATOM 2477  C C4    . DA  A 1 120 ? 8.396   -34.100 45.094  1.00 688.34 ?  -193 DA  J C4    1 
ATOM 2478  P P     . DA  A 1 121 ? 2.649   -33.685 43.429  1.00 683.82 ?  -192 DA  J P     1 
ATOM 2479  O OP1   . DA  A 1 121 ? 1.489   -33.989 42.561  1.00 683.82 ?  -192 DA  J OP1   1 
ATOM 2480  O OP2   . DA  A 1 121 ? 2.407   -33.335 44.851  1.00 683.82 -1 -192 DA  J OP2   1 
ATOM 2481  O "O5'" . DA  A 1 121 ? 3.694   -34.904 43.342  1.00 683.82 ?  -192 DA  J "O5'" 1 
ATOM 2482  C "C5'" . DA  A 1 121 ? 3.404   -36.137 42.668  1.00 683.82 ?  -192 DA  J "C5'" 1 
ATOM 2483  C "C4'" . DA  A 1 121 ? 3.358   -37.295 43.655  1.00 683.82 ?  -192 DA  J "C4'" 1 
ATOM 2484  O "O4'" . DA  A 1 121 ? 4.542   -37.274 44.496  1.00 683.82 ?  -192 DA  J "O4'" 1 
ATOM 2485  C "C3'" . DA  A 1 121 ? 2.146   -37.301 44.590  1.00 683.82 ?  -192 DA  J "C3'" 1 
ATOM 2486  O "O3'" . DA  A 1 121 ? 1.568   -38.626 44.616  1.00 683.82 ?  -192 DA  J "O3'" 1 
ATOM 2487  C "C2'" . DA  A 1 121 ? 2.704   -36.796 45.922  1.00 683.82 ?  -192 DA  J "C2'" 1 
ATOM 2488  C "C1'" . DA  A 1 121 ? 4.184   -37.175 45.864  1.00 683.82 ?  -192 DA  J "C1'" 1 
ATOM 2489  N N9    . DA  A 1 121 ? 5.066   -36.221 46.551  1.00 683.82 ?  -192 DA  J N9    1 
ATOM 2490  C C8    . DA  A 1 121 ? 4.878   -34.872 46.692  1.00 683.82 ?  -192 DA  J C8    1 
ATOM 2491  N N7    . DA  A 1 121 ? 5.821   -34.254 47.361  1.00 683.82 ?  -192 DA  J N7    1 
ATOM 2492  C C5    . DA  A 1 121 ? 6.694   -35.271 47.694  1.00 683.82 ?  -192 DA  J C5    1 
ATOM 2493  C C6    . DA  A 1 121 ? 7.908   -35.273 48.412  1.00 683.82 ?  -192 DA  J C6    1 
ATOM 2494  N N6    . DA  A 1 121 ? 8.448   -34.167 48.931  1.00 683.82 ?  -192 DA  J N6    1 
ATOM 2495  N N1    . DA  A 1 121 ? 8.546   -36.458 48.573  1.00 683.82 ?  -192 DA  J N1    1 
ATOM 2496  C C2    . DA  A 1 121 ? 7.998   -37.568 48.046  1.00 683.82 ?  -192 DA  J C2    1 
ATOM 2497  N N3    . DA  A 1 121 ? 6.862   -37.687 47.350  1.00 683.82 ?  -192 DA  J N3    1 
ATOM 2498  C C4    . DA  A 1 121 ? 6.251   -36.492 47.205  1.00 683.82 ?  -192 DA  J C4    1 
ATOM 2499  P P     . DT  A 1 122 ? 1.095   -39.426 45.928  1.00 676.06 ?  -191 DT  J P     1 
ATOM 2500  O OP1   . DT  A 1 122 ? 0.200   -40.523 45.491  1.00 676.06 ?  -191 DT  J OP1   1 
ATOM 2501  O OP2   . DT  A 1 122 ? 0.630   -38.474 46.964  1.00 676.06 -1 -191 DT  J OP2   1 
ATOM 2502  O "O5'" . DT  A 1 122 ? 2.469   -40.062 46.434  1.00 676.06 ?  -191 DT  J "O5'" 1 
ATOM 2503  C "C5'" . DT  A 1 122 ? 3.134   -41.097 45.707  1.00 676.06 ?  -191 DT  J "C5'" 1 
ATOM 2504  C "C4'" . DT  A 1 122 ? 3.821   -42.037 46.683  1.00 676.06 ?  -191 DT  J "C4'" 1 
ATOM 2505  O "O4'" . DT  A 1 122 ? 4.863   -41.327 47.405  1.00 676.06 ?  -191 DT  J "O4'" 1 
ATOM 2506  C "C3'" . DT  A 1 122 ? 2.896   -42.629 47.742  1.00 676.06 ?  -191 DT  J "C3'" 1 
ATOM 2507  O "O3'" . DT  A 1 122 ? 3.246   -44.002 47.959  1.00 676.06 ?  -191 DT  J "O3'" 1 
ATOM 2508  C "C2'" . DT  A 1 122 ? 3.136   -41.725 48.950  1.00 676.06 ?  -191 DT  J "C2'" 1 
ATOM 2509  C "C1'" . DT  A 1 122 ? 4.610   -41.358 48.799  1.00 676.06 ?  -191 DT  J "C1'" 1 
ATOM 2510  N N1    . DT  A 1 122 ? 4.999   -40.038 49.428  1.00 676.06 ?  -191 DT  J N1    1 
ATOM 2511  C C2    . DT  A 1 122 ? 6.192   -39.927 50.136  1.00 676.06 ?  -191 DT  J C2    1 
ATOM 2512  O O2    . DT  A 1 122 ? 6.986   -40.840 50.303  1.00 676.06 ?  -191 DT  J O2    1 
ATOM 2513  N N3    . DT  A 1 122 ? 6.432   -38.678 50.660  1.00 676.06 ?  -191 DT  J N3    1 
ATOM 2514  C C4    . DT  A 1 122 ? 5.630   -37.552 50.553  1.00 676.06 ?  -191 DT  J C4    1 
ATOM 2515  O O4    . DT  A 1 122 ? 5.949   -36.482 51.060  1.00 676.06 ?  -191 DT  J O4    1 
ATOM 2516  C C5    . DT  A 1 122 ? 4.407   -37.729 49.808  1.00 676.06 ?  -191 DT  J C5    1 
ATOM 2517  C C7    . DT  A 1 122 ? 3.453   -36.586 49.618  1.00 676.06 ?  -191 DT  J C7    1 
ATOM 2518  C C6    . DT  A 1 122 ? 4.156   -38.941 49.289  1.00 676.06 ?  -191 DT  J C6    1 
ATOM 2519  P P     . DT  A 1 123 ? 3.006   -44.762 49.350  1.00 671.07 ?  -190 DT  J P     1 
ATOM 2520  O OP1   . DT  A 1 123 ? 2.988   -46.215 49.072  1.00 671.07 ?  -190 DT  J OP1   1 
ATOM 2521  O OP2   . DT  A 1 123 ? 1.876   -44.135 50.079  1.00 671.07 -1 -190 DT  J OP2   1 
ATOM 2522  O "O5'" . DT  A 1 123 ? 4.366   -44.423 50.117  1.00 671.07 ?  -190 DT  J "O5'" 1 
ATOM 2523  C "C5'" . DT  A 1 123 ? 5.615   -45.037 49.776  1.00 671.07 ?  -190 DT  J "C5'" 1 
ATOM 2524  C "C4'" . DT  A 1 123 ? 6.513   -45.107 51.005  1.00 671.07 ?  -190 DT  J "C4'" 1 
ATOM 2525  O "O4'" . DT  A 1 123 ? 6.767   -43.766 51.508  1.00 671.07 ?  -190 DT  J "O4'" 1 
ATOM 2526  C "C3'" . DT  A 1 123 ? 5.932   -45.885 52.184  1.00 671.07 ?  -190 DT  J "C3'" 1 
ATOM 2527  O "O3'" . DT  A 1 123 ? 6.963   -46.625 52.845  1.00 671.07 ?  -190 DT  J "O3'" 1 
ATOM 2528  C "C2'" . DT  A 1 123 ? 5.321   -44.798 53.079  1.00 671.07 ?  -190 DT  J "C2'" 1 
ATOM 2529  C "C1'" . DT  A 1 123 ? 6.258   -43.617 52.829  1.00 671.07 ?  -190 DT  J "C1'" 1 
ATOM 2530  N N1    . DT  A 1 123 ? 5.635   -42.243 52.959  1.00 671.07 ?  -190 DT  J N1    1 
ATOM 2531  C C2    . DT  A 1 123 ? 6.386   -41.202 53.497  1.00 671.07 ?  -190 DT  J C2    1 
ATOM 2532  O O2    . DT  A 1 123 ? 7.539   -41.319 53.897  1.00 671.07 ?  -190 DT  J O2    1 
ATOM 2533  N N3    . DT  A 1 123 ? 5.723   -39.995 53.561  1.00 671.07 ?  -190 DT  J N3    1 
ATOM 2534  C C4    . DT  A 1 123 ? 4.426   -39.719 53.146  1.00 671.07 ?  -190 DT  J C4    1 
ATOM 2535  O O4    . DT  A 1 123 ? 3.941   -38.594 53.250  1.00 671.07 ?  -190 DT  J O4    1 
ATOM 2536  C C5    . DT  A 1 123 ? 3.701   -40.845 52.594  1.00 671.07 ?  -190 DT  J C5    1 
ATOM 2537  C C7    . DT  A 1 123 ? 2.286   -40.689 52.113  1.00 671.07 ?  -190 DT  J C7    1 
ATOM 2538  C C6    . DT  A 1 123 ? 4.332   -42.031 52.527  1.00 671.07 ?  -190 DT  J C6    1 
ATOM 2539  P P     . DG  A 1 124 ? 6.622   -47.702 53.983  1.00 667.19 ?  -189 DG  J P     1 
ATOM 2540  O OP1   . DG  A 1 124 ? 7.247   -48.964 53.535  1.00 667.19 ?  -189 DG  J OP1   1 
ATOM 2541  O OP2   . DG  A 1 124 ? 5.181   -47.669 54.325  1.00 667.19 -1 -189 DG  J OP2   1 
ATOM 2542  O "O5'" . DG  A 1 124 ? 7.414   -47.149 55.261  1.00 667.19 ?  -189 DG  J "O5'" 1 
ATOM 2543  C "C5'" . DG  A 1 124 ? 8.823   -47.343 55.402  1.00 667.19 ?  -189 DG  J "C5'" 1 
ATOM 2544  C "C4'" . DG  A 1 124 ? 9.377   -46.625 56.626  1.00 667.19 ?  -189 DG  J "C4'" 1 
ATOM 2545  O "O4'" . DG  A 1 124 ? 8.921   -45.252 56.665  1.00 667.19 ?  -189 DG  J "O4'" 1 
ATOM 2546  C "C3'" . DG  A 1 124 ? 9.024   -47.221 57.988  1.00 667.19 ?  -189 DG  J "C3'" 1 
ATOM 2547  O "O3'" . DG  A 1 124 ? 10.122  -47.081 58.927  1.00 667.19 ?  -189 DG  J "O3'" 1 
ATOM 2548  C "C2'" . DG  A 1 124 ? 7.801   -46.401 58.413  1.00 667.19 ?  -189 DG  J "C2'" 1 
ATOM 2549  C "C1'" . DG  A 1 124 ? 8.110   -45.029 57.803  1.00 667.19 ?  -189 DG  J "C1'" 1 
ATOM 2550  N N9    . DG  A 1 124 ? 6.983   -44.250 57.294  1.00 667.19 ?  -189 DG  J N9    1 
ATOM 2551  C C8    . DG  A 1 124 ? 5.881   -44.714 56.616  1.00 667.19 ?  -189 DG  J C8    1 
ATOM 2552  N N7    . DG  A 1 124 ? 5.048   -43.775 56.259  1.00 667.19 ?  -189 DG  J N7    1 
ATOM 2553  C C5    . DG  A 1 124 ? 5.639   -42.607 56.724  1.00 667.19 ?  -189 DG  J C5    1 
ATOM 2554  C C6    . DG  A 1 124 ? 5.194   -41.264 56.634  1.00 667.19 ?  -189 DG  J C6    1 
ATOM 2555  O O6    . DG  A 1 124 ? 4.161   -40.830 56.107  1.00 667.19 ?  -189 DG  J O6    1 
ATOM 2556  N N1    . DG  A 1 124 ? 6.091   -40.381 57.234  1.00 667.19 ?  -189 DG  J N1    1 
ATOM 2557  C C2    . DG  A 1 124 ? 7.268   -40.756 57.843  1.00 667.19 ?  -189 DG  J C2    1 
ATOM 2558  N N2    . DG  A 1 124 ? 8.005   -39.768 58.366  1.00 667.19 ?  -189 DG  J N2    1 
ATOM 2559  N N3    . DG  A 1 124 ? 7.696   -42.010 57.937  1.00 667.19 ?  -189 DG  J N3    1 
ATOM 2560  C C4    . DG  A 1 124 ? 6.834   -42.883 57.357  1.00 667.19 ?  -189 DG  J C4    1 
ATOM 2561  P P     . DA  A 1 125 ? 11.665  -47.419 58.613  1.00 648.84 ?  -188 DA  J P     1 
ATOM 2562  O OP1   . DA  A 1 125 ? 11.923  -47.463 57.156  1.00 648.84 ?  -188 DA  J OP1   1 
ATOM 2563  O OP2   . DA  A 1 125 ? 12.043  -48.564 59.462  1.00 648.84 -1 -188 DA  J OP2   1 
ATOM 2564  O "O5'" . DA  A 1 125 ? 12.417  -46.151 59.210  1.00 648.84 ?  -188 DA  J "O5'" 1 
ATOM 2565  C "C5'" . DA  A 1 125 ? 12.940  -45.113 58.372  1.00 648.84 ?  -188 DA  J "C5'" 1 
ATOM 2566  C "C4'" . DA  A 1 125 ? 13.163  -43.865 59.208  1.00 648.84 ?  -188 DA  J "C4'" 1 
ATOM 2567  O "O4'" . DA  A 1 125 ? 11.874  -43.300 59.556  1.00 648.84 ?  -188 DA  J "O4'" 1 
ATOM 2568  C "C3'" . DA  A 1 125 ? 13.889  -44.093 60.532  1.00 648.84 ?  -188 DA  J "C3'" 1 
ATOM 2569  O "O3'" . DA  A 1 125 ? 14.733  -42.978 60.770  1.00 648.84 ?  -188 DA  J "O3'" 1 
ATOM 2570  C "C2'" . DA  A 1 125 ? 12.758  -44.199 61.555  1.00 648.84 ?  -188 DA  J "C2'" 1 
ATOM 2571  C "C1'" . DA  A 1 125 ? 11.737  -43.237 60.965  1.00 648.84 ?  -188 DA  J "C1'" 1 
ATOM 2572  N N9    . DA  A 1 125 ? 10.358  -43.566 61.278  1.00 648.84 ?  -188 DA  J N9    1 
ATOM 2573  C C8    . DA  A 1 125 ? 9.842   -44.788 61.599  1.00 648.84 ?  -188 DA  J C8    1 
ATOM 2574  N N7    . DA  A 1 125 ? 8.555   -44.768 61.822  1.00 648.84 ?  -188 DA  J N7    1 
ATOM 2575  C C5    . DA  A 1 125 ? 8.205   -43.441 61.621  1.00 648.84 ?  -188 DA  J C5    1 
ATOM 2576  C C6    . DA  A 1 125 ? 6.974   -42.750 61.705  1.00 648.84 ?  -188 DA  J C6    1 
ATOM 2577  N N6    . DA  A 1 125 ? 5.825   -43.353 62.027  1.00 648.84 ?  -188 DA  J N6    1 
ATOM 2578  N N1    . DA  A 1 125 ? 6.971   -41.418 61.456  1.00 648.84 ?  -188 DA  J N1    1 
ATOM 2579  C C2    . DA  A 1 125 ? 8.127   -40.821 61.143  1.00 648.84 ?  -188 DA  J C2    1 
ATOM 2580  N N3    . DA  A 1 125 ? 9.338   -41.367 61.030  1.00 648.84 ?  -188 DA  J N3    1 
ATOM 2581  C C4    . DA  A 1 125 ? 9.308   -42.686 61.288  1.00 648.84 ?  -188 DA  J C4    1 
ATOM 2582  P P     . DG  A 1 126 ? 15.456  -42.677 62.162  1.00 646.49 ?  -187 DG  J P     1 
ATOM 2583  O OP1   . DG  A 1 126 ? 16.627  -41.864 61.789  1.00 646.49 ?  -187 DG  J OP1   1 
ATOM 2584  O OP2   . DG  A 1 126 ? 15.630  -43.899 62.979  1.00 646.49 -1 -187 DG  J OP2   1 
ATOM 2585  O "O5'" . DG  A 1 126 ? 14.372  -41.781 62.902  1.00 646.49 ?  -187 DG  J "O5'" 1 
ATOM 2586  C "C5'" . DG  A 1 126 ? 14.130  -40.452 62.487  1.00 646.49 ?  -187 DG  J "C5'" 1 
ATOM 2587  C "C4'" . DG  A 1 126 ? 13.389  -39.733 63.594  1.00 646.49 ?  -187 DG  J "C4'" 1 
ATOM 2588  O "O4'" . DG  A 1 126 ? 12.047  -40.267 63.649  1.00 646.49 ?  -187 DG  J "O4'" 1 
ATOM 2589  C "C3'" . DG  A 1 126 ? 13.990  -39.879 64.991  1.00 646.49 ?  -187 DG  J "C3'" 1 
ATOM 2590  O "O3'" . DG  A 1 126 ? 14.169  -38.562 65.544  1.00 646.49 ?  -187 DG  J "O3'" 1 
ATOM 2591  C "C2'" . DG  A 1 126 ? 13.019  -40.804 65.741  1.00 646.49 ?  -187 DG  J "C2'" 1 
ATOM 2592  C "C1'" . DG  A 1 126 ? 11.713  -40.660 64.963  1.00 646.49 ?  -187 DG  J "C1'" 1 
ATOM 2593  N N9    . DG  A 1 126 ? 10.873  -41.863 64.859  1.00 646.49 ?  -187 DG  J N9    1 
ATOM 2594  C C8    . DG  A 1 126 ? 11.263  -43.178 64.719  1.00 646.49 ?  -187 DG  J C8    1 
ATOM 2595  N N7    . DG  A 1 126 ? 10.263  -44.016 64.643  1.00 646.49 ?  -187 DG  J N7    1 
ATOM 2596  C C5    . DG  A 1 126 ? 9.131   -43.213 64.736  1.00 646.49 ?  -187 DG  J C5    1 
ATOM 2597  C C6    . DG  A 1 126 ? 7.744   -43.544 64.717  1.00 646.49 ?  -187 DG  J C6    1 
ATOM 2598  O O6    . DG  A 1 126 ? 7.208   -44.655 64.598  1.00 646.49 ?  -187 DG  J O6    1 
ATOM 2599  N N1    . DG  A 1 126 ? 6.930   -42.418 64.831  1.00 646.49 ?  -187 DG  J N1    1 
ATOM 2600  C C2    . DG  A 1 126 ? 7.394   -41.130 64.958  1.00 646.49 ?  -187 DG  J C2    1 
ATOM 2601  N N2    . DG  A 1 126 ? 6.463   -40.177 65.058  1.00 646.49 ?  -187 DG  J N2    1 
ATOM 2602  N N3    . DG  A 1 126 ? 8.680   -40.801 64.982  1.00 646.49 ?  -187 DG  J N3    1 
ATOM 2603  C C4    . DG  A 1 126 ? 9.492   -41.885 64.862  1.00 646.49 ?  -187 DG  J C4    1 
ATOM 2604  P P     . DC  A 1 127 ? 14.118  -38.206 67.106  1.00 645.70 ?  -186 DC  J P     1 
ATOM 2605  O OP1   . DC  A 1 127 ? 14.838  -36.928 67.276  1.00 645.70 ?  -186 DC  J OP1   1 
ATOM 2606  O OP2   . DC  A 1 127 ? 14.494  -39.390 67.914  1.00 645.70 -1 -186 DC  J OP2   1 
ATOM 2607  O "O5'" . DC  A 1 127 ? 12.567  -37.937 67.342  1.00 645.70 ?  -186 DC  J "O5'" 1 
ATOM 2608  C "C5'" . DC  A 1 127 ? 11.970  -36.743 66.882  1.00 645.70 ?  -186 DC  J "C5'" 1 
ATOM 2609  C "C4'" . DC  A 1 127 ? 10.724  -36.476 67.700  1.00 645.70 ?  -186 DC  J "C4'" 1 
ATOM 2610  O "O4'" . DC  A 1 127 ? 9.764   -37.530 67.448  1.00 645.70 ?  -186 DC  J "O4'" 1 
ATOM 2611  C "C3'" . DC  A 1 127 ? 10.958  -36.425 69.208  1.00 645.70 ?  -186 DC  J "C3'" 1 
ATOM 2612  O "O3'" . DC  A 1 127 ? 10.299  -35.291 69.767  1.00 645.70 ?  -186 DC  J "O3'" 1 
ATOM 2613  C "C2'" . DC  A 1 127 ? 10.397  -37.753 69.716  1.00 645.70 ?  -186 DC  J "C2'" 1 
ATOM 2614  C "C1'" . DC  A 1 127 ? 9.333   -38.084 68.676  1.00 645.70 ?  -186 DC  J "C1'" 1 
ATOM 2615  N N1    . DC  A 1 127 ? 9.120   -39.563 68.533  1.00 645.70 ?  -186 DC  J N1    1 
ATOM 2616  C C2    . DC  A 1 127 ? 7.891   -40.137 68.895  1.00 645.70 ?  -186 DC  J C2    1 
ATOM 2617  O O2    . DC  A 1 127 ? 6.983   -39.411 69.322  1.00 645.70 ?  -186 DC  J O2    1 
ATOM 2618  N N3    . DC  A 1 127 ? 7.730   -41.479 68.759  1.00 645.70 ?  -186 DC  J N3    1 
ATOM 2619  C C4    . DC  A 1 127 ? 8.729   -42.234 68.295  1.00 645.70 ?  -186 DC  J C4    1 
ATOM 2620  N N4    . DC  A 1 127 ? 8.536   -43.549 68.177  1.00 645.70 ?  -186 DC  J N4    1 
ATOM 2621  C C5    . DC  A 1 127 ? 9.988   -41.673 67.934  1.00 645.70 ?  -186 DC  J C5    1 
ATOM 2622  C C6    . DC  A 1 127 ? 10.135  -40.352 68.063  1.00 645.70 ?  -186 DC  J C6    1 
ATOM 2623  P P     . DG  A 1 128 ? 9.970   -35.178 71.329  1.00 640.19 ?  -185 DG  J P     1 
ATOM 2624  O OP1   . DG  A 1 128 ? 9.953   -33.736 71.662  1.00 640.45 ?  -185 DG  J OP1   1 
ATOM 2625  O OP2   . DG  A 1 128 ? 10.820  -36.096 72.120  1.00 639.73 -1 -185 DG  J OP2   1 
ATOM 2626  O "O5'" . DG  A 1 128 ? 8.481   -35.743 71.353  1.00 642.37 ?  -185 DG  J "O5'" 1 
ATOM 2627  C "C5'" . DG  A 1 128 ? 7.382   -34.913 70.999  1.00 646.25 ?  -185 DG  J "C5'" 1 
ATOM 2628  C "C4'" . DG  A 1 128 ? 6.122   -35.418 71.678  1.00 649.42 ?  -185 DG  J "C4'" 1 
ATOM 2629  O "O4'" . DG  A 1 128 ? 6.065   -36.864 71.574  1.00 649.98 ?  -185 DG  J "O4'" 1 
ATOM 2630  C "C3'" . DG  A 1 128 ? 5.983   -35.134 73.170  1.00 651.67 ?  -185 DG  J "C3'" 1 
ATOM 2631  O "O3'" . DG  A 1 128 ? 4.579   -35.003 73.447  1.00 654.82 ?  -185 DG  J "O3'" 1 
ATOM 2632  C "C2'" . DG  A 1 128 ? 6.639   -36.364 73.805  1.00 651.08 ?  -185 DG  J "C2'" 1 
ATOM 2633  C "C1'" . DG  A 1 128 ? 6.160   -37.462 72.859  1.00 650.77 ?  -185 DG  J "C1'" 1 
ATOM 2634  N N9    . DG  A 1 128 ? 7.037   -38.624 72.706  1.00 650.95 ?  -185 DG  J N9    1 
ATOM 2635  C C8    . DG  A 1 128 ? 8.398   -38.713 72.907  1.00 651.11 ?  -185 DG  J C8    1 
ATOM 2636  N N7    . DG  A 1 128 ? 8.889   -39.902 72.669  1.00 651.08 ?  -185 DG  J N7    1 
ATOM 2637  C C5    . DG  A 1 128 ? 7.783   -40.645 72.275  1.00 650.85 ?  -185 DG  J C5    1 
ATOM 2638  C C6    . DG  A 1 128 ? 7.680   -42.002 71.889  1.00 650.76 ?  -185 DG  J C6    1 
ATOM 2639  O O6    . DG  A 1 128 ? 8.588   -42.835 71.820  1.00 650.94 ?  -185 DG  J O6    1 
ATOM 2640  N N1    . DG  A 1 128 ? 6.374   -42.373 71.571  1.00 650.79 ?  -185 DG  J N1    1 
ATOM 2641  C C2    . DG  A 1 128 ? 5.293   -41.522 71.620  1.00 650.82 ?  -185 DG  J C2    1 
ATOM 2642  N N2    . DG  A 1 128 ? 4.105   -42.029 71.279  1.00 650.89 ?  -185 DG  J N2    1 
ATOM 2643  N N3    . DG  A 1 128 ? 5.374   -40.249 71.981  1.00 650.94 ?  -185 DG  J N3    1 
ATOM 2644  C C4    . DG  A 1 128 ? 6.641   -39.877 72.295  1.00 650.89 ?  -185 DG  J C4    1 
ATOM 2645  P P     . DG  A 1 129 ? 3.896   -35.139 74.896  1.00 646.83 ?  -184 DG  J P     1 
ATOM 2646  O OP1   . DG  A 1 129 ? 3.604   -33.769 75.368  1.00 647.02 ?  -184 DG  J OP1   1 
ATOM 2647  O OP2   . DG  A 1 129 ? 4.683   -36.057 75.755  1.00 646.77 -1 -184 DG  J OP2   1 
ATOM 2648  O "O5'" . DG  A 1 129 ? 2.503   -35.857 74.554  1.00 648.49 ?  -184 DG  J "O5'" 1 
ATOM 2649  C "C5'" . DG  A 1 129 ? 2.447   -37.069 73.791  1.00 650.43 ?  -184 DG  J "C5'" 1 
ATOM 2650  C "C4'" . DG  A 1 129 ? 1.925   -38.250 74.604  1.00 651.72 ?  -184 DG  J "C4'" 1 
ATOM 2651  O "O4'" . DG  A 1 129 ? 2.837   -39.370 74.454  1.00 652.34 ?  -184 DG  J "O4'" 1 
ATOM 2652  C "C3'" . DG  A 1 129 ? 1.777   -38.063 76.114  1.00 652.34 ?  -184 DG  J "C3'" 1 
ATOM 2653  O "O3'" . DG  A 1 129 ? 0.714   -38.905 76.575  1.00 653.07 ?  -184 DG  J "O3'" 1 
ATOM 2654  C "C2'" . DG  A 1 129 ? 3.141   -38.527 76.607  1.00 652.53 ?  -184 DG  J "C2'" 1 
ATOM 2655  C "C1'" . DG  A 1 129 ? 3.320   -39.755 75.726  1.00 653.13 ?  -184 DG  J "C1'" 1 
ATOM 2656  N N9    . DG  A 1 129 ? 4.696   -40.227 75.602  1.00 653.31 ?  -184 DG  J N9    1 
ATOM 2657  C C8    . DG  A 1 129 ? 5.851   -39.525 75.851  1.00 653.46 ?  -184 DG  J C8    1 
ATOM 2658  N N7    . DG  A 1 129 ? 6.938   -40.217 75.654  1.00 653.44 ?  -184 DG  J N7    1 
ATOM 2659  C C5    . DG  A 1 129 ? 6.472   -41.460 75.248  1.00 653.52 ?  -184 DG  J C5    1 
ATOM 2660  C C6    . DG  A 1 129 ? 7.189   -42.631 74.893  1.00 653.68 ?  -184 DG  J C6    1 
ATOM 2661  O O6    . DG  A 1 129 ? 8.417   -42.787 74.862  1.00 653.69 ?  -184 DG  J O6    1 
ATOM 2662  N N1    . DG  A 1 129 ? 6.344   -43.684 74.535  1.00 653.54 ?  -184 DG  J N1    1 
ATOM 2663  C C2    . DG  A 1 129 ? 4.970   -43.608 74.527  1.00 653.47 ?  -184 DG  J C2    1 
ATOM 2664  N N2    . DG  A 1 129 ? 4.317   -44.718 74.162  1.00 653.44 ?  -184 DG  J N2    1 
ATOM 2665  N N3    . DG  A 1 129 ? 4.284   -42.519 74.863  1.00 653.54 ?  -184 DG  J N3    1 
ATOM 2666  C C4    . DG  A 1 129 ? 5.095   -41.485 75.211  1.00 653.43 ?  -184 DG  J C4    1 
ATOM 2667  P P     . DC  A 1 130 ? 0.442   -39.242 78.124  1.00 659.87 ?  -183 DC  J P     1 
ATOM 2668  O OP1   . DC  A 1 130 ? -0.460  -38.186 78.637  1.00 659.61 ?  -183 DC  J OP1   1 
ATOM 2669  O OP2   . DC  A 1 130 ? 1.728   -39.505 78.813  1.00 659.72 -1 -183 DC  J OP2   1 
ATOM 2670  O "O5'" . DC  A 1 130 ? -0.347  -40.644 78.083  1.00 660.10 ?  -183 DC  J "O5'" 1 
ATOM 2671  C "C5'" . DC  A 1 130 ? -0.091  -41.660 77.092  1.00 660.36 ?  -183 DC  J "C5'" 1 
ATOM 2672  C "C4'" . DC  A 1 130 ? 0.542   -42.937 77.636  1.00 660.52 ?  -183 DC  J "C4'" 1 
ATOM 2673  O "O4'" . DC  A 1 130 ? 1.918   -42.989 77.184  1.00 660.61 ?  -183 DC  J "O4'" 1 
ATOM 2674  C "C3'" . DC  A 1 130 ? 0.607   -43.108 79.152  1.00 660.92 ?  -183 DC  J "C3'" 1 
ATOM 2675  O "O3'" . DC  A 1 130 ? -0.519  -43.856 79.617  1.00 661.87 ?  -183 DC  J "O3'" 1 
ATOM 2676  C "C2'" . DC  A 1 130 ? 1.904   -43.877 79.389  1.00 660.65 ?  -183 DC  J "C2'" 1 
ATOM 2677  C "C1'" . DC  A 1 130 ? 2.701   -43.740 78.094  1.00 660.51 ?  -183 DC  J "C1'" 1 
ATOM 2678  N N1    . DC  A 1 130 ? 4.060   -43.097 78.281  1.00 660.39 ?  -183 DC  J N1    1 
ATOM 2679  C C2    . DC  A 1 130 ? 5.214   -43.769 77.845  1.00 660.32 ?  -183 DC  J C2    1 
ATOM 2680  O O2    . DC  A 1 130 ? 5.112   -44.876 77.306  1.00 660.35 ?  -183 DC  J O2    1 
ATOM 2681  N N3    . DC  A 1 130 ? 6.428   -43.186 78.018  1.00 660.26 ?  -183 DC  J N3    1 
ATOM 2682  C C4    . DC  A 1 130 ? 6.528   -41.989 78.598  1.00 660.33 ?  -183 DC  J C4    1 
ATOM 2683  N N4    . DC  A 1 130 ? 7.751   -41.466 78.744  1.00 660.26 ?  -183 DC  J N4    1 
ATOM 2684  C C5    . DC  A 1 130 ? 5.370   -41.285 79.054  1.00 660.39 ?  -183 DC  J C5    1 
ATOM 2685  C C6    . DC  A 1 130 ? 4.175   -41.868 78.876  1.00 660.38 ?  -183 DC  J C6    1 
ATOM 2686  P P     . DC  A 1 131 ? -0.822  -44.099 81.178  1.00 659.38 ?  -182 DC  J P     1 
ATOM 2687  O OP1   . DC  A 1 131 ? -2.221  -44.579 81.273  1.00 659.30 ?  -182 DC  J OP1   1 
ATOM 2688  O OP2   . DC  A 1 131 ? -0.433  -42.886 81.939  1.00 659.06 -1 -182 DC  J OP2   1 
ATOM 2689  O "O5'" . DC  A 1 131 ? 0.170   -45.301 81.576  1.00 659.96 ?  -182 DC  J "O5'" 1 
ATOM 2690  C "C5'" . DC  A 1 131 ? -0.011  -46.627 81.042  1.00 660.96 ?  -182 DC  J "C5'" 1 
ATOM 2691  C "C4'" . DC  A 1 131 ? 1.090   -47.609 81.438  1.00 661.56 ?  -182 DC  J "C4'" 1 
ATOM 2692  O "O4'" . DC  A 1 131 ? 2.392   -47.131 81.009  1.00 661.81 ?  -182 DC  J "O4'" 1 
ATOM 2693  C "C3'" . DC  A 1 131 ? 1.235   -47.932 82.926  1.00 661.90 ?  -182 DC  J "C3'" 1 
ATOM 2694  O "O3'" . DC  A 1 131 ? 1.516   -49.323 83.059  1.00 662.52 ?  -182 DC  J "O3'" 1 
ATOM 2695  C "C2'" . DC  A 1 131 ? 2.430   -47.083 83.349  1.00 661.91 ?  -182 DC  J "C2'" 1 
ATOM 2696  C "C1'" . DC  A 1 131 ? 3.297   -47.173 82.097  1.00 661.92 ?  -182 DC  J "C1'" 1 
ATOM 2697  N N1    . DC  A 1 131 ? 4.312   -46.073 81.940  1.00 662.09 ?  -182 DC  J N1    1 
ATOM 2698  C C2    . DC  A 1 131 ? 5.662   -46.394 81.709  1.00 662.02 ?  -182 DC  J C2    1 
ATOM 2699  O O2    . DC  A 1 131 ? 6.001   -47.582 81.639  1.00 661.91 ?  -182 DC  J O2    1 
ATOM 2700  N N3    . DC  A 1 131 ? 6.565   -45.386 81.566  1.00 662.02 ?  -182 DC  J N3    1 
ATOM 2701  C C4    . DC  A 1 131 ? 6.167   -44.111 81.645  1.00 661.98 ?  -182 DC  J C4    1 
ATOM 2702  N N4    . DC  A 1 131 ? 7.088   -43.155 81.499  1.00 661.97 ?  -182 DC  J N4    1 
ATOM 2703  C C5    . DC  A 1 131 ? 4.804   -43.757 81.877  1.00 662.05 ?  -182 DC  J C5    1 
ATOM 2704  C C6    . DC  A 1 131 ? 3.926   -44.759 82.017  1.00 662.19 ?  -182 DC  J C6    1 
ATOM 2705  P P     . DT  A 1 132 ? 1.408   -50.084 84.468  1.00 665.29 ?  -181 DT  J P     1 
ATOM 2706  O OP1   . DT  A 1 132 ? -0.018  -50.094 84.861  1.00 665.29 ?  -181 DT  J OP1   1 
ATOM 2707  O OP2   . DT  A 1 132 ? 2.406   -49.526 85.411  1.00 665.29 -1 -181 DT  J OP2   1 
ATOM 2708  O "O5'" . DT  A 1 132 ? 1.874   -51.576 84.103  1.00 665.29 ?  -181 DT  J "O5'" 1 
ATOM 2709  C "C5'" . DT  A 1 132 ? 2.860   -51.832 83.093  1.00 665.29 ?  -181 DT  J "C5'" 1 
ATOM 2710  C "C4'" . DT  A 1 132 ? 4.239   -52.154 83.662  1.00 665.29 ?  -181 DT  J "C4'" 1 
ATOM 2711  O "O4'" . DT  A 1 132 ? 5.082   -50.980 83.561  1.00 665.29 ?  -181 DT  J "O4'" 1 
ATOM 2712  C "C3'" . DT  A 1 132 ? 4.282   -52.604 85.122  1.00 665.29 ?  -181 DT  J "C3'" 1 
ATOM 2713  O "O3'" . DT  A 1 132 ? 4.770   -53.974 85.169  1.00 665.29 ?  -181 DT  J "O3'" 1 
ATOM 2714  C "C2'" . DT  A 1 132 ? 5.104   -51.537 85.860  1.00 665.29 ?  -181 DT  J "C2'" 1 
ATOM 2715  C "C1'" . DT  A 1 132 ? 5.851   -50.819 84.737  1.00 665.29 ?  -181 DT  J "C1'" 1 
ATOM 2716  N N1    . DT  A 1 132 ? 6.094   -49.338 84.915  1.00 665.29 ?  -181 DT  J N1    1 
ATOM 2717  C C2    . DT  A 1 132 ? 7.184   -48.744 84.282  1.00 665.29 ?  -181 DT  J C2    1 
ATOM 2718  O O2    . DT  A 1 132 ? 7.988   -49.338 83.582  1.00 665.29 ?  -181 DT  J O2    1 
ATOM 2719  N N3    . DT  A 1 132 ? 7.308   -47.391 84.501  1.00 665.29 ?  -181 DT  J N3    1 
ATOM 2720  C C4    . DT  A 1 132 ? 6.478   -46.589 85.265  1.00 665.29 ?  -181 DT  J C4    1 
ATOM 2721  O O4    . DT  A 1 132 ? 6.693   -45.388 85.385  1.00 665.29 ?  -181 DT  J O4    1 
ATOM 2722  C C5    . DT  A 1 132 ? 5.360   -47.266 85.897  1.00 665.29 ?  -181 DT  J C5    1 
ATOM 2723  C C7    . DT  A 1 132 ? 4.378   -46.519 86.755  1.00 665.29 ?  -181 DT  J C7    1 
ATOM 2724  C C6    . DT  A 1 132 ? 5.226   -48.585 85.692  1.00 665.29 ?  -181 DT  J C6    1 
ATOM 2725  P P     . DC  A 1 133 ? 6.254   -54.485 85.518  1.00 668.21 ?  -180 DC  J P     1 
ATOM 2726  O OP1   . DC  A 1 133 ? 6.308   -55.927 85.181  1.00 668.21 ?  -180 DC  J OP1   1 
ATOM 2727  O OP2   . DC  A 1 133 ? 6.548   -54.069 86.906  1.00 668.21 -1 -180 DC  J OP2   1 
ATOM 2728  O "O5'" . DC  A 1 133 ? 7.210   -53.686 84.506  1.00 668.21 ?  -180 DC  J "O5'" 1 
ATOM 2729  C "C5'" . DC  A 1 133 ? 8.410   -54.272 83.986  1.00 668.21 ?  -180 DC  J "C5'" 1 
ATOM 2730  C "C4'" . DC  A 1 133 ? 9.652   -53.774 84.712  1.00 668.21 ?  -180 DC  J "C4'" 1 
ATOM 2731  O "O4'" . DC  A 1 133 ? 9.474   -52.406 85.167  1.00 668.21 ?  -180 DC  J "O4'" 1 
ATOM 2732  C "C3'" . DC  A 1 133 ? 10.056  -54.573 85.949  1.00 668.21 ?  -180 DC  J "C3'" 1 
ATOM 2733  O "O3'" . DC  A 1 133 ? 11.465  -54.718 85.961  1.00 668.21 ?  -180 DC  J "O3'" 1 
ATOM 2734  C "C2'" . DC  A 1 133 ? 9.594   -53.701 87.110  1.00 668.21 ?  -180 DC  J "C2'" 1 
ATOM 2735  C "C1'" . DC  A 1 133 ? 9.827   -52.308 86.535  1.00 668.21 ?  -180 DC  J "C1'" 1 
ATOM 2736  N N1    . DC  A 1 133 ? 9.057   -51.171 87.171  1.00 668.21 ?  -180 DC  J N1    1 
ATOM 2737  C C2    . DC  A 1 133 ? 9.332   -49.848 86.773  1.00 668.21 ?  -180 DC  J C2    1 
ATOM 2738  O O2    . DC  A 1 133 ? 10.196  -49.632 85.912  1.00 668.21 ?  -180 DC  J O2    1 
ATOM 2739  N N3    . DC  A 1 133 ? 8.638   -48.825 87.340  1.00 668.21 ?  -180 DC  J N3    1 
ATOM 2740  C C4    . DC  A 1 133 ? 7.709   -49.072 88.266  1.00 668.21 ?  -180 DC  J C4    1 
ATOM 2741  N N4    . DC  A 1 133 ? 7.059   -48.027 88.789  1.00 668.21 ?  -180 DC  J N4    1 
ATOM 2742  C C5    . DC  A 1 133 ? 7.411   -50.405 88.687  1.00 668.21 ?  -180 DC  J C5    1 
ATOM 2743  C C6    . DC  A 1 133 ? 8.100   -51.408 88.122  1.00 668.21 ?  -180 DC  J C6    1 
ATOM 2744  P P     . DG  A 1 134 ? 12.138  -56.134 86.288  1.00 659.26 ?  -179 DG  J P     1 
ATOM 2745  O OP1   . DG  A 1 134 ? 11.637  -57.115 85.295  1.00 659.26 ?  -179 DG  J OP1   1 
ATOM 2746  O OP2   . DG  A 1 134 ? 11.963  -56.368 87.742  1.00 659.26 -1 -179 DG  J OP2   1 
ATOM 2747  O "O5'" . DG  A 1 134 ? 13.702  -55.907 86.010  1.00 659.26 ?  -179 DG  J "O5'" 1 
ATOM 2748  C "C5'" . DG  A 1 134 ? 14.193  -54.785 85.264  1.00 659.26 ?  -179 DG  J "C5'" 1 
ATOM 2749  C "C4'" . DG  A 1 134 ? 15.031  -53.837 86.117  1.00 659.26 ?  -179 DG  J "C4'" 1 
ATOM 2750  O "O4'" . DG  A 1 134 ? 14.179  -52.825 86.713  1.00 659.26 ?  -179 DG  J "O4'" 1 
ATOM 2751  C "C3'" . DG  A 1 134 ? 15.811  -54.450 87.280  1.00 659.26 ?  -179 DG  J "C3'" 1 
ATOM 2752  O "O3'" . DG  A 1 134 ? 17.100  -53.845 87.354  1.00 659.26 ?  -179 DG  J "O3'" 1 
ATOM 2753  C "C2'" . DG  A 1 134 ? 14.955  -54.101 88.498  1.00 659.26 ?  -179 DG  J "C2'" 1 
ATOM 2754  C "C1'" . DG  A 1 134 ? 14.472  -52.717 88.091  1.00 659.26 ?  -179 DG  J "C1'" 1 
ATOM 2755  N N9    . DG  A 1 134 ? 13.262  -52.225 88.745  1.00 659.26 ?  -179 DG  J N9    1 
ATOM 2756  C C8    . DG  A 1 134 ? 12.162  -52.940 89.158  1.00 659.26 ?  -179 DG  J C8    1 
ATOM 2757  N N7    . DG  A 1 134 ? 11.228  -52.204 89.698  1.00 659.26 ?  -179 DG  J N7    1 
ATOM 2758  C C5    . DG  A 1 134 ? 11.740  -50.915 89.637  1.00 659.26 ?  -179 DG  J C5    1 
ATOM 2759  C C6    . DG  A 1 134 ? 11.184  -49.684 90.072  1.00 659.26 ?  -179 DG  J C6    1 
ATOM 2760  O O6    . DG  A 1 134 ? 10.086  -49.492 90.614  1.00 659.26 ?  -179 DG  J O6    1 
ATOM 2761  N N1    . DG  A 1 134 ? 12.035  -48.604 89.829  1.00 659.26 ?  -179 DG  J N1    1 
ATOM 2762  C C2    . DG  A 1 134 ? 13.275  -48.705 89.234  1.00 659.26 ?  -179 DG  J C2    1 
ATOM 2763  N N2    . DG  A 1 134 ? 13.957  -47.562 89.073  1.00 659.26 ?  -179 DG  J N2    1 
ATOM 2764  N N3    . DG  A 1 134 ? 13.808  -49.850 88.817  1.00 659.26 ?  -179 DG  J N3    1 
ATOM 2765  C C4    . DG  A 1 134 ? 12.991  -50.910 89.052  1.00 659.26 ?  -179 DG  J C4    1 
ATOM 2766  P P     . DG  A 1 135 ? 18.378  -54.495 86.646  1.00 674.10 ?  -178 DG  J P     1 
ATOM 2767  O OP1   . DG  A 1 135 ? 18.034  -54.835 85.247  1.00 674.10 ?  -178 DG  J OP1   1 
ATOM 2768  O OP2   . DG  A 1 135 ? 18.902  -55.534 87.561  1.00 674.10 -1 -178 DG  J OP2   1 
ATOM 2769  O "O5'" . DG  A 1 135 ? 19.423  -53.283 86.646  1.00 674.10 ?  -178 DG  J "O5'" 1 
ATOM 2770  C "C5'" . DG  A 1 135 ? 19.280  -52.160 85.775  1.00 674.10 ?  -178 DG  J "C5'" 1 
ATOM 2771  C "C4'" . DG  A 1 135 ? 19.788  -50.874 86.418  1.00 674.10 ?  -178 DG  J "C4'" 1 
ATOM 2772  O "O4'" . DG  A 1 135 ? 18.799  -50.402 87.361  1.00 674.10 ?  -178 DG  J "O4'" 1 
ATOM 2773  C "C3'" . DG  A 1 135 ? 21.096  -50.939 87.202  1.00 674.10 ?  -178 DG  J "C3'" 1 
ATOM 2774  O "O3'" . DG  A 1 135 ? 21.827  -49.720 86.993  1.00 674.10 ?  -178 DG  J "O3'" 1 
ATOM 2775  C "C2'" . DG  A 1 135 ? 20.641  -51.140 88.645  1.00 674.10 ?  -178 DG  J "C2'" 1 
ATOM 2776  C "C1'" . DG  A 1 135 ? 19.332  -50.370 88.667  1.00 674.10 ?  -178 DG  J "C1'" 1 
ATOM 2777  N N9    . DG  A 1 135 ? 18.304  -50.940 89.522  1.00 674.10 ?  -178 DG  J N9    1 
ATOM 2778  C C8    . DG  A 1 135 ? 18.023  -52.268 89.729  1.00 674.10 ?  -178 DG  J C8    1 
ATOM 2779  N N7    . DG  A 1 135 ? 17.029  -52.466 90.542  1.00 674.10 ?  -178 DG  J N7    1 
ATOM 2780  C C5    . DG  A 1 135 ? 16.624  -51.185 90.891  1.00 674.10 ?  -178 DG  J C5    1 
ATOM 2781  C C6    . DG  A 1 135 ? 15.585  -50.758 91.751  1.00 674.10 ?  -178 DG  J C6    1 
ATOM 2782  O O6    . DG  A 1 135 ? 14.791  -51.462 92.389  1.00 674.10 ?  -178 DG  J O6    1 
ATOM 2783  N N1    . DG  A 1 135 ? 15.509  -49.364 91.834  1.00 674.10 ?  -178 DG  J N1    1 
ATOM 2784  C C2    . DG  A 1 135 ? 16.337  -48.492 91.167  1.00 674.10 ?  -178 DG  J C2    1 
ATOM 2785  N N2    . DG  A 1 135 ? 16.114  -47.185 91.372  1.00 674.10 ?  -178 DG  J N2    1 
ATOM 2786  N N3    . DG  A 1 135 ? 17.314  -48.882 90.358  1.00 674.10 ?  -178 DG  J N3    1 
ATOM 2787  C C4    . DG  A 1 135 ? 17.398  -50.234 90.269  1.00 674.10 ?  -178 DG  J C4    1 
ATOM 2788  P P     . DC  A 1 136 ? 23.115  -49.288 87.849  1.00 671.33 ?  -177 DC  J P     1 
ATOM 2789  O OP1   . DC  A 1 136 ? 23.882  -48.320 87.035  1.00 671.33 ?  -177 DC  J OP1   1 
ATOM 2790  O OP2   . DC  A 1 136 ? 23.815  -50.490 88.358  1.00 671.33 -1 -177 DC  J OP2   1 
ATOM 2791  O "O5'" . DC  A 1 136 ? 22.450  -48.544 89.097  1.00 671.33 ?  -177 DC  J "O5'" 1 
ATOM 2792  C "C5'" . DC  A 1 136 ? 21.632  -47.384 88.935  1.00 671.33 ?  -177 DC  J "C5'" 1 
ATOM 2793  C "C4'" . DC  A 1 136 ? 21.119  -46.902 90.283  1.00 671.33 ?  -177 DC  J "C4'" 1 
ATOM 2794  O "O4'" . DC  A 1 136 ? 20.227  -47.906 90.832  1.00 671.33 ?  -177 DC  J "O4'" 1 
ATOM 2795  C "C3'" . DC  A 1 136 ? 22.190  -46.661 91.350  1.00 671.33 ?  -177 DC  J "C3'" 1 
ATOM 2796  O "O3'" . DC  A 1 136 ? 21.967  -45.444 92.060  1.00 671.33 ?  -177 DC  J "O3'" 1 
ATOM 2797  C "C2'" . DC  A 1 136 ? 22.066  -47.861 92.281  1.00 671.33 ?  -177 DC  J "C2'" 1 
ATOM 2798  C "C1'" . DC  A 1 136 ? 20.570  -48.130 92.185  1.00 671.33 ?  -177 DC  J "C1'" 1 
ATOM 2799  N N1    . DC  A 1 136 ? 20.137  -49.506 92.604  1.00 671.33 ?  -177 DC  J N1    1 
ATOM 2800  C C2    . DC  A 1 136 ? 18.977  -49.644 93.380  1.00 671.33 ?  -177 DC  J C2    1 
ATOM 2801  O O2    . DC  A 1 136 ? 18.332  -48.639 93.701  1.00 671.33 ?  -177 DC  J O2    1 
ATOM 2802  N N3    . DC  A 1 136 ? 18.582  -50.885 93.764  1.00 671.33 ?  -177 DC  J N3    1 
ATOM 2803  C C4    . DC  A 1 136 ? 19.294  -51.959 93.405  1.00 671.33 ?  -177 DC  J C4    1 
ATOM 2804  N N4    . DC  A 1 136 ? 18.857  -53.154 93.814  1.00 671.33 ?  -177 DC  J N4    1 
ATOM 2805  C C5    . DC  A 1 136 ? 20.479  -51.844 92.615  1.00 671.33 ?  -177 DC  J C5    1 
ATOM 2806  C C6    . DC  A 1 136 ? 20.860  -50.613 92.242  1.00 671.33 ?  -177 DC  J C6    1 
ATOM 2807  P P     . DA  A 1 137 ? 23.215  -44.491 92.365  1.00 666.83 ?  -176 DA  J P     1 
ATOM 2808  O OP1   . DA  A 1 137 ? 23.550  -43.802 91.101  1.00 666.83 ?  -176 DA  J OP1   1 
ATOM 2809  O OP2   . DA  A 1 137 ? 24.247  -45.293 93.058  1.00 666.83 -1 -176 DA  J OP2   1 
ATOM 2810  O "O5'" . DA  A 1 137 ? 22.663  -43.430 93.425  1.00 666.83 ?  -176 DA  J "O5'" 1 
ATOM 2811  C "C5'" . DA  A 1 137 ? 21.523  -42.613 93.172  1.00 666.83 ?  -176 DA  J "C5'" 1 
ATOM 2812  C "C4'" . DA  A 1 137 ? 20.642  -42.546 94.413  1.00 666.83 ?  -176 DA  J "C4'" 1 
ATOM 2813  O "O4'" . DA  A 1 137 ? 19.999  -43.833 94.607  1.00 666.83 ?  -176 DA  J "O4'" 1 
ATOM 2814  C "C3'" . DA  A 1 137 ? 21.348  -42.224 95.735  1.00 666.83 ?  -176 DA  J "C3'" 1 
ATOM 2815  O "O3'" . DA  A 1 137 ? 20.524  -41.337 96.513  1.00 666.83 ?  -176 DA  J "O3'" 1 
ATOM 2816  C "C2'" . DA  A 1 137 ? 21.514  -43.603 96.372  1.00 666.83 ?  -176 DA  J "C2'" 1 
ATOM 2817  C "C1'" . DA  A 1 137 ? 20.209  -44.256 95.937  1.00 666.83 ?  -176 DA  J "C1'" 1 
ATOM 2818  N N9    . DA  A 1 137 ? 20.254  -45.710 95.976  1.00 666.83 ?  -176 DA  J N9    1 
ATOM 2819  C C8    . DA  A 1 137 ? 21.164  -46.523 95.361  1.00 666.83 ?  -176 DA  J C8    1 
ATOM 2820  N N7    . DA  A 1 137 ? 20.961  -47.801 95.576  1.00 666.83 ?  -176 DA  J N7    1 
ATOM 2821  C C5    . DA  A 1 137 ? 19.840  -47.826 96.388  1.00 666.83 ?  -176 DA  J C5    1 
ATOM 2822  C C6    . DA  A 1 137 ? 19.110  -48.883 96.975  1.00 666.83 ?  -176 DA  J C6    1 
ATOM 2823  N N6    . DA  A 1 137 ? 19.427  -50.172 96.812  1.00 666.83 ?  -176 DA  J N6    1 
ATOM 2824  N N1    . DA  A 1 137 ? 18.036  -48.562 97.737  1.00 666.83 ?  -176 DA  J N1    1 
ATOM 2825  C C2    . DA  A 1 137 ? 17.717  -47.270 97.902  1.00 666.83 ?  -176 DA  J C2    1 
ATOM 2826  N N3    . DA  A 1 137 ? 18.329  -46.192 97.401  1.00 666.83 ?  -176 DA  J N3    1 
ATOM 2827  C C4    . DA  A 1 137 ? 19.389  -46.542 96.646  1.00 666.83 ?  -176 DA  J C4    1 
ATOM 2828  P P     . DC  A 1 138 ? 20.710  -41.077 98.088  1.00 676.62 ?  -175 DC  J P     1 
ATOM 2829  O OP1   . DC  A 1 138 ? 19.970  -39.834 98.413  1.00 676.62 ?  -175 DC  J OP1   1 
ATOM 2830  O OP2   . DC  A 1 138 ? 22.152  -41.175 98.421  1.00 676.62 -1 -175 DC  J OP2   1 
ATOM 2831  O "O5'" . DC  A 1 138 ? 19.962  -42.336 98.748  1.00 676.62 ?  -175 DC  J "O5'" 1 
ATOM 2832  C "C5'" . DC  A 1 138 ? 18.678  -42.244 99.383  1.00 676.62 ?  -175 DC  J "C5'" 1 
ATOM 2833  C "C4'" . DC  A 1 138 ? 18.558  -43.225 100.545 1.00 676.62 ?  -175 DC  J "C4'" 1 
ATOM 2834  O "O4'" . DC  A 1 138 ? 18.806  -44.577 100.079 1.00 676.62 ?  -175 DC  J "O4'" 1 
ATOM 2835  C "C3'" . DC  A 1 138 ? 19.528  -42.985 101.703 1.00 676.62 ?  -175 DC  J "C3'" 1 
ATOM 2836  O "O3'" . DC  A 1 138 ? 18.802  -42.745 102.909 1.00 676.62 ?  -175 DC  J "O3'" 1 
ATOM 2837  C "C2'" . DC  A 1 138 ? 20.385  -44.249 101.795 1.00 676.62 ?  -175 DC  J "C2'" 1 
ATOM 2838  C "C1'" . DC  A 1 138 ? 19.570  -45.287 101.035 1.00 676.62 ?  -175 DC  J "C1'" 1 
ATOM 2839  N N1    . DC  A 1 138 ? 20.407  -46.309 100.323 1.00 676.62 ?  -175 DC  J N1    1 
ATOM 2840  C C2    . DC  A 1 138 ? 20.279  -47.677 100.637 1.00 676.62 ?  -175 DC  J C2    1 
ATOM 2841  O O2    . DC  A 1 138 ? 19.474  -48.042 101.505 1.00 676.62 ?  -175 DC  J O2    1 
ATOM 2842  N N3    . DC  A 1 138 ? 21.051  -48.577 99.968  1.00 676.62 ?  -175 DC  J N3    1 
ATOM 2843  C C4    . DC  A 1 138 ? 21.916  -48.160 99.034  1.00 676.62 ?  -175 DC  J C4    1 
ATOM 2844  N N4    . DC  A 1 138 ? 22.656  -49.079 98.406  1.00 676.62 ?  -175 DC  J N4    1 
ATOM 2845  C C5    . DC  A 1 138 ? 22.065  -46.779 98.703  1.00 676.62 ?  -175 DC  J C5    1 
ATOM 2846  C C6    . DC  A 1 138 ? 21.297  -45.900 99.363  1.00 676.62 ?  -175 DC  J C6    1 
ATOM 2847  P P     . DC  A 1 139 ? 19.530  -42.185 104.227 1.00 694.90 ?  -174 DC  J P     1 
ATOM 2848  O OP1   . DC  A 1 139 ? 18.523  -41.406 104.988 1.00 694.90 ?  -174 DC  J OP1   1 
ATOM 2849  O OP2   . DC  A 1 139 ? 20.812  -41.544 103.842 1.00 694.90 -1 -174 DC  J OP2   1 
ATOM 2850  O "O5'" . DC  A 1 139 ? 19.889  -43.527 105.035 1.00 694.90 ?  -174 DC  J "O5'" 1 
ATOM 2851  C "C5'" . DC  A 1 139 ? 18.866  -44.466 105.393 1.00 694.90 ?  -174 DC  J "C5'" 1 
ATOM 2852  C "C4'" . DC  A 1 139 ? 19.431  -45.844 105.701 1.00 694.90 ?  -174 DC  J "C4'" 1 
ATOM 2853  O "O4'" . DC  A 1 139 ? 20.097  -46.384 104.526 1.00 694.90 ?  -174 DC  J "O4'" 1 
ATOM 2854  C "C3'" . DC  A 1 139 ? 20.452  -45.887 106.842 1.00 694.90 ?  -174 DC  J "C3'" 1 
ATOM 2855  O "O3'" . DC  A 1 139 ? 20.100  -46.869 107.833 1.00 694.90 ?  -174 DC  J "O3'" 1 
ATOM 2856  C "C2'" . DC  A 1 139 ? 21.750  -46.241 106.121 1.00 694.90 ?  -174 DC  J "C2'" 1 
ATOM 2857  C "C1'" . DC  A 1 139 ? 21.216  -47.107 104.987 1.00 694.90 ?  -174 DC  J "C1'" 1 
ATOM 2858  N N1    . DC  A 1 139 ? 22.168  -47.386 103.859 1.00 694.90 ?  -174 DC  J N1    1 
ATOM 2859  C C2    . DC  A 1 139 ? 22.242  -48.686 103.317 1.00 694.90 ?  -174 DC  J C2    1 
ATOM 2860  O O2    . DC  A 1 139 ? 21.523  -49.586 103.768 1.00 694.90 ?  -174 DC  J O2    1 
ATOM 2861  N N3    . DC  A 1 139 ? 23.112  -48.925 102.297 1.00 694.90 ?  -174 DC  J N3    1 
ATOM 2862  C C4    . DC  A 1 139 ? 23.882  -47.938 101.822 1.00 694.90 ?  -174 DC  J C4    1 
ATOM 2863  N N4    . DC  A 1 139 ? 24.717  -48.225 100.818 1.00 694.90 ?  -174 DC  J N4    1 
ATOM 2864  C C5    . DC  A 1 139 ? 23.822  -46.613 102.357 1.00 694.90 ?  -174 DC  J C5    1 
ATOM 2865  C C6    . DC  A 1 139 ? 22.962  -46.386 103.362 1.00 694.90 ?  -174 DC  J C6    1 
ATOM 2866  P P     . DG  A 1 140 ? 18.980  -46.598 108.957 1.00 704.73 ?  -173 DG  J P     1 
ATOM 2867  O OP1   . DG  A 1 140 ? 17.683  -47.075 108.425 1.00 704.73 ?  -173 DG  J OP1   1 
ATOM 2868  O OP2   . DG  A 1 140 ? 19.104  -45.196 109.422 1.00 704.73 -1 -173 DG  J OP2   1 
ATOM 2869  O "O5'" . DG  A 1 140 ? 19.446  -47.541 110.170 1.00 704.73 ?  -173 DG  J "O5'" 1 
ATOM 2870  C "C5'" . DG  A 1 140 ? 19.007  -48.900 110.284 1.00 704.73 ?  -173 DG  J "C5'" 1 
ATOM 2871  C "C4'" . DG  A 1 140 ? 20.185  -49.862 110.312 1.00 704.73 ?  -173 DG  J "C4'" 1 
ATOM 2872  O "O4'" . DG  A 1 140 ? 21.076  -49.597 109.194 1.00 704.73 ?  -173 DG  J "O4'" 1 
ATOM 2873  C "C3'" . DG  A 1 140 ? 21.057  -49.809 111.564 1.00 704.73 ?  -173 DG  J "C3'" 1 
ATOM 2874  O "O3'" . DG  A 1 140 ? 21.384  -51.140 111.953 1.00 704.73 ?  -173 DG  J "O3'" 1 
ATOM 2875  C "C2'" . DG  A 1 140 ? 22.287  -49.034 111.091 1.00 704.73 ?  -173 DG  J "C2'" 1 
ATOM 2876  C "C1'" . DG  A 1 140 ? 22.406  -49.573 109.671 1.00 704.73 ?  -173 DG  J "C1'" 1 
ATOM 2877  N N9    . DG  A 1 140 ? 23.229  -48.778 108.759 1.00 704.73 ?  -173 DG  J N9    1 
ATOM 2878  C C8    . DG  A 1 140 ? 23.530  -47.439 108.849 1.00 704.73 ?  -173 DG  J C8    1 
ATOM 2879  N N7    . DG  A 1 140 ? 24.298  -47.012 107.884 1.00 704.73 ?  -173 DG  J N7    1 
ATOM 2880  C C5    . DG  A 1 140 ? 24.521  -48.138 107.100 1.00 704.73 ?  -173 DG  J C5    1 
ATOM 2881  C C6    . DG  A 1 140 ? 25.280  -48.290 105.908 1.00 704.73 ?  -173 DG  J C6    1 
ATOM 2882  O O6    . DG  A 1 140 ? 25.926  -47.425 105.299 1.00 704.73 ?  -173 DG  J O6    1 
ATOM 2883  N N1    . DG  A 1 140 ? 25.252  -49.605 105.431 1.00 704.73 ?  -173 DG  J N1    1 
ATOM 2884  C C2    . DG  A 1 140 ? 24.569  -50.640 106.035 1.00 704.73 ?  -173 DG  J C2    1 
ATOM 2885  N N2    . DG  A 1 140 ? 24.651  -51.837 105.441 1.00 704.73 ?  -173 DG  J N2    1 
ATOM 2886  N N3    . DG  A 1 140 ? 23.852  -50.509 107.149 1.00 704.73 ?  -173 DG  J N3    1 
ATOM 2887  C C4    . DG  A 1 140 ? 23.870  -49.236 107.627 1.00 704.73 ?  -173 DG  J C4    1 
ATOM 2888  P P     . DG  A 1 141 ? 22.074  -51.449 113.363 1.00 714.97 ?  -172 DG  J P     1 
ATOM 2889  O OP1   . DG  A 1 141 ? 21.096  -51.076 114.408 1.00 714.97 ?  -172 DG  J OP1   1 
ATOM 2890  O OP2   . DG  A 1 141 ? 23.433  -50.859 113.369 1.00 714.97 -1 -172 DG  J OP2   1 
ATOM 2891  O "O5'" . DG  A 1 141 ? 22.260  -53.040 113.370 1.00 714.97 ?  -172 DG  J "O5'" 1 
ATOM 2892  C "C5'" . DG  A 1 141 ? 22.263  -53.816 112.162 1.00 714.97 ?  -172 DG  J "C5'" 1 
ATOM 2893  C "C4'" . DG  A 1 141 ? 23.662  -54.183 111.676 1.00 714.97 ?  -172 DG  J "C4'" 1 
ATOM 2894  O "O4'" . DG  A 1 141 ? 24.138  -53.171 110.753 1.00 714.97 ?  -172 DG  J "O4'" 1 
ATOM 2895  C "C3'" . DG  A 1 141 ? 24.754  -54.361 112.739 1.00 714.97 ?  -172 DG  J "C3'" 1 
ATOM 2896  O "O3'" . DG  A 1 141 ? 25.179  -55.748 112.740 1.00 714.97 ?  -172 DG  J "O3'" 1 
ATOM 2897  C "C2'" . DG  A 1 141 ? 25.821  -53.332 112.354 1.00 714.97 ?  -172 DG  J "C2'" 1 
ATOM 2898  C "C1'" . DG  A 1 141 ? 25.539  -53.102 110.875 1.00 714.97 ?  -172 DG  J "C1'" 1 
ATOM 2899  N N9    . DG  A 1 141 ? 25.984  -51.804 110.372 1.00 714.97 ?  -172 DG  J N9    1 
ATOM 2900  C C8    . DG  A 1 141 ? 25.851  -50.580 110.987 1.00 714.97 ?  -172 DG  J C8    1 
ATOM 2901  N N7    . DG  A 1 141 ? 26.345  -49.590 110.299 1.00 714.97 ?  -172 DG  J N7    1 
ATOM 2902  C C5    . DG  A 1 141 ? 26.840  -50.195 109.150 1.00 714.97 ?  -172 DG  J C5    1 
ATOM 2903  C C6    . DG  A 1 141 ? 27.495  -49.625 108.028 1.00 714.97 ?  -172 DG  J C6    1 
ATOM 2904  O O6    . DG  A 1 141 ? 27.769  -48.431 107.830 1.00 714.97 ?  -172 DG  J O6    1 
ATOM 2905  N N1    . DG  A 1 141 ? 27.837  -50.586 107.073 1.00 714.97 ?  -172 DG  J N1    1 
ATOM 2906  C C2    . DG  A 1 141 ? 27.577  -51.934 107.195 1.00 714.97 ?  -172 DG  J C2    1 
ATOM 2907  N N2    . DG  A 1 141 ? 27.980  -52.712 106.180 1.00 714.97 ?  -172 DG  J N2    1 
ATOM 2908  N N3    . DG  A 1 141 ? 26.967  -52.481 108.240 1.00 714.97 ?  -172 DG  J N3    1 
ATOM 2909  C C4    . DG  A 1 141 ? 26.626  -51.558 109.177 1.00 714.97 ?  -172 DG  J C4    1 
ATOM 2910  P P     . DG  A 1 142 ? 26.682  -56.329 112.710 1.00 722.21 ?  -171 DG  J P     1 
ATOM 2911  O OP1   . DG  A 1 142 ? 26.632  -57.643 113.394 1.00 722.21 ?  -171 DG  J OP1   1 
ATOM 2912  O OP2   . DG  A 1 142 ? 27.645  -55.315 113.198 1.00 722.21 -1 -171 DG  J OP2   1 
ATOM 2913  O "O5'" . DG  A 1 142 ? 26.934  -56.568 111.145 1.00 722.21 ?  -171 DG  J "O5'" 1 
ATOM 2914  C "C5'" . DG  A 1 142 ? 27.593  -57.752 110.678 1.00 722.21 ?  -171 DG  J "C5'" 1 
ATOM 2915  C "C4'" . DG  A 1 142 ? 29.070  -57.513 110.400 1.00 722.21 ?  -171 DG  J "C4'" 1 
ATOM 2916  O "O4'" . DG  A 1 142 ? 29.273  -56.122 110.041 1.00 722.21 ?  -171 DG  J "O4'" 1 
ATOM 2917  C "C3'" . DG  A 1 142 ? 30.025  -57.798 111.564 1.00 722.21 ?  -171 DG  J "C3'" 1 
ATOM 2918  O "O3'" . DG  A 1 142 ? 31.034  -58.801 111.200 1.00 722.21 ?  -171 DG  J "O3'" 1 
ATOM 2919  C "C2'" . DG  A 1 142 ? 30.562  -56.428 111.994 1.00 722.21 ?  -171 DG  J "C2'" 1 
ATOM 2920  C "C1'" . DG  A 1 142 ? 30.411  -55.622 110.708 1.00 722.21 ?  -171 DG  J "C1'" 1 
ATOM 2921  N N9    . DG  A 1 142 ? 30.246  -54.177 110.856 1.00 722.21 ?  -171 DG  J N9    1 
ATOM 2922  C C8    . DG  A 1 142 ? 29.881  -53.466 111.977 1.00 722.21 ?  -171 DG  J C8    1 
ATOM 2923  N N7    . DG  A 1 142 ? 29.821  -52.178 111.776 1.00 722.21 ?  -171 DG  J N7    1 
ATOM 2924  C C5    . DG  A 1 142 ? 30.167  -52.025 110.438 1.00 722.21 ?  -171 DG  J C5    1 
ATOM 2925  C C6    . DG  A 1 142 ? 30.277  -50.855 109.647 1.00 722.21 ?  -171 DG  J C6    1 
ATOM 2926  O O6    . DG  A 1 142 ? 30.081  -49.682 109.993 1.00 722.21 ?  -171 DG  J O6    1 
ATOM 2927  N N1    . DG  A 1 142 ? 30.656  -51.140 108.332 1.00 722.21 ?  -171 DG  J N1    1 
ATOM 2928  C C2    . DG  A 1 142 ? 30.900  -52.405 107.843 1.00 722.21 ?  -171 DG  J C2    1 
ATOM 2929  N N2    . DG  A 1 142 ? 31.254  -52.492 106.553 1.00 722.21 ?  -171 DG  J N2    1 
ATOM 2930  N N3    . DG  A 1 142 ? 30.799  -53.511 108.575 1.00 722.21 ?  -171 DG  J N3    1 
ATOM 2931  C C4    . DG  A 1 142 ? 30.429  -53.247 109.857 1.00 722.21 ?  -171 DG  J C4    1 
ATOM 2932  P P     . DA  A 1 143 ? 32.369  -58.628 110.302 1.00 715.72 ?  -170 DA  J P     1 
ATOM 2933  O OP1   . DA  A 1 143 ? 32.846  -59.984 109.946 1.00 715.72 ?  -170 DA  J OP1   1 
ATOM 2934  O OP2   . DA  A 1 143 ? 33.278  -57.719 111.043 1.00 715.72 -1 -170 DA  J OP2   1 
ATOM 2935  O "O5'" . DA  A 1 143 ? 31.890  -57.903 108.952 1.00 715.72 ?  -170 DA  J "O5'" 1 
ATOM 2936  C "C5'" . DA  A 1 143 ? 32.269  -58.391 107.658 1.00 715.72 ?  -170 DA  J "C5'" 1 
ATOM 2937  C "C4'" . DA  A 1 143 ? 33.480  -57.649 107.107 1.00 715.72 ?  -170 DA  J "C4'" 1 
ATOM 2938  O "O4'" . DA  A 1 143 ? 33.357  -56.223 107.366 1.00 715.72 ?  -170 DA  J "O4'" 1 
ATOM 2939  C "C3'" . DA  A 1 143 ? 34.836  -58.066 107.671 1.00 715.72 ?  -170 DA  J "C3'" 1 
ATOM 2940  O "O3'" . DA  A 1 143 ? 35.747  -58.207 106.581 1.00 715.72 ?  -170 DA  J "O3'" 1 
ATOM 2941  C "C2'" . DA  A 1 143 ? 35.201  -56.926 108.624 1.00 715.72 ?  -170 DA  J "C2'" 1 
ATOM 2942  C "C1'" . DA  A 1 143 ? 34.544  -55.729 107.951 1.00 715.72 ?  -170 DA  J "C1'" 1 
ATOM 2943  N N9    . DA  A 1 143 ? 34.187  -54.649 108.867 1.00 715.72 ?  -170 DA  J N9    1 
ATOM 2944  C C8    . DA  A 1 143 ? 33.658  -54.771 110.123 1.00 715.72 ?  -170 DA  J C8    1 
ATOM 2945  N N7    . DA  A 1 143 ? 33.431  -53.629 110.728 1.00 715.72 ?  -170 DA  J N7    1 
ATOM 2946  C C5    . DA  A 1 143 ? 33.838  -52.684 109.800 1.00 715.72 ?  -170 DA  J C5    1 
ATOM 2947  C C6    . DA  A 1 143 ? 33.859  -51.273 109.827 1.00 715.72 ?  -170 DA  J C6    1 
ATOM 2948  N N6    . DA  A 1 143 ? 33.434  -50.555 110.870 1.00 715.72 ?  -170 DA  J N6    1 
ATOM 2949  N N1    . DA  A 1 143 ? 34.331  -50.630 108.735 1.00 715.72 ?  -170 DA  J N1    1 
ATOM 2950  C C2    . DA  A 1 143 ? 34.754  -51.347 107.683 1.00 715.72 ?  -170 DA  J C2    1 
ATOM 2951  N N3    . DA  A 1 143 ? 34.784  -52.673 107.543 1.00 715.72 ?  -170 DA  J N3    1 
ATOM 2952  C C4    . DA  A 1 143 ? 34.308  -53.293 108.645 1.00 715.72 ?  -170 DA  J C4    1 
ATOM 2953  P P     . DT  A 1 144 ? 37.343  -58.088 106.723 1.00 717.68 ?  -169 DT  J P     1 
ATOM 2954  O OP1   . DT  A 1 144 ? 37.908  -58.893 105.612 1.00 717.68 ?  -169 DT  J OP1   1 
ATOM 2955  O OP2   . DT  A 1 144 ? 37.747  -58.395 108.119 1.00 717.68 -1 -169 DT  J OP2   1 
ATOM 2956  O "O5'" . DT  A 1 144 ? 37.628  -56.525 106.462 1.00 717.68 ?  -169 DT  J "O5'" 1 
ATOM 2957  C "C5'" . DT  A 1 144 ? 38.140  -56.043 105.200 1.00 717.68 ?  -169 DT  J "C5'" 1 
ATOM 2958  C "C4'" . DT  A 1 144 ? 38.851  -54.695 105.313 1.00 717.68 ?  -169 DT  J "C4'" 1 
ATOM 2959  O "O4'" . DT  A 1 144 ? 38.152  -53.837 106.257 1.00 717.68 ?  -169 DT  J "O4'" 1 
ATOM 2960  C "C3'" . DT  A 1 144 ? 40.307  -54.712 105.790 1.00 717.68 ?  -169 DT  J "C3'" 1 
ATOM 2961  O "O3'" . DT  A 1 144 ? 41.023  -53.615 105.230 1.00 717.68 ?  -169 DT  J "O3'" 1 
ATOM 2962  C "C2'" . DT  A 1 144 ? 40.128  -54.450 107.274 1.00 717.68 ?  -169 DT  J "C2'" 1 
ATOM 2963  C "C1'" . DT  A 1 144 ? 39.118  -53.317 107.141 1.00 717.68 ?  -169 DT  J "C1'" 1 
ATOM 2964  N N1    . DT  A 1 144 ? 38.438  -52.873 108.376 1.00 717.68 ?  -169 DT  J N1    1 
ATOM 2965  C C2    . DT  A 1 144 ? 38.259  -51.517 108.577 1.00 717.68 ?  -169 DT  J C2    1 
ATOM 2966  O O2    . DT  A 1 144 ? 38.631  -50.652 107.800 1.00 717.68 ?  -169 DT  J O2    1 
ATOM 2967  N N3    . DT  A 1 144 ? 37.618  -51.199 109.743 1.00 717.68 ?  -169 DT  J N3    1 
ATOM 2968  C C4    . DT  A 1 144 ? 37.151  -52.080 110.699 1.00 717.68 ?  -169 DT  J C4    1 
ATOM 2969  O O4    . DT  A 1 144 ? 36.589  -51.668 111.708 1.00 717.68 ?  -169 DT  J O4    1 
ATOM 2970  C C5    . DT  A 1 144 ? 37.367  -53.488 110.430 1.00 717.68 ?  -169 DT  J C5    1 
ATOM 2971  C C7    . DT  A 1 144 ? 36.909  -54.553 111.389 1.00 717.68 ?  -169 DT  J C7    1 
ATOM 2972  C C6    . DT  A 1 144 ? 37.992  -53.810 109.289 1.00 717.68 ?  -169 DT  J C6    1 
ATOM 2973  P P     . DT  A 1 145 ? 41.969  -53.822 103.954 1.00 720.49 ?  -168 DT  J P     1 
ATOM 2974  O OP1   . DT  A 1 145 ? 41.134  -54.352 102.852 1.00 720.49 ?  -168 DT  J OP1   1 
ATOM 2975  O OP2   . DT  A 1 145 ? 43.164  -54.574 104.401 1.00 720.49 -1 -168 DT  J OP2   1 
ATOM 2976  O "O5'" . DT  A 1 145 ? 42.412  -52.329 103.593 1.00 720.49 ?  -168 DT  J "O5'" 1 
ATOM 2977  C "C5'" . DT  A 1 145 ? 41.519  -51.242 103.853 1.00 720.49 ?  -168 DT  J "C5'" 1 
ATOM 2978  C "C4'" . DT  A 1 145 ? 42.111  -50.294 104.883 1.00 720.49 ?  -168 DT  J "C4'" 1 
ATOM 2979  O "O4'" . DT  A 1 145 ? 41.511  -50.534 106.188 1.00 720.49 ?  -168 DT  J "O4'" 1 
ATOM 2980  C "C3'" . DT  A 1 145 ? 43.627  -50.423 105.078 1.00 720.49 ?  -168 DT  J "C3'" 1 
ATOM 2981  O "O3'" . DT  A 1 145 ? 44.242  -49.144 104.978 1.00 720.49 ?  -168 DT  J "O3'" 1 
ATOM 2982  C "C2'" . DT  A 1 145 ? 43.763  -51.008 106.490 1.00 720.49 ?  -168 DT  J "C2'" 1 
ATOM 2983  C "C1'" . DT  A 1 145 ? 42.522  -50.450 107.165 1.00 720.49 ?  -168 DT  J "C1'" 1 
ATOM 2984  N N1    . DT  A 1 145 ? 42.097  -51.207 108.399 1.00 720.49 ?  -168 DT  J N1    1 
ATOM 2985  C C2    . DT  A 1 145 ? 41.258  -50.595 109.304 1.00 720.49 ?  -168 DT  J C2    1 
ATOM 2986  O O2    . DT  A 1 145 ? 40.819  -49.467 109.152 1.00 720.49 ?  -168 DT  J O2    1 
ATOM 2987  N N3    . DT  A 1 145 ? 40.936  -51.362 110.397 1.00 720.49 ?  -168 DT  J N3    1 
ATOM 2988  C C4    . DT  A 1 145 ? 41.368  -52.649 110.676 1.00 720.49 ?  -168 DT  J C4    1 
ATOM 2989  O O4    . DT  A 1 145 ? 41.024  -53.256 111.687 1.00 720.49 ?  -168 DT  J O4    1 
ATOM 2990  C C5    . DT  A 1 145 ? 42.253  -53.228 109.694 1.00 720.49 ?  -168 DT  J C5    1 
ATOM 2991  C C7    . DT  A 1 145 ? 42.784  -54.618 109.890 1.00 720.49 ?  -168 DT  J C7    1 
ATOM 2992  C C6    . DT  A 1 145 ? 42.577  -52.487 108.618 1.00 720.49 ?  -168 DT  J C6    1 
ATOM 2993  P P     . DC  A 1 146 ? 45.577  -48.948 104.105 1.00 716.27 ?  -167 DC  J P     1 
ATOM 2994  O OP1   . DC  A 1 146 ? 45.226  -49.149 102.681 1.00 716.27 ?  -167 DC  J OP1   1 
ATOM 2995  O OP2   . DC  A 1 146 ? 46.642  -49.768 104.730 1.00 716.27 -1 -167 DC  J OP2   1 
ATOM 2996  O "O5'" . DC  A 1 146 ? 45.954  -47.410 104.334 1.00 716.27 ?  -167 DC  J "O5'" 1 
ATOM 2997  C "C5'" . DC  A 1 146 ? 46.746  -47.029 105.459 1.00 716.27 ?  -167 DC  J "C5'" 1 
ATOM 2998  C "C4'" . DC  A 1 146 ? 45.954  -46.167 106.432 1.00 716.27 ?  -167 DC  J "C4'" 1 
ATOM 2999  O "O4'" . DC  A 1 146 ? 45.063  -47.007 107.216 1.00 716.27 ?  -167 DC  J "O4'" 1 
ATOM 3000  C "C3'" . DC  A 1 146 ? 46.814  -45.398 107.437 1.00 716.27 ?  -167 DC  J "C3'" 1 
ATOM 3001  O "O3'" . DC  A 1 146 ? 46.379  -44.053 107.549 1.00 716.27 ?  -167 DC  J "O3'" 1 
ATOM 3002  C "C2'" . DC  A 1 146 ? 46.626  -46.160 108.743 1.00 716.27 ?  -167 DC  J "C2'" 1 
ATOM 3003  C "C1'" . DC  A 1 146 ? 45.234  -46.744 108.592 1.00 716.27 ?  -167 DC  J "C1'" 1 
ATOM 3004  N N1    . DC  A 1 146 ? 45.065  -48.020 109.346 1.00 716.27 ?  -167 DC  J N1    1 
ATOM 3005  C C2    . DC  A 1 146 ? 44.312  -48.034 110.525 1.00 716.27 ?  -167 DC  J C2    1 
ATOM 3006  O O2    . DC  A 1 146 ? 43.781  -46.981 110.915 1.00 716.27 ?  -167 DC  J O2    1 
ATOM 3007  N N3    . DC  A 1 146 ? 44.177  -49.208 111.204 1.00 716.27 ?  -167 DC  J N3    1 
ATOM 3008  C C4    . DC  A 1 146 ? 44.768  -50.322 110.746 1.00 716.27 ?  -167 DC  J C4    1 
ATOM 3009  N N4    . DC  A 1 146 ? 44.609  -51.455 111.447 1.00 716.27 ?  -167 DC  J N4    1 
ATOM 3010  C C5    . DC  A 1 146 ? 45.546  -50.320 109.551 1.00 716.27 ?  -167 DC  J C5    1 
ATOM 3011  C C6    . DC  A 1 146 ? 45.670  -49.160 108.893 1.00 716.27 ?  -167 DC  J C6    1 
ATOM 3012  P P     . DT  A 1 147 ? 47.428  -42.913 107.973 1.00 714.03 ?  -166 DT  J P     1 
ATOM 3013  O OP1   . DT  A 1 147 ? 48.108  -42.445 106.745 1.00 714.03 ?  -166 DT  J OP1   1 
ATOM 3014  O OP2   . DT  A 1 147 ? 48.224  -43.436 109.106 1.00 714.03 -1 -166 DT  J OP2   1 
ATOM 3015  O "O5'" . DT  A 1 147 ? 46.508  -41.731 108.521 1.00 714.03 ?  -166 DT  J "O5'" 1 
ATOM 3016  C "C5'" . DT  A 1 147 ? 45.398  -42.038 109.335 1.00 714.03 ?  -166 DT  J "C5'" 1 
ATOM 3017  C "C4'" . DT  A 1 147 ? 45.403  -41.203 110.597 1.00 714.03 ?  -166 DT  J "C4'" 1 
ATOM 3018  O "O4'" . DT  A 1 147 ? 45.131  -42.057 111.736 1.00 714.03 ?  -166 DT  J "O4'" 1 
ATOM 3019  C "C3'" . DT  A 1 147 ? 46.713  -40.498 110.919 1.00 714.03 ?  -166 DT  J "C3'" 1 
ATOM 3020  O "O3'" . DT  A 1 147 ? 46.450  -39.307 111.660 1.00 714.03 ?  -166 DT  J "O3'" 1 
ATOM 3021  C "C2'" . DT  A 1 147 ? 47.448  -41.534 111.764 1.00 714.03 ?  -166 DT  J "C2'" 1 
ATOM 3022  C "C1'" . DT  A 1 147 ? 46.307  -42.233 112.507 1.00 714.03 ?  -166 DT  J "C1'" 1 
ATOM 3023  N N1    . DT  A 1 147 ? 46.534  -43.698 112.692 1.00 714.03 ?  -166 DT  J N1    1 
ATOM 3024  C C2    . DT  A 1 147 ? 45.739  -44.400 113.567 1.00 714.03 ?  -166 DT  J C2    1 
ATOM 3025  O O2    . DT  A 1 147 ? 44.839  -43.890 114.210 1.00 714.03 ?  -166 DT  J O2    1 
ATOM 3026  N N3    . DT  A 1 147 ? 46.034  -45.733 113.660 1.00 714.03 ?  -166 DT  J N3    1 
ATOM 3027  C C4    . DT  A 1 147 ? 47.026  -46.419 112.981 1.00 714.03 ?  -166 DT  J C4    1 
ATOM 3028  O O4    . DT  A 1 147 ? 47.214  -47.619 113.132 1.00 714.03 ?  -166 DT  J O4    1 
ATOM 3029  C C5    . DT  A 1 147 ? 47.825  -45.625 112.083 1.00 714.03 ?  -166 DT  J C5    1 
ATOM 3030  C C7    . DT  A 1 147 ? 48.935  -46.262 111.296 1.00 714.03 ?  -166 DT  J C7    1 
ATOM 3031  C C6    . DT  A 1 147 ? 47.545  -44.319 111.983 1.00 714.03 ?  -166 DT  J C6    1 
ATOM 3032  P P     . DC  A 1 148 ? 47.613  -38.229 111.933 1.00 718.40 ?  -165 DC  J P     1 
ATOM 3033  O OP1   . DC  A 1 148 ? 46.976  -36.903 111.794 1.00 718.40 ?  -165 DC  J OP1   1 
ATOM 3034  O OP2   . DC  A 1 148 ? 48.787  -38.566 111.095 1.00 718.40 -1 -165 DC  J OP2   1 
ATOM 3035  O "O5'" . DC  A 1 148 ? 48.005  -38.460 113.474 1.00 718.40 ?  -165 DC  J "O5'" 1 
ATOM 3036  C "C5'" . DC  A 1 148 ? 47.135  -38.001 114.509 1.00 718.40 ?  -165 DC  J "C5'" 1 
ATOM 3037  C "C4'" . DC  A 1 148 ? 47.380  -38.747 115.813 1.00 718.40 ?  -165 DC  J "C4'" 1 
ATOM 3038  O "O4'" . DC  A 1 148 ? 47.471  -40.167 115.547 1.00 718.40 ?  -165 DC  J "O4'" 1 
ATOM 3039  C "C3'" . DC  A 1 148 ? 48.660  -38.359 116.572 1.00 718.40 ?  -165 DC  J "C3'" 1 
ATOM 3040  O "O3'" . DC  A 1 148 ? 48.333  -37.896 117.899 1.00 718.40 ?  -165 DC  J "O3'" 1 
ATOM 3041  C "C2'" . DC  A 1 148 ? 49.486  -39.657 116.603 1.00 718.40 ?  -165 DC  J "C2'" 1 
ATOM 3042  C "C1'" . DC  A 1 148 ? 48.422  -40.733 116.408 1.00 718.40 ?  -165 DC  J "C1'" 1 
ATOM 3043  N N1    . DC  A 1 148 ? 48.940  -41.999 115.783 1.00 718.40 ?  -165 DC  J N1    1 
ATOM 3044  C C2    . DC  A 1 148 ? 48.592  -43.244 116.330 1.00 718.40 ?  -165 DC  J C2    1 
ATOM 3045  O O2    . DC  A 1 148 ? 47.856  -43.286 117.326 1.00 718.40 ?  -165 DC  J O2    1 
ATOM 3046  N N3    . DC  A 1 148 ? 49.074  -44.372 115.750 1.00 718.40 ?  -165 DC  J N3    1 
ATOM 3047  C C4    . DC  A 1 148 ? 49.863  -44.287 114.677 1.00 718.40 ?  -165 DC  J C4    1 
ATOM 3048  N N4    . DC  A 1 148 ? 50.316  -45.423 114.142 1.00 718.40 ?  -165 DC  J N4    1 
ATOM 3049  C C5    . DC  A 1 148 ? 50.228  -43.032 114.109 1.00 718.40 ?  -165 DC  J C5    1 
ATOM 3050  C C6    . DC  A 1 148 ? 49.748  -41.927 114.686 1.00 718.40 ?  -165 DC  J C6    1 
ATOM 3051  P P     . DC  A 1 149 ? 49.458  -37.235 118.844 1.00 712.62 ?  -164 DC  J P     1 
ATOM 3052  O OP1   . DC  A 1 149 ? 48.842  -36.067 119.508 1.00 712.62 ?  -164 DC  J OP1   1 
ATOM 3053  O OP2   . DC  A 1 149 ? 50.683  -37.052 118.034 1.00 712.62 -1 -164 DC  J OP2   1 
ATOM 3054  O "O5'" . DC  A 1 149 ? 49.744  -38.352 119.962 1.00 712.62 ?  -164 DC  J "O5'" 1 
ATOM 3055  C "C5'" . DC  A 1 149 ? 48.790  -38.576 121.003 1.00 712.62 ?  -164 DC  J "C5'" 1 
ATOM 3056  C "C4'" . DC  A 1 149 ? 48.840  -40.013 121.518 1.00 712.62 ?  -164 DC  J "C4'" 1 
ATOM 3057  O "O4'" . DC  A 1 149 ? 49.046  -40.935 120.412 1.00 712.62 ?  -164 DC  J "O4'" 1 
ATOM 3058  C "C3'" . DC  A 1 149 ? 49.948  -40.321 122.544 1.00 712.62 ?  -164 DC  J "C3'" 1 
ATOM 3059  O "O3'" . DC  A 1 149 ? 49.380  -40.885 123.738 1.00 712.62 ?  -164 DC  J "O3'" 1 
ATOM 3060  C "C2'" . DC  A 1 149 ? 50.843  -41.331 121.820 1.00 712.62 ?  -164 DC  J "C2'" 1 
ATOM 3061  C "C1'" . DC  A 1 149 ? 49.862  -41.988 120.863 1.00 712.62 ?  -164 DC  J "C1'" 1 
ATOM 3062  N N1    . DC  A 1 149 ? 50.518  -42.664 119.682 1.00 712.62 ?  -164 DC  J N1    1 
ATOM 3063  C C2    . DC  A 1 149 ? 50.460  -44.062 119.558 1.00 712.62 ?  -164 DC  J C2    1 
ATOM 3064  O O2    . DC  A 1 149 ? 49.863  -44.722 120.420 1.00 712.62 ?  -164 DC  J O2    1 
ATOM 3065  N N3    . DC  A 1 149 ? 51.058  -44.653 118.492 1.00 712.62 ?  -164 DC  J N3    1 
ATOM 3066  C C4    . DC  A 1 149 ? 51.691  -43.906 117.583 1.00 712.62 ?  -164 DC  J C4    1 
ATOM 3067  N N4    . DC  A 1 149 ? 52.267  -44.528 116.550 1.00 712.62 ?  -164 DC  J N4    1 
ATOM 3068  C C5    . DC  A 1 149 ? 51.764  -42.487 117.693 1.00 712.62 ?  -164 DC  J C5    1 
ATOM 3069  C C6    . DC  A 1 149 ? 51.172  -41.914 118.747 1.00 712.62 ?  -164 DC  J C6    1 
ATOM 3070  P P     . DA  A 1 150 ? 50.303  -41.180 125.021 1.00 700.15 ?  -163 DA  J P     1 
ATOM 3071  O OP1   . DA  A 1 150 ? 49.446  -41.267 126.219 1.00 700.15 ?  -163 DA  J OP1   1 
ATOM 3072  O OP2   . DA  A 1 150 ? 51.456  -40.260 124.969 1.00 700.15 -1 -163 DA  J OP2   1 
ATOM 3073  O "O5'" . DA  A 1 150 ? 50.840  -42.654 124.774 1.00 700.15 ?  -163 DA  J "O5'" 1 
ATOM 3074  C "C5'" . DA  A 1 150 ? 49.964  -43.772 124.960 1.00 700.15 ?  -163 DA  J "C5'" 1 
ATOM 3075  C "C4'" . DA  A 1 150 ? 50.674  -45.024 124.548 1.00 700.15 ?  -163 DA  J "C4'" 1 
ATOM 3076  O "O4'" . DA  A 1 150 ? 51.264  -44.819 123.234 1.00 700.15 ?  -163 DA  J "O4'" 1 
ATOM 3077  C "C3'" . DA  A 1 150 ? 51.836  -45.394 125.468 1.00 700.15 ?  -163 DA  J "C3'" 1 
ATOM 3078  O "O3'" . DA  A 1 150 ? 51.869  -46.786 125.619 1.00 700.15 ?  -163 DA  J "O3'" 1 
ATOM 3079  C "C2'" . DA  A 1 150 ? 53.063  -44.900 124.700 1.00 700.15 ?  -163 DA  J "C2'" 1 
ATOM 3080  C "C1'" . DA  A 1 150 ? 52.613  -45.218 123.293 1.00 700.15 ?  -163 DA  J "C1'" 1 
ATOM 3081  N N9    . DA  A 1 150 ? 53.400  -44.606 122.206 1.00 700.15 ?  -163 DA  J N9    1 
ATOM 3082  C C8    . DA  A 1 150 ? 53.466  -43.291 121.808 1.00 700.15 ?  -163 DA  J C8    1 
ATOM 3083  N N7    . DA  A 1 150 ? 54.268  -43.093 120.773 1.00 700.15 ?  -163 DA  J N7    1 
ATOM 3084  C C5    . DA  A 1 150 ? 54.745  -44.362 120.482 1.00 700.15 ?  -163 DA  J C5    1 
ATOM 3085  C C6    . DA  A 1 150 ? 55.637  -44.858 119.501 1.00 700.15 ?  -163 DA  J C6    1 
ATOM 3086  N N6    . DA  A 1 150 ? 56.236  -44.086 118.585 1.00 700.15 ?  -163 DA  J N6    1 
ATOM 3087  N N1    . DA  A 1 150 ? 55.889  -46.183 119.501 1.00 700.15 ?  -163 DA  J N1    1 
ATOM 3088  C C2    . DA  A 1 150 ? 55.292  -46.954 120.415 1.00 700.15 ?  -163 DA  J C2    1 
ATOM 3089  N N3    . DA  A 1 150 ? 54.444  -46.609 121.374 1.00 700.15 ?  -163 DA  J N3    1 
ATOM 3090  C C4    . DA  A 1 150 ? 54.211  -45.295 121.354 1.00 700.15 ?  -163 DA  J C4    1 
ATOM 3091  P P     . DG  A 1 151 ? 52.435  -48.183 126.176 1.00 684.54 ?  -162 DG  J P     1 
ATOM 3092  O OP1   . DG  A 1 151 ? 52.160  -48.042 124.731 1.00 684.54 ?  -162 DG  J OP1   1 
ATOM 3093  O OP2   . DG  A 1 151 ? 53.278  -47.208 126.893 1.00 684.54 -1 -162 DG  J OP2   1 
ATOM 3094  O "O5'" . DG  A 1 151 ? 53.080  -49.633 126.428 1.00 684.54 ?  -162 DG  J "O5'" 1 
ATOM 3095  C "C5'" . DG  A 1 151 ? 52.410  -50.776 125.942 1.00 684.54 ?  -162 DG  J "C5'" 1 
ATOM 3096  C "C4'" . DG  A 1 151 ? 53.346  -51.657 125.152 1.00 684.54 ?  -162 DG  J "C4'" 1 
ATOM 3097  O "O4'" . DG  A 1 151 ? 54.120  -50.841 124.229 1.00 684.54 ?  -162 DG  J "O4'" 1 
ATOM 3098  C "C3'" . DG  A 1 151 ? 54.359  -52.414 126.001 1.00 684.54 ?  -162 DG  J "C3'" 1 
ATOM 3099  O "O3'" . DG  A 1 151 ? 54.453  -53.752 125.536 1.00 684.54 ?  -162 DG  J "O3'" 1 
ATOM 3100  C "C2'" . DG  A 1 151 ? 55.653  -51.629 125.782 1.00 684.54 ?  -162 DG  J "C2'" 1 
ATOM 3101  C "C1'" . DG  A 1 151 ? 55.490  -51.168 124.351 1.00 684.54 ?  -162 DG  J "C1'" 1 
ATOM 3102  N N9    . DG  A 1 151 ? 56.315  -49.995 124.003 1.00 684.54 ?  -162 DG  J N9    1 
ATOM 3103  C C8    . DG  A 1 151 ? 56.425  -48.815 124.703 1.00 684.54 ?  -162 DG  J C8    1 
ATOM 3104  N N7    . DG  A 1 151 ? 57.233  -47.949 124.149 1.00 684.54 ?  -162 DG  J N7    1 
ATOM 3105  C C5    . DG  A 1 151 ? 57.687  -48.589 123.004 1.00 684.54 ?  -162 DG  J C5    1 
ATOM 3106  C C6    . DG  A 1 151 ? 58.587  -48.142 122.003 1.00 684.54 ?  -162 DG  J C6    1 
ATOM 3107  O O6    . DG  A 1 151 ? 59.182  -47.054 121.926 1.00 684.54 ?  -162 DG  J O6    1 
ATOM 3108  N N1    . DG  A 1 151 ? 58.772  -49.106 121.015 1.00 684.54 ?  -162 DG  J N1    1 
ATOM 3109  C C2    . DG  A 1 151 ? 58.171  -50.341 120.995 1.00 684.54 ?  -162 DG  J C2    1 
ATOM 3110  N N2    . DG  A 1 151 ? 58.476  -51.135 119.954 1.00 684.54 ?  -162 DG  J N2    1 
ATOM 3111  N N3    . DG  A 1 151 ? 57.327  -50.769 121.923 1.00 684.54 ?  -162 DG  J N3    1 
ATOM 3112  C C4    . DG  A 1 151 ? 57.131  -49.846 122.896 1.00 684.54 ?  -162 DG  J C4    1 
ATOM 3113  P P     . DG  A 1 152 ? 55.109  -54.905 126.447 1.00 678.69 ?  -161 DG  J P     1 
ATOM 3114  O OP1   . DG  A 1 152 ? 54.126  -56.001 126.552 1.00 678.69 ?  -161 DG  J OP1   1 
ATOM 3115  O OP2   . DG  A 1 152 ? 55.652  -54.310 127.685 1.00 678.69 -1 -161 DG  J OP2   1 
ATOM 3116  O "O5'" . DG  A 1 152 ? 56.318  -55.417 125.545 1.00 678.69 ?  -161 DG  J "O5'" 1 
ATOM 3117  C "C5'" . DG  A 1 152 ? 56.252  -55.193 124.143 1.00 678.69 ?  -161 DG  J "C5'" 1 
ATOM 3118  C "C4'" . DG  A 1 152 ? 57.633  -55.041 123.550 1.00 678.69 ?  -161 DG  J "C4'" 1 
ATOM 3119  O "O4'" . DG  A 1 152 ? 57.990  -53.642 123.524 1.00 678.69 ?  -161 DG  J "O4'" 1 
ATOM 3120  C "C3'" . DG  A 1 152 ? 58.706  -55.772 124.329 1.00 678.69 ?  -161 DG  J "C3'" 1 
ATOM 3121  O "O3'" . DG  A 1 152 ? 59.096  -56.936 123.629 1.00 678.69 ?  -161 DG  J "O3'" 1 
ATOM 3122  C "C2'" . DG  A 1 152 ? 59.865  -54.779 124.480 1.00 678.69 ?  -161 DG  J "C2'" 1 
ATOM 3123  C "C1'" . DG  A 1 152 ? 59.301  -53.438 124.008 1.00 678.69 ?  -161 DG  J "C1'" 1 
ATOM 3124  N N9    . DG  A 1 152 ? 59.252  -52.394 125.045 1.00 678.69 ?  -161 DG  J N9    1 
ATOM 3125  C C8    . DG  A 1 152 ? 58.638  -52.467 126.263 1.00 678.69 ?  -161 DG  J C8    1 
ATOM 3126  N N7    . DG  A 1 152 ? 58.740  -51.363 126.958 1.00 678.69 ?  -161 DG  J N7    1 
ATOM 3127  C C5    . DG  A 1 152 ? 59.476  -50.511 126.148 1.00 678.69 ?  -161 DG  J C5    1 
ATOM 3128  C C6    . DG  A 1 152 ? 59.916  -49.177 126.356 1.00 678.69 ?  -161 DG  J C6    1 
ATOM 3129  O O6    . DG  A 1 152 ? 59.727  -48.452 127.350 1.00 678.69 ?  -161 DG  J O6    1 
ATOM 3130  N N1    . DG  A 1 152 ? 60.637  -48.690 125.270 1.00 678.69 ?  -161 DG  J N1    1 
ATOM 3131  C C2    . DG  A 1 152 ? 60.901  -49.401 124.122 1.00 678.69 ?  -161 DG  J C2    1 
ATOM 3132  N N2    . DG  A 1 152 ? 61.611  -48.767 123.181 1.00 678.69 ?  -161 DG  J N2    1 
ATOM 3133  N N3    . DG  A 1 152 ? 60.498  -50.640 123.914 1.00 678.69 ?  -161 DG  J N3    1 
ATOM 3134  C C4    . DG  A 1 152 ? 59.798  -51.134 124.953 1.00 678.69 ?  -161 DG  J C4    1 
ATOM 3135  P P     . DA  A 1 153 ? 59.880  -58.094 124.407 1.00 678.50 ?  -160 DA  J P     1 
ATOM 3136  O OP1   . DA  A 1 153 ? 59.242  -59.374 124.034 1.00 678.50 ?  -160 DA  J OP1   1 
ATOM 3137  O OP2   . DA  A 1 153 ? 59.917  -57.716 125.838 1.00 678.50 -1 -160 DA  J OP2   1 
ATOM 3138  O "O5'" . DA  A 1 153 ? 61.364  -57.996 123.815 1.00 678.50 ?  -160 DA  J "O5'" 1 
ATOM 3139  C "C5'" . DA  A 1 153 ? 61.563  -57.439 122.512 1.00 678.50 ?  -160 DA  J "C5'" 1 
ATOM 3140  C "C4'" . DA  A 1 153 ? 62.837  -56.611 122.441 1.00 678.50 ?  -160 DA  J "C4'" 1 
ATOM 3141  O "O4'" . DA  A 1 153 ? 62.724  -55.439 123.295 1.00 678.50 ?  -160 DA  J "O4'" 1 
ATOM 3142  C "C3'" . DA  A 1 153 ? 64.099  -57.330 122.889 1.00 678.50 ?  -160 DA  J "C3'" 1 
ATOM 3143  O "O3'" . DA  A 1 153 ? 65.204  -56.871 122.114 1.00 678.50 ?  -160 DA  J "O3'" 1 
ATOM 3144  C "C2'" . DA  A 1 153 ? 64.213  -56.906 124.355 1.00 678.50 ?  -160 DA  J "C2'" 1 
ATOM 3145  C "C1'" . DA  A 1 153 ? 63.749  -55.459 124.271 1.00 678.50 ?  -160 DA  J "C1'" 1 
ATOM 3146  N N9    . DA  A 1 153 ? 63.212  -54.911 125.514 1.00 678.50 ?  -160 DA  J N9    1 
ATOM 3147  C C8    . DA  A 1 153 ? 62.598  -55.612 126.521 1.00 678.50 ?  -160 DA  J C8    1 
ATOM 3148  N N7    . DA  A 1 153 ? 62.204  -54.864 127.522 1.00 678.50 ?  -160 DA  J N7    1 
ATOM 3149  C C5    . DA  A 1 153 ? 62.580  -53.574 127.149 1.00 678.50 ?  -160 DA  J C5    1 
ATOM 3150  C C6    . DA  A 1 153 ? 62.435  -52.338 127.798 1.00 678.50 ?  -160 DA  J C6    1 
ATOM 3151  N N6    . DA  A 1 153 ? 61.861  -52.182 128.987 1.00 678.50 ?  -160 DA  J N6    1 
ATOM 3152  N N1    . DA  A 1 153 ? 62.914  -51.246 127.159 1.00 678.50 ?  -160 DA  J N1    1 
ATOM 3153  C C2    . DA  A 1 153 ? 63.491  -51.405 125.966 1.00 678.50 ?  -160 DA  J C2    1 
ATOM 3154  N N3    . DA  A 1 153 ? 63.681  -52.524 125.262 1.00 678.50 ?  -160 DA  J N3    1 
ATOM 3155  C C4    . DA  A 1 153 ? 63.191  -53.599 125.925 1.00 678.50 ?  -160 DA  J C4    1 
ATOM 3156  P P     . DG  A 1 154 ? 66.454  -57.840 121.843 1.00 697.20 ?  -159 DG  J P     1 
ATOM 3157  O OP1   . DG  A 1 154 ? 66.460  -58.233 120.419 1.00 697.20 ?  -159 DG  J OP1   1 
ATOM 3158  O OP2   . DG  A 1 154 ? 66.424  -58.878 122.896 1.00 697.20 -1 -159 DG  J OP2   1 
ATOM 3159  O "O5'" . DG  A 1 154 ? 67.723  -56.906 122.099 1.00 697.20 ?  -159 DG  J "O5'" 1 
ATOM 3160  C "C5'" . DG  A 1 154 ? 67.830  -55.651 121.435 1.00 697.20 ?  -159 DG  J "C5'" 1 
ATOM 3161  C "C4'" . DG  A 1 154 ? 68.420  -54.622 122.373 1.00 697.20 ?  -159 DG  J "C4'" 1 
ATOM 3162  O "O4'" . DG  A 1 154 ? 67.540  -54.470 123.505 1.00 697.20 ?  -159 DG  J "O4'" 1 
ATOM 3163  C "C3'" . DG  A 1 154 ? 69.786  -55.011 122.942 1.00 697.20 ?  -159 DG  J "C3'" 1 
ATOM 3164  O "O3'" . DG  A 1 154 ? 70.802  -54.165 122.415 1.00 697.20 ?  -159 DG  J "O3'" 1 
ATOM 3165  C "C2'" . DG  A 1 154 ? 69.644  -54.866 124.467 1.00 697.20 ?  -159 DG  J "C2'" 1 
ATOM 3166  C "C1'" . DG  A 1 154 ? 68.301  -54.165 124.638 1.00 697.20 ?  -159 DG  J "C1'" 1 
ATOM 3167  N N9    . DG  A 1 154 ? 67.569  -54.599 125.824 1.00 697.20 ?  -159 DG  J N9    1 
ATOM 3168  C C8    . DG  A 1 154 ? 66.983  -55.825 126.054 1.00 697.20 ?  -159 DG  J C8    1 
ATOM 3169  N N7    . DG  A 1 154 ? 66.404  -55.909 127.222 1.00 697.20 ?  -159 DG  J N7    1 
ATOM 3170  C C5    . DG  A 1 154 ? 66.626  -54.662 127.796 1.00 697.20 ?  -159 DG  J C5    1 
ATOM 3171  C C6    . DG  A 1 154 ? 66.236  -54.153 129.056 1.00 697.20 ?  -159 DG  J C6    1 
ATOM 3172  O O6    . DG  A 1 154 ? 65.594  -54.726 129.950 1.00 697.20 ?  -159 DG  J O6    1 
ATOM 3173  N N1    . DG  A 1 154 ? 66.669  -52.835 129.237 1.00 697.20 ?  -159 DG  J N1    1 
ATOM 3174  C C2    . DG  A 1 154 ? 67.385  -52.108 128.312 1.00 697.20 ?  -159 DG  J C2    1 
ATOM 3175  N N2    . DG  A 1 154 ? 67.714  -50.854 128.659 1.00 697.20 ?  -159 DG  J N2    1 
ATOM 3176  N N3    . DG  A 1 154 ? 67.753  -52.575 127.131 1.00 697.20 ?  -159 DG  J N3    1 
ATOM 3177  C C4    . DG  A 1 154 ? 67.341  -53.851 126.944 1.00 697.20 ?  -159 DG  J C4    1 
ATOM 3178  P P     . DT  A 1 155 ? 72.312  -54.701 122.292 1.00 697.74 ?  -158 DT  J P     1 
ATOM 3179  O OP1   . DT  A 1 155 ? 72.702  -54.658 120.866 1.00 697.74 ?  -158 DT  J OP1   1 
ATOM 3180  O OP2   . DT  A 1 155 ? 72.419  -55.960 123.066 1.00 697.74 -1 -158 DT  J OP2   1 
ATOM 3181  O "O5'" . DT  A 1 155 ? 73.156  -53.591 123.055 1.00 697.74 ?  -158 DT  J "O5'" 1 
ATOM 3182  C "C5'" . DT  A 1 155 ? 72.724  -52.244 123.020 1.00 697.74 ?  -158 DT  J "C5'" 1 
ATOM 3183  C "C4'" . DT  A 1 155 ? 73.011  -51.571 124.344 1.00 697.74 ?  -158 DT  J "C4'" 1 
ATOM 3184  O "O4'" . DT  A 1 155 ? 72.029  -51.976 125.326 1.00 697.74 ?  -158 DT  J "O4'" 1 
ATOM 3185  C "C3'" . DT  A 1 155 ? 74.376  -51.909 124.943 1.00 697.74 ?  -158 DT  J "C3'" 1 
ATOM 3186  O "O3'" . DT  A 1 155 ? 75.201  -50.752 124.924 1.00 697.74 ?  -158 DT  J "O3'" 1 
ATOM 3187  C "C2'" . DT  A 1 155 ? 74.068  -52.384 126.375 1.00 697.74 ?  -158 DT  J "C2'" 1 
ATOM 3188  C "C1'" . DT  A 1 155 ? 72.627  -51.945 126.594 1.00 697.74 ?  -158 DT  J "C1'" 1 
ATOM 3189  N N1    . DT  A 1 155 ? 71.870  -52.862 127.511 1.00 697.74 ?  -158 DT  J N1    1 
ATOM 3190  C C2    . DT  A 1 155 ? 71.137  -52.337 128.556 1.00 697.74 ?  -158 DT  J C2    1 
ATOM 3191  O O2    . DT  A 1 155 ? 71.056  -51.141 128.781 1.00 697.74 ?  -158 DT  J O2    1 
ATOM 3192  N N3    . DT  A 1 155 ? 70.497  -53.272 129.334 1.00 697.74 ?  -158 DT  J N3    1 
ATOM 3193  C C4    . DT  A 1 155 ? 70.521  -54.651 129.173 1.00 697.74 ?  -158 DT  J C4    1 
ATOM 3194  O O4    . DT  A 1 155 ? 69.913  -55.414 129.919 1.00 697.74 ?  -158 DT  J O4    1 
ATOM 3195  C C5    . DT  A 1 155 ? 71.311  -55.130 128.064 1.00 697.74 ?  -158 DT  J C5    1 
ATOM 3196  C C7    . DT  A 1 155 ? 71.412  -56.604 127.790 1.00 697.74 ?  -158 DT  J C7    1 
ATOM 3197  C C6    . DT  A 1 155 ? 71.942  -54.225 127.301 1.00 697.74 ?  -158 DT  J C6    1 
ATOM 3198  P P     . DA  A 1 156 ? 76.587  -50.715 125.732 1.00 701.95 ?  -157 DA  J P     1 
ATOM 3199  O OP1   . DA  A 1 156 ? 77.486  -49.786 125.017 1.00 701.95 ?  -157 DA  J OP1   1 
ATOM 3200  O OP2   . DA  A 1 156 ? 77.037  -52.101 125.995 1.00 701.95 -1 -157 DA  J OP2   1 
ATOM 3201  O "O5'" . DA  A 1 156 ? 76.186  -50.018 127.107 1.00 701.95 ?  -157 DA  J "O5'" 1 
ATOM 3202  C "C5'" . DA  A 1 156 ? 75.606  -48.717 127.092 1.00 701.95 ?  -157 DA  J "C5'" 1 
ATOM 3203  C "C4'" . DA  A 1 156 ? 74.905  -48.435 128.404 1.00 701.95 ?  -157 DA  J "C4'" 1 
ATOM 3204  O "O4'" . DA  A 1 156 ? 73.997  -49.511 128.693 1.00 701.95 ?  -157 DA  J "O4'" 1 
ATOM 3205  C "C3'" . DA  A 1 156 ? 75.830  -48.367 129.606 1.00 701.95 ?  -157 DA  J "C3'" 1 
ATOM 3206  O "O3'" . DA  A 1 156 ? 76.232  -47.023 129.822 1.00 701.95 ?  -157 DA  J "O3'" 1 
ATOM 3207  C "C2'" . DA  A 1 156 ? 74.971  -48.882 130.768 1.00 701.95 ?  -157 DA  J "C2'" 1 
ATOM 3208  C "C1'" . DA  A 1 156 ? 73.797  -49.589 130.086 1.00 701.95 ?  -157 DA  J "C1'" 1 
ATOM 3209  N N9    . DA  A 1 156 ? 73.668  -50.997 130.460 1.00 701.95 ?  -157 DA  J N9    1 
ATOM 3210  C C8    . DA  A 1 156 ? 74.028  -52.082 129.713 1.00 701.95 ?  -157 DA  J C8    1 
ATOM 3211  N N7    . DA  A 1 156 ? 73.792  -53.231 130.302 1.00 701.95 ?  -157 DA  J N7    1 
ATOM 3212  C C5    . DA  A 1 156 ? 73.251  -52.876 131.524 1.00 701.95 ?  -157 DA  J C5    1 
ATOM 3213  C C6    . DA  A 1 156 ? 72.791  -53.637 132.620 1.00 701.95 ?  -157 DA  J C6    1 
ATOM 3214  N N6    . DA  A 1 156 ? 72.811  -54.977 132.645 1.00 701.95 ?  -157 DA  J N6    1 
ATOM 3215  N N1    . DA  A 1 156 ? 72.310  -52.969 133.689 1.00 701.95 ?  -157 DA  J N1    1 
ATOM 3216  C C2    . DA  A 1 156 ? 72.295  -51.629 133.659 1.00 701.95 ?  -157 DA  J C2    1 
ATOM 3217  N N3    . DA  A 1 156 ? 72.696  -50.806 132.688 1.00 701.95 ?  -157 DA  J N3    1 
ATOM 3218  C C4    . DA  A 1 156 ? 73.168  -51.497 131.641 1.00 701.95 ?  -157 DA  J C4    1 
ATOM 3219  P P     . DC  A 1 157 ? 77.623  -46.700 130.558 1.00 709.62 ?  -156 DC  J P     1 
ATOM 3220  O OP1   . DC  A 1 157 ? 78.139  -45.432 129.990 1.00 709.62 ?  -156 DC  J OP1   1 
ATOM 3221  O OP2   . DC  A 1 157 ? 78.451  -47.928 130.491 1.00 709.62 -1 -156 DC  J OP2   1 
ATOM 3222  O "O5'" . DC  A 1 157 ? 77.211  -46.478 132.095 1.00 709.62 ?  -156 DC  J "O5'" 1 
ATOM 3223  C "C5'" . DC  A 1 157 ? 76.124  -45.611 132.434 1.00 709.62 ?  -156 DC  J "C5'" 1 
ATOM 3224  C "C4'" . DC  A 1 157 ? 75.522  -45.976 133.789 1.00 709.62 ?  -156 DC  J "C4'" 1 
ATOM 3225  O "O4'" . DC  A 1 157 ? 75.151  -47.383 133.801 1.00 709.62 ?  -156 DC  J "O4'" 1 
ATOM 3226  C "C3'" . DC  A 1 157 ? 76.430  -45.752 135.005 1.00 709.62 ?  -156 DC  J "C3'" 1 
ATOM 3227  O "O3'" . DC  A 1 157 ? 75.691  -45.098 136.050 1.00 709.62 ?  -156 DC  J "O3'" 1 
ATOM 3228  C "C2'" . DC  A 1 157 ? 76.853  -47.172 135.403 1.00 709.62 ?  -156 DC  J "C2'" 1 
ATOM 3229  C "C1'" . DC  A 1 157 ? 75.652  -48.004 134.966 1.00 709.62 ?  -156 DC  J "C1'" 1 
ATOM 3230  N N1    . DC  A 1 157 ? 75.990  -49.435 134.636 1.00 709.62 ?  -156 DC  J N1    1 
ATOM 3231  C C2    . DC  A 1 157 ? 75.206  -50.475 135.157 1.00 709.62 ?  -156 DC  J C2    1 
ATOM 3232  O O2    . DC  A 1 157 ? 74.244  -50.201 135.885 1.00 709.62 ?  -156 DC  J O2    1 
ATOM 3233  N N3    . DC  A 1 157 ? 75.524  -51.756 134.847 1.00 709.62 ?  -156 DC  J N3    1 
ATOM 3234  C C4    . DC  A 1 157 ? 76.568  -52.013 134.058 1.00 709.62 ?  -156 DC  J C4    1 
ATOM 3235  N N4    . DC  A 1 157 ? 76.842  -53.291 133.782 1.00 709.62 ?  -156 DC  J N4    1 
ATOM 3236  C C5    . DC  A 1 157 ? 77.378  -50.972 133.518 1.00 709.62 ?  -156 DC  J C5    1 
ATOM 3237  C C6    . DC  A 1 157 ? 77.056  -49.712 133.829 1.00 709.62 ?  -156 DC  J C6    1 
ATOM 3238  P P     . DT  A 1 158 ? 76.438  -44.238 137.187 1.00 704.58 ?  -155 DT  J P     1 
ATOM 3239  O OP1   . DT  A 1 158 ? 75.919  -42.850 137.122 1.00 704.58 ?  -155 DT  J OP1   1 
ATOM 3240  O OP2   . DT  A 1 158 ? 77.895  -44.473 137.052 1.00 704.58 -1 -155 DT  J OP2   1 
ATOM 3241  O "O5'" . DT  A 1 158 ? 75.949  -44.927 138.551 1.00 704.58 ?  -155 DT  J "O5'" 1 
ATOM 3242  C "C5'" . DT  A 1 158 ? 74.557  -45.196 138.752 1.00 704.58 ?  -155 DT  J "C5'" 1 
ATOM 3243  C "C4'" . DT  A 1 158 ? 74.344  -46.491 139.532 1.00 704.58 ?  -155 DT  J "C4'" 1 
ATOM 3244  O "O4'" . DT  A 1 158 ? 74.748  -47.620 138.730 1.00 704.58 ?  -155 DT  J "O4'" 1 
ATOM 3245  C "C3'" . DT  A 1 158 ? 75.130  -46.603 140.826 1.00 704.58 ?  -155 DT  J "C3'" 1 
ATOM 3246  O "O3'" . DT  A 1 158 ? 74.331  -46.102 141.899 1.00 704.58 ?  -155 DT  J "O3'" 1 
ATOM 3247  C "C2'" . DT  A 1 158 ? 75.382  -48.113 140.972 1.00 704.58 ?  -155 DT  J "C2'" 1 
ATOM 3248  C "C1'" . DT  A 1 158 ? 75.152  -48.685 139.567 1.00 704.58 ?  -155 DT  J "C1'" 1 
ATOM 3249  N N1    . DT  A 1 158 ? 76.414  -49.331 138.942 1.00 20.00  ?  -155 DT  J N1    1 
ATOM 3250  C C2    . DT  A 1 158 ? 76.537  -50.713 138.900 1.00 20.00  ?  -155 DT  J C2    1 
ATOM 3251  O O2    . DT  A 1 158 ? 75.686  -51.488 139.340 1.00 20.00  ?  -155 DT  J O2    1 
ATOM 3252  N N3    . DT  A 1 158 ? 77.699  -51.159 138.319 1.00 20.00  ?  -155 DT  J N3    1 
ATOM 3253  C C4    . DT  A 1 158 ? 78.720  -50.408 137.797 1.00 20.00  ?  -155 DT  J C4    1 
ATOM 3254  O O4    . DT  A 1 158 ? 79.695  -50.970 137.298 1.00 20.00  ?  -155 DT  J O4    1 
ATOM 3255  C C5    . DT  A 1 158 ? 78.539  -48.973 137.887 1.00 20.00  ?  -155 DT  J C5    1 
ATOM 3256  C C7    . DT  A 1 158 ? 79.602  -48.073 137.347 1.00 20.00  ?  -155 DT  J C7    1 
ATOM 3257  C C6    . DT  A 1 158 ? 77.410  -48.514 138.456 1.00 20.00  ?  -155 DT  J C6    1 
ATOM 3258  P P     . DG  A 1 159 ? 74.982  -45.687 143.308 1.00 703.07 ?  -154 DG  J P     1 
ATOM 3259  O OP1   . DG  A 1 159 ? 74.556  -44.298 143.583 1.00 703.07 ?  -154 DG  J OP1   1 
ATOM 3260  O OP2   . DG  A 1 159 ? 76.421  -46.037 143.309 1.00 703.07 -1 -154 DG  J OP2   1 
ATOM 3261  O "O5'" . DG  A 1 159 ? 74.246  -46.647 144.350 1.00 703.07 ?  -154 DG  J "O5'" 1 
ATOM 3262  C "C5'" . DG  A 1 159 ? 73.406  -47.696 143.874 1.00 703.07 ?  -154 DG  J "C5'" 1 
ATOM 3263  C "C4'" . DG  A 1 159 ? 73.858  -49.040 144.416 1.00 703.07 ?  -154 DG  J "C4'" 1 
ATOM 3264  O "O4'" . DG  A 1 159 ? 74.826  -49.647 143.509 1.00 703.07 ?  -154 DG  J "O4'" 1 
ATOM 3265  C "C3'" . DG  A 1 159 ? 74.546  -48.981 145.778 1.00 703.07 ?  -154 DG  J "C3'" 1 
ATOM 3266  O "O3'" . DG  A 1 159 ? 74.196  -50.125 146.535 1.00 703.07 ?  -154 DG  J "O3'" 1 
ATOM 3267  C "C2'" . DG  A 1 159 ? 76.023  -49.002 145.397 1.00 703.07 ?  -154 DG  J "C2'" 1 
ATOM 3268  C "C1'" . DG  A 1 159 ? 75.990  -49.980 144.234 1.00 703.07 ?  -154 DG  J "C1'" 1 
ATOM 3269  N N9    . DG  A 1 159 ? 77.161  -49.901 143.352 1.00 703.07 ?  -154 DG  J N9    1 
ATOM 3270  C C8    . DG  A 1 159 ? 77.960  -48.801 143.131 1.00 703.07 ?  -154 DG  J C8    1 
ATOM 3271  N N7    . DG  A 1 159 ? 78.942  -49.028 142.301 1.00 703.07 ?  -154 DG  J N7    1 
ATOM 3272  C C5    . DG  A 1 159 ? 78.791  -50.366 141.952 1.00 703.07 ?  -154 DG  J C5    1 
ATOM 3273  C C6    . DG  A 1 159 ? 79.566  -51.168 141.081 1.00 703.07 ?  -154 DG  J C6    1 
ATOM 3274  O O6    . DG  A 1 159 ? 80.568  -50.843 140.427 1.00 703.07 ?  -154 DG  J O6    1 
ATOM 3275  N N1    . DG  A 1 159 ? 79.072  -52.474 141.006 1.00 703.07 ?  -154 DG  J N1    1 
ATOM 3276  C C2    . DG  A 1 159 ? 77.972  -52.942 141.691 1.00 703.07 ?  -154 DG  J C2    1 
ATOM 3277  N N2    . DG  A 1 159 ? 77.647  -54.231 141.488 1.00 703.07 ?  -154 DG  J N2    1 
ATOM 3278  N N3    . DG  A 1 159 ? 77.234  -52.196 142.507 1.00 703.07 ?  -154 DG  J N3    1 
ATOM 3279  C C4    . DG  A 1 159 ? 77.703  -50.920 142.592 1.00 703.07 ?  -154 DG  J C4    1 
ATOM 3280  P P     . DC  A 1 160 ? 74.122  -50.054 148.138 1.00 709.59 ?  -153 DC  J P     1 
ATOM 3281  O OP1   . DC  A 1 160 ? 72.865  -49.364 148.502 1.00 709.59 ?  -153 DC  J OP1   1 
ATOM 3282  O OP2   . DC  A 1 160 ? 75.418  -49.528 148.630 1.00 709.59 -1 -153 DC  J OP2   1 
ATOM 3283  O "O5'" . DC  A 1 160 ? 74.001  -51.590 148.568 1.00 709.59 ?  -153 DC  J "O5'" 1 
ATOM 3284  C "C5'" . DC  A 1 160 ? 73.386  -52.525 147.684 1.00 709.59 ?  -153 DC  J "C5'" 1 
ATOM 3285  C "C4'" . DC  A 1 160 ? 74.401  -53.534 147.170 1.00 709.59 ?  -153 DC  J "C4'" 1 
ATOM 3286  O "O4'" . DC  A 1 160 ? 75.391  -52.866 146.365 1.00 709.59 ?  -153 DC  J "O4'" 1 
ATOM 3287  C "C3'" . DC  A 1 160 ? 75.202  -54.245 148.251 1.00 709.59 ?  -153 DC  J "C3'" 1 
ATOM 3288  O "O3'" . DC  A 1 160 ? 74.519  -55.443 148.651 1.00 709.59 ?  -153 DC  J "O3'" 1 
ATOM 3289  C "C2'" . DC  A 1 160 ? 76.554  -54.547 147.568 1.00 709.59 ?  -153 DC  J "C2'" 1 
ATOM 3290  C "C1'" . DC  A 1 160 ? 76.532  -53.692 146.288 1.00 709.59 ?  -153 DC  J "C1'" 1 
ATOM 3291  N N1    . DC  A 1 160 ? 77.766  -52.822 146.087 1.00 709.59 ?  -153 DC  J N1    1 
ATOM 3292  C C2    . DC  A 1 160 ? 78.793  -53.255 145.233 1.00 709.59 ?  -153 DC  J C2    1 
ATOM 3293  O O2    . DC  A 1 160 ? 78.682  -54.350 144.660 1.00 709.59 ?  -153 DC  J O2    1 
ATOM 3294  N N3    . DC  A 1 160 ? 79.886  -52.459 145.056 1.00 709.59 ?  -153 DC  J N3    1 
ATOM 3295  C C4    . DC  A 1 160 ? 79.974  -51.287 145.693 1.00 709.59 ?  -153 DC  J C4    1 
ATOM 3296  N N4    . DC  A 1 160 ? 81.070  -50.541 145.491 1.00 709.59 ?  -153 DC  J N4    1 
ATOM 3297  C C5    . DC  A 1 160 ? 78.939  -50.828 146.563 1.00 709.59 ?  -153 DC  J C5    1 
ATOM 3298  C C6    . DC  A 1 160 ? 77.867  -51.619 146.730 1.00 709.59 ?  -153 DC  J C6    1 
ATOM 3299  P P     . DA  A 1 161 ? 74.938  -56.219 149.996 1.00 695.01 ?  -152 DA  J P     1 
ATOM 3300  O OP1   . DA  A 1 161 ? 73.744  -56.914 150.525 1.00 695.01 ?  -152 DA  J OP1   1 
ATOM 3301  O OP2   . DA  A 1 161 ? 75.686  -55.279 150.861 1.00 695.01 -1 -152 DA  J OP2   1 
ATOM 3302  O "O5'" . DA  A 1 161 ? 75.971  -57.323 149.488 1.00 695.01 ?  -152 DA  J "O5'" 1 
ATOM 3303  C "C5'" . DA  A 1 161 ? 75.651  -58.136 148.373 1.00 695.01 ?  -152 DA  J "C5'" 1 
ATOM 3304  C "C4'" . DA  A 1 161 ? 76.917  -58.591 147.679 1.00 695.01 ?  -152 DA  J "C4'" 1 
ATOM 3305  O "O4'" . DA  A 1 161 ? 77.588  -57.440 147.115 1.00 695.01 ?  -152 DA  J "O4'" 1 
ATOM 3306  C "C3'" . DA  A 1 161 ? 77.949  -59.226 148.595 1.00 695.01 ?  -152 DA  J "C3'" 1 
ATOM 3307  O "O3'" . DA  A 1 161 ? 77.665  -60.638 148.793 1.00 695.01 ?  -152 DA  J "O3'" 1 
ATOM 3308  C "C2'" . DA  A 1 161 ? 79.254  -58.976 147.847 1.00 695.01 ?  -152 DA  J "C2'" 1 
ATOM 3309  C "C1'" . DA  A 1 161 ? 78.993  -57.617 147.187 1.00 695.01 ?  -152 DA  J "C1'" 1 
ATOM 3310  N N9    . DA  A 1 161 ? 79.591  -56.486 147.902 1.00 695.01 ?  -152 DA  J N9    1 
ATOM 3311  C C8    . DA  A 1 161 ? 79.380  -56.113 149.204 1.00 695.01 ?  -152 DA  J C8    1 
ATOM 3312  N N7    . DA  A 1 161 ? 80.070  -55.055 149.572 1.00 695.01 ?  -152 DA  J N7    1 
ATOM 3313  C C5    . DA  A 1 161 ? 80.784  -54.712 148.433 1.00 695.01 ?  -152 DA  J C5    1 
ATOM 3314  C C6    . DA  A 1 161 ? 81.710  -53.677 148.159 1.00 695.01 ?  -152 DA  J C6    1 
ATOM 3315  N N6    . DA  A 1 161 ? 82.081  -52.757 149.058 1.00 695.01 ?  -152 DA  J N6    1 
ATOM 3316  N N1    . DA  A 1 161 ? 82.239  -53.626 146.918 1.00 695.01 ?  -152 DA  J N1    1 
ATOM 3317  C C2    . DA  A 1 161 ? 81.871  -54.549 146.020 1.00 695.01 ?  -152 DA  J C2    1 
ATOM 3318  N N3    . DA  A 1 161 ? 81.015  -55.560 146.159 1.00 695.01 ?  -152 DA  J N3    1 
ATOM 3319  C C4    . DA  A 1 161 ? 80.503  -55.587 147.400 1.00 695.01 ?  -152 DA  J C4    1 
ATOM 3320  P P     . DC  A 1 162 ? 78.034  -61.768 147.698 1.00 696.50 ?  -151 DC  J P     1 
ATOM 3321  O OP1   . DC  A 1 162 ? 77.793  -61.252 146.329 1.00 696.50 ?  -151 DC  J OP1   1 
ATOM 3322  O OP2   . DC  A 1 162 ? 77.311  -62.985 148.139 1.00 696.50 -1 -151 DC  J OP2   1 
ATOM 3323  O "O5'" . DC  A 1 162 ? 79.609  -62.053 147.912 1.00 696.50 ?  -151 DC  J "O5'" 1 
ATOM 3324  C "C5'" . DC  A 1 162 ? 80.130  -63.413 147.793 1.00 696.50 ?  -151 DC  J "C5'" 1 
ATOM 3325  C "C4'" . DC  A 1 162 ? 81.655  -63.450 147.598 1.00 696.50 ?  -151 DC  J "C4'" 1 
ATOM 3326  O "O4'" . DC  A 1 162 ? 82.110  -62.193 147.052 1.00 696.50 ?  -151 DC  J "O4'" 1 
ATOM 3327  C "C3'" . DC  A 1 162 ? 82.487  -63.719 148.865 1.00 696.50 ?  -151 DC  J "C3'" 1 
ATOM 3328  O "O3'" . DC  A 1 162 ? 83.068  -65.055 148.821 1.00 696.50 ?  -151 DC  J "O3'" 1 
ATOM 3329  C "C2'" . DC  A 1 162 ? 83.570  -62.630 148.879 1.00 696.50 ?  -151 DC  J "C2'" 1 
ATOM 3330  C "C1'" . DC  A 1 162 ? 83.363  -61.835 147.588 1.00 696.50 ?  -151 DC  J "C1'" 1 
ATOM 3331  N N1    . DC  A 1 162 ? 83.347  -60.366 147.815 1.00 696.50 ?  -151 DC  J N1    1 
ATOM 3332  C C2    . DC  A 1 162 ? 84.006  -59.511 146.923 1.00 696.50 ?  -151 DC  J C2    1 
ATOM 3333  O O2    . DC  A 1 162 ? 84.604  -59.992 145.958 1.00 696.50 ?  -151 DC  J O2    1 
ATOM 3334  N N3    . DC  A 1 162 ? 83.968  -58.178 147.147 1.00 696.50 ?  -151 DC  J N3    1 
ATOM 3335  C C4    . DC  A 1 162 ? 83.308  -57.700 148.204 1.00 696.50 ?  -151 DC  J C4    1 
ATOM 3336  N N4    . DC  A 1 162 ? 83.296  -56.380 148.390 1.00 696.50 ?  -151 DC  J N4    1 
ATOM 3337  C C5    . DC  A 1 162 ? 82.631  -58.555 149.120 1.00 696.50 ?  -151 DC  J C5    1 
ATOM 3338  C C6    . DC  A 1 162 ? 82.675  -59.866 148.890 1.00 696.50 ?  -151 DC  J C6    1 
ATOM 3339  P P     . DA  A 1 163 ? 84.016  -65.595 150.018 1.00 695.92 ?  -150 DA  J P     1 
ATOM 3340  O OP1   . DA  A 1 163 ? 83.848  -67.067 150.049 1.00 695.92 ?  -150 DA  J OP1   1 
ATOM 3341  O OP2   . DA  A 1 163 ? 83.769  -64.805 151.244 1.00 695.92 -1 -150 DA  J OP2   1 
ATOM 3342  O "O5'" . DA  A 1 163 ? 85.494  -65.234 149.520 1.00 695.92 ?  -150 DA  J "O5'" 1 
ATOM 3343  C "C5'" . DA  A 1 163 ? 86.610  -65.400 150.390 1.00 695.92 ?  -150 DA  J "C5'" 1 
ATOM 3344  C "C4'" . DA  A 1 163 ? 87.829  -64.694 149.822 1.00 695.92 ?  -150 DA  J "C4'" 1 
ATOM 3345  O "O4'" . DA  A 1 163 ? 87.461  -63.339 149.436 1.00 695.92 ?  -150 DA  J "O4'" 1 
ATOM 3346  C "C3'" . DA  A 1 163 ? 89.002  -64.544 150.781 1.00 695.92 ?  -150 DA  J "C3'" 1 
ATOM 3347  O "O3'" . DA  A 1 163 ? 90.239  -64.526 150.037 1.00 695.92 ?  -150 DA  J "O3'" 1 
ATOM 3348  C "C2'" . DA  A 1 163 ? 88.704  -63.193 151.440 1.00 695.92 ?  -150 DA  J "C2'" 1 
ATOM 3349  C "C1'" . DA  A 1 163 ? 88.094  -62.396 150.285 1.00 695.92 ?  -150 DA  J "C1'" 1 
ATOM 3350  N N9    . DA  A 1 163 ? 87.102  -61.391 150.700 1.00 695.92 ?  -150 DA  J N9    1 
ATOM 3351  C C8    . DA  A 1 163 ? 85.863  -61.626 151.235 1.00 695.92 ?  -150 DA  J C8    1 
ATOM 3352  N N7    . DA  A 1 163 ? 85.182  -60.538 151.505 1.00 695.92 ?  -150 DA  J N7    1 
ATOM 3353  C C5    . DA  A 1 163 ? 86.026  -59.515 151.116 1.00 695.92 ?  -150 DA  J C5    1 
ATOM 3354  C C6    . DA  A 1 163 ? 85.879  -58.120 151.151 1.00 695.92 ?  -150 DA  J C6    1 
ATOM 3355  N N6    . DA  A 1 163 ? 84.790  -57.508 151.606 1.00 695.92 ?  -150 DA  J N6    1 
ATOM 3356  N N1    . DA  A 1 163 ? 86.903  -57.377 150.691 1.00 695.92 ?  -150 DA  J N1    1 
ATOM 3357  C C2    . DA  A 1 163 ? 87.993  -57.996 150.235 1.00 695.92 ?  -150 DA  J C2    1 
ATOM 3358  N N3    . DA  A 1 163 ? 88.246  -59.304 150.154 1.00 695.92 ?  -150 DA  J N3    1 
ATOM 3359  C C4    . DA  A 1 163 ? 87.206  -60.017 150.619 1.00 695.92 ?  -150 DA  J C4    1 
ATOM 3360  P P     . DG  A 1 164 ? 91.601  -65.155 150.636 1.00 691.06 ?  -149 DG  J P     1 
ATOM 3361  O OP1   . DG  A 1 164 ? 91.976  -66.338 149.823 1.00 691.06 ?  -149 DG  J OP1   1 
ATOM 3362  O OP2   . DG  A 1 164 ? 91.454  -65.280 152.102 1.00 691.06 -1 -149 DG  J OP2   1 
ATOM 3363  O "O5'" . DG  A 1 164 ? 92.677  -63.998 150.370 1.00 691.06 ?  -149 DG  J "O5'" 1 
ATOM 3364  C "C5'" . DG  A 1 164 ? 92.236  -62.636 150.334 1.00 691.06 ?  -149 DG  J "C5'" 1 
ATOM 3365  C "C4'" . DG  A 1 164 ? 93.398  -61.655 150.345 1.00 691.06 ?  -149 DG  J "C4'" 1 
ATOM 3366  O "O4'" . DG  A 1 164 ? 92.874  -60.328 150.588 1.00 691.06 ?  -149 DG  J "O4'" 1 
ATOM 3367  C "C3'" . DG  A 1 164 ? 94.395  -61.851 151.466 1.00 691.06 ?  -149 DG  J "C3'" 1 
ATOM 3368  O "O3'" . DG  A 1 164 ? 95.584  -61.104 151.179 1.00 691.06 ?  -149 DG  J "O3'" 1 
ATOM 3369  C "C2'" . DG  A 1 164 ? 93.627  -61.254 152.638 1.00 691.06 ?  -149 DG  J "C2'" 1 
ATOM 3370  C "C1'" . DG  A 1 164 ? 92.946  -60.050 151.981 1.00 691.06 ?  -149 DG  J "C1'" 1 
ATOM 3371  N N9    . DG  A 1 164 ? 91.601  -59.787 152.485 1.00 691.06 ?  -149 DG  J N9    1 
ATOM 3372  C C8    . DG  A 1 164 ? 90.623  -60.718 152.777 1.00 691.06 ?  -149 DG  J C8    1 
ATOM 3373  N N7    . DG  A 1 164 ? 89.514  -60.194 153.220 1.00 691.06 ?  -149 DG  J N7    1 
ATOM 3374  C C5    . DG  A 1 164 ? 89.773  -58.822 153.227 1.00 691.06 ?  -149 DG  J C5    1 
ATOM 3375  C C6    . DG  A 1 164 ? 88.934  -57.755 153.613 1.00 691.06 ?  -149 DG  J C6    1 
ATOM 3376  O O6    . DG  A 1 164 ? 87.770  -57.795 154.035 1.00 691.06 ?  -149 DG  J O6    1 
ATOM 3377  N N1    . DG  A 1 164 ? 89.587  -56.521 153.467 1.00 691.06 ?  -149 DG  J N1    1 
ATOM 3378  C C2    . DG  A 1 164 ? 90.875  -56.358 153.010 1.00 691.06 ?  -149 DG  J C2    1 
ATOM 3379  N N2    . DG  A 1 164 ? 91.328  -55.091 152.937 1.00 691.06 ?  -149 DG  J N2    1 
ATOM 3380  N N3    . DG  A 1 164 ? 91.668  -57.358 152.644 1.00 691.06 ?  -149 DG  J N3    1 
ATOM 3381  C C4    . DG  A 1 164 ? 91.044  -58.567 152.782 1.00 691.06 ?  -149 DG  J C4    1 
ATOM 3382  P P     . DG  A 1 165 ? 96.654  -60.759 152.331 1.00 687.61 ?  -148 DG  J P     1 
ATOM 3383  O OP1   . DG  A 1 165 ? 97.945  -60.519 151.648 1.00 687.61 ?  -148 DG  J OP1   1 
ATOM 3384  O OP2   . DG  A 1 165 ? 96.573  -61.794 153.389 1.00 687.61 -1 -148 DG  J OP2   1 
ATOM 3385  O "O5'" . DG  A 1 165 ? 96.148  -59.363 152.937 1.00 687.61 ?  -148 DG  J "O5'" 1 
ATOM 3386  C "C5'" . DG  A 1 165 ? 96.678  -58.125 152.441 1.00 687.61 ?  -148 DG  J "C5'" 1 
ATOM 3387  C "C4'" . DG  A 1 165 ? 96.453  -56.993 153.435 1.00 687.61 ?  -148 DG  J "C4'" 1 
ATOM 3388  O "O4'" . DG  A 1 165 ? 95.066  -56.996 153.869 1.00 687.61 ?  -148 DG  J "O4'" 1 
ATOM 3389  C "C3'" . DG  A 1 165 ? 97.276  -57.081 154.719 1.00 687.61 ?  -148 DG  J "C3'" 1 
ATOM 3390  O "O3'" . DG  A 1 165 ? 97.503  -55.776 155.238 1.00 687.61 ?  -148 DG  J "O3'" 1 
ATOM 3391  C "C2'" . DG  A 1 165 ? 96.348  -57.870 155.629 1.00 687.61 ?  -148 DG  J "C2'" 1 
ATOM 3392  C "C1'" . DG  A 1 165 ? 95.008  -57.249 155.263 1.00 687.61 ?  -148 DG  J "C1'" 1 
ATOM 3393  N N9    . DG  A 1 165 ? 93.858  -58.104 155.544 1.00 687.61 ?  -148 DG  J N9    1 
ATOM 3394  C C8    . DG  A 1 165 ? 93.815  -59.481 155.512 1.00 687.61 ?  -148 DG  J C8    1 
ATOM 3395  N N7    . DG  A 1 165 ? 92.644  -59.976 155.811 1.00 687.61 ?  -148 DG  J N7    1 
ATOM 3396  C C5    . DG  A 1 165 ? 91.859  -58.853 156.059 1.00 687.61 ?  -148 DG  J C5    1 
ATOM 3397  C C6    . DG  A 1 165 ? 90.498  -58.766 156.433 1.00 687.61 ?  -148 DG  J C6    1 
ATOM 3398  O O6    . DG  A 1 165 ? 89.688  -59.685 156.619 1.00 687.61 ?  -148 DG  J O6    1 
ATOM 3399  N N1    . DG  A 1 165 ? 90.096  -57.435 156.585 1.00 687.61 ?  -148 DG  J N1    1 
ATOM 3400  C C2    . DG  A 1 165 ? 90.909  -56.339 156.397 1.00 687.61 ?  -148 DG  J C2    1 
ATOM 3401  N N2    . DG  A 1 165 ? 90.347  -55.134 156.593 1.00 687.61 ?  -148 DG  J N2    1 
ATOM 3402  N N3    . DG  A 1 165 ? 92.188  -56.413 156.052 1.00 687.61 ?  -148 DG  J N3    1 
ATOM 3403  C C4    . DG  A 1 165 ? 92.592  -57.702 155.900 1.00 687.61 ?  -148 DG  J C4    1 
ATOM 3404  P P     . DA  A 1 166 ? 98.963  -55.345 155.759 1.00 684.86 ?  -147 DA  J P     1 
ATOM 3405  O OP1   . DA  A 1 166 ? 99.584  -54.542 154.683 1.00 684.86 ?  -147 DA  J OP1   1 
ATOM 3406  O OP2   . DA  A 1 166 ? 99.652  -56.546 156.279 1.00 684.86 -1 -147 DA  J OP2   1 
ATOM 3407  O "O5'" . DA  A 1 166 ? 98.661  -54.393 157.008 1.00 684.86 ?  -147 DA  J "O5'" 1 
ATOM 3408  C "C5'" . DA  A 1 166 ? 97.768  -53.297 156.866 1.00 684.86 ?  -147 DA  J "C5'" 1 
ATOM 3409  C "C4'" . DA  A 1 166 ? 96.945  -53.095 158.128 1.00 684.86 ?  -147 DA  J "C4'" 1 
ATOM 3410  O "O4'" . DA  A 1 166 ? 95.848  -54.052 158.158 1.00 684.86 ?  -147 DA  J "O4'" 1 
ATOM 3411  C "C3'" . DA  A 1 166 ? 97.710  -53.288 159.445 1.00 684.86 ?  -147 DA  J "C3'" 1 
ATOM 3412  O "O3'" . DA  A 1 166 ? 97.271  -52.345 160.406 1.00 684.86 ?  -147 DA  J "O3'" 1 
ATOM 3413  C "C2'" . DA  A 1 166 ? 97.295  -54.691 159.859 1.00 684.86 ?  -147 DA  J "C2'" 1 
ATOM 3414  C "C1'" . DA  A 1 166 ? 95.843  -54.696 159.411 1.00 684.86 ?  -147 DA  J "C1'" 1 
ATOM 3415  N N9    . DA  A 1 166 ? 95.298  -56.042 159.262 1.00 684.86 ?  -147 DA  J N9    1 
ATOM 3416  C C8    . DA  A 1 166 ? 96.009  -57.190 159.068 1.00 684.86 ?  -147 DA  J C8    1 
ATOM 3417  N N7    . DA  A 1 166 ? 95.268  -58.267 158.983 1.00 684.86 ?  -147 DA  J N7    1 
ATOM 3418  C C5    . DA  A 1 166 ? 93.976  -57.796 159.137 1.00 684.86 ?  -147 DA  J C5    1 
ATOM 3419  C C6    . DA  A 1 166 ? 92.725  -58.445 159.144 1.00 684.86 ?  -147 DA  J C6    1 
ATOM 3420  N N6    . DA  A 1 166 ? 92.581  -59.767 158.983 1.00 684.86 ?  -147 DA  J N6    1 
ATOM 3421  N N1    . DA  A 1 166 ? 91.627  -57.683 159.322 1.00 684.86 ?  -147 DA  J N1    1 
ATOM 3422  C C2    . DA  A 1 166 ? 91.776  -56.361 159.486 1.00 684.86 ?  -147 DA  J C2    1 
ATOM 3423  N N3    . DA  A 1 166 ? 92.897  -55.637 159.495 1.00 684.86 ?  -147 DA  J N3    1 
ATOM 3424  C C4    . DA  A 1 166 ? 93.971  -56.422 159.315 1.00 684.86 ?  -147 DA  J C4    1 
ATOM 3425  P P     . DT  A 1 167 ? 97.994  -50.922 160.575 1.00 684.84 ?  -146 DT  J P     1 
ATOM 3426  O OP1   . DT  A 1 167 ? 98.152  -50.317 159.232 1.00 684.84 ?  -146 DT  J OP1   1 
ATOM 3427  O OP2   . DT  A 1 167 ? 99.189  -51.103 161.431 1.00 684.84 -1 -146 DT  J OP2   1 
ATOM 3428  O "O5'" . DT  A 1 167 ? 96.922  -50.081 161.416 1.00 684.84 ?  -146 DT  J "O5'" 1 
ATOM 3429  C "C5'" . DT  A 1 167 ? 95.545  -50.082 161.016 1.00 684.84 ?  -146 DT  J "C5'" 1 
ATOM 3430  C "C4'" . DT  A 1 167 ? 94.636  -50.643 162.109 1.00 684.84 ?  -146 DT  J "C4'" 1 
ATOM 3431  O "O4'" . DT  A 1 167 ? 94.351  -52.031 161.854 1.00 684.84 ?  -146 DT  J "O4'" 1 
ATOM 3432  C "C3'" . DT  A 1 167 ? 95.186  -50.588 163.539 1.00 684.84 ?  -146 DT  J "C3'" 1 
ATOM 3433  O "O3'" . DT  A 1 167 ? 94.597  -49.483 164.230 1.00 684.84 ?  -146 DT  J "O3'" 1 
ATOM 3434  C "C2'" . DT  A 1 167 ? 94.768  -51.935 164.165 1.00 684.84 ?  -146 DT  J "C2'" 1 
ATOM 3435  C "C1'" . DT  A 1 167 ? 93.957  -52.624 163.062 1.00 684.84 ?  -146 DT  J "C1'" 1 
ATOM 3436  N N1    . DT  A 1 167 ? 94.214  -54.084 162.972 1.00 684.84 ?  -146 DT  J N1    1 
ATOM 3437  C C2    . DT  A 1 167 ? 93.162  -54.948 162.760 1.00 684.84 ?  -146 DT  J C2    1 
ATOM 3438  O O2    . DT  A 1 167 ? 92.006  -54.580 162.634 1.00 684.84 ?  -146 DT  J O2    1 
ATOM 3439  N N3    . DT  A 1 167 ? 93.516  -56.270 162.697 1.00 684.84 ?  -146 DT  J N3    1 
ATOM 3440  C C4    . DT  A 1 167 ? 94.789  -56.802 162.824 1.00 684.84 ?  -146 DT  J C4    1 
ATOM 3441  O O4    . DT  A 1 167 ? 95.008  -58.007 162.752 1.00 684.84 ?  -146 DT  J O4    1 
ATOM 3442  C C5    . DT  A 1 167 ? 95.841  -55.837 163.047 1.00 684.84 ?  -146 DT  J C5    1 
ATOM 3443  C C7    . DT  A 1 167 ? 97.261  -56.290 163.200 1.00 684.84 ?  -146 DT  J C7    1 
ATOM 3444  C C6    . DT  A 1 167 ? 95.505  -54.543 163.110 1.00 684.84 ?  -146 DT  J C6    1 
ATOM 3445  P P     . DG  A 1 168 ? 94.914  -49.177 165.781 1.00 685.84 ?  -145 DG  J P     1 
ATOM 3446  O OP1   . DG  A 1 168 ? 94.668  -47.724 165.908 1.00 685.84 ?  -145 DG  J OP1   1 
ATOM 3447  O OP2   . DG  A 1 168 ? 96.215  -49.753 166.188 1.00 685.84 -1 -145 DG  J OP2   1 
ATOM 3448  O "O5'" . DG  A 1 168 ? 93.776  -49.953 166.569 1.00 685.84 ?  -145 DG  J "O5'" 1 
ATOM 3449  C "C5'" . DG  A 1 168 ? 92.427  -49.811 166.163 1.00 685.84 ?  -145 DG  J "C5'" 1 
ATOM 3450  C "C4'" . DG  A 1 168 ? 91.540  -50.614 167.089 1.00 685.84 ?  -145 DG  J "C4'" 1 
ATOM 3451  O "O4'" . DG  A 1 168 ? 91.641  -52.023 166.762 1.00 685.84 ?  -145 DG  J "O4'" 1 
ATOM 3452  C "C3'" . DG  A 1 168 ? 91.914  -50.470 168.555 1.00 685.84 ?  -145 DG  J "C3'" 1 
ATOM 3453  O "O3'" . DG  A 1 168 ? 90.733  -50.300 169.304 1.00 685.84 ?  -145 DG  J "O3'" 1 
ATOM 3454  C "C2'" . DG  A 1 168 ? 92.654  -51.763 168.888 1.00 685.84 ?  -145 DG  J "C2'" 1 
ATOM 3455  C "C1'" . DG  A 1 168 ? 92.112  -52.758 167.871 1.00 685.84 ?  -145 DG  J "C1'" 1 
ATOM 3456  N N9    . DG  A 1 168 ? 93.126  -53.701 167.407 1.00 685.84 ?  -145 DG  J N9    1 
ATOM 3457  C C8    . DG  A 1 168 ? 94.477  -53.472 167.265 1.00 685.84 ?  -145 DG  J C8    1 
ATOM 3458  N N7    . DG  A 1 168 ? 95.136  -54.505 166.825 1.00 685.84 ?  -145 DG  J N7    1 
ATOM 3459  C C5    . DG  A 1 168 ? 94.161  -55.479 166.672 1.00 685.84 ?  -145 DG  J C5    1 
ATOM 3460  C C6    . DG  A 1 168 ? 94.280  -56.816 166.232 1.00 685.84 ?  -145 DG  J C6    1 
ATOM 3461  O O6    . DG  A 1 168 ? 95.312  -57.401 165.880 1.00 685.84 ?  -145 DG  J O6    1 
ATOM 3462  N N1    . DG  A 1 168 ? 93.054  -57.485 166.220 1.00 685.84 ?  -145 DG  J N1    1 
ATOM 3463  C C2    . DG  A 1 168 ? 91.854  -56.921 166.591 1.00 685.84 ?  -145 DG  J C2    1 
ATOM 3464  N N2    . DG  A 1 168 ? 90.776  -57.713 166.511 1.00 685.84 ?  -145 DG  J N2    1 
ATOM 3465  N N3    . DG  A 1 168 ? 91.726  -55.664 167.010 1.00 685.84 ?  -145 DG  J N3    1 
ATOM 3466  C C4    . DG  A 1 168 ? 92.917  -55.006 167.025 1.00 685.84 ?  -145 DG  J C4    1 
ATOM 3467  P P     . DT  A 1 169 ? 90.734  -50.368 170.900 1.00 687.82 ?  -144 DT  J P     1 
ATOM 3468  O OP1   . DT  A 1 169 ? 89.710  -49.420 171.391 1.00 687.82 ?  -144 DT  J OP1   1 
ATOM 3469  O OP2   . DT  A 1 169 ? 92.127  -50.268 171.396 1.00 687.82 -1 -144 DT  J OP2   1 
ATOM 3470  O "O5'" . DT  A 1 169 ? 90.208  -51.859 171.162 1.00 687.82 ?  -144 DT  J "O5'" 1 
ATOM 3471  C "C5'" . DT  A 1 169 ? 89.112  -52.389 170.405 1.00 687.82 ?  -144 DT  J "C5'" 1 
ATOM 3472  C "C4'" . DT  A 1 169 ? 88.799  -53.834 170.776 1.00 687.82 ?  -144 DT  J "C4'" 1 
ATOM 3473  O "O4'" . DT  A 1 169 ? 89.722  -54.757 170.133 1.00 687.82 ?  -144 DT  J "O4'" 1 
ATOM 3474  C "C3'" . DT  A 1 169 ? 88.834  -54.155 172.268 1.00 687.82 ?  -144 DT  J "C3'" 1 
ATOM 3475  O "O3'" . DT  A 1 169 ? 87.722  -54.992 172.559 1.00 687.82 ?  -144 DT  J "O3'" 1 
ATOM 3476  C "C2'" . DT  A 1 169 ? 90.168  -54.874 172.450 1.00 687.82 ?  -144 DT  J "C2'" 1 
ATOM 3477  C "C1'" . DT  A 1 169 ? 90.346  -55.571 171.103 1.00 687.82 ?  -144 DT  J "C1'" 1 
ATOM 3478  N N1    . DT  A 1 169 ? 91.767  -55.789 170.692 1.00 687.82 ?  -144 DT  J N1    1 
ATOM 3479  C C2    . DT  A 1 169 ? 92.108  -56.973 170.072 1.00 687.82 ?  -144 DT  J C2    1 
ATOM 3480  O O2    . DT  A 1 169 ? 91.310  -57.863 169.840 1.00 687.82 ?  -144 DT  J O2    1 
ATOM 3481  N N3    . DT  A 1 169 ? 93.436  -57.080 169.735 1.00 687.82 ?  -144 DT  J N3    1 
ATOM 3482  C C4    . DT  A 1 169 ? 94.439  -56.141 169.949 1.00 687.82 ?  -144 DT  J C4    1 
ATOM 3483  O O4    . DT  A 1 169 ? 95.604  -56.338 169.603 1.00 687.82 ?  -144 DT  J O4    1 
ATOM 3484  C C5    . DT  A 1 169 ? 94.013  -54.923 170.600 1.00 687.82 ?  -144 DT  J C5    1 
ATOM 3485  C C7    . DT  A 1 169 ? 94.999  -53.827 170.890 1.00 687.82 ?  -144 DT  J C7    1 
ATOM 3486  C C6    . DT  A 1 169 ? 92.720  -54.811 170.934 1.00 687.82 ?  -144 DT  J C6    1 
ATOM 3487  P P     . DA  A 1 170 ? 87.199  -55.268 174.046 1.00 673.97 ?  -143 DA  J P     1 
ATOM 3488  O OP1   . DA  A 1 170 ? 85.788  -54.824 174.097 1.00 673.97 ?  -143 DA  J OP1   1 
ATOM 3489  O OP2   . DA  A 1 170 ? 88.181  -54.737 175.023 1.00 673.97 -1 -143 DA  J OP2   1 
ATOM 3490  O "O5'" . DA  A 1 170 ? 87.242  -56.875 174.137 1.00 673.97 ?  -143 DA  J "O5'" 1 
ATOM 3491  C "C5'" . DA  A 1 170 ? 87.142  -57.733 172.986 1.00 673.97 ?  -143 DA  J "C5'" 1 
ATOM 3492  C "C4'" . DA  A 1 170 ? 88.110  -58.908 173.053 1.00 673.97 ?  -143 DA  J "C4'" 1 
ATOM 3493  O "O4'" . DA  A 1 170 ? 89.435  -58.527 172.592 1.00 673.97 ?  -143 DA  J "O4'" 1 
ATOM 3494  C "C3'" . DA  A 1 170 ? 88.308  -59.540 174.436 1.00 673.97 ?  -143 DA  J "C3'" 1 
ATOM 3495  O "O3'" . DA  A 1 170 ? 87.968  -60.938 174.397 1.00 673.97 ?  -143 DA  J "O3'" 1 
ATOM 3496  C "C2'" . DA  A 1 170 ? 89.794  -59.325 174.719 1.00 673.97 ?  -143 DA  J "C2'" 1 
ATOM 3497  C "C1'" . DA  A 1 170 ? 90.361  -59.314 173.306 1.00 673.97 ?  -143 DA  J "C1'" 1 
ATOM 3498  N N9    . DA  A 1 170 ? 91.711  -58.758 173.197 1.00 673.97 ?  -143 DA  J N9    1 
ATOM 3499  C C8    . DA  A 1 170 ? 92.088  -57.467 173.422 1.00 673.97 ?  -143 DA  J C8    1 
ATOM 3500  N N7    . DA  A 1 170 ? 93.368  -57.243 173.249 1.00 673.97 ?  -143 DA  J N7    1 
ATOM 3501  C C5    . DA  A 1 170 ? 93.880  -58.479 172.889 1.00 673.97 ?  -143 DA  J C5    1 
ATOM 3502  C C6    . DA  A 1 170 ? 95.190  -58.922 172.568 1.00 673.97 ?  -143 DA  J C6    1 
ATOM 3503  N N6    . DA  A 1 170 ? 96.260  -58.119 172.563 1.00 673.97 ?  -143 DA  J N6    1 
ATOM 3504  N N1    . DA  A 1 170 ? 95.363  -60.227 172.251 1.00 673.97 ?  -143 DA  J N1    1 
ATOM 3505  C C2    . DA  A 1 170 ? 94.293  -61.037 172.257 1.00 673.97 ?  -143 DA  J C2    1 
ATOM 3506  N N3    . DA  A 1 170 ? 93.019  -60.733 172.538 1.00 673.97 ?  -143 DA  J N3    1 
ATOM 3507  C C4    . DA  A 1 170 ? 92.871  -59.428 172.852 1.00 673.97 ?  -143 DA  J C4    1 
ATOM 3508  P P     . DT  A 1 171 ? 87.470  -61.775 175.679 1.00 658.08 ?  -142 DT  J P     1 
ATOM 3509  O OP1   . DT  A 1 171 ? 86.585  -62.840 175.158 1.00 658.08 ?  -142 DT  J OP1   1 
ATOM 3510  O OP2   . DT  A 1 171 ? 86.939  -60.851 176.708 1.00 658.08 -1 -142 DT  J OP2   1 
ATOM 3511  O "O5'" . DT  A 1 171 ? 88.833  -62.414 176.237 1.00 658.08 ?  -142 DT  J "O5'" 1 
ATOM 3512  C "C5'" . DT  A 1 171 ? 89.425  -63.509 175.548 1.00 658.08 ?  -142 DT  J "C5'" 1 
ATOM 3513  C "C4'" . DT  A 1 171 ? 90.930  -63.585 175.745 1.00 658.08 ?  -142 DT  J "C4'" 1 
ATOM 3514  O "O4'" . DT  A 1 171 ? 91.589  -62.328 175.443 1.00 658.08 ?  -142 DT  J "O4'" 1 
ATOM 3515  C "C3'" . DT  A 1 171 ? 91.403  -63.980 177.148 1.00 658.08 ?  -142 DT  J "C3'" 1 
ATOM 3516  O "O3'" . DT  A 1 171 ? 92.185  -65.171 177.046 1.00 658.08 ?  -142 DT  J "O3'" 1 
ATOM 3517  C "C2'" . DT  A 1 171 ? 92.272  -62.801 177.581 1.00 658.08 ?  -142 DT  J "C2'" 1 
ATOM 3518  C "C1'" . DT  A 1 171 ? 92.776  -62.361 176.211 1.00 658.08 ?  -142 DT  J "C1'" 1 
ATOM 3519  N N1    . DT  A 1 171 ? 93.525  -61.057 176.182 1.00 658.08 ?  -142 DT  J N1    1 
ATOM 3520  C C2    . DT  A 1 171 ? 94.887  -61.062 175.908 1.00 658.08 ?  -142 DT  J C2    1 
ATOM 3521  O O2    . DT  A 1 171 ? 95.546  -62.065 175.683 1.00 658.08 ?  -142 DT  J O2    1 
ATOM 3522  N N3    . DT  A 1 171 ? 95.471  -59.817 175.910 1.00 658.08 ?  -142 DT  J N3    1 
ATOM 3523  C C4    . DT  A 1 171 ? 94.851  -58.601 176.150 1.00 658.08 ?  -142 DT  J C4    1 
ATOM 3524  O O4    . DT  A 1 171 ? 95.482  -57.550 176.121 1.00 658.08 ?  -142 DT  J O4    1 
ATOM 3525  C C5    . DT  A 1 171 ? 93.431  -58.664 176.425 1.00 658.08 ?  -142 DT  J C5    1 
ATOM 3526  C C7    . DT  A 1 171 ? 92.634  -57.422 176.703 1.00 658.08 ?  -142 DT  J C7    1 
ATOM 3527  C C6    . DT  A 1 171 ? 92.848  -59.872 176.429 1.00 658.08 ?  -142 DT  J C6    1 
ATOM 3528  P P     . DA  A 1 172 ? 92.302  -66.228 178.247 1.00 659.55 ?  -141 DA  J P     1 
ATOM 3529  O OP1   . DA  A 1 172 ? 90.945  -66.788 178.465 1.00 659.55 ?  -141 DA  J OP1   1 
ATOM 3530  O OP2   . DA  A 1 172 ? 93.011  -65.600 179.385 1.00 659.55 -1 -141 DA  J OP2   1 
ATOM 3531  O "O5'" . DA  A 1 172 ? 93.268  -67.350 177.627 1.00 659.55 ?  -141 DA  J "O5'" 1 
ATOM 3532  C "C5'" . DA  A 1 172 ? 94.360  -67.027 176.750 1.00 659.55 ?  -141 DA  J "C5'" 1 
ATOM 3533  C "C4'" . DA  A 1 172 ? 95.726  -67.165 177.417 1.00 659.55 ?  -141 DA  J "C4'" 1 
ATOM 3534  O "O4'" . DA  A 1 172 ? 96.506  -65.963 177.162 1.00 659.55 ?  -141 DA  J "O4'" 1 
ATOM 3535  C "C3'" . DA  A 1 172 ? 95.700  -67.375 178.934 1.00 659.55 ?  -141 DA  J "C3'" 1 
ATOM 3536  O "O3'" . DA  A 1 172 ? 96.442  -68.545 179.318 1.00 659.55 ?  -141 DA  J "O3'" 1 
ATOM 3537  C "C2'" . DA  A 1 172 ? 96.276  -66.084 179.512 1.00 659.55 ?  -141 DA  J "C2'" 1 
ATOM 3538  C "C1'" . DA  A 1 172 ? 97.056  -65.453 178.364 1.00 659.55 ?  -141 DA  J "C1'" 1 
ATOM 3539  N N9    . DA  A 1 172 ? 96.992  -63.986 178.404 1.00 659.55 ?  -141 DA  J N9    1 
ATOM 3540  C C8    . DA  A 1 172 ? 95.902  -63.211 178.704 1.00 659.55 ?  -141 DA  J C8    1 
ATOM 3541  N N7    . DA  A 1 172 ? 96.136  -61.921 178.679 1.00 659.55 ?  -141 DA  J N7    1 
ATOM 3542  C C5    . DA  A 1 172 ? 97.477  -61.835 178.338 1.00 659.55 ?  -141 DA  J C5    1 
ATOM 3543  C C6    . DA  A 1 172 ? 98.349  -60.738 178.141 1.00 659.55 ?  -141 DA  J C6    1 
ATOM 3544  N N6    . DA  A 1 172 ? 97.980  -59.461 178.264 1.00 659.55 ?  -141 DA  J N6    1 
ATOM 3545  N N1    . DA  A 1 172 ? 99.630  -61.001 177.811 1.00 659.55 ?  -141 DA  J N1    1 
ATOM 3546  C C2    . DA  A 1 172 ? 100.019 -62.277 177.679 1.00 659.55 ?  -141 DA  J C2    1 
ATOM 3547  N N3    . DA  A 1 172 ? 99.294  -63.387 177.839 1.00 659.55 ?  -141 DA  J N3    1 
ATOM 3548  C C4    . DA  A 1 172 ? 98.021  -63.099 178.170 1.00 659.55 ?  -141 DA  J C4    1 
ATOM 3549  P P     . DT  A 1 173 ? 96.826  -68.891 180.847 1.00 663.87 ?  -140 DT  J P     1 
ATOM 3550  O OP1   . DT  A 1 173 ? 96.939  -70.364 180.936 1.00 663.87 ?  -140 DT  J OP1   1 
ATOM 3551  O OP2   . DT  A 1 173 ? 95.915  -68.183 181.781 1.00 663.87 -1 -140 DT  J OP2   1 
ATOM 3552  O "O5'" . DT  A 1 173 ? 98.303  -68.271 180.971 1.00 663.87 ?  -140 DT  J "O5'" 1 
ATOM 3553  C "C5'" . DT  A 1 173 ? 99.262  -68.460 179.912 1.00 663.87 ?  -140 DT  J "C5'" 1 
ATOM 3554  C "C4'" . DT  A 1 173 ? 100.444 -67.513 180.040 1.00 663.87 ?  -140 DT  J "C4'" 1 
ATOM 3555  O "O4'" . DT  A 1 173 ? 100.033 -66.158 179.727 1.00 663.87 ?  -140 DT  J "O4'" 1 
ATOM 3556  C "C3'" . DT  A 1 173 ? 101.026 -67.455 181.444 1.00 663.87 ?  -140 DT  J "C3'" 1 
ATOM 3557  O "O3'" . DT  A 1 173 ? 102.162 -68.302 181.547 1.00 663.87 ?  -140 DT  J "O3'" 1 
ATOM 3558  C "C2'" . DT  A 1 173 ? 101.418 -65.997 181.656 1.00 663.87 ?  -140 DT  J "C2'" 1 
ATOM 3559  C "C1'" . DT  A 1 173 ? 100.732 -65.227 180.538 1.00 663.87 ?  -140 DT  J "C1'" 1 
ATOM 3560  N N1    . DT  A 1 173 ? 99.806  -64.148 181.049 1.00 663.87 ?  -140 DT  J N1    1 
ATOM 3561  C C2    . DT  A 1 173 ? 100.203 -62.822 180.967 1.00 663.87 ?  -140 DT  J C2    1 
ATOM 3562  O O2    . DT  A 1 173 ? 101.269 -62.455 180.499 1.00 663.87 ?  -140 DT  J O2    1 
ATOM 3563  N N3    . DT  A 1 173 ? 99.288  -61.923 181.455 1.00 663.87 ?  -140 DT  J N3    1 
ATOM 3564  C C4    . DT  A 1 173 ? 98.051  -62.207 182.008 1.00 663.87 ?  -140 DT  J C4    1 
ATOM 3565  O O4    . DT  A 1 173 ? 97.311  -61.318 182.414 1.00 663.87 ?  -140 DT  J O4    1 
ATOM 3566  C C5    . DT  A 1 173 ? 97.695  -63.607 182.072 1.00 663.87 ?  -140 DT  J C5    1 
ATOM 3567  C C7    . DT  A 1 173 ? 96.376  -64.041 182.654 1.00 663.87 ?  -140 DT  J C7    1 
ATOM 3568  C C6    . DT  A 1 173 ? 98.582  -64.494 181.599 1.00 663.87 ?  -140 DT  J C6    1 
ATOM 3569  P P     . DA  A 1 174 ? 102.621 -68.844 182.986 1.00 661.45 ?  -139 DA  J P     1 
ATOM 3570  O OP1   . DA  A 1 174 ? 103.073 -70.240 182.779 1.00 661.45 ?  -139 DA  J OP1   1 
ATOM 3571  O OP2   . DA  A 1 174 ? 101.541 -68.568 183.967 1.00 661.45 -1 -139 DA  J OP2   1 
ATOM 3572  O "O5'" . DA  A 1 174 ? 103.889 -67.937 183.389 1.00 661.45 ?  -139 DA  J "O5'" 1 
ATOM 3573  C "C5'" . DA  A 1 174 ? 104.678 -67.194 182.433 1.00 661.45 ?  -139 DA  J "C5'" 1 
ATOM 3574  C "C4'" . DA  A 1 174 ? 105.126 -65.845 182.992 1.00 661.45 ?  -139 DA  J "C4'" 1 
ATOM 3575  O "O4'" . DA  A 1 174 ? 104.042 -64.873 182.942 1.00 661.45 ?  -139 DA  J "O4'" 1 
ATOM 3576  C "C3'" . DA  A 1 174 ? 105.633 -65.852 184.437 1.00 661.45 ?  -139 DA  J "C3'" 1 
ATOM 3577  O "O3'" . DA  A 1 174 ? 106.872 -65.142 184.477 1.00 661.45 ?  -139 DA  J "O3'" 1 
ATOM 3578  C "C2'" . DA  A 1 174 ? 104.504 -65.173 185.212 1.00 661.45 ?  -139 DA  J "C2'" 1 
ATOM 3579  C "C1'" . DA  A 1 174 ? 103.970 -64.188 184.178 1.00 661.45 ?  -139 DA  J "C1'" 1 
ATOM 3580  N N9    . DA  A 1 174 ? 102.599 -63.743 184.436 1.00 661.45 ?  -139 DA  J N9    1 
ATOM 3581  C C8    . DA  A 1 174 ? 101.516 -64.530 184.717 1.00 661.45 ?  -139 DA  J C8    1 
ATOM 3582  N N7    . DA  A 1 174 ? 100.403 -63.865 184.910 1.00 661.45 ?  -139 DA  J N7    1 
ATOM 3583  C C5    . DA  A 1 174 ? 100.782 -62.544 184.748 1.00 661.45 ?  -139 DA  J C5    1 
ATOM 3584  C C6    . DA  A 1 174 ? 100.058 -61.339 184.828 1.00 661.45 ?  -139 DA  J C6    1 
ATOM 3585  N N6    . DA  A 1 174 ? 98.754  -61.310 185.100 1.00 661.45 ?  -139 DA  J N6    1 
ATOM 3586  N N1    . DA  A 1 174 ? 100.721 -60.177 184.616 1.00 661.45 ?  -139 DA  J N1    1 
ATOM 3587  C C2    . DA  A 1 174 ? 102.031 -60.224 184.339 1.00 661.45 ?  -139 DA  J C2    1 
ATOM 3588  N N3    . DA  A 1 174 ? 102.819 -61.300 184.242 1.00 661.45 ?  -139 DA  J N3    1 
ATOM 3589  C C4    . DA  A 1 174 ? 102.131 -62.443 184.458 1.00 661.45 ?  -139 DA  J C4    1 
ATOM 3590  P P     . DT  A 1 175 ? 107.678 -64.756 185.810 1.00 666.14 ?  -138 DT  J P     1 
ATOM 3591  O OP1   . DT  A 1 175 ? 108.895 -65.595 185.851 1.00 666.14 ?  -138 DT  J OP1   1 
ATOM 3592  O OP2   . DT  A 1 175 ? 106.765 -64.737 186.976 1.00 666.14 -1 -138 DT  J OP2   1 
ATOM 3593  O "O5'" . DT  A 1 175 ? 108.135 -63.254 185.491 1.00 666.14 ?  -138 DT  J "O5'" 1 
ATOM 3594  C "C5'" . DT  A 1 175 ? 107.232 -62.286 184.941 1.00 666.14 ?  -138 DT  J "C5'" 1 
ATOM 3595  C "C4'" . DT  A 1 175 ? 107.031 -61.102 185.876 1.00 666.14 ?  -138 DT  J "C4'" 1 
ATOM 3596  O "O4'" . DT  A 1 175 ? 105.613 -60.825 186.033 1.00 666.14 ?  -138 DT  J "O4'" 1 
ATOM 3597  C "C3'" . DT  A 1 175 ? 107.581 -61.274 187.289 1.00 666.14 ?  -138 DT  J "C3'" 1 
ATOM 3598  O "O3'" . DT  A 1 175 ? 108.164 -60.058 187.720 1.00 666.14 ?  -138 DT  J "O3'" 1 
ATOM 3599  C "C2'" . DT  A 1 175 ? 106.344 -61.613 188.113 1.00 666.14 ?  -138 DT  J "C2'" 1 
ATOM 3600  C "C1'" . DT  A 1 175 ? 105.301 -60.753 187.411 1.00 666.14 ?  -138 DT  J "C1'" 1 
ATOM 3601  N N1    . DT  A 1 175 ? 103.886 -61.184 187.602 1.00 666.14 ?  -138 DT  J N1    1 
ATOM 3602  C C2    . DT  A 1 175 ? 102.889 -60.229 187.521 1.00 666.14 ?  -138 DT  J C2    1 
ATOM 3603  O O2    . DT  A 1 175 ? 103.098 -59.046 187.301 1.00 666.14 ?  -138 DT  J O2    1 
ATOM 3604  N N3    . DT  A 1 175 ? 101.618 -60.712 187.703 1.00 666.14 ?  -138 DT  J N3    1 
ATOM 3605  C C4    . DT  A 1 175 ? 101.248 -62.020 187.958 1.00 666.14 ?  -138 DT  J C4    1 
ATOM 3606  O O4    . DT  A 1 175 ? 100.071 -62.333 188.105 1.00 666.14 ?  -138 DT  J O4    1 
ATOM 3607  C C5    . DT  A 1 175 ? 102.337 -62.972 188.029 1.00 666.14 ?  -138 DT  J C5    1 
ATOM 3608  C C7    . DT  A 1 175 ? 102.075 -64.427 188.300 1.00 666.14 ?  -138 DT  J C7    1 
ATOM 3609  C C6    . DT  A 1 175 ? 103.586 -62.512 187.850 1.00 666.14 ?  -138 DT  J C6    1 
ATOM 3610  P P     . DC  A 1 176 ? 109.316 -60.066 188.830 1.00 661.09 ?  -137 DC  J P     1 
ATOM 3611  O OP1   . DC  A 1 176 ? 110.576 -60.315 188.096 1.00 661.33 ?  -137 DC  J OP1   1 
ATOM 3612  O OP2   . DC  A 1 176 ? 108.895 -60.956 189.943 1.00 660.88 -1 -137 DC  J OP2   1 
ATOM 3613  O "O5'" . DC  A 1 176 ? 109.358 -58.564 189.397 1.00 659.74 ?  -137 DC  J "O5'" 1 
ATOM 3614  C "C5'" . DC  A 1 176 ? 108.615 -57.506 188.783 1.00 657.49 ?  -137 DC  J "C5'" 1 
ATOM 3615  C "C4'" . DC  A 1 176 ? 107.673 -56.858 189.778 1.00 655.71 ?  -137 DC  J "C4'" 1 
ATOM 3616  O "O4'" . DC  A 1 176 ? 106.380 -57.500 189.681 1.00 655.16 ?  -137 DC  J "O4'" 1 
ATOM 3617  C "C3'" . DC  A 1 176 ? 108.114 -56.940 191.244 1.00 654.98 ?  -137 DC  J "C3'" 1 
ATOM 3618  O "O3'" . DC  A 1 176 ? 108.548 -55.633 191.725 1.00 653.90 ?  -137 DC  J "O3'" 1 
ATOM 3619  C "C2'" . DC  A 1 176 ? 106.915 -57.576 191.959 1.00 654.92 ?  -137 DC  J "C2'" 1 
ATOM 3620  C "C1'" . DC  A 1 176 ? 105.771 -57.475 190.953 1.00 654.75 ?  -137 DC  J "C1'" 1 
ATOM 3621  N N1    . DC  A 1 176 ? 104.749 -58.583 191.059 1.00 654.77 ?  -137 DC  J N1    1 
ATOM 3622  C C2    . DC  A 1 176 ? 103.370 -58.285 191.133 1.00 654.65 ?  -137 DC  J C2    1 
ATOM 3623  O O2    . DC  A 1 176 ? 102.980 -57.110 191.107 1.00 654.55 ?  -137 DC  J O2    1 
ATOM 3624  N N3    . DC  A 1 176 ? 102.473 -59.304 191.231 1.00 654.39 ?  -137 DC  J N3    1 
ATOM 3625  C C4    . DC  A 1 176 ? 102.897 -60.570 191.257 1.00 654.45 ?  -137 DC  J C4    1 
ATOM 3626  N N4    . DC  A 1 176 ? 101.977 -61.532 191.354 1.00 654.32 ?  -137 DC  J N4    1 
ATOM 3627  C C5    . DC  A 1 176 ? 104.287 -60.903 191.184 1.00 654.55 ?  -137 DC  J C5    1 
ATOM 3628  C C6    . DC  A 1 176 ? 105.164 -59.892 191.087 1.00 654.74 ?  -137 DC  J C6    1 
ATOM 3629  P P     . DT  A 1 177 ? 107.975 -54.846 193.008 1.00 644.21 ?  -136 DT  J P     1 
ATOM 3630  O OP1   . DT  A 1 177 ? 108.768 -53.606 193.171 1.00 644.27 ?  -136 DT  J OP1   1 
ATOM 3631  O OP2   . DT  A 1 177 ? 107.860 -55.777 194.162 1.00 643.84 -1 -136 DT  J OP2   1 
ATOM 3632  O "O5'" . DT  A 1 177 ? 106.510 -54.464 192.483 1.00 643.69 ?  -136 DT  J "O5'" 1 
ATOM 3633  C "C5'" . DT  A 1 177 ? 106.019 -53.130 192.500 1.00 642.65 ?  -136 DT  J "C5'" 1 
ATOM 3634  C "C4'" . DT  A 1 177 ? 104.748 -53.096 193.327 1.00 642.31 ?  -136 DT  J "C4'" 1 
ATOM 3635  O "O4'" . DT  A 1 177 ? 104.056 -54.373 193.258 1.00 642.89 ?  -136 DT  J "O4'" 1 
ATOM 3636  C "C3'" . DT  A 1 177 ? 104.944 -52.823 194.812 1.00 641.54 ?  -136 DT  J "C3'" 1 
ATOM 3637  O "O3'" . DT  A 1 177 ? 103.888 -51.981 195.242 1.00 639.82 ?  -136 DT  J "O3'" 1 
ATOM 3638  C "C2'" . DT  A 1 177 ? 104.825 -54.209 195.444 1.00 642.12 ?  -136 DT  J "C2'" 1 
ATOM 3639  C "C1'" . DT  A 1 177 ? 103.712 -54.780 194.571 1.00 643.39 ?  -136 DT  J "C1'" 1 
ATOM 3640  N N1    . DT  A 1 177 ? 103.496 -56.275 194.619 1.00 643.91 ?  -136 DT  J N1    1 
ATOM 3641  C C2    . DT  A 1 177 ? 102.197 -56.767 194.562 1.00 644.31 ?  -136 DT  J C2    1 
ATOM 3642  O O2    . DT  A 1 177 ? 101.198 -56.059 194.477 1.00 644.43 ?  -136 DT  J O2    1 
ATOM 3643  N N3    . DT  A 1 177 ? 102.099 -58.143 194.609 1.00 644.23 ?  -136 DT  J N3    1 
ATOM 3644  C C4    . DT  A 1 177 ? 103.138 -59.057 194.704 1.00 644.07 ?  -136 DT  J C4    1 
ATOM 3645  O O4    . DT  A 1 177 ? 102.928 -60.266 194.739 1.00 644.09 ?  -136 DT  J O4    1 
ATOM 3646  C C5    . DT  A 1 177 ? 104.468 -58.485 194.757 1.00 644.31 ?  -136 DT  J C5    1 
ATOM 3647  C C7    . DT  A 1 177 ? 105.680 -59.371 194.860 1.00 644.03 ?  -136 DT  J C7    1 
ATOM 3648  C C6    . DT  A 1 177 ? 104.578 -57.143 194.710 1.00 644.23 ?  -136 DT  J C6    1 
ATOM 3649  P P     . DG  A 1 178 ? 104.179 -50.709 196.168 1.00 649.52 ?  -135 DG  J P     1 
ATOM 3650  O OP1   . DG  A 1 178 ? 105.083 -49.821 195.403 1.00 649.45 ?  -135 DG  J OP1   1 
ATOM 3651  O OP2   . DG  A 1 178 ? 104.584 -51.207 197.508 1.00 649.60 -1 -135 DG  J OP2   1 
ATOM 3652  O "O5'" . DG  A 1 178 ? 102.738 -50.005 196.317 1.00 648.14 ?  -135 DG  J "O5'" 1 
ATOM 3653  C "C5'" . DG  A 1 178 ? 101.523 -50.592 195.806 1.00 645.28 ?  -135 DG  J "C5'" 1 
ATOM 3654  C "C4'" . DG  A 1 178 ? 100.519 -51.007 196.887 1.00 643.12 ?  -135 DG  J "C4'" 1 
ATOM 3655  O "O4'" . DG  A 1 178 ? 100.545 -52.443 197.099 1.00 643.05 ?  -135 DG  J "O4'" 1 
ATOM 3656  C "C3'" . DG  A 1 178 ? 100.682 -50.427 198.287 1.00 641.81 ?  -135 DG  J "C3'" 1 
ATOM 3657  O "O3'" . DG  A 1 178 ? 99.404  -50.381 198.889 1.00 639.74 ?  -135 DG  J "O3'" 1 
ATOM 3658  C "C2'" . DG  A 1 178 ? 101.534 -51.481 198.990 1.00 642.39 ?  -135 DG  J "C2'" 1 
ATOM 3659  C "C1'" . DG  A 1 178 ? 100.873 -52.743 198.448 1.00 642.87 ?  -135 DG  J "C1'" 1 
ATOM 3660  N N9    . DG  A 1 178 ? 101.700 -53.938 198.379 1.00 642.88 ?  -135 DG  J N9    1 
ATOM 3661  C C8    . DG  A 1 178 ? 103.070 -54.038 198.436 1.00 643.05 ?  -135 DG  J C8    1 
ATOM 3662  N N7    . DG  A 1 178 ? 103.506 -55.260 198.314 1.00 643.00 ?  -135 DG  J N7    1 
ATOM 3663  C C5    . DG  A 1 178 ? 102.353 -56.017 198.154 1.00 642.91 ?  -135 DG  J C5    1 
ATOM 3664  C C6    . DG  A 1 178 ? 102.188 -57.414 197.974 1.00 642.88 ?  -135 DG  J C6    1 
ATOM 3665  O O6    . DG  A 1 178 ? 103.061 -58.287 197.919 1.00 642.89 ?  -135 DG  J O6    1 
ATOM 3666  N N1    . DG  A 1 178 ? 100.844 -57.772 197.853 1.00 643.15 ?  -135 DG  J N1    1 
ATOM 3667  C C2    . DG  A 1 178 ? 99.784  -56.887 197.894 1.00 643.13 ?  -135 DG  J C2    1 
ATOM 3668  N N2    . DG  A 1 178 ? 98.558  -57.417 197.763 1.00 643.00 ?  -135 DG  J N2    1 
ATOM 3669  N N3    . DG  A 1 178 ? 99.926  -55.575 198.062 1.00 642.85 ?  -135 DG  J N3    1 
ATOM 3670  C C4    . DG  A 1 178 ? 101.231 -55.214 198.187 1.00 642.95 ?  -135 DG  J C4    1 
ATOM 3671  P P     . DA  A 1 179 ? 98.466  -49.095 198.806 1.00 647.41 ?  -134 DA  J P     1 
ATOM 3672  O OP1   . DA  A 1 179 ? 98.727  -48.392 197.527 1.00 647.49 ?  -134 DA  J OP1   1 
ATOM 3673  O OP2   . DA  A 1 179 ? 98.606  -48.430 200.122 1.00 646.43 -1 -134 DA  J OP2   1 
ATOM 3674  O "O5'" . DA  A 1 179 ? 96.979  -49.674 198.711 1.00 647.13 ?  -134 DA  J "O5'" 1 
ATOM 3675  C "C5'" . DA  A 1 179 ? 96.609  -50.692 197.765 1.00 645.72 ?  -134 DA  J "C5'" 1 
ATOM 3676  C "C4'" . DA  A 1 179 ? 95.699  -51.750 198.392 1.00 644.45 ?  -134 DA  J "C4'" 1 
ATOM 3677  O "O4'" . DA  A 1 179 ? 96.481  -52.847 198.936 1.00 644.27 ?  -134 DA  J "O4'" 1 
ATOM 3678  C "C3'" . DA  A 1 179 ? 94.802  -51.302 199.546 1.00 643.42 ?  -134 DA  J "C3'" 1 
ATOM 3679  O "O3'" . DA  A 1 179 ? 93.592  -52.057 199.487 1.00 641.52 ?  -134 DA  J "O3'" 1 
ATOM 3680  C "C2'" . DA  A 1 179 ? 95.634  -51.624 200.787 1.00 643.32 ?  -134 DA  J "C2'" 1 
ATOM 3681  C "C1'" . DA  A 1 179 ? 96.312  -52.916 200.343 1.00 644.73 ?  -134 DA  J "C1'" 1 
ATOM 3682  N N9    . DA  A 1 179 ? 97.642  -53.149 200.883 1.00 644.98 ?  -134 DA  J N9    1 
ATOM 3683  C C8    . DA  A 1 179 ? 98.538  -52.230 201.356 1.00 645.15 ?  -134 DA  J C8    1 
ATOM 3684  N N7    . DA  A 1 179 ? 99.668  -52.752 201.763 1.00 645.13 ?  -134 DA  J N7    1 
ATOM 3685  C C5    . DA  A 1 179 ? 99.498  -54.104 201.536 1.00 645.16 ?  -134 DA  J C5    1 
ATOM 3686  C C6    . DA  A 1 179 ? 100.341 -55.209 201.753 1.00 645.25 ?  -134 DA  J C6    1 
ATOM 3687  N N6    . DA  A 1 179 ? 101.563 -55.089 202.275 1.00 645.07 ?  -134 DA  J N6    1 
ATOM 3688  N N1    . DA  A 1 179 ? 99.870  -56.434 201.420 1.00 645.27 ?  -134 DA  J N1    1 
ATOM 3689  C C2    . DA  A 1 179 ? 98.632  -56.538 200.901 1.00 645.16 ?  -134 DA  J C2    1 
ATOM 3690  N N3    . DA  A 1 179 ? 97.753  -55.570 200.642 1.00 644.79 ?  -134 DA  J N3    1 
ATOM 3691  C C4    . DA  A 1 179 ? 98.256  -54.370 200.989 1.00 645.01 ?  -134 DA  J C4    1 
ATOM 3692  P P     . DC  A 1 180 ? 92.255  -51.626 200.259 1.00 645.48 ?  -133 DC  J P     1 
ATOM 3693  O OP1   . DC  A 1 180 ? 91.252  -51.245 199.232 1.00 644.74 ?  -133 DC  J OP1   1 
ATOM 3694  O OP2   . DC  A 1 180 ? 92.600  -50.708 201.370 1.00 644.38 -1 -133 DC  J OP2   1 
ATOM 3695  O "O5'" . DC  A 1 180 ? 91.823  -53.015 200.930 1.00 645.91 ?  -133 DC  J "O5'" 1 
ATOM 3696  C "C5'" . DC  A 1 180 ? 91.542  -54.200 200.160 1.00 644.62 ?  -133 DC  J "C5'" 1 
ATOM 3697  C "C4'" . DC  A 1 180 ? 91.593  -55.454 201.024 1.00 643.26 ?  -133 DC  J "C4'" 1 
ATOM 3698  O "O4'" . DC  A 1 180 ? 92.942  -55.648 201.531 1.00 642.55 ?  -133 DC  J "O4'" 1 
ATOM 3699  C "C3'" . DC  A 1 180 ? 90.699  -55.456 202.262 1.00 642.43 ?  -133 DC  J "C3'" 1 
ATOM 3700  O "O3'" . DC  A 1 180 ? 90.449  -56.805 202.619 1.00 641.89 ?  -133 DC  J "O3'" 1 
ATOM 3701  C "C2'" . DC  A 1 180 ? 91.640  -54.869 203.311 1.00 642.05 ?  -133 DC  J "C2'" 1 
ATOM 3702  C "C1'" . DC  A 1 180 ? 92.904  -55.654 202.949 1.00 642.02 ?  -133 DC  J "C1'" 1 
ATOM 3703  N N1    . DC  A 1 180 ? 94.206  -55.133 203.486 1.00 642.13 ?  -133 DC  J N1    1 
ATOM 3704  C C2    . DC  A 1 180 ? 95.335  -55.978 203.556 1.00 642.18 ?  -133 DC  J C2    1 
ATOM 3705  O O2    . DC  A 1 180 ? 95.266  -57.157 203.180 1.00 642.18 ?  -133 DC  J O2    1 
ATOM 3706  N N3    . DC  A 1 180 ? 96.501  -55.481 204.044 1.00 641.80 ?  -133 DC  J N3    1 
ATOM 3707  C C4    . DC  A 1 180 ? 96.568  -54.211 204.448 1.00 641.92 ?  -133 DC  J C4    1 
ATOM 3708  N N4    . DC  A 1 180 ? 97.733  -53.765 204.920 1.00 642.16 ?  -133 DC  J N4    1 
ATOM 3709  C C5    . DC  A 1 180 ? 95.440  -53.337 204.388 1.00 642.01 ?  -133 DC  J C5    1 
ATOM 3710  C C6    . DC  A 1 180 ? 94.294  -53.833 203.905 1.00 641.93 ?  -133 DC  J C6    1 
ATOM 3711  P P     . DA  A 1 181 ? 89.174  -57.693 202.232 1.00 653.43 ?  -132 DA  J P     1 
ATOM 3712  O OP1   . DA  A 1 181 ? 89.266  -58.123 200.815 1.00 652.42 ?  -132 DA  J OP1   1 
ATOM 3713  O OP2   . DA  A 1 181 ? 87.945  -57.060 202.750 1.00 652.62 -1 -132 DA  J OP2   1 
ATOM 3714  O "O5'" . DA  A 1 181 ? 89.522  -58.928 203.175 1.00 654.99 ?  -132 DA  J "O5'" 1 
ATOM 3715  C "C5'" . DA  A 1 181 ? 90.845  -59.481 203.148 1.00 656.79 ?  -132 DA  J "C5'" 1 
ATOM 3716  C "C4'" . DA  A 1 181 ? 91.432  -59.611 204.543 1.00 658.38 ?  -132 DA  J "C4'" 1 
ATOM 3717  O "O4'" . DA  A 1 181 ? 92.363  -58.533 204.840 1.00 658.47 ?  -132 DA  J "O4'" 1 
ATOM 3718  C "C3'" . DA  A 1 181 ? 90.408  -59.630 205.680 1.00 659.83 ?  -132 DA  J "C3'" 1 
ATOM 3719  O "O3'" . DA  A 1 181 ? 90.604  -60.859 206.391 1.00 662.57 ?  -132 DA  J "O3'" 1 
ATOM 3720  C "C2'" . DA  A 1 181 ? 90.755  -58.370 206.473 1.00 659.45 ?  -132 DA  J "C2'" 1 
ATOM 3721  C "C1'" . DA  A 1 181 ? 92.258  -58.315 206.230 1.00 658.81 ?  -132 DA  J "C1'" 1 
ATOM 3722  N N9    . DA  A 1 181 ? 92.930  -57.082 206.645 1.00 658.72 ?  -132 DA  J N9    1 
ATOM 3723  C C8    . DA  A 1 181 ? 92.365  -55.859 206.896 1.00 658.64 ?  -132 DA  J C8    1 
ATOM 3724  N N7    . DA  A 1 181 ? 93.221  -54.936 207.265 1.00 658.41 ?  -132 DA  J N7    1 
ATOM 3725  C C5    . DA  A 1 181 ? 94.435  -55.600 207.254 1.00 658.81 ?  -132 DA  J C5    1 
ATOM 3726  C C6    . DA  A 1 181 ? 95.747  -55.184 207.554 1.00 658.86 ?  -132 DA  J C6    1 
ATOM 3727  N N6    . DA  A 1 181 ? 96.037  -53.932 207.925 1.00 658.84 ?  -132 DA  J N6    1 
ATOM 3728  N N1    . DA  A 1 181 ? 96.746  -56.094 207.451 1.00 658.76 ?  -132 DA  J N1    1 
ATOM 3729  C C2    . DA  A 1 181 ? 96.450  -57.343 207.075 1.00 658.47 ?  -132 DA  J C2    1 
ATOM 3730  N N3    . DA  A 1 181 ? 95.255  -57.851 206.772 1.00 658.78 ?  -132 DA  J N3    1 
ATOM 3731  C C4    . DA  A 1 181 ? 94.279  -56.925 206.882 1.00 658.90 ?  -132 DA  J C4    1 
ATOM 3732  P P     . DC  A 1 182 ? 90.029  -61.211 207.849 1.00 634.66 ?  -131 DC  J P     1 
ATOM 3733  O OP1   . DC  A 1 182 ? 88.754  -61.926 207.613 1.00 634.34 ?  -131 DC  J OP1   1 
ATOM 3734  O OP2   . DC  A 1 182 ? 90.040  -60.014 208.724 1.00 634.01 -1 -131 DC  J OP2   1 
ATOM 3735  O "O5'" . DC  A 1 182 ? 91.129  -62.237 208.434 1.00 636.22 ?  -131 DC  J "O5'" 1 
ATOM 3736  C "C5'" . DC  A 1 182 ? 92.542  -62.158 208.118 1.00 638.95 ?  -131 DC  J "C5'" 1 
ATOM 3737  C "C4'" . DC  A 1 182 ? 93.470  -62.155 209.337 1.00 641.00 ?  -131 DC  J "C4'" 1 
ATOM 3738  O "O4'" . DC  A 1 182 ? 94.150  -60.871 209.418 1.00 641.66 ?  -131 DC  J "O4'" 1 
ATOM 3739  C "C3'" . DC  A 1 182 ? 92.832  -62.370 210.718 1.00 642.26 ?  -131 DC  J "C3'" 1 
ATOM 3740  O "O3'" . DC  A 1 182 ? 93.706  -63.067 211.635 1.00 643.19 ?  -131 DC  J "O3'" 1 
ATOM 3741  C "C2'" . DC  A 1 182 ? 92.595  -60.937 211.174 1.00 642.45 ?  -131 DC  J "C2'" 1 
ATOM 3742  C "C1'" . DC  A 1 182 ? 93.882  -60.279 210.679 1.00 642.62 ?  -131 DC  J "C1'" 1 
ATOM 3743  N N1    . DC  A 1 182 ? 93.774  -58.784 210.570 1.00 643.05 ?  -131 DC  J N1    1 
ATOM 3744  C C2    . DC  A 1 182 ? 94.806  -57.947 211.033 1.00 642.89 ?  -131 DC  J C2    1 
ATOM 3745  O O2    . DC  A 1 182 ? 95.828  -58.425 211.538 1.00 643.05 ?  -131 DC  J O2    1 
ATOM 3746  N N3    . DC  A 1 182 ? 94.656  -56.605 210.919 1.00 642.89 ?  -131 DC  J N3    1 
ATOM 3747  C C4    . DC  A 1 182 ? 93.549  -56.090 210.376 1.00 643.03 ?  -131 DC  J C4    1 
ATOM 3748  N N4    . DC  A 1 182 ? 93.453  -54.760 210.283 1.00 642.94 ?  -131 DC  J N4    1 
ATOM 3749  C C5    . DC  A 1 182 ? 92.486  -56.916 209.905 1.00 643.15 ?  -131 DC  J C5    1 
ATOM 3750  C C6    . DC  A 1 182 ? 92.642  -58.240 210.019 1.00 643.28 ?  -131 DC  J C6    1 
ATOM 3751  P P     . DG  A 1 183 ? 93.159  -63.687 213.017 1.00 640.35 ?  -130 DG  J P     1 
ATOM 3752  O OP1   . DG  A 1 183 ? 92.334  -64.851 212.634 1.00 640.46 ?  -130 DG  J OP1   1 
ATOM 3753  O OP2   . DG  A 1 183 ? 92.561  -62.629 213.869 1.00 639.61 -1 -130 DG  J OP2   1 
ATOM 3754  O "O5'" . DG  A 1 183 ? 94.480  -64.217 213.761 1.00 641.70 ?  -130 DG  J "O5'" 1 
ATOM 3755  C "C5'" . DG  A 1 183 ? 95.780  -63.636 213.570 1.00 643.14 ?  -130 DG  J "C5'" 1 
ATOM 3756  C "C4'" . DG  A 1 183 ? 96.281  -62.790 214.743 1.00 644.41 ?  -130 DG  J "C4'" 1 
ATOM 3757  O "O4'" . DG  A 1 183 ? 96.237  -61.385 214.369 1.00 644.37 ?  -130 DG  J "O4'" 1 
ATOM 3758  C "C3'" . DG  A 1 183 ? 95.550  -62.911 216.087 1.00 645.46 ?  -130 DG  J "C3'" 1 
ATOM 3759  O "O3'" . DG  A 1 183 ? 96.499  -63.239 217.147 1.00 647.48 ?  -130 DG  J "O3'" 1 
ATOM 3760  C "C2'" . DG  A 1 183 ? 94.826  -61.570 216.232 1.00 644.81 ?  -130 DG  J "C2'" 1 
ATOM 3761  C "C1'" . DG  A 1 183 ? 95.697  -60.619 215.421 1.00 644.37 ?  -130 DG  J "C1'" 1 
ATOM 3762  N N9    . DG  A 1 183 ? 94.929  -59.521 214.849 1.00 644.39 ?  -130 DG  J N9    1 
ATOM 3763  C C8    . DG  A 1 183 ? 93.745  -59.644 214.165 1.00 644.39 ?  -130 DG  J C8    1 
ATOM 3764  N N7    . DG  A 1 183 ? 93.243  -58.518 213.757 1.00 644.27 ?  -130 DG  J N7    1 
ATOM 3765  C C5    . DG  A 1 183 ? 94.154  -57.578 214.203 1.00 644.29 ?  -130 DG  J C5    1 
ATOM 3766  C C6    . DG  A 1 183 ? 94.127  -56.178 214.048 1.00 644.29 ?  -130 DG  J C6    1 
ATOM 3767  O O6    . DG  A 1 183 ? 93.263  -55.505 213.474 1.00 644.19 ?  -130 DG  J O6    1 
ATOM 3768  N N1    . DG  A 1 183 ? 95.231  -55.564 214.637 1.00 644.55 ?  -130 DG  J N1    1 
ATOM 3769  C C2    . DG  A 1 183 ? 96.240  -56.231 215.297 1.00 644.36 ?  -130 DG  J C2    1 
ATOM 3770  N N2    . DG  A 1 183 ? 97.216  -55.456 215.794 1.00 644.31 ?  -130 DG  J N2    1 
ATOM 3771  N N3    . DG  A 1 183 ? 96.277  -57.554 215.453 1.00 644.26 ?  -130 DG  J N3    1 
ATOM 3772  C C4    . DG  A 1 183 ? 95.204  -58.167 214.879 1.00 644.41 ?  -130 DG  J C4    1 
ATOM 3773  P P     . DT  A 1 184 ? 96.697  -62.475 218.556 1.00 635.82 ?  -129 DT  J P     1 
ATOM 3774  O OP1   . DT  A 1 184 ? 97.615  -63.313 219.361 1.00 635.60 ?  -129 DT  J OP1   1 
ATOM 3775  O OP2   . DT  A 1 184 ? 95.374  -62.105 219.124 1.00 635.56 -1 -129 DT  J OP2   1 
ATOM 3776  O "O5'" . DT  A 1 184 ? 97.459  -61.127 218.118 1.00 637.04 ?  -129 DT  J "O5'" 1 
ATOM 3777  C "C5'" . DT  A 1 184 ? 98.715  -60.724 218.679 1.00 638.29 ?  -129 DT  J "C5'" 1 
ATOM 3778  C "C4'" . DT  A 1 184 ? 98.587  -59.440 219.493 1.00 639.05 ?  -129 DT  J "C4'" 1 
ATOM 3779  O "O4'" . DT  A 1 184 ? 97.756  -58.467 218.796 1.00 639.12 ?  -129 DT  J "O4'" 1 
ATOM 3780  C "C3'" . DT  A 1 184 ? 97.968  -59.606 220.882 1.00 639.72 ?  -129 DT  J "C3'" 1 
ATOM 3781  O "O3'" . DT  A 1 184 ? 98.686  -58.796 221.820 1.00 640.65 ?  -129 DT  J "O3'" 1 
ATOM 3782  C "C2'" . DT  A 1 184 ? 96.543  -59.104 220.665 1.00 639.37 ?  -129 DT  J "C2'" 1 
ATOM 3783  C "C1'" . DT  A 1 184 ? 96.831  -57.937 219.727 1.00 639.13 ?  -129 DT  J "C1'" 1 
ATOM 3784  N N1    . DT  A 1 184 ? 95.626  -57.352 219.038 1.00 639.12 ?  -129 DT  J N1    1 
ATOM 3785  C C2    . DT  A 1 184 ? 95.588  -55.995 218.761 1.00 638.99 ?  -129 DT  J C2    1 
ATOM 3786  O O2    . DT  A 1 184 ? 96.483  -55.214 219.035 1.00 638.99 ?  -129 DT  J O2    1 
ATOM 3787  N N3    . DT  A 1 184 ? 94.441  -55.572 218.137 1.00 638.93 ?  -129 DT  J N3    1 
ATOM 3788  C C4    . DT  A 1 184 ? 93.349  -56.342 217.771 1.00 638.99 ?  -129 DT  J C4    1 
ATOM 3789  O O4    . DT  A 1 184 ? 92.374  -55.843 217.217 1.00 638.94 ?  -129 DT  J O4    1 
ATOM 3790  C C5    . DT  A 1 184 ? 93.448  -57.749 218.093 1.00 638.98 ?  -129 DT  J C5    1 
ATOM 3791  C C7    . DT  A 1 184 ? 92.341  -58.707 217.756 1.00 639.00 ?  -129 DT  J C7    1 
ATOM 3792  C C6    . DT  A 1 184 ? 94.564  -58.177 218.699 1.00 639.12 ?  -129 DT  J C6    1 
ATOM 3793  P P     . DG  A 1 185 ? 98.324  -58.732 223.386 1.00 628.27 ?  -128 DG  J P     1 
ATOM 3794  O OP1   . DG  A 1 185 ? 98.897  -59.944 224.012 1.00 628.47 ?  -128 DG  J OP1   1 
ATOM 3795  O OP2   . DG  A 1 185 ? 96.885  -58.442 223.574 1.00 627.72 -1 -128 DG  J OP2   1 
ATOM 3796  O "O5'" . DG  A 1 185 ? 99.147  -57.444 223.868 1.00 628.50 ?  -128 DG  J "O5'" 1 
ATOM 3797  C "C5'" . DG  A 1 185 ? 99.399  -56.343 222.985 1.00 629.07 ?  -128 DG  J "C5'" 1 
ATOM 3798  C "C4'" . DG  A 1 185 ? 98.361  -55.231 223.113 1.00 629.51 ?  -128 DG  J "C4'" 1 
ATOM 3799  O "O4'" . DG  A 1 185 ? 97.215  -55.453 222.243 1.00 629.95 ?  -128 DG  J "O4'" 1 
ATOM 3800  C "C3'" . DG  A 1 185 ? 97.776  -54.992 224.502 1.00 629.39 ?  -128 DG  J "C3'" 1 
ATOM 3801  O "O3'" . DG  A 1 185 ? 97.889  -53.609 224.793 1.00 629.09 ?  -128 DG  J "O3'" 1 
ATOM 3802  C "C2'" . DG  A 1 185 ? 96.312  -55.401 224.360 1.00 629.64 ?  -128 DG  J "C2'" 1 
ATOM 3803  C "C1'" . DG  A 1 185 ? 96.080  -54.950 222.922 1.00 629.93 ?  -128 DG  J "C1'" 1 
ATOM 3804  N N9    . DG  A 1 185 ? 94.861  -55.411 222.250 1.00 630.02 ?  -128 DG  J N9    1 
ATOM 3805  C C8    . DG  A 1 185 ? 94.417  -56.707 222.113 1.00 629.92 ?  -128 DG  J C8    1 
ATOM 3806  N N7    . DG  A 1 185 ? 93.301  -56.811 221.448 1.00 629.91 ?  -128 DG  J N7    1 
ATOM 3807  C C5    . DG  A 1 185 ? 92.980  -55.501 221.116 1.00 630.05 ?  -128 DG  J C5    1 
ATOM 3808  C C6    . DG  A 1 185 ? 91.874  -54.988 220.391 1.00 629.90 ?  -128 DG  J C6    1 
ATOM 3809  O O6    . DG  A 1 185 ? 90.937  -55.620 219.886 1.00 629.86 ?  -128 DG  J O6    1 
ATOM 3810  N N1    . DG  A 1 185 ? 91.914  -53.598 220.271 1.00 629.82 ?  -128 DG  J N1    1 
ATOM 3811  C C2    . DG  A 1 185 ? 92.912  -52.803 220.787 1.00 629.85 ?  -128 DG  J C2    1 
ATOM 3812  N N2    . DG  A 1 185 ? 92.787  -51.486 220.577 1.00 629.86 ?  -128 DG  J N2    1 
ATOM 3813  N N3    . DG  A 1 185 ? 93.956  -53.268 221.469 1.00 629.91 ?  -128 DG  J N3    1 
ATOM 3814  C C4    . DG  A 1 185 ? 93.930  -54.624 221.598 1.00 630.09 ?  -128 DG  J C4    1 
ATOM 3815  P P     . DC  A 1 186 ? 98.287  -53.154 226.269 1.00 629.60 ?  -127 DC  J P     1 
ATOM 3816  O OP1   . DC  A 1 186 ? 99.760  -53.300 226.370 1.00 629.10 ?  -127 DC  J OP1   1 
ATOM 3817  O OP2   . DC  A 1 186 ? 97.388  -53.880 227.204 1.00 629.34 -1 -127 DC  J OP2   1 
ATOM 3818  O "O5'" . DC  A 1 186 ? 97.909  -51.594 226.350 1.00 628.93 ?  -127 DC  J "O5'" 1 
ATOM 3819  C "C5'" . DC  A 1 186 ? 98.008  -50.705 225.236 1.00 627.98 ?  -127 DC  J "C5'" 1 
ATOM 3820  C "C4'" . DC  A 1 186 ? 96.662  -50.065 224.923 1.00 627.38 ?  -127 DC  J "C4'" 1 
ATOM 3821  O "O4'" . DC  A 1 186 ? 95.768  -51.054 224.339 1.00 627.54 ?  -127 DC  J "O4'" 1 
ATOM 3822  C "C3'" . DC  A 1 186 ? 95.906  -49.451 226.110 1.00 626.65 ?  -127 DC  J "C3'" 1 
ATOM 3823  O "O3'" . DC  A 1 186 ? 95.450  -48.122 225.799 1.00 625.31 ?  -127 DC  J "O3'" 1 
ATOM 3824  C "C2'" . DC  A 1 186 ? 94.728  -50.404 226.294 1.00 626.97 ?  -127 DC  J "C2'" 1 
ATOM 3825  C "C1'" . DC  A 1 186 ? 94.476  -50.788 224.839 1.00 627.49 ?  -127 DC  J "C1'" 1 
ATOM 3826  N N1    . DC  A 1 186 ? 93.542  -51.950 224.617 1.00 627.72 ?  -127 DC  J N1    1 
ATOM 3827  C C2    . DC  A 1 186 ? 92.378  -51.761 223.850 1.00 627.75 ?  -127 DC  J C2    1 
ATOM 3828  O O2    . DC  A 1 186 ? 92.137  -50.650 223.365 1.00 627.84 ?  -127 DC  J O2    1 
ATOM 3829  N N3    . DC  A 1 186 ? 91.531  -52.804 223.660 1.00 627.65 ?  -127 DC  J N3    1 
ATOM 3830  C C4    . DC  A 1 186 ? 91.809  -53.994 224.192 1.00 627.55 ?  -127 DC  J C4    1 
ATOM 3831  N N4    . DC  A 1 186 ? 90.945  -54.985 223.966 1.00 627.58 ?  -127 DC  J N4    1 
ATOM 3832  C C5    . DC  A 1 186 ? 92.983  -54.215 224.973 1.00 627.69 ?  -127 DC  J C5    1 
ATOM 3833  C C6    . DC  A 1 186 ? 93.808  -53.177 225.162 1.00 627.73 ?  -127 DC  J C6    1 
ATOM 3834  P P     . DC  A 1 187 ? 95.087  -47.040 226.933 1.00 633.61 ?  -126 DC  J P     1 
ATOM 3835  O OP1   . DC  A 1 187 ? 95.938  -45.854 226.684 1.00 633.64 ?  -126 DC  J OP1   1 
ATOM 3836  O OP2   . DC  A 1 187 ? 95.103  -47.697 228.259 1.00 633.43 -1 -126 DC  J OP2   1 
ATOM 3837  O "O5'" . DC  A 1 187 ? 93.554  -46.666 226.641 1.00 632.46 ?  -126 DC  J "O5'" 1 
ATOM 3838  C "C5'" . DC  A 1 187 ? 93.161  -45.645 225.716 1.00 629.77 ?  -126 DC  J "C5'" 1 
ATOM 3839  C "C4'" . DC  A 1 187 ? 91.653  -45.674 225.523 1.00 627.66 ?  -126 DC  J "C4'" 1 
ATOM 3840  O "O4'" . DC  A 1 187 ? 91.207  -47.035 225.276 1.00 627.36 ?  -126 DC  J "O4'" 1 
ATOM 3841  C "C3'" . DC  A 1 187 ? 90.829  -45.198 226.715 1.00 626.59 ?  -126 DC  J "C3'" 1 
ATOM 3842  O "O3'" . DC  A 1 187 ? 89.684  -44.508 226.226 1.00 624.87 ?  -126 DC  J "O3'" 1 
ATOM 3843  C "C2'" . DC  A 1 187 ? 90.435  -46.499 227.412 1.00 626.68 ?  -126 DC  J "C2'" 1 
ATOM 3844  C "C1'" . DC  A 1 187 ? 90.166  -47.358 226.185 1.00 626.80 ?  -126 DC  J "C1'" 1 
ATOM 3845  N N1    . DC  A 1 187 ? 90.115  -48.844 226.415 1.00 626.73 ?  -126 DC  J N1    1 
ATOM 3846  C C2    . DC  A 1 187 ? 88.884  -49.472 226.679 1.00 626.72 ?  -126 DC  J C2    1 
ATOM 3847  O O2    . DC  A 1 187 ? 87.848  -48.797 226.741 1.00 626.36 ?  -126 DC  J O2    1 
ATOM 3848  N N3    . DC  A 1 187 ? 88.864  -50.821 226.868 1.00 626.82 ?  -126 DC  J N3    1 
ATOM 3849  C C4    . DC  A 1 187 ? 89.994  -51.533 226.797 1.00 626.67 ?  -126 DC  J C4    1 
ATOM 3850  N N4    . DC  A 1 187 ? 89.934  -52.856 226.991 1.00 626.57 ?  -126 DC  J N4    1 
ATOM 3851  C C5    . DC  A 1 187 ? 91.248  -50.914 226.533 1.00 626.28 ?  -126 DC  J C5    1 
ATOM 3852  C C6    . DC  A 1 187 ? 91.262  -49.588 226.343 1.00 626.43 ?  -126 DC  J C6    1 
ATOM 3853  P P     . DT  A 1 188 ? 89.630  -42.910 226.232 1.00 625.13 ?  -125 DT  J P     1 
ATOM 3854  O OP1   . DT  A 1 188 ? 90.963  -42.397 225.838 1.00 625.07 ?  -125 DT  J OP1   1 
ATOM 3855  O OP2   . DT  A 1 188 ? 88.982  -42.528 227.510 1.00 624.30 -1 -125 DT  J OP2   1 
ATOM 3856  O "O5'" . DT  A 1 188 ? 88.631  -42.502 225.055 1.00 624.36 ?  -125 DT  J "O5'" 1 
ATOM 3857  C "C5'" . DT  A 1 188 ? 88.417  -43.337 223.926 1.00 622.91 ?  -125 DT  J "C5'" 1 
ATOM 3858  C "C4'" . DT  A 1 188 ? 87.043  -43.979 224.008 1.00 621.65 ?  -125 DT  J "C4'" 1 
ATOM 3859  O "O4'" . DT  A 1 188 ? 87.071  -45.111 224.917 1.00 621.96 ?  -125 DT  J "O4'" 1 
ATOM 3860  C "C3'" . DT  A 1 188 ? 85.920  -43.069 224.507 1.00 620.38 ?  -125 DT  J "C3'" 1 
ATOM 3861  O "O3'" . DT  A 1 188 ? 84.822  -43.247 223.649 1.00 618.19 ?  -125 DT  J "O3'" 1 
ATOM 3862  C "C2'" . DT  A 1 188 ? 85.592  -43.608 225.896 1.00 620.99 ?  -125 DT  J "C2'" 1 
ATOM 3863  C "C1'" . DT  A 1 188 ? 85.861  -45.085 225.649 1.00 622.39 ?  -125 DT  J "C1'" 1 
ATOM 3864  N N1    . DT  A 1 188 ? 85.989  -45.911 226.885 1.00 622.90 ?  -125 DT  J N1    1 
ATOM 3865  C C2    . DT  A 1 188 ? 85.166  -47.013 227.045 1.00 622.85 ?  -125 DT  J C2    1 
ATOM 3866  O O2    . DT  A 1 188 ? 84.332  -47.367 226.234 1.00 622.88 ?  -125 DT  J O2    1 
ATOM 3867  N N3    . DT  A 1 188 ? 85.361  -47.706 228.210 1.00 622.76 ?  -125 DT  J N3    1 
ATOM 3868  C C4    . DT  A 1 188 ? 86.274  -47.410 229.209 1.00 622.92 ?  -125 DT  J C4    1 
ATOM 3869  O O4    . DT  A 1 188 ? 86.357  -48.107 230.211 1.00 622.75 ?  -125 DT  J O4    1 
ATOM 3870  C C5    . DT  A 1 188 ? 87.109  -46.246 228.982 1.00 623.22 ?  -125 DT  J C5    1 
ATOM 3871  C C7    . DT  A 1 188 ? 88.141  -45.810 229.985 1.00 623.04 ?  -125 DT  J C7    1 
ATOM 3872  C C6    . DT  A 1 188 ? 86.928  -45.561 227.843 1.00 623.33 ?  -125 DT  J C6    1 
ATOM 3873  P P     . DG  A 1 189 ? 83.734  -42.107 223.421 1.00 617.81 ?  -124 DG  J P     1 
ATOM 3874  O OP1   . DG  A 1 189 ? 84.241  -41.279 222.308 1.00 618.06 ?  -124 DG  J OP1   1 
ATOM 3875  O OP2   . DG  A 1 189 ? 83.351  -41.506 224.720 1.00 616.94 -1 -124 DG  J OP2   1 
ATOM 3876  O "O5'" . DG  A 1 189 ? 82.476  -42.931 222.885 1.00 618.03 ?  -124 DG  J "O5'" 1 
ATOM 3877  C "C5'" . DG  A 1 189 ? 82.649  -44.172 222.193 1.00 617.95 ?  -124 DG  J "C5'" 1 
ATOM 3878  C "C4'" . DG  A 1 189 ? 81.613  -45.199 222.626 1.00 617.51 ?  -124 DG  J "C4'" 1 
ATOM 3879  O "O4'" . DG  A 1 189 ? 81.925  -45.711 223.943 1.00 617.85 ?  -124 DG  J "O4'" 1 
ATOM 3880  C "C3'" . DG  A 1 189 ? 80.186  -44.685 222.747 1.00 617.22 ?  -124 DG  J "C3'" 1 
ATOM 3881  O "O3'" . DG  A 1 189 ? 79.337  -45.770 222.494 1.00 616.18 ?  -124 DG  J "O3'" 1 
ATOM 3882  C "C2'" . DG  A 1 189 ? 80.098  -44.278 224.213 1.00 617.92 ?  -124 DG  J "C2'" 1 
ATOM 3883  C "C1'" . DG  A 1 189 ? 80.839  -45.461 224.817 1.00 619.08 ?  -124 DG  J "C1'" 1 
ATOM 3884  N N9    . DG  A 1 189 ? 81.419  -45.235 226.128 1.00 619.40 ?  -124 DG  J N9    1 
ATOM 3885  C C8    . DG  A 1 189 ? 81.838  -44.046 226.676 1.00 619.85 ?  -124 DG  J C8    1 
ATOM 3886  N N7    . DG  A 1 189 ? 82.339  -44.173 227.871 1.00 620.10 ?  -124 DG  J N7    1 
ATOM 3887  C C5    . DG  A 1 189 ? 82.254  -45.535 228.126 1.00 619.98 ?  -124 DG  J C5    1 
ATOM 3888  C C6    . DG  A 1 189 ? 82.644  -46.278 229.267 1.00 619.70 ?  -124 DG  J C6    1 
ATOM 3889  O O6    . DG  A 1 189 ? 83.156  -45.855 230.310 1.00 619.75 ?  -124 DG  J O6    1 
ATOM 3890  N N1    . DG  A 1 189 ? 82.381  -47.639 229.123 1.00 619.68 ?  -124 DG  J N1    1 
ATOM 3891  C C2    . DG  A 1 189 ? 81.818  -48.214 228.007 1.00 619.89 ?  -124 DG  J C2    1 
ATOM 3892  N N2    . DG  A 1 189 ? 81.639  -49.544 228.047 1.00 619.91 ?  -124 DG  J N2    1 
ATOM 3893  N N3    . DG  A 1 189 ? 81.443  -47.530 226.930 1.00 620.00 ?  -124 DG  J N3    1 
ATOM 3894  C C4    . DG  A 1 189 ? 81.690  -46.202 227.060 1.00 619.85 ?  -124 DG  J C4    1 
ATOM 3895  P P     . DG  A 1 190 ? 77.799  -45.536 222.153 1.00 614.06 ?  -123 DG  J P     1 
ATOM 3896  O OP1   . DG  A 1 190 ? 77.693  -45.668 220.685 1.00 614.31 ?  -123 DG  J OP1   1 
ATOM 3897  O OP2   . DG  A 1 190 ? 77.280  -44.352 222.876 1.00 613.22 -1 -123 DG  J OP2   1 
ATOM 3898  O "O5'" . DG  A 1 190 ? 77.106  -46.812 222.807 1.00 615.19 ?  -123 DG  J "O5'" 1 
ATOM 3899  C "C5'" . DG  A 1 190 ? 77.622  -48.116 222.543 1.00 616.21 ?  -123 DG  J "C5'" 1 
ATOM 3900  C "C4'" . DG  A 1 190 ? 77.334  -49.049 223.704 1.00 616.62 ?  -123 DG  J "C4'" 1 
ATOM 3901  O "O4'" . DG  A 1 190 ? 78.120  -48.648 224.853 1.00 617.32 ?  -123 DG  J "O4'" 1 
ATOM 3902  C "C3'" . DG  A 1 190 ? 75.870  -49.085 224.147 1.00 616.52 ?  -123 DG  J "C3'" 1 
ATOM 3903  O "O3'" . DG  A 1 190 ? 75.441  -50.451 224.139 1.00 615.64 ?  -123 DG  J "O3'" 1 
ATOM 3904  C "C2'" . DG  A 1 190 ? 75.866  -48.404 225.519 1.00 616.87 ?  -123 DG  J "C2'" 1 
ATOM 3905  C "C1'" . DG  A 1 190 ? 77.295  -48.622 225.998 1.00 618.36 ?  -123 DG  J "C1'" 1 
ATOM 3906  N N9    . DG  A 1 190 ? 77.824  -47.589 226.885 1.00 618.85 ?  -123 DG  J N9    1 
ATOM 3907  C C8    . DG  A 1 190 ? 77.820  -46.223 226.711 1.00 619.16 ?  -123 DG  J C8    1 
ATOM 3908  N N7    . DG  A 1 190 ? 78.387  -45.570 227.689 1.00 619.18 ?  -123 DG  J N7    1 
ATOM 3909  C C5    . DG  A 1 190 ? 78.791  -46.566 228.571 1.00 619.14 ?  -123 DG  J C5    1 
ATOM 3910  C C6    . DG  A 1 190 ? 79.460  -46.481 229.817 1.00 618.86 ?  -123 DG  J C6    1 
ATOM 3911  O O6    . DG  A 1 190 ? 79.847  -45.474 230.421 1.00 619.10 ?  -123 DG  J O6    1 
ATOM 3912  N N1    . DG  A 1 190 ? 79.683  -47.735 230.381 1.00 618.93 ?  -123 DG  J N1    1 
ATOM 3913  C C2    . DG  A 1 190 ? 79.303  -48.926 229.809 1.00 619.09 ?  -123 DG  J C2    1 
ATOM 3914  N N2    . DG  A 1 190 ? 79.596  -50.044 230.488 1.00 619.28 ?  -123 DG  J N2    1 
ATOM 3915  N N3    . DG  A 1 190 ? 78.678  -49.023 228.645 1.00 619.18 ?  -123 DG  J N3    1 
ATOM 3916  C C4    . DG  A 1 190 ? 78.454  -47.809 228.085 1.00 619.10 ?  -123 DG  J C4    1 
ATOM 3917  P P     . DA  A 1 191 ? 73.968  -50.942 224.543 1.00 627.78 ?  -122 DA  J P     1 
ATOM 3918  O OP1   . DA  A 1 191 ? 73.550  -52.048 223.652 1.00 626.94 ?  -122 DA  J OP1   1 
ATOM 3919  O OP2   . DA  A 1 191 ? 73.050  -49.798 224.754 1.00 627.05 -1 -122 DA  J OP2   1 
ATOM 3920  O "O5'" . DA  A 1 191 ? 74.354  -51.541 225.969 1.00 630.31 ?  -122 DA  J "O5'" 1 
ATOM 3921  C "C5'" . DA  A 1 191 ? 75.524  -52.367 226.147 1.00 632.46 ?  -122 DA  J "C5'" 1 
ATOM 3922  C "C4'" . DA  A 1 191 ? 75.563  -52.934 227.558 1.00 633.75 ?  -122 DA  J "C4'" 1 
ATOM 3923  O "O4'" . DA  A 1 191 ? 76.210  -51.977 228.432 1.00 633.56 ?  -122 DA  J "O4'" 1 
ATOM 3924  C "C3'" . DA  A 1 191 ? 74.185  -53.209 228.155 1.00 635.13 ?  -122 DA  J "C3'" 1 
ATOM 3925  O "O3'" . DA  A 1 191 ? 74.171  -54.434 228.901 1.00 637.48 ?  -122 DA  J "O3'" 1 
ATOM 3926  C "C2'" . DA  A 1 191 ? 73.922  -51.976 229.014 1.00 634.88 ?  -122 DA  J "C2'" 1 
ATOM 3927  C "C1'" . DA  A 1 191 ? 75.324  -51.582 229.458 1.00 634.96 ?  -122 DA  J "C1'" 1 
ATOM 3928  N N9    . DA  A 1 191 ? 75.489  -50.150 229.701 1.00 635.18 ?  -122 DA  J N9    1 
ATOM 3929  C C8    . DA  A 1 191 ? 74.963  -49.115 228.975 1.00 635.44 ?  -122 DA  J C8    1 
ATOM 3930  N N7    . DA  A 1 191 ? 75.281  -47.923 229.424 1.00 635.30 ?  -122 DA  J N7    1 
ATOM 3931  C C5    . DA  A 1 191 ? 76.076  -48.196 230.521 1.00 635.26 ?  -122 DA  J C5    1 
ATOM 3932  C C6    . DA  A 1 191 ? 76.734  -47.357 231.441 1.00 635.33 ?  -122 DA  J C6    1 
ATOM 3933  N N6    . DA  A 1 191 ? 76.684  -46.022 231.374 1.00 635.28 ?  -122 DA  J N6    1 
ATOM 3934  N N1    . DA  A 1 191 ? 77.451  -47.943 232.432 1.00 635.64 ?  -122 DA  J N1    1 
ATOM 3935  C C2    . DA  A 1 191 ? 77.499  -49.286 232.503 1.00 635.50 ?  -122 DA  J C2    1 
ATOM 3936  N N3    . DA  A 1 191 ? 76.922  -50.175 231.688 1.00 635.36 ?  -122 DA  J N3    1 
ATOM 3937  C C4    . DA  A 1 191 ? 76.216  -49.563 230.714 1.00 635.33 ?  -122 DA  J C4    1 
ATOM 3938  P P     . DG  A 1 192 ? 72.817  -55.041 229.524 1.00 633.97 ?  -121 DG  J P     1 
ATOM 3939  O OP1   . DG  A 1 192 ? 72.942  -56.514 229.516 1.00 634.02 ?  -121 DG  J OP1   1 
ATOM 3940  O OP2   . DG  A 1 192 ? 71.625  -54.408 228.910 1.00 633.60 -1 -121 DG  J OP2   1 
ATOM 3941  O "O5'" . DG  A 1 192 ? 72.912  -54.525 231.031 1.00 635.29 ?  -121 DG  J "O5'" 1 
ATOM 3942  C "C5'" . DG  A 1 192 ? 74.076  -54.802 231.818 1.00 637.31 ?  -121 DG  J "C5'" 1 
ATOM 3943  C "C4'" . DG  A 1 192 ? 73.927  -54.236 233.220 1.00 638.63 ?  -121 DG  J "C4'" 1 
ATOM 3944  O "O4'" . DG  A 1 192 ? 74.356  -52.851 233.227 1.00 638.73 ?  -121 DG  J "O4'" 1 
ATOM 3945  C "C3'" . DG  A 1 192 ? 72.505  -54.271 233.783 1.00 639.42 ?  -121 DG  J "C3'" 1 
ATOM 3946  O "O3'" . DG  A 1 192 ? 72.512  -54.744 235.124 1.00 640.63 ?  -121 DG  J "O3'" 1 
ATOM 3947  C "C2'" . DG  A 1 192 ? 72.038  -52.822 233.708 1.00 639.44 ?  -121 DG  J "C2'" 1 
ATOM 3948  C "C1'" . DG  A 1 192 ? 73.346  -52.040 233.788 1.00 639.51 ?  -121 DG  J "C1'" 1 
ATOM 3949  N N9    . DG  A 1 192 ? 73.301  -50.784 233.049 1.00 639.67 ?  -121 DG  J N9    1 
ATOM 3950  C C8    . DG  A 1 192 ? 72.907  -50.597 231.744 1.00 639.68 ?  -121 DG  J C8    1 
ATOM 3951  N N7    . DG  A 1 192 ? 72.966  -49.360 231.347 1.00 639.71 ?  -121 DG  J N7    1 
ATOM 3952  C C5    . DG  A 1 192 ? 73.423  -48.679 232.470 1.00 639.85 ?  -121 DG  J C5    1 
ATOM 3953  C C6    . DG  A 1 192 ? 73.685  -47.297 232.654 1.00 639.63 ?  -121 DG  J C6    1 
ATOM 3954  O O6    . DG  A 1 192 ? 73.561  -46.384 231.831 1.00 639.57 ?  -121 DG  J O6    1 
ATOM 3955  N N1    . DG  A 1 192 ? 74.134  -47.017 233.943 1.00 639.75 ?  -121 DG  J N1    1 
ATOM 3956  C C2    . DG  A 1 192 ? 74.310  -47.960 234.931 1.00 639.74 ?  -121 DG  J C2    1 
ATOM 3957  N N2    . DG  A 1 192 ? 74.748  -47.507 236.110 1.00 639.81 ?  -121 DG  J N2    1 
ATOM 3958  N N3    . DG  A 1 192 ? 74.072  -49.258 234.777 1.00 639.49 ?  -121 DG  J N3    1 
ATOM 3959  C C4    . DG  A 1 192 ? 73.633  -49.542 233.526 1.00 639.70 ?  -121 DG  J C4    1 
ATOM 3960  P P     . DA  A 1 193 ? 71.217  -55.422 235.786 1.00 641.35 ?  -120 DA  J P     1 
ATOM 3961  O OP1   . DA  A 1 193 ? 71.627  -56.815 236.123 1.00 641.69 ?  -120 DA  J OP1   1 
ATOM 3962  O OP2   . DA  A 1 193 ? 70.021  -55.182 234.932 1.00 641.11 -1 -120 DA  J OP2   1 
ATOM 3963  O "O5'" . DA  A 1 193 ? 70.976  -54.578 237.138 1.00 641.91 ?  -120 DA  J "O5'" 1 
ATOM 3964  C "C5'" . DA  A 1 193 ? 72.000  -53.710 237.677 1.00 642.83 ?  -120 DA  J "C5'" 1 
ATOM 3965  C "C4'" . DA  A 1 193 ? 71.404  -52.506 238.403 1.00 643.59 ?  -120 DA  J "C4'" 1 
ATOM 3966  O "O4'" . DA  A 1 193 ? 71.652  -51.304 237.628 1.00 643.84 ?  -120 DA  J "O4'" 1 
ATOM 3967  C "C3'" . DA  A 1 193 ? 69.896  -52.545 238.681 1.00 644.14 ?  -120 DA  J "C3'" 1 
ATOM 3968  O "O3'" . DA  A 1 193 ? 69.646  -52.198 240.061 1.00 644.74 ?  -120 DA  J "O3'" 1 
ATOM 3969  C "C2'" . DA  A 1 193 ? 69.324  -51.546 237.675 1.00 644.27 ?  -120 DA  J "C2'" 1 
ATOM 3970  C "C1'" . DA  A 1 193 ? 70.464  -50.540 237.546 1.00 644.72 ?  -120 DA  J "C1'" 1 
ATOM 3971  N N9    . DA  A 1 193 ? 70.455  -49.773 236.295 1.00 645.01 ?  -120 DA  J N9    1 
ATOM 3972  C C8    . DA  A 1 193 ? 70.158  -50.240 235.042 1.00 645.01 ?  -120 DA  J C8    1 
ATOM 3973  N N7    . DA  A 1 193 ? 70.227  -49.330 234.102 1.00 645.10 ?  -120 DA  J N7    1 
ATOM 3974  C C5    . DA  A 1 193 ? 70.596  -48.180 234.780 1.00 645.08 ?  -120 DA  J C5    1 
ATOM 3975  C C6    . DA  A 1 193 ? 70.840  -46.854 234.353 1.00 645.01 ?  -120 DA  J C6    1 
ATOM 3976  N N6    . DA  A 1 193 ? 70.738  -46.466 233.077 1.00 644.98 ?  -120 DA  J N6    1 
ATOM 3977  N N1    . DA  A 1 193 ? 71.192  -45.935 235.282 1.00 645.14 ?  -120 DA  J N1    1 
ATOM 3978  C C2    . DA  A 1 193 ? 71.294  -46.319 236.562 1.00 645.10 ?  -120 DA  J C2    1 
ATOM 3979  N N3    . DA  A 1 193 ? 71.089  -47.535 237.078 1.00 645.38 ?  -120 DA  J N3    1 
ATOM 3980  C C4    . DA  A 1 193 ? 70.742  -48.431 236.133 1.00 645.15 ?  -120 DA  J C4    1 
ATOM 3981  P P     . DC  A 1 194 ? 68.205  -51.799 240.659 1.00 656.89 ?  -119 DC  J P     1 
ATOM 3982  O OP1   . DC  A 1 194 ? 68.194  -52.171 242.093 1.00 656.93 ?  -119 DC  J OP1   1 
ATOM 3983  O OP2   . DC  A 1 194 ? 67.132  -52.304 239.765 1.00 656.96 -1 -119 DC  J OP2   1 
ATOM 3984  O "O5'" . DC  A 1 194 ? 68.234  -50.204 240.568 1.00 656.59 ?  -119 DC  J "O5'" 1 
ATOM 3985  C "C5'" . DC  A 1 194 ? 69.019  -49.429 241.478 1.00 656.22 ?  -119 DC  J "C5'" 1 
ATOM 3986  C "C4'" . DC  A 1 194 ? 68.503  -48.008 241.479 1.00 656.14 ?  -119 DC  J "C4'" 1 
ATOM 3987  O "O4'" . DC  A 1 194 ? 68.759  -47.441 240.170 1.00 656.13 ?  -119 DC  J "O4'" 1 
ATOM 3988  C "C3'" . DC  A 1 194 ? 66.996  -47.931 241.716 1.00 656.27 ?  -119 DC  J "C3'" 1 
ATOM 3989  O "O3'" . DC  A 1 194 ? 66.695  -47.090 242.828 1.00 656.35 ?  -119 DC  J "O3'" 1 
ATOM 3990  C "C2'" . DC  A 1 194 ? 66.422  -47.399 240.405 1.00 656.21 ?  -119 DC  J "C2'" 1 
ATOM 3991  C "C1'" . DC  A 1 194 ? 67.613  -46.746 239.716 1.00 656.27 ?  -119 DC  J "C1'" 1 
ATOM 3992  N N1    . DC  A 1 194 ? 67.496  -46.803 238.213 1.00 656.26 ?  -119 DC  J N1    1 
ATOM 3993  C C2    . DC  A 1 194 ? 67.457  -45.620 237.444 1.00 656.02 ?  -119 DC  J C2    1 
ATOM 3994  O O2    . DC  A 1 194 ? 67.527  -44.508 237.991 1.00 655.57 ?  -119 DC  J O2    1 
ATOM 3995  N N3    . DC  A 1 194 ? 67.339  -45.734 236.090 1.00 656.05 ?  -119 DC  J N3    1 
ATOM 3996  C C4    . DC  A 1 194 ? 67.258  -46.943 235.512 1.00 656.13 ?  -119 DC  J C4    1 
ATOM 3997  N N4    . DC  A 1 194 ? 67.145  -47.008 234.184 1.00 655.96 ?  -119 DC  J N4    1 
ATOM 3998  C C5    . DC  A 1 194 ? 67.291  -48.151 236.271 1.00 656.10 ?  -119 DC  J C5    1 
ATOM 3999  C C6    . DC  A 1 194 ? 67.409  -48.030 237.600 1.00 656.42 ?  -119 DC  J C6    1 
ATOM 4000  P P     . DT  A 1 195 ? 65.191  -46.602 243.129 1.00 658.21 ?  -118 DT  J P     1 
ATOM 4001  O OP1   . DT  A 1 195 ? 65.061  -46.421 244.595 1.00 658.14 ?  -118 DT  J OP1   1 
ATOM 4002  O OP2   . DT  A 1 195 ? 64.222  -47.456 242.398 1.00 657.63 -1 -118 DT  J OP2   1 
ATOM 4003  O "O5'" . DT  A 1 195 ? 65.178  -45.163 242.433 1.00 657.96 ?  -118 DT  J "O5'" 1 
ATOM 4004  C "C5'" . DT  A 1 195 ? 66.215  -44.208 242.684 1.00 657.36 ?  -118 DT  J "C5'" 1 
ATOM 4005  C "C4'" . DT  A 1 195 ? 65.827  -42.850 242.121 1.00 656.82 ?  -118 DT  J "C4'" 1 
ATOM 4006  O "O4'" . DT  A 1 195 ? 65.902  -42.866 240.669 1.00 656.42 ?  -118 DT  J "O4'" 1 
ATOM 4007  C "C3'" . DT  A 1 195 ? 64.410  -42.399 242.452 1.00 656.58 ?  -118 DT  J "C3'" 1 
ATOM 4008  O "O3'" . DT  A 1 195 ? 64.414  -40.987 242.589 1.00 656.54 ?  -118 DT  J "O3'" 1 
ATOM 4009  C "C2'" . DT  A 1 195 ? 63.616  -42.862 241.229 1.00 656.31 ?  -118 DT  J "C2'" 1 
ATOM 4010  C "C1'" . DT  A 1 195 ? 64.627  -42.569 240.124 1.00 656.24 ?  -118 DT  J "C1'" 1 
ATOM 4011  N N1    . DT  A 1 195 ? 64.490  -43.344 238.852 1.00 656.24 ?  -118 DT  J N1    1 
ATOM 4012  C C2    . DT  A 1 195 ? 64.646  -42.678 237.650 1.00 656.22 ?  -118 DT  J C2    1 
ATOM 4013  O O2    . DT  A 1 195 ? 64.871  -41.481 237.563 1.00 656.21 ?  -118 DT  J O2    1 
ATOM 4014  N N3    . DT  A 1 195 ? 64.515  -43.474 236.536 1.00 656.05 ?  -118 DT  J N3    1 
ATOM 4015  C C4    . DT  A 1 195 ? 64.259  -44.835 236.504 1.00 656.02 ?  -118 DT  J C4    1 
ATOM 4016  O O4    . DT  A 1 195 ? 64.163  -45.457 235.455 1.00 656.03 ?  -118 DT  J O4    1 
ATOM 4017  C C5    . DT  A 1 195 ? 64.113  -45.473 237.789 1.00 656.17 ?  -118 DT  J C5    1 
ATOM 4018  C C7    . DT  A 1 195 ? 63.834  -46.945 237.874 1.00 656.14 ?  -118 DT  J C7    1 
ATOM 4019  C C6    . DT  A 1 195 ? 64.238  -44.708 238.888 1.00 656.44 ?  -118 DT  J C6    1 
ATOM 4020  P P     . DA  A 1 196 ? 63.217  -40.234 243.336 1.00 665.35 ?  -117 DA  J P     1 
ATOM 4021  O OP1   . DA  A 1 196 ? 63.380  -40.539 244.777 1.00 665.33 ?  -117 DA  J OP1   1 
ATOM 4022  O OP2   . DA  A 1 196 ? 61.934  -40.556 242.654 1.00 665.18 -1 -117 DA  J OP2   1 
ATOM 4023  O "O5'" . DA  A 1 196 ? 63.541  -38.680 243.092 1.00 664.10 ?  -117 DA  J "O5'" 1 
ATOM 4024  C "C5'" . DA  A 1 196 ? 64.132  -38.204 241.873 1.00 662.40 ?  -117 DA  J "C5'" 1 
ATOM 4025  C "C4'" . DA  A 1 196 ? 63.119  -37.792 240.809 1.00 660.98 ?  -117 DA  J "C4'" 1 
ATOM 4026  O "O4'" . DA  A 1 196 ? 63.021  -38.843 239.822 1.00 660.67 ?  -117 DA  J "O4'" 1 
ATOM 4027  C "C3'" . DA  A 1 196 ? 61.693  -37.505 241.288 1.00 660.03 ?  -117 DA  J "C3'" 1 
ATOM 4028  O "O3'" . DA  A 1 196 ? 61.443  -36.080 241.192 1.00 658.41 ?  -117 DA  J "O3'" 1 
ATOM 4029  C "C2'" . DA  A 1 196 ? 60.791  -38.433 240.463 1.00 660.35 ?  -117 DA  J "C2'" 1 
ATOM 4030  C "C1'" . DA  A 1 196 ? 61.700  -38.910 239.332 1.00 660.86 ?  -117 DA  J "C1'" 1 
ATOM 4031  N N9    . DA  A 1 196 ? 61.498  -40.287 238.886 1.00 660.96 ?  -117 DA  J N9    1 
ATOM 4032  C C8    . DA  A 1 196 ? 61.162  -41.366 239.656 1.00 661.12 ?  -117 DA  J C8    1 
ATOM 4033  N N7    . DA  A 1 196 ? 61.063  -42.490 238.985 1.00 661.21 ?  -117 DA  J N7    1 
ATOM 4034  C C5    . DA  A 1 196 ? 61.360  -42.125 237.683 1.00 661.10 ?  -117 DA  J C5    1 
ATOM 4035  C C6    . DA  A 1 196 ? 61.425  -42.859 236.475 1.00 660.94 ?  -117 DA  J C6    1 
ATOM 4036  N N6    . DA  A 1 196 ? 61.186  -44.170 236.411 1.00 660.94 ?  -117 DA  J N6    1 
ATOM 4037  N N1    . DA  A 1 196 ? 61.746  -42.199 235.338 1.00 660.93 ?  -117 DA  J N1    1 
ATOM 4038  C C2    . DA  A 1 196 ? 61.990  -40.883 235.410 1.00 661.02 ?  -117 DA  J C2    1 
ATOM 4039  N N3    . DA  A 1 196 ? 61.954  -40.090 236.485 1.00 661.16 ?  -117 DA  J N3    1 
ATOM 4040  C C4    . DA  A 1 196 ? 61.634  -40.771 237.602 1.00 661.08 ?  -117 DA  J C4    1 
ATOM 4041  P P     . DG  A 1 197 ? 60.482  -35.312 240.158 1.00 667.35 ?  -116 DG  J P     1 
ATOM 4042  O OP1   . DG  A 1 197 ? 60.666  -33.866 240.414 1.00 667.22 ?  -116 DG  J OP1   1 
ATOM 4043  O OP2   . DG  A 1 197 ? 59.115  -35.885 240.244 1.00 667.02 -1 -116 DG  J OP2   1 
ATOM 4044  O "O5'" . DG  A 1 197 ? 61.115  -35.626 238.719 1.00 666.73 ?  -116 DG  J "O5'" 1 
ATOM 4045  C "C5'" . DG  A 1 197 ? 61.314  -34.575 237.750 1.00 665.09 ?  -116 DG  J "C5'" 1 
ATOM 4046  C "C4'" . DG  A 1 197 ? 60.383  -34.712 236.549 1.00 663.50 ?  -116 DG  J "C4'" 1 
ATOM 4047  O "O4'" . DG  A 1 197 ? 60.179  -36.116 236.241 1.00 663.23 ?  -116 DG  J "O4'" 1 
ATOM 4048  C "C3'" . DG  A 1 197 ? 58.980  -34.124 236.702 1.00 662.34 ?  -116 DG  J "C3'" 1 
ATOM 4049  O "O3'" . DG  A 1 197 ? 58.518  -33.672 235.440 1.00 660.63 ?  -116 DG  J "O3'" 1 
ATOM 4050  C "C2'" . DG  A 1 197 ? 58.153  -35.326 237.138 1.00 662.75 ?  -116 DG  J "C2'" 1 
ATOM 4051  C "C1'" . DG  A 1 197 ? 58.792  -36.406 236.270 1.00 663.15 ?  -116 DG  J "C1'" 1 
ATOM 4052  N N9    . DG  A 1 197 ? 58.614  -37.781 236.733 1.00 663.31 ?  -116 DG  J N9    1 
ATOM 4053  C C8    . DG  A 1 197 ? 58.308  -38.224 237.999 1.00 663.34 ?  -116 DG  J C8    1 
ATOM 4054  N N7    . DG  A 1 197 ? 58.219  -39.521 238.095 1.00 663.31 ?  -116 DG  J N7    1 
ATOM 4055  C C5    . DG  A 1 197 ? 58.484  -39.967 236.806 1.00 663.42 ?  -116 DG  J C5    1 
ATOM 4056  C C6    . DG  A 1 197 ? 58.527  -41.280 236.280 1.00 663.31 ?  -116 DG  J C6    1 
ATOM 4057  O O6    . DG  A 1 197 ? 58.334  -42.339 236.885 1.00 663.43 ?  -116 DG  J O6    1 
ATOM 4058  N N1    . DG  A 1 197 ? 58.832  -41.305 234.918 1.00 663.21 ?  -116 DG  J N1    1 
ATOM 4059  C C2    . DG  A 1 197 ? 59.066  -40.188 234.150 1.00 663.16 ?  -116 DG  J C2    1 
ATOM 4060  N N2    . DG  A 1 197 ? 59.345  -40.392 232.856 1.00 663.17 ?  -116 DG  J N2    1 
ATOM 4061  N N3    . DG  A 1 197 ? 59.024  -38.952 234.627 1.00 663.47 ?  -116 DG  J N3    1 
ATOM 4062  C C4    . DG  A 1 197 ? 58.732  -38.912 235.956 1.00 663.54 ?  -116 DG  J C4    1 
ATOM 4063  P P     . DG  A 1 198 ? 58.514  -32.117 235.071 1.00 667.65 ?  -115 DG  J P     1 
ATOM 4064  O OP1   . DG  A 1 198 ? 59.912  -31.634 235.168 1.00 667.39 ?  -115 DG  J OP1   1 
ATOM 4065  O OP2   . DG  A 1 198 ? 57.432  -31.510 235.875 1.00 667.78 -1 -115 DG  J OP2   1 
ATOM 4066  O "O5'" . DG  A 1 198 ? 58.040  -32.043 233.534 1.00 665.88 ?  -115 DG  J "O5'" 1 
ATOM 4067  C "C5'" . DG  A 1 198 ? 58.639  -32.843 232.500 1.00 662.84 ?  -115 DG  J "C5'" 1 
ATOM 4068  C "C4'" . DG  A 1 198 ? 57.627  -33.667 231.701 1.00 660.64 ?  -115 DG  J "C4'" 1 
ATOM 4069  O "O4'" . DG  A 1 198 ? 57.435  -34.968 232.321 1.00 660.47 ?  -115 DG  J "O4'" 1 
ATOM 4070  C "C3'" . DG  A 1 198 ? 56.224  -33.079 231.498 1.00 658.76 ?  -115 DG  J "C3'" 1 
ATOM 4071  O "O3'" . DG  A 1 198 ? 55.726  -33.372 230.195 1.00 655.92 ?  -115 DG  J "O3'" 1 
ATOM 4072  C "C2'" . DG  A 1 198 ? 55.399  -33.854 232.520 1.00 659.74 ?  -115 DG  J "C2'" 1 
ATOM 4073  C "C1'" . DG  A 1 198 ? 56.049  -35.232 232.411 1.00 661.15 ?  -115 DG  J "C1'" 1 
ATOM 4074  N N9    . DG  A 1 198 ? 55.828  -36.137 233.538 1.00 661.71 ?  -115 DG  J N9    1 
ATOM 4075  C C8    . DG  A 1 198 ? 55.541  -35.801 234.844 1.00 661.98 ?  -115 DG  J C8    1 
ATOM 4076  N N7    . DG  A 1 198 ? 55.405  -36.829 235.639 1.00 661.99 ?  -115 DG  J N7    1 
ATOM 4077  C C5    . DG  A 1 198 ? 55.616  -37.923 234.809 1.00 662.03 ?  -115 DG  J C5    1 
ATOM 4078  C C6    . DG  A 1 198 ? 55.596  -39.312 235.102 1.00 661.89 ?  -115 DG  J C6    1 
ATOM 4079  O O6    . DG  A 1 198 ? 55.381  -39.865 236.189 1.00 661.90 ?  -115 DG  J O6    1 
ATOM 4080  N N1    . DG  A 1 198 ? 55.859  -40.094 233.977 1.00 661.94 ?  -115 DG  J N1    1 
ATOM 4081  C C2    . DG  A 1 198 ? 56.113  -39.597 232.719 1.00 661.86 ?  -115 DG  J C2    1 
ATOM 4082  N N2    . DG  A 1 198 ? 56.346  -40.511 231.761 1.00 661.82 ?  -115 DG  J N2    1 
ATOM 4083  N N3    . DG  A 1 198 ? 56.135  -38.296 232.427 1.00 661.93 ?  -115 DG  J N3    1 
ATOM 4084  C C4    . DG  A 1 198 ? 55.881  -37.517 233.513 1.00 661.98 ?  -115 DG  J C4    1 
ATOM 4085  P P     . DG  A 1 199 ? 56.090  -32.580 228.848 1.00 664.12 ?  -114 DG  J P     1 
ATOM 4086  O OP1   . DG  A 1 199 ? 57.453  -32.027 228.964 1.00 663.87 ?  -114 DG  J OP1   1 
ATOM 4087  O OP2   . DG  A 1 199 ? 54.923  -31.726 228.517 1.00 663.26 -1 -114 DG  J OP2   1 
ATOM 4088  O "O5'" . DG  A 1 199 ? 56.137  -33.727 227.727 1.00 664.07 ?  -114 DG  J "O5'" 1 
ATOM 4089  C "C5'" . DG  A 1 199 ? 56.881  -34.940 227.890 1.00 663.20 ?  -114 DG  J "C5'" 1 
ATOM 4090  C "C4'" . DG  A 1 199 ? 56.302  -36.102 227.082 1.00 662.30 ?  -114 DG  J "C4'" 1 
ATOM 4091  O "O4'" . DG  A 1 199 ? 55.682  -37.076 227.960 1.00 662.66 ?  -114 DG  J "O4'" 1 
ATOM 4092  C "C3'" . DG  A 1 199 ? 55.237  -35.814 226.030 1.00 661.36 ?  -114 DG  J "C3'" 1 
ATOM 4093  O "O3'" . DG  A 1 199 ? 55.393  -36.791 225.000 1.00 659.32 ?  -114 DG  J "O3'" 1 
ATOM 4094  C "C2'" . DG  A 1 199 ? 53.940  -35.976 226.829 1.00 662.05 ?  -114 DG  J "C2'" 1 
ATOM 4095  C "C1'" . DG  A 1 199 ? 54.275  -37.098 227.807 1.00 663.53 ?  -114 DG  J "C1'" 1 
ATOM 4096  N N9    . DG  A 1 199 ? 53.796  -36.952 229.174 1.00 663.80 ?  -114 DG  J N9    1 
ATOM 4097  C C8    . DG  A 1 199 ? 53.557  -35.775 229.829 1.00 664.48 ?  -114 DG  J C8    1 
ATOM 4098  N N7    . DG  A 1 199 ? 53.158  -35.931 231.062 1.00 665.02 ?  -114 DG  J N7    1 
ATOM 4099  C C5    . DG  A 1 199 ? 53.145  -37.303 231.252 1.00 664.64 ?  -114 DG  J C5    1 
ATOM 4100  C C6    . DG  A 1 199 ? 52.792  -38.061 232.402 1.00 664.33 ?  -114 DG  J C6    1 
ATOM 4101  O O6    . DG  A 1 199 ? 52.427  -37.651 233.511 1.00 664.28 ?  -114 DG  J O6    1 
ATOM 4102  N N1    . DG  A 1 199 ? 52.900  -39.432 232.184 1.00 664.28 ?  -114 DG  J N1    1 
ATOM 4103  C C2    . DG  A 1 199 ? 53.301  -39.998 230.994 1.00 664.49 ?  -114 DG  J C2    1 
ATOM 4104  N N2    . DG  A 1 199 ? 53.343  -41.340 230.977 1.00 664.37 ?  -114 DG  J N2    1 
ATOM 4105  N N3    . DG  A 1 199 ? 53.636  -39.295 229.907 1.00 664.79 ?  -114 DG  J N3    1 
ATOM 4106  C C4    . DG  A 1 199 ? 53.539  -37.951 230.096 1.00 664.45 ?  -114 DG  J C4    1 
ATOM 4107  P P     . DA  A 1 200 ? 54.643  -36.738 223.586 1.00 661.88 ?  -113 DA  J P     1 
ATOM 4108  O OP1   . DA  A 1 200 ? 55.704  -36.780 222.574 1.00 661.92 ?  -113 DA  J OP1   1 
ATOM 4109  O OP2   . DA  A 1 200 ? 53.625  -35.670 223.564 1.00 662.19 -1 -113 DA  J OP2   1 
ATOM 4110  O "O5'" . DA  A 1 200 ? 53.828  -38.108 223.500 1.00 663.07 ?  -113 DA  J "O5'" 1 
ATOM 4111  C "C5'" . DA  A 1 200 ? 54.166  -39.254 224.292 1.00 663.71 ?  -113 DA  J "C5'" 1 
ATOM 4112  C "C4'" . DA  A 1 200 ? 52.944  -40.077 224.677 1.00 664.09 ?  -113 DA  J "C4'" 1 
ATOM 4113  O "O4'" . DA  A 1 200 ? 52.488  -39.676 225.987 1.00 663.91 ?  -113 DA  J "O4'" 1 
ATOM 4114  C "C3'" . DA  A 1 200 ? 51.703  -39.950 223.796 1.00 665.56 ?  -113 DA  J "C3'" 1 
ATOM 4115  O "O3'" . DA  A 1 200 ? 51.020  -41.195 223.842 1.00 667.79 ?  -113 DA  J "O3'" 1 
ATOM 4116  C "C2'" . DA  A 1 200 ? 50.894  -38.853 224.478 1.00 664.51 ?  -113 DA  J "C2'" 1 
ATOM 4117  C "C1'" . DA  A 1 200 ? 51.117  -39.329 225.903 1.00 664.22 ?  -113 DA  J "C1'" 1 
ATOM 4118  N N9    . DA  A 1 200 ? 50.855  -38.396 226.983 1.00 664.17 ?  -113 DA  J N9    1 
ATOM 4119  C C8    . DA  A 1 200 ? 50.838  -37.027 226.969 1.00 664.20 ?  -113 DA  J C8    1 
ATOM 4120  N N7    . DA  A 1 200 ? 50.593  -36.491 228.142 1.00 664.07 ?  -113 DA  J N7    1 
ATOM 4121  C C5    . DA  A 1 200 ? 50.433  -37.593 228.969 1.00 664.22 ?  -113 DA  J C5    1 
ATOM 4122  C C6    . DA  A 1 200 ? 50.142  -37.727 230.338 1.00 664.15 ?  -113 DA  J C6    1 
ATOM 4123  N N6    . DA  A 1 200 ? 49.962  -36.678 231.141 1.00 664.30 ?  -113 DA  J N6    1 
ATOM 4124  N N1    . DA  A 1 200 ? 50.056  -38.978 230.852 1.00 664.21 ?  -113 DA  J N1    1 
ATOM 4125  C C2    . DA  A 1 200 ? 50.238  -40.036 230.047 1.00 663.98 ?  -113 DA  J C2    1 
ATOM 4126  N N3    . DA  A 1 200 ? 50.513  -40.036 228.747 1.00 663.71 ?  -113 DA  J N3    1 
ATOM 4127  C C4    . DA  A 1 200 ? 50.597  -38.777 228.271 1.00 664.14 ?  -113 DA  J C4    1 
ATOM 4128  P P     . DG  A 1 201 ? 50.564  -41.953 222.511 1.00 672.58 ?  -112 DG  J P     1 
ATOM 4129  O OP1   . DG  A 1 201 ? 51.735  -42.120 221.620 1.00 672.25 ?  -112 DG  J OP1   1 
ATOM 4130  O OP2   . DG  A 1 201 ? 49.343  -41.265 222.027 1.00 671.91 -1 -112 DG  J OP2   1 
ATOM 4131  O "O5'" . DG  A 1 201 ? 50.168  -43.406 223.047 1.00 675.17 ?  -112 DG  J "O5'" 1 
ATOM 4132  C "C5'" . DG  A 1 201 ? 50.168  -43.717 224.442 1.00 678.26 ?  -112 DG  J "C5'" 1 
ATOM 4133  C "C4'" . DG  A 1 201 ? 48.764  -43.915 225.008 1.00 678.26 ?  -112 DG  J "C4'" 1 
ATOM 4134  O "O4'" . DG  A 1 201 ? 48.537  -42.903 226.020 1.00 678.26 ?  -112 DG  J "O4'" 1 
ATOM 4135  C "C3'" . DG  A 1 201 ? 47.592  -43.847 224.018 1.00 678.26 ?  -112 DG  J "C3'" 1 
ATOM 4136  O "O3'" . DG  A 1 201 ? 46.985  -45.168 223.887 1.00 678.26 ?  -112 DG  J "O3'" 1 
ATOM 4137  C "C2'" . DG  A 1 201 ? 46.697  -42.717 224.543 1.00 678.26 ?  -112 DG  J "C2'" 1 
ATOM 4138  C "C1'" . DG  A 1 201 ? 47.215  -42.428 225.953 1.00 678.26 ?  -112 DG  J "C1'" 1 
ATOM 4139  N N9    . DG  A 1 201 ? 47.304  -41.018 226.309 1.00 678.26 ?  -112 DG  J N9    1 
ATOM 4140  C C8    . DG  A 1 201 ? 47.822  -40.016 225.537 1.00 678.26 ?  -112 DG  J C8    1 
ATOM 4141  N N7    . DG  A 1 201 ? 47.793  -38.844 226.105 1.00 678.26 ?  -112 DG  J N7    1 
ATOM 4142  C C5    . DG  A 1 201 ? 47.231  -39.089 227.344 1.00 678.26 ?  -112 DG  J C5    1 
ATOM 4143  C C6    . DG  A 1 201 ? 46.949  -38.191 228.400 1.00 678.26 ?  -112 DG  J C6    1 
ATOM 4144  O O6    . DG  A 1 201 ? 47.153  -36.971 228.438 1.00 678.26 ?  -112 DG  J O6    1 
ATOM 4145  N N1    . DG  A 1 201 ? 46.371  -38.837 229.494 1.00 678.26 ?  -112 DG  J N1    1 
ATOM 4146  C C2    . DG  A 1 201 ? 46.097  -40.189 229.553 1.00 678.26 ?  -112 DG  J C2    1 
ATOM 4147  N N2    . DG  A 1 201 ? 45.537  -40.638 230.690 1.00 678.26 ?  -112 DG  J N2    1 
ATOM 4148  N N3    . DG  A 1 201 ? 46.360  -41.040 228.562 1.00 678.26 ?  -112 DG  J N3    1 
ATOM 4149  C C4    . DG  A 1 201 ? 46.925  -40.425 227.490 1.00 678.26 ?  -112 DG  J C4    1 
ATOM 4150  P P     . DT  A 1 202 ? 45.445  -45.577 224.141 1.00 688.23 ?  -111 DT  J P     1 
ATOM 4151  O OP1   . DT  A 1 202 ? 45.424  -47.053 224.087 1.00 688.23 ?  -111 DT  J OP1   1 
ATOM 4152  O OP2   . DT  A 1 202 ? 44.557  -44.793 223.252 1.00 688.23 -1 -111 DT  J OP2   1 
ATOM 4153  O "O5'" . DT  A 1 202 ? 45.187  -45.089 225.643 1.00 688.23 ?  -111 DT  J "O5'" 1 
ATOM 4154  C "C5'" . DT  A 1 202 ? 44.612  -45.922 226.641 1.00 688.23 ?  -111 DT  J "C5'" 1 
ATOM 4155  C "C4'" . DT  A 1 202 ? 43.462  -45.177 227.289 1.00 688.23 ?  -111 DT  J "C4'" 1 
ATOM 4156  O "O4'" . DT  A 1 202 ? 43.844  -43.792 227.531 1.00 688.23 ?  -111 DT  J "O4'" 1 
ATOM 4157  C "C3'" . DT  A 1 202 ? 42.201  -45.123 226.429 1.00 688.23 ?  -111 DT  J "C3'" 1 
ATOM 4158  O "O3'" . DT  A 1 202 ? 41.060  -45.399 227.237 1.00 688.23 ?  -111 DT  J "O3'" 1 
ATOM 4159  C "C2'" . DT  A 1 202 ? 42.202  -43.684 225.916 1.00 688.23 ?  -111 DT  J "C2'" 1 
ATOM 4160  C "C1'" . DT  A 1 202 ? 42.752  -42.978 227.150 1.00 688.23 ?  -111 DT  J "C1'" 1 
ATOM 4161  N N1    . DT  A 1 202 ? 43.174  -41.542 226.960 1.00 688.23 ?  -111 DT  J N1    1 
ATOM 4162  C C2    . DT  A 1 202 ? 42.953  -40.624 227.976 1.00 688.23 ?  -111 DT  J C2    1 
ATOM 4163  O O2    . DT  A 1 202 ? 42.433  -40.895 229.045 1.00 688.23 ?  -111 DT  J O2    1 
ATOM 4164  N N3    . DT  A 1 202 ? 43.368  -39.347 227.705 1.00 688.23 ?  -111 DT  J N3    1 
ATOM 4165  C C4    . DT  A 1 202 ? 43.966  -38.899 226.541 1.00 688.23 ?  -111 DT  J C4    1 
ATOM 4166  O O4    . DT  A 1 202 ? 44.297  -37.729 226.406 1.00 688.23 ?  -111 DT  J O4    1 
ATOM 4167  C C5    . DT  A 1 202 ? 44.168  -39.898 225.518 1.00 688.23 ?  -111 DT  J C5    1 
ATOM 4168  C C7    . DT  A 1 202 ? 44.804  -39.542 224.209 1.00 688.23 ?  -111 DT  J C7    1 
ATOM 4169  C C6    . DT  A 1 202 ? 43.766  -41.149 225.773 1.00 688.23 ?  -111 DT  J C6    1 
ATOM 4170  P P     . DA  A 1 203 ? 39.638  -45.719 226.571 1.00 680.55 ?  -110 DA  J P     1 
ATOM 4171  O OP1   . DA  A 1 203 ? 39.741  -47.058 225.948 1.00 680.55 ?  -110 DA  J OP1   1 
ATOM 4172  O OP2   . DA  A 1 203 ? 39.210  -44.564 225.753 1.00 680.55 -1 -110 DA  J OP2   1 
ATOM 4173  O "O5'" . DA  A 1 203 ? 38.648  -45.793 227.827 1.00 680.55 ?  -110 DA  J "O5'" 1 
ATOM 4174  C "C5'" . DA  A 1 203 ? 38.995  -45.221 229.093 1.00 680.55 ?  -110 DA  J "C5'" 1 
ATOM 4175  C "C4'" . DA  A 1 203 ? 38.381  -43.845 229.286 1.00 680.55 ?  -110 DA  J "C4'" 1 
ATOM 4176  O "O4'" . DA  A 1 203 ? 39.241  -42.867 228.654 1.00 680.55 ?  -110 DA  J "O4'" 1 
ATOM 4177  C "C3'" . DA  A 1 203 ? 36.984  -43.624 228.690 1.00 680.55 ?  -110 DA  J "C3'" 1 
ATOM 4178  O "O3'" . DA  A 1 203 ? 36.122  -42.942 229.629 1.00 680.55 ?  -110 DA  J "O3'" 1 
ATOM 4179  C "C2'" . DA  A 1 203 ? 37.277  -42.768 227.458 1.00 680.55 ?  -110 DA  J "C2'" 1 
ATOM 4180  C "C1'" . DA  A 1 203 ? 38.389  -41.918 228.050 1.00 680.55 ?  -110 DA  J "C1'" 1 
ATOM 4181  N N9    . DA  A 1 203 ? 39.147  -41.100 227.113 1.00 680.55 ?  -110 DA  J N9    1 
ATOM 4182  C C8    . DA  A 1 203 ? 39.692  -41.472 225.917 1.00 680.55 ?  -110 DA  J C8    1 
ATOM 4183  N N7    . DA  A 1 203 ? 40.326  -40.506 225.302 1.00 680.55 ?  -110 DA  J N7    1 
ATOM 4184  C C5    . DA  A 1 203 ? 40.184  -39.423 226.153 1.00 680.55 ?  -110 DA  J C5    1 
ATOM 4185  C C6    . DA  A 1 203 ? 40.628  -38.084 226.082 1.00 680.55 ?  -110 DA  J C6    1 
ATOM 4186  N N6    . DA  A 1 203 ? 41.339  -37.604 225.056 1.00 680.55 ?  -110 DA  J N6    1 
ATOM 4187  N N1    . DA  A 1 203 ? 40.313  -37.257 227.107 1.00 680.55 ?  -110 DA  J N1    1 
ATOM 4188  C C2    . DA  A 1 203 ? 39.600  -37.738 228.138 1.00 680.55 ?  -110 DA  J C2    1 
ATOM 4189  N N3    . DA  A 1 203 ? 39.128  -38.975 228.315 1.00 680.55 ?  -110 DA  J N3    1 
ATOM 4190  C C4    . DA  A 1 203 ? 39.459  -39.772 227.278 1.00 680.55 ?  -110 DA  J C4    1 
ATOM 4191  P P     . DA  A 1 204 ? 34.570  -42.688 229.287 1.00 672.36 ?  -109 DA  J P     1 
ATOM 4192  O OP1   . DA  A 1 204 ? 33.926  -44.018 229.237 1.00 672.36 ?  -109 DA  J OP1   1 
ATOM 4193  O OP2   . DA  A 1 204 ? 34.512  -41.810 228.099 1.00 672.36 -1 -109 DA  J OP2   1 
ATOM 4194  O "O5'" . DA  A 1 204 ? 33.966  -41.867 230.528 1.00 672.36 ?  -109 DA  J "O5'" 1 
ATOM 4195  C "C5'" . DA  A 1 204 ? 34.590  -40.694 231.079 1.00 672.36 ?  -109 DA  J "C5'" 1 
ATOM 4196  C "C4'" . DA  A 1 204 ? 34.191  -39.379 230.416 1.00 672.36 ?  -109 DA  J "C4'" 1 
ATOM 4197  O "O4'" . DA  A 1 204 ? 35.249  -39.000 229.497 1.00 672.36 ?  -109 DA  J "O4'" 1 
ATOM 4198  C "C3'" . DA  A 1 204 ? 32.882  -39.333 229.617 1.00 672.36 ?  -109 DA  J "C3'" 1 
ATOM 4199  O "O3'" . DA  A 1 204 ? 32.023  -38.298 230.117 1.00 672.36 ?  -109 DA  J "O3'" 1 
ATOM 4200  C "C2'" . DA  A 1 204 ? 33.321  -39.049 228.179 1.00 672.36 ?  -109 DA  J "C2'" 1 
ATOM 4201  C "C1'" . DA  A 1 204 ? 34.665  -38.361 228.383 1.00 672.36 ?  -109 DA  J "C1'" 1 
ATOM 4202  N N9    . DA  A 1 204 ? 35.557  -38.432 227.221 1.00 672.36 ?  -109 DA  J N9    1 
ATOM 4203  C C8    . DA  A 1 204 ? 35.931  -39.549 226.524 1.00 672.36 ?  -109 DA  J C8    1 
ATOM 4204  N N7    . DA  A 1 204 ? 36.736  -39.301 225.519 1.00 672.36 ?  -109 DA  J N7    1 
ATOM 4205  C C5    . DA  A 1 204 ? 36.908  -37.926 225.557 1.00 672.36 ?  -109 DA  J C5    1 
ATOM 4206  C C6    . DA  A 1 204 ? 37.654  -37.031 224.759 1.00 672.36 ?  -109 DA  J C6    1 
ATOM 4207  N N6    . DA  A 1 204 ? 38.396  -37.416 223.720 1.00 672.36 ?  -109 DA  J N6    1 
ATOM 4208  N N1    . DA  A 1 204 ? 37.611  -35.716 225.065 1.00 672.36 ?  -109 DA  J N1    1 
ATOM 4209  C C2    . DA  A 1 204 ? 36.869  -35.318 226.107 1.00 672.36 ?  -109 DA  J C2    1 
ATOM 4210  N N3    . DA  A 1 204 ? 36.128  -36.067 226.925 1.00 672.36 ?  -109 DA  J N3    1 
ATOM 4211  C C4    . DA  A 1 204 ? 36.187  -37.373 226.598 1.00 672.36 ?  -109 DA  J C4    1 
ATOM 4212  P P     . DT  A 1 205 ? 30.596  -37.943 229.463 1.00 647.72 ?  -108 DT  J P     1 
ATOM 4213  O OP1   . DT  A 1 205 ? 29.694  -37.575 230.577 1.00 647.63 ?  -108 DT  J OP1   1 
ATOM 4214  O OP2   . DT  A 1 205 ? 30.189  -39.020 228.532 1.00 647.49 -1 -108 DT  J OP2   1 
ATOM 4215  O "O5'" . DT  A 1 205 ? 30.922  -36.634 228.589 1.00 648.56 ?  -108 DT  J "O5'" 1 
ATOM 4216  C "C5'" . DT  A 1 205 ? 31.049  -35.338 229.200 1.00 649.45 ?  -108 DT  J "C5'" 1 
ATOM 4217  C "C4'" . DT  A 1 205 ? 31.194  -34.204 228.190 1.00 649.85 ?  -108 DT  J "C4'" 1 
ATOM 4218  O "O4'" . DT  A 1 205 ? 32.370  -34.408 227.360 1.00 650.04 ?  -108 DT  J "O4'" 1 
ATOM 4219  C "C3'" . DT  A 1 205 ? 30.017  -33.978 227.240 1.00 650.07 ?  -108 DT  J "C3'" 1 
ATOM 4220  O "O3'" . DT  A 1 205 ? 29.610  -32.605 227.322 1.00 650.19 ?  -108 DT  J "O3'" 1 
ATOM 4221  C "C2'" . DT  A 1 205 ? 30.571  -34.365 225.867 1.00 650.36 ?  -108 DT  J "C2'" 1 
ATOM 4222  C "C1'" . DT  A 1 205 ? 32.065  -34.093 226.016 1.00 650.50 ?  -108 DT  J "C1'" 1 
ATOM 4223  N N1    . DT  A 1 205 ? 32.953  -34.898 225.085 1.00 650.63 ?  -108 DT  J N1    1 
ATOM 4224  C C2    . DT  A 1 205 ? 33.838  -34.250 224.237 1.00 650.64 ?  -108 DT  J C2    1 
ATOM 4225  O O2    . DT  A 1 205 ? 33.964  -33.040 224.176 1.00 650.66 ?  -108 DT  J O2    1 
ATOM 4226  N N3    . DT  A 1 205 ? 34.592  -35.085 223.443 1.00 650.76 ?  -108 DT  J N3    1 
ATOM 4227  C C4    . DT  A 1 205 ? 34.560  -36.469 223.402 1.00 650.70 ?  -108 DT  J C4    1 
ATOM 4228  O O4    . DT  A 1 205 ? 35.285  -37.111 222.647 1.00 650.65 ?  -108 DT  J O4    1 
ATOM 4229  C C5    . DT  A 1 205 ? 33.617  -37.089 224.307 1.00 650.71 ?  -108 DT  J C5    1 
ATOM 4230  C C7    . DT  A 1 205 ? 33.469  -38.581 224.369 1.00 650.65 ?  -108 DT  J C7    1 
ATOM 4231  C C6    . DT  A 1 205 ? 32.877  -36.285 225.089 1.00 650.72 ?  -108 DT  J C6    1 
ATOM 4232  P P     . DC  A 1 206 ? 28.716  -31.860 226.216 1.00 634.90 ?  -107 DC  J P     1 
ATOM 4233  O OP1   . DC  A 1 206 ? 28.151  -30.648 226.851 1.00 634.75 ?  -107 DC  J OP1   1 
ATOM 4234  O OP2   . DC  A 1 206 ? 27.806  -32.835 225.567 1.00 634.76 -1 -107 DC  J OP2   1 
ATOM 4235  O "O5'" . DC  A 1 206 ? 29.812  -31.416 225.145 1.00 634.61 ?  -107 DC  J "O5'" 1 
ATOM 4236  C "C5'" . DC  A 1 206 ? 30.819  -30.473 225.501 1.00 634.59 ?  -107 DC  J "C5'" 1 
ATOM 4237  C "C4'" . DC  A 1 206 ? 31.405  -29.855 224.245 1.00 634.58 ?  -107 DC  J "C4'" 1 
ATOM 4238  O "O4'" . DC  A 1 206 ? 32.018  -30.906 223.457 1.00 634.80 ?  -107 DC  J "O4'" 1 
ATOM 4239  C "C3'" . DC  A 1 206 ? 30.398  -29.155 223.334 1.00 634.39 ?  -107 DC  J "C3'" 1 
ATOM 4240  O "O3'" . DC  A 1 206 ? 30.931  -27.907 222.892 1.00 633.69 ?  -107 DC  J "O3'" 1 
ATOM 4241  C "C2'" . DC  A 1 206 ? 30.179  -30.123 222.169 1.00 634.66 ?  -107 DC  J "C2'" 1 
ATOM 4242  C "C1'" . DC  A 1 206 ? 31.472  -30.942 222.152 1.00 634.90 ?  -107 DC  J "C1'" 1 
ATOM 4243  N N1    . DC  A 1 206 ? 31.314  -32.386 221.750 1.00 634.97 ?  -107 DC  J N1    1 
ATOM 4244  C C2    . DC  A 1 206 ? 32.363  -33.042 221.074 1.00 634.91 ?  -107 DC  J C2    1 
ATOM 4245  O O2    . DC  A 1 206 ? 33.406  -32.434 220.806 1.00 634.85 ?  -107 DC  J O2    1 
ATOM 4246  N N3    . DC  A 1 206 ? 32.202  -34.344 220.718 1.00 634.91 ?  -107 DC  J N3    1 
ATOM 4247  C C4    . DC  A 1 206 ? 31.067  -34.984 221.015 1.00 634.98 ?  -107 DC  J C4    1 
ATOM 4248  N N4    . DC  A 1 206 ? 30.964  -36.263 220.642 1.00 634.97 ?  -107 DC  J N4    1 
ATOM 4249  C C5    . DC  A 1 206 ? 29.990  -34.345 221.704 1.00 634.89 ?  -107 DC  J C5    1 
ATOM 4250  C C6    . DC  A 1 206 ? 30.156  -33.061 222.048 1.00 634.96 ?  -107 DC  J C6    1 
ATOM 4251  P P     . DC  A 1 207 ? 30.010  -26.599 222.754 1.00 646.16 ?  -106 DC  J P     1 
ATOM 4252  O OP1   . DC  A 1 207 ? 30.713  -25.487 223.436 1.00 646.03 ?  -106 DC  J OP1   1 
ATOM 4253  O OP2   . DC  A 1 207 ? 28.626  -26.949 223.157 1.00 646.17 -1 -106 DC  J OP2   1 
ATOM 4254  O "O5'" . DC  A 1 207 ? 30.002  -26.315 221.172 1.00 645.23 ?  -106 DC  J "O5'" 1 
ATOM 4255  C "C5'" . DC  A 1 207 ? 31.220  -26.073 220.455 1.00 643.28 ?  -106 DC  J "C5'" 1 
ATOM 4256  C "C4'" . DC  A 1 207 ? 31.224  -26.749 219.092 1.00 641.79 ?  -106 DC  J "C4'" 1 
ATOM 4257  O "O4'" . DC  A 1 207 ? 31.071  -28.186 219.234 1.00 641.29 ?  -106 DC  J "O4'" 1 
ATOM 4258  C "C3'" . DC  A 1 207 ? 30.119  -26.306 218.132 1.00 641.07 ?  -106 DC  J "C3'" 1 
ATOM 4259  O "O3'" . DC  A 1 207 ? 30.702  -25.907 216.900 1.00 640.55 ?  -106 DC  J "O3'" 1 
ATOM 4260  C "C2'" . DC  A 1 207 ? 29.268  -27.558 217.939 1.00 640.91 ?  -106 DC  J "C2'" 1 
ATOM 4261  C "C1'" . DC  A 1 207 ? 30.339  -28.633 218.109 1.00 640.84 ?  -106 DC  J "C1'" 1 
ATOM 4262  N N1    . DC  A 1 207 ? 29.854  -30.053 218.294 1.00 640.62 ?  -106 DC  J N1    1 
ATOM 4263  C C2    . DC  A 1 207 ? 30.768  -31.059 218.683 1.00 640.46 ?  -106 DC  J C2    1 
ATOM 4264  O O2    . DC  A 1 207 ? 31.972  -30.782 218.885 1.00 640.42 ?  -106 DC  J O2    1 
ATOM 4265  N N3    . DC  A 1 207 ? 30.314  -32.330 218.840 1.00 640.32 ?  -106 DC  J N3    1 
ATOM 4266  C C4    . DC  A 1 207 ? 29.022  -32.621 218.623 1.00 640.42 ?  -106 DC  J C4    1 
ATOM 4267  N N4    . DC  A 1 207 ? 28.639  -33.888 218.789 1.00 640.56 ?  -106 DC  J N4    1 
ATOM 4268  C C5    . DC  A 1 207 ? 28.074  -31.622 218.218 1.00 640.39 ?  -106 DC  J C5    1 
ATOM 4269  C C6    . DC  A 1 207 ? 28.530  -30.371 218.066 1.00 640.46 ?  -106 DC  J C6    1 
ATOM 4270  P P     . DC  A 1 208 ? 30.972  -24.366 216.559 1.00 654.74 ?  -105 DC  J P     1 
ATOM 4271  O OP1   . DC  A 1 208 ? 30.951  -23.593 217.822 1.00 655.05 ?  -105 DC  J OP1   1 
ATOM 4272  O OP2   . DC  A 1 208 ? 30.057  -24.003 215.455 1.00 654.32 -1 -105 DC  J OP2   1 
ATOM 4273  O "O5'" . DC  A 1 208 ? 32.468  -24.354 215.986 1.00 654.20 ?  -105 DC  J "O5'" 1 
ATOM 4274  C "C5'" . DC  A 1 208 ? 33.380  -25.433 216.212 1.00 653.42 ?  -105 DC  J "C5'" 1 
ATOM 4275  C "C4'" . DC  A 1 208 ? 33.635  -26.258 214.957 1.00 652.85 ?  -105 DC  J "C4'" 1 
ATOM 4276  O "O4'" . DC  A 1 208 ? 32.782  -27.432 214.982 1.00 652.78 ?  -105 DC  J "O4'" 1 
ATOM 4277  C "C3'" . DC  A 1 208 ? 33.398  -25.583 213.601 1.00 652.60 ?  -105 DC  J "C3'" 1 
ATOM 4278  O "O3'" . DC  A 1 208 ? 34.454  -25.925 212.688 1.00 651.82 ?  -105 DC  J "O3'" 1 
ATOM 4279  C "C2'" . DC  A 1 208 ? 32.053  -26.161 213.162 1.00 652.84 ?  -105 DC  J "C2'" 1 
ATOM 4280  C "C1'" . DC  A 1 208 ? 32.192  -27.581 213.706 1.00 653.38 ?  -105 DC  J "C1'" 1 
ATOM 4281  N N1    . DC  A 1 208 ? 30.930  -28.395 213.831 1.00 653.62 ?  -105 DC  J N1    1 
ATOM 4282  C C2    . DC  A 1 208 ? 31.038  -29.796 213.815 1.00 653.65 ?  -105 DC  J C2    1 
ATOM 4283  O O2    . DC  A 1 208 ? 32.150  -30.323 213.699 1.00 653.71 ?  -105 DC  J O2    1 
ATOM 4284  N N3    . DC  A 1 208 ? 29.915  -30.545 213.925 1.00 653.82 ?  -105 DC  J N3    1 
ATOM 4285  C C4    . DC  A 1 208 ? 28.726  -29.950 214.048 1.00 653.77 ?  -105 DC  J C4    1 
ATOM 4286  N N4    . DC  A 1 208 ? 27.660  -30.746 214.155 1.00 653.78 ?  -105 DC  J N4    1 
ATOM 4287  C C5    . DC  A 1 208 ? 28.583  -28.525 214.066 1.00 653.51 ?  -105 DC  J C5    1 
ATOM 4288  C C6    . DC  A 1 208 ? 29.701  -27.797 213.958 1.00 653.52 ?  -105 DC  J C6    1 
ATOM 4289  P P     . DC  A 1 209 ? 34.822  -25.059 211.383 1.00 665.12 ?  -104 DC  J P     1 
ATOM 4290  O OP1   . DC  A 1 209 ? 35.944  -24.167 211.743 1.00 665.12 ?  -104 DC  J OP1   1 
ATOM 4291  O OP2   . DC  A 1 209 ? 33.591  -24.473 210.801 1.00 665.12 -1 -104 DC  J OP2   1 
ATOM 4292  O "O5'" . DC  A 1 209 ? 35.350  -26.148 210.332 1.00 665.12 ?  -104 DC  J "O5'" 1 
ATOM 4293  C "C5'" . DC  A 1 209 ? 35.768  -27.464 210.724 1.00 665.12 ?  -104 DC  J "C5'" 1 
ATOM 4294  C "C4'" . DC  A 1 209 ? 35.094  -28.551 209.897 1.00 665.12 ?  -104 DC  J "C4'" 1 
ATOM 4295  O "O4'" . DC  A 1 209 ? 33.751  -28.786 210.409 1.00 665.12 ?  -104 DC  J "O4'" 1 
ATOM 4296  C "C3'" . DC  A 1 209 ? 34.938  -28.274 208.397 1.00 665.12 ?  -104 DC  J "C3'" 1 
ATOM 4297  O "O3'" . DC  A 1 209 ? 35.390  -29.403 207.637 1.00 665.12 ?  -104 DC  J "O3'" 1 
ATOM 4298  C "C2'" . DC  A 1 209 ? 33.433  -28.057 208.251 1.00 665.12 ?  -104 DC  J "C2'" 1 
ATOM 4299  C "C1'" . DC  A 1 209 ? 32.931  -29.053 209.290 1.00 665.12 ?  -104 DC  J "C1'" 1 
ATOM 4300  N N1    . DC  A 1 209 ? 31.464  -28.997 209.637 1.00 665.12 ?  -104 DC  J N1    1 
ATOM 4301  C C2    . DC  A 1 209 ? 30.674  -30.160 209.513 1.00 665.12 ?  -104 DC  J C2    1 
ATOM 4302  O O2    . DC  A 1 209 ? 31.177  -31.219 209.121 1.00 665.12 ?  -104 DC  J O2    1 
ATOM 4303  N N3    . DC  A 1 209 ? 29.356  -30.103 209.824 1.00 665.12 ?  -104 DC  J N3    1 
ATOM 4304  C C4    . DC  A 1 209 ? 28.820  -28.958 210.247 1.00 665.12 ?  -104 DC  J C4    1 
ATOM 4305  N N4    . DC  A 1 209 ? 27.517  -28.962 210.543 1.00 665.12 ?  -104 DC  J N4    1 
ATOM 4306  C C5    . DC  A 1 209 ? 29.597  -27.762 210.383 1.00 665.12 ?  -104 DC  J C5    1 
ATOM 4307  C C6    . DC  A 1 209 ? 30.900  -27.826 210.073 1.00 665.12 ?  -104 DC  J C6    1 
ATOM 4308  P P     . DT  A 1 210 ? 35.746  -29.320 206.070 1.00 670.09 ?  -103 DT  J P     1 
ATOM 4309  O OP1   . DT  A 1 210 ? 37.154  -28.881 205.999 1.00 670.09 ?  -103 DT  J OP1   1 
ATOM 4310  O OP2   . DT  A 1 210 ? 34.704  -28.556 205.346 1.00 670.09 -1 -103 DT  J OP2   1 
ATOM 4311  O "O5'" . DT  A 1 210 ? 35.654  -30.833 205.565 1.00 670.09 ?  -103 DT  J "O5'" 1 
ATOM 4312  C "C5'" . DT  A 1 210 ? 35.348  -31.902 206.462 1.00 670.09 ?  -103 DT  J "C5'" 1 
ATOM 4313  C "C4'" . DT  A 1 210 ? 34.037  -32.567 206.088 1.00 670.09 ?  -103 DT  J "C4'" 1 
ATOM 4314  O "O4'" . DT  A 1 210 ? 32.922  -31.850 206.665 1.00 670.09 ?  -103 DT  J "O4'" 1 
ATOM 4315  C "C3'" . DT  A 1 210 ? 33.759  -32.614 204.591 1.00 670.09 ?  -103 DT  J "C3'" 1 
ATOM 4316  O "O3'" . DT  A 1 210 ? 33.917  -33.943 204.152 1.00 670.09 ?  -103 DT  J "O3'" 1 
ATOM 4317  C "C2'" . DT  A 1 210 ? 32.315  -32.134 204.435 1.00 670.09 ?  -103 DT  J "C2'" 1 
ATOM 4318  C "C1'" . DT  A 1 210 ? 31.797  -32.137 205.866 1.00 670.09 ?  -103 DT  J "C1'" 1 
ATOM 4319  N N1    . DT  A 1 210 ? 30.706  -31.139 206.114 1.00 670.09 ?  -103 DT  J N1    1 
ATOM 4320  C C2    . DT  A 1 210 ? 29.405  -31.597 206.254 1.00 670.09 ?  -103 DT  J C2    1 
ATOM 4321  O O2    . DT  A 1 210 ? 29.083  -32.776 206.195 1.00 670.09 ?  -103 DT  J O2    1 
ATOM 4322  N N3    . DT  A 1 210 ? 28.475  -30.609 206.478 1.00 670.09 ?  -103 DT  J N3    1 
ATOM 4323  C C4    . DT  A 1 210 ? 28.703  -29.245 206.571 1.00 670.09 ?  -103 DT  J C4    1 
ATOM 4324  O O4    . DT  A 1 210 ? 27.789  -28.450 206.775 1.00 670.09 ?  -103 DT  J O4    1 
ATOM 4325  C C5    . DT  A 1 210 ? 30.083  -28.839 206.413 1.00 670.09 ?  -103 DT  J C5    1 
ATOM 4326  C C7    . DT  A 1 210 ? 30.460  -27.389 206.489 1.00 670.09 ?  -103 DT  J C7    1 
ATOM 4327  C C6    . DT  A 1 210 ? 31.004  -29.788 206.192 1.00 670.09 ?  -103 DT  J C6    1 
ATOM 4328  P P     . DT  A 1 211 ? 33.984  -34.303 202.598 1.00 664.53 ?  -102 DT  J P     1 
ATOM 4329  O OP1   . DT  A 1 211 ? 35.177  -35.154 202.408 1.00 664.53 ?  -102 DT  J OP1   1 
ATOM 4330  O OP2   . DT  A 1 211 ? 33.818  -33.072 201.795 1.00 664.53 -1 -102 DT  J OP2   1 
ATOM 4331  O "O5'" . DT  A 1 211 ? 32.672  -35.185 202.357 1.00 664.53 ?  -102 DT  J "O5'" 1 
ATOM 4332  C "C5'" . DT  A 1 211 ? 32.111  -35.971 203.402 1.00 664.53 ?  -102 DT  J "C5'" 1 
ATOM 4333  C "C4'" . DT  A 1 211 ? 30.595  -35.891 203.376 1.00 664.53 ?  -102 DT  J "C4'" 1 
ATOM 4334  O "O4'" . DT  A 1 211 ? 30.136  -34.563 203.755 1.00 664.53 ?  -102 DT  J "O4'" 1 
ATOM 4335  C "C3'" . DT  A 1 211 ? 29.968  -36.189 202.013 1.00 664.53 ?  -102 DT  J "C3'" 1 
ATOM 4336  O "O3'" . DT  A 1 211 ? 29.243  -37.422 202.091 1.00 664.53 ?  -102 DT  J "O3'" 1 
ATOM 4337  C "C2'" . DT  A 1 211 ? 29.066  -34.978 201.756 1.00 664.53 ?  -102 DT  J "C2'" 1 
ATOM 4338  C "C1'" . DT  A 1 211 ? 28.862  -34.428 203.165 1.00 664.53 ?  -102 DT  J "C1'" 1 
ATOM 4339  N N1    . DT  A 1 211 ? 28.311  -33.015 203.253 1.00 664.53 ?  -102 DT  J N1    1 
ATOM 4340  C C2    . DT  A 1 211 ? 27.074  -32.811 203.850 1.00 664.53 ?  -102 DT  J C2    1 
ATOM 4341  O O2    . DT  A 1 211 ? 26.388  -33.695 204.328 1.00 664.53 ?  -102 DT  J O2    1 
ATOM 4342  N N3    . DT  A 1 211 ? 26.651  -31.505 203.879 1.00 664.53 ?  -102 DT  J N3    1 
ATOM 4343  C C4    . DT  A 1 211 ? 27.315  -30.402 203.382 1.00 664.53 ?  -102 DT  J C4    1 
ATOM 4344  O O4    . DT  A 1 211 ? 26.838  -29.278 203.464 1.00 664.53 ?  -102 DT  J O4    1 
ATOM 4345  C C5    . DT  A 1 211 ? 28.594  -30.670 202.769 1.00 664.53 ?  -102 DT  J C5    1 
ATOM 4346  C C7    . DT  A 1 211 ? 29.404  -29.545 202.193 1.00 664.53 ?  -102 DT  J C7    1 
ATOM 4347  C C6    . DT  A 1 211 ? 29.024  -31.945 202.733 1.00 664.53 ?  -102 DT  J C6    1 
ATOM 4348  P P     . DG  A 1 212 ? 28.693  -38.201 200.800 1.00 683.25 ?  -101 DG  J P     1 
ATOM 4349  O OP1   . DG  A 1 212 ? 29.259  -39.565 200.860 1.00 683.25 ?  -101 DG  J OP1   1 
ATOM 4350  O OP2   . DG  A 1 212 ? 28.896  -37.366 199.594 1.00 683.25 -1 -101 DG  J OP2   1 
ATOM 4351  O "O5'" . DG  A 1 212 ? 27.111  -38.299 201.042 1.00 683.25 ?  -101 DG  J "O5'" 1 
ATOM 4352  C "C5'" . DG  A 1 212 ? 26.445  -37.478 202.008 1.00 683.25 ?  -101 DG  J "C5'" 1 
ATOM 4353  C "C4'" . DG  A 1 212 ? 25.105  -36.949 201.518 1.00 683.25 ?  -101 DG  J "C4'" 1 
ATOM 4354  O "O4'" . DG  A 1 212 ? 24.968  -35.543 201.847 1.00 683.25 ?  -101 DG  J "O4'" 1 
ATOM 4355  C "C3'" . DG  A 1 212 ? 24.845  -37.040 200.020 1.00 683.25 ?  -101 DG  J "C3'" 1 
ATOM 4356  O "O3'" . DG  A 1 212 ? 23.517  -37.472 199.845 1.00 683.25 ?  -101 DG  J "O3'" 1 
ATOM 4357  C "C2'" . DG  A 1 212 ? 24.997  -35.603 199.542 1.00 683.25 ?  -101 DG  J "C2'" 1 
ATOM 4358  C "C1'" . DG  A 1 212 ? 24.407  -34.869 200.739 1.00 683.25 ?  -101 DG  J "C1'" 1 
ATOM 4359  N N9    . DG  A 1 212 ? 24.730  -33.445 200.823 1.00 683.25 ?  -101 DG  J N9    1 
ATOM 4360  C C8    . DG  A 1 212 ? 25.845  -32.814 200.326 1.00 683.25 ?  -101 DG  J C8    1 
ATOM 4361  N N7    . DG  A 1 212 ? 25.869  -31.530 200.556 1.00 683.25 ?  -101 DG  J N7    1 
ATOM 4362  C C5    . DG  A 1 212 ? 24.694  -31.284 201.257 1.00 683.25 ?  -101 DG  J C5    1 
ATOM 4363  C C6    . DG  A 1 212 ? 24.173  -30.067 201.782 1.00 683.25 ?  -101 DG  J C6    1 
ATOM 4364  O O6    . DG  A 1 212 ? 24.654  -28.926 201.722 1.00 683.25 ?  -101 DG  J O6    1 
ATOM 4365  N N1    . DG  A 1 212 ? 22.948  -30.259 202.417 1.00 683.25 ?  -101 DG  J N1    1 
ATOM 4366  C C2    . DG  A 1 212 ? 22.309  -31.476 202.541 1.00 683.25 ?  -101 DG  J C2    1 
ATOM 4367  N N2    . DG  A 1 212 ? 21.141  -31.466 203.199 1.00 683.25 ?  -101 DG  J N2    1 
ATOM 4368  N N3    . DG  A 1 212 ? 22.790  -32.622 202.061 1.00 683.25 ?  -101 DG  J N3    1 
ATOM 4369  C C4    . DG  A 1 212 ? 23.982  -32.456 201.429 1.00 683.25 ?  -101 DG  J C4    1 
ATOM 4370  P P     . DG  A 1 213 ? 23.159  -38.430 198.623 1.00 689.16 ?  -100 DG  J P     1 
ATOM 4371  O OP1   . DG  A 1 213 ? 23.741  -39.762 198.920 1.00 689.16 ?  -100 DG  J OP1   1 
ATOM 4372  O OP2   . DG  A 1 213 ? 23.515  -37.714 197.375 1.00 689.16 -1 -100 DG  J OP2   1 
ATOM 4373  O "O5'" . DG  A 1 213 ? 21.564  -38.535 198.677 1.00 689.16 ?  -100 DG  J "O5'" 1 
ATOM 4374  C "C5'" . DG  A 1 213 ? 20.816  -37.762 199.605 1.00 689.16 ?  -100 DG  J "C5'" 1 
ATOM 4375  C "C4'" . DG  A 1 213 ? 20.220  -36.518 198.969 1.00 689.16 ?  -100 DG  J "C4'" 1 
ATOM 4376  O "O4'" . DG  A 1 213 ? 21.023  -35.366 199.319 1.00 689.16 ?  -100 DG  J "O4'" 1 
ATOM 4377  C "C3'" . DG  A 1 213 ? 20.118  -36.488 197.439 1.00 689.16 ?  -100 DG  J "C3'" 1 
ATOM 4378  O "O3'" . DG  A 1 213 ? 18.779  -36.872 197.017 1.00 689.16 ?  -100 DG  J "O3'" 1 
ATOM 4379  C "C2'" . DG  A 1 213 ? 20.549  -35.064 197.071 1.00 689.16 ?  -100 DG  J "C2'" 1 
ATOM 4380  C "C1'" . DG  A 1 213 ? 20.615  -34.362 198.421 1.00 689.16 ?  -100 DG  J "C1'" 1 
ATOM 4381  N N9    . DG  A 1 213 ? 21.543  -33.233 198.439 1.00 689.16 ?  -100 DG  J N9    1 
ATOM 4382  C C8    . DG  A 1 213 ? 22.840  -33.212 197.981 1.00 689.16 ?  -100 DG  J C8    1 
ATOM 4383  N N7    . DG  A 1 213 ? 23.424  -32.055 198.117 1.00 689.16 ?  -100 DG  J N7    1 
ATOM 4384  C C5    . DG  A 1 213 ? 22.453  -31.254 198.701 1.00 689.16 ?  -100 DG  J C5    1 
ATOM 4385  C C6    . DG  A 1 213 ? 22.506  -29.889 199.083 1.00 689.16 ?  -100 DG  J C6    1 
ATOM 4386  O O6    . DG  A 1 213 ? 23.460  -29.106 198.978 1.00 689.16 ?  -100 DG  J O6    1 
ATOM 4387  N N1    . DG  A 1 213 ? 21.303  -29.452 199.646 1.00 689.16 ?  -100 DG  J N1    1 
ATOM 4388  C C2    . DG  A 1 213 ? 20.184  -30.242 199.810 1.00 689.16 ?  -100 DG  J C2    1 
ATOM 4389  N N2    . DG  A 1 213 ? 19.115  -29.655 200.367 1.00 689.16 ?  -100 DG  J N2    1 
ATOM 4390  N N3    . DG  A 1 213 ? 20.121  -31.522 199.449 1.00 689.16 ?  -100 DG  J N3    1 
ATOM 4391  C C4    . DG  A 1 213 ? 21.286  -31.962 198.903 1.00 689.16 ?  -100 DG  J C4    1 
ATOM 4392  P P     . DC  A 1 214 ? 17.755  -36.022 196.100 1.00 692.75 ?  -99  DC  J P     1 
ATOM 4393  O OP1   . DC  A 1 214 ? 16.546  -36.861 195.923 1.00 692.75 ?  -99  DC  J OP1   1 
ATOM 4394  O OP2   . DC  A 1 214 ? 18.466  -35.532 194.895 1.00 692.75 -1 -99  DC  J OP2   1 
ATOM 4395  O "O5'" . DC  A 1 214 ? 17.383  -34.750 197.009 1.00 692.75 ?  -99  DC  J "O5'" 1 
ATOM 4396  C "C5'" . DC  A 1 214 ? 16.087  -34.147 196.953 1.00 692.75 ?  -99  DC  J "C5'" 1 
ATOM 4397  C "C4'" . DC  A 1 214 ? 16.142  -32.732 196.401 1.00 692.75 ?  -99  DC  J "C4'" 1 
ATOM 4398  O "O4'" . DC  A 1 214 ? 17.425  -32.122 196.718 1.00 692.75 ?  -99  DC  J "O4'" 1 
ATOM 4399  C "C3'" . DC  A 1 214 ? 15.981  -32.616 194.883 1.00 692.75 ?  -99  DC  J "C3'" 1 
ATOM 4400  O "O3'" . DC  A 1 214 ? 14.999  -31.622 194.559 1.00 692.75 ?  -99  DC  J "O3'" 1 
ATOM 4401  C "C2'" . DC  A 1 214 ? 17.370  -32.191 194.410 1.00 692.75 ?  -99  DC  J "C2'" 1 
ATOM 4402  C "C1'" . DC  A 1 214 ? 17.787  -31.337 195.603 1.00 692.75 ?  -99  DC  J "C1'" 1 
ATOM 4403  N N1    . DC  A 1 214 ? 19.236  -30.939 195.655 1.00 692.75 ?  -99  DC  J N1    1 
ATOM 4404  C C2    . DC  A 1 214 ? 19.575  -29.638 196.068 1.00 692.75 ?  -99  DC  J C2    1 
ATOM 4405  O O2    . DC  A 1 214 ? 18.685  -28.844 196.390 1.00 692.75 ?  -99  DC  J O2    1 
ATOM 4406  N N3    . DC  A 1 214 ? 20.884  -29.278 196.106 1.00 692.75 ?  -99  DC  J N3    1 
ATOM 4407  C C4    . DC  A 1 214 ? 21.826  -30.155 195.750 1.00 692.75 ?  -99  DC  J C4    1 
ATOM 4408  N N4    . DC  A 1 214 ? 23.100  -29.754 195.809 1.00 692.75 ?  -99  DC  J N4    1 
ATOM 4409  C C5    . DC  A 1 214 ? 21.506  -31.483 195.326 1.00 692.75 ?  -99  DC  J C5    1 
ATOM 4410  C C6    . DC  A 1 214 ? 20.213  -31.828 195.294 1.00 692.75 ?  -99  DC  J C6    1 
ATOM 4411  P P     . DG  A 1 215 ? 14.220  -31.662 193.157 1.00 684.86 ?  -98  DG  J P     1 
ATOM 4412  O OP1   . DG  A 1 215 ? 13.204  -32.732 193.276 1.00 684.86 ?  -98  DG  J OP1   1 
ATOM 4413  O OP2   . DG  A 1 215 ? 15.220  -31.725 192.065 1.00 684.86 -1 -98  DG  J OP2   1 
ATOM 4414  O "O5'" . DG  A 1 215 ? 13.475  -30.242 193.035 1.00 684.86 ?  -98  DG  J "O5'" 1 
ATOM 4415  C "C5'" . DG  A 1 215 ? 13.934  -29.038 193.675 1.00 684.86 ?  -98  DG  J "C5'" 1 
ATOM 4416  C "C4'" . DG  A 1 215 ? 14.703  -28.081 192.762 1.00 684.86 ?  -98  DG  J "C4'" 1 
ATOM 4417  O "O4'" . DG  A 1 215 ? 16.084  -28.513 192.634 1.00 684.86 ?  -98  DG  J "O4'" 1 
ATOM 4418  C "C3'" . DG  A 1 215 ? 14.221  -27.832 191.327 1.00 684.86 ?  -98  DG  J "C3'" 1 
ATOM 4419  O "O3'" . DG  A 1 215 ? 14.336  -26.412 191.059 1.00 684.86 ?  -98  DG  J "O3'" 1 
ATOM 4420  C "C2'" . DG  A 1 215 ? 15.201  -28.672 190.498 1.00 684.86 ?  -98  DG  J "C2'" 1 
ATOM 4421  C "C1'" . DG  A 1 215 ? 16.483  -28.389 191.281 1.00 684.86 ?  -98  DG  J "C1'" 1 
ATOM 4422  N N9    . DG  A 1 215 ? 17.655  -29.253 191.097 1.00 684.86 ?  -98  DG  J N9    1 
ATOM 4423  C C8    . DG  A 1 215 ? 17.761  -30.476 190.473 1.00 684.86 ?  -98  DG  J C8    1 
ATOM 4424  N N7    . DG  A 1 215 ? 18.971  -30.976 190.509 1.00 684.86 ?  -98  DG  J N7    1 
ATOM 4425  C C5    . DG  A 1 215 ? 19.713  -30.028 191.203 1.00 684.86 ?  -98  DG  J C5    1 
ATOM 4426  C C6    . DG  A 1 215 ? 21.086  -30.004 191.561 1.00 684.86 ?  -98  DG  J C6    1 
ATOM 4427  O O6    . DG  A 1 215 ? 21.954  -30.854 191.321 1.00 684.86 ?  -98  DG  J O6    1 
ATOM 4428  N N1    . DG  A 1 215 ? 21.433  -28.848 192.266 1.00 684.86 ?  -98  DG  J N1    1 
ATOM 4429  C C2    . DG  A 1 215 ? 20.554  -27.836 192.589 1.00 684.86 ?  -98  DG  J C2    1 
ATOM 4430  N N2    . DG  A 1 215 ? 21.043  -26.793 193.273 1.00 684.86 ?  -98  DG  J N2    1 
ATOM 4431  N N3    . DG  A 1 215 ? 19.269  -27.849 192.260 1.00 684.86 ?  -98  DG  J N3    1 
ATOM 4432  C C4    . DG  A 1 215 ? 18.916  -28.967 191.571 1.00 684.86 ?  -98  DG  J C4    1 
ATOM 4433  P P     . DG  A 1 216 ? 13.541  -25.640 189.889 1.00 695.91 ?  -97  DG  J P     1 
ATOM 4434  O OP1   . DG  A 1 216 ? 12.097  -25.866 190.125 1.00 695.91 ?  -97  DG  J OP1   1 
ATOM 4435  O OP2   . DG  A 1 216 ? 14.152  -26.022 188.593 1.00 695.91 -1 -97  DG  J OP2   1 
ATOM 4436  O "O5'" . DG  A 1 216 ? 13.843  -24.078 190.132 1.00 695.91 ?  -97  DG  J "O5'" 1 
ATOM 4437  C "C5'" . DG  A 1 216 ? 15.169  -23.576 190.323 1.00 695.91 ?  -97  DG  J "C5'" 1 
ATOM 4438  C "C4'" . DG  A 1 216 ? 15.628  -22.632 189.215 1.00 695.91 ?  -97  DG  J "C4'" 1 
ATOM 4439  O "O4'" . DG  A 1 216 ? 17.060  -22.786 189.034 1.00 695.91 ?  -97  DG  J "O4'" 1 
ATOM 4440  C "C3'" . DG  A 1 216 ? 15.031  -22.825 187.821 1.00 695.91 ?  -97  DG  J "C3'" 1 
ATOM 4441  O "O3'" . DG  A 1 216 ? 14.970  -21.565 187.135 1.00 695.91 ?  -97  DG  J "O3'" 1 
ATOM 4442  C "C2'" . DG  A 1 216 ? 16.014  -23.791 187.168 1.00 695.91 ?  -97  DG  J "C2'" 1 
ATOM 4443  C "C1'" . DG  A 1 216 ? 17.348  -23.367 187.772 1.00 695.91 ?  -97  DG  J "C1'" 1 
ATOM 4444  N N9    . DG  A 1 216 ? 18.270  -24.488 187.955 1.00 695.91 ?  -97  DG  J N9    1 
ATOM 4445  C C8    . DG  A 1 216 ? 18.093  -25.773 187.503 1.00 695.91 ?  -97  DG  J C8    1 
ATOM 4446  N N7    . DG  A 1 216 ? 19.072  -26.575 187.804 1.00 695.91 ?  -97  DG  J N7    1 
ATOM 4447  C C5    . DG  A 1 216 ? 19.960  -25.770 188.503 1.00 695.91 ?  -97  DG  J C5    1 
ATOM 4448  C C6    . DG  A 1 216 ? 21.211  -26.093 189.085 1.00 695.91 ?  -97  DG  J C6    1 
ATOM 4449  O O6    . DG  A 1 216 ? 21.782  -27.191 189.086 1.00 695.91 ?  -97  DG  J O6    1 
ATOM 4450  N N1    . DG  A 1 216 ? 21.807  -24.995 189.708 1.00 695.91 ?  -97  DG  J N1    1 
ATOM 4451  C C2    . DG  A 1 216 ? 21.252  -23.735 189.762 1.00 695.91 ?  -97  DG  J C2    1 
ATOM 4452  N N2    . DG  A 1 216 ? 21.966  -22.799 190.401 1.00 695.91 ?  -97  DG  J N2    1 
ATOM 4453  N N3    . DG  A 1 216 ? 20.077  -23.420 189.219 1.00 695.91 ?  -97  DG  J N3    1 
ATOM 4454  C C4    . DG  A 1 216 ? 19.485  -24.481 188.607 1.00 695.91 ?  -97  DG  J C4    1 
ATOM 4455  P P     . DT  A 1 217 ? 14.519  -21.400 185.596 1.00 697.39 ?  -96  DT  J P     1 
ATOM 4456  O OP1   . DT  A 1 217 ? 13.291  -20.576 185.579 1.00 697.39 ?  -96  DT  J OP1   1 
ATOM 4457  O OP2   . DT  A 1 217 ? 14.512  -22.720 184.919 1.00 697.39 -1 -96  DT  J OP2   1 
ATOM 4458  O "O5'" . DT  A 1 217 ? 15.717  -20.540 184.968 1.00 697.39 ?  -96  DT  J "O5'" 1 
ATOM 4459  C "C5'" . DT  A 1 217 ? 16.299  -19.440 185.678 1.00 697.39 ?  -96  DT  J "C5'" 1 
ATOM 4460  C "C4'" . DT  A 1 217 ? 17.811  -19.406 185.491 1.00 697.39 ?  -96  DT  J "C4'" 1 
ATOM 4461  O "O4'" . DT  A 1 217 ? 18.378  -20.692 185.845 1.00 697.39 ?  -96  DT  J "O4'" 1 
ATOM 4462  C "C3'" . DT  A 1 217 ? 18.286  -19.104 184.067 1.00 697.39 ?  -96  DT  J "C3'" 1 
ATOM 4463  O "O3'" . DT  A 1 217 ? 18.839  -17.766 183.958 1.00 697.39 ?  -96  DT  J "O3'" 1 
ATOM 4464  C "C2'" . DT  A 1 217 ? 19.270  -20.223 183.701 1.00 697.39 ?  -96  DT  J "C2'" 1 
ATOM 4465  C "C1'" . DT  A 1 217 ? 19.484  -20.976 185.013 1.00 697.39 ?  -96  DT  J "C1'" 1 
ATOM 4466  N N1    . DT  A 1 217 ? 19.606  -22.477 184.879 1.00 697.39 ?  -96  DT  J N1    1 
ATOM 4467  C C2    . DT  A 1 217 ? 20.649  -23.147 185.507 1.00 697.39 ?  -96  DT  J C2    1 
ATOM 4468  O O2    . DT  A 1 217 ? 21.516  -22.604 186.180 1.00 697.39 ?  -96  DT  J O2    1 
ATOM 4469  N N3    . DT  A 1 217 ? 20.648  -24.511 185.314 1.00 697.39 ?  -96  DT  J N3    1 
ATOM 4470  C C4    . DT  A 1 217 ? 19.739  -25.260 184.581 1.00 697.39 ?  -96  DT  J C4    1 
ATOM 4471  O O4    . DT  A 1 217 ? 19.841  -26.480 184.480 1.00 697.39 ?  -96  DT  J O4    1 
ATOM 4472  C C5    . DT  A 1 217 ? 18.676  -24.503 183.958 1.00 697.39 ?  -96  DT  J C5    1 
ATOM 4473  C C7    . DT  A 1 217 ? 17.620  -25.186 183.135 1.00 697.39 ?  -96  DT  J C7    1 
ATOM 4474  C C6    . DT  A 1 217 ? 18.662  -23.172 184.137 1.00 697.39 ?  -96  DT  J C6    1 
ATOM 4475  P P     . DT  A 1 218 ? 20.120  -17.202 184.755 1.00 693.35 ?  -95  DT  J P     1 
ATOM 4476  O OP1   . DT  A 1 218 ? 20.142  -17.746 186.134 1.00 693.35 ?  -95  DT  J OP1   1 
ATOM 4477  O OP2   . DT  A 1 218 ? 20.127  -15.732 184.566 1.00 693.35 -1 -95  DT  J OP2   1 
ATOM 4478  O "O5'" . DT  A 1 218 ? 21.343  -17.799 183.907 1.00 693.35 ?  -95  DT  J "O5'" 1 
ATOM 4479  C "C5'" . DT  A 1 218 ? 22.595  -18.116 184.525 1.00 693.35 ?  -95  DT  J "C5'" 1 
ATOM 4480  C "C4'" . DT  A 1 218 ? 23.507  -18.934 183.619 1.00 693.35 ?  -95  DT  J "C4'" 1 
ATOM 4481  O "O4'" . DT  A 1 218 ? 23.079  -20.321 183.588 1.00 693.35 ?  -95  DT  J "O4'" 1 
ATOM 4482  C "C3'" . DT  A 1 218 ? 23.617  -18.496 182.154 1.00 693.35 ?  -95  DT  J "C3'" 1 
ATOM 4483  O "O3'" . DT  A 1 218 ? 24.997  -18.414 181.821 1.00 693.35 ?  -95  DT  J "O3'" 1 
ATOM 4484  C "C2'" . DT  A 1 218 ? 22.944  -19.636 181.393 1.00 693.35 ?  -95  DT  J "C2'" 1 
ATOM 4485  C "C1'" . DT  A 1 218 ? 23.348  -20.801 182.289 1.00 693.35 ?  -95  DT  J "C1'" 1 
ATOM 4486  N N1    . DT  A 1 218 ? 22.652  -22.113 182.061 1.00 693.35 ?  -95  DT  J N1    1 
ATOM 4487  C C2    . DT  A 1 218 ? 23.222  -23.277 182.561 1.00 693.35 ?  -95  DT  J C2    1 
ATOM 4488  O O2    . DT  A 1 218 ? 24.270  -23.316 183.187 1.00 693.35 ?  -95  DT  J O2    1 
ATOM 4489  N N3    . DT  A 1 218 ? 22.507  -24.421 182.297 1.00 693.35 ?  -95  DT  J N3    1 
ATOM 4490  C C4    . DT  A 1 218 ? 21.312  -24.522 181.606 1.00 693.35 ?  -95  DT  J C4    1 
ATOM 4491  O O4    . DT  A 1 218 ? 20.762  -25.604 181.434 1.00 693.35 ?  -95  DT  J O4    1 
ATOM 4492  C C5    . DT  A 1 218 ? 20.772  -23.274 181.110 1.00 693.35 ?  -95  DT  J C5    1 
ATOM 4493  C C7    . DT  A 1 218 ? 19.482  -23.236 180.342 1.00 693.35 ?  -95  DT  J C7    1 
ATOM 4494  C C6    . DT  A 1 218 ? 21.459  -22.149 181.358 1.00 693.35 ?  -95  DT  J C6    1 
ATOM 4495  P P     . DA  A 1 219 ? 25.550  -17.527 180.609 1.00 685.50 ?  -94  DA  J P     1 
ATOM 4496  O OP1   . DA  A 1 219 ? 25.156  -16.121 180.852 1.00 685.50 ?  -94  DA  J OP1   1 
ATOM 4497  O OP2   . DA  A 1 219 ? 25.181  -18.195 179.337 1.00 685.50 -1 -94  DA  J OP2   1 
ATOM 4498  O "O5'" . DA  A 1 219 ? 27.136  -17.649 180.793 1.00 685.50 ?  -94  DA  J "O5'" 1 
ATOM 4499  C "C5'" . DA  A 1 219 ? 27.725  -18.023 182.047 1.00 685.50 ?  -94  DA  J "C5'" 1 
ATOM 4500  C "C4'" . DA  A 1 219 ? 28.428  -19.373 181.974 1.00 685.50 ?  -94  DA  J "C4'" 1 
ATOM 4501  O "O4'" . DA  A 1 219 ? 27.445  -20.446 181.881 1.00 685.50 ?  -94  DA  J "O4'" 1 
ATOM 4502  C "C3'" . DA  A 1 219 ? 29.398  -19.582 180.805 1.00 685.50 ?  -94  DA  J "C3'" 1 
ATOM 4503  O "O3'" . DA  A 1 219 ? 30.586  -20.229 181.283 1.00 685.50 ?  -94  DA  J "O3'" 1 
ATOM 4504  C "C2'" . DA  A 1 219 ? 28.593  -20.472 179.858 1.00 685.50 ?  -94  DA  J "C2'" 1 
ATOM 4505  C "C1'" . DA  A 1 219 ? 27.819  -21.336 180.848 1.00 685.50 ?  -94  DA  J "C1'" 1 
ATOM 4506  N N9    . DA  A 1 219 ? 26.625  -21.982 180.302 1.00 685.50 ?  -94  DA  J N9    1 
ATOM 4507  C C8    . DA  A 1 219 ? 25.594  -21.386 179.628 1.00 685.50 ?  -94  DA  J C8    1 
ATOM 4508  N N7    . DA  A 1 219 ? 24.646  -22.217 179.258 1.00 685.50 ?  -94  DA  J N7    1 
ATOM 4509  C C5    . DA  A 1 219 ? 25.085  -23.450 179.717 1.00 685.50 ?  -94  DA  J C5    1 
ATOM 4510  C C6    . DA  A 1 219 ? 24.535  -24.753 179.647 1.00 685.50 ?  -94  DA  J C6    1 
ATOM 4511  N N6    . DA  A 1 219 ? 23.369  -25.028 179.054 1.00 685.50 ?  -94  DA  J N6    1 
ATOM 4512  N N1    . DA  A 1 219 ? 25.228  -25.770 180.210 1.00 685.50 ?  -94  DA  J N1    1 
ATOM 4513  C C2    . DA  A 1 219 ? 26.396  -25.496 180.807 1.00 685.50 ?  -94  DA  J C2    1 
ATOM 4514  N N3    . DA  A 1 219 ? 27.012  -24.316 180.937 1.00 685.50 ?  -94  DA  J N3    1 
ATOM 4515  C C4    . DA  A 1 219 ? 26.304  -23.324 180.367 1.00 685.50 ?  -94  DA  J C4    1 
ATOM 4516  P P     . DA  A 1 220 ? 31.966  -20.282 180.460 1.00 684.76 ?  -93  DA  J P     1 
ATOM 4517  O OP1   . DA  A 1 220 ? 32.765  -19.111 180.874 1.00 684.76 ?  -93  DA  J OP1   1 
ATOM 4518  O OP2   . DA  A 1 220 ? 31.681  -20.510 179.025 1.00 684.76 -1 -93  DA  J OP2   1 
ATOM 4519  O "O5'" . DA  A 1 220 ? 32.690  -21.597 181.021 1.00 684.76 ?  -93  DA  J "O5'" 1 
ATOM 4520  C "C5'" . DA  A 1 220 ? 32.006  -22.555 181.840 1.00 684.76 ?  -93  DA  J "C5'" 1 
ATOM 4521  C "C4'" . DA  A 1 220 ? 31.793  -23.898 181.150 1.00 684.76 ?  -93  DA  J "C4'" 1 
ATOM 4522  O "O4'" . DA  A 1 220 ? 30.473  -23.951 180.544 1.00 684.76 ?  -93  DA  J "O4'" 1 
ATOM 4523  C "C3'" . DA  A 1 220 ? 32.781  -24.295 180.049 1.00 684.76 ?  -93  DA  J "C3'" 1 
ATOM 4524  O "O3'" . DA  A 1 220 ? 33.342  -25.573 180.393 1.00 684.76 ?  -93  DA  J "O3'" 1 
ATOM 4525  C "C2'" . DA  A 1 220 ? 31.915  -24.317 178.782 1.00 684.76 ?  -93  DA  J "C2'" 1 
ATOM 4526  C "C1'" . DA  A 1 220 ? 30.569  -24.726 179.365 1.00 684.76 ?  -93  DA  J "C1'" 1 
ATOM 4527  N N9    . DA  A 1 220 ? 29.383  -24.487 178.537 1.00 684.76 ?  -93  DA  J N9    1 
ATOM 4528  C C8    . DA  A 1 220 ? 28.942  -23.292 178.032 1.00 684.76 ?  -93  DA  J C8    1 
ATOM 4529  N N7    . DA  A 1 220 ? 27.834  -23.373 177.332 1.00 684.76 ?  -93  DA  J N7    1 
ATOM 4530  C C5    . DA  A 1 220 ? 27.522  -24.721 177.380 1.00 684.76 ?  -93  DA  J C5    1 
ATOM 4531  C C6    . DA  A 1 220 ? 26.457  -25.468 176.832 1.00 684.76 ?  -93  DA  J C6    1 
ATOM 4532  N N6    . DA  A 1 220 ? 25.486  -24.923 176.098 1.00 684.76 ?  -93  DA  J N6    1 
ATOM 4533  N N1    . DA  A 1 220 ? 26.433  -26.799 177.065 1.00 684.76 ?  -93  DA  J N1    1 
ATOM 4534  C C2    . DA  A 1 220 ? 27.412  -27.344 177.803 1.00 684.76 ?  -93  DA  J C2    1 
ATOM 4535  N N3    . DA  A 1 220 ? 28.464  -26.749 178.370 1.00 684.76 ?  -93  DA  J N3    1 
ATOM 4536  C C4    . DA  A 1 220 ? 28.463  -25.424 178.119 1.00 684.76 ?  -93  DA  J C4    1 
ATOM 4537  P P     . DA  A 1 221 ? 34.352  -26.384 179.448 1.00 687.33 ?  -92  DA  J P     1 
ATOM 4538  O OP1   . DA  A 1 221 ? 35.418  -26.968 180.289 1.00 687.33 ?  -92  DA  J OP1   1 
ATOM 4539  O OP2   . DA  A 1 221 ? 34.720  -25.536 178.292 1.00 687.33 -1 -92  DA  J OP2   1 
ATOM 4540  O "O5'" . DA  A 1 221 ? 33.426  -27.564 178.903 1.00 687.33 ?  -92  DA  J "O5'" 1 
ATOM 4541  C "C5'" . DA  A 1 221 ? 33.001  -28.626 179.751 1.00 687.33 ?  -92  DA  J "C5'" 1 
ATOM 4542  C "C4'" . DA  A 1 221 ? 32.312  -29.700 178.928 1.00 687.33 ?  -92  DA  J "C4'" 1 
ATOM 4543  O "O4'" . DA  A 1 221 ? 31.156  -29.147 178.251 1.00 687.33 ?  -92  DA  J "O4'" 1 
ATOM 4544  C "C3'" . DA  A 1 221 ? 33.170  -30.343 177.847 1.00 687.33 ?  -92  DA  J "C3'" 1 
ATOM 4545  O "O3'" . DA  A 1 221 ? 32.931  -31.740 177.902 1.00 687.33 ?  -92  DA  J "O3'" 1 
ATOM 4546  C "C2'" . DA  A 1 221 ? 32.697  -29.684 176.550 1.00 687.33 ?  -92  DA  J "C2'" 1 
ATOM 4547  C "C1'" . DA  A 1 221 ? 31.243  -29.340 176.854 1.00 687.33 ?  -92  DA  J "C1'" 1 
ATOM 4548  N N9    . DA  A 1 221 ? 30.749  -28.114 176.224 1.00 687.33 ?  -92  DA  J N9    1 
ATOM 4549  C C8    . DA  A 1 221 ? 31.301  -26.868 176.307 1.00 687.33 ?  -92  DA  J C8    1 
ATOM 4550  N N7    . DA  A 1 221 ? 30.645  -25.943 175.649 1.00 687.33 ?  -92  DA  J N7    1 
ATOM 4551  C C5    . DA  A 1 221 ? 29.583  -26.627 175.095 1.00 687.33 ?  -92  DA  J C5    1 
ATOM 4552  C C6    . DA  A 1 221 ? 28.512  -26.208 174.277 1.00 687.33 ?  -92  DA  J C6    1 
ATOM 4553  N N6    . DA  A 1 221 ? 28.352  -24.944 173.873 1.00 687.33 ?  -92  DA  J N6    1 
ATOM 4554  N N1    . DA  A 1 221 ? 27.610  -27.139 173.895 1.00 687.33 ?  -92  DA  J N1    1 
ATOM 4555  C C2    . DA  A 1 221 ? 27.777  -28.407 174.305 1.00 687.33 ?  -92  DA  J C2    1 
ATOM 4556  N N3    . DA  A 1 221 ? 28.743  -28.921 175.071 1.00 687.33 ?  -92  DA  J N3    1 
ATOM 4557  C C4    . DA  A 1 221 ? 29.627  -27.970 175.438 1.00 687.33 ?  -92  DA  J C4    1 
ATOM 4558  P P     . DA  A 1 222 ? 33.645  -32.775 176.918 1.00 683.20 ?  -91  DA  J P     1 
ATOM 4559  O OP1   . DA  A 1 222 ? 33.573  -34.118 177.530 1.00 683.20 ?  -91  DA  J OP1   1 
ATOM 4560  O OP2   . DA  A 1 222 ? 34.957  -32.230 176.509 1.00 683.20 -1 -91  DA  J OP2   1 
ATOM 4561  O "O5'" . DA  A 1 222 ? 32.664  -32.736 175.658 1.00 683.20 ?  -91  DA  J "O5'" 1 
ATOM 4562  C "C5'" . DA  A 1 222 ? 31.282  -33.026 175.849 1.00 683.20 ?  -91  DA  J "C5'" 1 
ATOM 4563  C "C4'" . DA  A 1 222 ? 30.497  -32.972 174.551 1.00 683.20 ?  -91  DA  J "C4'" 1 
ATOM 4564  O "O4'" . DA  A 1 222 ? 30.202  -31.593 174.225 1.00 683.20 ?  -91  DA  J "O4'" 1 
ATOM 4565  C "C3'" . DA  A 1 222 ? 31.195  -33.582 173.341 1.00 683.20 ?  -91  DA  J "C3'" 1 
ATOM 4566  O "O3'" . DA  A 1 222 ? 30.355  -34.593 172.812 1.00 683.20 ?  -91  DA  J "O3'" 1 
ATOM 4567  C "C2'" . DA  A 1 222 ? 31.363  -32.416 172.372 1.00 683.20 ?  -91  DA  J "C2'" 1 
ATOM 4568  C "C1'" . DA  A 1 222 ? 30.275  -31.451 172.827 1.00 683.20 ?  -91  DA  J "C1'" 1 
ATOM 4569  N N9    . DA  A 1 222 ? 30.567  -30.055 172.531 1.00 683.20 ?  -91  DA  J N9    1 
ATOM 4570  C C8    . DA  A 1 222 ? 31.641  -29.329 172.959 1.00 683.20 ?  -91  DA  J C8    1 
ATOM 4571  N N7    . DA  A 1 222 ? 31.649  -28.088 172.537 1.00 683.20 ?  -91  DA  J N7    1 
ATOM 4572  C C5    . DA  A 1 222 ? 30.499  -27.992 171.781 1.00 683.20 ?  -91  DA  J C5    1 
ATOM 4573  C C6    . DA  A 1 222 ? 29.930  -26.930 171.052 1.00 683.20 ?  -91  DA  J C6    1 
ATOM 4574  N N6    . DA  A 1 222 ? 30.481  -25.716 170.977 1.00 683.20 ?  -91  DA  J N6    1 
ATOM 4575  N N1    . DA  A 1 222 ? 28.770  -27.161 170.399 1.00 683.20 ?  -91  DA  J N1    1 
ATOM 4576  C C2    . DA  A 1 222 ? 28.221  -28.382 170.478 1.00 683.20 ?  -91  DA  J C2    1 
ATOM 4577  N N3    . DA  A 1 222 ? 28.666  -29.458 171.131 1.00 683.20 ?  -91  DA  J N3    1 
ATOM 4578  C C4    . DA  A 1 222 ? 29.820  -29.197 171.765 1.00 683.20 ?  -91  DA  J C4    1 
ATOM 4579  P P     . DC  A 1 223 ? 30.926  -35.912 172.102 1.00 687.09 ?  -90  DC  J P     1 
ATOM 4580  O OP1   . DC  A 1 223 ? 30.367  -37.076 172.821 1.00 687.09 ?  -90  DC  J OP1   1 
ATOM 4581  O OP2   . DC  A 1 223 ? 32.392  -35.791 171.920 1.00 687.09 -1 -90  DC  J OP2   1 
ATOM 4582  O "O5'" . DC  A 1 223 ? 30.251  -35.842 170.655 1.00 687.09 ?  -90  DC  J "O5'" 1 
ATOM 4583  C "C5'" . DC  A 1 223 ? 29.114  -35.007 170.438 1.00 687.09 ?  -90  DC  J "C5'" 1 
ATOM 4584  C "C4'" . DC  A 1 223 ? 29.225  -34.204 169.151 1.00 687.09 ?  -90  DC  J "C4'" 1 
ATOM 4585  O "O4'" . DC  A 1 223 ? 29.638  -32.848 169.431 1.00 687.09 ?  -90  DC  J "O4'" 1 
ATOM 4586  C "C3'" . DC  A 1 223 ? 30.229  -34.716 168.121 1.00 687.09 ?  -90  DC  J "C3'" 1 
ATOM 4587  O "O3'" . DC  A 1 223 ? 29.510  -35.518 167.175 1.00 687.09 ?  -90  DC  J "O3'" 1 
ATOM 4588  C "C2'" . DC  A 1 223 ? 30.846  -33.439 167.528 1.00 687.09 ?  -90  DC  J "C2'" 1 
ATOM 4589  C "C1'" . DC  A 1 223 ? 30.059  -32.313 168.196 1.00 687.09 ?  -90  DC  J "C1'" 1 
ATOM 4590  N N1    . DC  A 1 223 ? 30.789  -31.022 168.455 1.00 687.09 ?  -90  DC  J N1    1 
ATOM 4591  C C2    . DC  A 1 223 ? 30.240  -29.802 168.006 1.00 687.09 ?  -90  DC  J C2    1 
ATOM 4592  O O2    . DC  A 1 223 ? 29.166  -29.777 167.390 1.00 687.09 ?  -90  DC  J O2    1 
ATOM 4593  N N3    . DC  A 1 223 ? 30.908  -28.648 168.261 1.00 687.09 ?  -90  DC  J N3    1 
ATOM 4594  C C4    . DC  A 1 223 ? 32.064  -28.671 168.923 1.00 687.09 ?  -90  DC  J C4    1 
ATOM 4595  N N4    . DC  A 1 223 ? 32.666  -27.500 169.138 1.00 687.09 ?  -90  DC  J N4    1 
ATOM 4596  C C5    . DC  A 1 223 ? 32.641  -29.894 169.393 1.00 687.09 ?  -90  DC  J C5    1 
ATOM 4597  C C6    . DC  A 1 223 ? 31.976  -31.029 169.141 1.00 687.09 ?  -90  DC  J C6    1 
ATOM 4598  P P     . DG  A 1 224 ? 30.187  -36.278 165.937 1.00 689.14 ?  -89  DG  J P     1 
ATOM 4599  O OP1   . DG  A 1 224 ? 29.380  -37.487 165.682 1.00 689.14 ?  -89  DG  J OP1   1 
ATOM 4600  O OP2   . DG  A 1 224 ? 31.641  -36.411 166.186 1.00 689.14 -1 -89  DG  J OP2   1 
ATOM 4601  O "O5'" . DG  A 1 224 ? 29.959  -35.252 164.728 1.00 689.14 ?  -89  DG  J "O5'" 1 
ATOM 4602  C "C5'" . DG  A 1 224 ? 28.746  -34.490 164.614 1.00 689.14 ?  -89  DG  J "C5'" 1 
ATOM 4603  C "C4'" . DG  A 1 224 ? 28.908  -33.307 163.669 1.00 689.14 ?  -89  DG  J "C4'" 1 
ATOM 4604  O "O4'" . DG  A 1 224 ? 29.543  -32.190 164.351 1.00 689.14 ?  -89  DG  J "O4'" 1 
ATOM 4605  C "C3'" . DG  A 1 224 ? 29.740  -33.587 162.414 1.00 689.14 ?  -89  DG  J "C3'" 1 
ATOM 4606  O "O3'" . DG  A 1 224 ? 28.986  -33.236 161.237 1.00 689.14 ?  -89  DG  J "O3'" 1 
ATOM 4607  C "C2'" . DG  A 1 224 ? 31.012  -32.756 162.623 1.00 689.14 ?  -89  DG  J "C2'" 1 
ATOM 4608  C "C1'" . DG  A 1 224 ? 30.523  -31.614 163.504 1.00 689.14 ?  -89  DG  J "C1'" 1 
ATOM 4609  N N9    . DG  A 1 224 ? 31.585  -31.013 164.313 1.00 689.14 ?  -89  DG  J N9    1 
ATOM 4610  C C8    . DG  A 1 224 ? 32.527  -31.678 165.067 1.00 689.14 ?  -89  DG  J C8    1 
ATOM 4611  N N7    . DG  A 1 224 ? 33.354  -30.892 165.695 1.00 689.14 ?  -89  DG  J N7    1 
ATOM 4612  C C5    . DG  A 1 224 ? 32.943  -29.615 165.336 1.00 689.14 ?  -89  DG  J C5    1 
ATOM 4613  C C6    . DG  A 1 224 ? 33.468  -28.352 165.712 1.00 689.14 ?  -89  DG  J C6    1 
ATOM 4614  O O6    . DG  A 1 224 ? 34.427  -28.120 166.456 1.00 689.14 ?  -89  DG  J O6    1 
ATOM 4615  N N1    . DG  A 1 224 ? 32.765  -27.295 165.132 1.00 689.14 ?  -89  DG  J N1    1 
ATOM 4616  C C2    . DG  A 1 224 ? 31.685  -27.444 164.288 1.00 689.14 ?  -89  DG  J C2    1 
ATOM 4617  N N2    . DG  A 1 224 ? 31.132  -26.311 163.825 1.00 689.14 ?  -89  DG  J N2    1 
ATOM 4618  N N3    . DG  A 1 224 ? 31.181  -28.624 163.928 1.00 689.14 ?  -89  DG  J N3    1 
ATOM 4619  C C4    . DG  A 1 224 ? 31.855  -29.668 164.485 1.00 689.14 ?  -89  DG  J C4    1 
ATOM 4620  P P     . DC  A 1 225 ? 29.634  -33.036 159.773 1.00 694.30 ?  -88  DC  J P     1 
ATOM 4621  O OP1   . DC  A 1 225 ? 28.560  -33.242 158.776 1.00 694.30 ?  -88  DC  J OP1   1 
ATOM 4622  O OP2   . DC  A 1 225 ? 30.891  -33.819 159.641 1.00 694.30 -1 -88  DC  J OP2   1 
ATOM 4623  O "O5'" . DC  A 1 225 ? 30.011  -31.476 159.834 1.00 694.30 ?  -88  DC  J "O5'" 1 
ATOM 4624  C "C5'" . DC  A 1 225 ? 29.122  -30.457 159.364 1.00 694.30 ?  -88  DC  J "C5'" 1 
ATOM 4625  C "C4'" . DC  A 1 225 ? 29.928  -29.409 158.611 1.00 694.30 ?  -88  DC  J "C4'" 1 
ATOM 4626  O "O4'" . DC  A 1 225 ? 30.931  -28.833 159.493 1.00 694.30 ?  -88  DC  J "O4'" 1 
ATOM 4627  C "C3'" . DC  A 1 225 ? 30.685  -29.933 157.393 1.00 694.30 ?  -88  DC  J "C3'" 1 
ATOM 4628  O "O3'" . DC  A 1 225 ? 30.635  -28.961 156.354 1.00 694.30 ?  -88  DC  J "O3'" 1 
ATOM 4629  C "C2'" . DC  A 1 225 ? 32.107  -30.150 157.912 1.00 694.30 ?  -88  DC  J "C2'" 1 
ATOM 4630  C "C1'" . DC  A 1 225 ? 32.242  -29.116 159.028 1.00 694.30 ?  -88  DC  J "C1'" 1 
ATOM 4631  N N1    . DC  A 1 225 ? 33.096  -29.571 160.189 1.00 694.30 ?  -88  DC  J N1    1 
ATOM 4632  C C2    . DC  A 1 225 ? 33.628  -28.626 161.086 1.00 694.30 ?  -88  DC  J C2    1 
ATOM 4633  O O2    . DC  A 1 225 ? 33.394  -27.422 160.922 1.00 694.30 ?  -88  DC  J O2    1 
ATOM 4634  N N3    . DC  A 1 225 ? 34.392  -29.061 162.121 1.00 694.30 ?  -88  DC  J N3    1 
ATOM 4635  C C4    . DC  A 1 225 ? 34.633  -30.366 162.281 1.00 694.30 ?  -88  DC  J C4    1 
ATOM 4636  N N4    . DC  A 1 225 ? 35.388  -30.742 163.315 1.00 694.30 ?  -88  DC  J N4    1 
ATOM 4637  C C5    . DC  A 1 225 ? 34.107  -31.347 161.387 1.00 694.30 ?  -88  DC  J C5    1 
ATOM 4638  C C6    . DC  A 1 225 ? 33.353  -30.908 160.371 1.00 694.30 ?  -88  DC  J C6    1 
ATOM 4639  P P     . DG  A 1 226 ? 31.265  -29.209 154.896 1.00 692.83 ?  -87  DG  J P     1 
ATOM 4640  O OP1   . DG  A 1 226 ? 30.152  -29.681 154.041 1.00 692.83 ?  -87  DG  J OP1   1 
ATOM 4641  O OP2   . DG  A 1 226 ? 32.509  -30.015 154.978 1.00 692.83 -1 -87  DG  J OP2   1 
ATOM 4642  O "O5'" . DG  A 1 226 ? 31.679  -27.718 154.461 1.00 692.83 ?  -87  DG  J "O5'" 1 
ATOM 4643  C "C5'" . DG  A 1 226 ? 31.965  -26.684 155.426 1.00 692.83 ?  -87  DG  J "C5'" 1 
ATOM 4644  C "C4'" . DG  A 1 226 ? 33.431  -26.260 155.425 1.00 692.83 ?  -87  DG  J "C4'" 1 
ATOM 4645  O "O4'" . DG  A 1 226 ? 34.100  -26.767 156.613 1.00 692.83 ?  -87  DG  J "O4'" 1 
ATOM 4646  C "C3'" . DG  A 1 226 ? 34.272  -26.734 154.240 1.00 692.83 ?  -87  DG  J "C3'" 1 
ATOM 4647  O "O3'" . DG  A 1 226 ? 35.146  -25.690 153.826 1.00 692.83 ?  -87  DG  J "O3'" 1 
ATOM 4648  C "C2'" . DG  A 1 226 ? 35.053  -27.914 154.816 1.00 692.83 ?  -87  DG  J "C2'" 1 
ATOM 4649  C "C1'" . DG  A 1 226 ? 35.317  -27.378 156.217 1.00 692.83 ?  -87  DG  J "C1'" 1 
ATOM 4650  N N9    . DG  A 1 226 ? 35.727  -28.366 157.216 1.00 692.83 ?  -87  DG  J N9    1 
ATOM 4651  C C8    . DG  A 1 226 ? 35.339  -29.682 157.324 1.00 692.83 ?  -87  DG  J C8    1 
ATOM 4652  N N7    . DG  A 1 226 ? 35.884  -30.308 158.330 1.00 692.83 ?  -87  DG  J N7    1 
ATOM 4653  C C5    . DG  A 1 226 ? 36.689  -29.347 158.930 1.00 692.83 ?  -87  DG  J C5    1 
ATOM 4654  C C6    . DG  A 1 226 ? 37.532  -29.434 160.067 1.00 692.83 ?  -87  DG  J C6    1 
ATOM 4655  O O6    . DG  A 1 226 ? 37.733  -30.417 160.793 1.00 692.83 ?  -87  DG  J O6    1 
ATOM 4656  N N1    . DG  A 1 226 ? 38.181  -28.224 160.339 1.00 692.83 ?  -87  DG  J N1    1 
ATOM 4657  C C2    . DG  A 1 226 ? 38.030  -27.068 159.600 1.00 692.83 ?  -87  DG  J C2    1 
ATOM 4658  N N2    . DG  A 1 226 ? 38.730  -25.995 160.005 1.00 692.83 ?  -87  DG  J N2    1 
ATOM 4659  N N3    . DG  A 1 226 ? 37.242  -26.975 158.531 1.00 692.83 ?  -87  DG  J N3    1 
ATOM 4660  C C4    . DG  A 1 226 ? 36.604  -28.146 158.254 1.00 692.83 ?  -87  DG  J C4    1 
ATOM 4661  P P     . DG  A 1 227 ? 35.554  -25.565 152.283 1.00 691.15 ?  -86  DG  J P     1 
ATOM 4662  O OP1   . DG  A 1 227 ? 34.406  -24.906 151.625 1.00 691.15 ?  -86  DG  J OP1   1 
ATOM 4663  O OP2   . DG  A 1 227 ? 36.025  -26.888 151.810 1.00 691.15 -1 -86  DG  J OP2   1 
ATOM 4664  O "O5'" . DG  A 1 227 ? 36.821  -24.582 152.259 1.00 691.15 ?  -86  DG  J "O5'" 1 
ATOM 4665  C "C5'" . DG  A 1 227 ? 37.164  -23.755 153.376 1.00 691.15 ?  -86  DG  J "C5'" 1 
ATOM 4666  C "C4'" . DG  A 1 227 ? 38.558  -24.053 153.917 1.00 691.15 ?  -86  DG  J "C4'" 1 
ATOM 4667  O "O4'" . DG  A 1 227 ? 38.515  -25.201 154.802 1.00 691.15 ?  -86  DG  J "O4'" 1 
ATOM 4668  C "C3'" . DG  A 1 227 ? 39.653  -24.357 152.891 1.00 691.15 ?  -86  DG  J "C3'" 1 
ATOM 4669  O "O3'" . DG  A 1 227 ? 40.829  -23.635 153.233 1.00 691.15 ?  -86  DG  J "O3'" 1 
ATOM 4670  C "C2'" . DG  A 1 227 ? 39.877  -25.857 153.044 1.00 691.15 ?  -86  DG  J "C2'" 1 
ATOM 4671  C "C1'" . DG  A 1 227 ? 39.656  -25.983 154.545 1.00 691.15 ?  -86  DG  J "C1'" 1 
ATOM 4672  N N9    . DG  A 1 227 ? 39.398  -27.323 155.055 1.00 691.15 ?  -86  DG  J N9    1 
ATOM 4673  C C8    . DG  A 1 227 ? 38.689  -28.340 154.463 1.00 691.15 ?  -86  DG  J C8    1 
ATOM 4674  N N7    . DG  A 1 227 ? 38.634  -29.424 155.185 1.00 691.15 ?  -86  DG  J N7    1 
ATOM 4675  C C5    . DG  A 1 227 ? 39.349  -29.105 156.334 1.00 691.15 ?  -86  DG  J C5    1 
ATOM 4676  C C6    . DG  A 1 227 ? 39.636  -29.880 157.488 1.00 691.15 ?  -86  DG  J C6    1 
ATOM 4677  O O6    . DG  A 1 227 ? 39.303  -31.047 157.733 1.00 691.15 ?  -86  DG  J O6    1 
ATOM 4678  N N1    . DG  A 1 227 ? 40.395  -29.173 158.420 1.00 691.15 ?  -86  DG  J N1    1 
ATOM 4679  C C2    . DG  A 1 227 ? 40.824  -27.873 158.255 1.00 691.15 ?  -86  DG  J C2    1 
ATOM 4680  N N2    . DG  A 1 227 ? 41.541  -27.340 159.254 1.00 691.15 ?  -86  DG  J N2    1 
ATOM 4681  N N3    . DG  A 1 227 ? 40.559  -27.137 157.183 1.00 691.15 ?  -86  DG  J N3    1 
ATOM 4682  C C4    . DG  A 1 227 ? 39.822  -27.813 156.266 1.00 691.15 ?  -86  DG  J C4    1 
ATOM 4683  P P     . DG  A 1 228 ? 41.025  -22.122 152.749 1.00 682.11 ?  -85  DG  J P     1 
ATOM 4684  O OP1   . DG  A 1 228 ? 39.817  -21.348 153.124 1.00 682.11 ?  -85  DG  J OP1   1 
ATOM 4685  O OP2   . DG  A 1 228 ? 41.476  -22.163 151.340 1.00 682.11 -1 -85  DG  J OP2   1 
ATOM 4686  O "O5'" . DG  A 1 228 ? 42.264  -21.616 153.626 1.00 682.11 ?  -85  DG  J "O5'" 1 
ATOM 4687  C "C5'" . DG  A 1 228 ? 42.131  -21.382 155.026 1.00 682.11 ?  -85  DG  J "C5'" 1 
ATOM 4688  C "C4'" . DG  A 1 228 ? 43.294  -21.980 155.809 1.00 682.11 ?  -85  DG  J "C4'" 1 
ATOM 4689  O "O4'" . DG  A 1 228 ? 43.107  -23.411 155.947 1.00 682.11 ?  -85  DG  J "O4'" 1 
ATOM 4690  C "C3'" . DG  A 1 228 ? 44.696  -21.814 155.220 1.00 682.11 ?  -85  DG  J "C3'" 1 
ATOM 4691  O "O3'" . DG  A 1 228 ? 45.603  -21.607 156.292 1.00 682.11 ?  -85  DG  J "O3'" 1 
ATOM 4692  C "C2'" . DG  A 1 228 ? 44.960  -23.156 154.546 1.00 682.11 ?  -85  DG  J "C2'" 1 
ATOM 4693  C "C1'" . DG  A 1 228 ? 44.298  -24.072 155.567 1.00 682.11 ?  -85  DG  J "C1'" 1 
ATOM 4694  N N9    . DG  A 1 228 ? 43.885  -25.384 155.097 1.00 682.11 ?  -85  DG  J N9    1 
ATOM 4695  C C8    . DG  A 1 228 ? 43.411  -25.721 153.854 1.00 682.11 ?  -85  DG  J C8    1 
ATOM 4696  N N7    . DG  A 1 228 ? 43.106  -26.985 153.747 1.00 682.11 ?  -85  DG  J N7    1 
ATOM 4697  C C5    . DG  A 1 228 ? 43.386  -27.516 155.000 1.00 682.11 ?  -85  DG  J C5    1 
ATOM 4698  C C6    . DG  A 1 228 ? 43.251  -28.840 155.486 1.00 682.11 ?  -85  DG  J C6    1 
ATOM 4699  O O6    . DG  A 1 228 ? 42.841  -29.839 154.881 1.00 682.11 ?  -85  DG  J O6    1 
ATOM 4700  N N1    . DG  A 1 228 ? 43.647  -28.953 156.819 1.00 682.11 ?  -85  DG  J N1    1 
ATOM 4701  C C2    . DG  A 1 228 ? 44.117  -27.910 157.590 1.00 682.11 ?  -85  DG  J C2    1 
ATOM 4702  N N2    . DG  A 1 228 ? 44.454  -28.202 158.857 1.00 682.11 ?  -85  DG  J N2    1 
ATOM 4703  N N3    . DG  A 1 228 ? 44.244  -26.665 157.145 1.00 682.11 ?  -85  DG  J N3    1 
ATOM 4704  C C4    . DG  A 1 228 ? 43.862  -26.540 155.846 1.00 682.11 ?  -85  DG  J C4    1 
ATOM 4705  P P     . DG  A 1 229 ? 46.657  -20.395 156.307 1.00 676.60 ?  -84  DG  J P     1 
ATOM 4706  O OP1   . DG  A 1 229 ? 46.027  -19.259 157.023 1.00 676.60 ?  -84  DG  J OP1   1 
ATOM 4707  O OP2   . DG  A 1 229 ? 47.212  -20.215 154.944 1.00 676.60 -1 -84  DG  J OP2   1 
ATOM 4708  O "O5'" . DG  A 1 229 ? 47.840  -20.980 157.211 1.00 676.60 ?  -84  DG  J "O5'" 1 
ATOM 4709  C "C5'" . DG  A 1 229 ? 47.550  -21.754 158.369 1.00 676.60 ?  -84  DG  J "C5'" 1 
ATOM 4710  C "C4'" . DG  A 1 229 ? 48.534  -22.899 158.516 1.00 676.60 ?  -84  DG  J "C4'" 1 
ATOM 4711  O "O4'" . DG  A 1 229 ? 48.038  -24.056 157.801 1.00 676.60 ?  -84  DG  J "O4'" 1 
ATOM 4712  C "C3'" . DG  A 1 229 ? 49.954  -22.640 158.003 1.00 676.60 ?  -84  DG  J "C3'" 1 
ATOM 4713  O "O3'" . DG  A 1 229 ? 50.909  -23.142 158.930 1.00 676.60 ?  -84  DG  J "O3'" 1 
ATOM 4714  C "C2'" . DG  A 1 229 ? 50.015  -23.433 156.700 1.00 676.60 ?  -84  DG  J "C2'" 1 
ATOM 4715  C "C1'" . DG  A 1 229 ? 49.085  -24.596 157.024 1.00 676.60 ?  -84  DG  J "C1'" 1 
ATOM 4716  N N9    . DG  A 1 229 ? 48.443  -25.225 155.881 1.00 676.60 ?  -84  DG  J N9    1 
ATOM 4717  C C8    . DG  A 1 229 ? 48.242  -24.700 154.627 1.00 676.60 ?  -84  DG  J C8    1 
ATOM 4718  N N7    . DG  A 1 229 ? 47.621  -25.517 153.823 1.00 676.60 ?  -84  DG  J N7    1 
ATOM 4719  C C5    . DG  A 1 229 ? 47.392  -26.648 154.593 1.00 676.60 ?  -84  DG  J C5    1 
ATOM 4720  C C6    . DG  A 1 229 ? 46.755  -27.870 154.263 1.00 676.60 ?  -84  DG  J C6    1 
ATOM 4721  O O6    . DG  A 1 229 ? 46.251  -28.199 153.178 1.00 676.60 ?  -84  DG  J O6    1 
ATOM 4722  N N1    . DG  A 1 229 ? 46.733  -28.755 155.346 1.00 676.60 ?  -84  DG  J N1    1 
ATOM 4723  C C2    . DG  A 1 229 ? 47.263  -28.489 156.589 1.00 676.60 ?  -84  DG  J C2    1 
ATOM 4724  N N2    . DG  A 1 229 ? 47.154  -29.451 157.514 1.00 676.60 ?  -84  DG  J N2    1 
ATOM 4725  N N3    . DG  A 1 229 ? 47.861  -27.349 156.906 1.00 676.60 ?  -84  DG  J N3    1 
ATOM 4726  C C4    . DG  A 1 229 ? 47.889  -26.479 155.866 1.00 676.60 ?  -84  DG  J C4    1 
ATOM 4727  P P     . DG  A 1 230 ? 51.215  -22.451 160.343 1.00 669.41 ?  -83  DG  J P     1 
ATOM 4728  O OP1   . DG  A 1 230 ? 49.963  -22.001 160.996 1.00 669.41 ?  -83  DG  J OP1   1 
ATOM 4729  O OP2   . DG  A 1 230 ? 52.318  -21.488 160.121 1.00 669.41 -1 -83  DG  J OP2   1 
ATOM 4730  O "O5'" . DG  A 1 230 ? 51.778  -23.697 161.173 1.00 669.41 ?  -83  DG  J "O5'" 1 
ATOM 4731  C "C5'" . DG  A 1 230 ? 50.894  -24.700 161.679 1.00 669.41 ?  -83  DG  J "C5'" 1 
ATOM 4732  C "C4'" . DG  A 1 230 ? 51.360  -26.106 161.328 1.00 669.41 ?  -83  DG  J "C4'" 1 
ATOM 4733  O "O4'" . DG  A 1 230 ? 50.986  -26.424 159.962 1.00 669.41 ?  -83  DG  J "O4'" 1 
ATOM 4734  C "C3'" . DG  A 1 230 ? 52.867  -26.364 161.425 1.00 669.41 ?  -83  DG  J "C3'" 1 
ATOM 4735  O "O3'" . DG  A 1 230 ? 53.105  -27.419 162.367 1.00 669.41 ?  -83  DG  J "O3'" 1 
ATOM 4736  C "C2'" . DG  A 1 230 ? 53.263  -26.720 159.989 1.00 669.41 ?  -83  DG  J "C2'" 1 
ATOM 4737  C "C1'" . DG  A 1 230 ? 51.962  -27.303 159.458 1.00 669.41 ?  -83  DG  J "C1'" 1 
ATOM 4738  N N9    . DG  A 1 230 ? 51.836  -27.375 158.004 1.00 669.41 ?  -83  DG  J N9    1 
ATOM 4739  C C8    . DG  A 1 230 ? 52.244  -26.449 157.072 1.00 669.41 ?  -83  DG  J C8    1 
ATOM 4740  N N7    . DG  A 1 230 ? 51.991  -26.797 155.840 1.00 669.41 ?  -83  DG  J N7    1 
ATOM 4741  C C5    . DG  A 1 230 ? 51.374  -28.032 155.963 1.00 669.41 ?  -83  DG  J C5    1 
ATOM 4742  C C6    . DG  A 1 230 ? 50.872  -28.901 154.967 1.00 669.41 ?  -83  DG  J C6    1 
ATOM 4743  O O6    . DG  A 1 230 ? 50.879  -28.735 153.743 1.00 669.41 ?  -83  DG  J O6    1 
ATOM 4744  N N1    . DG  A 1 230 ? 50.323  -30.064 155.507 1.00 669.41 ?  -83  DG  J N1    1 
ATOM 4745  C C2    . DG  A 1 230 ? 50.266  -30.347 156.851 1.00 669.41 ?  -83  DG  J C2    1 
ATOM 4746  N N2    . DG  A 1 230 ? 49.701  -31.512 157.188 1.00 669.41 ?  -83  DG  J N2    1 
ATOM 4747  N N3    . DG  A 1 230 ? 50.732  -29.541 157.797 1.00 669.41 ?  -83  DG  J N3    1 
ATOM 4748  C C4    . DG  A 1 230 ? 51.270  -28.404 157.286 1.00 669.41 ?  -83  DG  J C4    1 
ATOM 4749  P P     . DA  A 1 231 ? 54.566  -27.921 162.824 1.00 670.47 ?  -82  DA  J P     1 
ATOM 4750  O OP1   . DA  A 1 231 ? 54.591  -27.914 164.303 1.00 670.47 ?  -82  DA  J OP1   1 
ATOM 4751  O OP2   . DA  A 1 231 ? 55.649  -27.239 162.080 1.00 670.47 -1 -82  DA  J OP2   1 
ATOM 4752  O "O5'" . DA  A 1 231 ? 54.480  -29.438 162.342 1.00 670.47 ?  -82  DA  J "O5'" 1 
ATOM 4753  C "C5'" . DA  A 1 231 ? 53.289  -30.176 162.644 1.00 670.47 ?  -82  DA  J "C5'" 1 
ATOM 4754  C "C4'" . DA  A 1 231 ? 53.296  -31.563 162.027 1.00 670.47 ?  -82  DA  J "C4'" 1 
ATOM 4755  O "O4'" . DA  A 1 231 ? 52.977  -31.486 160.613 1.00 670.47 ?  -82  DA  J "O4'" 1 
ATOM 4756  C "C3'" . DA  A 1 231 ? 54.624  -32.299 162.109 1.00 670.47 ?  -82  DA  J "C3'" 1 
ATOM 4757  O "O3'" . DA  A 1 231 ? 54.348  -33.669 162.294 1.00 670.47 ?  -82  DA  J "O3'" 1 
ATOM 4758  C "C2'" . DA  A 1 231 ? 55.281  -32.026 160.757 1.00 670.47 ?  -82  DA  J "C2'" 1 
ATOM 4759  C "C1'" . DA  A 1 231 ? 54.063  -31.962 159.840 1.00 670.47 ?  -82  DA  J "C1'" 1 
ATOM 4760  N N9    . DA  A 1 231 ? 54.195  -31.054 158.714 1.00 670.47 ?  -82  DA  J N9    1 
ATOM 4761  C C8    . DA  A 1 231 ? 54.662  -29.770 158.723 1.00 670.47 ?  -82  DA  J C8    1 
ATOM 4762  N N7    . DA  A 1 231 ? 54.652  -29.190 157.546 1.00 670.47 ?  -82  DA  J N7    1 
ATOM 4763  C C5    . DA  A 1 231 ? 54.131  -30.166 156.718 1.00 670.47 ?  -82  DA  J C5    1 
ATOM 4764  C C6    . DA  A 1 231 ? 53.865  -30.191 155.343 1.00 670.47 ?  -82  DA  J C6    1 
ATOM 4765  N N6    . DA  A 1 231 ? 54.096  -29.143 154.555 1.00 670.47 ?  -82  DA  J N6    1 
ATOM 4766  N N1    . DA  A 1 231 ? 53.346  -31.319 154.812 1.00 670.47 ?  -82  DA  J N1    1 
ATOM 4767  C C2    . DA  A 1 231 ? 53.111  -32.366 155.614 1.00 670.47 ?  -82  DA  J C2    1 
ATOM 4768  N N3    . DA  A 1 231 ? 53.326  -32.464 156.926 1.00 670.47 ?  -82  DA  J N3    1 
ATOM 4769  C C4    . DA  A 1 231 ? 53.841  -31.321 157.419 1.00 670.47 ?  -82  DA  J C4    1 
ATOM 4770  P P     . DC  A 1 232 ? 55.525  -34.662 162.714 1.00 670.45 ?  -81  DC  J P     1 
ATOM 4771  O OP1   . DC  A 1 232 ? 54.904  -35.728 163.529 1.00 670.45 ?  -81  DC  J OP1   1 
ATOM 4772  O OP2   . DC  A 1 232 ? 56.660  -33.858 163.217 1.00 670.45 -1 -81  DC  J OP2   1 
ATOM 4773  O "O5'" . DC  A 1 232 ? 56.004  -35.303 161.336 1.00 670.45 ?  -81  DC  J "O5'" 1 
ATOM 4774  C "C5'" . DC  A 1 232 ? 55.133  -36.150 160.593 1.00 670.45 ?  -81  DC  J "C5'" 1 
ATOM 4775  C "C4'" . DC  A 1 232 ? 55.626  -36.218 159.166 1.00 670.45 ?  -81  DC  J "C4'" 1 
ATOM 4776  O "O4'" . DC  A 1 232 ? 55.578  -34.891 158.580 1.00 670.45 ?  -81  DC  J "O4'" 1 
ATOM 4777  C "C3'" . DC  A 1 232 ? 57.074  -36.686 159.058 1.00 670.45 ?  -81  DC  J "C3'" 1 
ATOM 4778  O "O3'" . DC  A 1 232 ? 57.143  -37.783 158.166 1.00 670.45 ?  -81  DC  J "O3'" 1 
ATOM 4779  C "C2'" . DC  A 1 232 ? 57.812  -35.464 158.518 1.00 670.45 ?  -81  DC  J "C2'" 1 
ATOM 4780  C "C1'" . DC  A 1 232 ? 56.691  -34.807 157.720 1.00 670.45 ?  -81  DC  J "C1'" 1 
ATOM 4781  N N1    . DC  A 1 232 ? 56.927  -33.390 157.287 1.00 670.45 ?  -81  DC  J N1    1 
ATOM 4782  C C2    . DC  A 1 232 ? 56.546  -32.992 155.996 1.00 670.45 ?  -81  DC  J C2    1 
ATOM 4783  O O2    . DC  A 1 232 ? 56.015  -33.807 155.231 1.00 670.45 ?  -81  DC  J O2    1 
ATOM 4784  N N3    . DC  A 1 232 ? 56.765  -31.710 155.609 1.00 670.45 ?  -81  DC  J N3    1 
ATOM 4785  C C4    . DC  A 1 232 ? 57.337  -30.847 156.450 1.00 670.45 ?  -81  DC  J C4    1 
ATOM 4786  N N4    . DC  A 1 232 ? 57.528  -29.597 156.022 1.00 670.45 ?  -81  DC  J N4    1 
ATOM 4787  C C5    . DC  A 1 232 ? 57.731  -31.230 157.769 1.00 670.45 ?  -81  DC  J C5    1 
ATOM 4788  C C6    . DC  A 1 232 ? 57.512  -32.498 158.139 1.00 670.45 ?  -81  DC  J C6    1 
ATOM 4789  P P     . DA  A 1 233 ? 58.264  -38.913 158.346 1.00 672.35 ?  -80  DA  J P     1 
ATOM 4790  O OP1   . DA  A 1 233 ? 57.820  -39.810 159.436 1.00 672.35 ?  -80  DA  J OP1   1 
ATOM 4791  O OP2   . DA  A 1 233 ? 59.590  -38.257 158.399 1.00 672.35 -1 -80  DA  J OP2   1 
ATOM 4792  O "O5'" . DA  A 1 233 ? 58.186  -39.737 156.972 1.00 672.35 ?  -80  DA  J "O5'" 1 
ATOM 4793  C "C5'" . DA  A 1 233 ? 57.256  -39.378 155.934 1.00 672.35 ?  -80  DA  J "C5'" 1 
ATOM 4794  C "C4'" . DA  A 1 233 ? 57.945  -38.916 154.655 1.00 672.35 ?  -80  DA  J "C4'" 1 
ATOM 4795  O "O4'" . DA  A 1 233 ? 57.999  -37.461 154.608 1.00 672.35 ?  -80  DA  J "O4'" 1 
ATOM 4796  C "C3'" . DA  A 1 233 ? 59.376  -39.423 154.443 1.00 672.35 ?  -80  DA  J "C3'" 1 
ATOM 4797  O "O3'" . DA  A 1 233 ? 59.469  -40.070 153.169 1.00 672.35 ?  -80  DA  J "O3'" 1 
ATOM 4798  C "C2'" . DA  A 1 233 ? 60.218  -38.148 154.526 1.00 672.35 ?  -80  DA  J "C2'" 1 
ATOM 4799  C "C1'" . DA  A 1 233 ? 59.236  -37.096 154.034 1.00 672.35 ?  -80  DA  J "C1'" 1 
ATOM 4800  N N9    . DA  A 1 233 ? 59.588  -35.746 154.449 1.00 672.35 ?  -80  DA  J N9    1 
ATOM 4801  C C8    . DA  A 1 233 ? 59.793  -35.303 155.724 1.00 672.35 ?  -80  DA  J C8    1 
ATOM 4802  N N7    . DA  A 1 233 ? 60.102  -34.033 155.806 1.00 672.35 ?  -80  DA  J N7    1 
ATOM 4803  C C5    . DA  A 1 233 ? 60.103  -33.612 154.490 1.00 672.35 ?  -80  DA  J C5    1 
ATOM 4804  C C6    . DA  A 1 233 ? 60.355  -32.360 153.892 1.00 672.35 ?  -80  DA  J C6    1 
ATOM 4805  N N6    . DA  A 1 233 ? 60.669  -31.270 154.593 1.00 672.35 ?  -80  DA  J N6    1 
ATOM 4806  N N1    . DA  A 1 233 ? 60.277  -32.276 152.546 1.00 672.35 ?  -80  DA  J N1    1 
ATOM 4807  C C2    . DA  A 1 233 ? 59.957  -33.372 151.839 1.00 672.35 ?  -80  DA  J C2    1 
ATOM 4808  N N3    . DA  A 1 233 ? 59.699  -34.604 152.290 1.00 672.35 ?  -80  DA  J N3    1 
ATOM 4809  C C4    . DA  A 1 233 ? 59.786  -34.656 153.635 1.00 672.35 ?  -80  DA  J C4    1 
ATOM 4810  P P     . DG  A 1 234 ? 60.808  -40.770 152.613 1.00 678.12 ?  -79  DG  J P     1 
ATOM 4811  O OP1   . DG  A 1 234 ? 60.643  -42.228 152.823 1.00 678.12 ?  -79  DG  J OP1   1 
ATOM 4812  O OP2   . DG  A 1 234 ? 62.013  -40.095 153.151 1.00 678.12 -1 -79  DG  J OP2   1 
ATOM 4813  O "O5'" . DG  A 1 234 ? 60.730  -40.429 151.047 1.00 678.12 ?  -79  DG  J "O5'" 1 
ATOM 4814  C "C5'" . DG  A 1 234 ? 60.165  -39.191 150.601 1.00 678.12 ?  -79  DG  J "C5'" 1 
ATOM 4815  C "C4'" . DG  A 1 234 ? 60.981  -38.479 149.523 1.00 678.12 ?  -79  DG  J "C4'" 1 
ATOM 4816  O "O4'" . DG  A 1 234 ? 61.112  -37.075 149.870 1.00 678.12 ?  -79  DG  J "O4'" 1 
ATOM 4817  C "C3'" . DG  A 1 234 ? 62.400  -38.974 149.244 1.00 678.12 ?  -79  DG  J "C3'" 1 
ATOM 4818  O "O3'" . DG  A 1 234 ? 62.658  -38.904 147.834 1.00 678.12 ?  -79  DG  J "O3'" 1 
ATOM 4819  C "C2'" . DG  A 1 234 ? 63.271  -38.010 150.046 1.00 678.12 ?  -79  DG  J "C2'" 1 
ATOM 4820  C "C1'" . DG  A 1 234 ? 62.475  -36.713 149.958 1.00 678.12 ?  -79  DG  J "C1'" 1 
ATOM 4821  N N9    . DG  A 1 234 ? 62.669  -35.866 151.131 1.00 678.12 ?  -79  DG  J N9    1 
ATOM 4822  C C8    . DG  A 1 234 ? 62.496  -36.231 152.446 1.00 678.12 ?  -79  DG  J C8    1 
ATOM 4823  N N7    . DG  A 1 234 ? 62.752  -35.270 153.287 1.00 678.12 ?  -79  DG  J N7    1 
ATOM 4824  C C5    . DG  A 1 234 ? 63.122  -34.203 152.481 1.00 678.12 ?  -79  DG  J C5    1 
ATOM 4825  C C6    . DG  A 1 234 ? 63.511  -32.888 152.831 1.00 678.12 ?  -79  DG  J C6    1 
ATOM 4826  O O6    . DG  A 1 234 ? 63.603  -32.404 153.968 1.00 678.12 ?  -79  DG  J O6    1 
ATOM 4827  N N1    . DG  A 1 234 ? 63.807  -32.107 151.712 1.00 678.12 ?  -79  DG  J N1    1 
ATOM 4828  C C2    . DG  A 1 234 ? 63.734  -32.547 150.410 1.00 678.12 ?  -79  DG  J C2    1 
ATOM 4829  N N2    . DG  A 1 234 ? 64.061  -31.662 149.462 1.00 678.12 ?  -79  DG  J N2    1 
ATOM 4830  N N3    . DG  A 1 234 ? 63.370  -33.779 150.069 1.00 678.12 ?  -79  DG  J N3    1 
ATOM 4831  C C4    . DG  A 1 234 ? 63.076  -34.551 151.148 1.00 678.12 ?  -79  DG  J C4    1 
ATOM 4832  P P     . DC  A 1 235 ? 64.091  -39.222 147.178 1.00 685.03 ?  -78  DC  J P     1 
ATOM 4833  O OP1   . DC  A 1 235 ? 63.839  -39.687 145.799 1.00 685.03 ?  -78  DC  J OP1   1 
ATOM 4834  O OP2   . DC  A 1 235 ? 64.896  -40.065 148.095 1.00 685.03 -1 -78  DC  J OP2   1 
ATOM 4835  O "O5'" . DC  A 1 235 ? 64.775  -37.775 147.130 1.00 685.03 ?  -78  DC  J "O5'" 1 
ATOM 4836  C "C5'" . DC  A 1 235 ? 64.283  -36.754 146.262 1.00 685.03 ?  -78  DC  J "C5'" 1 
ATOM 4837  C "C4'" . DC  A 1 235 ? 65.211  -35.552 146.287 1.00 685.03 ?  -78  DC  J "C4'" 1 
ATOM 4838  O "O4'" . DC  A 1 235 ? 65.117  -34.910 147.586 1.00 685.03 ?  -78  DC  J "O4'" 1 
ATOM 4839  C "C3'" . DC  A 1 235 ? 66.691  -35.871 146.058 1.00 685.03 ?  -78  DC  J "C3'" 1 
ATOM 4840  O "O3'" . DC  A 1 235 ? 67.218  -35.031 145.039 1.00 685.03 ?  -78  DC  J "O3'" 1 
ATOM 4841  C "C2'" . DC  A 1 235 ? 67.342  -35.578 147.408 1.00 685.03 ?  -78  DC  J "C2'" 1 
ATOM 4842  C "C1'" . DC  A 1 235 ? 66.414  -34.514 147.982 1.00 685.03 ?  -78  DC  J "C1'" 1 
ATOM 4843  N N1    . DC  A 1 235 ? 66.523  -34.392 149.482 1.00 685.03 ?  -78  DC  J N1    1 
ATOM 4844  C C2    . DC  A 1 235 ? 66.916  -33.161 150.038 1.00 685.03 ?  -78  DC  J C2    1 
ATOM 4845  O O2    . DC  A 1 235 ? 67.150  -32.198 149.296 1.00 685.03 ?  -78  DC  J O2    1 
ATOM 4846  N N3    . DC  A 1 235 ? 67.024  -33.053 151.388 1.00 685.03 ?  -78  DC  J N3    1 
ATOM 4847  C C4    . DC  A 1 235 ? 66.763  -34.108 152.162 1.00 685.03 ?  -78  DC  J C4    1 
ATOM 4848  N N4    . DC  A 1 235 ? 66.887  -33.941 153.480 1.00 685.03 ?  -78  DC  J N4    1 
ATOM 4849  C C5    . DC  A 1 235 ? 66.371  -35.374 151.626 1.00 685.03 ?  -78  DC  J C5    1 
ATOM 4850  C C6    . DC  A 1 235 ? 66.266  -35.470 150.294 1.00 685.03 ?  -78  DC  J C6    1 
ATOM 4851  P P     . DG  A 1 236 ? 68.689  -35.241 144.439 1.00 701.57 ?  -77  DG  J P     1 
ATOM 4852  O OP1   . DG  A 1 236 ? 68.606  -36.310 143.420 1.00 701.57 ?  -77  DG  J OP1   1 
ATOM 4853  O OP2   . DG  A 1 236 ? 69.689  -35.349 145.523 1.00 701.57 -1 -77  DG  J OP2   1 
ATOM 4854  O "O5'" . DG  A 1 236 ? 68.928  -33.834 143.720 1.00 701.57 ?  -77  DG  J "O5'" 1 
ATOM 4855  C "C5'" . DG  A 1 236 ? 68.335  -32.647 144.251 1.00 701.57 ?  -77  DG  J "C5'" 1 
ATOM 4856  C "C4'" . DG  A 1 236 ? 69.272  -31.904 145.193 1.00 701.57 ?  -77  DG  J "C4'" 1 
ATOM 4857  O "O4'" . DG  A 1 236 ? 69.062  -32.329 146.564 1.00 701.57 ?  -77  DG  J "O4'" 1 
ATOM 4858  C "C3'" . DG  A 1 236 ? 70.768  -32.079 144.929 1.00 701.57 ?  -77  DG  J "C3'" 1 
ATOM 4859  O "O3'" . DG  A 1 236 ? 71.298  -30.826 144.520 1.00 701.57 ?  -77  DG  J "O3'" 1 
ATOM 4860  C "C2'" . DG  A 1 236 ? 71.344  -32.540 146.272 1.00 701.57 ?  -77  DG  J "C2'" 1 
ATOM 4861  C "C1'" . DG  A 1 236 ? 70.269  -32.090 147.251 1.00 701.57 ?  -77  DG  J "C1'" 1 
ATOM 4862  N N9    . DG  A 1 236 ? 70.249  -32.818 148.514 1.00 701.57 ?  -77  DG  J N9    1 
ATOM 4863  C C8    . DG  A 1 236 ? 70.140  -34.177 148.683 1.00 701.57 ?  -77  DG  J C8    1 
ATOM 4864  N N7    . DG  A 1 236 ? 70.144  -34.547 149.931 1.00 701.57 ?  -77  DG  J N7    1 
ATOM 4865  C C5    . DG  A 1 236 ? 70.265  -33.357 150.643 1.00 701.57 ?  -77  DG  J C5    1 
ATOM 4866  C C6    . DG  A 1 236 ? 70.323  -33.128 152.044 1.00 701.57 ?  -77  DG  J C6    1 
ATOM 4867  O O6    . DG  A 1 236 ? 70.280  -33.964 152.957 1.00 701.57 ?  -77  DG  J O6    1 
ATOM 4868  N N1    . DG  A 1 236 ? 70.447  -31.770 152.347 1.00 701.57 ?  -77  DG  J N1    1 
ATOM 4869  C C2    . DG  A 1 236 ? 70.507  -30.760 151.410 1.00 701.57 ?  -77  DG  J C2    1 
ATOM 4870  N N2    . DG  A 1 236 ? 70.628  -29.511 151.882 1.00 701.57 ?  -77  DG  J N2    1 
ATOM 4871  N N3    . DG  A 1 236 ? 70.451  -30.963 150.098 1.00 701.57 ?  -77  DG  J N3    1 
ATOM 4872  C C4    . DG  A 1 236 ? 70.331  -32.281 149.782 1.00 701.57 ?  -77  DG  J C4    1 
ATOM 4873  P P     . DC  A 1 237 ? 72.809  -30.648 144.008 1.00 701.90 ?  -76  DC  J P     1 
ATOM 4874  O OP1   . DC  A 1 237 ? 72.735  -30.107 142.634 1.00 701.90 ?  -76  DC  J OP1   1 
ATOM 4875  O OP2   . DC  A 1 237 ? 73.600  -31.870 144.294 1.00 701.90 -1 -76  DC  J OP2   1 
ATOM 4876  O "O5'" . DC  A 1 237 ? 73.362  -29.489 144.961 1.00 701.90 ?  -76  DC  J "O5'" 1 
ATOM 4877  C "C5'" . DC  A 1 237 ? 72.533  -28.381 145.330 1.00 701.90 ?  -76  DC  J "C5'" 1 
ATOM 4878  C "C4'" . DC  A 1 237 ? 73.115  -27.666 146.537 1.00 701.90 ?  -76  DC  J "C4'" 1 
ATOM 4879  O "O4'" . DC  A 1 237 ? 72.850  -28.444 147.736 1.00 701.90 ?  -76  DC  J "O4'" 1 
ATOM 4880  C "C3'" . DC  A 1 237 ? 74.627  -27.460 146.475 1.00 701.90 ?  -76  DC  J "C3'" 1 
ATOM 4881  O "O3'" . DC  A 1 237 ? 74.966  -26.172 146.978 1.00 701.90 ?  -76  DC  J "O3'" 1 
ATOM 4882  C "C2'" . DC  A 1 237 ? 75.160  -28.578 147.366 1.00 701.90 ?  -76  DC  J "C2'" 1 
ATOM 4883  C "C1'" . DC  A 1 237 ? 74.065  -28.681 148.422 1.00 701.90 ?  -76  DC  J "C1'" 1 
ATOM 4884  N N1    . DC  A 1 237 ? 74.000  -30.006 149.126 1.00 701.90 ?  -76  DC  J N1    1 
ATOM 4885  C C2    . DC  A 1 237 ? 73.824  -30.041 150.519 1.00 701.90 ?  -76  DC  J C2    1 
ATOM 4886  O O2    . DC  A 1 237 ? 73.723  -28.979 151.151 1.00 701.90 ?  -76  DC  J O2    1 
ATOM 4887  N N3    . DC  A 1 237 ? 73.769  -31.252 151.140 1.00 701.90 ?  -76  DC  J N3    1 
ATOM 4888  C C4    . DC  A 1 237 ? 73.882  -32.381 150.433 1.00 701.90 ?  -76  DC  J C4    1 
ATOM 4889  N N4    . DC  A 1 237 ? 73.819  -33.540 151.091 1.00 701.90 ?  -76  DC  J N4    1 
ATOM 4890  C C5    . DC  A 1 237 ? 74.063  -32.369 149.018 1.00 701.90 ?  -76  DC  J C5    1 
ATOM 4891  C C6    . DC  A 1 237 ? 74.115  -31.173 148.415 1.00 701.90 ?  -76  DC  J C6    1 
ATOM 4892  P P     . DG  A 1 238 ? 76.387  -25.478 146.680 1.00 687.88 ?  -75  DG  J P     1 
ATOM 4893  O OP1   . DG  A 1 238 ? 76.156  -24.510 145.590 1.00 687.88 ?  -75  DG  J OP1   1 
ATOM 4894  O OP2   . DG  A 1 238 ? 77.434  -26.518 146.514 1.00 687.88 -1 -75  DG  J OP2   1 
ATOM 4895  O "O5'" . DG  A 1 238 ? 76.691  -24.636 148.014 1.00 687.88 ?  -75  DG  J "O5'" 1 
ATOM 4896  C "C5'" . DG  A 1 238 ? 75.855  -24.696 149.184 1.00 687.88 ?  -75  DG  J "C5'" 1 
ATOM 4897  C "C4'" . DG  A 1 238 ? 76.652  -25.041 150.434 1.00 687.88 ?  -75  DG  J "C4'" 1 
ATOM 4898  O "O4'" . DG  A 1 238 ? 76.392  -26.421 150.814 1.00 687.88 ?  -75  DG  J "O4'" 1 
ATOM 4899  C "C3'" . DG  A 1 238 ? 78.171  -24.911 150.313 1.00 687.88 ?  -75  DG  J "C3'" 1 
ATOM 4900  O "O3'" . DG  A 1 238 ? 78.655  -24.190 151.439 1.00 687.88 ?  -75  DG  J "O3'" 1 
ATOM 4901  C "C2'" . DG  A 1 238 ? 78.653  -26.357 150.257 1.00 687.88 ?  -75  DG  J "C2'" 1 
ATOM 4902  C "C1'" . DG  A 1 238 ? 77.616  -27.063 151.116 1.00 687.88 ?  -75  DG  J "C1'" 1 
ATOM 4903  N N9    . DG  A 1 238 ? 77.494  -28.489 150.826 1.00 687.88 ?  -75  DG  J N9    1 
ATOM 4904  C C8    . DG  A 1 238 ? 77.489  -29.070 149.583 1.00 687.88 ?  -75  DG  J C8    1 
ATOM 4905  N N7    . DG  A 1 238 ? 77.362  -30.367 149.604 1.00 687.88 ?  -75  DG  J N7    1 
ATOM 4906  C C5    . DG  A 1 238 ? 77.280  -30.673 150.953 1.00 687.88 ?  -75  DG  J C5    1 
ATOM 4907  C C6    . DG  A 1 238 ? 77.135  -31.931 151.585 1.00 687.88 ?  -75  DG  J C6    1 
ATOM 4908  O O6    . DG  A 1 238 ? 77.051  -33.043 151.049 1.00 687.88 ?  -75  DG  J O6    1 
ATOM 4909  N N1    . DG  A 1 238 ? 77.091  -31.811 152.976 1.00 687.88 ?  -75  DG  J N1    1 
ATOM 4910  C C2    . DG  A 1 238 ? 77.175  -30.619 153.661 1.00 687.88 ?  -75  DG  J C2    1 
ATOM 4911  N N2    . DG  A 1 238 ? 77.113  -30.694 154.996 1.00 687.88 ?  -75  DG  J N2    1 
ATOM 4912  N N3    . DG  A 1 238 ? 77.311  -29.433 153.077 1.00 687.88 ?  -75  DG  J N3    1 
ATOM 4913  C C4    . DG  A 1 238 ? 77.359  -29.529 151.723 1.00 687.88 ?  -75  DG  J C4    1 
ATOM 4914  P P     . DT  A 1 239 ? 80.202  -23.982 151.822 1.00 694.27 ?  -74  DT  J P     1 
ATOM 4915  O OP1   . DT  A 1 239 ? 80.640  -22.668 151.314 1.00 694.27 ?  -74  DT  J OP1   1 
ATOM 4916  O OP2   . DT  A 1 239 ? 81.029  -25.166 151.500 1.00 694.27 -1 -74  DT  J OP2   1 
ATOM 4917  O "O5'" . DT  A 1 239 ? 80.048  -23.896 153.411 1.00 694.27 ?  -74  DT  J "O5'" 1 
ATOM 4918  C "C5'" . DT  A 1 239 ? 78.942  -24.530 154.078 1.00 694.27 ?  -74  DT  J "C5'" 1 
ATOM 4919  C "C4'" . DT  A 1 239 ? 79.441  -25.648 154.968 1.00 694.27 ?  -74  DT  J "C4'" 1 
ATOM 4920  O "O4'" . DT  A 1 239 ? 79.398  -26.898 154.236 1.00 694.27 ?  -74  DT  J "O4'" 1 
ATOM 4921  C "C3'" . DT  A 1 239 ? 80.886  -25.454 155.442 1.00 694.27 ?  -74  DT  J "C3'" 1 
ATOM 4922  O "O3'" . DT  A 1 239 ? 80.976  -25.649 156.843 1.00 694.27 ?  -74  DT  J "O3'" 1 
ATOM 4923  C "C2'" . DT  A 1 239 ? 81.672  -26.524 154.690 1.00 694.27 ?  -74  DT  J "C2'" 1 
ATOM 4924  C "C1'" . DT  A 1 239 ? 80.598  -27.597 154.517 1.00 694.27 ?  -74  DT  J "C1'" 1 
ATOM 4925  N N1    . DT  A 1 239 ? 80.958  -28.620 153.465 1.00 694.27 ?  -74  DT  J N1    1 
ATOM 4926  C C2    . DT  A 1 239 ? 81.268  -29.907 153.866 1.00 694.27 ?  -74  DT  J C2    1 
ATOM 4927  O O2    . DT  A 1 239 ? 81.243  -30.275 155.028 1.00 694.27 ?  -74  DT  J O2    1 
ATOM 4928  N N3    . DT  A 1 239 ? 81.594  -30.763 152.838 1.00 694.27 ?  -74  DT  J N3    1 
ATOM 4929  C C4    . DT  A 1 239 ? 81.652  -30.468 151.482 1.00 694.27 ?  -74  DT  J C4    1 
ATOM 4930  O O4    . DT  A 1 239 ? 81.962  -31.312 150.644 1.00 694.27 ?  -74  DT  J O4    1 
ATOM 4931  C C5    . DT  A 1 239 ? 81.325  -29.101 151.131 1.00 694.27 ?  -74  DT  J C5    1 
ATOM 4932  C C7    . DT  A 1 239 ? 81.351  -28.643 149.700 1.00 694.27 ?  -74  DT  J C7    1 
ATOM 4933  C C6    . DT  A 1 239 ? 81.003  -28.260 152.126 1.00 694.27 ?  -74  DT  J C6    1 
ATOM 4934  P P     . DA  A 1 240 ? 81.562  -24.529 157.825 1.00 689.54 ?  -73  DA  J P     1 
ATOM 4935  O OP1   . DA  A 1 240 ? 80.960  -23.233 157.448 1.00 689.54 ?  -73  DA  J OP1   1 
ATOM 4936  O OP2   . DA  A 1 240 ? 83.039  -24.691 157.854 1.00 689.54 -1 -73  DA  J OP2   1 
ATOM 4937  O "O5'" . DA  A 1 240 ? 80.935  -24.933 159.249 1.00 689.54 ?  -73  DA  J "O5'" 1 
ATOM 4938  C "C5'" . DA  A 1 240 ? 79.877  -25.921 159.368 1.00 689.54 ?  -73  DA  J "C5'" 1 
ATOM 4939  C "C4'" . DA  A 1 240 ? 80.344  -27.283 159.893 1.00 689.54 ?  -73  DA  J "C4'" 1 
ATOM 4940  O "O4'" . DA  A 1 240 ? 80.880  -28.120 158.837 1.00 689.54 ?  -73  DA  J "O4'" 1 
ATOM 4941  C "C3'" . DA  A 1 240 ? 81.441  -27.307 160.956 1.00 689.54 ?  -73  DA  J "C3'" 1 
ATOM 4942  O "O3'" . DA  A 1 240 ? 81.222  -28.418 161.774 1.00 689.54 ?  -73  DA  J "O3'" 1 
ATOM 4943  C "C2'" . DA  A 1 240 ? 82.707  -27.599 160.168 1.00 689.54 ?  -73  DA  J "C2'" 1 
ATOM 4944  C "C1'" . DA  A 1 240 ? 82.109  -28.668 159.281 1.00 689.54 ?  -73  DA  J "C1'" 1 
ATOM 4945  N N9    . DA  A 1 240 ? 82.871  -28.991 158.098 1.00 689.54 ?  -73  DA  J N9    1 
ATOM 4946  C C8    . DA  A 1 240 ? 83.541  -28.138 157.270 1.00 689.54 ?  -73  DA  J C8    1 
ATOM 4947  N N7    . DA  A 1 240 ? 84.113  -28.733 156.257 1.00 689.54 ?  -73  DA  J N7    1 
ATOM 4948  C C5    . DA  A 1 240 ? 83.787  -30.064 156.440 1.00 689.54 ?  -73  DA  J C5    1 
ATOM 4949  C C6    . DA  A 1 240 ? 84.088  -31.228 155.705 1.00 689.54 ?  -73  DA  J C6    1 
ATOM 4950  N N6    . DA  A 1 240 ? 84.820  -31.210 154.587 1.00 689.54 ?  -73  DA  J N6    1 
ATOM 4951  N N1    . DA  A 1 240 ? 83.602  -32.411 156.163 1.00 689.54 ?  -73  DA  J N1    1 
ATOM 4952  C C2    . DA  A 1 240 ? 82.858  -32.426 157.283 1.00 689.54 ?  -73  DA  J C2    1 
ATOM 4953  N N3    . DA  A 1 240 ? 82.509  -31.397 158.055 1.00 689.54 ?  -73  DA  J N3    1 
ATOM 4954  C C4    . DA  A 1 240 ? 83.013  -30.241 157.571 1.00 689.54 ?  -73  DA  J C4    1 
ATOM 4955  P P     . DC  A 1 241 ? 81.241  -28.315 163.356 1.00 674.62 ?  -72  DC  J P     1 
ATOM 4956  O OP1   . DC  A 1 241 ? 79.887  -27.811 163.715 1.00 674.07 ?  -72  DC  J OP1   1 
ATOM 4957  O OP2   . DC  A 1 241 ? 82.517  -27.699 163.805 1.00 673.90 -1 -72  DC  J OP2   1 
ATOM 4958  O "O5'" . DC  A 1 241 ? 81.378  -29.853 163.784 1.00 674.62 ?  -72  DC  J "O5'" 1 
ATOM 4959  C "C5'" . DC  A 1 241 ? 80.770  -30.934 163.072 1.00 673.47 ?  -72  DC  J "C5'" 1 
ATOM 4960  C "C4'" . DC  A 1 241 ? 81.770  -32.064 162.918 1.00 672.42 ?  -72  DC  J "C4'" 1 
ATOM 4961  O "O4'" . DC  A 1 241 ? 82.623  -31.848 161.762 1.00 673.20 ?  -72  DC  J "O4'" 1 
ATOM 4962  C "C3'" . DC  A 1 241 ? 82.728  -32.296 164.082 1.00 671.31 ?  -72  DC  J "C3'" 1 
ATOM 4963  O "O3'" . DC  A 1 241 ? 82.759  -33.692 164.243 1.00 668.91 ?  -72  DC  J "O3'" 1 
ATOM 4964  C "C2'" . DC  A 1 241 ? 84.057  -31.722 163.575 1.00 672.08 ?  -72  DC  J "C2'" 1 
ATOM 4965  C "C1'" . DC  A 1 241 ? 83.967  -32.128 162.114 1.00 673.68 ?  -72  DC  J "C1'" 1 
ATOM 4966  N N1    . DC  A 1 241 ? 84.822  -31.410 161.118 1.00 674.57 ?  -72  DC  J N1    1 
ATOM 4967  C C2    . DC  A 1 241 ? 85.305  -32.123 160.008 1.00 674.62 ?  -72  DC  J C2    1 
ATOM 4968  O O2    . DC  A 1 241 ? 85.050  -33.330 159.898 1.00 674.62 ?  -72  DC  J O2    1 
ATOM 4969  N N3    . DC  A 1 241 ? 86.061  -31.463 159.089 1.00 674.54 ?  -72  DC  J N3    1 
ATOM 4970  C C4    . DC  A 1 241 ? 86.327  -30.163 159.241 1.00 674.45 ?  -72  DC  J C4    1 
ATOM 4971  N N4    . DC  A 1 241 ? 87.071  -29.577 158.306 1.00 674.62 ?  -72  DC  J N4    1 
ATOM 4972  C C5    . DC  A 1 241 ? 85.842  -29.411 160.352 1.00 674.62 ?  -72  DC  J C5    1 
ATOM 4973  C C6    . DC  A 1 241 ? 85.094  -30.069 161.250 1.00 674.62 ?  -72  DC  J C6    1 
ATOM 4974  P P     . DG  A 1 242 ? 83.482  -34.442 165.442 1.00 664.85 ?  -71  DG  J P     1 
ATOM 4975  O OP1   . DG  A 1 242 ? 82.396  -34.839 166.356 1.00 665.85 ?  -71  DG  J OP1   1 
ATOM 4976  O OP2   . DG  A 1 242 ? 84.668  -33.701 165.917 1.00 664.70 -1 -71  DG  J OP2   1 
ATOM 4977  O "O5'" . DG  A 1 242 ? 84.038  -35.760 164.751 1.00 665.78 ?  -71  DG  J "O5'" 1 
ATOM 4978  C "C5'" . DG  A 1 242 ? 83.241  -36.500 163.834 1.00 666.82 ?  -71  DG  J "C5'" 1 
ATOM 4979  C "C4'" . DG  A 1 242 ? 84.137  -37.477 163.090 1.00 668.12 ?  -71  DG  J "C4'" 1 
ATOM 4980  O "O4'" . DG  A 1 242 ? 84.936  -36.776 162.109 1.00 668.79 ?  -71  DG  J "O4'" 1 
ATOM 4981  C "C3'" . DG  A 1 242 ? 85.137  -38.242 163.952 1.00 668.23 ?  -71  DG  J "C3'" 1 
ATOM 4982  O "O3'" . DG  A 1 242 ? 85.305  -39.565 163.437 1.00 667.13 ?  -71  DG  J "O3'" 1 
ATOM 4983  C "C2'" . DG  A 1 242 ? 86.413  -37.409 163.841 1.00 668.99 ?  -71  DG  J "C2'" 1 
ATOM 4984  C "C1'" . DG  A 1 242 ? 86.312  -36.866 162.424 1.00 671.63 ?  -71  DG  J "C1'" 1 
ATOM 4985  N N9    . DG  A 1 242 ? 86.824  -35.516 162.264 1.00 672.83 ?  -71  DG  J N9    1 
ATOM 4986  C C8    . DG  A 1 242 ? 86.712  -34.463 163.148 1.00 673.36 ?  -71  DG  J C8    1 
ATOM 4987  N N7    . DG  A 1 242 ? 87.251  -33.359 162.721 1.00 673.30 ?  -71  DG  J N7    1 
ATOM 4988  C C5    . DG  A 1 242 ? 87.745  -33.703 161.473 1.00 672.95 ?  -71  DG  J C5    1 
ATOM 4989  C C6    . DG  A 1 242 ? 88.441  -32.913 160.540 1.00 672.95 ?  -71  DG  J C6    1 
ATOM 4990  O O6    . DG  A 1 242 ? 88.750  -31.716 160.644 1.00 673.37 ?  -71  DG  J O6    1 
ATOM 4991  N N1    . DG  A 1 242 ? 88.773  -33.639 159.394 1.00 673.32 ?  -71  DG  J N1    1 
ATOM 4992  C C2    . DG  A 1 242 ? 88.464  -34.968 159.173 1.00 673.40 ?  -71  DG  J C2    1 
ATOM 4993  N N2    . DG  A 1 242 ? 88.860  -35.495 158.000 1.00 673.06 ?  -71  DG  J N2    1 
ATOM 4994  N N3    . DG  A 1 242 ? 87.811  -35.720 160.056 1.00 673.41 ?  -71  DG  J N3    1 
ATOM 4995  C C4    . DG  A 1 242 ? 87.487  -35.022 161.173 1.00 672.95 ?  -71  DG  J C4    1 
ATOM 4996  P P     . DT  A 1 243 ? 86.113  -40.680 164.250 1.00 658.63 ?  -70  DT  J P     1 
ATOM 4997  O OP1   . DT  A 1 243 ? 85.270  -41.892 164.154 1.00 659.10 ?  -70  DT  J OP1   1 
ATOM 4998  O OP2   . DT  A 1 243 ? 86.507  -40.179 165.581 1.00 659.17 -1 -70  DT  J OP2   1 
ATOM 4999  O "O5'" . DT  A 1 243 ? 87.490  -40.825 163.454 1.00 658.60 ?  -70  DT  J "O5'" 1 
ATOM 5000  C "C5'" . DT  A 1 243 ? 87.459  -40.981 162.048 1.00 660.43 ?  -70  DT  J "C5'" 1 
ATOM 5001  C "C4'" . DT  A 1 243 ? 88.810  -40.699 161.423 1.00 661.84 ?  -70  DT  J "C4'" 1 
ATOM 5002  O "O4'" . DT  A 1 243 ? 88.963  -39.264 161.270 1.00 662.47 ?  -70  DT  J "O4'" 1 
ATOM 5003  C "C3'" . DT  A 1 243 ? 90.022  -41.202 162.203 1.00 662.94 ?  -70  DT  J "C3'" 1 
ATOM 5004  O "O3'" . DT  A 1 243 ? 90.712  -42.143 161.379 1.00 665.75 ?  -70  DT  J "O3'" 1 
ATOM 5005  C "C2'" . DT  A 1 243 ? 90.836  -39.932 162.478 1.00 662.74 ?  -70  DT  J "C2'" 1 
ATOM 5006  C "C1'" . DT  A 1 243 ? 90.330  -38.935 161.425 1.00 662.35 ?  -70  DT  J "C1'" 1 
ATOM 5007  N N1    . DT  A 1 243 ? 90.470  -37.427 161.703 1.00 662.17 ?  -70  DT  J N1    1 
ATOM 5008  C C2    . DT  A 1 243 ? 90.870  -36.539 160.692 1.00 662.00 ?  -70  DT  J C2    1 
ATOM 5009  O O2    . DT  A 1 243 ? 91.141  -36.848 159.547 1.00 661.74 ?  -70  DT  J O2    1 
ATOM 5010  N N3    . DT  A 1 243 ? 90.942  -35.213 161.053 1.00 661.75 ?  -70  DT  J N3    1 
ATOM 5011  C C4    . DT  A 1 243 ? 90.672  -34.670 162.297 1.00 662.31 ?  -70  DT  J C4    1 
ATOM 5012  O O4    . DT  A 1 243 ? 90.778  -33.456 162.504 1.00 661.97 ?  -70  DT  J O4    1 
ATOM 5013  C C5    . DT  A 1 243 ? 90.253  -35.636 163.307 1.00 662.17 ?  -70  DT  J C5    1 
ATOM 5014  C C7    . DT  A 1 243 ? 89.920  -35.193 164.705 1.00 662.33 ?  -70  DT  J C7    1 
ATOM 5015  C C6    . DT  A 1 243 ? 90.171  -36.938 162.967 1.00 661.87 ?  -70  DT  J C6    1 
ATOM 5016  P P     . DG  A 1 244 ? 91.759  -43.229 161.931 1.00 660.69 ?  -69  DG  J P     1 
ATOM 5017  O OP1   . DG  A 1 244 ? 91.535  -44.475 161.169 1.00 660.28 ?  -69  DG  J OP1   1 
ATOM 5018  O OP2   . DG  A 1 244 ? 91.763  -43.205 163.409 1.00 660.36 -1 -69  DG  J OP2   1 
ATOM 5019  O "O5'" . DG  A 1 244 ? 93.178  -42.667 161.495 1.00 662.05 ?  -69  DG  J "O5'" 1 
ATOM 5020  C "C5'" . DG  A 1 244 ? 93.502  -42.482 160.130 1.00 662.05 ?  -69  DG  J "C5'" 1 
ATOM 5021  C "C4'" . DG  A 1 244 ? 94.633  -41.482 160.060 1.00 662.05 ?  -69  DG  J "C4'" 1 
ATOM 5022  O "O4'" . DG  A 1 244 ? 94.126  -40.185 160.454 1.00 662.05 ?  -69  DG  J "O4'" 1 
ATOM 5023  C "C3'" . DG  A 1 244 ? 95.794  -41.787 161.001 1.00 662.05 ?  -69  DG  J "C3'" 1 
ATOM 5024  O "O3'" . DG  A 1 244 ? 96.922  -42.146 160.200 1.00 662.05 ?  -69  DG  J "O3'" 1 
ATOM 5025  C "C2'" . DG  A 1 244 ? 95.956  -40.518 161.848 1.00 662.05 ?  -69  DG  J "C2'" 1 
ATOM 5026  C "C1'" . DG  A 1 244 ? 95.186  -39.474 161.045 1.00 662.05 ?  -69  DG  J "C1'" 1 
ATOM 5027  N N9    . DG  A 1 244 ? 94.615  -38.380 161.829 1.00 662.05 ?  -69  DG  J N9    1 
ATOM 5028  C C8    . DG  A 1 244 ? 93.634  -38.488 162.782 1.00 662.05 ?  -69  DG  J C8    1 
ATOM 5029  N N7    . DG  A 1 244 ? 93.297  -37.355 163.332 1.00 662.05 ?  -69  DG  J N7    1 
ATOM 5030  C C5    . DG  A 1 244 ? 94.113  -36.422 162.706 1.00 662.05 ?  -69  DG  J C5    1 
ATOM 5031  C C6    . DG  A 1 244 ? 94.205  -35.016 162.894 1.00 662.05 ?  -69  DG  J C6    1 
ATOM 5032  O O6    . DG  A 1 244 ? 93.561  -34.297 163.673 1.00 662.05 ?  -69  DG  J O6    1 
ATOM 5033  N N1    . DG  A 1 244 ? 95.165  -34.435 162.064 1.00 662.05 ?  -69  DG  J N1    1 
ATOM 5034  C C2    . DG  A 1 244 ? 95.932  -35.132 161.160 1.00 662.05 ?  -69  DG  J C2    1 
ATOM 5035  N N2    . DG  A 1 244 ? 96.798  -34.401 160.447 1.00 662.05 ?  -69  DG  J N2    1 
ATOM 5036  N N3    . DG  A 1 244 ? 95.858  -36.450 160.975 1.00 662.05 ?  -69  DG  J N3    1 
ATOM 5037  C C4    . DG  A 1 244 ? 94.930  -37.038 161.776 1.00 662.05 ?  -69  DG  J C4    1 
ATOM 5038  P P     . DC  A 1 245 ? 98.391  -42.354 160.810 1.00 666.30 ?  -68  DC  J P     1 
ATOM 5039  O OP1   . DC  A 1 245 ? 99.137  -43.302 159.952 1.00 666.30 ?  -68  DC  J OP1   1 
ATOM 5040  O OP2   . DC  A 1 245 ? 98.335  -42.544 162.277 1.00 666.30 -1 -68  DC  J OP2   1 
ATOM 5041  O "O5'" . DC  A 1 245 ? 98.979  -40.898 160.605 1.00 666.30 ?  -68  DC  J "O5'" 1 
ATOM 5042  C "C5'" . DC  A 1 245 ? 99.214  -40.316 159.331 1.00 666.30 ?  -68  DC  J "C5'" 1 
ATOM 5043  C "C4'" . DC  A 1 245 ? 100.181 -39.184 159.588 1.00 666.30 ?  -68  DC  J "C4'" 1 
ATOM 5044  O "O4'" . DC  A 1 245 ? 99.483  -38.170 160.356 1.00 666.30 ?  -68  DC  J "O4'" 1 
ATOM 5045  C "C3'" . DC  A 1 245 ? 101.388 -39.609 160.424 1.00 666.30 ?  -68  DC  J "C3'" 1 
ATOM 5046  O "O3'" . DC  A 1 245 ? 102.592 -39.084 159.870 1.00 666.30 ?  -68  DC  J "O3'" 1 
ATOM 5047  C "C2'" . DC  A 1 245 ? 101.078 -39.082 161.828 1.00 666.30 ?  -68  DC  J "C2'" 1 
ATOM 5048  C "C1'" . DC  A 1 245 ? 100.228 -37.856 161.522 1.00 666.30 ?  -68  DC  J "C1'" 1 
ATOM 5049  N N1    . DC  A 1 245 ? 99.295  -37.405 162.611 1.00 666.30 ?  -68  DC  J N1    1 
ATOM 5050  C C2    . DC  A 1 245 ? 98.740  -36.116 162.526 1.00 666.30 ?  -68  DC  J C2    1 
ATOM 5051  O O2    . DC  A 1 245 ? 99.018  -35.378 161.569 1.00 666.30 ?  -68  DC  J O2    1 
ATOM 5052  N N3    . DC  A 1 245 ? 97.896  -35.698 163.501 1.00 666.30 ?  -68  DC  J N3    1 
ATOM 5053  C C4    . DC  A 1 245 ? 97.605  -36.502 164.524 1.00 666.30 ?  -68  DC  J C4    1 
ATOM 5054  N N4    . DC  A 1 245 ? 96.767  -36.022 165.450 1.00 666.30 ?  -68  DC  J N4    1 
ATOM 5055  C C5    . DC  A 1 245 ? 98.159  -37.817 164.635 1.00 666.30 ?  -68  DC  J C5    1 
ATOM 5056  C C6    . DC  A 1 245 ? 98.989  -38.222 163.666 1.00 666.30 ?  -68  DC  J C6    1 
ATOM 5057  P P     . DG  A 1 246 ? 104.048 -39.500 160.417 1.00 681.26 ?  -67  DG  J P     1 
ATOM 5058  O OP1   . DG  A 1 246 ? 104.544 -40.629 159.598 1.00 681.26 ?  -67  DG  J OP1   1 
ATOM 5059  O OP2   . DG  A 1 246 ? 104.019 -39.650 161.890 1.00 681.26 -1 -67  DG  J OP2   1 
ATOM 5060  O "O5'" . DG  A 1 246 ? 104.895 -38.176 160.081 1.00 681.26 ?  -67  DG  J "O5'" 1 
ATOM 5061  C "C5'" . DG  A 1 246 ? 104.267 -36.995 159.543 1.00 681.26 ?  -67  DG  J "C5'" 1 
ATOM 5062  C "C4'" . DG  A 1 246 ? 104.401 -35.778 160.452 1.00 681.26 ?  -67  DG  J "C4'" 1 
ATOM 5063  O "O4'" . DG  A 1 246 ? 103.265 -35.688 161.355 1.00 681.26 ?  -67  DG  J "O4'" 1 
ATOM 5064  C "C3'" . DG  A 1 246 ? 105.656 -35.720 161.328 1.00 681.26 ?  -67  DG  J "C3'" 1 
ATOM 5065  O "O3'" . DG  A 1 246 ? 106.258 -34.427 161.204 1.00 681.26 ?  -67  DG  J "O3'" 1 
ATOM 5066  C "C2'" . DG  A 1 246 ? 105.113 -35.974 162.729 1.00 681.26 ?  -67  DG  J "C2'" 1 
ATOM 5067  C "C1'" . DG  A 1 246 ? 103.747 -35.308 162.628 1.00 681.26 ?  -67  DG  J "C1'" 1 
ATOM 5068  N N9    . DG  A 1 246 ? 102.810 -35.714 163.680 1.00 681.26 ?  -67  DG  J N9    1 
ATOM 5069  C C8    . DG  A 1 246 ? 102.593 -36.991 164.142 1.00 681.26 ?  -67  DG  J C8    1 
ATOM 5070  N N7    . DG  A 1 246 ? 101.703 -37.067 165.088 1.00 681.26 ?  -67  DG  J N7    1 
ATOM 5071  C C5    . DG  A 1 246 ? 101.301 -35.752 165.272 1.00 681.26 ?  -67  DG  J C5    1 
ATOM 5072  C C6    . DG  A 1 246 ? 100.351 -35.214 166.176 1.00 681.26 ?  -67  DG  J C6    1 
ATOM 5073  O O6    . DG  A 1 246 ? 99.666  -35.830 167.002 1.00 681.26 ?  -67  DG  J O6    1 
ATOM 5074  N N1    . DG  A 1 246 ? 100.225 -33.825 166.058 1.00 681.26 ?  -67  DG  J N1    1 
ATOM 5075  C C2    . DG  A 1 246 ? 100.938 -33.050 165.167 1.00 681.26 ?  -67  DG  J C2    1 
ATOM 5076  N N2    . DG  A 1 246 ? 100.684 -31.733 165.198 1.00 681.26 ?  -67  DG  J N2    1 
ATOM 5077  N N3    . DG  A 1 246 ? 101.838 -33.542 164.316 1.00 681.26 ?  -67  DG  J N3    1 
ATOM 5078  C C4    . DG  A 1 246 ? 101.974 -34.898 164.419 1.00 681.26 ?  -67  DG  J C4    1 
ATOM 5079  P P     . DT  A 1 247 ? 107.540 -33.953 162.049 1.00 675.26 ?  -66  DT  J P     1 
ATOM 5080  O OP1   . DT  A 1 247 ? 108.412 -33.200 161.119 1.00 675.26 ?  -66  DT  J OP1   1 
ATOM 5081  O OP2   . DT  A 1 247 ? 108.106 -35.083 162.822 1.00 675.26 -1 -66  DT  J OP2   1 
ATOM 5082  O "O5'" . DT  A 1 247 ? 106.877 -32.933 163.083 1.00 675.26 ?  -66  DT  J "O5'" 1 
ATOM 5083  C "C5'" . DT  A 1 247 ? 106.181 -31.773 162.625 1.00 675.26 ?  -66  DT  J "C5'" 1 
ATOM 5084  C "C4'" . DT  A 1 247 ? 105.782 -30.913 163.810 1.00 675.26 ?  -66  DT  J "C4'" 1 
ATOM 5085  O "O4'" . DT  A 1 247 ? 104.737 -31.587 164.558 1.00 675.26 ?  -66  DT  J "O4'" 1 
ATOM 5086  C "C3'" . DT  A 1 247 ? 106.911 -30.619 164.800 1.00 675.26 ?  -66  DT  J "C3'" 1 
ATOM 5087  O "O3'" . DT  A 1 247 ? 106.920 -29.217 165.112 1.00 675.26 ?  -66  DT  J "O3'" 1 
ATOM 5088  C "C2'" . DT  A 1 247 ? 106.604 -31.528 165.993 1.00 675.26 ?  -66  DT  J "C2'" 1 
ATOM 5089  C "C1'" . DT  A 1 247 ? 105.081 -31.642 165.931 1.00 675.26 ?  -66  DT  J "C1'" 1 
ATOM 5090  N N1    . DT  A 1 247 ? 104.522 -32.903 166.546 1.00 675.26 ?  -66  DT  J N1    1 
ATOM 5091  C C2    . DT  A 1 247 ? 103.398 -32.858 167.360 1.00 675.26 ?  -66  DT  J C2    1 
ATOM 5092  O O2    . DT  A 1 247 ? 102.781 -31.846 167.636 1.00 675.26 ?  -66  DT  J O2    1 
ATOM 5093  N N3    . DT  A 1 247 ? 102.998 -34.075 167.851 1.00 675.26 ?  -66  DT  J N3    1 
ATOM 5094  C C4    . DT  A 1 247 ? 103.594 -35.303 167.625 1.00 675.26 ?  -66  DT  J C4    1 
ATOM 5095  O O4    . DT  A 1 247 ? 103.152 -36.336 168.118 1.00 675.26 ?  -66  DT  J O4    1 
ATOM 5096  C C5    . DT  A 1 247 ? 104.759 -35.284 166.772 1.00 675.26 ?  -66  DT  J C5    1 
ATOM 5097  C C7    . DT  A 1 247 ? 105.502 -36.548 166.446 1.00 675.26 ?  -66  DT  J C7    1 
ATOM 5098  C C6    . DT  A 1 247 ? 105.159 -34.103 166.283 1.00 675.26 ?  -66  DT  J C6    1 
ATOM 5099  P P     . DT  A 1 248 ? 107.709 -28.593 166.365 1.00 668.59 ?  -65  DT  J P     1 
ATOM 5100  O OP1   . DT  A 1 248 ? 107.947 -27.157 166.086 1.00 668.59 ?  -65  DT  J OP1   1 
ATOM 5101  O OP2   . DT  A 1 248 ? 108.840 -29.473 166.757 1.00 668.59 -1 -65  DT  J OP2   1 
ATOM 5102  O "O5'" . DT  A 1 248 ? 106.598 -28.718 167.505 1.00 668.59 ?  -65  DT  J "O5'" 1 
ATOM 5103  C "C5'" . DT  A 1 248 ? 105.293 -28.122 167.413 1.00 668.59 ?  -65  DT  J "C5'" 1 
ATOM 5104  C "C4'" . DT  A 1 248 ? 104.679 -28.120 168.803 1.00 668.59 ?  -65  DT  J "C4'" 1 
ATOM 5105  O "O4'" . DT  A 1 248 ? 104.308 -29.478 169.184 1.00 668.59 ?  -65  DT  J "O4'" 1 
ATOM 5106  C "C3'" . DT  A 1 248 ? 105.646 -27.628 169.877 1.00 668.59 ?  -65  DT  J "C3'" 1 
ATOM 5107  O "O3'" . DT  A 1 248 ? 104.954 -26.855 170.812 1.00 668.59 ?  -65  DT  J "O3'" 1 
ATOM 5108  C "C2'" . DT  A 1 248 ? 106.131 -28.913 170.538 1.00 668.59 ?  -65  DT  J "C2'" 1 
ATOM 5109  C "C1'" . DT  A 1 248 ? 104.870 -29.768 170.453 1.00 668.59 ?  -65  DT  J "C1'" 1 
ATOM 5110  N N1    . DT  A 1 248 ? 105.177 -31.225 170.673 1.00 668.59 ?  -65  DT  J N1    1 
ATOM 5111  C C2    . DT  A 1 248 ? 104.455 -31.966 171.603 1.00 668.59 ?  -65  DT  J C2    1 
ATOM 5112  O O2    . DT  A 1 248 ? 103.536 -31.525 172.272 1.00 668.59 ?  -65  DT  J O2    1 
ATOM 5113  N N3    . DT  A 1 248 ? 104.856 -33.276 171.729 1.00 668.59 ?  -65  DT  J N3    1 
ATOM 5114  C C4    . DT  A 1 248 ? 105.879 -33.904 171.042 1.00 668.59 ?  -65  DT  J C4    1 
ATOM 5115  O O4    . DT  A 1 248 ? 106.152 -35.085 171.233 1.00 668.59 ?  -65  DT  J O4    1 
ATOM 5116  C C5    . DT  A 1 248 ? 106.596 -33.079 170.095 1.00 668.59 ?  -65  DT  J C5    1 
ATOM 5117  C C7    . DT  A 1 248 ? 107.727 -33.634 169.280 1.00 668.59 ?  -65  DT  J C7    1 
ATOM 5118  C C6    . DT  A 1 248 ? 106.218 -31.800 169.962 1.00 668.59 ?  -65  DT  J C6    1 
ATOM 5119  P P     . DT  A 1 249 ? 105.737 -25.901 171.832 1.00 663.62 ?  -64  DT  J P     1 
ATOM 5120  O OP1   . DT  A 1 249 ? 105.714 -24.596 171.142 1.00 663.62 ?  -64  DT  J OP1   1 
ATOM 5121  O OP2   . DT  A 1 249 ? 107.015 -26.506 172.304 1.00 663.62 -1 -64  DT  J OP2   1 
ATOM 5122  O "O5'" . DT  A 1 249 ? 104.740 -25.820 173.079 1.00 663.62 ?  -64  DT  J "O5'" 1 
ATOM 5123  C "C5'" . DT  A 1 249 ? 103.391 -26.289 172.925 1.00 663.62 ?  -64  DT  J "C5'" 1 
ATOM 5124  C "C4'" . DT  A 1 249 ? 102.997 -27.264 174.022 1.00 663.62 ?  -64  DT  J "C4'" 1 
ATOM 5125  O "O4'" . DT  A 1 249 ? 103.557 -28.576 173.789 1.00 663.62 ?  -64  DT  J "O4'" 1 
ATOM 5126  C "C3'" . DT  A 1 249 ? 103.465 -26.855 175.413 1.00 663.62 ?  -64  DT  J "C3'" 1 
ATOM 5127  O "O3'" . DT  A 1 249 ? 102.321 -26.778 176.219 1.00 663.62 ?  -64  DT  J "O3'" 1 
ATOM 5128  C "C2'" . DT  A 1 249 ? 104.441 -27.945 175.859 1.00 663.62 ?  -64  DT  J "C2'" 1 
ATOM 5129  C "C1'" . DT  A 1 249 ? 103.880 -29.105 175.054 1.00 663.62 ?  -64  DT  J "C1'" 1 
ATOM 5130  N N1    . DT  A 1 249 ? 104.776 -30.276 174.879 1.00 663.62 ?  -64  DT  J N1    1 
ATOM 5131  C C2    . DT  A 1 249 ? 104.417 -31.468 175.488 1.00 663.62 ?  -64  DT  J C2    1 
ATOM 5132  O O2    . DT  A 1 249 ? 103.419 -31.617 176.177 1.00 663.62 ?  -64  DT  J O2    1 
ATOM 5133  N N3    . DT  A 1 249 ? 105.289 -32.498 175.264 1.00 663.62 ?  -64  DT  J N3    1 
ATOM 5134  C C4    . DT  A 1 249 ? 106.446 -32.464 174.511 1.00 663.62 ?  -64  DT  J C4    1 
ATOM 5135  O O4    . DT  A 1 249 ? 107.142 -33.467 174.395 1.00 663.62 ?  -64  DT  J O4    1 
ATOM 5136  C C5    . DT  A 1 249 ? 106.768 -31.191 173.897 1.00 663.62 ?  -64  DT  J C5    1 
ATOM 5137  C C7    . DT  A 1 249 ? 107.999 -31.022 173.053 1.00 663.62 ?  -64  DT  J C7    1 
ATOM 5138  C C6    . DT  A 1 249 ? 105.924 -30.169 174.107 1.00 663.62 ?  -64  DT  J C6    1 
ATOM 5139  P P     . DA  A 1 250 ? 102.382 -26.008 177.607 1.00 637.59 ?  -63  DA  J P     1 
ATOM 5140  O OP1   . DA  A 1 250 ? 101.212 -25.099 177.672 1.00 637.13 ?  -63  DA  J OP1   1 
ATOM 5141  O OP2   . DA  A 1 250 ? 103.769 -25.545 177.866 1.00 637.82 -1 -63  DA  J OP2   1 
ATOM 5142  O "O5'" . DA  A 1 250 ? 102.196 -27.203 178.630 1.00 636.67 ?  -63  DA  J "O5'" 1 
ATOM 5143  C "C5'" . DA  A 1 250 ? 100.952 -27.826 178.848 1.00 635.08 ?  -63  DA  J "C5'" 1 
ATOM 5144  C "C4'" . DA  A 1 250 ? 101.250 -28.986 179.757 1.00 633.71 ?  -63  DA  J "C4'" 1 
ATOM 5145  O "O4'" . DA  A 1 250 ? 102.235 -29.786 179.079 1.00 634.17 ?  -63  DA  J "O4'" 1 
ATOM 5146  C "C3'" . DA  A 1 250 ? 101.872 -28.587 181.099 1.00 632.77 ?  -63  DA  J "C3'" 1 
ATOM 5147  O "O3'" . DA  A 1 250 ? 101.350 -29.370 182.155 1.00 629.88 ?  -63  DA  J "O3'" 1 
ATOM 5148  C "C2'" . DA  A 1 250 ? 103.353 -28.902 180.931 1.00 634.23 ?  -63  DA  J "C2'" 1 
ATOM 5149  C "C1'" . DA  A 1 250 ? 103.222 -30.116 180.027 1.00 636.69 ?  -63  DA  J "C1'" 1 
ATOM 5150  N N9    . DA  A 1 250 ? 104.421 -30.493 179.311 1.00 637.53 ?  -63  DA  J N9    1 
ATOM 5151  C C8    . DA  A 1 250 ? 105.342 -29.677 178.714 1.00 638.21 ?  -63  DA  J C8    1 
ATOM 5152  N N7    . DA  A 1 250 ? 106.317 -30.339 178.137 1.00 638.79 ?  -63  DA  J N7    1 
ATOM 5153  C C5    . DA  A 1 250 ? 106.004 -31.670 178.376 1.00 638.73 ?  -63  DA  J C5    1 
ATOM 5154  C C6    . DA  A 1 250 ? 106.638 -32.884 178.030 1.00 638.53 ?  -63  DA  J C6    1 
ATOM 5155  N N6    . DA  A 1 250 ? 107.776 -32.937 177.328 1.00 638.20 ?  -63  DA  J N6    1 
ATOM 5156  N N1    . DA  A 1 250 ? 106.051 -34.043 178.430 1.00 638.32 ?  -63  DA  J N1    1 
ATOM 5157  C C2    . DA  A 1 250 ? 104.902 -33.995 179.120 1.00 638.10 ?  -63  DA  J C2    1 
ATOM 5158  N N3    . DA  A 1 250 ? 104.219 -32.917 179.507 1.00 638.14 ?  -63  DA  J N3    1 
ATOM 5159  C C4    . DA  A 1 250 ? 104.829 -31.784 179.099 1.00 638.30 ?  -63  DA  J C4    1 
ATOM 5160  P P     . DA  A 1 251 ? 99.944  -29.070 182.846 1.00 618.72 ?  -62  DA  J P     1 
ATOM 5161  O OP1   . DA  A 1 251 ? 98.995  -28.444 181.890 1.00 617.53 ?  -62  DA  J OP1   1 
ATOM 5162  O OP2   . DA  A 1 251 ? 100.210 -28.435 184.160 1.00 617.60 -1 -62  DA  J OP2   1 
ATOM 5163  O "O5'" . DA  A 1 251 ? 99.478  -30.580 183.101 1.00 620.66 ?  -62  DA  J "O5'" 1 
ATOM 5164  C "C5'" . DA  A 1 251 ? 98.950  -31.392 182.042 1.00 621.73 ?  -62  DA  J "C5'" 1 
ATOM 5165  C "C4'" . DA  A 1 251 ? 99.138  -32.876 182.307 1.00 622.32 ?  -62  DA  J "C4'" 1 
ATOM 5166  O "O4'" . DA  A 1 251 ? 100.446 -33.272 181.836 1.00 623.23 ?  -62  DA  J "O4'" 1 
ATOM 5167  C "C3'" . DA  A 1 251 ? 99.053  -33.305 183.768 1.00 622.62 ?  -62  DA  J "C3'" 1 
ATOM 5168  O "O3'" . DA  A 1 251 ? 98.287  -34.498 183.866 1.00 622.04 ?  -62  DA  J "O3'" 1 
ATOM 5169  C "C2'" . DA  A 1 251 ? 100.507 -33.516 184.180 1.00 623.69 ?  -62  DA  J "C2'" 1 
ATOM 5170  C "C1'" . DA  A 1 251 ? 101.165 -33.916 182.867 1.00 625.76 ?  -62  DA  J "C1'" 1 
ATOM 5171  N N9    . DA  A 1 251 ? 102.562 -33.515 182.709 1.00 626.66 ?  -62  DA  J N9    1 
ATOM 5172  C C8    . DA  A 1 251 ? 103.077 -32.252 182.808 1.00 627.18 ?  -62  DA  J C8    1 
ATOM 5173  N N7    . DA  A 1 251 ? 104.370 -32.178 182.600 1.00 627.02 ?  -62  DA  J N7    1 
ATOM 5174  C C5    . DA  A 1 251 ? 104.733 -33.489 182.341 1.00 627.43 ?  -62  DA  J C5    1 
ATOM 5175  C C6    . DA  A 1 251 ? 105.973 -34.100 182.035 1.00 627.16 ?  -62  DA  J C6    1 
ATOM 5176  N N6    . DA  A 1 251 ? 107.120 -33.424 181.943 1.00 627.29 ?  -62  DA  J N6    1 
ATOM 5177  N N1    . DA  A 1 251 ? 106.000 -35.437 181.831 1.00 627.00 ?  -62  DA  J N1    1 
ATOM 5178  C C2    . DA  A 1 251 ? 104.851 -36.119 181.926 1.00 627.15 ?  -62  DA  J C2    1 
ATOM 5179  N N3    . DA  A 1 251 ? 103.628 -35.658 182.203 1.00 627.72 ?  -62  DA  J N3    1 
ATOM 5180  C C4    . DA  A 1 251 ? 103.630 -34.325 182.399 1.00 627.35 ?  -62  DA  J C4    1 
ATOM 5181  P P     . DG  A 1 252 ? 97.840  -35.119 185.272 1.00 602.10 ?  -61  DG  J P     1 
ATOM 5182  O OP1   . DG  A 1 252 ? 96.536  -35.738 184.995 1.00 602.50 ?  -61  DG  J OP1   1 
ATOM 5183  O OP2   . DG  A 1 252 ? 97.976  -34.165 186.385 1.00 601.63 -1 -61  DG  J OP2   1 
ATOM 5184  O "O5'" . DG  A 1 252 ? 98.973  -36.198 185.550 1.00 604.03 ?  -61  DG  J "O5'" 1 
ATOM 5185  C "C5'" . DG  A 1 252 ? 99.187  -37.286 184.683 1.00 608.16 ?  -61  DG  J "C5'" 1 
ATOM 5186  C "C4'" . DG  A 1 252 ? 100.363 -38.110 185.173 1.00 611.77 ?  -61  DG  J "C4'" 1 
ATOM 5187  O "O4'" . DG  A 1 252 ? 101.615 -37.502 184.774 1.00 613.87 ?  -61  DG  J "O4'" 1 
ATOM 5188  C "C3'" . DG  A 1 252 ? 100.456 -38.325 186.681 1.00 613.18 ?  -61  DG  J "C3'" 1 
ATOM 5189  O "O3'" . DG  A 1 252 ? 100.855 -39.657 186.885 1.00 614.78 ?  -61  DG  J "O3'" 1 
ATOM 5190  C "C2'" . DG  A 1 252 ? 101.557 -37.372 187.116 1.00 614.43 ?  -61  DG  J "C2'" 1 
ATOM 5191  C "C1'" . DG  A 1 252 ? 102.466 -37.387 185.895 1.00 616.22 ?  -61  DG  J "C1'" 1 
ATOM 5192  N N9    . DG  A 1 252 ? 103.219 -36.151 185.746 1.00 616.89 ?  -61  DG  J N9    1 
ATOM 5193  C C8    . DG  A 1 252 ? 102.724 -34.877 185.886 1.00 617.35 ?  -61  DG  J C8    1 
ATOM 5194  N N7    . DG  A 1 252 ? 103.609 -33.944 185.693 1.00 617.56 ?  -61  DG  J N7    1 
ATOM 5195  C C5    . DG  A 1 252 ? 104.770 -34.652 185.415 1.00 617.50 ?  -61  DG  J C5    1 
ATOM 5196  C C6    . DG  A 1 252 ? 106.068 -34.173 185.129 1.00 617.35 ?  -61  DG  J C6    1 
ATOM 5197  O O6    . DG  A 1 252 ? 106.440 -32.996 185.059 1.00 617.33 ?  -61  DG  J O6    1 
ATOM 5198  N N1    . DG  A 1 252 ? 106.972 -35.211 184.895 1.00 617.32 ?  -61  DG  J N1    1 
ATOM 5199  C C2    . DG  A 1 252 ? 106.660 -36.550 184.943 1.00 617.20 ?  -61  DG  J C2    1 
ATOM 5200  N N2    . DG  A 1 252 ? 107.669 -37.399 184.695 1.00 617.16 ?  -61  DG  J N2    1 
ATOM 5201  N N3    . DG  A 1 252 ? 105.442 -37.012 185.216 1.00 617.28 ?  -61  DG  J N3    1 
ATOM 5202  C C4    . DG  A 1 252 ? 104.550 -36.013 185.437 1.00 617.14 ?  -61  DG  J C4    1 
ATOM 5203  P P     . DC  A 1 253 ? 100.868 -40.348 188.320 1.00 602.69 ?  -60  DC  J P     1 
ATOM 5204  O OP1   . DC  A 1 253 ? 100.078 -41.591 188.184 1.00 602.76 ?  -60  DC  J OP1   1 
ATOM 5205  O OP2   . DC  A 1 253 ? 100.487 -39.357 189.352 1.00 602.49 -1 -60  DC  J OP2   1 
ATOM 5206  O "O5'" . DC  A 1 253 ? 102.416 -40.703 188.509 1.00 604.29 ?  -60  DC  J "O5'" 1 
ATOM 5207  C "C5'" . DC  A 1 253 ? 103.269 -40.860 187.377 1.00 607.88 ?  -60  DC  J "C5'" 1 
ATOM 5208  C "C4'" . DC  A 1 253 ? 104.715 -41.084 187.793 1.00 610.92 ?  -60  DC  J "C4'" 1 
ATOM 5209  O "O4'" . DC  A 1 253 ? 105.535 -39.933 187.466 1.00 611.71 ?  -60  DC  J "O4'" 1 
ATOM 5210  C "C3'" . DC  A 1 253 ? 104.921 -41.351 189.277 1.00 612.61 ?  -60  DC  J "C3'" 1 
ATOM 5211  O "O3'" . DC  A 1 253 ? 105.813 -42.432 189.447 1.00 614.85 ?  -60  DC  J "O3'" 1 
ATOM 5212  C "C2'" . DC  A 1 253 ? 105.507 -40.060 189.841 1.00 612.77 ?  -60  DC  J "C2'" 1 
ATOM 5213  C "C1'" . DC  A 1 253 ? 106.164 -39.415 188.627 1.00 612.83 ?  -60  DC  J "C1'" 1 
ATOM 5214  N N1    . DC  A 1 253 ? 105.995 -37.934 188.604 1.00 613.41 ?  -60  DC  J N1    1 
ATOM 5215  C C2    . DC  A 1 253 ? 107.082 -37.086 188.309 1.00 613.21 ?  -60  DC  J C2    1 
ATOM 5216  O O2    . DC  A 1 253 ? 108.202 -37.558 188.070 1.00 613.21 ?  -60  DC  J O2    1 
ATOM 5217  N N3    . DC  A 1 253 ? 106.865 -35.745 188.297 1.00 613.16 ?  -60  DC  J N3    1 
ATOM 5218  C C4    . DC  A 1 253 ? 105.649 -35.248 188.561 1.00 613.19 ?  -60  DC  J C4    1 
ATOM 5219  N N4    . DC  A 1 253 ? 105.490 -33.923 188.534 1.00 613.22 ?  -60  DC  J N4    1 
ATOM 5220  C C5    . DC  A 1 253 ? 104.533 -36.088 188.861 1.00 613.56 ?  -60  DC  J C5    1 
ATOM 5221  C C6    . DC  A 1 253 ? 104.753 -37.408 188.870 1.00 613.86 ?  -60  DC  J C6    1 
ATOM 5222  P P     . DG  A 1 254 ? 105.760 -43.286 190.797 1.00 604.02 ?  -59  DG  J P     1 
ATOM 5223  O OP1   . DG  A 1 254 ? 106.084 -44.685 190.434 1.00 603.68 ?  -59  DG  J OP1   1 
ATOM 5224  O OP2   . DG  A 1 254 ? 104.487 -42.983 191.502 1.00 603.39 -1 -59  DG  J OP2   1 
ATOM 5225  O "O5'" . DG  A 1 254 ? 106.950 -42.666 191.672 1.00 605.68 ?  -59  DG  J "O5'" 1 
ATOM 5226  C "C5'" . DG  A 1 254 ? 108.298 -42.619 191.197 1.00 608.77 ?  -59  DG  J "C5'" 1 
ATOM 5227  C "C4'" . DG  A 1 254 ? 109.167 -41.712 192.067 1.00 611.43 ?  -59  DG  J "C4'" 1 
ATOM 5228  O "O4'" . DG  A 1 254 ? 108.796 -40.319 191.913 1.00 612.03 ?  -59  DG  J "O4'" 1 
ATOM 5229  C "C3'" . DG  A 1 254 ? 109.128 -41.925 193.582 1.00 612.95 ?  -59  DG  J "C3'" 1 
ATOM 5230  O "O3'" . DG  A 1 254 ? 110.342 -41.398 194.124 1.00 614.81 ?  -59  DG  J "O3'" 1 
ATOM 5231  C "C2'" . DG  A 1 254 ? 107.986 -41.003 193.998 1.00 612.57 ?  -59  DG  J "C2'" 1 
ATOM 5232  C "C1'" . DG  A 1 254 ? 108.480 -39.804 193.196 1.00 612.53 ?  -59  DG  J "C1'" 1 
ATOM 5233  N N9    . DG  A 1 254 ? 107.587 -38.673 192.992 1.00 612.72 ?  -59  DG  J N9    1 
ATOM 5234  C C8    . DG  A 1 254 ? 106.234 -38.551 193.219 1.00 612.77 ?  -59  DG  J C8    1 
ATOM 5235  N N7    . DG  A 1 254 ? 105.763 -37.373 192.903 1.00 612.64 ?  -59  DG  J N7    1 
ATOM 5236  C C5    . DG  A 1 254 ? 106.877 -36.682 192.436 1.00 612.79 ?  -59  DG  J C5    1 
ATOM 5237  C C6    . DG  A 1 254 ? 107.005 -35.357 191.949 1.00 612.78 ?  -59  DG  J C6    1 
ATOM 5238  O O6    . DG  A 1 254 ? 106.109 -34.509 191.834 1.00 612.60 ?  -59  DG  J O6    1 
ATOM 5239  N N1    . DG  A 1 254 ? 108.325 -35.060 191.572 1.00 612.74 ?  -59  DG  J N1    1 
ATOM 5240  C C2    . DG  A 1 254 ? 109.394 -35.930 191.659 1.00 612.53 ?  -59  DG  J C2    1 
ATOM 5241  N N2    . DG  A 1 254 ? 110.589 -35.477 191.261 1.00 612.57 ?  -59  DG  J N2    1 
ATOM 5242  N N3    . DG  A 1 254 ? 109.286 -37.168 192.117 1.00 612.58 ?  -59  DG  J N3    1 
ATOM 5243  C C4    . DG  A 1 254 ? 108.008 -37.472 192.481 1.00 612.90 ?  -59  DG  J C4    1 
ATOM 5244  P P     . DG  A 1 255 ? 111.700 -42.199 194.424 1.00 610.76 ?  -58  DG  J P     1 
ATOM 5245  O OP1   . DG  A 1 255 ? 111.452 -43.147 193.303 1.00 610.48 ?  -58  DG  J OP1   1 
ATOM 5246  O OP2   . DG  A 1 255 ? 111.142 -42.269 195.808 1.00 610.73 -1 -58  DG  J OP2   1 
ATOM 5247  O "O5'" . DG  A 1 255 ? 112.339 -40.809 193.929 1.00 611.91 ?  -58  DG  J "O5'" 1 
ATOM 5248  C "C5'" . DG  A 1 255 ? 113.627 -40.385 194.361 1.00 613.64 ?  -58  DG  J "C5'" 1 
ATOM 5249  C "C4'" . DG  A 1 255 ? 113.473 -39.181 195.266 1.00 614.90 ?  -58  DG  J "C4'" 1 
ATOM 5250  O "O4'" . DG  A 1 255 ? 112.491 -38.280 194.698 1.00 615.23 ?  -58  DG  J "O4'" 1 
ATOM 5251  C "C3'" . DG  A 1 255 ? 112.963 -39.522 196.672 1.00 615.80 ?  -58  DG  J "C3'" 1 
ATOM 5252  O "O3'" . DG  A 1 255 ? 114.020 -39.411 197.658 1.00 617.10 ?  -58  DG  J "O3'" 1 
ATOM 5253  C "C2'" . DG  A 1 255 ? 111.748 -38.613 196.881 1.00 615.77 ?  -58  DG  J "C2'" 1 
ATOM 5254  C "C1'" . DG  A 1 255 ? 111.987 -37.561 195.801 1.00 616.10 ?  -58  DG  J "C1'" 1 
ATOM 5255  N N9    . DG  A 1 255 ? 110.823 -36.725 195.484 1.00 616.29 ?  -58  DG  J N9    1 
ATOM 5256  C C8    . DG  A 1 255 ? 109.495 -37.018 195.699 1.00 616.27 ?  -58  DG  J C8    1 
ATOM 5257  N N7    . DG  A 1 255 ? 108.686 -36.061 195.341 1.00 616.23 ?  -58  DG  J N7    1 
ATOM 5258  C C5    . DG  A 1 255 ? 109.527 -35.063 194.865 1.00 616.31 ?  -58  DG  J C5    1 
ATOM 5259  C C6    . DG  A 1 255 ? 109.222 -33.780 194.337 1.00 616.37 ?  -58  DG  J C6    1 
ATOM 5260  O O6    . DG  A 1 255 ? 108.105 -33.270 194.183 1.00 616.30 ?  -58  DG  J O6    1 
ATOM 5261  N N1    . DG  A 1 255 ? 110.367 -33.071 193.962 1.00 616.30 ?  -58  DG  J N1    1 
ATOM 5262  C C2    . DG  A 1 255 ? 111.652 -33.545 194.090 1.00 616.24 ?  -58  DG  J C2    1 
ATOM 5263  N N2    . DG  A 1 255 ? 112.632 -32.726 193.684 1.00 616.21 ?  -58  DG  J N2    1 
ATOM 5264  N N3    . DG  A 1 255 ? 111.952 -34.744 194.584 1.00 616.39 ?  -58  DG  J N3    1 
ATOM 5265  C C4    . DG  A 1 255 ? 110.848 -35.452 194.950 1.00 616.37 ?  -58  DG  J C4    1 
ATOM 5266  P P     . DT  A 1 256 ? 114.355 -38.157 198.609 1.00 625.39 ?  -57  DT  J P     1 
ATOM 5267  O OP1   . DT  A 1 256 ? 115.610 -38.498 199.316 1.00 625.45 ?  -57  DT  J OP1   1 
ATOM 5268  O OP2   . DT  A 1 256 ? 113.149 -37.831 199.409 1.00 625.18 -1 -57  DT  J OP2   1 
ATOM 5269  O "O5'" . DT  A 1 256 ? 114.651 -36.962 197.579 1.00 625.87 ?  -57  DT  J "O5'" 1 
ATOM 5270  C "C5'" . DT  A 1 256 ? 115.786 -36.097 197.729 1.00 626.32 ?  -57  DT  J "C5'" 1 
ATOM 5271  C "C4'" . DT  A 1 256 ? 115.404 -34.760 198.351 1.00 626.75 ?  -57  DT  J "C4'" 1 
ATOM 5272  O "O4'" . DT  A 1 256 ? 114.089 -34.328 197.898 1.00 626.49 ?  -57  DT  J "O4'" 1 
ATOM 5273  C "C3'" . DT  A 1 256 ? 115.356 -34.715 199.880 1.00 627.26 ?  -57  DT  J "C3'" 1 
ATOM 5274  O "O3'" . DT  A 1 256 ? 115.980 -33.503 200.340 1.00 628.34 ?  -57  DT  J "O3'" 1 
ATOM 5275  C "C2'" . DT  A 1 256 ? 113.855 -34.724 200.158 1.00 626.78 ?  -57  DT  J "C2'" 1 
ATOM 5276  C "C1'" . DT  A 1 256 ? 113.375 -33.836 199.015 1.00 626.03 ?  -57  DT  J "C1'" 1 
ATOM 5277  N N1    . DT  A 1 256 ? 111.904 -33.872 198.734 1.00 625.65 ?  -57  DT  J N1    1 
ATOM 5278  C C2    . DT  A 1 256 ? 111.334 -32.914 197.914 1.00 625.40 ?  -57  DT  J C2    1 
ATOM 5279  O O2    . DT  A 1 256 ? 111.956 -32.010 197.385 1.00 625.39 ?  -57  DT  J O2    1 
ATOM 5280  N N3    . DT  A 1 256 ? 109.980 -33.056 197.733 1.00 625.40 ?  -57  DT  J N3    1 
ATOM 5281  C C4    . DT  A 1 256 ? 109.161 -34.035 198.277 1.00 625.61 ?  -57  DT  J C4    1 
ATOM 5282  O O4    . DT  A 1 256 ? 107.959 -34.073 198.049 1.00 625.60 ?  -57  DT  J O4    1 
ATOM 5283  C C5    . DT  A 1 256 ? 109.817 -35.004 199.125 1.00 625.56 ?  -57  DT  J C5    1 
ATOM 5284  C C7    . DT  A 1 256 ? 109.049 -36.115 199.778 1.00 625.53 ?  -57  DT  J C7    1 
ATOM 5285  C C6    . DT  A 1 256 ? 111.137 -34.873 199.306 1.00 625.64 ?  -57  DT  J C6    1 
ATOM 5286  P P     . DG  A 1 257 ? 116.142 -33.123 201.899 1.00 624.33 ?  -56  DG  J P     1 
ATOM 5287  O OP1   . DG  A 1 257 ? 117.187 -34.020 202.449 1.00 624.33 ?  -56  DG  J OP1   1 
ATOM 5288  O OP2   . DG  A 1 257 ? 114.810 -33.079 202.552 1.00 624.05 -1 -56  DG  J OP2   1 
ATOM 5289  O "O5'" . DG  A 1 257 ? 116.697 -31.614 201.845 1.00 623.82 ?  -56  DG  J "O5'" 1 
ATOM 5290  C "C5'" . DG  A 1 257 ? 116.238 -30.655 200.873 1.00 622.96 ?  -56  DG  J "C5'" 1 
ATOM 5291  C "C4'" . DG  A 1 257 ? 115.052 -29.821 201.346 1.00 622.26 ?  -56  DG  J "C4'" 1 
ATOM 5292  O "O4'" . DG  A 1 257 ? 113.810 -30.369 200.825 1.00 622.55 ?  -56  DG  J "O4'" 1 
ATOM 5293  C "C3'" . DG  A 1 257 ? 114.864 -29.672 202.861 1.00 621.61 ?  -56  DG  J "C3'" 1 
ATOM 5294  O "O3'" . DG  A 1 257 ? 115.215 -28.332 203.285 1.00 620.34 ?  -56  DG  J "O3'" 1 
ATOM 5295  C "C2'" . DG  A 1 257 ? 113.394 -30.047 203.081 1.00 622.10 ?  -56  DG  J "C2'" 1 
ATOM 5296  C "C1'" . DG  A 1 257 ? 112.777 -29.937 201.687 1.00 622.42 ?  -56  DG  J "C1'" 1 
ATOM 5297  N N9    . DG  A 1 257 ? 111.546 -30.731 201.542 1.00 622.52 ?  -56  DG  J N9    1 
ATOM 5298  C C8    . DG  A 1 257 ? 111.406 -32.086 201.759 1.00 622.46 ?  -56  DG  J C8    1 
ATOM 5299  N N7    . DG  A 1 257 ? 110.195 -32.532 201.576 1.00 622.35 ?  -56  DG  J N7    1 
ATOM 5300  C C5    . DG  A 1 257 ? 109.474 -31.401 201.220 1.00 622.37 ?  -56  DG  J C5    1 
ATOM 5301  C C6    . DG  A 1 257 ? 108.101 -31.271 200.899 1.00 622.35 ?  -56  DG  J C6    1 
ATOM 5302  O O6    . DG  A 1 257 ? 107.246 -32.164 200.872 1.00 622.36 ?  -56  DG  J O6    1 
ATOM 5303  N N1    . DG  A 1 257 ? 107.750 -29.955 200.588 1.00 622.29 ?  -56  DG  J N1    1 
ATOM 5304  C C2    . DG  A 1 257 ? 108.629 -28.897 200.593 1.00 622.30 ?  -56  DG  J C2    1 
ATOM 5305  N N2    . DG  A 1 257 ? 108.118 -27.703 200.266 1.00 622.30 ?  -56  DG  J N2    1 
ATOM 5306  N N3    . DG  A 1 257 ? 109.922 -29.006 200.891 1.00 622.35 ?  -56  DG  J N3    1 
ATOM 5307  C C4    . DG  A 1 257 ? 110.284 -30.283 201.195 1.00 622.40 ?  -56  DG  J C4    1 
ATOM 5308  P P     . DC  A 1 258 ? 114.543 -27.528 204.509 1.00 634.02 ?  -55  DC  J P     1 
ATOM 5309  O OP1   . DC  A 1 258 ? 115.425 -26.381 204.812 1.00 634.29 ?  -55  DC  J OP1   1 
ATOM 5310  O OP2   . DC  A 1 258 ? 114.194 -28.460 205.608 1.00 634.06 -1 -55  DC  J OP2   1 
ATOM 5311  O "O5'" . DC  A 1 258 ? 113.178 -27.004 203.848 1.00 633.12 ?  -55  DC  J "O5'" 1 
ATOM 5312  C "C5'" . DC  A 1 258 ? 112.989 -25.658 203.402 1.00 631.39 ?  -55  DC  J "C5'" 1 
ATOM 5313  C "C4'" . DC  A 1 258 ? 111.705 -25.078 203.985 1.00 629.99 ?  -55  DC  J "C4'" 1 
ATOM 5314  O "O4'" . DC  A 1 258 ? 110.576 -25.931 203.653 1.00 629.90 ?  -55  DC  J "O4'" 1 
ATOM 5315  C "C3'" . DC  A 1 258 ? 111.697 -24.952 205.506 1.00 628.99 ?  -55  DC  J "C3'" 1 
ATOM 5316  O "O3'" . DC  A 1 258 ? 110.971 -23.792 205.912 1.00 626.69 ?  -55  DC  J "O3'" 1 
ATOM 5317  C "C2'" . DC  A 1 258 ? 110.985 -26.232 205.931 1.00 629.53 ?  -55  DC  J "C2'" 1 
ATOM 5318  C "C1'" . DC  A 1 258 ? 109.915 -26.296 204.849 1.00 630.38 ?  -55  DC  J "C1'" 1 
ATOM 5319  N N1    . DC  A 1 258 ? 109.248 -27.630 204.706 1.00 630.85 ?  -55  DC  J N1    1 
ATOM 5320  C C2    . DC  A 1 258 ? 107.842 -27.700 204.648 1.00 631.05 ?  -55  DC  J C2    1 
ATOM 5321  O O2    . DC  A 1 258 ? 107.172 -26.660 204.713 1.00 631.15 ?  -55  DC  J O2    1 
ATOM 5322  N N3    . DC  A 1 258 ? 107.246 -28.916 204.524 1.00 630.93 ?  -55  DC  J N3    1 
ATOM 5323  C C4    . DC  A 1 258 ? 107.993 -30.023 204.455 1.00 630.89 ?  -55  DC  J C4    1 
ATOM 5324  N N4    . DC  A 1 258 ? 107.367 -31.195 204.332 1.00 630.85 ?  -55  DC  J N4    1 
ATOM 5325  C C5    . DC  A 1 258 ? 109.421 -29.977 204.515 1.00 631.09 ?  -55  DC  J C5    1 
ATOM 5326  C C6    . DC  A 1 258 ? 110.000 -28.774 204.638 1.00 630.99 ?  -55  DC  J C6    1 
ATOM 5327  P P     . DT  A 1 259 ? 111.021 -23.294 207.439 1.00 640.33 ?  -54  DT  J P     1 
ATOM 5328  O OP1   . DT  A 1 259 ? 112.246 -22.475 207.568 1.00 640.71 ?  -54  DT  J OP1   1 
ATOM 5329  O OP2   . DT  A 1 259 ? 110.824 -24.454 208.345 1.00 640.08 -1 -54  DT  J OP2   1 
ATOM 5330  O "O5'" . DT  A 1 259 ? 109.747 -22.322 207.577 1.00 637.71 ?  -54  DT  J "O5'" 1 
ATOM 5331  C "C5'" . DT  A 1 259 ? 108.766 -22.184 206.538 1.00 633.04 ?  -54  DT  J "C5'" 1 
ATOM 5332  C "C4'" . DT  A 1 259 ? 107.359 -22.596 206.971 1.00 629.35 ?  -54  DT  J "C4'" 1 
ATOM 5333  O "O4'" . DT  A 1 259 ? 107.154 -24.010 206.748 1.00 628.93 ?  -54  DT  J "O4'" 1 
ATOM 5334  C "C3'" . DT  A 1 259 ? 106.964 -22.358 208.427 1.00 627.10 ?  -54  DT  J "C3'" 1 
ATOM 5335  O "O3'" . DT  A 1 259 ? 105.613 -21.956 208.439 1.00 623.74 ?  -54  DT  J "O3'" 1 
ATOM 5336  C "C2'" . DT  A 1 259 ? 107.116 -23.741 209.057 1.00 627.80 ?  -54  DT  J "C2'" 1 
ATOM 5337  C "C1'" . DT  A 1 259 ? 106.558 -24.567 207.904 1.00 628.76 ?  -54  DT  J "C1'" 1 
ATOM 5338  N N1    . DT  A 1 259 ? 106.811 -26.047 207.865 1.00 629.03 ?  -54  DT  J N1    1 
ATOM 5339  C C2    . DT  A 1 259 ? 105.750 -26.884 207.537 1.00 629.05 ?  -54  DT  J C2    1 
ATOM 5340  O O2    . DT  A 1 259 ? 104.613 -26.500 207.301 1.00 628.92 ?  -54  DT  J O2    1 
ATOM 5341  N N3    . DT  A 1 259 ? 106.064 -28.216 207.496 1.00 628.53 ?  -54  DT  J N3    1 
ATOM 5342  C C4    . DT  A 1 259 ? 107.298 -28.781 207.742 1.00 628.66 ?  -54  DT  J C4    1 
ATOM 5343  O O4    . DT  A 1 259 ? 107.454 -29.992 207.675 1.00 629.08 ?  -54  DT  J O4    1 
ATOM 5344  C C5    . DT  A 1 259 ? 108.367 -27.861 208.068 1.00 628.84 ?  -54  DT  J C5    1 
ATOM 5345  C C7    . DT  A 1 259 ? 109.751 -28.372 208.353 1.00 628.88 ?  -54  DT  J C7    1 
ATOM 5346  C C6    . DT  A 1 259 ? 108.079 -26.549 208.110 1.00 628.71 ?  -54  DT  J C6    1 
ATOM 5347  P P     . DA  A 1 260 ? 105.166 -20.421 208.386 1.00 637.70 ?  -53  DA  J P     1 
ATOM 5348  O OP1   . DA  A 1 260 ? 105.946 -19.683 207.371 1.00 637.52 ?  -53  DA  J OP1   1 
ATOM 5349  O OP2   . DA  A 1 260 ? 105.128 -19.952 209.783 1.00 637.51 -1 -53  DA  J OP2   1 
ATOM 5350  O "O5'" . DA  A 1 260 ? 103.668 -20.516 207.844 1.00 637.29 ?  -53  DA  J "O5'" 1 
ATOM 5351  C "C5'" . DA  A 1 260 ? 103.395 -21.086 206.558 1.00 636.27 ?  -53  DA  J "C5'" 1 
ATOM 5352  C "C4'" . DA  A 1 260 ? 102.092 -21.874 206.551 1.00 635.15 ?  -53  DA  J "C4'" 1 
ATOM 5353  O "O4'" . DA  A 1 260 ? 102.314 -23.199 207.102 1.00 636.06 ?  -53  DA  J "O4'" 1 
ATOM 5354  C "C3'" . DA  A 1 260 ? 100.960 -21.285 207.379 1.00 633.91 ?  -53  DA  J "C3'" 1 
ATOM 5355  O "O3'" . DA  A 1 260 ? 99.725  -21.613 206.782 1.00 631.27 ?  -53  DA  J "O3'" 1 
ATOM 5356  C "C2'" . DA  A 1 260 ? 101.115 -21.975 208.730 1.00 635.18 ?  -53  DA  J "C2'" 1 
ATOM 5357  C "C1'" . DA  A 1 260 ? 101.577 -23.366 208.303 1.00 637.20 ?  -53  DA  J "C1'" 1 
ATOM 5358  N N9    . DA  A 1 260 ? 102.410 -24.067 209.287 1.00 637.74 ?  -53  DA  J N9    1 
ATOM 5359  C C8    . DA  A 1 260 ? 103.185 -23.516 210.274 1.00 638.16 ?  -53  DA  J C8    1 
ATOM 5360  N N7    . DA  A 1 260 ? 103.821 -24.395 211.012 1.00 638.34 ?  -53  DA  J N7    1 
ATOM 5361  C C5    . DA  A 1 260 ? 103.444 -25.611 210.467 1.00 638.06 ?  -53  DA  J C5    1 
ATOM 5362  C C6    . DA  A 1 260 ? 103.773 -26.944 210.796 1.00 637.95 ?  -53  DA  J C6    1 
ATOM 5363  N N6    . DA  A 1 260 ? 104.594 -27.278 211.793 1.00 637.91 ?  -53  DA  J N6    1 
ATOM 5364  N N1    . DA  A 1 260 ? 103.216 -27.931 210.061 1.00 638.18 ?  -53  DA  J N1    1 
ATOM 5365  C C2    . DA  A 1 260 ? 102.384 -27.600 209.060 1.00 638.28 ?  -53  DA  J C2    1 
ATOM 5366  N N3    . DA  A 1 260 ? 102.004 -26.385 208.656 1.00 638.17 ?  -53  DA  J N3    1 
ATOM 5367  C C4    . DA  A 1 260 ? 102.572 -25.426 209.408 1.00 637.87 ?  -53  DA  J C4    1 
ATOM 5368  P P     . DG  A 1 261 ? 98.441  -20.719 207.098 1.00 631.84 ?  -52  DG  J P     1 
ATOM 5369  O OP1   . DG  A 1 261 ? 98.153  -19.957 205.868 1.00 631.77 ?  -52  DG  J OP1   1 
ATOM 5370  O OP2   . DG  A 1 261 ? 98.629  -20.038 208.396 1.00 631.79 -1 -52  DG  J OP2   1 
ATOM 5371  O "O5'" . DG  A 1 261 ? 97.263  -21.763 207.349 1.00 632.18 ?  -52  DG  J "O5'" 1 
ATOM 5372  C "C5'" . DG  A 1 261 ? 97.370  -23.103 206.901 1.00 631.80 ?  -52  DG  J "C5'" 1 
ATOM 5373  C "C4'" . DG  A 1 261 ? 97.091  -24.113 207.999 1.00 630.74 ?  -52  DG  J "C4'" 1 
ATOM 5374  O "O4'" . DG  A 1 261 ? 98.320  -24.370 208.720 1.00 630.65 ?  -52  DG  J "O4'" 1 
ATOM 5375  C "C3'" . DG  A 1 261 ? 96.016  -23.738 209.030 1.00 629.67 ?  -52  DG  J "C3'" 1 
ATOM 5376  O "O3'" . DG  A 1 261 ? 95.029  -24.760 209.059 1.00 627.96 ?  -52  DG  J "O3'" 1 
ATOM 5377  C "C2'" . DG  A 1 261 ? 96.785  -23.697 210.344 1.00 630.21 ?  -52  DG  J "C2'" 1 
ATOM 5378  C "C1'" . DG  A 1 261 ? 97.912  -24.680 210.032 1.00 632.00 ?  -52  DG  J "C1'" 1 
ATOM 5379  N N9    . DG  A 1 261 ? 99.058  -24.656 210.936 1.00 632.32 ?  -52  DG  J N9    1 
ATOM 5380  C C8    . DG  A 1 261 ? 99.716  -23.566 211.450 1.00 632.69 ?  -52  DG  J C8    1 
ATOM 5381  N N7    . DG  A 1 261 ? 100.707 -23.885 212.237 1.00 633.08 ?  -52  DG  J N7    1 
ATOM 5382  C C5    . DG  A 1 261 ? 100.705 -25.275 212.255 1.00 632.90 ?  -52  DG  J C5    1 
ATOM 5383  C C6    . DG  A 1 261 ? 101.543 -26.195 212.938 1.00 632.57 ?  -52  DG  J C6    1 
ATOM 5384  O O6    . DG  A 1 261 ? 102.501 -25.963 213.688 1.00 632.51 ?  -52  DG  J O6    1 
ATOM 5385  N N1    . DG  A 1 261 ? 101.192 -27.517 212.672 1.00 632.60 ?  -52  DG  J N1    1 
ATOM 5386  C C2    . DG  A 1 261 ? 100.156 -27.897 211.850 1.00 632.68 ?  -52  DG  J C2    1 
ATOM 5387  N N2    . DG  A 1 261 ? 99.954  -29.211 211.707 1.00 632.79 ?  -52  DG  J N2    1 
ATOM 5388  N N3    . DG  A 1 261 ? 99.365  -27.052 211.210 1.00 632.80 ?  -52  DG  J N3    1 
ATOM 5389  C C4    . DG  A 1 261 ? 99.694  -25.760 211.455 1.00 632.78 ?  -52  DG  J C4    1 
ATOM 5390  P P     . DA  A 1 262 ? 93.442  -24.516 209.117 1.00 628.84 ?  -51  DA  J P     1 
ATOM 5391  O OP1   . DA  A 1 262 ? 92.947  -24.193 207.772 1.00 627.76 ?  -51  DA  J OP1   1 
ATOM 5392  O OP2   . DA  A 1 262 ? 93.055  -23.663 210.257 1.00 627.93 -1 -51  DA  J OP2   1 
ATOM 5393  O "O5'" . DA  A 1 262 ? 92.999  -26.000 209.468 1.00 631.82 ?  -51  DA  J "O5'" 1 
ATOM 5394  C "C5'" . DA  A 1 262 ? 93.643  -27.080 208.787 1.00 635.34 ?  -51  DA  J "C5'" 1 
ATOM 5395  C "C4'" . DA  A 1 262 ? 93.968  -28.227 209.725 1.00 637.94 ?  -51  DA  J "C4'" 1 
ATOM 5396  O "O4'" . DA  A 1 262 ? 95.113  -27.907 210.550 1.00 638.23 ?  -51  DA  J "O4'" 1 
ATOM 5397  C "C3'" . DA  A 1 262 ? 92.839  -28.632 210.670 1.00 639.77 ?  -51  DA  J "C3'" 1 
ATOM 5398  O "O3'" . DA  A 1 262 ? 92.691  -30.061 210.563 1.00 641.97 ?  -51  DA  J "O3'" 1 
ATOM 5399  C "C2'" . DA  A 1 262 ? 93.308  -28.124 212.041 1.00 639.27 ?  -51  DA  J "C2'" 1 
ATOM 5400  C "C1'" . DA  A 1 262 ? 94.825  -28.207 211.898 1.00 639.38 ?  -51  DA  J "C1'" 1 
ATOM 5401  N N9    . DA  A 1 262 ? 95.620  -27.276 212.691 1.00 639.73 ?  -51  DA  J N9    1 
ATOM 5402  C C8    . DA  A 1 262 ? 95.452  -25.922 212.804 1.00 639.91 ?  -51  DA  J C8    1 
ATOM 5403  N N7    . DA  A 1 262 ? 96.340  -25.338 213.576 1.00 640.11 ?  -51  DA  J N7    1 
ATOM 5404  C C5    . DA  A 1 262 ? 97.156  -26.382 213.993 1.00 640.20 ?  -51  DA  J C5    1 
ATOM 5405  C C6    . DA  A 1 262 ? 98.297  -26.435 214.833 1.00 640.00 ?  -51  DA  J C6    1 
ATOM 5406  N N6    . DA  A 1 262 ? 98.824  -25.359 215.427 1.00 639.73 ?  -51  DA  J N6    1 
ATOM 5407  N N1    . DA  A 1 262 ? 98.874  -27.643 215.043 1.00 640.06 ?  -51  DA  J N1    1 
ATOM 5408  C C2    . DA  A 1 262 ? 98.350  -28.731 214.456 1.00 639.86 ?  -51  DA  J C2    1 
ATOM 5409  N N3    . DA  A 1 262 ? 97.292  -28.801 213.646 1.00 639.76 ?  -51  DA  J N3    1 
ATOM 5410  C C4    . DA  A 1 262 ? 96.732  -27.586 213.452 1.00 640.02 ?  -51  DA  J C4    1 
ATOM 5411  P P     . DG  A 1 263 ? 91.372  -30.872 210.972 1.00 623.43 ?  -50  DG  J P     1 
ATOM 5412  O OP1   . DG  A 1 263 ? 91.219  -31.962 209.991 1.00 623.37 ?  -50  DG  J OP1   1 
ATOM 5413  O OP2   . DG  A 1 263 ? 90.248  -29.944 211.221 1.00 623.50 -1 -50  DG  J OP2   1 
ATOM 5414  O "O5'" . DG  A 1 263 ? 91.829  -31.501 212.367 1.00 626.14 ?  -50  DG  J "O5'" 1 
ATOM 5415  C "C5'" . DG  A 1 263 ? 93.092  -32.179 212.442 1.00 630.48 ?  -50  DG  J "C5'" 1 
ATOM 5416  C "C4'" . DG  A 1 263 ? 93.552  -32.385 213.877 1.00 633.73 ?  -50  DG  J "C4'" 1 
ATOM 5417  O "O4'" . DG  A 1 263 ? 94.329  -31.244 214.329 1.00 634.31 ?  -50  DG  J "O4'" 1 
ATOM 5418  C "C3'" . DG  A 1 263 ? 92.433  -32.564 214.903 1.00 636.06 ?  -50  DG  J "C3'" 1 
ATOM 5419  O "O3'" . DG  A 1 263 ? 92.829  -33.582 215.822 1.00 639.54 ?  -50  DG  J "O3'" 1 
ATOM 5420  C "C2'" . DG  A 1 263 ? 92.356  -31.177 215.537 1.00 635.45 ?  -50  DG  J "C2'" 1 
ATOM 5421  C "C1'" . DG  A 1 263 ? 93.847  -30.872 215.603 1.00 635.03 ?  -50  DG  J "C1'" 1 
ATOM 5422  N N9    . DG  A 1 263 ? 94.203  -29.492 215.933 1.00 635.15 ?  -50  DG  J N9    1 
ATOM 5423  C C8    . DG  A 1 263 ? 93.512  -28.334 215.652 1.00 635.18 ?  -50  DG  J C8    1 
ATOM 5424  N N7    . DG  A 1 263 ? 94.096  -27.256 216.097 1.00 635.10 ?  -50  DG  J N7    1 
ATOM 5425  C C5    . DG  A 1 263 ? 95.245  -27.725 216.716 1.00 635.11 ?  -50  DG  J C5    1 
ATOM 5426  C C6    . DG  A 1 263 ? 96.277  -27.028 217.387 1.00 635.05 ?  -50  DG  J C6    1 
ATOM 5427  O O6    . DG  A 1 263 ? 96.380  -25.813 217.567 1.00 635.18 ?  -50  DG  J O6    1 
ATOM 5428  N N1    . DG  A 1 263 ? 97.268  -27.881 217.874 1.00 635.33 ?  -50  DG  J N1    1 
ATOM 5429  C C2    . DG  A 1 263 ? 97.260  -29.254 217.735 1.00 635.31 ?  -50  DG  J C2    1 
ATOM 5430  N N2    . DG  A 1 263 ? 98.295  -29.927 218.266 1.00 635.13 ?  -50  DG  J N2    1 
ATOM 5431  N N3    . DG  A 1 263 ? 96.295  -29.918 217.108 1.00 635.35 ?  -50  DG  J N3    1 
ATOM 5432  C C4    . DG  A 1 263 ? 95.325  -29.097 216.627 1.00 635.24 ?  -50  DG  J C4    1 
ATOM 5433  P P     . DC  A 1 264 ? 91.866  -34.105 216.991 1.00 631.32 ?  -49  DC  J P     1 
ATOM 5434  O OP1   . DC  A 1 264 ? 90.785  -34.880 216.339 1.00 631.06 ?  -49  DC  J OP1   1 
ATOM 5435  O OP2   . DC  A 1 264 ? 91.519  -32.983 217.896 1.00 630.98 -1 -49  DC  J OP2   1 
ATOM 5436  O "O5'" . DC  A 1 264 ? 92.828  -35.081 217.828 1.00 633.30 ?  -49  DC  J "O5'" 1 
ATOM 5437  C "C5'" . DC  A 1 264 ? 94.250  -34.895 217.880 1.00 636.23 ?  -49  DC  J "C5'" 1 
ATOM 5438  C "C4'" . DC  A 1 264 ? 94.717  -34.113 219.105 1.00 638.74 ?  -49  DC  J "C4'" 1 
ATOM 5439  O "O4'" . DC  A 1 264 ? 94.720  -32.680 218.852 1.00 639.18 ?  -49  DC  J "O4'" 1 
ATOM 5440  C "C3'" . DC  A 1 264 ? 93.919  -34.304 220.398 1.00 640.56 ?  -49  DC  J "C3'" 1 
ATOM 5441  O "O3'" . DC  A 1 264 ? 94.822  -34.750 221.426 1.00 641.70 ?  -49  DC  J "O3'" 1 
ATOM 5442  C "C2'" . DC  A 1 264 ? 93.351  -32.905 220.668 1.00 640.23 ?  -49  DC  J "C2'" 1 
ATOM 5443  C "C1'" . DC  A 1 264 ? 94.475  -32.050 220.093 1.00 639.55 ?  -49  DC  J "C1'" 1 
ATOM 5444  N N1    . DC  A 1 264 ? 94.213  -30.554 219.947 1.00 639.64 ?  -49  DC  J N1    1 
ATOM 5445  C C2    . DC  A 1 264 ? 95.102  -29.633 220.539 1.00 639.62 ?  -49  DC  J C2    1 
ATOM 5446  O O2    . DC  A 1 264 ? 96.082  -30.043 221.173 1.00 639.57 ?  -49  DC  J O2    1 
ATOM 5447  N N3    . DC  A 1 264 ? 94.869  -28.297 220.407 1.00 639.46 ?  -49  DC  J N3    1 
ATOM 5448  C C4    . DC  A 1 264 ? 93.811  -27.864 219.720 1.00 639.36 ?  -49  DC  J C4    1 
ATOM 5449  N N4    . DC  A 1 264 ? 93.632  -26.543 219.621 1.00 639.32 ?  -49  DC  J N4    1 
ATOM 5450  C C5    . DC  A 1 264 ? 92.891  -28.773 219.112 1.00 639.42 ?  -49  DC  J C5    1 
ATOM 5451  C C6    . DC  A 1 264 ? 93.129  -30.089 219.245 1.00 639.60 ?  -49  DC  J C6    1 
ATOM 5452  P P     . DT  A 1 265 ? 94.400  -34.989 222.961 1.00 639.34 ?  -48  DT  J P     1 
ATOM 5453  O OP1   . DT  A 1 265 ? 95.298  -36.046 223.483 1.00 639.14 ?  -48  DT  J OP1   1 
ATOM 5454  O OP2   . DT  A 1 265 ? 92.928  -35.160 223.025 1.00 639.00 -1 -48  DT  J OP2   1 
ATOM 5455  O "O5'" . DT  A 1 265 ? 94.752  -33.605 223.703 1.00 640.76 ?  -48  DT  J "O5'" 1 
ATOM 5456  C "C5'" . DT  A 1 265 ? 96.105  -33.236 224.020 1.00 642.84 ?  -48  DT  J "C5'" 1 
ATOM 5457  C "C4'" . DT  A 1 265 ? 96.190  -31.924 224.793 1.00 643.31 ?  -48  DT  J "C4'" 1 
ATOM 5458  O "O4'" . DT  A 1 265 ? 95.688  -30.821 223.984 1.00 643.31 ?  -48  DT  J "O4'" 1 
ATOM 5459  C "C3'" . DT  A 1 265 ? 95.408  -31.891 226.109 1.00 643.31 ?  -48  DT  J "C3'" 1 
ATOM 5460  O "O3'" . DT  A 1 265 ? 96.234  -31.430 227.191 1.00 643.31 ?  -48  DT  J "O3'" 1 
ATOM 5461  C "C2'" . DT  A 1 265 ? 94.264  -30.922 225.811 1.00 643.31 ?  -48  DT  J "C2'" 1 
ATOM 5462  C "C1'" . DT  A 1 265 ? 94.903  -29.974 224.800 1.00 643.31 ?  -48  DT  J "C1'" 1 
ATOM 5463  N N1    . DT  A 1 265 ? 93.912  -29.172 223.974 1.00 643.31 ?  -48  DT  J N1    1 
ATOM 5464  C C2    . DT  A 1 265 ? 94.039  -27.792 223.854 1.00 643.31 ?  -48  DT  J C2    1 
ATOM 5465  O O2    . DT  A 1 265 ? 94.921  -27.128 224.369 1.00 643.31 ?  -48  DT  J O2    1 
ATOM 5466  N N3    . DT  A 1 265 ? 93.074  -27.189 223.084 1.00 643.31 ?  -48  DT  J N3    1 
ATOM 5467  C C4    . DT  A 1 265 ? 92.012  -27.797 222.435 1.00 643.31 ?  -48  DT  J C4    1 
ATOM 5468  O O4    . DT  A 1 265 ? 91.206  -27.152 221.771 1.00 643.31 ?  -48  DT  J O4    1 
ATOM 5469  C C5    . DT  A 1 265 ? 91.934  -29.233 222.597 1.00 643.31 ?  -48  DT  J C5    1 
ATOM 5470  C C7    . DT  A 1 265 ? 90.833  -30.025 221.951 1.00 643.31 ?  -48  DT  J C7    1 
ATOM 5471  C C6    . DT  A 1 265 ? 92.870  -29.835 223.347 1.00 643.31 ?  -48  DT  J C6    1 
ATOM 5472  P P     . DG  A 1 266 ? 95.916  -31.802 228.726 1.00 639.81 ?  -47  DG  J P     1 
ATOM 5473  O OP1   . DG  A 1 266 ? 96.636  -33.063 229.017 1.00 639.74 ?  -47  DG  J OP1   1 
ATOM 5474  O OP2   . DG  A 1 266 ? 94.449  -31.711 228.951 1.00 639.60 -1 -47  DG  J OP2   1 
ATOM 5475  O "O5'" . DG  A 1 266 ? 96.603  -30.637 229.594 1.00 639.96 ?  -47  DG  J "O5'" 1 
ATOM 5476  C "C5'" . DG  A 1 266 ? 96.930  -29.354 229.044 1.00 640.15 ?  -47  DG  J "C5'" 1 
ATOM 5477  C "C4'" . DG  A 1 266 ? 96.198  -28.195 229.719 1.00 640.16 ?  -47  DG  J "C4'" 1 
ATOM 5478  O "O4'" . DG  A 1 266 ? 95.368  -27.505 228.742 1.00 640.33 ?  -47  DG  J "O4'" 1 
ATOM 5479  C "C3'" . DG  A 1 266 ? 95.262  -28.503 230.889 1.00 639.81 ?  -47  DG  J "C3'" 1 
ATOM 5480  O "O3'" . DG  A 1 266 ? 95.300  -27.402 231.797 1.00 639.21 ?  -47  DG  J "O3'" 1 
ATOM 5481  C "C2'" . DG  A 1 266 ? 93.908  -28.606 230.195 1.00 640.09 ?  -47  DG  J "C2'" 1 
ATOM 5482  C "C1'" . DG  A 1 266 ? 94.035  -27.443 229.214 1.00 640.50 ?  -47  DG  J "C1'" 1 
ATOM 5483  N N9    . DG  A 1 266 ? 93.139  -27.457 228.056 1.00 640.68 ?  -47  DG  J N9    1 
ATOM 5484  C C8    . DG  A 1 266 ? 92.694  -28.547 227.344 1.00 640.64 ?  -47  DG  J C8    1 
ATOM 5485  N N7    . DG  A 1 266 ? 91.907  -28.239 226.350 1.00 640.61 ?  -47  DG  J N7    1 
ATOM 5486  C C5    . DG  A 1 266 ? 91.823  -26.855 226.404 1.00 640.55 ?  -47  DG  J C5    1 
ATOM 5487  C C6    . DG  A 1 266 ? 91.115  -25.953 225.579 1.00 640.46 ?  -47  DG  J C6    1 
ATOM 5488  O O6    . DG  A 1 266 ? 90.396  -26.209 224.609 1.00 640.61 ?  -47  DG  J O6    1 
ATOM 5489  N N1    . DG  A 1 266 ? 91.295  -24.631 225.973 1.00 640.54 ?  -47  DG  J N1    1 
ATOM 5490  C C2    . DG  A 1 266 ? 92.073  -24.231 227.031 1.00 640.54 ?  -47  DG  J C2    1 
ATOM 5491  N N2    . DG  A 1 266 ? 92.128  -22.915 227.262 1.00 640.63 ?  -47  DG  J N2    1 
ATOM 5492  N N3    . DG  A 1 266 ? 92.743  -25.063 227.814 1.00 640.55 ?  -47  DG  J N3    1 
ATOM 5493  C C4    . DG  A 1 266 ? 92.577  -26.358 227.444 1.00 640.65 ?  -47  DG  J C4    1 
ATOM 5494  P P     . DT  A 1 267 ? 94.943  -27.562 233.349 1.00 652.66 ?  -46  DT  J P     1 
ATOM 5495  O OP1   . DT  A 1 267 ? 96.216  -27.752 234.082 1.00 652.42 ?  -46  DT  J OP1   1 
ATOM 5496  O OP2   . DT  A 1 267 ? 93.850  -28.557 233.474 1.00 652.70 -1 -46  DT  J OP2   1 
ATOM 5497  O "O5'" . DT  A 1 267 ? 94.328  -26.137 233.749 1.00 651.35 ?  -46  DT  J "O5'" 1 
ATOM 5498  C "C5'" . DT  A 1 267 ? 95.071  -24.935 233.570 1.00 649.55 ?  -46  DT  J "C5'" 1 
ATOM 5499  C "C4'" . DT  A 1 267 ? 94.127  -23.774 233.312 1.00 648.05 ?  -46  DT  J "C4'" 1 
ATOM 5500  O "O4'" . DT  A 1 267 ? 93.420  -23.965 232.058 1.00 647.90 ?  -46  DT  J "O4'" 1 
ATOM 5501  C "C3'" . DT  A 1 267 ? 93.047  -23.569 234.366 1.00 647.14 ?  -46  DT  J "C3'" 1 
ATOM 5502  O "O3'" . DT  A 1 267 ? 92.952  -22.185 234.586 1.00 645.99 ?  -46  DT  J "O3'" 1 
ATOM 5503  C "C2'" . DT  A 1 267 ? 91.791  -24.113 233.690 1.00 647.40 ?  -46  DT  J "C2'" 1 
ATOM 5504  C "C1'" . DT  A 1 267 ? 92.053  -23.661 232.260 1.00 647.65 ?  -46  DT  J "C1'" 1 
ATOM 5505  N N1    . DT  A 1 267 ? 91.217  -24.280 231.163 1.00 647.69 ?  -46  DT  J N1    1 
ATOM 5506  C C2    . DT  A 1 267 ? 90.533  -23.448 230.291 1.00 647.58 ?  -46  DT  J C2    1 
ATOM 5507  O O2    . DT  A 1 267 ? 90.546  -22.232 230.363 1.00 647.60 ?  -46  DT  J O2    1 
ATOM 5508  N N3    . DT  A 1 267 ? 89.808  -24.091 229.320 1.00 647.51 ?  -46  DT  J N3    1 
ATOM 5509  C C4    . DT  A 1 267 ? 89.704  -25.456 229.122 1.00 647.54 ?  -46  DT  J C4    1 
ATOM 5510  O O4    . DT  A 1 267 ? 89.031  -25.926 228.212 1.00 647.49 ?  -46  DT  J O4    1 
ATOM 5511  C C5    . DT  A 1 267 ? 90.442  -26.274 230.058 1.00 647.64 ?  -46  DT  J C5    1 
ATOM 5512  C C7    . DT  A 1 267 ? 90.401  -27.770 229.951 1.00 647.63 ?  -46  DT  J C7    1 
ATOM 5513  C C6    . DT  A 1 267 ? 91.156  -25.659 231.016 1.00 647.73 ?  -46  DT  J C6    1 
ATOM 5514  P P     . DC  A 1 268 ? 92.184  -21.579 235.846 1.00 648.63 ?  -45  DC  J P     1 
ATOM 5515  O OP1   . DC  A 1 268 ? 93.090  -21.717 237.006 1.00 648.63 ?  -45  DC  J OP1   1 
ATOM 5516  O OP2   . DC  A 1 268 ? 90.805  -22.111 235.915 1.00 648.63 -1 -45  DC  J OP2   1 
ATOM 5517  O "O5'" . DC  A 1 268 ? 92.071  -20.043 235.423 1.00 648.63 ?  -45  DC  J "O5'" 1 
ATOM 5518  C "C5'" . DC  A 1 268 ? 91.622  -19.684 234.113 1.00 648.63 ?  -45  DC  J "C5'" 1 
ATOM 5519  C "C4'" . DC  A 1 268 ? 90.327  -18.878 234.120 1.00 648.63 ?  -45  DC  J "C4'" 1 
ATOM 5520  O "O4'" . DC  A 1 268 ? 89.444  -19.381 233.090 1.00 648.63 ?  -45  DC  J "O4'" 1 
ATOM 5521  C "C3'" . DC  A 1 268 ? 89.504  -18.850 235.409 1.00 648.63 ?  -45  DC  J "C3'" 1 
ATOM 5522  O "O3'" . DC  A 1 268 ? 89.176  -17.466 235.750 1.00 648.63 ?  -45  DC  J "O3'" 1 
ATOM 5523  C "C2'" . DC  A 1 268 ? 88.332  -19.807 235.157 1.00 648.63 ?  -45  DC  J "C2'" 1 
ATOM 5524  C "C1'" . DC  A 1 268 ? 88.226  -19.855 233.632 1.00 648.63 ?  -45  DC  J "C1'" 1 
ATOM 5525  N N1    . DC  A 1 268 ? 87.978  -21.192 232.995 1.00 648.63 ?  -45  DC  J N1    1 
ATOM 5526  C C2    . DC  A 1 268 ? 87.168  -21.265 231.844 1.00 648.63 ?  -45  DC  J C2    1 
ATOM 5527  O O2    . DC  A 1 268 ? 86.656  -20.235 231.380 1.00 648.63 ?  -45  DC  J O2    1 
ATOM 5528  N N3    . DC  A 1 268 ? 86.959  -22.480 231.268 1.00 648.63 ?  -45  DC  J N3    1 
ATOM 5529  C C4    . DC  A 1 268 ? 87.521  -23.576 231.785 1.00 648.63 ?  -45  DC  J C4    1 
ATOM 5530  N N4    . DC  A 1 268 ? 87.286  -24.742 231.179 1.00 648.63 ?  -45  DC  J N4    1 
ATOM 5531  C C5    . DC  A 1 268 ? 88.351  -23.523 232.946 1.00 648.63 ?  -45  DC  J C5    1 
ATOM 5532  C C6    . DC  A 1 268 ? 88.555  -22.324 233.510 1.00 648.63 ?  -45  DC  J C6    1 
ATOM 5533  P P     . DT  A 1 269 ? 87.867  -16.603 235.373 1.00 655.86 ?  -44  DT  J P     1 
ATOM 5534  O OP1   . DT  A 1 269 ? 88.233  -15.188 235.616 1.00 655.86 ?  -44  DT  J OP1   1 
ATOM 5535  O OP2   . DT  A 1 269 ? 86.720  -17.173 236.109 1.00 655.86 -1 -44  DT  J OP2   1 
ATOM 5536  O "O5'" . DT  A 1 269 ? 87.629  -16.801 233.799 1.00 655.86 ?  -44  DT  J "O5'" 1 
ATOM 5537  C "C5'" . DT  A 1 269 ? 86.980  -15.792 233.021 1.00 655.86 ?  -44  DT  J "C5'" 1 
ATOM 5538  C "C4'" . DT  A 1 269 ? 85.519  -16.122 232.731 1.00 655.86 ?  -44  DT  J "C4'" 1 
ATOM 5539  O "O4'" . DT  A 1 269 ? 85.330  -17.534 232.451 1.00 655.86 ?  -44  DT  J "O4'" 1 
ATOM 5540  C "C3'" . DT  A 1 269 ? 84.515  -15.786 233.835 1.00 655.86 ?  -44  DT  J "C3'" 1 
ATOM 5541  O "O3'" . DT  A 1 269 ? 83.413  -15.102 233.254 1.00 655.86 ?  -44  DT  J "O3'" 1 
ATOM 5542  C "C2'" . DT  A 1 269 ? 84.057  -17.158 234.326 1.00 655.86 ?  -44  DT  J "C2'" 1 
ATOM 5543  C "C1'" . DT  A 1 269 ? 84.077  -17.895 232.993 1.00 655.86 ?  -44  DT  J "C1'" 1 
ATOM 5544  N N1    . DT  A 1 269 ? 83.968  -19.386 233.010 1.00 655.86 ?  -44  DT  J N1    1 
ATOM 5545  C C2    . DT  A 1 269 ? 83.228  -20.014 232.026 1.00 655.86 ?  -44  DT  J C2    1 
ATOM 5546  O O2    . DT  A 1 269 ? 82.635  -19.426 231.134 1.00 655.86 ?  -44  DT  J O2    1 
ATOM 5547  N N3    . DT  A 1 269 ? 83.205  -21.385 232.127 1.00 655.86 ?  -44  DT  J N3    1 
ATOM 5548  C C4    . DT  A 1 269 ? 83.835  -22.169 233.083 1.00 655.86 ?  -44  DT  J C4    1 
ATOM 5549  O O4    . DT  A 1 269 ? 83.750  -23.394 233.086 1.00 655.86 ?  -44  DT  J O4    1 
ATOM 5550  C C5    . DT  A 1 269 ? 84.590  -21.451 234.077 1.00 655.86 ?  -44  DT  J C5    1 
ATOM 5551  C C7    . DT  A 1 269 ? 85.314  -22.189 235.164 1.00 655.86 ?  -44  DT  J C7    1 
ATOM 5552  C C6    . DT  A 1 269 ? 84.621  -20.115 233.990 1.00 655.86 ?  -44  DT  J C6    1 
ATOM 5553  P P     . DA  A 1 270 ? 83.345  -13.514 233.106 1.00 660.14 ?  -43  DA  J P     1 
ATOM 5554  O OP1   . DA  A 1 270 ? 84.725  -12.984 232.994 1.00 660.14 ?  -43  DA  J OP1   1 
ATOM 5555  O OP2   . DA  A 1 270 ? 82.420  -13.028 234.152 1.00 660.14 -1 -43  DA  J OP2   1 
ATOM 5556  O "O5'" . DA  A 1 270 ? 82.619  -13.294 231.701 1.00 660.14 ?  -43  DA  J "O5'" 1 
ATOM 5557  C "C5'" . DA  A 1 270 ? 83.242  -13.684 230.479 1.00 660.14 ?  -43  DA  J "C5'" 1 
ATOM 5558  C "C4'" . DA  A 1 270 ? 82.253  -14.426 229.599 1.00 660.14 ?  -43  DA  J "C4'" 1 
ATOM 5559  O "O4'" . DA  A 1 270 ? 82.017  -15.748 230.149 1.00 660.14 ?  -43  DA  J "O4'" 1 
ATOM 5560  C "C3'" . DA  A 1 270 ? 80.880  -13.771 229.441 1.00 660.14 ?  -43  DA  J "C3'" 1 
ATOM 5561  O "O3'" . DA  A 1 270 ? 80.498  -13.815 228.064 1.00 660.14 ?  -43  DA  J "O3'" 1 
ATOM 5562  C "C2'" . DA  A 1 270 ? 79.957  -14.597 230.339 1.00 660.14 ?  -43  DA  J "C2'" 1 
ATOM 5563  C "C1'" . DA  A 1 270 ? 80.631  -15.964 230.327 1.00 660.14 ?  -43  DA  J "C1'" 1 
ATOM 5564  N N9    . DA  A 1 270 ? 80.494  -16.718 231.567 1.00 660.14 ?  -43  DA  J N9    1 
ATOM 5565  C C8    . DA  A 1 270 ? 80.961  -16.345 232.792 1.00 660.14 ?  -43  DA  J C8    1 
ATOM 5566  N N7    . DA  A 1 270 ? 80.725  -17.207 233.749 1.00 660.14 ?  -43  DA  J N7    1 
ATOM 5567  C C5    . DA  A 1 270 ? 80.049  -18.222 233.106 1.00 660.14 ?  -43  DA  J C5    1 
ATOM 5568  C C6    . DA  A 1 270 ? 79.515  -19.435 233.579 1.00 660.14 ?  -43  DA  J C6    1 
ATOM 5569  N N6    . DA  A 1 270 ? 79.594  -19.817 234.858 1.00 660.14 ?  -43  DA  J N6    1 
ATOM 5570  N N1    . DA  A 1 270 ? 78.896  -20.232 232.678 1.00 660.14 ?  -43  DA  J N1    1 
ATOM 5571  C C2    . DA  A 1 270 ? 78.824  -19.836 231.394 1.00 660.14 ?  -43  DA  J C2    1 
ATOM 5572  N N3    . DA  A 1 270 ? 79.288  -18.714 230.834 1.00 660.14 ?  -43  DA  J N3    1 
ATOM 5573  C C4    . DA  A 1 270 ? 79.897  -17.943 231.754 1.00 660.14 ?  -43  DA  J C4    1 
ATOM 5574  P P     . DC  A 1 271 ? 79.279  -12.945 227.491 1.00 652.61 ?  -42  DC  J P     1 
ATOM 5575  O OP1   . DC  A 1 271 ? 79.750  -12.256 226.270 1.00 652.61 ?  -42  DC  J OP1   1 
ATOM 5576  O OP2   . DC  A 1 271 ? 78.663  -12.178 228.596 1.00 652.61 -1 -42  DC  J OP2   1 
ATOM 5577  O "O5'" . DC  A 1 271 ? 78.231  -14.064 227.042 1.00 652.61 ?  -42  DC  J "O5'" 1 
ATOM 5578  C "C5'" . DC  A 1 271 ? 78.647  -15.314 226.479 1.00 652.61 ?  -42  DC  J "C5'" 1 
ATOM 5579  C "C4'" . DC  A 1 271 ? 77.549  -16.355 226.629 1.00 652.61 ?  -42  DC  J "C4'" 1 
ATOM 5580  O "O4'" . DC  A 1 271 ? 77.600  -16.889 227.974 1.00 652.61 ?  -42  DC  J "O4'" 1 
ATOM 5581  C "C3'" . DC  A 1 271 ? 76.119  -15.847 226.407 1.00 652.61 ?  -42  DC  J "C3'" 1 
ATOM 5582  O "O3'" . DC  A 1 271 ? 75.410  -16.708 225.519 1.00 652.61 ?  -42  DC  J "O3'" 1 
ATOM 5583  C "C2'" . DC  A 1 271 ? 75.497  -15.855 227.799 1.00 652.61 ?  -42  DC  J "C2'" 1 
ATOM 5584  C "C1'" . DC  A 1 271 ? 76.276  -16.982 228.460 1.00 652.61 ?  -42  DC  J "C1'" 1 
ATOM 5585  N N1    . DC  A 1 271 ? 76.247  -16.924 229.954 1.00 652.61 ?  -42  DC  J N1    1 
ATOM 5586  C C2    . DC  A 1 271 ? 76.021  -18.105 230.677 1.00 652.61 ?  -42  DC  J C2    1 
ATOM 5587  O O2    . DC  A 1 271 ? 75.845  -19.172 230.078 1.00 652.61 ?  -42  DC  J O2    1 
ATOM 5588  N N3    . DC  A 1 271 ? 75.984  -18.048 232.028 1.00 652.61 ?  -42  DC  J N3    1 
ATOM 5589  C C4    . DC  A 1 271 ? 76.166  -16.886 232.656 1.00 652.61 ?  -42  DC  J C4    1 
ATOM 5590  N N4    . DC  A 1 271 ? 76.120  -16.904 233.990 1.00 652.61 ?  -42  DC  J N4    1 
ATOM 5591  C C5    . DC  A 1 271 ? 76.403  -15.664 231.948 1.00 652.61 ?  -42  DC  J C5    1 
ATOM 5592  C C6    . DC  A 1 271 ? 76.433  -15.733 230.611 1.00 652.61 ?  -42  DC  J C6    1 
ATOM 5593  P P     . DG  A 1 272 ? 73.945  -16.363 224.964 1.00 656.45 ?  -41  DG  J P     1 
ATOM 5594  O OP1   . DG  A 1 272 ? 74.067  -16.126 223.514 1.00 656.45 ?  -41  DG  J OP1   1 
ATOM 5595  O OP2   . DG  A 1 272 ? 73.290  -15.351 225.812 1.00 656.45 -1 -41  DG  J OP2   1 
ATOM 5596  O "O5'" . DG  A 1 272 ? 73.156  -17.723 225.214 1.00 656.45 ?  -41  DG  J "O5'" 1 
ATOM 5597  C "C5'" . DG  A 1 272 ? 73.807  -18.997 225.098 1.00 656.45 ?  -41  DG  J "C5'" 1 
ATOM 5598  C "C4'" . DG  A 1 272 ? 73.064  -20.054 225.899 1.00 656.45 ?  -41  DG  J "C4'" 1 
ATOM 5599  O "O4'" . DG  A 1 272 ? 73.529  -20.017 227.274 1.00 656.45 ?  -41  DG  J "O4'" 1 
ATOM 5600  C "C3'" . DG  A 1 272 ? 71.543  -19.888 225.930 1.00 656.45 ?  -41  DG  J "C3'" 1 
ATOM 5601  O "O3'" . DG  A 1 272 ? 70.873  -21.119 225.634 1.00 656.45 ?  -41  DG  J "O3'" 1 
ATOM 5602  C "C2'" . DG  A 1 272 ? 71.278  -19.399 227.346 1.00 656.45 ?  -41  DG  J "C2'" 1 
ATOM 5603  C "C1'" . DG  A 1 272 ? 72.412  -20.038 228.133 1.00 656.45 ?  -41  DG  J "C1'" 1 
ATOM 5604  N N9    . DG  A 1 272 ? 72.674  -19.255 229.330 1.00 656.45 ?  -41  DG  J N9    1 
ATOM 5605  C C8    . DG  A 1 272 ? 72.976  -17.917 229.340 1.00 656.45 ?  -41  DG  J C8    1 
ATOM 5606  N N7    . DG  A 1 272 ? 73.147  -17.429 230.532 1.00 656.45 ?  -41  DG  J N7    1 
ATOM 5607  C C5    . DG  A 1 272 ? 72.935  -18.512 231.376 1.00 656.45 ?  -41  DG  J C5    1 
ATOM 5608  C C6    . DG  A 1 272 ? 72.991  -18.575 232.795 1.00 656.45 ?  -41  DG  J C6    1 
ATOM 5609  O O6    . DG  A 1 272 ? 73.243  -17.652 233.590 1.00 656.45 ?  -41  DG  J O6    1 
ATOM 5610  N N1    . DG  A 1 272 ? 72.718  -19.859 233.277 1.00 656.45 ?  -41  DG  J N1    1 
ATOM 5611  C C2    . DG  A 1 272 ? 72.438  -20.942 232.479 1.00 656.45 ?  -41  DG  J C2    1 
ATOM 5612  N N2    . DG  A 1 272 ? 72.201  -22.086 233.133 1.00 656.45 ?  -41  DG  J N2    1 
ATOM 5613  N N3    . DG  A 1 272 ? 72.379  -20.895 231.145 1.00 656.45 ?  -41  DG  J N3    1 
ATOM 5614  C C4    . DG  A 1 272 ? 72.641  -19.651 230.654 1.00 656.45 ?  -41  DG  J C4    1 
ATOM 5615  P P     . DA  A 1 273 ? 69.289  -21.279 225.823 1.00 663.78 ?  -40  DA  J P     1 
ATOM 5616  O OP1   . DA  A 1 273 ? 68.715  -22.007 224.678 1.00 663.78 ?  -40  DA  J OP1   1 
ATOM 5617  O OP2   . DA  A 1 273 ? 68.712  -19.974 226.188 1.00 663.78 -1 -40  DA  J OP2   1 
ATOM 5618  O "O5'" . DA  A 1 273 ? 69.238  -22.228 227.101 1.00 663.78 ?  -40  DA  J "O5'" 1 
ATOM 5619  C "C5'" . DA  A 1 273 ? 70.105  -23.358 227.273 1.00 663.78 ?  -40  DA  J "C5'" 1 
ATOM 5620  C "C4'" . DA  A 1 273 ? 69.662  -24.157 228.495 1.00 663.78 ?  -40  DA  J "C4'" 1 
ATOM 5621  O "O4'" . DA  A 1 273 ? 69.996  -23.433 229.708 1.00 663.78 ?  -40  DA  J "O4'" 1 
ATOM 5622  C "C3'" . DA  A 1 273 ? 68.166  -24.457 228.618 1.00 663.78 ?  -40  DA  J "C3'" 1 
ATOM 5623  O "O3'" . DA  A 1 273 ? 67.991  -25.711 229.306 1.00 663.78 ?  -40  DA  J "O3'" 1 
ATOM 5624  C "C2'" . DA  A 1 273 ? 67.645  -23.251 229.407 1.00 663.78 ?  -40  DA  J "C2'" 1 
ATOM 5625  C "C1'" . DA  A 1 273 ? 68.815  -22.962 230.346 1.00 663.78 ?  -40  DA  J "C1'" 1 
ATOM 5626  N N9    . DA  A 1 273 ? 69.040  -21.551 230.655 1.00 663.78 ?  -40  DA  J N9    1 
ATOM 5627  C C8    . DA  A 1 273 ? 69.102  -20.511 229.769 1.00 663.78 ?  -40  DA  J C8    1 
ATOM 5628  N N7    . DA  A 1 273 ? 69.334  -19.343 230.313 1.00 663.78 ?  -40  DA  J N7    1 
ATOM 5629  C C5    . DA  A 1 273 ? 69.434  -19.637 231.658 1.00 663.78 ?  -40  DA  J C5    1 
ATOM 5630  C C6    . DA  A 1 273 ? 69.675  -18.827 232.783 1.00 663.78 ?  -40  DA  J C6    1 
ATOM 5631  N N6    . DA  A 1 273 ? 69.862  -17.508 232.690 1.00 663.78 ?  -40  DA  J N6    1 
ATOM 5632  N N1    . DA  A 1 273 ? 69.717  -19.423 233.998 1.00 663.78 ?  -40  DA  J N1    1 
ATOM 5633  C C2    . DA  A 1 273 ? 69.531  -20.748 234.088 1.00 663.78 ?  -40  DA  J C2    1 
ATOM 5634  N N3    . DA  A 1 273 ? 69.293  -21.614 233.098 1.00 663.78 ?  -40  DA  J N3    1 
ATOM 5635  C C4    . DA  A 1 273 ? 69.258  -20.992 231.896 1.00 663.78 ?  -40  DA  J C4    1 
ATOM 5636  P P     . DC  A 1 274 ? 66.569  -26.339 229.728 1.00 670.85 ?  -39  DC  J P     1 
ATOM 5637  O OP1   . DC  A 1 274 ? 66.450  -27.607 228.980 1.00 670.85 ?  -39  DC  J OP1   1 
ATOM 5638  O OP2   . DC  A 1 274 ? 65.503  -25.311 229.610 1.00 670.85 -1 -39  DC  J OP2   1 
ATOM 5639  O "O5'" . DC  A 1 274 ? 66.740  -26.703 231.285 1.00 670.85 ?  -39  DC  J "O5'" 1 
ATOM 5640  C "C5'" . DC  A 1 274 ? 67.391  -25.826 232.217 1.00 670.85 ?  -39  DC  J "C5'" 1 
ATOM 5641  C "C4'" . DC  A 1 274 ? 66.539  -25.403 233.413 1.00 670.85 ?  -39  DC  J "C4'" 1 
ATOM 5642  O "O4'" . DC  A 1 274 ? 66.864  -24.022 233.733 1.00 670.85 ?  -39  DC  J "O4'" 1 
ATOM 5643  C "C3'" . DC  A 1 274 ? 65.009  -25.474 233.284 1.00 670.85 ?  -39  DC  J "C3'" 1 
ATOM 5644  O "O3'" . DC  A 1 274 ? 64.442  -26.073 234.476 1.00 670.85 ?  -39  DC  J "O3'" 1 
ATOM 5645  C "C2'" . DC  A 1 274 ? 64.601  -24.016 233.074 1.00 670.85 ?  -39  DC  J "C2'" 1 
ATOM 5646  C "C1'" . DC  A 1 274 ? 65.676  -23.254 233.845 1.00 670.85 ?  -39  DC  J "C1'" 1 
ATOM 5647  N N1    . DC  A 1 274 ? 65.933  -21.843 233.357 1.00 670.85 ?  -39  DC  J N1    1 
ATOM 5648  C C2    . DC  A 1 274 ? 66.313  -20.842 234.265 1.00 670.85 ?  -39  DC  J C2    1 
ATOM 5649  O O2    . DC  A 1 274 ? 66.442  -21.120 235.462 1.00 670.85 ?  -39  DC  J O2    1 
ATOM 5650  N N3    . DC  A 1 274 ? 66.543  -19.583 233.806 1.00 670.85 ?  -39  DC  J N3    1 
ATOM 5651  C C4    . DC  A 1 274 ? 66.399  -19.301 232.512 1.00 670.85 ?  -39  DC  J C4    1 
ATOM 5652  N N4    . DC  A 1 274 ? 66.635  -18.048 232.110 1.00 670.85 ?  -39  DC  J N4    1 
ATOM 5653  C C5    . DC  A 1 274 ? 66.008  -20.295 231.567 1.00 670.85 ?  -39  DC  J C5    1 
ATOM 5654  C C6    . DC  A 1 274 ? 65.791  -21.533 232.032 1.00 670.85 ?  -39  DC  J C6    1 
ATOM 5655  P P     . DC  A 1 275 ? 62.932  -25.886 235.010 1.00 669.09 ?  -38  DC  J P     1 
ATOM 5656  O OP1   . DC  A 1 275 ? 62.618  -27.082 235.819 1.00 669.09 ?  -38  DC  J OP1   1 
ATOM 5657  O OP2   . DC  A 1 275 ? 62.018  -25.500 233.910 1.00 669.09 -1 -38  DC  J OP2   1 
ATOM 5658  O "O5'" . DC  A 1 275 ? 63.089  -24.624 235.980 1.00 669.09 ?  -38  DC  J "O5'" 1 
ATOM 5659  C "C5'" . DC  A 1 275 ? 63.619  -24.733 237.308 1.00 669.09 ?  -38  DC  J "C5'" 1 
ATOM 5660  C "C4'" . DC  A 1 275 ? 62.949  -23.730 238.242 1.00 669.09 ?  -38  DC  J "C4'" 1 
ATOM 5661  O "O4'" . DC  A 1 275 ? 63.334  -22.381 237.867 1.00 669.09 ?  -38  DC  J "O4'" 1 
ATOM 5662  C "C3'" . DC  A 1 275 ? 61.418  -23.752 238.255 1.00 669.09 ?  -38  DC  J "C3'" 1 
ATOM 5663  O "O3'" . DC  A 1 275 ? 60.929  -23.686 239.612 1.00 669.09 ?  -38  DC  J "O3'" 1 
ATOM 5664  C "C2'" . DC  A 1 275 ? 61.007  -22.554 237.390 1.00 669.09 ?  -38  DC  J "C2'" 1 
ATOM 5665  C "C1'" . DC  A 1 275 ? 62.194  -21.603 237.532 1.00 669.09 ?  -38  DC  J "C1'" 1 
ATOM 5666  N N1    . DC  A 1 275 ? 62.498  -20.802 236.290 1.00 669.09 ?  -38  DC  J N1    1 
ATOM 5667  C C2    . DC  A 1 275 ? 62.646  -19.403 236.344 1.00 669.09 ?  -38  DC  J C2    1 
ATOM 5668  O O2    . DC  A 1 275 ? 62.526  -18.802 237.416 1.00 669.09 ?  -38  DC  J O2    1 
ATOM 5669  N N3    . DC  A 1 275 ? 62.925  -18.731 235.197 1.00 669.09 ?  -38  DC  J N3    1 
ATOM 5670  C C4    . DC  A 1 275 ? 63.056  -19.389 234.037 1.00 669.09 ?  -38  DC  J C4    1 
ATOM 5671  N N4    . DC  A 1 275 ? 63.328  -18.684 232.935 1.00 669.09 ?  -38  DC  J N4    1 
ATOM 5672  C C5    . DC  A 1 275 ? 62.907  -20.804 233.955 1.00 669.09 ?  -38  DC  J C5    1 
ATOM 5673  C C6    . DC  A 1 275 ? 62.637  -21.457 235.093 1.00 669.09 ?  -38  DC  J C6    1 
ATOM 5674  P P     . DA  A 1 276 ? 59.372  -23.483 239.979 1.00 672.10 ?  -37  DA  J P     1 
ATOM 5675  O OP1   . DA  A 1 276 ? 59.144  -23.966 241.356 1.00 672.10 ?  -37  DA  J OP1   1 
ATOM 5676  O OP2   . DA  A 1 276 ? 58.539  -24.020 238.879 1.00 672.10 -1 -37  DA  J OP2   1 
ATOM 5677  O "O5'" . DA  A 1 276 ? 59.233  -21.890 239.989 1.00 672.10 ?  -37  DA  J "O5'" 1 
ATOM 5678  C "C5'" . DA  A 1 276 ? 59.989  -21.078 240.897 1.00 672.10 ?  -37  DA  J "C5'" 1 
ATOM 5679  C "C4'" . DA  A 1 276 ? 59.386  -19.684 240.988 1.00 672.10 ?  -37  DA  J "C4'" 1 
ATOM 5680  O "O4'" . DA  A 1 276 ? 59.859  -18.890 239.875 1.00 672.10 ?  -37  DA  J "O4'" 1 
ATOM 5681  C "C3'" . DA  A 1 276 ? 57.856  -19.627 240.954 1.00 672.10 ?  -37  DA  J "C3'" 1 
ATOM 5682  O "O3'" . DA  A 1 276 ? 57.388  -18.858 242.085 1.00 672.10 ?  -37  DA  J "O3'" 1 
ATOM 5683  C "C2'" . DA  A 1 276 ? 57.522  -19.084 239.560 1.00 672.10 ?  -37  DA  J "C2'" 1 
ATOM 5684  C "C1'" . DA  A 1 276 ? 58.772  -18.294 239.190 1.00 672.10 ?  -37  DA  J "C1'" 1 
ATOM 5685  N N9    . DA  A 1 276 ? 59.096  -18.293 237.763 1.00 672.10 ?  -37  DA  J N9    1 
ATOM 5686  C C8    . DA  A 1 276 ? 59.151  -19.375 236.926 1.00 672.10 ?  -37  DA  J C8    1 
ATOM 5687  N N7    . DA  A 1 276 ? 59.481  -19.081 235.691 1.00 672.10 ?  -37  DA  J N7    1 
ATOM 5688  C C5    . DA  A 1 276 ? 59.660  -17.710 235.718 1.00 672.10 ?  -37  DA  J C5    1 
ATOM 5689  C C6    . DA  A 1 276 ? 60.018  -16.784 234.721 1.00 672.10 ?  -37  DA  J C6    1 
ATOM 5690  N N6    . DA  A 1 276 ? 60.265  -17.139 233.461 1.00 672.10 ?  -37  DA  J N6    1 
ATOM 5691  N N1    . DA  A 1 276 ? 60.109  -15.480 235.070 1.00 672.10 ?  -37  DA  J N1    1 
ATOM 5692  C C2    . DA  A 1 276 ? 59.861  -15.130 236.342 1.00 672.10 ?  -37  DA  J C2    1 
ATOM 5693  N N3    . DA  A 1 276 ? 59.512  -15.913 237.366 1.00 672.10 ?  -37  DA  J N3    1 
ATOM 5694  C C4    . DA  A 1 276 ? 59.429  -17.203 236.987 1.00 672.10 ?  -37  DA  J C4    1 
ATOM 5695  P P     . DA  A 1 277 ? 56.298  -17.679 242.081 1.00 675.89 ?  -36  DA  J P     1 
ATOM 5696  O OP1   . DA  A 1 277 ? 56.018  -17.385 243.504 1.00 675.89 ?  -36  DA  J OP1   1 
ATOM 5697  O OP2   . DA  A 1 277 ? 55.166  -18.039 241.189 1.00 675.89 -1 -36  DA  J OP2   1 
ATOM 5698  O "O5'" . DA  A 1 277 ? 57.115  -16.447 241.448 1.00 675.89 ?  -36  DA  J "O5'" 1 
ATOM 5699  C "C5'" . DA  A 1 277 ? 57.338  -15.216 242.147 1.00 675.89 ?  -36  DA  J "C5'" 1 
ATOM 5700  C "C4'" . DA  A 1 277 ? 56.627  -14.063 241.452 1.00 675.89 ?  -36  DA  J "C4'" 1 
ATOM 5701  O "O4'" . DA  A 1 277 ? 56.938  -14.073 240.034 1.00 675.89 ?  -36  DA  J "O4'" 1 
ATOM 5702  C "C3'" . DA  A 1 277 ? 55.101  -14.074 241.575 1.00 675.89 ?  -36  DA  J "C3'" 1 
ATOM 5703  O "O3'" . DA  A 1 277 ? 54.640  -12.757 241.950 1.00 675.89 ?  -36  DA  J "O3'" 1 
ATOM 5704  C "C2'" . DA  A 1 277 ? 54.626  -14.579 240.211 1.00 675.89 ?  -36  DA  J "C2'" 1 
ATOM 5705  C "C1'" . DA  A 1 277 ? 55.756  -14.182 239.262 1.00 675.89 ?  -36  DA  J "C1'" 1 
ATOM 5706  N N9    . DA  A 1 277 ? 55.959  -15.129 238.155 1.00 675.89 ?  -36  DA  J N9    1 
ATOM 5707  C C8    . DA  A 1 277 ? 55.742  -16.481 238.171 1.00 675.89 ?  -36  DA  J C8    1 
ATOM 5708  N N7    . DA  A 1 277 ? 55.997  -17.091 237.039 1.00 675.89 ?  -36  DA  J N7    1 
ATOM 5709  C C5    . DA  A 1 277 ? 56.408  -16.066 236.211 1.00 675.89 ?  -36  DA  J C5    1 
ATOM 5710  C C6    . DA  A 1 277 ? 56.824  -16.052 234.864 1.00 675.89 ?  -36  DA  J C6    1 
ATOM 5711  N N6    . DA  A 1 277 ? 56.888  -17.155 234.111 1.00 675.89 ?  -36  DA  J N6    1 
ATOM 5712  N N1    . DA  A 1 277 ? 57.174  -14.862 234.321 1.00 675.89 ?  -36  DA  J N1    1 
ATOM 5713  C C2    . DA  A 1 277 ? 57.110  -13.755 235.085 1.00 675.89 ?  -36  DA  J C2    1 
ATOM 5714  N N3    . DA  A 1 277 ? 56.734  -13.646 236.364 1.00 675.89 ?  -36  DA  J N3    1 
ATOM 5715  C C4    . DA  A 1 277 ? 56.393  -14.848 236.876 1.00 675.89 ?  -36  DA  J C4    1 
ATOM 5716  P P     . DT  A 1 278 ? 53.399  -11.968 241.300 1.00 659.80 ?  -35  DT  J P     1 
ATOM 5717  O OP1   . DT  A 1 278 ? 53.016  -10.881 242.230 1.00 659.80 ?  -35  DT  J OP1   1 
ATOM 5718  O OP2   . DT  A 1 278 ? 52.369  -12.932 240.841 1.00 659.80 -1 -35  DT  J OP2   1 
ATOM 5719  O "O5'" . DT  A 1 278 ? 54.069  -11.319 240.005 1.00 659.80 ?  -35  DT  J "O5'" 1 
ATOM 5720  C "C5'" . DT  A 1 278 ? 55.037  -10.272 240.101 1.00 659.80 ?  -35  DT  J "C5'" 1 
ATOM 5721  C "C4'" . DT  A 1 278 ? 54.878  -9.329  238.921 1.00 659.80 ?  -35  DT  J "C4'" 1 
ATOM 5722  O "O4'" . DT  A 1 278 ? 55.174  -10.030 237.683 1.00 659.80 ?  -35  DT  J "O4'" 1 
ATOM 5723  C "C3'" . DT  A 1 278 ? 53.474  -8.753  238.761 1.00 659.80 ?  -35  DT  J "C3'" 1 
ATOM 5724  O "O3'" . DT  A 1 278 ? 53.572  -7.377  238.371 1.00 659.80 ?  -35  DT  J "O3'" 1 
ATOM 5725  C "C2'" . DT  A 1 278 ? 52.851  -9.660  237.701 1.00 659.80 ?  -35  DT  J "C2'" 1 
ATOM 5726  C "C1'" . DT  A 1 278 ? 54.049  -10.009 236.820 1.00 659.80 ?  -35  DT  J "C1'" 1 
ATOM 5727  N N1    . DT  A 1 278 ? 53.930  -11.328 236.086 1.00 659.80 ?  -35  DT  J N1    1 
ATOM 5728  C C2    . DT  A 1 278 ? 54.339  -11.427 234.761 1.00 659.80 ?  -35  DT  J C2    1 
ATOM 5729  O O2    . DT  A 1 278 ? 54.804  -10.505 234.108 1.00 659.80 ?  -35  DT  J O2    1 
ATOM 5730  N N3    . DT  A 1 278 ? 54.180  -12.677 234.205 1.00 659.80 ?  -35  DT  J N3    1 
ATOM 5731  C C4    . DT  A 1 278 ? 53.671  -13.810 234.819 1.00 659.80 ?  -35  DT  J C4    1 
ATOM 5732  O O4    . DT  A 1 278 ? 53.579  -14.879 234.225 1.00 659.80 ?  -35  DT  J O4    1 
ATOM 5733  C C5    . DT  A 1 278 ? 53.264  -13.644 236.195 1.00 659.80 ?  -35  DT  J C5    1 
ATOM 5734  C C7    . DT  A 1 278 ? 52.698  -14.798 236.970 1.00 659.80 ?  -35  DT  J C7    1 
ATOM 5735  C C6    . DT  A 1 278 ? 53.413  -12.433 236.752 1.00 659.80 ?  -35  DT  J C6    1 
ATOM 5736  P P     . DT  A 1 279 ? 52.451  -6.626  237.506 1.00 669.95 ?  -34  DT  J P     1 
ATOM 5737  O OP1   . DT  A 1 279 ? 52.607  -5.173  237.730 1.00 669.95 ?  -34  DT  J OP1   1 
ATOM 5738  O OP2   . DT  A 1 279 ? 51.130  -7.270  237.721 1.00 669.95 -1 -34  DT  J OP2   1 
ATOM 5739  O "O5'" . DT  A 1 279 ? 52.946  -6.953  236.022 1.00 669.95 ?  -34  DT  J "O5'" 1 
ATOM 5740  C "C5'" . DT  A 1 279 ? 54.093  -6.322  235.439 1.00 669.95 ?  -34  DT  J "C5'" 1 
ATOM 5741  C "C4'" . DT  A 1 279 ? 53.930  -6.248  233.925 1.00 669.95 ?  -34  DT  J "C4'" 1 
ATOM 5742  O "O4'" . DT  A 1 279 ? 53.796  -7.588  233.376 1.00 669.95 ?  -34  DT  J "O4'" 1 
ATOM 5743  C "C3'" . DT  A 1 279 ? 52.698  -5.482  233.446 1.00 669.95 ?  -34  DT  J "C3'" 1 
ATOM 5744  O "O3'" . DT  A 1 279 ? 53.009  -4.735  232.267 1.00 669.95 ?  -34  DT  J "O3'" 1 
ATOM 5745  C "C2'" . DT  A 1 279 ? 51.658  -6.581  233.189 1.00 669.95 ?  -34  DT  J "C2'" 1 
ATOM 5746  C "C1'" . DT  A 1 279 ? 52.534  -7.750  232.739 1.00 669.95 ?  -34  DT  J "C1'" 1 
ATOM 5747  N N1    . DT  A 1 279 ? 52.002  -9.131  233.056 1.00 669.95 ?  -34  DT  J N1    1 
ATOM 5748  C C2    . DT  A 1 279 ? 52.208  -10.166 232.147 1.00 669.95 ?  -34  DT  J C2    1 
ATOM 5749  O O2    . DT  A 1 279 ? 52.792  -10.038 231.076 1.00 669.95 ?  -34  DT  J O2    1 
ATOM 5750  N N3    . DT  A 1 279 ? 51.690  -11.382 232.540 1.00 669.95 ?  -34  DT  J N3    1 
ATOM 5751  C C4    . DT  A 1 279 ? 51.011  -11.671 233.718 1.00 669.95 ?  -34  DT  J C4    1 
ATOM 5752  O O4    . DT  A 1 279 ? 50.596  -12.802 233.962 1.00 669.95 ?  -34  DT  J O4    1 
ATOM 5753  C C5    . DT  A 1 279 ? 50.832  -10.551 234.619 1.00 669.95 ?  -34  DT  J C5    1 
ATOM 5754  C C7    . DT  A 1 279 ? 50.109  -10.721 235.925 1.00 669.95 ?  -34  DT  J C7    1 
ATOM 5755  C C6    . DT  A 1 279 ? 51.330  -9.357  234.250 1.00 669.95 ?  -34  DT  J C6    1 
ATOM 5756  P P     . DG  A 1 280 ? 51.979  -3.666  231.657 1.00 668.51 ?  -33  DG  J P     1 
ATOM 5757  O OP1   . DG  A 1 280 ? 52.728  -2.395  231.575 1.00 668.51 ?  -33  DG  J OP1   1 
ATOM 5758  O OP2   . DG  A 1 280 ? 50.683  -3.718  232.373 1.00 668.51 -1 -33  DG  J OP2   1 
ATOM 5759  O "O5'" . DG  A 1 280 ? 51.713  -4.216  230.177 1.00 668.51 ?  -33  DG  J "O5'" 1 
ATOM 5760  C "C5'" . DG  A 1 280 ? 52.659  -4.005  229.126 1.00 668.51 ?  -33  DG  J "C5'" 1 
ATOM 5761  C "C4'" . DG  A 1 280 ? 52.256  -4.723  227.845 1.00 668.51 ?  -33  DG  J "C4'" 1 
ATOM 5762  O "O4'" . DG  A 1 280 ? 51.908  -6.101  228.116 1.00 668.51 ?  -33  DG  J "O4'" 1 
ATOM 5763  C "C3'" . DG  A 1 280 ? 51.072  -4.137  227.075 1.00 668.51 ?  -33  DG  J "C3'" 1 
ATOM 5764  O "O3'" . DG  A 1 280 ? 51.256  -4.269  225.642 1.00 668.51 ?  -33  DG  J "O3'" 1 
ATOM 5765  C "C2'" . DG  A 1 280 ? 49.892  -4.974  227.579 1.00 668.51 ?  -33  DG  J "C2'" 1 
ATOM 5766  C "C1'" . DG  A 1 280 ? 50.546  -6.339  227.817 1.00 668.51 ?  -33  DG  J "C1'" 1 
ATOM 5767  N N9    . DG  A 1 280 ? 50.063  -7.129  228.948 1.00 668.51 ?  -33  DG  J N9    1 
ATOM 5768  C C8    . DG  A 1 280 ? 49.697  -6.675  230.193 1.00 668.51 ?  -33  DG  J C8    1 
ATOM 5769  N N7    . DG  A 1 280 ? 49.330  -7.622  231.012 1.00 668.51 ?  -33  DG  J N7    1 
ATOM 5770  C C5    . DG  A 1 280 ? 49.471  -8.784  230.266 1.00 668.51 ?  -33  DG  J C5    1 
ATOM 5771  C C6    . DG  A 1 280 ? 49.218  -10.133 230.626 1.00 668.51 ?  -33  DG  J C6    1 
ATOM 5772  O O6    . DG  A 1 280 ? 48.812  -10.577 231.708 1.00 668.51 ?  -33  DG  J O6    1 
ATOM 5773  N N1    . DG  A 1 280 ? 49.489  -11.008 229.575 1.00 668.51 ?  -33  DG  J N1    1 
ATOM 5774  C C2    . DG  A 1 280 ? 49.947  -10.622 228.333 1.00 668.51 ?  -33  DG  J C2    1 
ATOM 5775  N N2    . DG  A 1 280 ? 50.153  -11.603 227.448 1.00 668.51 ?  -33  DG  J N2    1 
ATOM 5776  N N3    . DG  A 1 280 ? 50.186  -9.363  227.983 1.00 668.51 ?  -33  DG  J N3    1 
ATOM 5777  C C4    . DG  A 1 280 ? 49.927  -8.497  228.995 1.00 668.51 ?  -33  DG  J C4    1 
ATOM 5778  P P     . DA  A 1 281 ? 52.606  -3.911  224.839 1.00 663.35 ?  -32  DA  J P     1 
ATOM 5779  O OP1   . DA  A 1 281 ? 53.775  -3.857  225.745 1.00 663.35 ?  -32  DA  J OP1   1 
ATOM 5780  O OP2   . DA  A 1 281 ? 52.302  -2.766  223.962 1.00 663.35 -1 -32  DA  J OP2   1 
ATOM 5781  O "O5'" . DA  A 1 281 ? 52.776  -5.173  223.886 1.00 663.35 ?  -32  DA  J "O5'" 1 
ATOM 5782  C "C5'" . DA  A 1 281 ? 53.738  -6.201  224.150 1.00 663.35 ?  -32  DA  J "C5'" 1 
ATOM 5783  C "C4'" . DA  A 1 281 ? 53.358  -7.450  223.376 1.00 663.35 ?  -32  DA  J "C4'" 1 
ATOM 5784  O "O4'" . DA  A 1 281 ? 52.175  -8.032  223.982 1.00 663.35 ?  -32  DA  J "O4'" 1 
ATOM 5785  C "C3'" . DA  A 1 281 ? 53.002  -7.220  221.909 1.00 663.35 ?  -32  DA  J "C3'" 1 
ATOM 5786  O "O3'" . DA  A 1 281 ? 53.481  -8.325  221.160 1.00 663.35 ?  -32  DA  J "O3'" 1 
ATOM 5787  C "C2'" . DA  A 1 281 ? 51.476  -7.131  221.911 1.00 663.35 ?  -32  DA  J "C2'" 1 
ATOM 5788  C "C1'" . DA  A 1 281 ? 51.128  -8.103  223.030 1.00 663.35 ?  -32  DA  J "C1'" 1 
ATOM 5789  N N9    . DA  A 1 281 ? 49.893  -7.792  223.726 1.00 663.35 ?  -32  DA  J N9    1 
ATOM 5790  C C8    . DA  A 1 281 ? 49.281  -6.577  223.841 1.00 663.35 ?  -32  DA  J C8    1 
ATOM 5791  N N7    . DA  A 1 281 ? 48.177  -6.614  224.541 1.00 663.35 ?  -32  DA  J N7    1 
ATOM 5792  C C5    . DA  A 1 281 ? 48.069  -7.943  224.919 1.00 663.35 ?  -32  DA  J C5    1 
ATOM 5793  C C6    . DA  A 1 281 ? 47.110  -8.650  225.680 1.00 663.35 ?  -32  DA  J C6    1 
ATOM 5794  N N6    . DA  A 1 281 ? 46.035  -8.062  226.217 1.00 663.35 ?  -32  DA  J N6    1 
ATOM 5795  N N1    . DA  A 1 281 ? 47.291  -9.981  225.861 1.00 663.35 ?  -32  DA  J N1    1 
ATOM 5796  C C2    . DA  A 1 281 ? 48.364  -10.562 225.313 1.00 663.35 ?  -32  DA  J C2    1 
ATOM 5797  N N3    . DA  A 1 281 ? 49.331  -10.002 224.586 1.00 663.35 ?  -32  DA  J N3    1 
ATOM 5798  C C4    . DA  A 1 281 ? 49.120  -8.684  224.421 1.00 663.35 ?  -32  DA  J C4    1 
ATOM 5799  P P     . DG  A 1 282 ? 53.084  -8.624  219.643 1.00 661.02 ?  -31  DG  J P     1 
ATOM 5800  O OP1   . DG  A 1 282 ? 54.211  -9.422  219.127 1.00 661.02 ?  -31  DG  J OP1   1 
ATOM 5801  O OP2   . DG  A 1 282 ? 52.649  -7.405  218.925 1.00 661.02 -1 -31  DG  J OP2   1 
ATOM 5802  O "O5'" . DG  A 1 282 ? 51.795  -9.537  219.818 1.00 661.02 ?  -31  DG  J "O5'" 1 
ATOM 5803  C "C5'" . DG  A 1 282 ? 51.910  -10.866 220.283 1.00 661.02 ?  -31  DG  J "C5'" 1 
ATOM 5804  C "C4'" . DG  A 1 282 ? 50.626  -11.599 219.958 1.00 661.02 ?  -31  DG  J "C4'" 1 
ATOM 5805  O "O4'" . DG  A 1 282 ? 49.590  -11.081 220.821 1.00 661.02 ?  -31  DG  J "O4'" 1 
ATOM 5806  C "C3'" . DG  A 1 282 ? 50.131  -11.453 218.519 1.00 661.02 ?  -31  DG  J "C3'" 1 
ATOM 5807  O "O3'" . DG  A 1 282 ? 49.907  -12.770 217.983 1.00 661.02 ?  -31  DG  J "O3'" 1 
ATOM 5808  C "C2'" . DG  A 1 282 ? 48.897  -10.544 218.620 1.00 661.02 ?  -31  DG  J "C2'" 1 
ATOM 5809  C "C1'" . DG  A 1 282 ? 48.454  -10.699 220.073 1.00 661.02 ?  -31  DG  J "C1'" 1 
ATOM 5810  N N9    . DG  A 1 282 ? 47.887  -9.506  220.721 1.00 661.02 ?  -31  DG  J N9    1 
ATOM 5811  C C8    . DG  A 1 282 ? 48.255  -8.185  220.568 1.00 661.02 ?  -31  DG  J C8    1 
ATOM 5812  N N7    . DG  A 1 282 ? 47.556  -7.358  221.300 1.00 661.02 ?  -31  DG  J N7    1 
ATOM 5813  C C5    . DG  A 1 282 ? 46.664  -8.176  221.988 1.00 661.02 ?  -31  DG  J C5    1 
ATOM 5814  C C6    . DG  A 1 282 ? 45.646  -7.861  222.936 1.00 661.02 ?  -31  DG  J C6    1 
ATOM 5815  O O6    . DG  A 1 282 ? 45.317  -6.756  223.389 1.00 661.02 ?  -31  DG  J O6    1 
ATOM 5816  N N1    . DG  A 1 282 ? 44.981  -8.997  223.394 1.00 661.02 ?  -31  DG  J N1    1 
ATOM 5817  C C2    . DG  A 1 282 ? 45.253  -10.280 222.982 1.00 661.02 ?  -31  DG  J C2    1 
ATOM 5818  N N2    . DG  A 1 282 ? 44.509  -11.245 223.530 1.00 661.02 ?  -31  DG  J N2    1 
ATOM 5819  N N3    . DG  A 1 282 ? 46.194  -10.593 222.099 1.00 661.02 ?  -31  DG  J N3    1 
ATOM 5820  C C4    . DG  A 1 282 ? 46.863  -9.500  221.646 1.00 661.02 ?  -31  DG  J C4    1 
ATOM 5821  P P     . DC  A 1 283 ? 48.825  -13.134 216.860 1.00 674.00 ?  -30  DC  J P     1 
ATOM 5822  O OP1   . DC  A 1 283 ? 49.259  -14.405 216.245 1.00 674.00 ?  -30  DC  J OP1   1 
ATOM 5823  O OP2   . DC  A 1 283 ? 48.546  -11.949 216.014 1.00 674.00 -1 -30  DC  J OP2   1 
ATOM 5824  O "O5'" . DC  A 1 283 ? 47.521  -13.423 217.726 1.00 674.00 ?  -30  DC  J "O5'" 1 
ATOM 5825  C "C5'" . DC  A 1 283 ? 47.402  -14.623 218.463 1.00 674.00 ?  -30  DC  J "C5'" 1 
ATOM 5826  C "C4'" . DC  A 1 283 ? 45.933  -14.908 218.693 1.00 674.00 ?  -30  DC  J "C4'" 1 
ATOM 5827  O "O4'" . DC  A 1 283 ? 45.379  -13.864 219.529 1.00 674.00 ?  -30  DC  J "O4'" 1 
ATOM 5828  C "C3'" . DC  A 1 283 ? 45.093  -14.962 217.420 1.00 674.00 ?  -30  DC  J "C3'" 1 
ATOM 5829  O "O3'" . DC  A 1 283 ? 44.244  -16.107 217.442 1.00 674.00 ?  -30  DC  J "O3'" 1 
ATOM 5830  C "C2'" . DC  A 1 283 ? 44.321  -13.643 217.425 1.00 674.00 ?  -30  DC  J "C2'" 1 
ATOM 5831  C "C1'" . DC  A 1 283 ? 44.227  -13.321 218.912 1.00 674.00 ?  -30  DC  J "C1'" 1 
ATOM 5832  N N1    . DC  A 1 283 ? 44.149  -11.843 219.168 1.00 674.00 ?  -30  DC  J N1    1 
ATOM 5833  C C2    . DC  A 1 283 ? 42.988  -11.287 219.728 1.00 674.00 ?  -30  DC  J C2    1 
ATOM 5834  O O2    . DC  A 1 283 ? 42.038  -12.024 220.019 1.00 674.00 ?  -30  DC  J O2    1 
ATOM 5835  N N3    . DC  A 1 283 ? 42.944  -9.945  219.942 1.00 674.00 ?  -30  DC  J N3    1 
ATOM 5836  C C4    . DC  A 1 283 ? 43.987  -9.175  219.619 1.00 674.00 ?  -30  DC  J C4    1 
ATOM 5837  N N4    . DC  A 1 283 ? 43.908  -7.862  219.843 1.00 674.00 ?  -30  DC  J N4    1 
ATOM 5838  C C5    . DC  A 1 283 ? 45.169  -9.720  219.038 1.00 674.00 ?  -30  DC  J C5    1 
ATOM 5839  C C6    . DC  A 1 283 ? 45.207  -11.041 218.837 1.00 674.00 ?  -30  DC  J C6    1 
ATOM 5840  P P     . DG  A 1 284 ? 42.952  -16.232 216.506 1.00 688.32 ?  -29  DG  J P     1 
ATOM 5841  O OP1   . DG  A 1 284 ? 42.733  -17.674 216.265 1.00 688.32 ?  -29  DG  J OP1   1 
ATOM 5842  O OP2   . DG  A 1 284 ? 43.038  -15.306 215.354 1.00 688.32 -1 -29  DG  J OP2   1 
ATOM 5843  O "O5'" . DG  A 1 284 ? 41.825  -15.684 217.492 1.00 688.32 ?  -29  DG  J "O5'" 1 
ATOM 5844  C "C5'" . DG  A 1 284 ? 41.261  -16.525 218.489 1.00 688.32 ?  -29  DG  J "C5'" 1 
ATOM 5845  C "C4'" . DG  A 1 284 ? 39.864  -16.037 218.836 1.00 688.32 ?  -29  DG  J "C4'" 1 
ATOM 5846  O "O4'" . DG  A 1 284 ? 39.875  -14.593 218.957 1.00 688.32 ?  -29  DG  J "O4'" 1 
ATOM 5847  C "C3'" . DG  A 1 284 ? 38.762  -16.331 217.822 1.00 688.32 ?  -29  DG  J "C3'" 1 
ATOM 5848  O "O3'" . DG  A 1 284 ? 37.538  -16.480 218.561 1.00 688.32 ?  -29  DG  J "O3'" 1 
ATOM 5849  C "C2'" . DG  A 1 284 ? 38.807  -15.096 216.917 1.00 688.32 ?  -29  DG  J "C2'" 1 
ATOM 5850  C "C1'" . DG  A 1 284 ? 39.075  -14.000 217.945 1.00 688.32 ?  -29  DG  J "C1'" 1 
ATOM 5851  N N9    . DG  A 1 284 ? 39.813  -12.826 217.473 1.00 688.32 ?  -29  DG  J N9    1 
ATOM 5852  C C8    . DG  A 1 284 ? 40.684  -12.723 216.411 1.00 688.32 ?  -29  DG  J C8    1 
ATOM 5853  N N7    . DG  A 1 284 ? 41.194  -11.526 216.262 1.00 688.32 ?  -29  DG  J N7    1 
ATOM 5854  C C5    . DG  A 1 284 ? 40.630  -10.794 217.300 1.00 688.32 ?  -29  DG  J C5    1 
ATOM 5855  C C6    . DG  A 1 284 ? 40.798  -9.438  217.661 1.00 688.32 ?  -29  DG  J C6    1 
ATOM 5856  O O6    . DG  A 1 284 ? 41.506  -8.594  217.106 1.00 688.32 ?  -29  DG  J O6    1 
ATOM 5857  N N1    . DG  A 1 284 ? 40.040  -9.081  218.777 1.00 688.32 ?  -29  DG  J N1    1 
ATOM 5858  C C2    . DG  A 1 284 ? 39.217  -9.944  219.462 1.00 688.32 ?  -29  DG  J C2    1 
ATOM 5859  N N2    . DG  A 1 284 ? 38.560  -9.449  220.516 1.00 688.32 ?  -29  DG  J N2    1 
ATOM 5860  N N3    . DG  A 1 284 ? 39.049  -11.218 219.136 1.00 688.32 ?  -29  DG  J N3    1 
ATOM 5861  C C4    . DG  A 1 284 ? 39.780  -11.577 218.050 1.00 688.32 ?  -29  DG  J C4    1 
ATOM 5862  P P     . DG  A 1 285 ? 36.057  -16.359 217.947 1.00 692.80 ?  -28  DG  J P     1 
ATOM 5863  O OP1   . DG  A 1 285 ? 35.540  -17.734 217.787 1.00 692.80 ?  -28  DG  J OP1   1 
ATOM 5864  O OP2   . DG  A 1 285 ? 36.051  -15.436 216.786 1.00 692.80 -1 -28  DG  J OP2   1 
ATOM 5865  O "O5'" . DG  A 1 285 ? 35.246  -15.656 219.139 1.00 692.80 ?  -28  DG  J "O5'" 1 
ATOM 5866  C "C5'" . DG  A 1 285 ? 35.704  -14.440 219.747 1.00 692.80 ?  -28  DG  J "C5'" 1 
ATOM 5867  C "C4'" . DG  A 1 285 ? 34.756  -13.270 219.501 1.00 692.80 ?  -28  DG  J "C4'" 1 
ATOM 5868  O "O4'" . DG  A 1 285 ? 35.520  -12.139 219.004 1.00 692.80 ?  -28  DG  J "O4'" 1 
ATOM 5869  C "C3'" . DG  A 1 285 ? 33.634  -13.466 218.482 1.00 692.80 ?  -28  DG  J "C3'" 1 
ATOM 5870  O "O3'" . DG  A 1 285 ? 32.527  -12.639 218.859 1.00 692.80 ?  -28  DG  J "O3'" 1 
ATOM 5871  C "C2'" . DG  A 1 285 ? 34.308  -12.989 217.202 1.00 692.80 ?  -28  DG  J "C2'" 1 
ATOM 5872  C "C1'" . DG  A 1 285 ? 35.017  -11.754 217.739 1.00 692.80 ?  -28  DG  J "C1'" 1 
ATOM 5873  N N9    . DG  A 1 285 ? 36.114  -11.265 216.909 1.00 692.80 ?  -28  DG  J N9    1 
ATOM 5874  C C8    . DG  A 1 285 ? 36.812  -11.955 215.946 1.00 692.80 ?  -28  DG  J C8    1 
ATOM 5875  N N7    . DG  A 1 285 ? 37.740  -11.249 215.365 1.00 692.80 ?  -28  DG  J N7    1 
ATOM 5876  C C5    . DG  A 1 285 ? 37.653  -10.009 215.983 1.00 692.80 ?  -28  DG  J C5    1 
ATOM 5877  C C6    . DG  A 1 285 ? 38.408  -8.829  215.770 1.00 692.80 ?  -28  DG  J C6    1 
ATOM 5878  O O6    . DG  A 1 285 ? 39.336  -8.659  214.967 1.00 692.80 ?  -28  DG  J O6    1 
ATOM 5879  N N1    . DG  A 1 285 ? 38.010  -7.783  216.608 1.00 692.80 ?  -28  DG  J N1    1 
ATOM 5880  C C2    . DG  A 1 285 ? 36.999  -7.876  217.536 1.00 692.80 ?  -28  DG  J C2    1 
ATOM 5881  N N2    . DG  A 1 285 ? 36.748  -6.771  218.250 1.00 692.80 ?  -28  DG  J N2    1 
ATOM 5882  N N3    . DG  A 1 285 ? 36.279  -8.976  217.744 1.00 692.80 ?  -28  DG  J N3    1 
ATOM 5883  C C4    . DG  A 1 285 ? 36.657  -10.001 216.937 1.00 692.80 ?  -28  DG  J C4    1 
ATOM 5884  P P     . DC  A 1 286 ? 31.282  -12.313 217.895 1.00 697.76 ?  -27  DC  J P     1 
ATOM 5885  O OP1   . DC  A 1 286 ? 30.282  -13.382 218.117 1.00 697.76 ?  -27  DC  J OP1   1 
ATOM 5886  O OP2   . DC  A 1 286 ? 31.767  -12.037 216.522 1.00 697.76 -1 -27  DC  J OP2   1 
ATOM 5887  O "O5'" . DC  A 1 286 ? 30.708  -10.920 218.463 1.00 697.76 ?  -27  DC  J "O5'" 1 
ATOM 5888  C "C5'" . DC  A 1 286 ? 31.551  -9.896  219.028 1.00 697.76 ?  -27  DC  J "C5'" 1 
ATOM 5889  C "C4'" . DC  A 1 286 ? 31.639  -8.614  218.207 1.00 697.76 ?  -27  DC  J "C4'" 1 
ATOM 5890  O "O4'" . DC  A 1 286 ? 32.961  -8.543  217.616 1.00 697.76 ?  -27  DC  J "O4'" 1 
ATOM 5891  C "C3'" . DC  A 1 286 ? 30.667  -8.450  217.041 1.00 697.76 ?  -27  DC  J "C3'" 1 
ATOM 5892  O "O3'" . DC  A 1 286 ? 29.512  -7.717  217.456 1.00 697.76 ?  -27  DC  J "O3'" 1 
ATOM 5893  C "C2'" . DC  A 1 286 ? 31.459  -7.666  215.997 1.00 697.76 ?  -27  DC  J "C2'" 1 
ATOM 5894  C "C1'" . DC  A 1 286 ? 32.921  -7.788  216.421 1.00 697.76 ?  -27  DC  J "C1'" 1 
ATOM 5895  N N1    . DC  A 1 286 ? 33.810  -8.415  215.366 1.00 697.76 ?  -27  DC  J N1    1 
ATOM 5896  C C2    . DC  A 1 286 ? 34.948  -7.728  214.916 1.00 697.76 ?  -27  DC  J C2    1 
ATOM 5897  O O2    . DC  A 1 286 ? 35.221  -6.620  215.388 1.00 697.76 ?  -27  DC  J O2    1 
ATOM 5898  N N3    . DC  A 1 286 ? 35.739  -8.298  213.968 1.00 697.76 ?  -27  DC  J N3    1 
ATOM 5899  C C4    . DC  A 1 286 ? 35.437  -9.496  213.467 1.00 697.76 ?  -27  DC  J C4    1 
ATOM 5900  N N4    . DC  A 1 286 ? 36.250  -10.006 212.535 1.00 697.76 ?  -27  DC  J N4    1 
ATOM 5901  C C5    . DC  A 1 286 ? 34.281  -10.216 213.905 1.00 697.76 ?  -27  DC  J C5    1 
ATOM 5902  C C6    . DC  A 1 286 ? 33.508  -9.646  214.842 1.00 697.76 ?  -27  DC  J C6    1 
ATOM 5903  P P     . DC  A 1 287 ? 28.235  -7.485  216.505 1.00 699.64 ?  -26  DC  J P     1 
ATOM 5904  O OP1   . DC  A 1 287 ? 27.130  -7.022  217.376 1.00 699.64 ?  -26  DC  J OP1   1 
ATOM 5905  O OP2   . DC  A 1 287 ? 28.026  -8.696  215.675 1.00 699.64 -1 -26  DC  J OP2   1 
ATOM 5906  O "O5'" . DC  A 1 287 ? 28.689  -6.273  215.549 1.00 699.64 ?  -26  DC  J "O5'" 1 
ATOM 5907  C "C5'" . DC  A 1 287 ? 28.897  -4.948  216.073 1.00 699.64 ?  -26  DC  J "C5'" 1 
ATOM 5908  C "C4'" . DC  A 1 287 ? 29.434  -3.954  215.043 1.00 699.64 ?  -26  DC  J "C4'" 1 
ATOM 5909  O "O4'" . DC  A 1 287 ? 30.693  -4.414  214.484 1.00 699.64 ?  -26  DC  J "O4'" 1 
ATOM 5910  C "C3'" . DC  A 1 287 ? 28.538  -3.635  213.846 1.00 699.64 ?  -26  DC  J "C3'" 1 
ATOM 5911  O "O3'" . DC  A 1 287 ? 28.640  -2.243  213.565 1.00 699.64 ?  -26  DC  J "O3'" 1 
ATOM 5912  C "C2'" . DC  A 1 287 ? 29.150  -4.473  212.725 1.00 699.64 ?  -26  DC  J "C2'" 1 
ATOM 5913  C "C1'" . DC  A 1 287 ? 30.631  -4.367  213.071 1.00 699.64 ?  -26  DC  J "C1'" 1 
ATOM 5914  N N1    . DC  A 1 287 ? 31.501  -5.454  212.500 1.00 699.64 ?  -26  DC  J N1    1 
ATOM 5915  C C2    . DC  A 1 287 ? 32.651  -5.116  211.765 1.00 699.64 ?  -26  DC  J C2    1 
ATOM 5916  O O2    . DC  A 1 287 ? 32.935  -3.924  211.595 1.00 699.64 ?  -26  DC  J O2    1 
ATOM 5917  N N3    . DC  A 1 287 ? 33.429  -6.114  211.259 1.00 699.64 ?  -26  DC  J N3    1 
ATOM 5918  C C4    . DC  A 1 287 ? 33.097  -7.393  211.463 1.00 699.64 ?  -26  DC  J C4    1 
ATOM 5919  N N4    . DC  A 1 287 ? 33.887  -8.337  210.947 1.00 699.64 ?  -26  DC  J N4    1 
ATOM 5920  C C5    . DC  A 1 287 ? 31.935  -7.764  212.204 1.00 699.64 ?  -26  DC  J C5    1 
ATOM 5921  C C6    . DC  A 1 287 ? 31.179  -6.773  212.697 1.00 699.64 ?  -26  DC  J C6    1 
ATOM 5922  P P     . DT  A 1 288 ? 27.604  -1.490  212.597 1.00 693.70 ?  -25  DT  J P     1 
ATOM 5923  O OP1   . DT  A 1 288 ? 26.284  -1.498  213.265 1.00 693.70 ?  -25  DT  J OP1   1 
ATOM 5924  O OP2   . DT  A 1 288 ? 27.717  -2.040  211.226 1.00 693.70 -1 -25  DT  J OP2   1 
ATOM 5925  O "O5'" . DT  A 1 288 ? 28.177  0.008   212.561 1.00 693.70 ?  -25  DT  J "O5'" 1 
ATOM 5926  C "C5'" . DT  A 1 288 ? 29.582  0.281   212.647 1.00 693.70 ?  -25  DT  J "C5'" 1 
ATOM 5927  C "C4'" . DT  A 1 288 ? 30.217  0.617   211.301 1.00 693.70 ?  -25  DT  J "C4'" 1 
ATOM 5928  O "O4'" . DT  A 1 288 ? 30.923  -0.546  210.804 1.00 693.70 ?  -25  DT  J "O4'" 1 
ATOM 5929  C "C3'" . DT  A 1 288 ? 29.263  1.061   210.192 1.00 693.70 ?  -25  DT  J "C3'" 1 
ATOM 5930  O "O3'" . DT  A 1 288 ? 29.575  2.436   209.837 1.00 693.70 ?  -25  DT  J "O3'" 1 
ATOM 5931  C "C2'" . DT  A 1 288 ? 29.388  0.000   209.089 1.00 693.70 ?  -25  DT  J "C2'" 1 
ATOM 5932  C "C1'" . DT  A 1 288 ? 30.705  -0.704  209.415 1.00 693.70 ?  -25  DT  J "C1'" 1 
ATOM 5933  N N1    . DT  A 1 288 ? 30.782  -2.182  209.113 1.00 693.70 ?  -25  DT  J N1    1 
ATOM 5934  C C2    . DT  A 1 288 ? 32.020  -2.761  208.848 1.00 693.70 ?  -25  DT  J C2    1 
ATOM 5935  O O2    . DT  A 1 288 ? 33.080  -2.154  208.827 1.00 693.70 ?  -25  DT  J O2    1 
ATOM 5936  N N3    . DT  A 1 288 ? 31.983  -4.112  208.597 1.00 693.70 ?  -25  DT  J N3    1 
ATOM 5937  C C4    . DT  A 1 288 ? 30.864  -4.927  208.584 1.00 693.70 ?  -25  DT  J C4    1 
ATOM 5938  O O4    . DT  A 1 288 ? 30.957  -6.128  208.346 1.00 693.70 ?  -25  DT  J O4    1 
ATOM 5939  C C5    . DT  A 1 288 ? 29.604  -4.266  208.871 1.00 693.70 ?  -25  DT  J C5    1 
ATOM 5940  C C7    . DT  A 1 288 ? 28.309  -5.030  208.892 1.00 693.70 ?  -25  DT  J C7    1 
ATOM 5941  C C6    . DT  A 1 288 ? 29.627  -2.948  209.118 1.00 693.70 ?  -25  DT  J C6    1 
ATOM 5942  P P     . DC  A 1 289 ? 30.434  2.964   208.582 1.00 692.04 ?  -24  DC  J P     1 
ATOM 5943  O OP1   . DC  A 1 289 ? 30.684  4.407   208.802 1.00 692.04 ?  -24  DC  J OP1   1 
ATOM 5944  O OP2   . DC  A 1 289 ? 29.724  2.544   207.355 1.00 692.04 -1 -24  DC  J OP2   1 
ATOM 5945  O "O5'" . DC  A 1 289 ? 31.832  2.181   208.686 1.00 692.04 ?  -24  DC  J "O5'" 1 
ATOM 5946  C "C5'" . DC  A 1 289 ? 33.062  2.783   208.267 1.00 692.04 ?  -24  DC  J "C5'" 1 
ATOM 5947  C "C4'" . DC  A 1 289 ? 33.500  2.297   206.893 1.00 692.04 ?  -24  DC  J "C4'" 1 
ATOM 5948  O "O4'" . DC  A 1 289 ? 33.080  0.924   206.669 1.00 692.04 ?  -24  DC  J "O4'" 1 
ATOM 5949  C "C3'" . DC  A 1 289 ? 32.959  3.094   205.710 1.00 692.04 ?  -24  DC  J "C3'" 1 
ATOM 5950  O "O3'" . DC  A 1 289 ? 33.993  3.256   204.754 1.00 692.04 ?  -24  DC  J "O3'" 1 
ATOM 5951  C "C2'" . DC  A 1 289 ? 31.846  2.210   205.156 1.00 692.04 ?  -24  DC  J "C2'" 1 
ATOM 5952  C "C1'" . DC  A 1 289 ? 32.423  0.824   205.418 1.00 692.04 ?  -24  DC  J "C1'" 1 
ATOM 5953  N N1    . DC  A 1 289 ? 31.438  -0.325  205.460 1.00 692.04 ?  -24  DC  J N1    1 
ATOM 5954  C C2    . DC  A 1 289 ? 31.925  -1.642  205.565 1.00 692.04 ?  -24  DC  J C2    1 
ATOM 5955  O O2    . DC  A 1 289 ? 33.147  -1.844  205.621 1.00 692.04 ?  -24  DC  J O2    1 
ATOM 5956  N N3    . DC  A 1 289 ? 31.043  -2.677  205.606 1.00 692.04 ?  -24  DC  J N3    1 
ATOM 5957  C C4    . DC  A 1 289 ? 29.729  -2.445  205.547 1.00 692.04 ?  -24  DC  J C4    1 
ATOM 5958  N N4    . DC  A 1 289 ? 28.909  -3.500  205.591 1.00 692.04 ?  -24  DC  J N4    1 
ATOM 5959  C C5    . DC  A 1 289 ? 29.210  -1.118  205.441 1.00 692.04 ?  -24  DC  J C5    1 
ATOM 5960  C C6    . DC  A 1 289 ? 30.087  -0.103  205.401 1.00 692.04 ?  -24  DC  J C6    1 
ATOM 5961  P P     . DG  A 1 290 ? 34.253  4.678   204.066 1.00 682.40 ?  -23  DG  J P     1 
ATOM 5962  O OP1   . DG  A 1 290 ? 34.538  5.657   205.142 1.00 682.40 ?  -23  DG  J OP1   1 
ATOM 5963  O OP2   . DG  A 1 290 ? 33.144  4.902   203.107 1.00 682.40 -1 -23  DG  J OP2   1 
ATOM 5964  O "O5'" . DG  A 1 290 ? 35.602  4.471   203.220 1.00 682.40 ?  -23  DG  J "O5'" 1 
ATOM 5965  C "C5'" . DG  A 1 290 ? 36.479  3.359   203.437 1.00 682.40 ?  -23  DG  J "C5'" 1 
ATOM 5966  C "C4'" . DG  A 1 290 ? 36.538  2.416   202.239 1.00 682.40 ?  -23  DG  J "C4'" 1 
ATOM 5967  O "O4'" . DG  A 1 290 ? 35.519  1.391   202.364 1.00 682.40 ?  -23  DG  J "O4'" 1 
ATOM 5968  C "C3'" . DG  A 1 290 ? 36.327  3.034   200.855 1.00 682.40 ?  -23  DG  J "C3'" 1 
ATOM 5969  O "O3'" . DG  A 1 290 ? 37.239  2.443   199.931 1.00 682.40 ?  -23  DG  J "O3'" 1 
ATOM 5970  C "C2'" . DG  A 1 290 ? 34.880  2.669   200.527 1.00 682.40 ?  -23  DG  J "C2'" 1 
ATOM 5971  C "C1'" . DG  A 1 290 ? 34.811  1.281   201.147 1.00 682.40 ?  -23  DG  J "C1'" 1 
ATOM 5972  N N9    . DG  A 1 290 ? 33.482  0.770   201.473 1.00 682.40 ?  -23  DG  J N9    1 
ATOM 5973  C C8    . DG  A 1 290 ? 32.380  1.472   201.910 1.00 682.40 ?  -23  DG  J C8    1 
ATOM 5974  N N7    . DG  A 1 290 ? 31.335  0.723   202.134 1.00 682.40 ?  -23  DG  J N7    1 
ATOM 5975  C C5    . DG  A 1 290 ? 31.771  -0.561  201.829 1.00 682.40 ?  -23  DG  J C5    1 
ATOM 5976  C C6    . DG  A 1 290 ? 31.082  -1.800  201.876 1.00 682.40 ?  -23  DG  J C6    1 
ATOM 5977  O O6    . DG  A 1 290 ? 29.908  -2.008  202.212 1.00 682.40 ?  -23  DG  J O6    1 
ATOM 5978  N N1    . DG  A 1 290 ? 31.888  -2.870  201.480 1.00 682.40 ?  -23  DG  J N1    1 
ATOM 5979  C C2    . DG  A 1 290 ? 33.205  -2.751  201.087 1.00 682.40 ?  -23  DG  J C2    1 
ATOM 5980  N N2    . DG  A 1 290 ? 33.831  -3.884  200.743 1.00 682.40 ?  -23  DG  J N2    1 
ATOM 5981  N N3    . DG  A 1 290 ? 33.865  -1.598  201.043 1.00 682.40 ?  -23  DG  J N3    1 
ATOM 5982  C C4    . DG  A 1 290 ? 33.091  -0.548  201.423 1.00 682.40 ?  -23  DG  J C4    1 
ATOM 5983  P P     . DG  A 1 291 ? 38.653  3.112   199.601 1.00 681.01 ?  -22  DG  J P     1 
ATOM 5984  O OP1   . DG  A 1 291 ? 39.335  3.454   200.869 1.00 681.01 ?  -22  DG  J OP1   1 
ATOM 5985  O OP2   . DG  A 1 291 ? 38.414  4.153   198.575 1.00 681.01 -1 -22  DG  J OP2   1 
ATOM 5986  O "O5'" . DG  A 1 291 ? 39.442  1.912   198.892 1.00 681.01 ?  -22  DG  J "O5'" 1 
ATOM 5987  C "C5'" . DG  A 1 291 ? 39.934  0.791   199.627 1.00 681.01 ?  -22  DG  J "C5'" 1 
ATOM 5988  C "C4'" . DG  A 1 291 ? 39.893  -0.490  198.806 1.00 681.01 ?  -22  DG  J "C4'" 1 
ATOM 5989  O "O4'" . DG  A 1 291 ? 38.533  -0.978  198.769 1.00 681.01 ?  -22  DG  J "O4'" 1 
ATOM 5990  C "C3'" . DG  A 1 291 ? 40.335  -0.414  197.346 1.00 681.01 ?  -22  DG  J "C3'" 1 
ATOM 5991  O "O3'" . DG  A 1 291 ? 41.031  -1.624  197.003 1.00 681.01 ?  -22  DG  J "O3'" 1 
ATOM 5992  C "C2'" . DG  A 1 291 ? 39.025  -0.225  196.583 1.00 681.01 ?  -22  DG  J "C2'" 1 
ATOM 5993  C "C1'" . DG  A 1 291 ? 38.050  -1.011  197.444 1.00 681.01 ?  -22  DG  J "C1'" 1 
ATOM 5994  N N9    . DG  A 1 291 ? 36.709  -0.458  197.503 1.00 681.01 ?  -22  DG  J N9    1 
ATOM 5995  C C8    . DG  A 1 291 ? 36.346  0.866   197.546 1.00 681.01 ?  -22  DG  J C8    1 
ATOM 5996  N N7    . DG  A 1 291 ? 35.060  1.049   197.613 1.00 681.01 ?  -22  DG  J N7    1 
ATOM 5997  C C5    . DG  A 1 291 ? 34.542  -0.239  197.621 1.00 681.01 ?  -22  DG  J C5    1 
ATOM 5998  C C6    . DG  A 1 291 ? 33.200  -0.682  197.680 1.00 681.01 ?  -22  DG  J C6    1 
ATOM 5999  O O6    . DG  A 1 291 ? 32.174  0.010   197.744 1.00 681.01 ?  -22  DG  J O6    1 
ATOM 6000  N N1    . DG  A 1 291 ? 33.104  -2.076  197.663 1.00 681.01 ?  -22  DG  J N1    1 
ATOM 6001  C C2    . DG  A 1 291 ? 34.175  -2.936  197.596 1.00 681.01 ?  -22  DG  J C2    1 
ATOM 6002  N N2    . DG  A 1 291 ? 33.889  -4.246  197.588 1.00 681.01 ?  -22  DG  J N2    1 
ATOM 6003  N N3    . DG  A 1 291 ? 35.438  -2.531  197.540 1.00 681.01 ?  -22  DG  J N3    1 
ATOM 6004  C C4    . DG  A 1 291 ? 35.544  -1.177  197.556 1.00 681.01 ?  -22  DG  J C4    1 
ATOM 6005  P P     . DC  A 1 292 ? 41.415  -2.044  195.502 1.00 676.95 ?  -21  DC  J P     1 
ATOM 6006  O OP1   . DC  A 1 292 ? 42.540  -2.999  195.585 1.00 676.95 ?  -21  DC  J OP1   1 
ATOM 6007  O OP2   . DC  A 1 292 ? 41.576  -0.838  194.660 1.00 676.95 -1 -21  DC  J OP2   1 
ATOM 6008  O "O5'" . DC  A 1 292 ? 40.092  -2.803  195.023 1.00 676.95 ?  -21  DC  J "O5'" 1 
ATOM 6009  C "C5'" . DC  A 1 292 ? 39.609  -3.970  195.686 1.00 676.95 ?  -21  DC  J "C5'" 1 
ATOM 6010  C "C4'" . DC  A 1 292 ? 38.329  -4.465  195.030 1.00 676.95 ?  -21  DC  J "C4'" 1 
ATOM 6011  O "O4'" . DC  A 1 292 ? 37.289  -3.475  195.228 1.00 676.95 ?  -21  DC  J "O4'" 1 
ATOM 6012  C "C3'" . DC  A 1 292 ? 38.409  -4.699  193.519 1.00 676.95 ?  -21  DC  J "C3'" 1 
ATOM 6013  O "O3'" . DC  A 1 292 ? 37.780  -5.922  193.139 1.00 676.95 ?  -21  DC  J "O3'" 1 
ATOM 6014  C "C2'" . DC  A 1 292 ? 37.677  -3.504  192.920 1.00 676.95 ?  -21  DC  J "C2'" 1 
ATOM 6015  C "C1'" . DC  A 1 292 ? 36.630  -3.253  193.997 1.00 676.95 ?  -21  DC  J "C1'" 1 
ATOM 6016  N N1    . DC  A 1 292 ? 36.011  -1.885  193.983 1.00 676.95 ?  -21  DC  J N1    1 
ATOM 6017  C C2    . DC  A 1 292 ? 34.629  -1.764  194.189 1.00 676.95 ?  -21  DC  J C2    1 
ATOM 6018  O O2    . DC  A 1 292 ? 33.949  -2.778  194.380 1.00 676.95 ?  -21  DC  J O2    1 
ATOM 6019  N N3    . DC  A 1 292 ? 34.064  -0.529  194.176 1.00 676.95 ?  -21  DC  J N3    1 
ATOM 6020  C C4    . DC  A 1 292 ? 34.820  0.555   193.968 1.00 676.95 ?  -21  DC  J C4    1 
ATOM 6021  N N4    . DC  A 1 292 ? 34.208  1.742   193.964 1.00 676.95 ?  -21  DC  J N4    1 
ATOM 6022  C C5    . DC  A 1 292 ? 36.229  0.458   193.755 1.00 676.95 ?  -21  DC  J C5    1 
ATOM 6023  C C6    . DC  A 1 292 ? 36.776  -0.766  193.771 1.00 676.95 ?  -21  DC  J C6    1 
ATOM 6024  P P     . DA  A 1 293 ? 38.511  -6.861  192.069 1.00 687.44 ?  -20  DA  J P     1 
ATOM 6025  O OP1   . DA  A 1 293 ? 39.617  -7.540  192.777 1.00 687.44 ?  -20  DA  J OP1   1 
ATOM 6026  O OP2   . DA  A 1 293 ? 38.800  -6.050  190.866 1.00 687.44 -1 -20  DA  J OP2   1 
ATOM 6027  O "O5'" . DA  A 1 293 ? 37.403  -7.934  191.650 1.00 687.44 ?  -20  DA  J "O5'" 1 
ATOM 6028  C "C5'" . DA  A 1 293 ? 36.738  -8.763  192.600 1.00 687.44 ?  -20  DA  J "C5'" 1 
ATOM 6029  C "C4'" . DA  A 1 293 ? 35.253  -8.847  192.274 1.00 687.44 ?  -20  DA  J "C4'" 1 
ATOM 6030  O "O4'" . DA  A 1 293 ? 34.631  -7.568  192.568 1.00 687.44 ?  -20  DA  J "O4'" 1 
ATOM 6031  C "C3'" . DA  A 1 293 ? 34.890  -9.165  190.819 1.00 687.44 ?  -20  DA  J "C3'" 1 
ATOM 6032  O "O3'" . DA  A 1 293 ? 33.770  -10.067 190.791 1.00 687.44 ?  -20  DA  J "O3'" 1 
ATOM 6033  C "C2'" . DA  A 1 293 ? 34.569  -7.788  190.242 1.00 687.44 ?  -20  DA  J "C2'" 1 
ATOM 6034  C "C1'" . DA  A 1 293 ? 33.888  -7.149  191.443 1.00 687.44 ?  -20  DA  J "C1'" 1 
ATOM 6035  N N9    . DA  A 1 293 ? 33.878  -5.694  191.391 1.00 687.44 ?  -20  DA  J N9    1 
ATOM 6036  C C8    . DA  A 1 293 ? 34.955  -4.867  191.239 1.00 687.44 ?  -20  DA  J C8    1 
ATOM 6037  N N7    . DA  A 1 293 ? 34.645  -3.593  191.222 1.00 687.44 ?  -20  DA  J N7    1 
ATOM 6038  C C5    . DA  A 1 293 ? 33.269  -3.585  191.373 1.00 687.44 ?  -20  DA  J C5    1 
ATOM 6039  C C6    . DA  A 1 293 ? 32.321  -2.540  191.433 1.00 687.44 ?  -20  DA  J C6    1 
ATOM 6040  N N6    . DA  A 1 293 ? 32.649  -1.247  191.347 1.00 687.44 ?  -20  DA  J N6    1 
ATOM 6041  N N1    . DA  A 1 293 ? 31.018  -2.877  191.590 1.00 687.44 ?  -20  DA  J N1    1 
ATOM 6042  C C2    . DA  A 1 293 ? 30.686  -4.174  191.677 1.00 687.44 ?  -20  DA  J C2    1 
ATOM 6043  N N3    . DA  A 1 293 ? 31.489  -5.241  191.632 1.00 687.44 ?  -20  DA  J N3    1 
ATOM 6044  C C4    . DA  A 1 293 ? 32.777  -4.875  191.479 1.00 687.44 ?  -20  DA  J C4    1 
ATOM 6045  P P     . DC  A 1 294 ? 32.852  -10.332 189.499 1.00 699.96 ?  -19  DC  J P     1 
ATOM 6046  O OP1   . DC  A 1 294 ? 32.100  -11.585 189.751 1.00 699.96 ?  -19  DC  J OP1   1 
ATOM 6047  O OP2   . DC  A 1 294 ? 33.695  -10.217 188.284 1.00 699.96 -1 -19  DC  J OP2   1 
ATOM 6048  O "O5'" . DC  A 1 294 ? 31.839  -9.085  189.520 1.00 699.96 ?  -19  DC  J "O5'" 1 
ATOM 6049  C "C5'" . DC  A 1 294 ? 30.462  -9.195  189.911 1.00 699.96 ?  -19  DC  J "C5'" 1 
ATOM 6050  C "C4'" . DC  A 1 294 ? 29.581  -8.221  189.136 1.00 699.96 ?  -19  DC  J "C4'" 1 
ATOM 6051  O "O4'" . DC  A 1 294 ? 30.062  -6.864  189.321 1.00 699.96 ?  -19  DC  J "O4'" 1 
ATOM 6052  C "C3'" . DC  A 1 294 ? 29.524  -8.455  187.625 1.00 699.96 ?  -19  DC  J "C3'" 1 
ATOM 6053  O "O3'" . DC  A 1 294 ? 28.179  -8.708  187.219 1.00 699.96 ?  -19  DC  J "O3'" 1 
ATOM 6054  C "C2'" . DC  A 1 294 ? 30.082  -7.181  186.987 1.00 699.96 ?  -19  DC  J "C2'" 1 
ATOM 6055  C "C1'" . DC  A 1 294 ? 29.976  -6.149  188.102 1.00 699.96 ?  -19  DC  J "C1'" 1 
ATOM 6056  N N1    . DC  A 1 294 ? 31.062  -5.114  188.071 1.00 699.96 ?  -19  DC  J N1    1 
ATOM 6057  C C2    . DC  A 1 294 ? 30.740  -3.748  187.931 1.00 699.96 ?  -19  DC  J C2    1 
ATOM 6058  O O2    . DC  A 1 294 ? 29.556  -3.398  187.830 1.00 699.96 ?  -19  DC  J O2    1 
ATOM 6059  N N3    . DC  A 1 294 ? 31.752  -2.836  187.912 1.00 699.96 ?  -19  DC  J N3    1 
ATOM 6060  C C4    . DC  A 1 294 ? 33.024  -3.239  188.021 1.00 699.96 ?  -19  DC  J C4    1 
ATOM 6061  N N4    . DC  A 1 294 ? 33.983  -2.309  187.992 1.00 699.96 ?  -19  DC  J N4    1 
ATOM 6062  C C5    . DC  A 1 294 ? 33.373  -4.618  188.159 1.00 699.96 ?  -19  DC  J C5    1 
ATOM 6063  C C6    . DC  A 1 294 ? 32.371  -5.509  188.182 1.00 699.96 ?  -19  DC  J C6    1 
ATOM 6064  P P     . DC  A 1 295 ? 27.839  -9.267  185.752 1.00 706.99 ?  -18  DC  J P     1 
ATOM 6065  O OP1   . DC  A 1 295 ? 26.591  -10.061 185.861 1.00 706.99 ?  -18  DC  J OP1   1 
ATOM 6066  O OP2   . DC  A 1 295 ? 29.054  -9.891  185.171 1.00 706.99 -1 -18  DC  J OP2   1 
ATOM 6067  O "O5'" . DC  A 1 295 ? 27.546  -7.925  184.918 1.00 706.99 ?  -18  DC  J "O5'" 1 
ATOM 6068  C "C5'" . DC  A 1 295 ? 26.537  -6.999  185.345 1.00 706.99 ?  -18  DC  J "C5'" 1 
ATOM 6069  C "C4'" . DC  A 1 295 ? 26.730  -5.617  184.743 1.00 706.99 ?  -18  DC  J "C4'" 1 
ATOM 6070  O "O4'" . DC  A 1 295 ? 28.007  -5.062  185.169 1.00 706.99 ?  -18  DC  J "O4'" 1 
ATOM 6071  C "C3'" . DC  A 1 295 ? 26.720  -5.567  183.212 1.00 706.99 ?  -18  DC  J "C3'" 1 
ATOM 6072  O "O3'" . DC  A 1 295 ? 25.782  -4.592  182.719 1.00 706.99 ?  -18  DC  J "O3'" 1 
ATOM 6073  C "C2'" . DC  A 1 295 ? 28.162  -5.194  182.875 1.00 706.99 ?  -18  DC  J "C2'" 1 
ATOM 6074  C "C1'" . DC  A 1 295 ? 28.518  -4.329  184.078 1.00 706.99 ?  -18  DC  J "C1'" 1 
ATOM 6075  N N1    . DC  A 1 295 ? 29.978  -4.033  184.275 1.00 706.99 ?  -18  DC  J N1    1 
ATOM 6076  C C2    . DC  A 1 295 ? 30.381  -2.730  184.632 1.00 706.99 ?  -18  DC  J C2    1 
ATOM 6077  O O2    . DC  A 1 295 ? 29.535  -1.840  184.785 1.00 706.99 ?  -18  DC  J O2    1 
ATOM 6078  N N3    . DC  A 1 295 ? 31.707  -2.475  184.803 1.00 706.99 ?  -18  DC  J N3    1 
ATOM 6079  C C4    . DC  A 1 295 ? 32.608  -3.451  184.634 1.00 706.99 ?  -18  DC  J C4    1 
ATOM 6080  N N4    . DC  A 1 295 ? 33.899  -3.149  184.817 1.00 706.99 ?  -18  DC  J N4    1 
ATOM 6081  C C5    . DC  A 1 295 ? 32.221  -4.779  184.272 1.00 706.99 ?  -18  DC  J C5    1 
ATOM 6082  C C6    . DC  A 1 295 ? 30.911  -5.021  184.104 1.00 706.99 ?  -18  DC  J C6    1 
ATOM 6083  P P     . DG  A 1 296 ? 24.200  -4.884  182.638 1.00 715.03 ?  -17  DG  J P     1 
ATOM 6084  O OP1   . DG  A 1 296 ? 23.592  -4.419  183.906 1.00 715.03 ?  -17  DG  J OP1   1 
ATOM 6085  O OP2   . DG  A 1 296 ? 23.996  -6.286  182.204 1.00 715.03 -1 -17  DG  J OP2   1 
ATOM 6086  O "O5'" . DG  A 1 296 ? 23.719  -3.940  181.431 1.00 715.03 ?  -17  DG  J "O5'" 1 
ATOM 6087  C "C5'" . DG  A 1 296 ? 23.301  -2.586  181.647 1.00 715.03 ?  -17  DG  J "C5'" 1 
ATOM 6088  C "C4'" . DG  A 1 296 ? 24.143  -1.610  180.840 1.00 715.03 ?  -17  DG  J "C4'" 1 
ATOM 6089  O "O4'" . DG  A 1 296 ? 25.558  -1.859  181.067 1.00 715.03 ?  -17  DG  J "O4'" 1 
ATOM 6090  C "C3'" . DG  A 1 296 ? 23.948  -1.659  179.326 1.00 715.03 ?  -17  DG  J "C3'" 1 
ATOM 6091  O "O3'" . DG  A 1 296 ? 23.913  -0.327  178.825 1.00 715.03 ?  -17  DG  J "O3'" 1 
ATOM 6092  C "C2'" . DG  A 1 296 ? 25.185  -2.418  178.846 1.00 715.03 ?  -17  DG  J "C2'" 1 
ATOM 6093  C "C1'" . DG  A 1 296 ? 26.221  -1.871  179.821 1.00 715.03 ?  -17  DG  J "C1'" 1 
ATOM 6094  N N9    . DG  A 1 296 ? 27.453  -2.651  179.938 1.00 715.03 ?  -17  DG  J N9    1 
ATOM 6095  C C8    . DG  A 1 296 ? 27.632  -3.988  179.664 1.00 715.03 ?  -17  DG  J C8    1 
ATOM 6096  N N7    . DG  A 1 296 ? 28.853  -4.400  179.861 1.00 715.03 ?  -17  DG  J N7    1 
ATOM 6097  C C5    . DG  A 1 296 ? 29.533  -3.269  180.297 1.00 715.03 ?  -17  DG  J C5    1 
ATOM 6098  C C6    . DG  A 1 296 ? 30.893  -3.102  180.671 1.00 715.03 ?  -17  DG  J C6    1 
ATOM 6099  O O6    . DG  A 1 296 ? 31.791  -3.956  180.684 1.00 715.03 ?  -17  DG  J O6    1 
ATOM 6100  N N1    . DG  A 1 296 ? 31.177  -1.786  181.048 1.00 715.03 ?  -17  DG  J N1    1 
ATOM 6101  C C2    . DG  A 1 296 ? 30.253  -0.762  181.065 1.00 715.03 ?  -17  DG  J C2    1 
ATOM 6102  N N2    . DG  A 1 296 ? 30.700  0.439   181.454 1.00 715.03 ?  -17  DG  J N2    1 
ATOM 6103  N N3    . DG  A 1 296 ? 28.975  -0.906  180.720 1.00 715.03 ?  -17  DG  J N3    1 
ATOM 6104  C C4    . DG  A 1 296 ? 28.683  -2.181  180.348 1.00 715.03 ?  -17  DG  J C4    1 
ATOM 6105  P P     . DG  A 1 297 ? 23.472  -0.016  177.317 1.00 709.27 ?  -16  DG  J P     1 
ATOM 6106  O OP1   . DG  A 1 297 ? 22.050  -0.405  177.199 1.00 709.27 ?  -16  DG  J OP1   1 
ATOM 6107  O OP2   . DG  A 1 297 ? 24.482  -0.590  176.397 1.00 709.27 -1 -16  DG  J OP2   1 
ATOM 6108  O "O5'" . DG  A 1 297 ? 23.586  1.577   177.195 1.00 709.27 ?  -16  DG  J "O5'" 1 
ATOM 6109  C "C5'" . DG  A 1 297 ? 24.391  2.359   178.091 1.00 709.27 ?  -16  DG  J "C5'" 1 
ATOM 6110  C "C4'" . DG  A 1 297 ? 25.749  2.745   177.513 1.00 709.27 ?  -16  DG  J "C4'" 1 
ATOM 6111  O "O4'" . DG  A 1 297 ? 26.734  1.743   177.872 1.00 709.27 ?  -16  DG  J "O4'" 1 
ATOM 6112  C "C3'" . DG  A 1 297 ? 25.841  2.929   175.992 1.00 709.27 ?  -16  DG  J "C3'" 1 
ATOM 6113  O "O3'" . DG  A 1 297 ? 26.139  4.322   175.712 1.00 709.27 ?  -16  DG  J "O3'" 1 
ATOM 6114  C "C2'" . DG  A 1 297 ? 26.902  1.915   175.556 1.00 709.27 ?  -16  DG  J "C2'" 1 
ATOM 6115  C "C1'" . DG  A 1 297 ? 27.691  1.690   176.840 1.00 709.27 ?  -16  DG  J "C1'" 1 
ATOM 6116  N N9    . DG  A 1 297 ? 28.374  0.399   176.906 1.00 709.27 ?  -16  DG  J N9    1 
ATOM 6117  C C8    . DG  A 1 297 ? 27.876  -0.829  176.536 1.00 709.27 ?  -16  DG  J C8    1 
ATOM 6118  N N7    . DG  A 1 297 ? 28.716  -1.811  176.709 1.00 709.27 ?  -16  DG  J N7    1 
ATOM 6119  C C5    . DG  A 1 297 ? 29.847  -1.194  177.230 1.00 709.27 ?  -16  DG  J C5    1 
ATOM 6120  C C6    . DG  A 1 297 ? 31.094  -1.751  177.618 1.00 709.27 ?  -16  DG  J C6    1 
ATOM 6121  O O6    . DG  A 1 297 ? 31.444  -2.940  177.574 1.00 709.27 ?  -16  DG  J O6    1 
ATOM 6122  N N1    . DG  A 1 297 ? 31.977  -0.781  178.100 1.00 709.27 ?  -16  DG  J N1    1 
ATOM 6123  C C2    . DG  A 1 297 ? 31.687  0.563   178.190 1.00 709.27 ?  -16  DG  J C2    1 
ATOM 6124  N N2    . DG  A 1 297 ? 32.658  1.350   178.674 1.00 709.27 ?  -16  DG  J N2    1 
ATOM 6125  N N3    . DG  A 1 297 ? 30.525  1.099   177.829 1.00 709.27 ?  -16  DG  J N3    1 
ATOM 6126  C C4    . DG  A 1 297 ? 29.654  0.167   177.359 1.00 709.27 ?  -16  DG  J C4    1 
ATOM 6127  P P     . DG  A 1 298 ? 27.265  4.922   174.727 1.00 692.29 ?  -15  DG  J P     1 
ATOM 6128  O OP1   . DG  A 1 298 ? 26.754  6.230   174.260 1.00 692.29 ?  -15  DG  J OP1   1 
ATOM 6129  O OP2   . DG  A 1 298 ? 27.662  3.916   173.713 1.00 692.29 -1 -15  DG  J OP2   1 
ATOM 6130  O "O5'" . DG  A 1 298 ? 28.500  5.170   175.718 1.00 692.29 ?  -15  DG  J "O5'" 1 
ATOM 6131  C "C5'" . DG  A 1 298 ? 29.288  6.364   175.626 1.00 692.29 ?  -15  DG  J "C5'" 1 
ATOM 6132  C "C4'" . DG  A 1 298 ? 30.572  6.143   174.838 1.00 692.29 ?  -15  DG  J "C4'" 1 
ATOM 6133  O "O4'" . DG  A 1 298 ? 30.979  4.758   174.961 1.00 692.29 ?  -15  DG  J "O4'" 1 
ATOM 6134  C "C3'" . DG  A 1 298 ? 30.492  6.434   173.335 1.00 692.29 ?  -15  DG  J "C3'" 1 
ATOM 6135  O "O3'" . DG  A 1 298 ? 31.472  7.451   172.931 1.00 692.29 ?  -15  DG  J "O3'" 1 
ATOM 6136  C "C2'" . DG  A 1 298 ? 30.618  5.069   172.648 1.00 692.29 ?  -15  DG  J "C2'" 1 
ATOM 6137  C "C1'" . DG  A 1 298 ? 31.380  4.268   173.700 1.00 692.29 ?  -15  DG  J "C1'" 1 
ATOM 6138  N N9    . DG  A 1 298 ? 31.175  2.820   173.695 1.00 692.29 ?  -15  DG  J N9    1 
ATOM 6139  C C8    . DG  A 1 298 ? 30.160  2.099   173.107 1.00 692.29 ?  -15  DG  J C8    1 
ATOM 6140  N N7    . DG  A 1 298 ? 30.266  0.811   173.290 1.00 692.29 ?  -15  DG  J N7    1 
ATOM 6141  C C5    . DG  A 1 298 ? 31.423  0.670   174.048 1.00 692.29 ?  -15  DG  J C5    1 
ATOM 6142  C C6    . DG  A 1 298 ? 32.051  -0.496  174.554 1.00 692.29 ?  -15  DG  J C6    1 
ATOM 6143  O O6    . DG  A 1 298 ? 31.687  -1.672  174.425 1.00 692.29 ?  -15  DG  J O6    1 
ATOM 6144  N N1    . DG  A 1 298 ? 33.212  -0.200  175.275 1.00 692.29 ?  -15  DG  J N1    1 
ATOM 6145  C C2    . DG  A 1 298 ? 33.706  1.071   175.479 1.00 692.29 ?  -15  DG  J C2    1 
ATOM 6146  N N2    . DG  A 1 298 ? 34.834  1.168   176.197 1.00 692.29 ?  -15  DG  J N2    1 
ATOM 6147  N N3    . DG  A 1 298 ? 33.126  2.171   175.010 1.00 692.29 ?  -15  DG  J N3    1 
ATOM 6148  C C4    . DG  A 1 298 ? 31.993  1.898   174.308 1.00 692.29 ?  -15  DG  J C4    1 
ATOM 6149  P P     . DA  A 1 299 ? 33.066  7.299   172.698 1.00 692.61 ?  -14  DA  J P     1 
ATOM 6150  O OP1   . DA  A 1 299 ? 33.643  8.662   172.647 1.00 692.61 ?  -14  DA  J OP1   1 
ATOM 6151  O OP2   . DA  A 1 299 ? 33.252  6.397   171.534 1.00 692.61 -1 -14  DA  J OP2   1 
ATOM 6152  O "O5'" . DA  A 1 299 ? 33.628  6.575   174.018 1.00 692.61 ?  -14  DA  J "O5'" 1 
ATOM 6153  C "C5'" . DA  A 1 299 ? 34.772  7.072   174.722 1.00 692.61 ?  -14  DA  J "C5'" 1 
ATOM 6154  C "C4'" . DA  A 1 299 ? 36.049  6.347   174.312 1.00 692.61 ?  -14  DA  J "C4'" 1 
ATOM 6155  O "O4'" . DA  A 1 299 ? 35.800  4.920   174.198 1.00 692.61 ?  -14  DA  J "O4'" 1 
ATOM 6156  C "C3'" . DA  A 1 299 ? 36.669  6.778   172.986 1.00 692.61 ?  -14  DA  J "C3'" 1 
ATOM 6157  O "O3'" . DA  A 1 299 ? 38.074  6.934   173.182 1.00 692.61 ?  -14  DA  J "O3'" 1 
ATOM 6158  C "C2'" . DA  A 1 299 ? 36.311  5.638   172.031 1.00 692.61 ?  -14  DA  J "C2'" 1 
ATOM 6159  C "C1'" . DA  A 1 299 ? 36.292  4.437   172.964 1.00 692.61 ?  -14  DA  J "C1'" 1 
ATOM 6160  N N9    . DA  A 1 299 ? 35.423  3.348   172.521 1.00 692.61 ?  -14  DA  J N9    1 
ATOM 6161  C C8    . DA  A 1 299 ? 34.187  3.459   171.947 1.00 692.61 ?  -14  DA  J C8    1 
ATOM 6162  N N7    . DA  A 1 299 ? 33.626  2.310   171.647 1.00 692.61 ?  -14  DA  J N7    1 
ATOM 6163  C C5    . DA  A 1 299 ? 34.563  1.375   172.057 1.00 692.61 ?  -14  DA  J C5    1 
ATOM 6164  C C6    . DA  A 1 299 ? 34.577  -0.035  172.017 1.00 692.61 ?  -14  DA  J C6    1 
ATOM 6165  N N6    . DA  A 1 299 ? 33.569  -0.764  171.525 1.00 692.61 ?  -14  DA  J N6    1 
ATOM 6166  N N1    . DA  A 1 299 ? 35.668  -0.668  172.505 1.00 692.61 ?  -14  DA  J N1    1 
ATOM 6167  C C2    . DA  A 1 299 ? 36.680  0.058   173.002 1.00 692.61 ?  -14  DA  J C2    1 
ATOM 6168  N N3    . DA  A 1 299 ? 36.780  1.386   173.092 1.00 692.61 ?  -14  DA  J N3    1 
ATOM 6169  C C4    . DA  A 1 299 ? 35.679  1.995   172.600 1.00 692.61 ?  -14  DA  J C4    1 
ATOM 6170  P P     . DT  A 1 300 ? 39.160  6.835   172.004 1.00 693.37 ?  -13  DT  J P     1 
ATOM 6171  O OP1   . DT  A 1 300 ? 40.317  7.650   172.450 1.00 693.37 ?  -13  DT  J OP1   1 
ATOM 6172  O OP2   . DT  A 1 300 ? 38.519  7.141   170.700 1.00 693.37 -1 -13  DT  J OP2   1 
ATOM 6173  O "O5'" . DT  A 1 300 ? 39.567  5.276   171.999 1.00 693.37 ?  -13  DT  J "O5'" 1 
ATOM 6174  C "C5'" . DT  A 1 300 ? 40.799  4.806   172.587 1.00 693.37 ?  -13  DT  J "C5'" 1 
ATOM 6175  C "C4'" . DT  A 1 300 ? 41.265  3.467   172.019 1.00 693.37 ?  -13  DT  J "C4'" 1 
ATOM 6176  O "O4'" . DT  A 1 300 ? 40.124  2.595   171.787 1.00 693.37 ?  -13  DT  J "O4'" 1 
ATOM 6177  C "C3'" . DT  A 1 300 ? 42.023  3.498   170.688 1.00 693.37 ?  -13  DT  J "C3'" 1 
ATOM 6178  O "O3'" . DT  A 1 300 ? 42.942  2.412   170.616 1.00 693.37 ?  -13  DT  J "O3'" 1 
ATOM 6179  C "C2'" . DT  A 1 300 ? 40.897  3.228   169.708 1.00 693.37 ?  -13  DT  J "C2'" 1 
ATOM 6180  C "C1'" . DT  A 1 300 ? 40.251  2.083   170.481 1.00 693.37 ?  -13  DT  J "C1'" 1 
ATOM 6181  N N1    . DT  A 1 300 ? 38.923  1.624   170.020 1.00 693.37 ?  -13  DT  J N1    1 
ATOM 6182  C C2    . DT  A 1 300 ? 38.673  0.266   169.985 1.00 693.37 ?  -13  DT  J C2    1 
ATOM 6183  O O2    . DT  A 1 300 ? 39.479  -0.592  170.307 1.00 693.37 ?  -13  DT  J O2    1 
ATOM 6184  N N3    . DT  A 1 300 ? 37.417  -0.065  169.552 1.00 693.37 ?  -13  DT  J N3    1 
ATOM 6185  C C4    . DT  A 1 300 ? 36.418  0.806   169.162 1.00 693.37 ?  -13  DT  J C4    1 
ATOM 6186  O O4    . DT  A 1 300 ? 35.329  0.383   168.790 1.00 693.37 ?  -13  DT  J O4    1 
ATOM 6187  C C5    . DT  A 1 300 ? 36.743  2.217   169.221 1.00 693.37 ?  -13  DT  J C5    1 
ATOM 6188  C C7    . DT  A 1 300 ? 35.746  3.273   168.824 1.00 693.37 ?  -13  DT  J C7    1 
ATOM 6189  C C6    . DT  A 1 300 ? 37.968  2.552   169.648 1.00 693.37 ?  -13  DT  J C6    1 
ATOM 6190  P P     . DT  A 1 301 ? 44.516  2.710   170.758 1.00 689.89 ?  -12  DT  J P     1 
ATOM 6191  O OP1   . DT  A 1 301 ? 44.710  3.415   172.046 1.00 689.89 ?  -12  DT  J OP1   1 
ATOM 6192  O OP2   . DT  A 1 301 ? 44.991  3.342   169.505 1.00 689.89 -1 -12  DT  J OP2   1 
ATOM 6193  O "O5'" . DT  A 1 301 ? 45.165  1.254   170.840 1.00 689.89 ?  -12  DT  J "O5'" 1 
ATOM 6194  C "C5'" . DT  A 1 301 ? 44.389  0.160   171.323 1.00 689.89 ?  -12  DT  J "C5'" 1 
ATOM 6195  C "C4'" . DT  A 1 301 ? 44.267  -0.932  170.268 1.00 689.89 ?  -12  DT  J "C4'" 1 
ATOM 6196  O "O4'" . DT  A 1 301 ? 42.948  -0.884  169.648 1.00 689.89 ?  -12  DT  J "O4'" 1 
ATOM 6197  C "C3'" . DT  A 1 301 ? 45.287  -0.860  169.122 1.00 689.89 ?  -12  DT  J "C3'" 1 
ATOM 6198  O "O3'" . DT  A 1 301 ? 45.869  -2.160  168.903 1.00 689.89 ?  -12  DT  J "O3'" 1 
ATOM 6199  C "C2'" . DT  A 1 301 ? 44.435  -0.404  167.927 1.00 689.89 ?  -12  DT  J "C2'" 1 
ATOM 6200  C "C1'" . DT  A 1 301 ? 43.093  -1.042  168.257 1.00 689.89 ?  -12  DT  J "C1'" 1 
ATOM 6201  N N1    . DT  A 1 301 ? 41.898  -0.419  167.555 1.00 689.89 ?  -12  DT  J N1    1 
ATOM 6202  C C2    . DT  A 1 301 ? 40.717  -1.127  167.487 1.00 689.89 ?  -12  DT  J C2    1 
ATOM 6203  O O2    . DT  A 1 301 ? 40.576  -2.234  167.972 1.00 689.89 ?  -12  DT  J O2    1 
ATOM 6204  N N3    . DT  A 1 301 ? 39.698  -0.486  166.831 1.00 689.89 ?  -12  DT  J N3    1 
ATOM 6205  C C4    . DT  A 1 301 ? 39.738  0.764   166.244 1.00 689.89 ?  -12  DT  J C4    1 
ATOM 6206  O O4    . DT  A 1 301 ? 38.768  1.255   165.677 1.00 689.89 ?  -12  DT  J O4    1 
ATOM 6207  C C5    . DT  A 1 301 ? 41.002  1.453   166.344 1.00 689.89 ?  -12  DT  J C5    1 
ATOM 6208  C C7    . DT  A 1 301 ? 41.163  2.819   165.743 1.00 689.89 ?  -12  DT  J C7    1 
ATOM 6209  C C6    . DT  A 1 301 ? 42.011  0.835   166.985 1.00 689.89 ?  -12  DT  J C6    1 
ATOM 6210  P P     . DC  A 1 302 ? 47.461  -2.343  168.730 1.00 689.05 ?  -11  DC  J P     1 
ATOM 6211  O OP1   . DC  A 1 302 ? 48.131  -2.036  170.014 1.00 689.05 ?  -11  DC  J OP1   1 
ATOM 6212  O OP2   . DC  A 1 302 ? 47.864  -1.621  167.506 1.00 689.05 -1 -11  DC  J OP2   1 
ATOM 6213  O "O5'" . DC  A 1 302 ? 47.635  -3.900  168.423 1.00 689.05 ?  -11  DC  J "O5'" 1 
ATOM 6214  C "C5'" . DC  A 1 302 ? 47.479  -4.378  167.095 1.00 689.05 ?  -11  DC  J "C5'" 1 
ATOM 6215  C "C4'" . DC  A 1 302 ? 46.040  -4.777  166.816 1.00 689.05 ?  -11  DC  J "C4'" 1 
ATOM 6216  O "O4'" . DC  A 1 302 ? 45.238  -3.602  166.597 1.00 689.05 ?  -11  DC  J "O4'" 1 
ATOM 6217  C "C3'" . DC  A 1 302 ? 45.849  -5.603  165.549 1.00 689.05 ?  -11  DC  J "C3'" 1 
ATOM 6218  O "O3'" . DC  A 1 302 ? 45.833  -6.988  165.857 1.00 689.05 ?  -11  DC  J "O3'" 1 
ATOM 6219  C "C2'" . DC  A 1 302 ? 44.495  -5.138  164.983 1.00 689.05 ?  -11  DC  J "C2'" 1 
ATOM 6220  C "C1'" . DC  A 1 302 ? 44.075  -4.004  165.918 1.00 689.05 ?  -11  DC  J "C1'" 1 
ATOM 6221  N N1    . DC  A 1 302 ? 43.470  -2.821  165.208 1.00 689.05 ?  -11  DC  J N1    1 
ATOM 6222  C C2    . DC  A 1 302 ? 42.098  -2.813  164.926 1.00 689.05 ?  -11  DC  J C2    1 
ATOM 6223  O O2    . DC  A 1 302 ? 41.409  -3.783  165.267 1.00 689.05 ?  -11  DC  J O2    1 
ATOM 6224  N N3    . DC  A 1 302 ? 41.561  -1.739  164.287 1.00 689.05 ?  -11  DC  J N3    1 
ATOM 6225  C C4    . DC  A 1 302 ? 42.339  -0.712  163.934 1.00 689.05 ?  -11  DC  J C4    1 
ATOM 6226  N N4    . DC  A 1 302 ? 41.767  0.324   163.307 1.00 689.05 ?  -11  DC  J N4    1 
ATOM 6227  C C5    . DC  A 1 302 ? 43.739  -0.703  164.211 1.00 689.05 ?  -11  DC  J C5    1 
ATOM 6228  C C6    . DC  A 1 302 ? 44.257  -1.769  164.838 1.00 689.05 ?  -11  DC  J C6    1 
ATOM 6229  P P     . DT  A 1 303 ? 46.526  -8.030  164.850 1.00 704.34 ?  -10  DT  J P     1 
ATOM 6230  O OP1   . DT  A 1 303 ? 47.838  -8.394  165.429 1.00 704.34 ?  -10  DT  J OP1   1 
ATOM 6231  O OP2   . DT  A 1 303 ? 46.456  -7.433  163.498 1.00 704.34 -1 -10  DT  J OP2   1 
ATOM 6232  O "O5'" . DT  A 1 303 ? 45.566  -9.314  164.871 1.00 704.34 ?  -10  DT  J "O5'" 1 
ATOM 6233  C "C5'" . DT  A 1 303 ? 44.201  -9.179  165.246 1.00 704.34 ?  -10  DT  J "C5'" 1 
ATOM 6234  C "C4'" . DT  A 1 303 ? 43.264  -9.759  164.190 1.00 704.34 ?  -10  DT  J "C4'" 1 
ATOM 6235  O "O4'" . DT  A 1 303 ? 42.406  -8.701  163.681 1.00 704.34 ?  -10  DT  J "O4'" 1 
ATOM 6236  C "C3'" . DT  A 1 303 ? 43.930  -10.395 162.967 1.00 704.34 ?  -10  DT  J "C3'" 1 
ATOM 6237  O "O3'" . DT  A 1 303 ? 43.183  -11.567 162.555 1.00 704.34 ?  -10  DT  J "O3'" 1 
ATOM 6238  C "C2'" . DT  A 1 303 ? 43.870  -9.272  161.924 1.00 704.34 ?  -10  DT  J "C2'" 1 
ATOM 6239  C "C1'" . DT  A 1 303 ? 42.559  -8.573  162.281 1.00 704.34 ?  -10  DT  J "C1'" 1 
ATOM 6240  N N1    . DT  A 1 303 ? 42.517  -7.094  161.925 1.00 704.34 ?  -10  DT  J N1    1 
ATOM 6241  C C2    . DT  A 1 303 ? 41.298  -6.491  161.680 1.00 704.34 ?  -10  DT  J C2    1 
ATOM 6242  O O2    . DT  A 1 303 ? 40.235  -7.085  161.728 1.00 704.34 ?  -10  DT  J O2    1 
ATOM 6243  N N3    . DT  A 1 303 ? 41.367  -5.156  161.375 1.00 704.34 ?  -10  DT  J N3    1 
ATOM 6244  C C4    . DT  A 1 303 ? 42.504  -4.372  161.291 1.00 704.34 ?  -10  DT  J C4    1 
ATOM 6245  O O4    . DT  A 1 303 ? 42.459  -3.177  161.009 1.00 704.34 ?  -10  DT  J O4    1 
ATOM 6246  C C5    . DT  A 1 303 ? 43.748  -5.058  161.557 1.00 704.34 ?  -10  DT  J C5    1 
ATOM 6247  C C7    . DT  A 1 303 ? 45.048  -4.308  161.493 1.00 704.34 ?  -10  DT  J C7    1 
ATOM 6248  C C6    . DT  A 1 303 ? 43.696  -6.371  161.857 1.00 704.34 ?  -10  DT  J C6    1 
ATOM 6249  P P     . DC  A 1 304 ? 43.618  -12.426 161.261 1.00 703.17 ?  -9   DC  J P     1 
ATOM 6250  O OP1   . DC  A 1 304 ? 43.320  -13.846 161.551 1.00 703.17 ?  -9   DC  J OP1   1 
ATOM 6251  O OP2   . DC  A 1 304 ? 45.009  -12.048 160.922 1.00 703.17 -1 -9   DC  J OP2   1 
ATOM 6252  O "O5'" . DC  A 1 304 ? 42.646  -11.898 160.087 1.00 703.17 ?  -9   DC  J "O5'" 1 
ATOM 6253  C "C5'" . DC  A 1 304 ? 41.498  -12.674 159.670 1.00 703.17 ?  -9   DC  J "C5'" 1 
ATOM 6254  C "C4'" . DC  A 1 304 ? 40.581  -11.873 158.734 1.00 703.17 ?  -9   DC  J "C4'" 1 
ATOM 6255  O "O4'" . DC  A 1 304 ? 40.811  -10.446 158.917 1.00 703.17 ?  -9   DC  J "O4'" 1 
ATOM 6256  C "C3'" . DC  A 1 304 ? 40.752  -12.145 157.226 1.00 703.17 ?  -9   DC  J "C3'" 1 
ATOM 6257  O "O3'" . DC  A 1 304 ? 39.452  -12.219 156.557 1.00 703.17 ?  -9   DC  J "O3'" 1 
ATOM 6258  C "C2'" . DC  A 1 304 ? 41.569  -10.940 156.754 1.00 703.17 ?  -9   DC  J "C2'" 1 
ATOM 6259  C "C1'" . DC  A 1 304 ? 41.045  -9.836  157.663 1.00 703.17 ?  -9   DC  J "C1'" 1 
ATOM 6260  N N1    . DC  A 1 304 ? 42.008  -8.701  157.846 1.00 703.17 ?  -9   DC  J N1    1 
ATOM 6261  C C2    . DC  A 1 304 ? 41.523  -7.398  158.009 1.00 703.17 ?  -9   DC  J C2    1 
ATOM 6262  O O2    . DC  A 1 304 ? 40.297  -7.204  158.010 1.00 703.17 ?  -9   DC  J O2    1 
ATOM 6263  N N3    . DC  A 1 304 ? 42.412  -6.383  158.171 1.00 703.17 ?  -9   DC  J N3    1 
ATOM 6264  C C4    . DC  A 1 304 ? 43.724  -6.636  158.165 1.00 703.17 ?  -9   DC  J C4    1 
ATOM 6265  N N4    . DC  A 1 304 ? 44.562  -5.608  158.326 1.00 703.17 ?  -9   DC  J N4    1 
ATOM 6266  C C5    . DC  A 1 304 ? 44.235  -7.953  157.995 1.00 703.17 ?  -9   DC  J C5    1 
ATOM 6267  C C6    . DC  A 1 304 ? 43.352  -8.944  157.838 1.00 703.17 ?  -9   DC  J C6    1 
ATOM 6268  P P     . DC  A 1 305 ? 39.317  -12.770 155.041 1.00 707.68 ?  -8   DC  J P     1 
ATOM 6269  O OP1   . DC  A 1 305 ? 38.904  -14.192 155.083 1.00 707.68 ?  -8   DC  J OP1   1 
ATOM 6270  O OP2   . DC  A 1 305 ? 40.528  -12.390 154.284 1.00 707.68 -1 -8   DC  J OP2   1 
ATOM 6271  O "O5'" . DC  A 1 305 ? 38.115  -11.914 154.411 1.00 707.68 ?  -8   DC  J "O5'" 1 
ATOM 6272  C "C5'" . DC  A 1 305 ? 37.727  -10.670 155.008 1.00 707.68 ?  -8   DC  J "C5'" 1 
ATOM 6273  C "C4'" . DC  A 1 305 ? 37.565  -9.568  153.965 1.00 707.68 ?  -8   DC  J "C4'" 1 
ATOM 6274  O "O4'" . DC  A 1 305 ? 38.468  -8.470  154.274 1.00 707.68 ?  -8   DC  J "O4'" 1 
ATOM 6275  C "C3'" . DC  A 1 305 ? 37.851  -9.975  152.519 1.00 707.68 ?  -8   DC  J "C3'" 1 
ATOM 6276  O "O3'" . DC  A 1 305 ? 36.826  -9.475  151.657 1.00 707.68 ?  -8   DC  J "O3'" 1 
ATOM 6277  C "C2'" . DC  A 1 305 ? 39.210  -9.336  152.221 1.00 707.68 ?  -8   DC  J "C2'" 1 
ATOM 6278  C "C1'" . DC  A 1 305 ? 39.215  -8.117  153.131 1.00 707.68 ?  -8   DC  J "C1'" 1 
ATOM 6279  N N1    . DC  A 1 305 ? 40.596  -7.714  153.570 1.00 707.68 ?  -8   DC  J N1    1 
ATOM 6280  C C2    . DC  A 1 305 ? 40.851  -6.389  153.947 1.00 707.68 ?  -8   DC  J C2    1 
ATOM 6281  O O2    . DC  A 1 305 ? 39.925  -5.565  153.918 1.00 707.68 ?  -8   DC  J O2    1 
ATOM 6282  N N3    . DC  A 1 305 ? 42.111  -6.046  154.337 1.00 707.68 ?  -8   DC  J N3    1 
ATOM 6283  C C4    . DC  A 1 305 ? 43.081  -6.967  154.354 1.00 707.68 ?  -8   DC  J C4    1 
ATOM 6284  N N4    . DC  A 1 305 ? 44.304  -6.587  154.744 1.00 707.68 ?  -8   DC  J N4    1 
ATOM 6285  C C5    . DC  A 1 305 ? 42.837  -8.321  153.973 1.00 707.68 ?  -8   DC  J C5    1 
ATOM 6286  C C6    . DC  A 1 305 ? 41.595  -8.645  153.591 1.00 707.68 ?  -8   DC  J C6    1 
ATOM 6287  P P     . DA  A 1 306 ? 36.882  -9.742  150.073 1.00 704.13 ?  -7   DA  J P     1 
ATOM 6288  O OP1   . DA  A 1 306 ? 35.490  -9.982  149.634 1.00 704.13 ?  -7   DA  J OP1   1 
ATOM 6289  O OP2   . DA  A 1 306 ? 37.912  -10.773 149.798 1.00 704.13 -1 -7   DA  J OP2   1 
ATOM 6290  O "O5'" . DA  A 1 306 ? 37.401  -8.348  149.468 1.00 704.13 ?  -7   DA  J "O5'" 1 
ATOM 6291  C "C5'" . DA  A 1 306 ? 37.006  -7.110  150.073 1.00 704.13 ?  -7   DA  J "C5'" 1 
ATOM 6292  C "C4'" . DA  A 1 306 ? 37.978  -5.986  149.722 1.00 704.13 ?  -7   DA  J "C4'" 1 
ATOM 6293  O "O4'" . DA  A 1 306 ? 39.234  -6.172  150.432 1.00 704.13 ?  -7   DA  J "O4'" 1 
ATOM 6294  C "C3'" . DA  A 1 306 ? 38.332  -5.865  148.237 1.00 704.13 ?  -7   DA  J "C3'" 1 
ATOM 6295  O "O3'" . DA  A 1 306 ? 38.144  -4.515  147.795 1.00 704.13 ?  -7   DA  J "O3'" 1 
ATOM 6296  C "C2'" . DA  A 1 306 ? 39.807  -6.292  148.174 1.00 704.13 ?  -7   DA  J "C2'" 1 
ATOM 6297  C "C1'" . DA  A 1 306 ? 40.311  -5.907  149.560 1.00 704.13 ?  -7   DA  J "C1'" 1 
ATOM 6298  N N9    . DA  A 1 306 ? 41.484  -6.675  150.012 1.00 704.13 ?  -7   DA  J N9    1 
ATOM 6299  C C8    . DA  A 1 306 ? 41.620  -8.038  150.031 1.00 704.13 ?  -7   DA  J C8    1 
ATOM 6300  N N7    . DA  A 1 306 ? 42.777  -8.456  150.494 1.00 704.13 ?  -7   DA  J N7    1 
ATOM 6301  C C5    . DA  A 1 306 ? 43.454  -7.287  150.806 1.00 704.13 ?  -7   DA  J C5    1 
ATOM 6302  C C6    . DA  A 1 306 ? 44.740  -7.053  151.341 1.00 704.13 ?  -7   DA  J C6    1 
ATOM 6303  N N6    . DA  A 1 306 ? 45.595  -8.026  151.666 1.00 704.13 ?  -7   DA  J N6    1 
ATOM 6304  N N1    . DA  A 1 306 ? 45.110  -5.769  151.530 1.00 704.13 ?  -7   DA  J N1    1 
ATOM 6305  C C2    . DA  A 1 306 ? 44.252  -4.795  151.204 1.00 704.13 ?  -7   DA  J C2    1 
ATOM 6306  N N3    . DA  A 1 306 ? 43.020  -4.892  150.695 1.00 704.13 ?  -7   DA  J N3    1 
ATOM 6307  C C4    . DA  A 1 306 ? 42.677  -6.182  150.518 1.00 704.13 ?  -7   DA  J C4    1 
ATOM 6308  P P     . DG  A 1 307 ? 37.809  -4.203  146.254 1.00 715.66 ?  -6   DG  J P     1 
ATOM 6309  O OP1   . DG  A 1 307 ? 36.620  -3.324  146.203 1.00 715.66 ?  -6   DG  J OP1   1 
ATOM 6310  O OP2   . DG  A 1 307 ? 37.815  -5.486  145.516 1.00 715.66 -1 -6   DG  J OP2   1 
ATOM 6311  O "O5'" . DG  A 1 307 ? 39.075  -3.372  145.747 1.00 715.66 ?  -6   DG  J "O5'" 1 
ATOM 6312  C "C5'" . DG  A 1 307 ? 39.369  -2.108  146.318 1.00 715.66 ?  -6   DG  J "C5'" 1 
ATOM 6313  C "C4'" . DG  A 1 307 ? 40.822  -1.741  146.081 1.00 715.66 ?  -6   DG  J "C4'" 1 
ATOM 6314  O "O4'" . DG  A 1 307 ? 41.667  -2.557  146.915 1.00 715.66 ?  -6   DG  J "O4'" 1 
ATOM 6315  C "C3'" . DG  A 1 307 ? 41.322  -1.959  144.648 1.00 715.66 ?  -6   DG  J "C3'" 1 
ATOM 6316  O "O3'" . DG  A 1 307 ? 41.469  -0.700  143.985 1.00 715.66 ?  -6   DG  J "O3'" 1 
ATOM 6317  C "C2'" . DG  A 1 307 ? 42.675  -2.690  144.811 1.00 715.66 ?  -6   DG  J "C2'" 1 
ATOM 6318  C "C1'" . DG  A 1 307 ? 42.933  -2.620  146.315 1.00 715.66 ?  -6   DG  J "C1'" 1 
ATOM 6319  N N9    . DG  A 1 307 ? 43.673  -3.768  146.862 1.00 715.66 ?  -6   DG  J N9    1 
ATOM 6320  C C8    . DG  A 1 307 ? 43.313  -5.099  146.824 1.00 715.66 ?  -6   DG  J C8    1 
ATOM 6321  N N7    . DG  A 1 307 ? 44.180  -5.891  147.405 1.00 715.66 ?  -6   DG  J N7    1 
ATOM 6322  C C5    . DG  A 1 307 ? 45.174  -5.032  147.859 1.00 715.66 ?  -6   DG  J C5    1 
ATOM 6323  C C6    . DG  A 1 307 ? 46.371  -5.310  148.564 1.00 715.66 ?  -6   DG  J C6    1 
ATOM 6324  O O6    . DG  A 1 307 ? 46.804  -6.412  148.941 1.00 715.66 ?  -6   DG  J O6    1 
ATOM 6325  N N1    . DG  A 1 307 ? 47.095  -4.143  148.828 1.00 715.66 ?  -6   DG  J N1    1 
ATOM 6326  C C2    . DG  A 1 307 ? 46.708  -2.872  148.458 1.00 715.66 ?  -6   DG  J C2    1 
ATOM 6327  N N2    . DG  A 1 307 ? 47.536  -1.869  148.801 1.00 715.66 ?  -6   DG  J N2    1 
ATOM 6328  N N3    . DG  A 1 307 ? 45.590  -2.601  147.799 1.00 715.66 ?  -6   DG  J N3    1 
ATOM 6329  C C4    . DG  A 1 307 ? 44.875  -3.723  147.533 1.00 715.66 ?  -6   DG  J C4    1 
ATOM 6330  P P     . DG  A 1 308 ? 41.951  -0.628  142.452 1.00 710.42 ?  -5   DG  J P     1 
ATOM 6331  O OP1   . DG  A 1 308 ? 41.359  0.592   141.862 1.00 710.42 ?  -5   DG  J OP1   1 
ATOM 6332  O OP2   . DG  A 1 308 ? 41.711  -1.947  141.820 1.00 710.42 -1 -5   DG  J OP2   1 
ATOM 6333  O "O5'" . DG  A 1 308 ? 43.529  -0.412  142.565 1.00 710.42 ?  -5   DG  J "O5'" 1 
ATOM 6334  C "C5'" . DG  A 1 308 ? 44.056  0.446   143.571 1.00 710.42 ?  -5   DG  J "C5'" 1 
ATOM 6335  C "C4'" . DG  A 1 308 ? 45.548  0.230   143.724 1.00 710.42 ?  -5   DG  J "C4'" 1 
ATOM 6336  O "O4'" . DG  A 1 308 ? 45.786  -0.955  144.508 1.00 710.42 ?  -5   DG  J "O4'" 1 
ATOM 6337  C "C3'" . DG  A 1 308 ? 46.288  0.022   142.409 1.00 710.42 ?  -5   DG  J "C3'" 1 
ATOM 6338  O "O3'" . DG  A 1 308 ? 47.017  1.194   142.082 1.00 710.42 ?  -5   DG  J "O3'" 1 
ATOM 6339  C "C2'" . DG  A 1 308 ? 47.215  -1.184  142.656 1.00 710.42 ?  -5   DG  J "C2'" 1 
ATOM 6340  C "C1'" . DG  A 1 308 ? 47.015  -1.522  144.134 1.00 710.42 ?  -5   DG  J "C1'" 1 
ATOM 6341  N N9    . DG  A 1 308 ? 46.945  -2.963  144.401 1.00 710.42 ?  -5   DG  J N9    1 
ATOM 6342  C C8    . DG  A 1 308 ? 45.988  -3.835  143.940 1.00 710.42 ?  -5   DG  J C8    1 
ATOM 6343  N N7    . DG  A 1 308 ? 46.162  -5.064  144.340 1.00 710.42 ?  -5   DG  J N7    1 
ATOM 6344  C C5    . DG  A 1 308 ? 47.306  -5.009  145.122 1.00 710.42 ?  -5   DG  J C5    1 
ATOM 6345  C C6    . DG  A 1 308 ? 47.974  -6.041  145.820 1.00 710.42 ?  -5   DG  J C6    1 
ATOM 6346  O O6    . DG  A 1 308 ? 47.671  -7.241  145.887 1.00 710.42 ?  -5   DG  J O6    1 
ATOM 6347  N N1    . DG  A 1 308 ? 49.098  -5.564  146.492 1.00 710.42 ?  -5   DG  J N1    1 
ATOM 6348  C C2    . DG  A 1 308 ? 49.521  -4.254  146.489 1.00 710.42 ?  -5   DG  J C2    1 
ATOM 6349  N N2    . DG  A 1 308 ? 50.634  -3.990  147.190 1.00 710.42 ?  -5   DG  J N2    1 
ATOM 6350  N N3    . DG  A 1 308 ? 48.903  -3.272  145.836 1.00 710.42 ?  -5   DG  J N3    1 
ATOM 6351  C C4    . DG  A 1 308 ? 47.804  -3.722  145.175 1.00 710.42 ?  -5   DG  J C4    1 
ATOM 6352  P P     . DG  A 1 309 ? 47.864  1.271   140.721 1.00 705.52 ?  -4   DG  J P     1 
ATOM 6353  O OP1   . DG  A 1 309 ? 47.980  2.701   140.361 1.00 705.52 ?  -4   DG  J OP1   1 
ATOM 6354  O OP2   . DG  A 1 309 ? 47.259  0.322   139.759 1.00 705.52 -1 -4   DG  J OP2   1 
ATOM 6355  O "O5'" . DG  A 1 309 ? 49.304  0.699   141.138 1.00 705.52 ?  -4   DG  J "O5'" 1 
ATOM 6356  C "C5'" . DG  A 1 309 ? 49.965  1.206   142.305 1.00 705.52 ?  -4   DG  J "C5'" 1 
ATOM 6357  C "C4'" . DG  A 1 309 ? 51.003  0.221   142.846 1.00 705.52 ?  -4   DG  J "C4'" 1 
ATOM 6358  O "O4'" . DG  A 1 309 ? 50.351  -0.968  143.332 1.00 705.52 ?  -4   DG  J "O4'" 1 
ATOM 6359  C "C3'" . DG  A 1 309 ? 52.024  -0.290  141.839 1.00 705.52 ?  -4   DG  J "C3'" 1 
ATOM 6360  O "O3'" . DG  A 1 309 ? 53.136  0.612   141.757 1.00 705.52 ?  -4   DG  J "O3'" 1 
ATOM 6361  C "C2'" . DG  A 1 309 ? 52.450  -1.645  142.429 1.00 705.52 ?  -4   DG  J "C2'" 1 
ATOM 6362  C "C1'" . DG  A 1 309 ? 51.289  -2.029  143.361 1.00 705.52 ?  -4   DG  J "C1'" 1 
ATOM 6363  N N9    . DG  A 1 309 ? 50.611  -3.272  142.981 1.00 705.52 ?  -4   DG  J N9    1 
ATOM 6364  C C8    . DG  A 1 309 ? 49.596  -3.412  142.065 1.00 705.52 ?  -4   DG  J C8    1 
ATOM 6365  N N7    . DG  A 1 309 ? 49.178  -4.640  141.930 1.00 705.52 ?  -4   DG  J N7    1 
ATOM 6366  C C5    . DG  A 1 309 ? 49.968  -5.368  142.811 1.00 705.52 ?  -4   DG  J C5    1 
ATOM 6367  C C6    . DG  A 1 309 ? 49.971  -6.755  143.096 1.00 705.52 ?  -4   DG  J C6    1 
ATOM 6368  O O6    . DG  A 1 309 ? 49.251  -7.645  142.609 1.00 705.52 ?  -4   DG  J O6    1 
ATOM 6369  N N1    . DG  A 1 309 ? 50.934  -7.079  144.055 1.00 705.52 ?  -4   DG  J N1    1 
ATOM 6370  C C2    . DG  A 1 309 ? 51.784  -6.176  144.659 1.00 705.52 ?  -4   DG  J C2    1 
ATOM 6371  N N2    . DG  A 1 309 ? 52.646  -6.677  145.558 1.00 705.52 ?  -4   DG  J N2    1 
ATOM 6372  N N3    . DG  A 1 309 ? 51.789  -4.873  144.399 1.00 705.52 ?  -4   DG  J N3    1 
ATOM 6373  C C4    . DG  A 1 309 ? 50.858  -4.541  143.468 1.00 705.52 ?  -4   DG  J C4    1 
ATOM 6374  P P     . DA  A 1 310 ? 54.211  0.479   140.567 1.00 697.73 ?  -3   DA  J P     1 
ATOM 6375  O OP1   . DA  A 1 310 ? 54.731  1.834   140.284 1.00 697.73 ?  -3   DA  J OP1   1 
ATOM 6376  O OP2   . DA  A 1 310 ? 53.574  -0.289  139.474 1.00 697.73 -1 -3   DA  J OP2   1 
ATOM 6377  O "O5'" . DA  A 1 310 ? 55.375  -0.435  141.188 1.00 697.73 ?  -3   DA  J "O5'" 1 
ATOM 6378  C "C5'" . DA  A 1 310 ? 55.913  -0.143  142.480 1.00 697.73 ?  -3   DA  J "C5'" 1 
ATOM 6379  C "C4'" . DA  A 1 310 ? 56.629  -1.355  143.056 1.00 697.73 ?  -3   DA  J "C4'" 1 
ATOM 6380  O "O4'" . DA  A 1 310 ? 55.660  -2.374  143.408 1.00 697.73 ?  -3   DA  J "O4'" 1 
ATOM 6381  C "C3'" . DA  A 1 310 ? 57.592  -2.043  142.106 1.00 697.73 ?  -3   DA  J "C3'" 1 
ATOM 6382  O "O3'" . DA  A 1 310 ? 58.867  -1.413  142.166 1.00 697.73 ?  -3   DA  J "O3'" 1 
ATOM 6383  C "C2'" . DA  A 1 310 ? 57.637  -3.462  142.667 1.00 697.73 ?  -3   DA  J "C2'" 1 
ATOM 6384  C "C1'" . DA  A 1 310 ? 56.199  -3.664  143.155 1.00 697.73 ?  -3   DA  J "C1'" 1 
ATOM 6385  N N9    . DA  A 1 310 ? 55.338  -4.353  142.190 1.00 697.73 ?  -3   DA  J N9    1 
ATOM 6386  C C8    . DA  A 1 310 ? 54.804  -3.831  141.043 1.00 697.73 ?  -3   DA  J C8    1 
ATOM 6387  N N7    . DA  A 1 310 ? 54.065  -4.681  140.367 1.00 697.73 ?  -3   DA  J N7    1 
ATOM 6388  C C5    . DA  A 1 310 ? 54.116  -5.842  141.120 1.00 697.73 ?  -3   DA  J C5    1 
ATOM 6389  C C6    . DA  A 1 310 ? 53.536  -7.115  140.943 1.00 697.73 ?  -3   DA  J C6    1 
ATOM 6390  N N6    . DA  A 1 310 ? 52.759  -7.433  139.900 1.00 697.73 ?  -3   DA  J N6    1 
ATOM 6391  N N1    . DA  A 1 310 ? 53.786  -8.052  141.882 1.00 697.73 ?  -3   DA  J N1    1 
ATOM 6392  C C2    . DA  A 1 310 ? 54.564  -7.729  142.924 1.00 697.73 ?  -3   DA  J C2    1 
ATOM 6393  N N3    . DA  A 1 310 ? 55.163  -6.570  143.198 1.00 697.73 ?  -3   DA  J N3    1 
ATOM 6394  C C4    . DA  A 1 310 ? 54.897  -5.659  142.249 1.00 697.73 ?  -3   DA  J C4    1 
ATOM 6395  N N     . THR B 2 33  ? 46.962  -10.491 37.642  1.00 602.06 ?  29   THR R N     1 
ATOM 6396  C CA    . THR B 2 33  ? 45.480  -10.445 37.850  1.00 602.07 ?  29   THR R CA    1 
ATOM 6397  C C     . THR B 2 33  ? 45.077  -9.493  38.979  1.00 602.09 ?  29   THR R C     1 
ATOM 6398  O O     . THR B 2 33  ? 45.937  -8.970  39.692  1.00 602.20 ?  29   THR R O     1 
ATOM 6399  C CB    . THR B 2 33  ? 44.924  -11.830 38.168  1.00 601.98 ?  29   THR R CB    1 
ATOM 6400  O OG1   . THR B 2 33  ? 45.718  -12.418 39.201  1.00 602.09 ?  29   THR R OG1   1 
ATOM 6401  C CG2   . THR B 2 33  ? 44.956  -12.709 36.936  1.00 602.13 ?  29   THR R CG2   1 
ATOM 6402  N N     . ARG B 2 34  ? 43.767  -9.278  39.135  1.00 588.69 ?  30   ARG R N     1 
ATOM 6403  C CA    . ARG B 2 34  ? 43.241  -8.369  40.160  1.00 588.42 ?  30   ARG R CA    1 
ATOM 6404  C C     . ARG B 2 34  ? 43.383  -8.959  41.563  1.00 587.34 ?  30   ARG R C     1 
ATOM 6405  O O     . ARG B 2 34  ? 42.762  -9.978  41.888  1.00 587.61 ?  30   ARG R O     1 
ATOM 6406  C CB    . ARG B 2 34  ? 41.758  -8.024  39.907  1.00 588.94 ?  30   ARG R CB    1 
ATOM 6407  C CG    . ARG B 2 34  ? 41.375  -7.678  38.458  1.00 591.59 ?  30   ARG R CG    1 
ATOM 6408  C CD    . ARG B 2 34  ? 41.662  -6.217  38.080  1.00 594.67 ?  30   ARG R CD    1 
ATOM 6409  N NE    . ARG B 2 34  ? 40.724  -5.282  38.704  1.00 597.04 ?  30   ARG R NE    1 
ATOM 6410  C CZ    . ARG B 2 34  ? 40.388  -4.094  38.199  1.00 598.19 ?  30   ARG R CZ    1 
ATOM 6411  N NH1   . ARG B 2 34  ? 40.903  -3.683  37.039  1.00 598.51 1  30   ARG R NH1   1 
ATOM 6412  N NH2   . ARG B 2 34  ? 39.530  -3.313  38.852  1.00 598.13 ?  30   ARG R NH2   1 
ATOM 6413  N N     . LYS B 2 35  ? 44.210  -8.321  42.384  1.00 591.47 ?  31   LYS R N     1 
ATOM 6414  C CA    . LYS B 2 35  ? 44.229  -8.589  43.813  1.00 590.04 ?  31   LYS R CA    1 
ATOM 6415  C C     . LYS B 2 35  ? 43.549  -7.424  44.537  1.00 588.63 ?  31   LYS R C     1 
ATOM 6416  O O     . LYS B 2 35  ? 44.128  -6.334  44.693  1.00 588.34 ?  31   LYS R O     1 
ATOM 6417  C CB    . LYS B 2 35  ? 45.663  -8.786  44.319  1.00 590.35 ?  31   LYS R CB    1 
ATOM 6418  C CG    . LYS B 2 35  ? 46.035  -10.225 44.631  1.00 591.60 ?  31   LYS R CG    1 
ATOM 6419  C CD    . LYS B 2 35  ? 46.117  -10.515 46.147  1.00 592.73 ?  31   LYS R CD    1 
ATOM 6420  C CE    . LYS B 2 35  ? 46.806  -11.875 46.391  1.00 593.73 ?  31   LYS R CE    1 
ATOM 6421  N NZ    . LYS B 2 35  ? 47.484  -12.031 47.719  1.00 594.07 1  31   LYS R NZ    1 
ATOM 6422  N N     . GLU B 2 36  ? 42.312  -7.657  44.969  1.00 601.11 ?  32   GLU R N     1 
ATOM 6423  C CA    . GLU B 2 36  ? 41.575  -6.664  45.733  1.00 598.96 ?  32   GLU R CA    1 
ATOM 6424  C C     . GLU B 2 36  ? 42.212  -6.422  47.087  1.00 597.85 ?  32   GLU R C     1 
ATOM 6425  O O     . GLU B 2 36  ? 42.941  -7.275  47.601  1.00 597.94 ?  32   GLU R O     1 
ATOM 6426  C CB    . GLU B 2 36  ? 40.127  -7.080  45.911  1.00 598.84 ?  32   GLU R CB    1 
ATOM 6427  C CG    . GLU B 2 36  ? 39.250  -6.694  44.743  1.00 598.37 ?  32   GLU R CG    1 
ATOM 6428  C CD    . GLU B 2 36  ? 37.842  -7.217  44.906  1.00 598.19 ?  32   GLU R CD    1 
ATOM 6429  O OE1   . GLU B 2 36  ? 37.522  -7.685  46.024  1.00 597.50 ?  32   GLU R OE1   1 
ATOM 6430  O OE2   . GLU B 2 36  ? 37.065  -7.165  43.923  1.00 597.07 -1 32   GLU R OE2   1 
ATOM 6431  N N     . SER B 2 37  ? 41.922  -5.253  47.657  1.00 614.80 ?  33   SER R N     1 
ATOM 6432  C CA    . SER B 2 37  ? 42.536  -4.779  48.896  1.00 614.80 ?  33   SER R CA    1 
ATOM 6433  C C     . SER B 2 37  ? 41.771  -3.569  49.414  1.00 614.80 ?  33   SER R C     1 
ATOM 6434  O O     . SER B 2 37  ? 41.131  -2.842  48.640  1.00 614.80 ?  33   SER R O     1 
ATOM 6435  C CB    . SER B 2 37  ? 43.986  -4.367  48.652  1.00 614.80 ?  33   SER R CB    1 
ATOM 6436  O OG    . SER B 2 37  ? 44.642  -4.128  49.881  1.00 614.80 ?  33   SER R OG    1 
ATOM 6437  N N     . TYR B 2 38  ? 41.840  -3.369  50.727  1.00 614.30 ?  34   TYR R N     1 
ATOM 6438  C CA    . TYR B 2 38  ? 41.335  -2.176  51.364  1.00 614.30 ?  34   TYR R CA    1 
ATOM 6439  C C     . TYR B 2 38  ? 42.407  -1.093  51.384  1.00 614.30 ?  34   TYR R C     1 
ATOM 6440  O O     . TYR B 2 38  ? 42.402  -0.229  52.262  1.00 614.30 ?  34   TYR R O     1 
ATOM 6441  C CB    . TYR B 2 38  ? 40.939  -2.492  52.792  1.00 614.30 ?  34   TYR R CB    1 
ATOM 6442  C CG    . TYR B 2 38  ? 39.783  -3.443  52.932  1.00 614.30 ?  34   TYR R CG    1 
ATOM 6443  C CD1   . TYR B 2 38  ? 38.474  -2.992  52.819  1.00 614.30 ?  34   TYR R CD1   1 
ATOM 6444  C CD2   . TYR B 2 38  ? 39.992  -4.782  53.211  1.00 614.30 ?  34   TYR R CD2   1 
ATOM 6445  C CE1   . TYR B 2 38  ? 37.403  -3.856  52.960  1.00 614.30 ?  34   TYR R CE1   1 
ATOM 6446  C CE2   . TYR B 2 38  ? 38.926  -5.657  53.352  1.00 614.30 ?  34   TYR R CE2   1 
ATOM 6447  C CZ    . TYR B 2 38  ? 37.637  -5.185  53.222  1.00 614.30 ?  34   TYR R CZ    1 
ATOM 6448  O OH    . TYR B 2 38  ? 36.569  -6.035  53.359  1.00 614.30 ?  34   TYR R OH    1 
ATOM 6449  N N     . ALA B 2 39  ? 43.324  -1.121  50.421  1.00 617.20 ?  35   ALA R N     1 
ATOM 6450  C CA    . ALA B 2 39  ? 44.463  -0.200  50.459  1.00 617.20 ?  35   ALA R CA    1 
ATOM 6451  C C     . ALA B 2 39  ? 44.055  1.257   50.220  1.00 617.20 ?  35   ALA R C     1 
ATOM 6452  O O     . ALA B 2 39  ? 44.673  2.175   50.752  1.00 617.20 ?  35   ALA R O     1 
ATOM 6453  C CB    . ALA B 2 39  ? 45.550  -0.634  49.491  1.00 617.20 ?  35   ALA R CB    1 
ATOM 6454  N N     . ILE B 2 40  ? 43.005  1.462   49.436  1.00 612.96 ?  36   ILE R N     1 
ATOM 6455  C CA    . ILE B 2 40  ? 42.584  2.817   49.116  1.00 612.96 ?  36   ILE R CA    1 
ATOM 6456  C C     . ILE B 2 40  ? 41.799  3.399   50.285  1.00 612.96 ?  36   ILE R C     1 
ATOM 6457  O O     . ILE B 2 40  ? 42.128  4.477   50.784  1.00 612.96 ?  36   ILE R O     1 
ATOM 6458  C CB    . ILE B 2 40  ? 41.812  2.923   47.766  1.00 612.96 ?  36   ILE R CB    1 
ATOM 6459  C CG1   . ILE B 2 40  ? 40.645  1.932   47.703  1.00 612.96 ?  36   ILE R CG1   1 
ATOM 6460  C CG2   . ILE B 2 40  ? 42.771  2.742   46.575  1.00 612.96 ?  36   ILE R CG2   1 
ATOM 6461  C CD1   . ILE B 2 40  ? 39.692  2.202   46.567  1.00 612.96 ?  36   ILE R CD1   1 
ATOM 6462  N N     . TYR B 2 41  ? 40.796  2.661   50.743  1.00 604.12 ?  37   TYR R N     1 
ATOM 6463  C CA    . TYR B 2 41  ? 40.000  3.065   51.890  1.00 604.12 ?  37   TYR R CA    1 
ATOM 6464  C C     . TYR B 2 41  ? 40.867  3.296   53.112  1.00 604.12 ?  37   TYR R C     1 
ATOM 6465  O O     . TYR B 2 41  ? 40.630  4.223   53.865  1.00 604.12 ?  37   TYR R O     1 
ATOM 6466  C CB    . TYR B 2 41  ? 38.921  2.027   52.159  1.00 604.12 ?  37   TYR R CB    1 
ATOM 6467  C CG    . TYR B 2 41  ? 38.432  1.455   50.855  1.00 604.12 ?  37   TYR R CG    1 
ATOM 6468  C CD1   . TYR B 2 41  ? 37.681  2.230   49.974  1.00 604.12 ?  37   TYR R CD1   1 
ATOM 6469  C CD2   . TYR B 2 41  ? 38.781  0.171   50.462  1.00 604.12 ?  37   TYR R CD2   1 
ATOM 6470  C CE1   . TYR B 2 41  ? 37.249  1.726   48.764  1.00 604.12 ?  37   TYR R CE1   1 
ATOM 6471  C CE2   . TYR B 2 41  ? 38.357  -0.341  49.247  1.00 604.12 ?  37   TYR R CE2   1 
ATOM 6472  C CZ    . TYR B 2 41  ? 37.593  0.442   48.403  1.00 604.12 ?  37   TYR R CZ    1 
ATOM 6473  O OH    . TYR B 2 41  ? 37.171  -0.056  47.190  1.00 604.12 ?  37   TYR R OH    1 
ATOM 6474  N N     . VAL B 2 42  ? 41.892  2.481   53.318  1.00 606.29 ?  38   VAL R N     1 
ATOM 6475  C CA    . VAL B 2 42  ? 42.754  2.754   54.452  1.00 606.29 ?  38   VAL R CA    1 
ATOM 6476  C C     . VAL B 2 42  ? 43.516  4.044   54.207  1.00 606.29 ?  38   VAL R C     1 
ATOM 6477  O O     . VAL B 2 42  ? 43.629  4.851   55.116  1.00 606.29 ?  38   VAL R O     1 
ATOM 6478  C CB    . VAL B 2 42  ? 43.702  1.606   54.793  1.00 606.29 ?  38   VAL R CB    1 
ATOM 6479  C CG1   . VAL B 2 42  ? 44.676  2.058   55.857  1.00 606.29 ?  38   VAL R CG1   1 
ATOM 6480  C CG2   . VAL B 2 42  ? 42.919  0.382   55.274  1.00 606.29 ?  38   VAL R CG2   1 
ATOM 6481  N N     . TYR B 2 43  ? 44.026  4.255   52.997  1.00 603.23 ?  39   TYR R N     1 
ATOM 6482  C CA    . TYR B 2 43  ? 44.685  5.527   52.698  1.00 603.23 ?  39   TYR R CA    1 
ATOM 6483  C C     . TYR B 2 43  ? 43.725  6.686   53.006  1.00 603.23 ?  39   TYR R C     1 
ATOM 6484  O O     . TYR B 2 43  ? 44.030  7.573   53.819  1.00 603.23 ?  39   TYR R O     1 
ATOM 6485  C CB    . TYR B 2 43  ? 45.120  5.616   51.238  1.00 603.23 ?  39   TYR R CB    1 
ATOM 6486  C CG    . TYR B 2 43  ? 46.570  5.335   50.985  1.00 603.23 ?  39   TYR R CG    1 
ATOM 6487  C CD1   . TYR B 2 43  ? 47.558  6.223   51.418  1.00 603.23 ?  39   TYR R CD1   1 
ATOM 6488  C CD2   . TYR B 2 43  ? 46.959  4.185   50.276  1.00 603.23 ?  39   TYR R CD2   1 
ATOM 6489  C CE1   . TYR B 2 43  ? 48.913  5.961   51.184  1.00 603.23 ?  39   TYR R CE1   1 
ATOM 6490  C CE2   . TYR B 2 43  ? 48.316  3.906   50.020  1.00 603.23 ?  39   TYR R CE2   1 
ATOM 6491  C CZ    . TYR B 2 43  ? 49.296  4.799   50.478  1.00 603.23 ?  39   TYR R CZ    1 
ATOM 6492  O OH    . TYR B 2 43  ? 50.630  4.520   50.227  1.00 603.23 ?  39   TYR R OH    1 
ATOM 6493  N N     . LYS B 2 44  ? 42.564  6.660   52.356  1.00 607.06 ?  40   LYS R N     1 
ATOM 6494  C CA    . LYS B 2 44  ? 41.575  7.694   52.539  1.00 607.06 ?  40   LYS R CA    1 
ATOM 6495  C C     . LYS B 2 44  ? 41.505  8.071   54.002  1.00 607.06 ?  40   LYS R C     1 
ATOM 6496  O O     . LYS B 2 44  ? 41.888  9.195   54.354  1.00 607.06 ?  40   LYS R O     1 
ATOM 6497  C CB    . LYS B 2 44  ? 40.228  7.261   51.987  1.00 607.06 ?  40   LYS R CB    1 
ATOM 6498  C CG    . LYS B 2 44  ? 40.196  7.368   50.472  1.00 607.06 ?  40   LYS R CG    1 
ATOM 6499  C CD    . LYS B 2 44  ? 38.835  7.045   49.909  1.00 607.06 ?  40   LYS R CD    1 
ATOM 6500  C CE    . LYS B 2 44  ? 38.794  7.388   48.438  1.00 607.06 ?  40   LYS R CE    1 
ATOM 6501  N NZ    . LYS B 2 44  ? 37.395  7.344   47.922  1.00 607.06 1  40   LYS R NZ    1 
ATOM 6502  N N     . VAL B 2 45  ? 41.093  7.129   54.854  1.00 620.05 ?  41   VAL R N     1 
ATOM 6503  C CA    . VAL B 2 45  ? 40.947  7.371   56.289  1.00 620.05 ?  41   VAL R CA    1 
ATOM 6504  C C     . VAL B 2 45  ? 42.235  7.888   56.949  1.00 620.05 ?  41   VAL R C     1 
ATOM 6505  O O     . VAL B 2 45  ? 42.206  8.851   57.705  1.00 620.05 ?  41   VAL R O     1 
ATOM 6506  C CB    . VAL B 2 45  ? 40.433  6.128   57.018  1.00 620.05 ?  41   VAL R CB    1 
ATOM 6507  C CG1   . VAL B 2 45  ? 40.280  6.393   58.512  1.00 620.05 ?  41   VAL R CG1   1 
ATOM 6508  C CG2   . VAL B 2 45  ? 39.111  5.673   56.433  1.00 620.05 ?  41   VAL R CG2   1 
ATOM 6509  N N     . LEU B 2 46  ? 43.376  7.273   56.669  1.00 620.73 ?  42   LEU R N     1 
ATOM 6510  C CA    . LEU B 2 46  ? 44.635  7.854   57.160  1.00 620.73 ?  42   LEU R CA    1 
ATOM 6511  C C     . LEU B 2 46  ? 44.767  9.335   56.757  1.00 620.73 ?  42   LEU R C     1 
ATOM 6512  O O     . LEU B 2 46  ? 45.188  10.158  57.579  1.00 620.73 ?  42   LEU R O     1 
ATOM 6513  C CB    . LEU B 2 46  ? 45.854  7.044   56.701  1.00 620.73 ?  42   LEU R CB    1 
ATOM 6514  C CG    . LEU B 2 46  ? 47.279  7.637   56.771  1.00 620.73 ?  42   LEU R CG    1 
ATOM 6515  C CD1   . LEU B 2 46  ? 47.760  7.951   58.177  1.00 620.73 ?  42   LEU R CD1   1 
ATOM 6516  C CD2   . LEU B 2 46  ? 48.267  6.714   56.100  1.00 620.73 ?  42   LEU R CD2   1 
ATOM 6517  N N     . LYS B 2 47  ? 44.401  9.689   55.522  1.00 605.85 ?  43   LYS R N     1 
ATOM 6518  C CA    . LYS B 2 47  ? 44.592  11.087  55.094  1.00 605.85 ?  43   LYS R CA    1 
ATOM 6519  C C     . LYS B 2 47  ? 43.666  12.020  55.835  1.00 605.85 ?  43   LYS R C     1 
ATOM 6520  O O     . LYS B 2 47  ? 44.100  13.055  56.364  1.00 605.85 ?  43   LYS R O     1 
ATOM 6521  C CB    . LYS B 2 47  ? 44.556  11.279  53.569  1.00 605.85 ?  43   LYS R CB    1 
ATOM 6522  C CG    . LYS B 2 47  ? 45.896  10.910  52.922  1.00 605.85 ?  43   LYS R CG    1 
ATOM 6523  C CD    . LYS B 2 47  ? 47.032  11.051  53.956  1.00 605.85 ?  43   LYS R CD    1 
ATOM 6524  C CE    . LYS B 2 47  ? 48.420  10.851  53.336  1.00 605.85 ?  43   LYS R CE    1 
ATOM 6525  N NZ    . LYS B 2 47  ? 48.912  12.071  52.631  1.00 605.85 1  43   LYS R NZ    1 
ATOM 6526  N N     . GLN B 2 48  ? 42.411  11.612  55.934  1.00 588.31 ?  44   GLN R N     1 
ATOM 6527  C CA    . GLN B 2 48  ? 41.504  12.227  56.882  1.00 588.31 ?  44   GLN R CA    1 
ATOM 6528  C C     . GLN B 2 48  ? 42.074  12.387  58.284  1.00 588.31 ?  44   GLN R C     1 
ATOM 6529  O O     . GLN B 2 48  ? 41.756  13.337  58.945  1.00 588.31 ?  44   GLN R O     1 
ATOM 6530  C CB    . GLN B 2 48  ? 40.213  11.435  56.972  1.00 588.31 ?  44   GLN R CB    1 
ATOM 6531  C CG    . GLN B 2 48  ? 39.264  11.715  55.859  1.00 588.31 ?  44   GLN R CG    1 
ATOM 6532  C CD    . GLN B 2 48  ? 37.942  11.055  56.083  1.00 588.31 ?  44   GLN R CD    1 
ATOM 6533  O OE1   . GLN B 2 48  ? 36.901  11.641  55.796  1.00 588.31 ?  44   GLN R OE1   1 
ATOM 6534  N NE2   . GLN B 2 48  ? 37.960  9.832   56.596  1.00 588.31 ?  44   GLN R NE2   1 
ATOM 6535  N N     . VAL B 2 49  ? 42.912  11.485  58.757  1.00 604.06 ?  45   VAL R N     1 
ATOM 6536  C CA    . VAL B 2 49  ? 43.273  11.515  60.183  1.00 604.06 ?  45   VAL R CA    1 
ATOM 6537  C C     . VAL B 2 49  ? 44.681  11.978  60.479  1.00 604.06 ?  45   VAL R C     1 
ATOM 6538  O O     . VAL B 2 49  ? 44.934  12.530  61.549  1.00 604.06 ?  45   VAL R O     1 
ATOM 6539  C CB    . VAL B 2 49  ? 43.059  10.151  60.884  1.00 604.06 ?  45   VAL R CB    1 
ATOM 6540  C CG1   . VAL B 2 49  ? 43.278  10.307  62.335  1.00 604.06 ?  45   VAL R CG1   1 
ATOM 6541  C CG2   . VAL B 2 49  ? 41.655  9.674   60.686  1.00 604.06 ?  45   VAL R CG2   1 
ATOM 6542  N N     . HIS B 2 50  ? 45.607  11.721  59.562  1.00 611.48 ?  46   HIS R N     1 
ATOM 6543  C CA    . HIS B 2 50  ? 46.974  12.211  59.709  1.00 611.48 ?  46   HIS R CA    1 
ATOM 6544  C C     . HIS B 2 50  ? 47.523  12.605  58.348  1.00 611.48 ?  46   HIS R C     1 
ATOM 6545  O O     . HIS B 2 50  ? 48.429  11.943  57.847  1.00 611.48 ?  46   HIS R O     1 
ATOM 6546  C CB    . HIS B 2 50  ? 47.881  11.160  60.373  1.00 611.48 ?  46   HIS R CB    1 
ATOM 6547  C CG    . HIS B 2 50  ? 47.807  11.149  61.864  1.00 611.48 ?  46   HIS R CG    1 
ATOM 6548  N ND1   . HIS B 2 50  ? 46.957  10.300  62.561  1.00 611.48 ?  46   HIS R ND1   1 
ATOM 6549  C CD2   . HIS B 2 50  ? 48.470  11.888  62.797  1.00 611.48 ?  46   HIS R CD2   1 
ATOM 6550  C CE1   . HIS B 2 50  ? 47.095  10.517  63.859  1.00 611.48 ?  46   HIS R CE1   1 
ATOM 6551  N NE2   . HIS B 2 50  ? 48.009  11.474  64.031  1.00 611.48 ?  46   HIS R NE2   1 
ATOM 6552  N N     . PRO B 2 51  ? 47.010  13.707  57.760  1.00 610.68 ?  47   PRO R N     1 
ATOM 6553  C CA    . PRO B 2 51  ? 47.301  14.121  56.370  1.00 610.68 ?  47   PRO R CA    1 
ATOM 6554  C C     . PRO B 2 51  ? 48.774  14.244  55.947  1.00 610.68 ?  47   PRO R C     1 
ATOM 6555  O O     . PRO B 2 51  ? 49.060  14.155  54.761  1.00 610.68 ?  47   PRO R O     1 
ATOM 6556  C CB    . PRO B 2 51  ? 46.605  15.466  56.252  1.00 610.68 ?  47   PRO R CB    1 
ATOM 6557  C CG    . PRO B 2 51  ? 46.438  15.924  57.665  1.00 610.68 ?  47   PRO R CG    1 
ATOM 6558  C CD    . PRO B 2 51  ? 46.119  14.675  58.412  1.00 610.68 ?  47   PRO R CD    1 
ATOM 6559  N N     . ASP B 2 52  ? 49.712  14.435  56.860  1.00 629.15 ?  48   ASP R N     1 
ATOM 6560  C CA    . ASP B 2 52  ? 51.110  14.459  56.407  1.00 629.15 ?  48   ASP R CA    1 
ATOM 6561  C C     . ASP B 2 52  ? 51.802  13.123  56.691  1.00 629.15 ?  48   ASP R C     1 
ATOM 6562  O O     . ASP B 2 52  ? 52.960  13.090  57.122  1.00 629.15 ?  48   ASP R O     1 
ATOM 6563  C CB    . ASP B 2 52  ? 51.911  15.604  57.060  1.00 629.15 ?  48   ASP R CB    1 
ATOM 6564  C CG    . ASP B 2 52  ? 51.261  16.977  56.877  1.00 629.15 ?  48   ASP R CG    1 
ATOM 6565  O OD1   . ASP B 2 52  ? 50.597  17.214  55.835  1.00 629.15 ?  48   ASP R OD1   1 
ATOM 6566  O OD2   . ASP B 2 52  ? 51.432  17.817  57.797  1.00 629.15 -1 48   ASP R OD2   1 
ATOM 6567  N N     . THR B 2 53  ? 51.089  12.020  56.474  1.00 625.04 ?  49   THR R N     1 
ATOM 6568  C CA    . THR B 2 53  ? 51.585  10.733  56.955  1.00 625.04 ?  49   THR R CA    1 
ATOM 6569  C C     . THR B 2 53  ? 51.329  9.574   56.004  1.00 625.04 ?  49   THR R C     1 
ATOM 6570  O O     . THR B 2 53  ? 50.189  9.344   55.555  1.00 625.04 ?  49   THR R O     1 
ATOM 6571  C CB    . THR B 2 53  ? 51.035  10.395  58.339  1.00 625.04 ?  49   THR R CB    1 
ATOM 6572  O OG1   . THR B 2 53  ? 50.763  11.610  59.050  1.00 625.04 ?  49   THR R OG1   1 
ATOM 6573  C CG2   . THR B 2 53  ? 52.050  9.572   59.111  1.00 625.04 ?  49   THR R CG2   1 
ATOM 6574  N N     . GLY B 2 54  ? 52.408  8.851   55.701  1.00 635.69 ?  50   GLY R N     1 
ATOM 6575  C CA    . GLY B 2 54  ? 52.344  7.729   54.766  1.00 635.69 ?  50   GLY R CA    1 
ATOM 6576  C C     . GLY B 2 54  ? 52.466  6.365   55.414  1.00 635.69 ?  50   GLY R C     1 
ATOM 6577  O O     . GLY B 2 54  ? 52.931  6.237   56.558  1.00 635.69 ?  50   GLY R O     1 
ATOM 6578  N N     . ILE B 2 55  ? 52.051  5.339   54.676  1.00 621.05 ?  51   ILE R N     1 
ATOM 6579  C CA    . ILE B 2 55  ? 52.106  3.989   55.205  1.00 621.05 ?  51   ILE R CA    1 
ATOM 6580  C C     . ILE B 2 55  ? 53.032  3.123   54.361  1.00 621.05 ?  51   ILE R C     1 
ATOM 6581  O O     . ILE B 2 55  ? 53.039  3.217   53.137  1.00 621.05 ?  51   ILE R O     1 
ATOM 6582  C CB    . ILE B 2 55  ? 50.677  3.398   55.409  1.00 621.05 ?  51   ILE R CB    1 
ATOM 6583  C CG1   . ILE B 2 55  ? 50.699  2.206   56.371  1.00 621.05 ?  51   ILE R CG1   1 
ATOM 6584  C CG2   . ILE B 2 55  ? 49.998  3.077   54.085  1.00 621.05 ?  51   ILE R CG2   1 
ATOM 6585  C CD1   . ILE B 2 55  ? 49.288  1.750   56.826  1.00 621.05 ?  51   ILE R CD1   1 
ATOM 6586  N N     . SER B 2 56  ? 53.848  2.317   55.038  1.00 605.30 ?  52   SER R N     1 
ATOM 6587  C CA    . SER B 2 56  ? 54.748  1.346   54.376  1.00 605.30 ?  52   SER R CA    1 
ATOM 6588  C C     . SER B 2 56  ? 53.995  0.161   53.833  1.00 605.30 ?  52   SER R C     1 
ATOM 6589  O O     . SER B 2 56  ? 52.959  -0.237  54.374  1.00 605.30 ?  52   SER R O     1 
ATOM 6590  C CB    . SER B 2 56  ? 55.744  0.776   55.361  1.00 605.30 ?  52   SER R CB    1 
ATOM 6591  O OG    . SER B 2 56  ? 55.135  -0.336  55.974  1.00 605.30 ?  52   SER R OG    1 
ATOM 6592  N N     . SER B 2 57  ? 54.568  -0.432  52.794  1.00 600.95 ?  53   SER R N     1 
ATOM 6593  C CA    . SER B 2 57  ? 54.068  -1.674  52.200  1.00 600.95 ?  53   SER R CA    1 
ATOM 6594  C C     . SER B 2 57  ? 53.640  -2.749  53.214  1.00 600.95 ?  53   SER R C     1 
ATOM 6595  O O     . SER B 2 57  ? 52.554  -3.313  53.087  1.00 600.95 ?  53   SER R O     1 
ATOM 6596  C CB    . SER B 2 57  ? 55.125  -2.252  51.288  1.00 600.95 ?  53   SER R CB    1 
ATOM 6597  O OG    . SER B 2 57  ? 54.511  -3.099  50.351  1.00 600.95 ?  53   SER R OG    1 
ATOM 6598  N N     . LYS B 2 58  ? 54.500  -3.027  54.199  1.00 591.06 ?  54   LYS R N     1 
ATOM 6599  C CA    . LYS B 2 58  ? 54.216  -4.004  55.237  1.00 591.06 ?  54   LYS R CA    1 
ATOM 6600  C C     . LYS B 2 58  ? 53.064  -3.556  56.126  1.00 591.06 ?  54   LYS R C     1 
ATOM 6601  O O     . LYS B 2 58  ? 52.081  -4.283  56.317  1.00 591.06 ?  54   LYS R O     1 
ATOM 6602  C CB    . LYS B 2 58  ? 55.462  -4.258  56.072  1.00 591.06 ?  54   LYS R CB    1 
ATOM 6603  C CG    . LYS B 2 58  ? 56.617  -4.961  55.306  1.00 591.06 ?  54   LYS R CG    1 
ATOM 6604  C CD    . LYS B 2 58  ? 57.828  -5.208  56.208  1.00 591.06 ?  54   LYS R CD    1 
ATOM 6605  C CE    . LYS B 2 58  ? 58.837  -6.151  55.576  1.00 591.06 ?  54   LYS R CE    1 
ATOM 6606  N NZ    . LYS B 2 58  ? 59.839  -6.586  56.625  1.00 591.06 1  54   LYS R NZ    1 
ATOM 6607  N N     . ALA B 2 59  ? 53.185  -2.338  56.657  1.00 599.35 ?  55   ALA R N     1 
ATOM 6608  C CA    . ALA B 2 59  ? 52.121  -1.694  57.424  1.00 599.35 ?  55   ALA R CA    1 
ATOM 6609  C C     . ALA B 2 59  ? 50.782  -1.771  56.704  1.00 599.35 ?  55   ALA R C     1 
ATOM 6610  O O     . ALA B 2 59  ? 49.777  -2.190  57.281  1.00 599.35 ?  55   ALA R O     1 
ATOM 6611  C CB    . ALA B 2 59  ? 52.475  -0.299  57.668  1.00 599.35 ?  55   ALA R CB    1 
ATOM 6612  N N     . MET B 2 60  ? 50.764  -1.393  55.434  1.00 608.06 ?  56   MET R N     1 
ATOM 6613  C CA    . MET B 2 60  ? 49.515  -1.492  54.700  1.00 608.06 ?  56   MET R CA    1 
ATOM 6614  C C     . MET B 2 60  ? 49.031  -2.912  54.847  1.00 608.06 ?  56   MET R C     1 
ATOM 6615  O O     . MET B 2 60  ? 47.924  -3.138  55.354  1.00 608.06 ?  56   MET R O     1 
ATOM 6616  C CB    . MET B 2 60  ? 49.689  -1.154  53.226  1.00 608.06 ?  56   MET R CB    1 
ATOM 6617  C CG    . MET B 2 60  ? 48.382  -0.901  52.481  1.00 608.06 ?  56   MET R CG    1 
ATOM 6618  S SD    . MET B 2 60  ? 47.243  0.183   53.384  1.00 608.06 ?  56   MET R SD    1 
ATOM 6619  C CE    . MET B 2 60  ? 45.837  -0.893  53.575  1.00 608.06 ?  56   MET R CE    1 
ATOM 6620  N N     . SER B 2 61  ? 49.896  -3.857  54.441  1.00 590.12 ?  57   SER R N     1 
ATOM 6621  C CA    . SER B 2 61  ? 49.583  -5.275  54.467  1.00 590.12 ?  57   SER R CA    1 
ATOM 6622  C C     . SER B 2 61  ? 48.915  -5.653  55.798  1.00 590.12 ?  57   SER R C     1 
ATOM 6623  O O     . SER B 2 61  ? 47.786  -6.121  55.805  1.00 590.12 ?  57   SER R O     1 
ATOM 6624  C CB    . SER B 2 61  ? 50.836  -6.105  54.200  1.00 590.12 ?  57   SER R CB    1 
ATOM 6625  O OG    . SER B 2 61  ? 50.558  -7.494  54.337  1.00 590.12 ?  57   SER R OG    1 
ATOM 6626  N N     . ILE B 2 62  ? 49.604  -5.384  56.908  1.00 588.62 ?  58   ILE R N     1 
ATOM 6627  C CA    . ILE B 2 62  ? 49.056  -5.582  58.246  1.00 588.17 ?  58   ILE R CA    1 
ATOM 6628  C C     . ILE B 2 62  ? 47.661  -4.999  58.395  1.00 588.10 ?  58   ILE R C     1 
ATOM 6629  O O     . ILE B 2 62  ? 46.717  -5.756  58.603  1.00 588.05 ?  58   ILE R O     1 
ATOM 6630  C CB    . ILE B 2 62  ? 49.949  -5.001  59.306  1.00 588.06 ?  58   ILE R CB    1 
ATOM 6631  C CG1   . ILE B 2 62  ? 51.259  -5.749  59.298  1.00 587.55 ?  58   ILE R CG1   1 
ATOM 6632  C CG2   . ILE B 2 62  ? 49.303  -5.150  60.686  1.00 589.49 ?  58   ILE R CG2   1 
ATOM 6633  C CD1   . ILE B 2 62  ? 52.391  -4.890  59.547  1.00 589.19 ?  58   ILE R CD1   1 
ATOM 6634  N N     . MET B 2 63  ? 47.530  -3.674  58.263  1.00 597.53 ?  59   MET R N     1 
ATOM 6635  C CA    . MET B 2 63  ? 46.212  -3.040  58.223  1.00 597.53 ?  59   MET R CA    1 
ATOM 6636  C C     . MET B 2 63  ? 45.240  -3.920  57.452  1.00 597.53 ?  59   MET R C     1 
ATOM 6637  O O     . MET B 2 63  ? 44.237  -4.421  58.008  1.00 597.53 ?  59   MET R O     1 
ATOM 6638  C CB    . MET B 2 63  ? 46.263  -1.662  57.555  1.00 597.53 ?  59   MET R CB    1 
ATOM 6639  C CG    . MET B 2 63  ? 46.670  -0.478  58.443  1.00 597.53 ?  59   MET R CG    1 
ATOM 6640  S SD    . MET B 2 63  ? 46.125  -0.618  60.155  1.00 597.53 ?  59   MET R SD    1 
ATOM 6641  C CE    . MET B 2 63  ? 44.328  -0.637  59.992  1.00 597.53 ?  59   MET R CE    1 
ATOM 6642  N N     . ASN B 2 64  ? 45.565  -4.142  56.182  1.00 590.79 ?  60   ASN R N     1 
ATOM 6643  C CA    . ASN B 2 64  ? 44.746  -5.004  55.322  1.00 589.67 ?  60   ASN R CA    1 
ATOM 6644  C C     . ASN B 2 64  ? 44.338  -6.319  55.947  1.00 589.43 ?  60   ASN R C     1 
ATOM 6645  O O     . ASN B 2 64  ? 43.239  -6.809  55.663  1.00 588.74 ?  60   ASN R O     1 
ATOM 6646  C CB    . ASN B 2 64  ? 45.387  -5.253  53.960  1.00 588.74 ?  60   ASN R CB    1 
ATOM 6647  C CG    . ASN B 2 64  ? 44.366  -5.692  52.930  1.00 587.22 ?  60   ASN R CG    1 
ATOM 6648  O OD1   . ASN B 2 64  ? 43.536  -4.903  52.495  1.00 587.47 ?  60   ASN R OD1   1 
ATOM 6649  N ND2   . ASN B 2 64  ? 44.445  -6.941  52.504  1.00 584.45 ?  60   ASN R ND2   1 
ATOM 6650  N N     . SER B 2 65  ? 45.211  -6.889  56.780  1.00 583.72 ?  61   SER R N     1 
ATOM 6651  C CA    . SER B 2 65  ? 44.872  -8.104  57.488  1.00 584.88 ?  61   SER R CA    1 
ATOM 6652  C C     . SER B 2 65  ? 43.800  -7.815  58.530  1.00 584.38 ?  61   SER R C     1 
ATOM 6653  O O     . SER B 2 65  ? 42.744  -8.429  58.540  1.00 583.33 ?  61   SER R O     1 
ATOM 6654  C CB    . SER B 2 65  ? 46.114  -8.740  58.131  1.00 585.65 ?  61   SER R CB    1 
ATOM 6655  O OG    . SER B 2 65  ? 47.063  -9.137  57.145  1.00 588.40 ?  61   SER R OG    1 
ATOM 6656  N N     . PHE B 2 66  ? 44.081  -6.826  59.368  1.00 576.96 ?  62   PHE R N     1 
ATOM 6657  C CA    . PHE B 2 66  ? 43.214  -6.428  60.485  1.00 576.87 ?  62   PHE R CA    1 
ATOM 6658  C C     . PHE B 2 66  ? 41.762  -6.227  60.042  1.00 576.68 ?  62   PHE R C     1 
ATOM 6659  O O     . PHE B 2 66  ? 40.818  -6.718  60.710  1.00 576.43 ?  62   PHE R O     1 
ATOM 6660  C CB    . PHE B 2 66  ? 43.795  -5.196  61.210  1.00 576.96 ?  62   PHE R CB    1 
ATOM 6661  C CG    . PHE B 2 66  ? 42.830  -4.534  62.140  1.00 577.40 ?  62   PHE R CG    1 
ATOM 6662  C CD1   . PHE B 2 66  ? 42.442  -5.157  63.330  1.00 579.32 ?  62   PHE R CD1   1 
ATOM 6663  C CD2   . PHE B 2 66  ? 42.271  -3.298  61.816  1.00 577.52 ?  62   PHE R CD2   1 
ATOM 6664  C CE1   . PHE B 2 66  ? 41.515  -4.563  64.177  1.00 578.71 ?  62   PHE R CE1   1 
ATOM 6665  C CE2   . PHE B 2 66  ? 41.363  -2.691  62.649  1.00 577.19 ?  62   PHE R CE2   1 
ATOM 6666  C CZ    . PHE B 2 66  ? 40.974  -3.321  63.837  1.00 577.87 ?  62   PHE R CZ    1 
ATOM 6667  N N     . VAL B 2 67  ? 41.573  -5.559  58.905  1.00 582.09 ?  63   VAL R N     1 
ATOM 6668  C CA    . VAL B 2 67  ? 40.215  -5.362  58.413  1.00 582.19 ?  63   VAL R CA    1 
ATOM 6669  C C     . VAL B 2 67  ? 39.550  -6.714  58.169  1.00 582.52 ?  63   VAL R C     1 
ATOM 6670  O O     . VAL B 2 67  ? 38.455  -7.004  58.724  1.00 582.67 ?  63   VAL R O     1 
ATOM 6671  C CB    . VAL B 2 67  ? 40.156  -4.518  57.137  1.00 582.73 ?  63   VAL R CB    1 
ATOM 6672  C CG1   . VAL B 2 67  ? 38.733  -4.380  56.692  1.00 582.71 ?  63   VAL R CG1   1 
ATOM 6673  C CG2   . VAL B 2 67  ? 40.811  -3.115  57.342  1.00 581.94 ?  63   VAL R CG2   1 
ATOM 6674  N N     . ASN B 2 68  ? 40.227  -7.565  57.379  1.00 560.66 ?  64   ASN R N     1 
ATOM 6675  C CA    . ASN B 2 68  ? 39.714  -8.921  57.110  1.00 559.90 ?  64   ASN R CA    1 
ATOM 6676  C C     . ASN B 2 68  ? 39.404  -9.781  58.397  1.00 559.91 ?  64   ASN R C     1 
ATOM 6677  O O     . ASN B 2 68  ? 38.370  -10.466 58.463  1.00 559.33 ?  64   ASN R O     1 
ATOM 6678  C CB    . ASN B 2 68  ? 40.626  -9.619  56.147  1.00 558.79 ?  64   ASN R CB    1 
ATOM 6679  C CG    . ASN B 2 68  ? 40.558  -9.031  54.742  1.00 561.06 ?  64   ASN R CG    1 
ATOM 6680  O OD1   . ASN B 2 68  ? 39.500  -9.038  54.098  1.00 562.73 ?  64   ASN R OD1   1 
ATOM 6681  N ND2   . ASN B 2 68  ? 41.701  -8.532  54.241  1.00 560.41 ?  64   ASN R ND2   1 
ATOM 6682  N N     . ASP B 2 69  ? 40.268  -9.706  59.411  1.00 572.76 ?  65   ASP R N     1 
ATOM 6683  C CA    . ASP B 2 69  ? 40.100  -10.489 60.608  1.00 573.72 ?  65   ASP R CA    1 
ATOM 6684  C C     . ASP B 2 69  ? 38.781  -10.109 61.280  1.00 574.36 ?  65   ASP R C     1 
ATOM 6685  O O     . ASP B 2 69  ? 37.896  -10.937 61.477  1.00 572.77 ?  65   ASP R O     1 
ATOM 6686  C CB    . ASP B 2 69  ? 41.296  -10.310 61.560  1.00 574.11 ?  65   ASP R CB    1 
ATOM 6687  C CG    . ASP B 2 69  ? 41.001  -10.832 63.004  1.00 575.77 ?  65   ASP R CG    1 
ATOM 6688  O OD1   . ASP B 2 69  ? 40.130  -11.727 63.136  1.00 578.09 ?  65   ASP R OD1   1 
ATOM 6689  O OD2   . ASP B 2 69  ? 41.610  -10.340 64.005  1.00 573.70 -1 65   ASP R OD2   1 
ATOM 6690  N N     . VAL B 2 70  ? 38.668  -8.815  61.582  1.00 580.60 ?  66   VAL R N     1 
ATOM 6691  C CA    . VAL B 2 70  ? 37.497  -8.214  62.232  1.00 580.48 ?  66   VAL R CA    1 
ATOM 6692  C C     . VAL B 2 70  ? 36.251  -8.357  61.378  1.00 580.04 ?  66   VAL R C     1 
ATOM 6693  O O     . VAL B 2 70  ? 35.166  -8.602  61.906  1.00 579.20 ?  66   VAL R O     1 
ATOM 6694  C CB    . VAL B 2 70  ? 37.790  -6.757  62.573  1.00 580.93 ?  66   VAL R CB    1 
ATOM 6695  C CG1   . VAL B 2 70  ? 36.519  -5.983  62.865  1.00 582.08 ?  66   VAL R CG1   1 
ATOM 6696  C CG2   . VAL B 2 70  ? 38.732  -6.710  63.753  1.00 581.77 ?  66   VAL R CG2   1 
ATOM 6697  N N     . PHE B 2 71  ? 36.404  -8.251  60.056  1.00 568.88 ?  67   PHE R N     1 
ATOM 6698  C CA    . PHE B 2 71  ? 35.294  -8.657  59.186  1.00 569.33 ?  67   PHE R CA    1 
ATOM 6699  C C     . PHE B 2 71  ? 34.741  -10.062 59.499  1.00 569.84 ?  67   PHE R C     1 
ATOM 6700  O O     . PHE B 2 71  ? 33.536  -10.187 59.733  1.00 569.91 ?  67   PHE R O     1 
ATOM 6701  C CB    . PHE B 2 71  ? 35.639  -8.574  57.707  1.00 569.06 ?  67   PHE R CB    1 
ATOM 6702  C CG    . PHE B 2 71  ? 34.465  -8.833  56.815  1.00 569.11 ?  67   PHE R CG    1 
ATOM 6703  C CD1   . PHE B 2 71  ? 33.813  -10.072 56.832  1.00 569.16 ?  67   PHE R CD1   1 
ATOM 6704  C CD2   . PHE B 2 71  ? 34.002  -7.839  55.948  1.00 569.58 ?  67   PHE R CD2   1 
ATOM 6705  C CE1   . PHE B 2 71  ? 32.715  -10.326 55.998  1.00 569.35 ?  67   PHE R CE1   1 
ATOM 6706  C CE2   . PHE B 2 71  ? 32.912  -8.076  55.103  1.00 568.86 ?  67   PHE R CE2   1 
ATOM 6707  C CZ    . PHE B 2 71  ? 32.265  -9.323  55.126  1.00 569.87 ?  67   PHE R CZ    1 
ATOM 6708  N N     . GLU B 2 72  ? 35.599  -11.106 59.485  1.00 572.75 ?  68   GLU R N     1 
ATOM 6709  C CA    . GLU B 2 72  ? 35.119  -12.467 59.726  1.00 572.87 ?  68   GLU R CA    1 
ATOM 6710  C C     . GLU B 2 72  ? 34.565  -12.565 61.119  1.00 571.96 ?  68   GLU R C     1 
ATOM 6711  O O     . GLU B 2 72  ? 33.528  -13.149 61.320  1.00 571.46 ?  68   GLU R O     1 
ATOM 6712  C CB    . GLU B 2 72  ? 36.200  -13.555 59.562  1.00 574.11 ?  68   GLU R CB    1 
ATOM 6713  C CG    . GLU B 2 72  ? 36.293  -14.253 58.180  1.00 577.34 ?  68   GLU R CG    1 
ATOM 6714  C CD    . GLU B 2 72  ? 37.600  -13.877 57.441  1.00 583.26 ?  68   GLU R CD    1 
ATOM 6715  O OE1   . GLU B 2 72  ? 38.671  -13.786 58.131  1.00 583.96 ?  68   GLU R OE1   1 
ATOM 6716  O OE2   . GLU B 2 72  ? 37.560  -13.670 56.191  1.00 583.05 -1 68   GLU R OE2   1 
ATOM 6717  N N     . ARG B 2 73  ? 35.271  -11.999 62.080  1.00 570.79 ?  69   ARG R N     1 
ATOM 6718  C CA    . ARG B 2 73  ? 34.909  -12.183 63.455  1.00 571.60 ?  69   ARG R CA    1 
ATOM 6719  C C     . ARG B 2 73  ? 33.475  -11.693 63.672  1.00 573.42 ?  69   ARG R C     1 
ATOM 6720  O O     . ARG B 2 73  ? 32.618  -12.412 64.234  1.00 573.01 ?  69   ARG R O     1 
ATOM 6721  C CB    . ARG B 2 73  ? 35.863  -11.435 64.342  1.00 571.07 ?  69   ARG R CB    1 
ATOM 6722  C CG    . ARG B 2 73  ? 37.290  -11.877 64.244  1.00 569.02 ?  69   ARG R CG    1 
ATOM 6723  C CD    . ARG B 2 73  ? 37.840  -11.898 65.633  1.00 566.73 ?  69   ARG R CD    1 
ATOM 6724  N NE    . ARG B 2 73  ? 39.136  -11.262 65.733  1.00 563.41 ?  69   ARG R NE    1 
ATOM 6725  C CZ    . ARG B 2 73  ? 39.596  -10.726 66.854  1.00 563.70 ?  69   ARG R CZ    1 
ATOM 6726  N NH1   . ARG B 2 73  ? 38.847  -10.743 67.960  1.00 563.14 1  69   ARG R NH1   1 
ATOM 6727  N NH2   . ARG B 2 73  ? 40.795  -10.165 66.872  1.00 562.33 ?  69   ARG R NH2   1 
ATOM 6728  N N     . ILE B 2 74  ? 33.226  -10.480 63.168  1.00 573.74 ?  70   ILE R N     1 
ATOM 6729  C CA    . ILE B 2 74  ? 31.916  -9.878  63.180  1.00 574.57 ?  70   ILE R CA    1 
ATOM 6730  C C     . ILE B 2 74  ? 30.942  -10.733 62.388  1.00 575.05 ?  70   ILE R C     1 
ATOM 6731  O O     . ILE B 2 74  ? 29.977  -11.278 62.959  1.00 575.54 ?  70   ILE R O     1 
ATOM 6732  C CB    . ILE B 2 74  ? 31.963  -8.409  62.664  1.00 575.30 ?  70   ILE R CB    1 
ATOM 6733  C CG1   . ILE B 2 74  ? 32.743  -7.530  63.664  1.00 574.98 ?  70   ILE R CG1   1 
ATOM 6734  C CG2   . ILE B 2 74  ? 30.535  -7.847  62.404  1.00 575.29 ?  70   ILE R CG2   1 
ATOM 6735  C CD1   . ILE B 2 74  ? 32.941  -6.110  63.220  1.00 574.18 ?  70   ILE R CD1   1 
ATOM 6736  N N     . ALA B 2 75  ? 31.213  -10.879 61.094  1.00 570.57 ?  71   ALA R N     1 
ATOM 6737  C CA    . ALA B 2 75  ? 30.316  -11.598 60.190  1.00 571.23 ?  71   ALA R CA    1 
ATOM 6738  C C     . ALA B 2 75  ? 29.931  -12.970 60.727  1.00 571.86 ?  71   ALA R C     1 
ATOM 6739  O O     . ALA B 2 75  ? 28.751  -13.313 60.749  1.00 572.69 ?  71   ALA R O     1 
ATOM 6740  C CB    . ALA B 2 75  ? 30.930  -11.715 58.806  1.00 571.04 ?  71   ALA R CB    1 
ATOM 6741  N N     . GLY B 2 76  ? 30.925  -13.743 61.164  1.00 569.07 ?  72   GLY R N     1 
ATOM 6742  C CA    . GLY B 2 76  ? 30.703  -15.048 61.770  1.00 569.91 ?  72   GLY R CA    1 
ATOM 6743  C C     . GLY B 2 76  ? 29.748  -15.020 62.948  1.00 570.70 ?  72   GLY R C     1 
ATOM 6744  O O     . GLY B 2 76  ? 28.758  -15.739 62.966  1.00 570.49 ?  72   GLY R O     1 
ATOM 6745  N N     . GLU B 2 77  ? 30.032  -14.168 63.923  1.00 574.79 ?  73   GLU R N     1 
ATOM 6746  C CA    . GLU B 2 77  ? 29.236  -14.124 65.164  1.00 575.81 ?  73   GLU R CA    1 
ATOM 6747  C C     . GLU B 2 77  ? 27.814  -13.636 64.885  1.00 576.22 ?  73   GLU R C     1 
ATOM 6748  O O     . GLU B 2 77  ? 26.864  -13.999 65.592  1.00 576.61 ?  73   GLU R O     1 
ATOM 6749  C CB    . GLU B 2 77  ? 29.933  -13.290 66.241  1.00 575.47 ?  73   GLU R CB    1 
ATOM 6750  C CG    . GLU B 2 77  ? 29.083  -13.052 67.482  1.00 578.04 ?  73   GLU R CG    1 
ATOM 6751  C CD    . GLU B 2 77  ? 28.872  -14.312 68.330  1.00 579.96 ?  73   GLU R CD    1 
ATOM 6752  O OE1   . GLU B 2 77  ? 27.723  -14.840 68.354  1.00 577.25 ?  73   GLU R OE1   1 
ATOM 6753  O OE2   . GLU B 2 77  ? 29.868  -14.758 68.968  1.00 581.30 -1 73   GLU R OE2   1 
ATOM 6754  N N     . ALA B 2 78  ? 27.663  -12.852 63.822  1.00 577.38 ?  74   ALA R N     1 
ATOM 6755  C CA    . ALA B 2 78  ? 26.338  -12.455 63.371  1.00 578.08 ?  74   ALA R CA    1 
ATOM 6756  C C     . ALA B 2 78  ? 25.598  -13.682 62.849  1.00 578.71 ?  74   ALA R C     1 
ATOM 6757  O O     . ALA B 2 78  ? 24.442  -13.951 63.222  1.00 578.37 ?  74   ALA R O     1 
ATOM 6758  C CB    . ALA B 2 78  ? 26.446  -11.401 62.288  1.00 577.82 ?  74   ALA R CB    1 
ATOM 6759  N N     . SER B 2 79  ? 26.299  -14.425 61.991  1.00 560.71 ?  75   SER R N     1 
ATOM 6760  C CA    . SER B 2 79  ? 25.811  -15.687 61.429  1.00 561.27 ?  75   SER R CA    1 
ATOM 6761  C C     . SER B 2 79  ? 25.316  -16.686 62.478  1.00 561.31 ?  75   SER R C     1 
ATOM 6762  O O     . SER B 2 79  ? 24.254  -17.293 62.303  1.00 561.29 ?  75   SER R O     1 
ATOM 6763  C CB    . SER B 2 79  ? 26.889  -16.332 60.578  1.00 560.89 ?  75   SER R CB    1 
ATOM 6764  O OG    . SER B 2 79  ? 26.301  -17.342 59.803  1.00 561.79 ?  75   SER R OG    1 
ATOM 6765  N N     . ARG B 2 80  ? 26.079  -16.851 63.555  1.00 561.42 ?  76   ARG R N     1 
ATOM 6766  C CA    . ARG B 2 80  ? 25.624  -17.643 64.691  1.00 562.22 ?  76   ARG R CA    1 
ATOM 6767  C C     . ARG B 2 80  ? 24.311  -17.130 65.259  1.00 562.81 ?  76   ARG R C     1 
ATOM 6768  O O     . ARG B 2 80  ? 23.435  -17.934 65.564  1.00 563.01 ?  76   ARG R O     1 
ATOM 6769  C CB    . ARG B 2 80  ? 26.680  -17.700 65.791  1.00 562.22 ?  76   ARG R CB    1 
ATOM 6770  C CG    . ARG B 2 80  ? 27.446  -19.012 65.868  1.00 562.10 ?  76   ARG R CG    1 
ATOM 6771  C CD    . ARG B 2 80  ? 28.793  -18.817 66.527  1.00 561.99 ?  76   ARG R CD    1 
ATOM 6772  N NE    . ARG B 2 80  ? 29.774  -18.287 65.579  1.00 562.31 ?  76   ARG R NE    1 
ATOM 6773  C CZ    . ARG B 2 80  ? 30.783  -17.489 65.917  1.00 562.28 ?  76   ARG R CZ    1 
ATOM 6774  N NH1   . ARG B 2 80  ? 30.945  -17.112 67.183  1.00 563.05 1  76   ARG R NH1   1 
ATOM 6775  N NH2   . ARG B 2 80  ? 31.630  -17.063 64.988  1.00 562.31 ?  76   ARG R NH2   1 
ATOM 6776  N N     . LEU B 2 81  ? 24.173  -15.802 65.376  1.00 582.87 ?  77   LEU R N     1 
ATOM 6777  C CA    . LEU B 2 81  ? 22.959  -15.171 65.932  1.00 583.17 ?  77   LEU R CA    1 
ATOM 6778  C C     . LEU B 2 81  ? 21.712  -15.388 65.081  1.00 583.60 ?  77   LEU R C     1 
ATOM 6779  O O     . LEU B 2 81  ? 20.634  -15.718 65.602  1.00 583.55 ?  77   LEU R O     1 
ATOM 6780  C CB    . LEU B 2 81  ? 23.175  -13.674 66.156  1.00 583.25 ?  77   LEU R CB    1 
ATOM 6781  C CG    . LEU B 2 81  ? 23.773  -13.274 67.510  1.00 582.86 ?  77   LEU R CG    1 
ATOM 6782  C CD1   . LEU B 2 81  ? 24.628  -12.031 67.360  1.00 582.03 ?  77   LEU R CD1   1 
ATOM 6783  C CD2   . LEU B 2 81  ? 22.698  -13.074 68.540  1.00 580.08 ?  77   LEU R CD2   1 
ATOM 6784  N N     . ALA B 2 82  ? 21.850  -15.197 63.773  1.00 564.02 ?  78   ALA R N     1 
ATOM 6785  C CA    . ALA B 2 82  ? 20.790  -15.613 62.865  1.00 564.58 ?  78   ALA R CA    1 
ATOM 6786  C C     . ALA B 2 82  ? 20.396  -17.054 63.195  1.00 565.21 ?  78   ALA R C     1 
ATOM 6787  O O     . ALA B 2 82  ? 19.239  -17.309 63.573  1.00 565.24 ?  78   ALA R O     1 
ATOM 6788  C CB    . ALA B 2 82  ? 21.236  -15.490 61.425  1.00 564.49 ?  78   ALA R CB    1 
ATOM 6789  N N     . HIS B 2 83  ? 21.372  -17.972 63.093  1.00 570.45 ?  79   HIS R N     1 
ATOM 6790  C CA    . HIS B 2 83  ? 21.141  -19.402 63.308  1.00 570.97 ?  79   HIS R CA    1 
ATOM 6791  C C     . HIS B 2 83  ? 20.478  -19.714 64.630  1.00 571.01 ?  79   HIS R C     1 
ATOM 6792  O O     . HIS B 2 83  ? 19.497  -20.440 64.657  1.00 571.07 ?  79   HIS R O     1 
ATOM 6793  C CB    . HIS B 2 83  ? 22.426  -20.219 63.166  1.00 571.13 ?  79   HIS R CB    1 
ATOM 6794  C CG    . HIS B 2 83  ? 22.762  -20.562 61.746  1.00 572.76 ?  79   HIS R CG    1 
ATOM 6795  N ND1   . HIS B 2 83  ? 23.729  -19.889 61.026  1.00 573.07 ?  79   HIS R ND1   1 
ATOM 6796  C CD2   . HIS B 2 83  ? 22.238  -21.484 60.902  1.00 573.69 ?  79   HIS R CD2   1 
ATOM 6797  C CE1   . HIS B 2 83  ? 23.792  -20.386 59.804  1.00 572.67 ?  79   HIS R CE1   1 
ATOM 6798  N NE2   . HIS B 2 83  ? 22.897  -21.352 59.701  1.00 573.65 ?  79   HIS R NE2   1 
ATOM 6799  N N     . TYR B 2 84  ? 20.996  -19.150 65.717  1.00 562.07 ?  80   TYR R N     1 
ATOM 6800  C CA    . TYR B 2 84  ? 20.521  -19.483 67.059  1.00 562.22 ?  80   TYR R CA    1 
ATOM 6801  C C     . TYR B 2 84  ? 19.064  -19.141 67.229  1.00 562.56 ?  80   TYR R C     1 
ATOM 6802  O O     . TYR B 2 84  ? 18.384  -19.710 68.080  1.00 562.16 ?  80   TYR R O     1 
ATOM 6803  C CB    . TYR B 2 84  ? 21.311  -18.728 68.119  1.00 562.04 ?  80   TYR R CB    1 
ATOM 6804  C CG    . TYR B 2 84  ? 22.760  -19.134 68.267  1.00 562.29 ?  80   TYR R CG    1 
ATOM 6805  C CD1   . TYR B 2 84  ? 23.211  -20.404 67.892  1.00 561.53 ?  80   TYR R CD1   1 
ATOM 6806  C CD2   . TYR B 2 84  ? 23.684  -18.245 68.816  1.00 562.33 ?  80   TYR R CD2   1 
ATOM 6807  C CE1   . TYR B 2 84  ? 24.549  -20.762 68.051  1.00 561.40 ?  80   TYR R CE1   1 
ATOM 6808  C CE2   . TYR B 2 84  ? 25.015  -18.602 68.981  1.00 561.49 ?  80   TYR R CE2   1 
ATOM 6809  C CZ    . TYR B 2 84  ? 25.440  -19.852 68.600  1.00 561.25 ?  80   TYR R CZ    1 
ATOM 6810  O OH    . TYR B 2 84  ? 26.762  -20.177 68.769  1.00 561.50 ?  80   TYR R OH    1 
ATOM 6811  N N     . ASN B 2 85  ? 18.609  -18.196 66.410  1.00 571.60 ?  81   ASN R N     1 
ATOM 6812  C CA    . ASN B 2 85  ? 17.261  -17.649 66.488  1.00 572.43 ?  81   ASN R CA    1 
ATOM 6813  C C     . ASN B 2 85  ? 16.414  -18.075 65.302  1.00 572.77 ?  81   ASN R C     1 
ATOM 6814  O O     . ASN B 2 85  ? 15.544  -17.335 64.841  1.00 572.88 ?  81   ASN R O     1 
ATOM 6815  C CB    . ASN B 2 85  ? 17.329  -16.120 66.558  1.00 572.62 ?  81   ASN R CB    1 
ATOM 6816  C CG    . ASN B 2 85  ? 17.876  -15.620 67.880  1.00 573.10 ?  81   ASN R CG    1 
ATOM 6817  O OD1   . ASN B 2 85  ? 17.174  -15.605 68.892  1.00 572.86 ?  81   ASN R OD1   1 
ATOM 6818  N ND2   . ASN B 2 85  ? 19.137  -15.195 67.876  1.00 574.13 ?  81   ASN R ND2   1 
ATOM 6819  N N     . LYS B 2 86  ? 16.683  -19.280 64.809  1.00 547.91 ?  82   LYS R N     1 
ATOM 6820  C CA    . LYS B 2 86  ? 16.050  -19.800 63.601  1.00 548.29 ?  82   LYS R CA    1 
ATOM 6821  C C     . LYS B 2 86  ? 15.713  -18.687 62.595  1.00 548.47 ?  82   LYS R C     1 
ATOM 6822  O O     . LYS B 2 86  ? 14.552  -18.468 62.251  1.00 548.56 ?  82   LYS R O     1 
ATOM 6823  C CB    . LYS B 2 86  ? 14.817  -20.635 63.958  1.00 548.20 ?  82   LYS R CB    1 
ATOM 6824  C CG    . LYS B 2 86  ? 15.133  -22.040 64.451  1.00 548.37 ?  82   LYS R CG    1 
ATOM 6825  C CD    . LYS B 2 86  ? 15.023  -22.154 65.961  1.00 549.32 ?  82   LYS R CD    1 
ATOM 6826  C CE    . LYS B 2 86  ? 13.574  -22.395 66.395  1.00 550.81 ?  82   LYS R CE    1 
ATOM 6827  N NZ    . LYS B 2 86  ? 13.458  -22.851 67.811  1.00 551.60 1  82   LYS R NZ    1 
ATOM 6828  N N     . ARG B 2 87  ? 16.738  -17.982 62.129  1.00 580.33 ?  83   ARG R N     1 
ATOM 6829  C CA    . ARG B 2 87  ? 16.506  -16.847 61.251  1.00 580.79 ?  83   ARG R CA    1 
ATOM 6830  C C     . ARG B 2 87  ? 17.378  -16.884 59.986  1.00 580.24 ?  83   ARG R C     1 
ATOM 6831  O O     . ARG B 2 87  ? 18.574  -17.163 60.054  1.00 580.50 ?  83   ARG R O     1 
ATOM 6832  C CB    . ARG B 2 87  ? 16.712  -15.563 62.045  1.00 581.32 ?  83   ARG R CB    1 
ATOM 6833  C CG    . ARG B 2 87  ? 15.905  -14.388 61.557  1.00 583.76 ?  83   ARG R CG    1 
ATOM 6834  C CD    . ARG B 2 87  ? 14.414  -14.616 61.733  1.00 587.62 ?  83   ARG R CD    1 
ATOM 6835  N NE    . ARG B 2 87  ? 13.757  -13.362 62.089  1.00 591.08 ?  83   ARG R NE    1 
ATOM 6836  C CZ    . ARG B 2 87  ? 13.392  -13.033 63.328  1.00 591.81 ?  83   ARG R CZ    1 
ATOM 6837  N NH1   . ARG B 2 87  ? 13.598  -13.886 64.332  1.00 592.18 1  83   ARG R NH1   1 
ATOM 6838  N NH2   . ARG B 2 87  ? 12.810  -11.860 63.560  1.00 591.49 ?  83   ARG R NH2   1 
ATOM 6839  N N     . SER B 2 88  ? 16.770  -16.600 58.838  1.00 591.86 ?  84   SER R N     1 
ATOM 6840  C CA    . SER B 2 88  ? 17.401  -16.837 57.535  1.00 591.57 ?  84   SER R CA    1 
ATOM 6841  C C     . SER B 2 88  ? 18.248  -15.684 57.019  1.00 591.33 ?  84   SER R C     1 
ATOM 6842  O O     . SER B 2 88  ? 18.783  -15.743 55.895  1.00 591.32 ?  84   SER R O     1 
ATOM 6843  C CB    . SER B 2 88  ? 16.337  -17.138 56.479  1.00 591.59 ?  84   SER R CB    1 
ATOM 6844  O OG    . SER B 2 88  ? 15.305  -17.963 56.989  1.00 593.08 ?  84   SER R OG    1 
ATOM 6845  N N     . THR B 2 89  ? 18.357  -14.622 57.813  1.00 597.26 ?  85   THR R N     1 
ATOM 6846  C CA    . THR B 2 89  ? 18.886  -13.362 57.284  1.00 596.58 ?  85   THR R CA    1 
ATOM 6847  C C     . THR B 2 89  ? 19.670  -12.533 58.301  1.00 596.13 ?  85   THR R C     1 
ATOM 6848  O O     . THR B 2 89  ? 19.254  -12.388 59.458  1.00 596.14 ?  85   THR R O     1 
ATOM 6849  C CB    . THR B 2 89  ? 17.769  -12.536 56.560  1.00 596.56 ?  85   THR R CB    1 
ATOM 6850  O OG1   . THR B 2 89  ? 18.299  -11.289 56.087  1.00 597.50 ?  85   THR R OG1   1 
ATOM 6851  C CG2   . THR B 2 89  ? 16.561  -12.297 57.456  1.00 595.44 ?  85   THR R CG2   1 
ATOM 6852  N N     . ILE B 2 90  ? 20.829  -12.037 57.860  1.00 592.88 ?  86   ILE R N     1 
ATOM 6853  C CA    . ILE B 2 90  ? 21.673  -11.171 58.675  1.00 592.88 ?  86   ILE R CA    1 
ATOM 6854  C C     . ILE B 2 90  ? 21.341  -9.720  58.346  1.00 592.88 ?  86   ILE R C     1 
ATOM 6855  O O     . ILE B 2 90  ? 21.703  -9.218  57.269  1.00 592.88 ?  86   ILE R O     1 
ATOM 6856  C CB    . ILE B 2 90  ? 23.194  -11.395 58.438  1.00 592.88 ?  86   ILE R CB    1 
ATOM 6857  C CG1   . ILE B 2 90  ? 23.596  -12.858 58.664  1.00 592.88 ?  86   ILE R CG1   1 
ATOM 6858  C CG2   . ILE B 2 90  ? 24.024  -10.453 59.326  1.00 592.88 ?  86   ILE R CG2   1 
ATOM 6859  C CD1   . ILE B 2 90  ? 25.102  -13.087 58.698  1.00 592.88 ?  86   ILE R CD1   1 
ATOM 6860  N N     . THR B 2 91  ? 20.652  -9.067  59.280  1.00 568.95 ?  87   THR R N     1 
ATOM 6861  C CA    . THR B 2 91  ? 20.319  -7.644  59.202  1.00 568.95 ?  87   THR R CA    1 
ATOM 6862  C C     . THR B 2 91  ? 21.220  -6.923  60.173  1.00 568.95 ?  87   THR R C     1 
ATOM 6863  O O     . THR B 2 91  ? 21.751  -7.541  61.091  1.00 568.95 ?  87   THR R O     1 
ATOM 6864  C CB    . THR B 2 91  ? 18.904  -7.391  59.678  1.00 568.95 ?  87   THR R CB    1 
ATOM 6865  O OG1   . THR B 2 91  ? 18.818  -7.746  61.065  1.00 568.95 ?  87   THR R OG1   1 
ATOM 6866  C CG2   . THR B 2 91  ? 17.923  -8.238  58.891  1.00 568.95 ?  87   THR R CG2   1 
ATOM 6867  N N     . SER B 2 92  ? 21.366  -5.615  60.003  1.00 562.57 ?  88   SER R N     1 
ATOM 6868  C CA    . SER B 2 92  ? 22.202  -4.824  60.905  1.00 561.53 ?  88   SER R CA    1 
ATOM 6869  C C     . SER B 2 92  ? 21.860  -4.956  62.399  1.00 560.75 ?  88   SER R C     1 
ATOM 6870  O O     . SER B 2 92  ? 22.683  -4.620  63.248  1.00 560.51 ?  88   SER R O     1 
ATOM 6871  C CB    . SER B 2 92  ? 22.261  -3.355  60.477  1.00 561.56 ?  88   SER R CB    1 
ATOM 6872  O OG    . SER B 2 92  ? 21.074  -2.944  59.824  1.00 561.56 ?  88   SER R OG    1 
ATOM 6873  N N     . ARG B 2 93  ? 20.686  -5.473  62.731  1.00 564.02 ?  89   ARG R N     1 
ATOM 6874  C CA    . ARG B 2 93  ? 20.424  -5.771  64.134  1.00 563.60 ?  89   ARG R CA    1 
ATOM 6875  C C     . ARG B 2 93  ? 21.436  -6.812  64.627  1.00 563.36 ?  89   ARG R C     1 
ATOM 6876  O O     . ARG B 2 93  ? 22.051  -6.625  65.683  1.00 563.51 ?  89   ARG R O     1 
ATOM 6877  C CB    . ARG B 2 93  ? 18.989  -6.223  64.365  1.00 563.60 ?  89   ARG R CB    1 
ATOM 6878  C CG    . ARG B 2 93  ? 18.651  -6.320  65.840  1.00 564.78 ?  89   ARG R CG    1 
ATOM 6879  C CD    . ARG B 2 93  ? 17.325  -7.026  66.100  1.00 567.03 ?  89   ARG R CD    1 
ATOM 6880  N NE    . ARG B 2 93  ? 16.860  -6.749  67.459  1.00 569.35 ?  89   ARG R NE    1 
ATOM 6881  C CZ    . ARG B 2 93  ? 16.795  -7.644  68.440  1.00 570.92 ?  89   ARG R CZ    1 
ATOM 6882  N NH1   . ARG B 2 93  ? 17.149  -8.902  68.221  1.00 572.73 1  89   ARG R NH1   1 
ATOM 6883  N NH2   . ARG B 2 93  ? 16.367  -7.284  69.644  1.00 571.14 ?  89   ARG R NH2   1 
ATOM 6884  N N     . GLU B 2 94  ? 21.612  -7.881  63.834  1.00 565.24 ?  90   GLU R N     1 
ATOM 6885  C CA    . GLU B 2 94  ? 22.648  -8.921  64.018  1.00 565.24 ?  90   GLU R CA    1 
ATOM 6886  C C     . GLU B 2 94  ? 24.060  -8.350  64.101  1.00 565.24 ?  90   GLU R C     1 
ATOM 6887  O O     . GLU B 2 94  ? 24.751  -8.564  65.102  1.00 565.24 ?  90   GLU R O     1 
ATOM 6888  C CB    . GLU B 2 94  ? 22.614  -9.917  62.851  1.00 565.24 ?  90   GLU R CB    1 
ATOM 6889  C CG    . GLU B 2 94  ? 21.563  -11.002 62.948  1.00 565.24 ?  90   GLU R CG    1 
ATOM 6890  C CD    . GLU B 2 94  ? 20.152  -10.458 63.013  1.00 565.24 ?  90   GLU R CD    1 
ATOM 6891  O OE1   . GLU B 2 94  ? 19.695  -9.863  62.005  1.00 565.24 ?  90   GLU R OE1   1 
ATOM 6892  O OE2   . GLU B 2 94  ? 19.512  -10.631 64.081  1.00 565.24 -1 90   GLU R OE2   1 
ATOM 6893  N N     . ILE B 2 95  ? 24.477  -7.640  63.046  1.00 567.03 ?  91   ILE R N     1 
ATOM 6894  C CA    . ILE B 2 95  ? 25.788  -6.985  62.988  1.00 567.03 ?  91   ILE R CA    1 
ATOM 6895  C C     . ILE B 2 95  ? 26.007  -6.101  64.199  1.00 567.03 ?  91   ILE R C     1 
ATOM 6896  O O     . ILE B 2 95  ? 27.104  -6.011  64.731  1.00 567.03 ?  91   ILE R O     1 
ATOM 6897  C CB    . ILE B 2 95  ? 25.936  -6.117  61.719  1.00 567.03 ?  91   ILE R CB    1 
ATOM 6898  C CG1   . ILE B 2 95  ? 25.844  -6.989  60.455  1.00 567.03 ?  91   ILE R CG1   1 
ATOM 6899  C CG2   . ILE B 2 95  ? 27.207  -5.261  61.775  1.00 567.03 ?  91   ILE R CG2   1 
ATOM 6900  C CD1   . ILE B 2 95  ? 27.161  -7.399  59.837  1.00 567.03 ?  91   ILE R CD1   1 
ATOM 6901  N N     . GLN B 2 96  ? 24.955  -5.441  64.646  1.00 579.54 ?  92   GLN R N     1 
ATOM 6902  C CA    . GLN B 2 96  ? 25.065  -4.725  65.903  1.00 579.54 ?  92   GLN R CA    1 
ATOM 6903  C C     . GLN B 2 96  ? 25.355  -5.634  67.062  1.00 579.54 ?  92   GLN R C     1 
ATOM 6904  O O     . GLN B 2 96  ? 26.396  -5.493  67.681  1.00 579.54 ?  92   GLN R O     1 
ATOM 6905  C CB    . GLN B 2 96  ? 23.822  -3.933  66.240  1.00 579.54 ?  92   GLN R CB    1 
ATOM 6906  C CG    . GLN B 2 96  ? 23.942  -3.177  67.563  1.00 579.54 ?  92   GLN R CG    1 
ATOM 6907  C CD    . GLN B 2 96  ? 22.967  -2.059  67.604  1.00 579.54 ?  92   GLN R CD    1 
ATOM 6908  O OE1   . GLN B 2 96  ? 21.929  -2.149  68.264  1.00 579.54 ?  92   GLN R OE1   1 
ATOM 6909  N NE2   . GLN B 2 96  ? 23.249  -1.013  66.844  1.00 579.54 ?  92   GLN R NE2   1 
ATOM 6910  N N     . THR B 2 97  ? 24.453  -6.547  67.390  1.00 553.77 ?  93   THR R N     1 
ATOM 6911  C CA    . THR B 2 97  ? 24.676  -7.307  68.623  1.00 553.77 ?  93   THR R CA    1 
ATOM 6912  C C     . THR B 2 97  ? 25.948  -8.135  68.562  1.00 553.77 ?  93   THR R C     1 
ATOM 6913  O O     . THR B 2 97  ? 26.636  -8.280  69.581  1.00 553.77 ?  93   THR R O     1 
ATOM 6914  C CB    . THR B 2 97  ? 23.493  -8.167  69.068  1.00 553.77 ?  93   THR R CB    1 
ATOM 6915  O OG1   . THR B 2 97  ? 23.994  -9.167  69.965  1.00 553.77 ?  93   THR R OG1   1 
ATOM 6916  C CG2   . THR B 2 97  ? 22.837  -8.821  67.891  1.00 553.77 ?  93   THR R CG2   1 
ATOM 6917  N N     . ALA B 2 98  ? 26.266  -8.635  67.362  1.00 563.54 ?  94   ALA R N     1 
ATOM 6918  C CA    . ALA B 2 98  ? 27.600  -9.182  67.049  1.00 563.54 ?  94   ALA R CA    1 
ATOM 6919  C C     . ALA B 2 98  ? 28.693  -8.290  67.606  1.00 563.54 ?  94   ALA R C     1 
ATOM 6920  O O     . ALA B 2 98  ? 29.612  -8.752  68.275  1.00 563.54 ?  94   ALA R O     1 
ATOM 6921  C CB    . ALA B 2 98  ? 27.778  -9.302  65.573  1.00 563.54 ?  94   ALA R CB    1 
ATOM 6922  N N     . VAL B 2 99  ? 28.566  -6.999  67.352  1.00 560.74 ?  95   VAL R N     1 
ATOM 6923  C CA    . VAL B 2 99  ? 29.546  -6.021  67.795  1.00 561.48 ?  95   VAL R CA    1 
ATOM 6924  C C     . VAL B 2 99  ? 29.622  -5.937  69.315  1.00 562.37 ?  95   VAL R C     1 
ATOM 6925  O O     . VAL B 2 99  ? 30.721  -5.768  69.890  1.00 562.51 ?  95   VAL R O     1 
ATOM 6926  C CB    . VAL B 2 99  ? 29.249  -4.660  67.165  1.00 561.19 ?  95   VAL R CB    1 
ATOM 6927  C CG1   . VAL B 2 99  ? 29.489  -3.541  68.142  1.00 561.34 ?  95   VAL R CG1   1 
ATOM 6928  C CG2   . VAL B 2 99  ? 30.077  -4.476  65.873  1.00 561.84 ?  95   VAL R CG2   1 
ATOM 6929  N N     . ARG B 2 100 ? 28.470  -6.091  69.971  1.00 557.70 ?  96   ARG R N     1 
ATOM 6930  C CA    . ARG B 2 100 ? 28.428  -5.963  71.421  1.00 558.48 ?  96   ARG R CA    1 
ATOM 6931  C C     . ARG B 2 100 ? 29.065  -7.139  72.139  1.00 557.78 ?  96   ARG R C     1 
ATOM 6932  O O     . ARG B 2 100 ? 29.436  -7.022  73.310  1.00 557.64 ?  96   ARG R O     1 
ATOM 6933  C CB    . ARG B 2 100 ? 27.003  -5.687  71.936  1.00 559.63 ?  96   ARG R CB    1 
ATOM 6934  C CG    . ARG B 2 100 ? 26.498  -4.267  71.596  1.00 563.02 ?  96   ARG R CG    1 
ATOM 6935  C CD    . ARG B 2 100 ? 25.425  -3.802  72.580  1.00 568.11 ?  96   ARG R CD    1 
ATOM 6936  N NE    . ARG B 2 100 ? 25.563  -2.381  72.947  1.00 571.93 ?  96   ARG R NE    1 
ATOM 6937  C CZ    . ARG B 2 100 ? 24.942  -1.363  72.336  1.00 574.26 ?  96   ARG R CZ    1 
ATOM 6938  N NH1   . ARG B 2 100 ? 24.136  -1.578  71.295  1.00 574.68 1  96   ARG R NH1   1 
ATOM 6939  N NH2   . ARG B 2 100 ? 25.126  -0.114  72.770  1.00 574.85 ?  96   ARG R NH2   1 
ATOM 6940  N N     . LEU B 2 101 ? 29.200  -8.265  71.433  1.00 582.56 ?  97   LEU R N     1 
ATOM 6941  C CA    . LEU B 2 101 ? 29.905  -9.445  71.961  1.00 582.56 ?  97   LEU R CA    1 
ATOM 6942  C C     . LEU B 2 101 ? 31.413  -9.369  71.686  1.00 582.56 ?  97   LEU R C     1 
ATOM 6943  O O     . LEU B 2 101 ? 32.233  -9.566  72.586  1.00 582.56 ?  97   LEU R O     1 
ATOM 6944  C CB    . LEU B 2 101 ? 29.314  -10.707 71.366  1.00 582.56 ?  97   LEU R CB    1 
ATOM 6945  C CG    . LEU B 2 101 ? 27.843  -10.985 71.663  1.00 582.56 ?  97   LEU R CG    1 
ATOM 6946  C CD1   . LEU B 2 101 ? 27.308  -11.831 70.548  1.00 582.56 ?  97   LEU R CD1   1 
ATOM 6947  C CD2   . LEU B 2 101 ? 27.549  -11.634 73.064  1.00 582.56 ?  97   LEU R CD2   1 
ATOM 6948  N N     . LEU B 2 102 ? 31.761  -9.049  70.446  1.00 573.54 ?  98   LEU R N     1 
ATOM 6949  C CA    . LEU B 2 102 ? 33.146  -8.976  69.997  1.00 574.62 ?  98   LEU R CA    1 
ATOM 6950  C C     . LEU B 2 102 ? 34.069  -7.934  70.598  1.00 575.12 ?  98   LEU R C     1 
ATOM 6951  O O     . LEU B 2 102 ? 35.190  -8.251  70.983  1.00 575.27 ?  98   LEU R O     1 
ATOM 6952  C CB    . LEU B 2 102 ? 33.164  -8.768  68.499  1.00 574.87 ?  98   LEU R CB    1 
ATOM 6953  C CG    . LEU B 2 102 ? 33.643  -10.024 67.818  1.00 576.00 ?  98   LEU R CG    1 
ATOM 6954  C CD1   . LEU B 2 102 ? 32.576  -10.483 66.818  1.00 575.82 ?  98   LEU R CD1   1 
ATOM 6955  C CD2   . LEU B 2 102 ? 35.029  -9.736  67.210  1.00 575.20 ?  98   LEU R CD2   1 
ATOM 6956  N N     . LEU B 2 103 ? 33.617  -6.679  70.619  1.00 561.95 ?  99   LEU R N     1 
ATOM 6957  C CA    . LEU B 2 103 ? 34.469  -5.545  70.993  1.00 562.36 ?  99   LEU R CA    1 
ATOM 6958  C C     . LEU B 2 103 ? 34.471  -5.275  72.500  1.00 562.90 ?  99   LEU R C     1 
ATOM 6959  O O     . LEU B 2 103 ? 33.512  -5.629  73.205  1.00 563.18 ?  99   LEU R O     1 
ATOM 6960  C CB    . LEU B 2 103 ? 34.063  -4.298  70.203  1.00 562.31 ?  99   LEU R CB    1 
ATOM 6961  C CG    . LEU B 2 103 ? 33.850  -4.359  68.679  1.00 563.32 ?  99   LEU R CG    1 
ATOM 6962  C CD1   . LEU B 2 103 ? 34.299  -3.056  68.014  1.00 563.95 ?  99   LEU R CD1   1 
ATOM 6963  C CD2   . LEU B 2 103 ? 34.623  -5.491  68.037  1.00 565.52 ?  99   LEU R CD2   1 
ATOM 6964  N N     . PRO B 2 104 ? 35.572  -4.704  73.017  1.00 583.03 ?  100  PRO R N     1 
ATOM 6965  C CA    . PRO B 2 104 ? 35.533  -4.187  74.389  1.00 583.60 ?  100  PRO R CA    1 
ATOM 6966  C C     . PRO B 2 104 ? 34.802  -2.824  74.483  1.00 584.58 ?  100  PRO R C     1 
ATOM 6967  O O     . PRO B 2 104 ? 34.750  -2.062  73.498  1.00 584.81 ?  100  PRO R O     1 
ATOM 6968  C CB    . PRO B 2 104 ? 37.003  -4.070  74.764  1.00 583.28 ?  100  PRO R CB    1 
ATOM 6969  C CG    . PRO B 2 104 ? 37.734  -3.895  73.442  1.00 583.48 ?  100  PRO R CG    1 
ATOM 6970  C CD    . PRO B 2 104 ? 36.891  -4.529  72.377  1.00 583.26 ?  100  PRO R CD    1 
ATOM 6971  N N     . GLY B 2 105 ? 34.234  -2.540  75.658  1.00 593.42 ?  101  GLY R N     1 
ATOM 6972  C CA    . GLY B 2 105 ? 33.405  -1.329  75.922  1.00 593.82 ?  101  GLY R CA    1 
ATOM 6973  C C     . GLY B 2 105 ? 33.527  -0.064  75.072  1.00 593.76 ?  101  GLY R C     1 
ATOM 6974  O O     . GLY B 2 105 ? 32.765  0.144   74.130  1.00 593.79 ?  101  GLY R O     1 
ATOM 6975  N N     . GLU B 2 106 ? 34.467  0.806   75.403  1.00 593.75 ?  102  GLU R N     1 
ATOM 6976  C CA    . GLU B 2 106 ? 34.510  2.090   74.727  1.00 594.42 ?  102  GLU R CA    1 
ATOM 6977  C C     . GLU B 2 106 ? 34.539  1.915   73.212  1.00 594.05 ?  102  GLU R C     1 
ATOM 6978  O O     . GLU B 2 106 ? 33.825  2.597   72.478  1.00 593.76 ?  102  GLU R O     1 
ATOM 6979  C CB    . GLU B 2 106 ? 35.671  2.955   75.229  1.00 594.91 ?  102  GLU R CB    1 
ATOM 6980  C CG    . GLU B 2 106 ? 35.210  4.365   75.694  1.00 597.41 ?  102  GLU R CG    1 
ATOM 6981  C CD    . GLU B 2 106 ? 34.336  4.318   76.963  1.00 600.08 ?  102  GLU R CD    1 
ATOM 6982  O OE1   . GLU B 2 106 ? 33.328  3.569   77.007  1.00 599.94 ?  102  GLU R OE1   1 
ATOM 6983  O OE2   . GLU B 2 106 ? 34.671  5.033   77.932  1.00 603.28 -1 102  GLU R OE2   1 
ATOM 6984  N N     . LEU B 2 107 ? 35.335  0.951   72.766  1.00 599.50 ?  103  LEU R N     1 
ATOM 6985  C CA    . LEU B 2 107 ? 35.400  0.572   71.367  1.00 599.03 ?  103  LEU R CA    1 
ATOM 6986  C C     . LEU B 2 107 ? 34.005  0.165   70.861  1.00 599.11 ?  103  LEU R C     1 
ATOM 6987  O O     . LEU B 2 107 ? 33.514  0.725   69.867  1.00 599.09 ?  103  LEU R O     1 
ATOM 6988  C CB    . LEU B 2 107 ? 36.442  -0.539  71.192  1.00 598.89 ?  103  LEU R CB    1 
ATOM 6989  C CG    . LEU B 2 107 ? 37.507  -0.401  70.088  1.00 599.20 ?  103  LEU R CG    1 
ATOM 6990  C CD1   . LEU B 2 107 ? 38.036  1.026   69.910  1.00 596.95 ?  103  LEU R CD1   1 
ATOM 6991  C CD2   . LEU B 2 107 ? 38.675  -1.372  70.328  1.00 598.89 ?  103  LEU R CD2   1 
ATOM 6992  N N     . ALA B 2 108 ? 33.348  -0.761  71.567  1.00 595.39 ?  104  ALA R N     1 
ATOM 6993  C CA    . ALA B 2 108 ? 32.019  -1.232  71.182  1.00 595.14 ?  104  ALA R CA    1 
ATOM 6994  C C     . ALA B 2 108 ? 31.025  -0.075  71.072  1.00 595.48 ?  104  ALA R C     1 
ATOM 6995  O O     . ALA B 2 108 ? 30.429  0.144   70.006  1.00 595.35 ?  104  ALA R O     1 
ATOM 6996  C CB    . ALA B 2 108 ? 31.515  -2.276  72.168  1.00 595.04 ?  104  ALA R CB    1 
ATOM 6997  N N     . LYS B 2 109 ? 30.875  0.675   72.167  1.00 585.63 ?  105  LYS R N     1 
ATOM 6998  C CA    . LYS B 2 109 ? 29.908  1.783   72.253  1.00 585.84 ?  105  LYS R CA    1 
ATOM 6999  C C     . LYS B 2 109 ? 30.033  2.753   71.080  1.00 585.36 ?  105  LYS R C     1 
ATOM 7000  O O     . LYS B 2 109 ? 29.095  2.936   70.306  1.00 584.92 ?  105  LYS R O     1 
ATOM 7001  C CB    . LYS B 2 109 ? 30.080  2.515   73.576  1.00 586.00 ?  105  LYS R CB    1 
ATOM 7002  C CG    . LYS B 2 109 ? 28.980  3.517   73.903  1.00 588.13 ?  105  LYS R CG    1 
ATOM 7003  C CD    . LYS B 2 109 ? 29.401  4.441   75.052  1.00 590.85 ?  105  LYS R CD    1 
ATOM 7004  C CE    . LYS B 2 109 ? 29.961  3.655   76.259  1.00 592.76 ?  105  LYS R CE    1 
ATOM 7005  N NZ    . LYS B 2 109 ? 30.989  4.445   77.024  1.00 594.65 1  105  LYS R NZ    1 
ATOM 7006  N N     . HIS B 2 110 ? 31.202  3.352   70.940  1.00 575.19 ?  106  HIS R N     1 
ATOM 7007  C CA    . HIS B 2 110 ? 31.465  4.216   69.800  1.00 576.34 ?  106  HIS R CA    1 
ATOM 7008  C C     . HIS B 2 110 ? 31.124  3.581   68.452  1.00 576.20 ?  106  HIS R C     1 
ATOM 7009  O O     . HIS B 2 110 ? 30.341  4.141   67.688  1.00 575.95 ?  106  HIS R O     1 
ATOM 7010  C CB    . HIS B 2 110 ? 32.906  4.699   69.841  1.00 576.84 ?  106  HIS R CB    1 
ATOM 7011  C CG    . HIS B 2 110 ? 33.183  5.629   70.981  1.00 579.45 ?  106  HIS R CG    1 
ATOM 7012  N ND1   . HIS B 2 110 ? 34.048  6.700   70.878  1.00 581.82 ?  106  HIS R ND1   1 
ATOM 7013  C CD2   . HIS B 2 110 ? 32.674  5.671   72.236  1.00 580.65 ?  106  HIS R CD2   1 
ATOM 7014  C CE1   . HIS B 2 110 ? 34.087  7.340   72.034  1.00 583.13 ?  106  HIS R CE1   1 
ATOM 7015  N NE2   . HIS B 2 110 ? 33.262  6.735   72.874  1.00 583.35 ?  106  HIS R NE2   1 
ATOM 7016  N N     . ALA B 2 111 ? 31.694  2.402   68.188  1.00 581.20 ?  107  ALA R N     1 
ATOM 7017  C CA    . ALA B 2 111 ? 31.431  1.636   66.960  1.00 580.85 ?  107  ALA R CA    1 
ATOM 7018  C C     . ALA B 2 111 ? 29.945  1.444   66.673  1.00 580.96 ?  107  ALA R C     1 
ATOM 7019  O O     . ALA B 2 111 ? 29.516  1.661   65.535  1.00 580.34 ?  107  ALA R O     1 
ATOM 7020  C CB    . ALA B 2 111 ? 32.116  0.305   67.029  1.00 580.77 ?  107  ALA R CB    1 
ATOM 7021  N N     . VAL B 2 112 ? 29.180  1.034   67.693  1.00 565.66 ?  108  VAL R N     1 
ATOM 7022  C CA    . VAL B 2 112 ? 27.718  0.933   67.603  1.00 565.66 ?  108  VAL R CA    1 
ATOM 7023  C C     . VAL B 2 112 ? 27.106  2.253   67.151  1.00 565.66 ?  108  VAL R C     1 
ATOM 7024  O O     . VAL B 2 112 ? 26.368  2.289   66.168  1.00 565.66 ?  108  VAL R O     1 
ATOM 7025  C CB    . VAL B 2 112 ? 27.071  0.534   68.955  1.00 565.66 ?  108  VAL R CB    1 
ATOM 7026  C CG1   . VAL B 2 112 ? 25.557  0.733   68.929  1.00 565.66 ?  108  VAL R CG1   1 
ATOM 7027  C CG2   . VAL B 2 112 ? 27.414  -0.899  69.307  1.00 565.66 ?  108  VAL R CG2   1 
ATOM 7028  N N     . SER B 2 113 ? 27.423  3.337   67.859  1.00 566.03 ?  109  SER R N     1 
ATOM 7029  C CA    . SER B 2 113 ? 26.857  4.643   67.520  1.00 566.03 ?  109  SER R CA    1 
ATOM 7030  C C     . SER B 2 113 ? 27.219  4.966   66.072  1.00 566.03 ?  109  SER R C     1 
ATOM 7031  O O     . SER B 2 113 ? 26.347  5.149   65.230  1.00 566.03 ?  109  SER R O     1 
ATOM 7032  C CB    . SER B 2 113 ? 27.323  5.740   68.503  1.00 566.03 ?  109  SER R CB    1 
ATOM 7033  O OG    . SER B 2 113 ? 28.267  6.648   67.911  1.00 566.03 ?  109  SER R OG    1 
ATOM 7034  N N     . GLU B 2 114 ? 28.517  4.983   65.799  1.00 541.40 ?  110  GLU R N     1 
ATOM 7035  C CA    . GLU B 2 114 ? 29.059  5.164   64.467  1.00 542.48 ?  110  GLU R CA    1 
ATOM 7036  C C     . GLU B 2 114 ? 28.313  4.381   63.390  1.00 542.88 ?  110  GLU R C     1 
ATOM 7037  O O     . GLU B 2 114 ? 28.042  4.900   62.290  1.00 543.32 ?  110  GLU R O     1 
ATOM 7038  C CB    . GLU B 2 114 ? 30.507  4.702   64.465  1.00 542.79 ?  110  GLU R CB    1 
ATOM 7039  C CG    . GLU B 2 114 ? 31.463  5.669   65.091  1.00 544.88 ?  110  GLU R CG    1 
ATOM 7040  C CD    . GLU B 2 114 ? 31.579  6.929   64.272  1.00 548.46 ?  110  GLU R CD    1 
ATOM 7041  O OE1   . GLU B 2 114 ? 31.407  6.846   63.027  1.00 549.26 ?  110  GLU R OE1   1 
ATOM 7042  O OE2   . GLU B 2 114 ? 31.814  8.001   64.880  1.00 550.88 -1 110  GLU R OE2   1 
ATOM 7043  N N     . GLY B 2 115 ? 28.002  3.126   63.710  1.00 546.43 ?  111  GLY R N     1 
ATOM 7044  C CA    . GLY B 2 115 ? 27.345  2.237   62.783  1.00 546.43 ?  111  GLY R CA    1 
ATOM 7045  C C     . GLY B 2 115 ? 25.898  2.591   62.541  1.00 546.43 ?  111  GLY R C     1 
ATOM 7046  O O     . GLY B 2 115 ? 25.505  2.777   61.385  1.00 546.43 ?  111  GLY R O     1 
ATOM 7047  N N     . THR B 2 116 ? 25.108  2.688   63.621  1.00 526.50 ?  112  THR R N     1 
ATOM 7048  C CA    . THR B 2 116 ? 23.659  2.917   63.499  1.00 526.50 ?  112  THR R CA    1 
ATOM 7049  C C     . THR B 2 116 ? 23.382  4.312   62.940  1.00 526.50 ?  112  THR R C     1 
ATOM 7050  O O     . THR B 2 116 ? 22.286  4.592   62.433  1.00 526.50 ?  112  THR R O     1 
ATOM 7051  C CB    . THR B 2 116 ? 22.875  2.751   64.827  1.00 526.50 ?  112  THR R CB    1 
ATOM 7052  O OG1   . THR B 2 116 ? 22.448  4.029   65.292  1.00 526.50 ?  112  THR R OG1   1 
ATOM 7053  C CG2   . THR B 2 116 ? 23.690  2.077   65.899  1.00 526.50 ?  112  THR R CG2   1 
ATOM 7054  N N     . LYS B 2 117 ? 24.387  5.176   63.046  1.00 548.85 ?  113  LYS R N     1 
ATOM 7055  C CA    . LYS B 2 117 ? 24.356  6.482   62.425  1.00 548.85 ?  113  LYS R CA    1 
ATOM 7056  C C     . LYS B 2 117 ? 24.329  6.358   60.896  1.00 548.85 ?  113  LYS R C     1 
ATOM 7057  O O     . LYS B 2 117 ? 23.421  6.877   60.251  1.00 548.85 ?  113  LYS R O     1 
ATOM 7058  C CB    . LYS B 2 117 ? 25.538  7.322   62.926  1.00 548.85 ?  113  LYS R CB    1 
ATOM 7059  C CG    . LYS B 2 117 ? 25.850  8.574   62.109  1.00 548.85 ?  113  LYS R CG    1 
ATOM 7060  C CD    . LYS B 2 117 ? 27.025  9.348   62.732  1.00 548.85 ?  113  LYS R CD    1 
ATOM 7061  C CE    . LYS B 2 117 ? 27.816  10.048  61.586  1.00 548.85 ?  113  LYS R CE    1 
ATOM 7062  N NZ    . LYS B 2 117 ? 28.808  11.016  62.193  1.00 548.85 1  113  LYS R NZ    1 
ATOM 7063  N N     . ALA B 2 118 ? 25.289  5.643   60.318  1.00 536.02 ?  114  ALA R N     1 
ATOM 7064  C CA    . ALA B 2 118 ? 25.413  5.569   58.849  1.00 536.02 ?  114  ALA R CA    1 
ATOM 7065  C C     . ALA B 2 118 ? 24.243  4.837   58.185  1.00 536.02 ?  114  ALA R C     1 
ATOM 7066  O O     . ALA B 2 118 ? 24.007  4.985   56.977  1.00 536.02 ?  114  ALA R O     1 
ATOM 7067  C CB    . ALA B 2 118 ? 26.726  4.933   58.454  1.00 536.02 ?  114  ALA R CB    1 
ATOM 7068  N N     . VAL B 2 119 ? 23.527  4.054   58.991  1.00 541.90 ?  115  VAL R N     1 
ATOM 7069  C CA    . VAL B 2 119 ? 22.344  3.307   58.565  1.00 541.90 ?  115  VAL R CA    1 
ATOM 7070  C C     . VAL B 2 119 ? 21.188  4.261   58.421  1.00 541.90 ?  115  VAL R C     1 
ATOM 7071  O O     . VAL B 2 119 ? 20.585  4.376   57.353  1.00 541.90 ?  115  VAL R O     1 
ATOM 7072  C CB    . VAL B 2 119 ? 21.955  2.260   59.621  1.00 541.90 ?  115  VAL R CB    1 
ATOM 7073  C CG1   . VAL B 2 119 ? 20.566  1.685   59.345  1.00 541.90 ?  115  VAL R CG1   1 
ATOM 7074  C CG2   . VAL B 2 119 ? 22.996  1.170   59.666  1.00 541.90 ?  115  VAL R CG2   1 
ATOM 7075  N N     . THR B 2 120 ? 20.869  4.912   59.532  1.00 533.44 ?  116  THR R N     1 
ATOM 7076  C CA    . THR B 2 120 ? 19.992  6.061   59.550  1.00 533.44 ?  116  THR R CA    1 
ATOM 7077  C C     . THR B 2 120 ? 20.306  6.974   58.353  1.00 533.44 ?  116  THR R C     1 
ATOM 7078  O O     . THR B 2 120 ? 19.444  7.173   57.503  1.00 533.44 ?  116  THR R O     1 
ATOM 7079  C CB    . THR B 2 120 ? 20.135  6.767   60.894  1.00 533.44 ?  116  THR R CB    1 
ATOM 7080  O OG1   . THR B 2 120 ? 19.482  5.990   61.905  1.00 533.44 ?  116  THR R OG1   1 
ATOM 7081  C CG2   . THR B 2 120 ? 19.529  8.110   60.855  1.00 533.44 ?  116  THR R CG2   1 
ATOM 7082  N N     . LYS B 2 121 ? 21.545  7.473   58.259  1.00 556.58 ?  117  LYS R N     1 
ATOM 7083  C CA    . LYS B 2 121 ? 21.991  8.295   57.116  1.00 556.58 ?  117  LYS R CA    1 
ATOM 7084  C C     . LYS B 2 121 ? 21.668  7.646   55.774  1.00 556.58 ?  117  LYS R C     1 
ATOM 7085  O O     . LYS B 2 121 ? 21.253  8.316   54.836  1.00 556.58 ?  117  LYS R O     1 
ATOM 7086  C CB    . LYS B 2 121 ? 23.495  8.571   57.203  1.00 556.58 ?  117  LYS R CB    1 
ATOM 7087  C CG    . LYS B 2 121 ? 24.087  9.360   56.034  1.00 556.58 ?  117  LYS R CG    1 
ATOM 7088  C CD    . LYS B 2 121 ? 24.642  10.688  56.498  1.00 556.58 ?  117  LYS R CD    1 
ATOM 7089  C CE    . LYS B 2 121 ? 25.778  11.197  55.592  1.00 556.58 ?  117  LYS R CE    1 
ATOM 7090  N NZ    . LYS B 2 121 ? 25.331  12.080  54.454  1.00 556.58 1  117  LYS R NZ    1 
ATOM 7091  N N     . TYR B 2 122 ? 21.853  6.333   55.704  1.00 552.15 ?  118  TYR R N     1 
ATOM 7092  C CA    . TYR B 2 122 ? 21.654  5.553   54.483  1.00 552.15 ?  118  TYR R CA    1 
ATOM 7093  C C     . TYR B 2 122 ? 20.181  5.385   54.062  1.00 552.15 ?  118  TYR R C     1 
ATOM 7094  O O     . TYR B 2 122 ? 19.855  5.505   52.880  1.00 552.15 ?  118  TYR R O     1 
ATOM 7095  C CB    . TYR B 2 122 ? 22.310  4.188   54.666  1.00 552.15 ?  118  TYR R CB    1 
ATOM 7096  C CG    . TYR B 2 122 ? 22.197  3.270   53.481  1.00 552.15 ?  118  TYR R CG    1 
ATOM 7097  C CD1   . TYR B 2 122 ? 23.090  3.370   52.414  1.00 552.15 ?  118  TYR R CD1   1 
ATOM 7098  C CD2   . TYR B 2 122 ? 21.204  2.286   53.435  1.00 552.15 ?  118  TYR R CD2   1 
ATOM 7099  C CE1   . TYR B 2 122 ? 22.989  2.527   51.326  1.00 552.15 ?  118  TYR R CE1   1 
ATOM 7100  C CE2   . TYR B 2 122 ? 21.093  1.441   52.349  1.00 552.15 ?  118  TYR R CE2   1 
ATOM 7101  C CZ    . TYR B 2 122 ? 21.990  1.569   51.300  1.00 552.15 ?  118  TYR R CZ    1 
ATOM 7102  O OH    . TYR B 2 122 ? 21.887  0.735   50.224  1.00 552.15 ?  118  TYR R OH    1 
ATOM 7103  N N     . THR B 2 123 ? 19.313  5.077   55.023  1.00 533.28 ?  119  THR R N     1 
ATOM 7104  C CA    . THR B 2 123 ? 17.871  5.003   54.789  1.00 533.28 ?  119  THR R CA    1 
ATOM 7105  C C     . THR B 2 123 ? 17.355  6.273   54.095  1.00 533.28 ?  119  THR R C     1 
ATOM 7106  O O     . THR B 2 123 ? 16.859  6.224   52.960  1.00 533.28 ?  119  THR R O     1 
ATOM 7107  C CB    . THR B 2 123 ? 17.105  4.807   56.124  1.00 533.28 ?  119  THR R CB    1 
ATOM 7108  O OG1   . THR B 2 123 ? 17.261  3.460   56.572  1.00 533.28 ?  119  THR R OG1   1 
ATOM 7109  C CG2   . THR B 2 123 ? 15.614  5.118   55.971  1.00 533.28 ?  119  THR R CG2   1 
ATOM 7110  N N     . SER B 2 124 ? 17.500  7.402   54.791  1.00 533.61 ?  120  SER R N     1 
ATOM 7111  C CA    . SER B 2 124 ? 16.994  8.699   54.352  1.00 533.61 ?  120  SER R CA    1 
ATOM 7112  C C     . SER B 2 124 ? 17.451  9.094   52.937  1.00 533.61 ?  120  SER R C     1 
ATOM 7113  O O     . SER B 2 124 ? 16.640  9.568   52.126  1.00 533.61 ?  120  SER R O     1 
ATOM 7114  C CB    . SER B 2 124 ? 17.429  9.765   55.353  1.00 533.61 ?  120  SER R CB    1 
ATOM 7115  O OG    . SER B 2 124 ? 18.836  9.931   55.298  1.00 533.61 ?  120  SER R OG    1 
ATOM 7116  N N     . ALA B 2 125 ? 18.742  8.897   52.654  1.00 517.49 ?  121  ALA R N     1 
ATOM 7117  C CA    . ALA B 2 125 ? 19.333  9.252   51.359  1.00 517.49 ?  121  ALA R CA    1 
ATOM 7118  C C     . ALA B 2 125 ? 19.185  8.133   50.322  1.00 517.49 ?  121  ALA R C     1 
ATOM 7119  O O     . ALA B 2 125 ? 18.070  7.625   50.102  1.00 517.49 ?  121  ALA R O     1 
ATOM 7120  C CB    . ALA B 2 125 ? 20.811  9.639   51.533  1.00 517.49 ?  121  ALA R CB    1 
ATOM 7121  N N     . ALA C 3 15  ? 24.280  11.339  44.921  1.00 578.85 ?  14   ALA Q N     1 
ATOM 7122  C CA    . ALA C 3 15  ? 25.425  10.389  44.772  1.00 578.85 ?  14   ALA Q CA    1 
ATOM 7123  C C     . ALA C 3 15  ? 24.971  8.969   44.395  1.00 578.85 ?  14   ALA Q C     1 
ATOM 7124  O O     . ALA C 3 15  ? 23.869  8.534   44.765  1.00 578.85 ?  14   ALA Q O     1 
ATOM 7125  C CB    . ALA C 3 15  ? 26.262  10.371  46.046  1.00 578.85 ?  14   ALA Q CB    1 
ATOM 7126  N N     . LYS C 3 16  ? 25.828  8.259   43.658  1.00 573.36 ?  15   LYS Q N     1 
ATOM 7127  C CA    . LYS C 3 16  ? 25.544  6.884   43.225  1.00 573.36 ?  15   LYS Q CA    1 
ATOM 7128  C C     . LYS C 3 16  ? 26.071  5.856   44.244  1.00 573.36 ?  15   LYS Q C     1 
ATOM 7129  O O     . LYS C 3 16  ? 25.309  5.004   44.731  1.00 573.36 ?  15   LYS Q O     1 
ATOM 7130  C CB    . LYS C 3 16  ? 26.105  6.615   41.817  1.00 573.36 ?  15   LYS Q CB    1 
ATOM 7131  C CG    . LYS C 3 16  ? 25.871  7.734   40.798  1.00 573.36 ?  15   LYS Q CG    1 
ATOM 7132  C CD    . LYS C 3 16  ? 24.474  7.694   40.160  1.00 573.36 ?  15   LYS Q CD    1 
ATOM 7133  C CE    . LYS C 3 16  ? 24.205  8.947   39.309  1.00 573.36 ?  15   LYS Q CE    1 
ATOM 7134  N NZ    . LYS C 3 16  ? 23.075  8.775   38.349  1.00 573.36 1  15   LYS Q NZ    1 
ATOM 7135  N N     . THR C 3 17  ? 27.364  5.952   44.569  1.00 552.35 ?  16   THR Q N     1 
ATOM 7136  C CA    . THR C 3 17  ? 28.007  5.095   45.576  1.00 551.44 ?  16   THR Q CA    1 
ATOM 7137  C C     . THR C 3 17  ? 27.211  5.018   46.881  1.00 550.43 ?  16   THR Q C     1 
ATOM 7138  O O     . THR C 3 17  ? 26.976  6.041   47.532  1.00 550.48 ?  16   THR Q O     1 
ATOM 7139  C CB    . THR C 3 17  ? 29.445  5.581   45.913  1.00 551.58 ?  16   THR Q CB    1 
ATOM 7140  O OG1   . THR C 3 17  ? 29.450  7.009   46.045  1.00 552.25 ?  16   THR Q OG1   1 
ATOM 7141  C CG2   . THR C 3 17  ? 30.433  5.175   44.830  1.00 551.62 ?  16   THR Q CG2   1 
ATOM 7142  N N     . ARG C 3 18  ? 26.800  3.803   47.252  1.00 572.34 ?  17   ARG Q N     1 
ATOM 7143  C CA    . ARG C 3 18  ? 26.117  3.546   48.529  1.00 572.34 ?  17   ARG Q CA    1 
ATOM 7144  C C     . ARG C 3 18  ? 26.956  4.021   49.697  1.00 572.34 ?  17   ARG Q C     1 
ATOM 7145  O O     . ARG C 3 18  ? 26.438  4.281   50.788  1.00 572.34 ?  17   ARG Q O     1 
ATOM 7146  C CB    . ARG C 3 18  ? 25.847  2.058   48.714  1.00 572.34 ?  17   ARG Q CB    1 
ATOM 7147  C CG    . ARG C 3 18  ? 24.816  1.490   47.781  1.00 572.34 ?  17   ARG Q CG    1 
ATOM 7148  C CD    . ARG C 3 18  ? 24.346  0.144   48.275  1.00 572.34 ?  17   ARG Q CD    1 
ATOM 7149  N NE    . ARG C 3 18  ? 25.030  -0.970  47.622  1.00 572.34 ?  17   ARG Q NE    1 
ATOM 7150  C CZ    . ARG C 3 18  ? 24.806  -2.250  47.906  1.00 572.34 ?  17   ARG Q CZ    1 
ATOM 7151  N NH1   . ARG C 3 18  ? 23.922  -2.588  48.843  1.00 572.34 1  17   ARG Q NH1   1 
ATOM 7152  N NH2   . ARG C 3 18  ? 25.474  -3.193  47.253  1.00 572.34 ?  17   ARG Q NH2   1 
ATOM 7153  N N     . SER C 3 19  ? 28.263  4.109   49.456  1.00 563.30 ?  18   SER Q N     1 
ATOM 7154  C CA    . SER C 3 19  ? 29.203  4.636   50.426  1.00 563.30 ?  18   SER Q CA    1 
ATOM 7155  C C     . SER C 3 19  ? 28.853  6.077   50.717  1.00 563.30 ?  18   SER Q C     1 
ATOM 7156  O O     . SER C 3 19  ? 28.776  6.480   51.881  1.00 563.30 ?  18   SER Q O     1 
ATOM 7157  C CB    . SER C 3 19  ? 30.629  4.530   49.897  1.00 563.30 ?  18   SER Q CB    1 
ATOM 7158  O OG    . SER C 3 19  ? 30.953  3.176   49.643  1.00 563.30 ?  18   SER Q OG    1 
ATOM 7159  N N     . SER C 3 20  ? 28.607  6.839   49.653  1.00 548.21 ?  19   SER Q N     1 
ATOM 7160  C CA    . SER C 3 20  ? 28.275  8.247   49.797  1.00 548.21 ?  19   SER Q CA    1 
ATOM 7161  C C     . SER C 3 20  ? 26.924  8.442   50.465  1.00 548.21 ?  19   SER Q C     1 
ATOM 7162  O O     . SER C 3 20  ? 26.806  9.243   51.378  1.00 548.21 ?  19   SER Q O     1 
ATOM 7163  C CB    . SER C 3 20  ? 28.339  8.973   48.460  1.00 548.21 ?  19   SER Q CB    1 
ATOM 7164  O OG    . SER C 3 20  ? 28.822  10.291  48.662  1.00 548.21 ?  19   SER Q OG    1 
ATOM 7165  N N     . ARG C 3 21  ? 25.916  7.691   50.036  1.00 525.53 ?  20   ARG Q N     1 
ATOM 7166  C CA    . ARG C 3 21  ? 24.631  7.686   50.732  1.00 524.17 ?  20   ARG Q CA    1 
ATOM 7167  C C     . ARG C 3 21  ? 24.779  7.505   52.241  1.00 522.85 ?  20   ARG Q C     1 
ATOM 7168  O O     . ARG C 3 21  ? 23.943  7.964   53.011  1.00 522.89 ?  20   ARG Q O     1 
ATOM 7169  C CB    . ARG C 3 21  ? 23.730  6.584   50.192  1.00 524.48 ?  20   ARG Q CB    1 
ATOM 7170  C CG    . ARG C 3 21  ? 23.309  6.758   48.753  1.00 526.24 ?  20   ARG Q CG    1 
ATOM 7171  C CD    . ARG C 3 21  ? 22.666  5.497   48.269  1.00 529.79 ?  20   ARG Q CD    1 
ATOM 7172  N NE    . ARG C 3 21  ? 21.984  5.674   46.995  1.00 533.09 ?  20   ARG Q NE    1 
ATOM 7173  C CZ    . ARG C 3 21  ? 21.602  4.665   46.207  1.00 533.09 ?  20   ARG Q CZ    1 
ATOM 7174  N NH1   . ARG C 3 21  ? 21.857  3.406   46.560  1.00 533.09 1  20   ARG Q NH1   1 
ATOM 7175  N NH2   . ARG C 3 21  ? 20.974  4.917   45.058  1.00 533.09 ?  20   ARG Q NH2   1 
ATOM 7176  N N     . ALA C 3 22  ? 25.840  6.829   52.662  1.00 524.58 ?  21   ALA Q N     1 
ATOM 7177  C CA    . ALA C 3 22  ? 26.061  6.569   54.076  1.00 524.58 ?  21   ALA Q CA    1 
ATOM 7178  C C     . ALA C 3 22  ? 27.136  7.481   54.622  1.00 524.58 ?  21   ALA Q C     1 
ATOM 7179  O O     . ALA C 3 22  ? 27.424  7.471   55.817  1.00 524.58 ?  21   ALA Q O     1 
ATOM 7180  C CB    . ALA C 3 22  ? 26.438  5.133   54.281  1.00 524.58 ?  21   ALA Q CB    1 
ATOM 7181  N N     . GLY C 3 23  ? 27.723  8.277   53.737  1.00 520.90 ?  22   GLY Q N     1 
ATOM 7182  C CA    . GLY C 3 23  ? 28.805  9.172   54.108  1.00 520.90 ?  22   GLY Q CA    1 
ATOM 7183  C C     . GLY C 3 23  ? 29.898  8.379   54.770  1.00 520.90 ?  22   GLY Q C     1 
ATOM 7184  O O     . GLY C 3 23  ? 30.216  8.588   55.950  1.00 520.90 ?  22   GLY Q O     1 
ATOM 7185  N N     . LEU C 3 24  ? 30.432  7.428   54.001  1.00 539.40 ?  23   LEU Q N     1 
ATOM 7186  C CA    . LEU C 3 24  ? 31.477  6.520   54.458  1.00 539.40 ?  23   LEU Q CA    1 
ATOM 7187  C C     . LEU C 3 24  ? 32.595  6.430   53.455  1.00 539.40 ?  23   LEU Q C     1 
ATOM 7188  O O     . LEU C 3 24  ? 32.392  6.596   52.246  1.00 539.40 ?  23   LEU Q O     1 
ATOM 7189  C CB    . LEU C 3 24  ? 30.928  5.124   54.716  1.00 539.40 ?  23   LEU Q CB    1 
ATOM 7190  C CG    . LEU C 3 24  ? 29.969  4.930   55.891  1.00 539.40 ?  23   LEU Q CG    1 
ATOM 7191  C CD1   . LEU C 3 24  ? 29.468  3.509   55.897  1.00 539.40 ?  23   LEU Q CD1   1 
ATOM 7192  C CD2   . LEU C 3 24  ? 30.591  5.275   57.231  1.00 539.40 ?  23   LEU Q CD2   1 
ATOM 7193  N N     . GLN C 3 25  ? 33.783  6.166   53.982  1.00 580.31 ?  24   GLN Q N     1 
ATOM 7194  C CA    . GLN C 3 25  ? 34.960  5.902   53.167  1.00 580.31 ?  24   GLN Q CA    1 
ATOM 7195  C C     . GLN C 3 25  ? 35.028  4.454   52.655  1.00 580.31 ?  24   GLN Q C     1 
ATOM 7196  O O     . GLN C 3 25  ? 35.618  4.187   51.612  1.00 580.31 ?  24   GLN Q O     1 
ATOM 7197  C CB    . GLN C 3 25  ? 36.218  6.268   53.950  1.00 580.31 ?  24   GLN Q CB    1 
ATOM 7198  C CG    . GLN C 3 25  ? 36.224  7.723   54.434  1.00 580.31 ?  24   GLN Q CG    1 
ATOM 7199  C CD    . GLN C 3 25  ? 36.095  8.731   53.298  1.00 580.31 ?  24   GLN Q CD    1 
ATOM 7200  O OE1   . GLN C 3 25  ? 36.021  8.365   52.128  1.00 580.31 ?  24   GLN Q OE1   1 
ATOM 7201  N NE2   . GLN C 3 25  ? 36.062  10.002  53.645  1.00 580.31 ?  24   GLN Q NE2   1 
ATOM 7202  N N     . PHE C 3 26  ? 34.395  3.534   53.373  1.00 570.49 ?  25   PHE Q N     1 
ATOM 7203  C CA    . PHE C 3 26  ? 34.501  2.122   53.060  1.00 570.49 ?  25   PHE Q CA    1 
ATOM 7204  C C     . PHE C 3 26  ? 33.518  1.682   51.978  1.00 570.49 ?  25   PHE Q C     1 
ATOM 7205  O O     . PHE C 3 26  ? 32.402  2.205   51.918  1.00 570.49 ?  25   PHE Q O     1 
ATOM 7206  C CB    . PHE C 3 26  ? 34.365  1.282   54.340  1.00 570.49 ?  25   PHE Q CB    1 
ATOM 7207  C CG    . PHE C 3 26  ? 35.671  1.049   55.024  1.00 570.49 ?  25   PHE Q CG    1 
ATOM 7208  C CD1   . PHE C 3 26  ? 36.367  2.100   55.591  1.00 570.49 ?  25   PHE Q CD1   1 
ATOM 7209  C CD2   . PHE C 3 26  ? 36.232  -0.217  55.069  1.00 570.49 ?  25   PHE Q CD2   1 
ATOM 7210  C CE1   . PHE C 3 26  ? 37.594  1.888   56.207  1.00 570.49 ?  25   PHE Q CE1   1 
ATOM 7211  C CE2   . PHE C 3 26  ? 37.452  -0.438  55.688  1.00 570.49 ?  25   PHE Q CE2   1 
ATOM 7212  C CZ    . PHE C 3 26  ? 38.130  0.612   56.251  1.00 570.49 ?  25   PHE Q CZ    1 
ATOM 7213  N N     . PRO C 3 27  ? 33.936  0.727   51.108  1.00 581.80 ?  26   PRO Q N     1 
ATOM 7214  C CA    . PRO C 3 27  ? 33.076  0.331   49.994  1.00 581.80 ?  26   PRO Q CA    1 
ATOM 7215  C C     . PRO C 3 27  ? 31.965  -0.627  50.430  1.00 581.80 ?  26   PRO Q C     1 
ATOM 7216  O O     . PRO C 3 27  ? 32.202  -1.814  50.602  1.00 581.80 ?  26   PRO Q O     1 
ATOM 7217  C CB    . PRO C 3 27  ? 34.054  -0.317  49.005  1.00 581.80 ?  26   PRO Q CB    1 
ATOM 7218  C CG    . PRO C 3 27  ? 35.153  -0.815  49.833  1.00 581.80 ?  26   PRO Q CG    1 
ATOM 7219  C CD    . PRO C 3 27  ? 35.215  -0.010  51.100  1.00 581.80 ?  26   PRO Q CD    1 
ATOM 7220  N N     . VAL C 3 28  ? 30.762  -0.082  50.585  1.00 576.01 ?  27   VAL Q N     1 
ATOM 7221  C CA    . VAL C 3 28  ? 29.578  -0.801  51.057  1.00 576.01 ?  27   VAL Q CA    1 
ATOM 7222  C C     . VAL C 3 28  ? 29.128  -1.856  50.051  1.00 576.01 ?  27   VAL Q C     1 
ATOM 7223  O O     . VAL C 3 28  ? 28.442  -2.821  50.422  1.00 576.01 ?  27   VAL Q O     1 
ATOM 7224  C CB    . VAL C 3 28  ? 28.399  0.182   51.341  1.00 576.01 ?  27   VAL Q CB    1 
ATOM 7225  C CG1   . VAL C 3 28  ? 27.345  -0.450  52.261  1.00 576.01 ?  27   VAL Q CG1   1 
ATOM 7226  C CG2   . VAL C 3 28  ? 28.919  1.471   51.973  1.00 576.01 ?  27   VAL Q CG2   1 
ATOM 7227  N N     . GLY C 3 29  ? 29.512  -1.672  48.784  1.00 593.68 ?  28   GLY Q N     1 
ATOM 7228  C CA    . GLY C 3 29  ? 29.240  -2.669  47.741  1.00 593.68 ?  28   GLY Q CA    1 
ATOM 7229  C C     . GLY C 3 29  ? 30.086  -3.916  47.950  1.00 593.68 ?  28   GLY Q C     1 
ATOM 7230  O O     . GLY C 3 29  ? 29.600  -5.050  47.846  1.00 593.68 ?  28   GLY Q O     1 
ATOM 7231  N N     . ARG C 3 30  ? 31.366  -3.696  48.258  1.00 598.22 ?  29   ARG Q N     1 
ATOM 7232  C CA    . ARG C 3 30  ? 32.290  -4.784  48.569  1.00 598.22 ?  29   ARG Q CA    1 
ATOM 7233  C C     . ARG C 3 30  ? 31.792  -5.548  49.809  1.00 598.22 ?  29   ARG Q C     1 
ATOM 7234  O O     . ARG C 3 30  ? 31.507  -6.739  49.743  1.00 598.22 ?  29   ARG Q O     1 
ATOM 7235  C CB    . ARG C 3 30  ? 33.706  -4.245  48.762  1.00 598.22 ?  29   ARG Q CB    1 
ATOM 7236  C CG    . ARG C 3 30  ? 34.794  -5.255  48.477  1.00 598.22 ?  29   ARG Q CG    1 
ATOM 7237  C CD    . ARG C 3 30  ? 36.179  -4.615  48.455  1.00 598.22 ?  29   ARG Q CD    1 
ATOM 7238  N NE    . ARG C 3 30  ? 36.525  -4.163  47.124  1.00 598.22 ?  29   ARG Q NE    1 
ATOM 7239  C CZ    . ARG C 3 30  ? 37.746  -3.773  46.751  1.00 598.22 ?  29   ARG Q CZ    1 
ATOM 7240  N NH1   . ARG C 3 30  ? 38.759  -3.772  47.621  1.00 598.22 1  29   ARG Q NH1   1 
ATOM 7241  N NH2   . ARG C 3 30  ? 37.971  -3.371  45.494  1.00 598.22 ?  29   ARG Q NH2   1 
ATOM 7242  N N     . VAL C 3 31  ? 31.636  -4.852  50.922  1.00 607.87 ?  30   VAL Q N     1 
ATOM 7243  C CA    . VAL C 3 31  ? 31.159  -5.491  52.142  1.00 607.87 ?  30   VAL Q CA    1 
ATOM 7244  C C     . VAL C 3 31  ? 29.855  -6.254  51.890  1.00 607.87 ?  30   VAL Q C     1 
ATOM 7245  O O     . VAL C 3 31  ? 29.512  -7.173  52.627  1.00 607.87 ?  30   VAL Q O     1 
ATOM 7246  C CB    . VAL C 3 31  ? 31.009  -4.474  53.300  1.00 607.87 ?  30   VAL Q CB    1 
ATOM 7247  C CG1   . VAL C 3 31  ? 30.481  -5.151  54.559  1.00 607.87 ?  30   VAL Q CG1   1 
ATOM 7248  C CG2   . VAL C 3 31  ? 32.336  -3.809  53.587  1.00 607.87 ?  30   VAL Q CG2   1 
ATOM 7249  N N     . HIS C 3 32  ? 29.153  -5.905  50.818  1.00 601.00 ?  31   HIS Q N     1 
ATOM 7250  C CA    . HIS C 3 32  ? 27.883  -6.556  50.524  1.00 602.45 ?  31   HIS Q CA    1 
ATOM 7251  C C     . HIS C 3 32  ? 28.106  -7.868  49.786  1.00 603.09 ?  31   HIS Q C     1 
ATOM 7252  O O     . HIS C 3 32  ? 27.533  -8.902  50.145  1.00 603.72 ?  31   HIS Q O     1 
ATOM 7253  C CB    . HIS C 3 32  ? 26.984  -5.633  49.719  1.00 602.61 ?  31   HIS Q CB    1 
ATOM 7254  C CG    . HIS C 3 32  ? 25.557  -6.060  49.692  1.00 603.84 ?  31   HIS Q CG    1 
ATOM 7255  N ND1   . HIS C 3 32  ? 24.905  -6.534  50.809  1.00 605.92 ?  31   HIS Q ND1   1 
ATOM 7256  C CD2   . HIS C 3 32  ? 24.643  -6.053  48.691  1.00 604.86 ?  31   HIS Q CD2   1 
ATOM 7257  C CE1   . HIS C 3 32  ? 23.649  -6.811  50.497  1.00 607.25 ?  31   HIS Q CE1   1 
ATOM 7258  N NE2   . HIS C 3 32  ? 23.469  -6.539  49.213  1.00 606.42 ?  31   HIS Q NE2   1 
ATOM 7259  N N     . ARG C 3 33  ? 28.946  -7.821  48.758  1.00 598.29 ?  32   ARG Q N     1 
ATOM 7260  C CA    . ARG C 3 33  ? 29.295  -9.008  48.006  1.00 598.63 ?  32   ARG Q CA    1 
ATOM 7261  C C     . ARG C 3 33  ? 29.892  -10.039 48.963  1.00 599.06 ?  32   ARG Q C     1 
ATOM 7262  O O     . ARG C 3 33  ? 29.415  -11.175 49.023  1.00 599.30 ?  32   ARG Q O     1 
ATOM 7263  C CB    . ARG C 3 33  ? 30.266  -8.631  46.887  1.00 598.67 ?  32   ARG Q CB    1 
ATOM 7264  C CG    . ARG C 3 33  ? 31.006  -9.767  46.236  1.00 598.16 ?  32   ARG Q CG    1 
ATOM 7265  C CD    . ARG C 3 33  ? 32.195  -9.202  45.483  1.00 597.48 ?  32   ARG Q CD    1 
ATOM 7266  N NE    . ARG C 3 33  ? 33.377  -9.083  46.334  1.00 597.31 ?  32   ARG Q NE    1 
ATOM 7267  C CZ    . ARG C 3 33  ? 34.494  -8.421  46.011  1.00 596.49 ?  32   ARG Q CZ    1 
ATOM 7268  N NH1   . ARG C 3 33  ? 34.600  -7.777  44.858  1.00 595.05 1  32   ARG Q NH1   1 
ATOM 7269  N NH2   . ARG C 3 33  ? 35.516  -8.391  46.856  1.00 596.14 ?  32   ARG Q NH2   1 
ATOM 7270  N N     . LEU C 3 34  ? 30.897  -9.627  49.736  1.00 596.69 ?  33   LEU Q N     1 
ATOM 7271  C CA    . LEU C 3 34  ? 31.563  -10.524 50.666  1.00 597.09 ?  33   LEU Q CA    1 
ATOM 7272  C C     . LEU C 3 34  ? 30.569  -11.243 51.581  1.00 597.92 ?  33   LEU Q C     1 
ATOM 7273  O O     . LEU C 3 34  ? 30.591  -12.470 51.677  1.00 598.72 ?  33   LEU Q O     1 
ATOM 7274  C CB    . LEU C 3 34  ? 32.612  -9.791  51.491  1.00 596.64 ?  33   LEU Q CB    1 
ATOM 7275  C CG    . LEU C 3 34  ? 33.688  -8.942  50.802  1.00 596.94 ?  33   LEU Q CG    1 
ATOM 7276  C CD1   . LEU C 3 34  ? 34.395  -8.087  51.839  1.00 597.01 ?  33   LEU Q CD1   1 
ATOM 7277  C CD2   . LEU C 3 34  ? 34.705  -9.746  50.010  1.00 596.33 ?  33   LEU Q CD2   1 
ATOM 7278  N N     . LEU C 3 35  ? 29.679  -10.510 52.235  1.00 596.30 ?  34   LEU Q N     1 
ATOM 7279  C CA    . LEU C 3 35  ? 28.723  -11.162 53.135  1.00 596.30 ?  34   LEU Q CA    1 
ATOM 7280  C C     . LEU C 3 35  ? 27.892  -12.258 52.468  1.00 596.30 ?  34   LEU Q C     1 
ATOM 7281  O O     . LEU C 3 35  ? 27.436  -13.187 53.139  1.00 596.30 ?  34   LEU Q O     1 
ATOM 7282  C CB    . LEU C 3 35  ? 27.797  -10.146 53.783  1.00 596.30 ?  34   LEU Q CB    1 
ATOM 7283  C CG    . LEU C 3 35  ? 28.317  -9.491  55.058  1.00 596.30 ?  34   LEU Q CG    1 
ATOM 7284  C CD1   . LEU C 3 35  ? 27.908  -8.049  55.050  1.00 596.30 ?  34   LEU Q CD1   1 
ATOM 7285  C CD2   . LEU C 3 35  ? 27.812  -10.202 56.331  1.00 596.30 ?  34   LEU Q CD2   1 
ATOM 7286  N N     . ARG C 3 36  ? 27.698  -12.154 51.153  1.00 585.45 ?  35   ARG Q N     1 
ATOM 7287  C CA    . ARG C 3 36  ? 26.944  -13.178 50.418  1.00 586.55 ?  35   ARG Q CA    1 
ATOM 7288  C C     . ARG C 3 36  ? 27.824  -14.342 49.954  1.00 586.04 ?  35   ARG Q C     1 
ATOM 7289  O O     . ARG C 3 36  ? 27.516  -15.505 50.237  1.00 586.54 ?  35   ARG Q O     1 
ATOM 7290  C CB    . ARG C 3 36  ? 26.155  -12.567 49.264  1.00 586.42 ?  35   ARG Q CB    1 
ATOM 7291  C CG    . ARG C 3 36  ? 24.787  -12.023 49.691  1.00 588.13 ?  35   ARG Q CG    1 
ATOM 7292  C CD    . ARG C 3 36  ? 23.939  -11.547 48.496  1.00 588.80 ?  35   ARG Q CD    1 
ATOM 7293  N NE    . ARG C 3 36  ? 24.175  -10.134 48.177  1.00 593.32 ?  35   ARG Q NE    1 
ATOM 7294  C CZ    . ARG C 3 36  ? 25.240  -9.666  47.521  1.00 594.69 ?  35   ARG Q CZ    1 
ATOM 7295  N NH1   . ARG C 3 36  ? 26.200  -10.484 47.096  1.00 594.60 1  35   ARG Q NH1   1 
ATOM 7296  N NH2   . ARG C 3 36  ? 25.350  -8.365  47.291  1.00 596.17 ?  35   ARG Q NH2   1 
ATOM 7297  N N     . LYS C 3 37  ? 28.923  -14.027 49.272  1.00 560.95 ?  36   LYS Q N     1 
ATOM 7298  C CA    . LYS C 3 37  ? 29.920  -15.032 48.911  1.00 560.33 ?  36   LYS Q CA    1 
ATOM 7299  C C     . LYS C 3 37  ? 30.680  -15.502 50.160  1.00 559.77 ?  36   LYS Q C     1 
ATOM 7300  O O     . LYS C 3 37  ? 31.915  -15.585 50.151  1.00 559.81 ?  36   LYS Q O     1 
ATOM 7301  C CB    . LYS C 3 37  ? 30.925  -14.467 47.891  1.00 560.53 ?  36   LYS Q CB    1 
ATOM 7302  C CG    . LYS C 3 37  ? 30.365  -13.460 46.892  1.00 560.93 ?  36   LYS Q CG    1 
ATOM 7303  C CD    . LYS C 3 37  ? 29.780  -14.097 45.657  1.00 561.53 ?  36   LYS Q CD    1 
ATOM 7304  C CE    . LYS C 3 37  ? 28.783  -13.141 45.033  1.00 562.43 ?  36   LYS Q CE    1 
ATOM 7305  N NZ    . LYS C 3 37  ? 29.031  -12.961 43.575  1.00 564.27 1  36   LYS Q NZ    1 
ATOM 7306  N N     . GLY C 3 38  ? 29.949  -15.814 51.230  1.00 565.50 ?  37   GLY Q N     1 
ATOM 7307  C CA    . GLY C 3 38  ? 30.577  -16.113 52.507  1.00 564.48 ?  37   GLY Q CA    1 
ATOM 7308  C C     . GLY C 3 38  ? 29.722  -16.992 53.392  1.00 564.01 ?  37   GLY Q C     1 
ATOM 7309  O O     . GLY C 3 38  ? 30.134  -17.380 54.483  1.00 563.66 ?  37   GLY Q O     1 
ATOM 7310  N N     . ASN C 3 39  ? 28.520  -17.306 52.932  1.00 570.48 ?  38   ASN Q N     1 
ATOM 7311  C CA    . ASN C 3 39  ? 27.742  -18.343 53.581  1.00 570.29 ?  38   ASN Q CA    1 
ATOM 7312  C C     . ASN C 3 39  ? 27.626  -18.071 55.074  1.00 569.54 ?  38   ASN Q C     1 
ATOM 7313  O O     . ASN C 3 39  ? 28.082  -18.871 55.901  1.00 569.70 ?  38   ASN Q O     1 
ATOM 7314  C CB    . ASN C 3 39  ? 28.387  -19.723 53.315  1.00 570.55 ?  38   ASN Q CB    1 
ATOM 7315  C CG    . ASN C 3 39  ? 28.563  -20.010 51.810  1.00 571.62 ?  38   ASN Q CG    1 
ATOM 7316  O OD1   . ASN C 3 39  ? 27.587  -20.295 51.095  1.00 572.96 ?  38   ASN Q OD1   1 
ATOM 7317  N ND2   . ASN C 3 39  ? 29.802  -19.927 51.329  1.00 570.02 ?  38   ASN Q ND2   1 
ATOM 7318  N N     . TYR C 3 40  ? 27.058  -16.913 55.409  1.00 563.64 ?  39   TYR Q N     1 
ATOM 7319  C CA    . TYR C 3 40  ? 26.795  -16.556 56.802  1.00 562.42 ?  39   TYR Q CA    1 
ATOM 7320  C C     . TYR C 3 40  ? 25.304  -16.726 57.024  1.00 563.16 ?  39   TYR Q C     1 
ATOM 7321  O O     . TYR C 3 40  ? 24.850  -17.066 58.128  1.00 562.65 ?  39   TYR Q O     1 
ATOM 7322  C CB    . TYR C 3 40  ? 27.220  -15.119 57.106  1.00 560.89 ?  39   TYR Q CB    1 
ATOM 7323  C CG    . TYR C 3 40  ? 28.662  -14.798 56.794  1.00 558.85 ?  39   TYR Q CG    1 
ATOM 7324  C CD1   . TYR C 3 40  ? 29.661  -15.023 57.733  1.00 556.52 ?  39   TYR Q CD1   1 
ATOM 7325  C CD2   . TYR C 3 40  ? 29.027  -14.273 55.557  1.00 556.27 ?  39   TYR Q CD2   1 
ATOM 7326  C CE1   . TYR C 3 40  ? 30.987  -14.749 57.444  1.00 555.78 ?  39   TYR Q CE1   1 
ATOM 7327  C CE2   . TYR C 3 40  ? 30.348  -13.990 55.269  1.00 555.75 ?  39   TYR Q CE2   1 
ATOM 7328  C CZ    . TYR C 3 40  ? 31.320  -14.232 56.211  1.00 556.24 ?  39   TYR Q CZ    1 
ATOM 7329  O OH    . TYR C 3 40  ? 32.631  -13.949 55.931  1.00 557.17 ?  39   TYR Q OH    1 
ATOM 7330  N N     . ALA C 3 41  ? 24.551  -16.481 55.953  1.00 568.48 ?  40   ALA Q N     1 
ATOM 7331  C CA    . ALA C 3 41  ? 23.127  -16.773 55.914  1.00 569.89 ?  40   ALA Q CA    1 
ATOM 7332  C C     . ALA C 3 41  ? 22.602  -16.741 54.492  1.00 570.97 ?  40   ALA Q C     1 
ATOM 7333  O O     . ALA C 3 41  ? 23.225  -16.180 53.579  1.00 570.62 ?  40   ALA Q O     1 
ATOM 7334  C CB    . ALA C 3 41  ? 22.351  -15.801 56.790  1.00 570.03 ?  40   ALA Q CB    1 
ATOM 7335  N N     . GLU C 3 42  ? 21.444  -17.362 54.315  1.00 564.16 ?  41   GLU Q N     1 
ATOM 7336  C CA    . GLU C 3 42  ? 20.720  -17.317 53.058  1.00 566.01 ?  41   GLU Q CA    1 
ATOM 7337  C C     . GLU C 3 42  ? 20.767  -15.898 52.524  1.00 566.39 ?  41   GLU Q C     1 
ATOM 7338  O O     . GLU C 3 42  ? 21.375  -15.608 51.488  1.00 566.58 ?  41   GLU Q O     1 
ATOM 7339  C CB    . GLU C 3 42  ? 19.255  -17.654 53.308  1.00 566.40 ?  41   GLU Q CB    1 
ATOM 7340  C CG    . GLU C 3 42  ? 18.995  -18.996 53.926  1.00 569.38 ?  41   GLU Q CG    1 
ATOM 7341  C CD    . GLU C 3 42  ? 18.436  -19.966 52.913  1.00 573.52 ?  41   GLU Q CD    1 
ATOM 7342  O OE1   . GLU C 3 42  ? 17.352  -19.665 52.335  1.00 574.03 ?  41   GLU Q OE1   1 
ATOM 7343  O OE2   . GLU C 3 42  ? 19.086  -21.025 52.710  1.00 574.89 -1 41   GLU Q OE2   1 
ATOM 7344  N N     . ARG C 3 43  ? 20.127  -15.015 53.280  1.00 580.86 ?  42   ARG Q N     1 
ATOM 7345  C CA    . ARG C 3 43  ? 19.849  -13.674 52.833  1.00 581.26 ?  42   ARG Q CA    1 
ATOM 7346  C C     . ARG C 3 43  ? 20.547  -12.652 53.728  1.00 580.97 ?  42   ARG Q C     1 
ATOM 7347  O O     . ARG C 3 43  ? 20.788  -12.899 54.919  1.00 581.08 ?  42   ARG Q O     1 
ATOM 7348  C CB    . ARG C 3 43  ? 18.334  -13.462 52.799  1.00 581.59 ?  42   ARG Q CB    1 
ATOM 7349  C CG    . ARG C 3 43  ? 17.629  -14.360 51.772  1.00 583.74 ?  42   ARG Q CG    1 
ATOM 7350  C CD    . ARG C 3 43  ? 16.168  -14.672 52.105  1.00 586.76 ?  42   ARG Q CD    1 
ATOM 7351  N NE    . ARG C 3 43  ? 15.354  -13.464 52.192  1.00 589.30 ?  42   ARG Q NE    1 
ATOM 7352  C CZ    . ARG C 3 43  ? 14.980  -12.900 53.340  1.00 591.39 ?  42   ARG Q CZ    1 
ATOM 7353  N NH1   . ARG C 3 43  ? 15.332  -13.443 54.506  1.00 592.01 1  42   ARG Q NH1   1 
ATOM 7354  N NH2   . ARG C 3 43  ? 14.250  -11.789 53.326  1.00 592.70 ?  42   ARG Q NH2   1 
ATOM 7355  N N     . VAL C 3 44  ? 20.896  -11.517 53.129  1.00 588.39 ?  43   VAL Q N     1 
ATOM 7356  C CA    . VAL C 3 44  ? 21.522  -10.414 53.844  1.00 587.74 ?  43   VAL Q CA    1 
ATOM 7357  C C     . VAL C 3 44  ? 20.618  -9.185  53.781  1.00 587.09 ?  43   VAL Q C     1 
ATOM 7358  O O     . VAL C 3 44  ? 20.129  -8.831  52.705  1.00 587.44 ?  43   VAL Q O     1 
ATOM 7359  C CB    . VAL C 3 44  ? 22.904  -10.044 53.232  1.00 587.87 ?  43   VAL Q CB    1 
ATOM 7360  C CG1   . VAL C 3 44  ? 23.552  -8.890  54.003  1.00 587.23 ?  43   VAL Q CG1   1 
ATOM 7361  C CG2   . VAL C 3 44  ? 23.828  -11.257 53.196  1.00 587.55 ?  43   VAL Q CG2   1 
ATOM 7362  N N     . GLY C 3 45  ? 20.412  -8.530  54.922  1.00 587.49 ?  44   GLY Q N     1 
ATOM 7363  C CA    . GLY C 3 45  ? 19.740  -7.231  54.951  1.00 586.17 ?  44   GLY Q CA    1 
ATOM 7364  C C     . GLY C 3 45  ? 20.517  -6.195  54.154  1.00 585.29 ?  44   GLY Q C     1 
ATOM 7365  O O     . GLY C 3 45  ? 21.553  -6.507  53.552  1.00 585.71 ?  44   GLY Q O     1 
ATOM 7366  N N     . ALA C 3 46  ? 20.033  -4.958  54.137  1.00 580.36 ?  45   ALA Q N     1 
ATOM 7367  C CA    . ALA C 3 46  ? 20.740  -3.907  53.397  1.00 578.66 ?  45   ALA Q CA    1 
ATOM 7368  C C     . ALA C 3 46  ? 21.391  -2.917  54.327  1.00 577.33 ?  45   ALA Q C     1 
ATOM 7369  O O     . ALA C 3 46  ? 22.200  -2.101  53.891  1.00 577.38 ?  45   ALA Q O     1 
ATOM 7370  C CB    . ALA C 3 46  ? 19.812  -3.200  52.429  1.00 578.82 ?  45   ALA Q CB    1 
ATOM 7371  N N     . GLY C 3 47  ? 21.038  -2.986  55.607  1.00 575.72 ?  46   GLY Q N     1 
ATOM 7372  C CA    . GLY C 3 47  ? 21.650  -2.119  56.613  1.00 575.72 ?  46   GLY Q CA    1 
ATOM 7373  C C     . GLY C 3 47  ? 22.900  -2.721  57.229  1.00 575.72 ?  46   GLY Q C     1 
ATOM 7374  O O     . GLY C 3 47  ? 23.802  -2.000  57.707  1.00 575.72 ?  46   GLY Q O     1 
ATOM 7375  N N     . ALA C 3 48  ? 22.930  -4.056  57.229  1.00 572.09 ?  47   ALA Q N     1 
ATOM 7376  C CA    . ALA C 3 48  ? 24.047  -4.838  57.739  1.00 572.09 ?  47   ALA Q CA    1 
ATOM 7377  C C     . ALA C 3 48  ? 25.403  -4.532  57.041  1.00 572.09 ?  47   ALA Q C     1 
ATOM 7378  O O     . ALA C 3 48  ? 26.391  -4.270  57.736  1.00 572.09 ?  47   ALA Q O     1 
ATOM 7379  C CB    . ALA C 3 48  ? 23.697  -6.321  57.719  1.00 572.09 ?  47   ALA Q CB    1 
ATOM 7380  N N     . PRO C 3 49  ? 25.456  -4.523  55.694  1.00 576.21 ?  48   PRO Q N     1 
ATOM 7381  C CA    . PRO C 3 49  ? 26.714  -4.076  55.051  1.00 576.21 ?  48   PRO Q CA    1 
ATOM 7382  C C     . PRO C 3 49  ? 27.119  -2.711  55.539  1.00 576.21 ?  48   PRO Q C     1 
ATOM 7383  O O     . PRO C 3 49  ? 28.263  -2.536  55.972  1.00 576.21 ?  48   PRO Q O     1 
ATOM 7384  C CB    . PRO C 3 49  ? 26.373  -3.962  53.560  1.00 576.21 ?  48   PRO Q CB    1 
ATOM 7385  C CG    . PRO C 3 49  ? 25.100  -4.692  53.383  1.00 576.21 ?  48   PRO Q CG    1 
ATOM 7386  C CD    . PRO C 3 49  ? 24.427  -4.906  54.720  1.00 576.21 ?  48   PRO Q CD    1 
ATOM 7387  N N     . VAL C 3 50  ? 26.166  -1.770  55.484  1.00 571.87 ?  49   VAL Q N     1 
ATOM 7388  C CA    . VAL C 3 50  ? 26.360  -0.365  55.854  1.00 571.87 ?  49   VAL Q CA    1 
ATOM 7389  C C     . VAL C 3 50  ? 26.960  -0.260  57.233  1.00 571.87 ?  49   VAL Q C     1 
ATOM 7390  O O     . VAL C 3 50  ? 28.046  0.309   57.403  1.00 571.87 ?  49   VAL Q O     1 
ATOM 7391  C CB    . VAL C 3 50  ? 25.016  0.416   55.825  1.00 571.87 ?  49   VAL Q CB    1 
ATOM 7392  C CG1   . VAL C 3 50  ? 25.182  1.821   56.357  1.00 571.87 ?  49   VAL Q CG1   1 
ATOM 7393  C CG2   . VAL C 3 50  ? 24.445  0.464   54.418  1.00 571.87 ?  49   VAL Q CG2   1 
ATOM 7394  N N     . TYR C 3 51  ? 26.244  -0.822  58.202  1.00 577.69 ?  50   TYR Q N     1 
ATOM 7395  C CA    . TYR C 3 51  ? 26.682  -0.870  59.579  1.00 577.69 ?  50   TYR Q CA    1 
ATOM 7396  C C     . TYR C 3 51  ? 28.097  -1.428  59.667  1.00 577.69 ?  50   TYR Q C     1 
ATOM 7397  O O     . TYR C 3 51  ? 29.024  -0.747  60.128  1.00 577.69 ?  50   TYR Q O     1 
ATOM 7398  C CB    . TYR C 3 51  ? 25.725  -1.752  60.352  1.00 577.69 ?  50   TYR Q CB    1 
ATOM 7399  C CG    . TYR C 3 51  ? 25.721  -1.583  61.842  1.00 577.69 ?  50   TYR Q CG    1 
ATOM 7400  C CD1   . TYR C 3 51  ? 26.898  -1.644  62.584  1.00 577.69 ?  50   TYR Q CD1   1 
ATOM 7401  C CD2   . TYR C 3 51  ? 24.506  -1.401  62.528  1.00 577.69 ?  50   TYR Q CD2   1 
ATOM 7402  C CE1   . TYR C 3 51  ? 26.877  -1.510  63.992  1.00 577.69 ?  50   TYR Q CE1   1 
ATOM 7403  C CE2   . TYR C 3 51  ? 24.460  -1.278  63.938  1.00 577.69 ?  50   TYR Q CE2   1 
ATOM 7404  C CZ    . TYR C 3 51  ? 25.650  -1.332  64.660  1.00 577.69 ?  50   TYR Q CZ    1 
ATOM 7405  O OH    . TYR C 3 51  ? 25.609  -1.207  66.031  1.00 577.69 ?  50   TYR Q OH    1 
ATOM 7406  N N     . LEU C 3 52  ? 28.270  -2.664  59.202  1.00 581.36 ?  51   LEU Q N     1 
ATOM 7407  C CA    . LEU C 3 52  ? 29.590  -3.285  59.186  1.00 581.36 ?  51   LEU Q CA    1 
ATOM 7408  C C     . LEU C 3 52  ? 30.653  -2.441  58.457  1.00 581.36 ?  51   LEU Q C     1 
ATOM 7409  O O     . LEU C 3 52  ? 31.759  -2.278  58.970  1.00 581.36 ?  51   LEU Q O     1 
ATOM 7410  C CB    . LEU C 3 52  ? 29.498  -4.715  58.622  1.00 581.36 ?  51   LEU Q CB    1 
ATOM 7411  C CG    . LEU C 3 52  ? 30.690  -5.571  58.147  1.00 581.36 ?  51   LEU Q CG    1 
ATOM 7412  C CD1   . LEU C 3 52  ? 31.880  -5.586  59.113  1.00 581.36 ?  51   LEU Q CD1   1 
ATOM 7413  C CD2   . LEU C 3 52  ? 30.209  -6.982  57.885  1.00 581.36 ?  51   LEU Q CD2   1 
ATOM 7414  N N     . ALA C 3 53  ? 30.331  -1.888  57.291  1.00 574.04 ?  52   ALA Q N     1 
ATOM 7415  C CA    . ALA C 3 53  ? 31.341  -1.128  56.538  1.00 574.04 ?  52   ALA Q CA    1 
ATOM 7416  C C     . ALA C 3 53  ? 31.824  0.072   57.352  1.00 574.04 ?  52   ALA Q C     1 
ATOM 7417  O O     . ALA C 3 53  ? 32.997  0.483   57.265  1.00 574.04 ?  52   ALA Q O     1 
ATOM 7418  C CB    . ALA C 3 53  ? 30.812  -0.701  55.189  1.00 574.04 ?  52   ALA Q CB    1 
ATOM 7419  N N     . ALA C 3 54  ? 30.912  0.587   58.173  1.00 594.53 ?  53   ALA Q N     1 
ATOM 7420  C CA    . ALA C 3 54  ? 31.170  1.715   59.058  1.00 594.53 ?  53   ALA Q CA    1 
ATOM 7421  C C     . ALA C 3 54  ? 32.010  1.337   60.263  1.00 594.53 ?  53   ALA Q C     1 
ATOM 7422  O O     . ALA C 3 54  ? 32.968  2.036   60.616  1.00 594.53 ?  53   ALA Q O     1 
ATOM 7423  C CB    . ALA C 3 54  ? 29.848  2.293   59.530  1.00 594.53 ?  53   ALA Q CB    1 
ATOM 7424  N N     . VAL C 3 55  ? 31.618  0.247   60.920  1.00 577.61 ?  54   VAL Q N     1 
ATOM 7425  C CA    . VAL C 3 55  ? 32.388  -0.280  62.061  1.00 577.61 ?  54   VAL Q CA    1 
ATOM 7426  C C     . VAL C 3 55  ? 33.800  -0.642  61.636  1.00 577.61 ?  54   VAL Q C     1 
ATOM 7427  O O     . VAL C 3 55  ? 34.746  -0.411  62.373  1.00 577.61 ?  54   VAL Q O     1 
ATOM 7428  C CB    . VAL C 3 55  ? 31.757  -1.536  62.649  1.00 577.61 ?  54   VAL Q CB    1 
ATOM 7429  C CG1   . VAL C 3 55  ? 32.440  -1.892  63.942  1.00 577.61 ?  54   VAL Q CG1   1 
ATOM 7430  C CG2   . VAL C 3 55  ? 30.273  -1.327  62.840  1.00 577.61 ?  54   VAL Q CG2   1 
ATOM 7431  N N     . LEU C 3 56  ? 33.945  -1.232  60.461  1.00 578.62 ?  55   LEU Q N     1 
ATOM 7432  C CA    . LEU C 3 56  ? 35.289  -1.432  59.941  1.00 578.62 ?  55   LEU Q CA    1 
ATOM 7433  C C     . LEU C 3 56  ? 36.079  -0.121  59.947  1.00 578.62 ?  55   LEU Q C     1 
ATOM 7434  O O     . LEU C 3 56  ? 37.151  -0.079  60.524  1.00 578.62 ?  55   LEU Q O     1 
ATOM 7435  C CB    . LEU C 3 56  ? 35.255  -2.104  58.574  1.00 578.62 ?  55   LEU Q CB    1 
ATOM 7436  C CG    . LEU C 3 56  ? 35.079  -3.640  58.631  1.00 578.62 ?  55   LEU Q CG    1 
ATOM 7437  C CD1   . LEU C 3 56  ? 34.887  -4.247  57.258  1.00 578.62 ?  55   LEU Q CD1   1 
ATOM 7438  C CD2   . LEU C 3 56  ? 36.241  -4.305  59.316  1.00 578.62 ?  55   LEU Q CD2   1 
ATOM 7439  N N     . GLU C 3 57  ? 35.471  0.946   59.415  1.00 591.28 ?  56   GLU Q N     1 
ATOM 7440  C CA    . GLU C 3 57  ? 36.027  2.326   59.358  1.00 592.08 ?  56   GLU Q CA    1 
ATOM 7441  C C     . GLU C 3 57  ? 36.355  2.942   60.717  1.00 591.87 ?  56   GLU Q C     1 
ATOM 7442  O O     . GLU C 3 57  ? 37.446  3.525   60.909  1.00 591.29 ?  56   GLU Q O     1 
ATOM 7443  C CB    . GLU C 3 57  ? 35.082  3.273   58.585  1.00 591.92 ?  56   GLU Q CB    1 
ATOM 7444  C CG    . GLU C 3 57  ? 35.750  4.578   58.119  1.00 593.57 ?  56   GLU Q CG    1 
ATOM 7445  C CD    . GLU C 3 57  ? 34.940  5.416   57.087  1.00 593.61 ?  56   GLU Q CD    1 
ATOM 7446  O OE1   . GLU C 3 57  ? 34.313  4.870   56.149  1.00 593.06 ?  56   GLU Q OE1   1 
ATOM 7447  O OE2   . GLU C 3 57  ? 34.969  6.667   57.209  1.00 597.98 -1 56   GLU Q OE2   1 
ATOM 7448  N N     . TYR C 3 58  ? 35.423  2.821   61.660  1.00 584.24 ?  57   TYR Q N     1 
ATOM 7449  C CA    . TYR C 3 58  ? 35.681  3.348   62.986  1.00 584.80 ?  57   TYR Q CA    1 
ATOM 7450  C C     . TYR C 3 58  ? 37.029  2.807   63.447  1.00 584.74 ?  57   TYR Q C     1 
ATOM 7451  O O     . TYR C 3 58  ? 37.945  3.590   63.747  1.00 584.93 ?  57   TYR Q O     1 
ATOM 7452  C CB    . TYR C 3 58  ? 34.562  2.973   63.948  1.00 586.02 ?  57   TYR Q CB    1 
ATOM 7453  C CG    . TYR C 3 58  ? 34.901  3.140   65.419  1.00 587.97 ?  57   TYR Q CG    1 
ATOM 7454  C CD1   . TYR C 3 58  ? 35.270  4.390   65.955  1.00 589.71 ?  57   TYR Q CD1   1 
ATOM 7455  C CD2   . TYR C 3 58  ? 34.827  2.054   66.281  1.00 588.16 ?  57   TYR Q CD2   1 
ATOM 7456  C CE1   . TYR C 3 58  ? 35.569  4.532   67.327  1.00 589.99 ?  57   TYR Q CE1   1 
ATOM 7457  C CE2   . TYR C 3 58  ? 35.101  2.180   67.650  1.00 588.76 ?  57   TYR Q CE2   1 
ATOM 7458  C CZ    . TYR C 3 58  ? 35.472  3.412   68.172  1.00 590.21 ?  57   TYR Q CZ    1 
ATOM 7459  O OH    . TYR C 3 58  ? 35.762  3.497   69.539  1.00 589.93 ?  57   TYR Q OH    1 
ATOM 7460  N N     . LEU C 3 59  ? 37.166  1.469   63.431  1.00 587.28 ?  58   LEU Q N     1 
ATOM 7461  C CA    . LEU C 3 59  ? 38.384  0.777   63.888  1.00 586.22 ?  58   LEU Q CA    1 
ATOM 7462  C C     . LEU C 3 59  ? 39.657  1.085   63.085  1.00 585.66 ?  58   LEU Q C     1 
ATOM 7463  O O     . LEU C 3 59  ? 40.704  1.354   63.691  1.00 585.09 ?  58   LEU Q O     1 
ATOM 7464  C CB    . LEU C 3 59  ? 38.148  -0.710  63.952  1.00 586.25 ?  58   LEU Q CB    1 
ATOM 7465  C CG    . LEU C 3 59  ? 36.977  -1.129  64.842  1.00 587.09 ?  58   LEU Q CG    1 
ATOM 7466  C CD1   . LEU C 3 59  ? 36.475  -2.502  64.422  1.00 586.52 ?  58   LEU Q CD1   1 
ATOM 7467  C CD2   . LEU C 3 59  ? 37.391  -1.131  66.288  1.00 587.03 ?  58   LEU Q CD2   1 
ATOM 7468  N N     . THR C 3 60  ? 39.599  1.072   61.753  1.00 571.83 ?  59   THR Q N     1 
ATOM 7469  C CA    . THR C 3 60  ? 40.825  1.407   61.036  1.00 572.19 ?  59   THR Q CA    1 
ATOM 7470  C C     . THR C 3 60  ? 41.259  2.819   61.411  1.00 573.28 ?  59   THR Q C     1 
ATOM 7471  O O     . THR C 3 60  ? 42.449  3.066   61.608  1.00 573.11 ?  59   THR Q O     1 
ATOM 7472  C CB    . THR C 3 60  ? 40.774  1.259   59.487  1.00 572.37 ?  59   THR Q CB    1 
ATOM 7473  O OG1   . THR C 3 60  ? 40.981  2.537   58.871  1.00 570.33 ?  59   THR Q OG1   1 
ATOM 7474  C CG2   . THR C 3 60  ? 39.477  0.601   59.005  1.00 569.32 ?  59   THR Q CG2   1 
ATOM 7475  N N     . ALA C 3 61  ? 40.272  3.715   61.564  1.00 591.31 ?  60   ALA Q N     1 
ATOM 7476  C CA    . ALA C 3 61  ? 40.501  5.085   62.033  1.00 591.64 ?  60   ALA Q CA    1 
ATOM 7477  C C     . ALA C 3 61  ? 41.065  5.133   63.441  1.00 592.29 ?  60   ALA Q C     1 
ATOM 7478  O O     . ALA C 3 61  ? 42.157  5.662   63.658  1.00 592.54 ?  60   ALA Q O     1 
ATOM 7479  C CB    . ALA C 3 61  ? 39.228  5.860   61.970  1.00 592.09 ?  60   ALA Q CB    1 
ATOM 7480  N N     . GLU C 3 62  ? 40.320  4.574   64.393  1.00 585.28 ?  61   GLU Q N     1 
ATOM 7481  C CA    . GLU C 3 62  ? 40.783  4.439   65.766  1.00 586.49 ?  61   GLU Q CA    1 
ATOM 7482  C C     . GLU C 3 62  ? 42.232  3.967   65.841  1.00 587.18 ?  61   GLU Q C     1 
ATOM 7483  O O     . GLU C 3 62  ? 42.957  4.421   66.701  1.00 587.77 ?  61   GLU Q O     1 
ATOM 7484  C CB    . GLU C 3 62  ? 39.883  3.438   66.516  1.00 587.57 ?  61   GLU Q CB    1 
ATOM 7485  C CG    . GLU C 3 62  ? 40.180  3.243   67.981  1.00 587.91 ?  61   GLU Q CG    1 
ATOM 7486  C CD    . GLU C 3 62  ? 39.854  4.488   68.793  1.00 593.21 ?  61   GLU Q CD    1 
ATOM 7487  O OE1   . GLU C 3 62  ? 38.691  5.015   68.704  1.00 591.76 ?  61   GLU Q OE1   1 
ATOM 7488  O OE2   . GLU C 3 62  ? 40.786  4.933   69.512  1.00 595.16 -1 61   GLU Q OE2   1 
ATOM 7489  N N     . ILE C 3 63  ? 42.646  3.036   64.974  1.00 593.76 ?  62   ILE Q N     1 
ATOM 7490  C CA    . ILE C 3 63  ? 44.011  2.488   65.039  1.00 594.46 ?  62   ILE Q CA    1 
ATOM 7491  C C     . ILE C 3 63  ? 44.994  3.398   64.347  1.00 594.80 ?  62   ILE Q C     1 
ATOM 7492  O O     . ILE C 3 63  ? 45.975  3.802   64.947  1.00 595.00 ?  62   ILE Q O     1 
ATOM 7493  C CB    . ILE C 3 63  ? 44.129  1.009   64.502  1.00 595.08 ?  62   ILE Q CB    1 
ATOM 7494  C CG1   . ILE C 3 63  ? 43.442  0.051   65.476  1.00 594.98 ?  62   ILE Q CG1   1 
ATOM 7495  C CG2   . ILE C 3 63  ? 45.621  0.549   64.321  1.00 593.58 ?  62   ILE Q CG2   1 
ATOM 7496  C CD1   . ILE C 3 63  ? 43.461  -1.365  65.043  1.00 594.75 ?  62   ILE Q CD1   1 
ATOM 7497  N N     . LEU C 3 64  ? 44.736  3.705   63.085  1.00 592.45 ?  63   LEU Q N     1 
ATOM 7498  C CA    . LEU C 3 64  ? 45.580  4.640   62.345  1.00 593.85 ?  63   LEU Q CA    1 
ATOM 7499  C C     . LEU C 3 64  ? 45.902  5.908   63.150  1.00 594.90 ?  63   LEU Q C     1 
ATOM 7500  O O     . LEU C 3 64  ? 47.025  6.416   63.076  1.00 595.41 ?  63   LEU Q O     1 
ATOM 7501  C CB    . LEU C 3 64  ? 44.923  5.025   61.023  1.00 593.62 ?  63   LEU Q CB    1 
ATOM 7502  C CG    . LEU C 3 64  ? 44.856  3.898   60.000  1.00 593.17 ?  63   LEU Q CG    1 
ATOM 7503  C CD1   . LEU C 3 64  ? 43.735  4.157   59.008  1.00 592.14 ?  63   LEU Q CD1   1 
ATOM 7504  C CD2   . LEU C 3 64  ? 46.211  3.743   59.313  1.00 593.05 ?  63   LEU Q CD2   1 
ATOM 7505  N N     . GLU C 3 65  ? 44.923  6.393   63.927  1.00 612.61 ?  64   GLU Q N     1 
ATOM 7506  C CA    . GLU C 3 65  ? 45.102  7.561   64.790  1.00 612.75 ?  64   GLU Q CA    1 
ATOM 7507  C C     . GLU C 3 65  ? 46.290  7.337   65.701  1.00 612.20 ?  64   GLU Q C     1 
ATOM 7508  O O     . GLU C 3 65  ? 47.281  8.053   65.613  1.00 612.60 ?  64   GLU Q O     1 
ATOM 7509  C CB    . GLU C 3 65  ? 43.823  7.823   65.602  1.00 613.42 ?  64   GLU Q CB    1 
ATOM 7510  C CG    . GLU C 3 65  ? 43.863  9.014   66.608  1.00 615.45 ?  64   GLU Q CG    1 
ATOM 7511  C CD    . GLU C 3 65  ? 44.266  10.358  65.986  1.00 615.85 ?  64   GLU Q CD    1 
ATOM 7512  O OE1   . GLU C 3 65  ? 45.120  11.068  66.573  1.00 616.52 ?  64   GLU Q OE1   1 
ATOM 7513  O OE2   . GLU C 3 65  ? 43.732  10.707  64.918  1.00 615.91 -1 64   GLU Q OE2   1 
ATOM 7514  N N     . LEU C 3 66  ? 46.202  6.309   66.539  1.00 599.66 ?  65   LEU Q N     1 
ATOM 7515  C CA    . LEU C 3 66  ? 47.276  5.973   67.498  1.00 599.03 ?  65   LEU Q CA    1 
ATOM 7516  C C     . LEU C 3 66  ? 48.608  5.528   66.878  1.00 598.13 ?  65   LEU Q C     1 
ATOM 7517  O O     . LEU C 3 66  ? 49.668  5.649   67.511  1.00 597.17 ?  65   LEU Q O     1 
ATOM 7518  C CB    . LEU C 3 66  ? 46.790  4.909   68.469  1.00 598.53 ?  65   LEU Q CB    1 
ATOM 7519  C CG    . LEU C 3 66  ? 45.534  5.375   69.161  1.00 599.19 ?  65   LEU Q CG    1 
ATOM 7520  C CD1   . LEU C 3 66  ? 44.581  4.203   69.365  1.00 600.99 ?  65   LEU Q CD1   1 
ATOM 7521  C CD2   . LEU C 3 66  ? 45.924  6.001   70.474  1.00 601.26 ?  65   LEU Q CD2   1 
ATOM 7522  N N     . ALA C 3 67  ? 48.545  4.988   65.668  1.00 612.59 ?  66   ALA Q N     1 
ATOM 7523  C CA    . ALA C 3 67  ? 49.763  4.580   64.966  1.00 613.07 ?  66   ALA Q CA    1 
ATOM 7524  C C     . ALA C 3 67  ? 50.551  5.812   64.548  1.00 612.41 ?  66   ALA Q C     1 
ATOM 7525  O O     . ALA C 3 67  ? 51.718  5.941   64.887  1.00 611.82 ?  66   ALA Q O     1 
ATOM 7526  C CB    . ALA C 3 67  ? 49.455  3.686   63.767  1.00 613.35 ?  66   ALA Q CB    1 
ATOM 7527  N N     . GLY C 3 68  ? 49.876  6.721   63.849  1.00 612.04 ?  67   GLY Q N     1 
ATOM 7528  C CA    . GLY C 3 68  ? 50.416  8.050   63.478  1.00 611.91 ?  67   GLY Q CA    1 
ATOM 7529  C C     . GLY C 3 68  ? 51.070  8.811   64.615  1.00 611.59 ?  67   GLY Q C     1 
ATOM 7530  O O     . GLY C 3 68  ? 52.137  9.436   64.455  1.00 610.63 ?  67   GLY Q O     1 
ATOM 7531  N N     . ASN C 3 69  ? 50.450  8.737   65.781  1.00 626.38 ?  68   ASN Q N     1 
ATOM 7532  C CA    . ASN C 3 69  ? 51.039  9.361   66.943  1.00 627.38 ?  68   ASN Q CA    1 
ATOM 7533  C C     . ASN C 3 69  ? 52.313  8.659   67.302  1.00 627.90 ?  68   ASN Q C     1 
ATOM 7534  O O     . ASN C 3 69  ? 53.298  9.296   67.682  1.00 627.91 ?  68   ASN Q O     1 
ATOM 7535  C CB    . ASN C 3 69  ? 50.056  9.383   68.100  1.00 627.46 ?  68   ASN Q CB    1 
ATOM 7536  C CG    . ASN C 3 69  ? 48.856  10.255  67.794  1.00 628.65 ?  68   ASN Q CG    1 
ATOM 7537  O OD1   . ASN C 3 69  ? 48.912  11.106  66.881  1.00 627.93 ?  68   ASN Q OD1   1 
ATOM 7538  N ND2   . ASN C 3 69  ? 47.754  10.045  68.533  1.00 628.88 ?  68   ASN Q ND2   1 
ATOM 7539  N N     . ALA C 3 70  ? 52.298  7.336   67.133  1.00 642.61 ?  69   ALA Q N     1 
ATOM 7540  C CA    . ALA C 3 70  ? 53.457  6.518   67.426  1.00 642.60 ?  69   ALA Q CA    1 
ATOM 7541  C C     . ALA C 3 70  ? 54.529  6.839   66.407  1.00 642.85 ?  69   ALA Q C     1 
ATOM 7542  O O     . ALA C 3 70  ? 55.695  6.940   66.748  1.00 642.62 ?  69   ALA Q O     1 
ATOM 7543  C CB    . ALA C 3 70  ? 53.096  5.081   67.393  1.00 642.03 ?  69   ALA Q CB    1 
ATOM 7544  N N     . ALA C 3 71  ? 54.119  7.030   65.162  1.00 641.06 ?  70   ALA Q N     1 
ATOM 7545  C CA    . ALA C 3 71  ? 55.046  7.340   64.100  1.00 642.68 ?  70   ALA Q CA    1 
ATOM 7546  C C     . ALA C 3 71  ? 55.702  8.678   64.400  1.00 644.41 ?  70   ALA Q C     1 
ATOM 7547  O O     . ALA C 3 71  ? 56.927  8.814   64.253  1.00 644.42 ?  70   ALA Q O     1 
ATOM 7548  C CB    . ALA C 3 71  ? 54.331  7.384   62.792  1.00 642.32 ?  70   ALA Q CB    1 
ATOM 7549  N N     . ARG C 3 72  ? 54.875  9.635   64.863  1.00 625.96 ?  71   ARG Q N     1 
ATOM 7550  C CA    . ARG C 3 72  ? 55.288  11.018  65.152  1.00 627.36 ?  71   ARG Q CA    1 
ATOM 7551  C C     . ARG C 3 72  ? 56.402  11.072  66.197  1.00 627.80 ?  71   ARG Q C     1 
ATOM 7552  O O     . ARG C 3 72  ? 57.471  11.652  65.939  1.00 628.17 ?  71   ARG Q O     1 
ATOM 7553  C CB    . ARG C 3 72  ? 54.085  11.860  65.593  1.00 628.01 ?  71   ARG Q CB    1 
ATOM 7554  C CG    . ARG C 3 72  ? 54.372  13.340  65.902  1.00 630.95 ?  71   ARG Q CG    1 
ATOM 7555  C CD    . ARG C 3 72  ? 53.682  13.828  67.217  1.00 636.03 ?  71   ARG Q CD    1 
ATOM 7556  N NE    . ARG C 3 72  ? 54.054  15.223  67.529  1.00 637.22 ?  71   ARG Q NE    1 
ATOM 7557  C CZ    . ARG C 3 72  ? 53.303  16.121  68.197  1.00 637.22 ?  71   ARG Q CZ    1 
ATOM 7558  N NH1   . ARG C 3 72  ? 52.088  15.810  68.670  1.00 637.22 1  71   ARG Q NH1   1 
ATOM 7559  N NH2   . ARG C 3 72  ? 53.777  17.355  68.390  1.00 637.22 ?  71   ARG Q NH2   1 
ATOM 7560  N N     . ASP C 3 73  ? 56.171  10.460  67.356  1.00 640.67 ?  72   ASP Q N     1 
ATOM 7561  C CA    . ASP C 3 73  ? 57.179  10.422  68.410  1.00 641.61 ?  72   ASP Q CA    1 
ATOM 7562  C C     . ASP C 3 73  ? 58.479  9.819   67.879  1.00 642.18 ?  72   ASP Q C     1 
ATOM 7563  O O     . ASP C 3 73  ? 59.577  10.286  68.194  1.00 642.40 ?  72   ASP Q O     1 
ATOM 7564  C CB    . ASP C 3 73  ? 56.682  9.635   69.622  1.00 641.84 ?  72   ASP Q CB    1 
ATOM 7565  C CG    . ASP C 3 73  ? 55.179  9.802   69.863  1.00 643.16 ?  72   ASP Q CG    1 
ATOM 7566  O OD1   . ASP C 3 73  ? 54.606  10.845  69.468  1.00 644.95 ?  72   ASP Q OD1   1 
ATOM 7567  O OD2   . ASP C 3 73  ? 54.558  8.879   70.433  1.00 644.72 -1 72   ASP Q OD2   1 
ATOM 7568  N N     . ASN C 3 74  ? 58.367  8.798   67.043  1.00 642.52 ?  73   ASN Q N     1 
ATOM 7569  C CA    . ASN C 3 74  ? 59.563  8.217   66.442  1.00 643.15 ?  73   ASN Q CA    1 
ATOM 7570  C C     . ASN C 3 74  ? 60.050  9.025   65.223  1.00 642.93 ?  73   ASN Q C     1 
ATOM 7571  O O     . ASN C 3 74  ? 60.730  8.496   64.342  1.00 643.09 ?  73   ASN Q O     1 
ATOM 7572  C CB    . ASN C 3 74  ? 59.346  6.731   66.122  1.00 643.38 ?  73   ASN Q CB    1 
ATOM 7573  C CG    . ASN C 3 74  ? 59.218  5.869   67.388  1.00 645.14 ?  73   ASN Q CG    1 
ATOM 7574  O OD1   . ASN C 3 74  ? 60.152  5.142   67.745  1.00 646.03 ?  73   ASN Q OD1   1 
ATOM 7575  N ND2   . ASN C 3 74  ? 58.064  5.959   68.077  1.00 644.75 ?  73   ASN Q ND2   1 
ATOM 7576  N N     . LYS C 3 75  ? 59.706  10.313  65.212  1.00 643.33 ?  74   LYS Q N     1 
ATOM 7577  C CA    . LYS C 3 75  ? 60.074  11.272  64.151  1.00 643.33 ?  74   LYS Q CA    1 
ATOM 7578  C C     . LYS C 3 75  ? 59.882  10.774  62.728  1.00 643.33 ?  74   LYS Q C     1 
ATOM 7579  O O     . LYS C 3 75  ? 60.745  10.987  61.884  1.00 643.33 ?  74   LYS Q O     1 
ATOM 7580  C CB    . LYS C 3 75  ? 61.508  11.787  64.314  1.00 643.33 ?  74   LYS Q CB    1 
ATOM 7581  C CG    . LYS C 3 75  ? 61.925  12.100  65.740  1.00 643.33 ?  74   LYS Q CG    1 
ATOM 7582  C CD    . LYS C 3 75  ? 63.006  11.126  66.186  1.00 643.33 ?  74   LYS Q CD    1 
ATOM 7583  C CE    . LYS C 3 75  ? 63.051  10.944  67.696  1.00 643.33 ?  74   LYS Q CE    1 
ATOM 7584  N NZ    . LYS C 3 75  ? 63.760  9.654   67.969  1.00 643.33 1  74   LYS Q NZ    1 
ATOM 7585  N N     . LYS C 3 76  ? 58.759  10.124  62.444  1.00 634.67 ?  75   LYS Q N     1 
ATOM 7586  C CA    . LYS C 3 76  ? 58.622  9.533   61.126  1.00 634.67 ?  75   LYS Q CA    1 
ATOM 7587  C C     . LYS C 3 76  ? 57.325  9.863   60.413  1.00 634.67 ?  75   LYS Q C     1 
ATOM 7588  O O     . LYS C 3 76  ? 56.247  9.895   61.022  1.00 634.67 ?  75   LYS Q O     1 
ATOM 7589  C CB    . LYS C 3 76  ? 58.873  8.015   61.149  1.00 634.67 ?  75   LYS Q CB    1 
ATOM 7590  C CG    . LYS C 3 76  ? 60.261  7.627   61.631  1.00 634.67 ?  75   LYS Q CG    1 
ATOM 7591  C CD    . LYS C 3 76  ? 60.782  6.373   60.969  1.00 634.67 ?  75   LYS Q CD    1 
ATOM 7592  C CE    . LYS C 3 76  ? 62.256  6.534   60.538  1.00 634.67 ?  75   LYS Q CE    1 
ATOM 7593  N NZ    . LYS C 3 76  ? 63.111  7.269   61.536  1.00 634.67 1  75   LYS Q NZ    1 
ATOM 7594  N N     . THR C 3 77  ? 57.498  10.094  59.111  1.00 627.70 ?  76   THR Q N     1 
ATOM 7595  C CA    . THR C 3 77  ? 56.482  10.378  58.105  1.00 627.70 ?  76   THR Q CA    1 
ATOM 7596  C C     . THR C 3 77  ? 55.601  9.172   57.808  1.00 627.70 ?  76   THR Q C     1 
ATOM 7597  O O     . THR C 3 77  ? 54.461  9.317   57.364  1.00 627.70 ?  76   THR Q O     1 
ATOM 7598  C CB    . THR C 3 77  ? 57.205  10.747  56.749  1.00 627.70 ?  76   THR Q CB    1 
ATOM 7599  O OG1   . THR C 3 77  ? 58.063  11.877  56.939  1.00 627.70 ?  76   THR Q OG1   1 
ATOM 7600  C CG2   . THR C 3 77  ? 56.240  11.043  55.609  1.00 627.70 ?  76   THR Q CG2   1 
ATOM 7601  N N     . ARG C 3 78  ? 56.143  7.975   57.996  1.00 637.23 ?  77   ARG Q N     1 
ATOM 7602  C CA    . ARG C 3 78  ? 55.508  6.782   57.439  1.00 637.23 ?  77   ARG Q CA    1 
ATOM 7603  C C     . ARG C 3 78  ? 55.295  5.723   58.490  1.00 637.23 ?  77   ARG Q C     1 
ATOM 7604  O O     . ARG C 3 78  ? 56.255  5.310   59.147  1.00 637.23 ?  77   ARG Q O     1 
ATOM 7605  C CB    . ARG C 3 78  ? 56.365  6.225   56.317  1.00 637.23 ?  77   ARG Q CB    1 
ATOM 7606  C CG    . ARG C 3 78  ? 56.011  6.756   54.920  1.00 637.23 ?  77   ARG Q CG    1 
ATOM 7607  C CD    . ARG C 3 78  ? 56.672  5.822   53.918  1.00 637.23 ?  77   ARG Q CD    1 
ATOM 7608  N NE    . ARG C 3 78  ? 57.362  6.563   52.865  1.00 637.23 ?  77   ARG Q NE    1 
ATOM 7609  C CZ    . ARG C 3 78  ? 58.584  6.273   52.424  1.00 637.23 ?  77   ARG Q CZ    1 
ATOM 7610  N NH1   . ARG C 3 78  ? 59.277  5.265   52.958  1.00 637.23 1  77   ARG Q NH1   1 
ATOM 7611  N NH2   . ARG C 3 78  ? 59.124  7.012   51.457  1.00 637.23 ?  77   ARG Q NH2   1 
ATOM 7612  N N     . ILE C 3 79  ? 54.038  5.300   58.636  1.00 614.80 ?  78   ILE Q N     1 
ATOM 7613  C CA    . ILE C 3 79  ? 53.623  4.242   59.585  1.00 614.80 ?  78   ILE Q CA    1 
ATOM 7614  C C     . ILE C 3 79  ? 54.128  2.844   59.186  1.00 614.80 ?  78   ILE Q C     1 
ATOM 7615  O O     . ILE C 3 79  ? 53.656  2.265   58.216  1.00 614.80 ?  78   ILE Q O     1 
ATOM 7616  C CB    . ILE C 3 79  ? 52.079  4.165   59.675  1.00 614.80 ?  78   ILE Q CB    1 
ATOM 7617  C CG1   . ILE C 3 79  ? 51.478  5.548   59.961  1.00 614.80 ?  78   ILE Q CG1   1 
ATOM 7618  C CG2   . ILE C 3 79  ? 51.634  3.104   60.689  1.00 614.80 ?  78   ILE Q CG2   1 
ATOM 7619  C CD1   . ILE C 3 79  ? 50.001  5.537   60.390  1.00 614.80 ?  78   ILE Q CD1   1 
ATOM 7620  N N     . ILE C 3 80  ? 55.081  2.324   59.953  1.00 587.38 ?  79   ILE Q N     1 
ATOM 7621  C CA    . ILE C 3 80  ? 55.627  0.977   59.807  1.00 587.38 ?  79   ILE Q CA    1 
ATOM 7622  C C     . ILE C 3 80  ? 55.118  0.099   60.994  1.00 587.38 ?  79   ILE Q C     1 
ATOM 7623  O O     . ILE C 3 80  ? 54.768  0.634   62.034  1.00 587.38 ?  79   ILE Q O     1 
ATOM 7624  C CB    . ILE C 3 80  ? 57.170  1.040   59.793  1.00 587.38 ?  79   ILE Q CB    1 
ATOM 7625  C CG1   . ILE C 3 80  ? 57.719  1.262   61.201  1.00 587.38 ?  79   ILE Q CG1   1 
ATOM 7626  C CG2   . ILE C 3 80  ? 57.635  2.143   58.864  1.00 587.38 ?  79   ILE Q CG2   1 
ATOM 7627  C CD1   . ILE C 3 80  ? 59.207  1.500   61.288  1.00 587.38 ?  79   ILE Q CD1   1 
ATOM 7628  N N     . PRO C 3 81  ? 55.074  -1.241  60.845  1.00 597.35 ?  80   PRO Q N     1 
ATOM 7629  C CA    . PRO C 3 81  ? 54.347  -2.054  61.846  1.00 597.40 ?  80   PRO Q CA    1 
ATOM 7630  C C     . PRO C 3 81  ? 54.738  -1.853  63.320  1.00 597.92 ?  80   PRO Q C     1 
ATOM 7631  O O     . PRO C 3 81  ? 53.868  -1.936  64.183  1.00 598.08 ?  80   PRO Q O     1 
ATOM 7632  C CB    . PRO C 3 81  ? 54.594  -3.487  61.384  1.00 597.21 ?  80   PRO Q CB    1 
ATOM 7633  C CG    . PRO C 3 81  ? 54.821  -3.348  59.904  1.00 597.56 ?  80   PRO Q CG    1 
ATOM 7634  C CD    . PRO C 3 81  ? 55.612  -2.079  59.756  1.00 597.18 ?  80   PRO Q CD    1 
ATOM 7635  N N     . ARG C 3 82  ? 56.003  -1.552  63.629  1.00 599.16 ?  81   ARG Q N     1 
ATOM 7636  C CA    . ARG C 3 82  ? 56.320  -1.189  65.014  1.00 598.82 ?  81   ARG Q CA    1 
ATOM 7637  C C     . ARG C 3 82  ? 55.270  -0.171  65.460  1.00 598.52 ?  81   ARG Q C     1 
ATOM 7638  O O     . ARG C 3 82  ? 54.650  -0.308  66.530  1.00 599.95 ?  81   ARG Q O     1 
ATOM 7639  C CB    . ARG C 3 82  ? 57.698  -0.566  65.112  1.00 598.89 ?  81   ARG Q CB    1 
ATOM 7640  C CG    . ARG C 3 82  ? 57.985  0.092   66.448  1.00 600.55 ?  81   ARG Q CG    1 
ATOM 7641  C CD    . ARG C 3 82  ? 58.976  -0.689  67.332  1.00 603.38 ?  81   ARG Q CD    1 
ATOM 7642  N NE    . ARG C 3 82  ? 58.318  -1.343  68.457  1.00 604.44 ?  81   ARG Q NE    1 
ATOM 7643  C CZ    . ARG C 3 82  ? 58.904  -1.676  69.607  1.00 604.58 ?  81   ARG Q CZ    1 
ATOM 7644  N NH1   . ARG C 3 82  ? 60.182  -1.437  69.828  1.00 603.23 1  81   ARG Q NH1   1 
ATOM 7645  N NH2   . ARG C 3 82  ? 58.191  -2.269  70.550  1.00 606.94 ?  81   ARG Q NH2   1 
ATOM 7646  N N     . HIS C 3 83  ? 55.041  0.834   64.616  1.00 603.42 ?  82   HIS Q N     1 
ATOM 7647  C CA    . HIS C 3 83  ? 54.070  1.879   64.919  1.00 600.91 ?  82   HIS Q CA    1 
ATOM 7648  C C     . HIS C 3 83  ? 52.677  1.307   65.147  1.00 600.57 ?  82   HIS Q C     1 
ATOM 7649  O O     . HIS C 3 83  ? 51.929  1.854   65.972  1.00 600.39 ?  82   HIS Q O     1 
ATOM 7650  C CB    . HIS C 3 83  ? 54.018  2.916   63.825  1.00 598.79 ?  82   HIS Q CB    1 
ATOM 7651  C CG    . HIS C 3 83  ? 55.333  3.566   63.561  1.00 598.09 ?  82   HIS Q CG    1 
ATOM 7652  N ND1   . HIS C 3 83  ? 55.713  3.992   62.300  1.00 593.69 ?  82   HIS Q ND1   1 
ATOM 7653  C CD2   . HIS C 3 83  ? 56.356  3.872   64.396  1.00 594.10 ?  82   HIS Q CD2   1 
ATOM 7654  C CE1   . HIS C 3 83  ? 56.916  4.539   62.378  1.00 596.73 ?  82   HIS Q CE1   1 
ATOM 7655  N NE2   . HIS C 3 83  ? 57.333  4.466   63.633  1.00 596.39 ?  82   HIS Q NE2   1 
ATOM 7656  N N     . LEU C 3 84  ? 52.303  0.253   64.426  1.00 596.50 ?  83   LEU Q N     1 
ATOM 7657  C CA    . LEU C 3 84  ? 50.990  -0.325  64.705  1.00 597.08 ?  83   LEU Q CA    1 
ATOM 7658  C C     . LEU C 3 84  ? 51.050  -1.070  66.044  1.00 597.55 ?  83   LEU Q C     1 
ATOM 7659  O O     . LEU C 3 84  ? 50.132  -0.974  66.853  1.00 597.61 ?  83   LEU Q O     1 
ATOM 7660  C CB    . LEU C 3 84  ? 50.498  -1.233  63.588  1.00 596.65 ?  83   LEU Q CB    1 
ATOM 7661  C CG    . LEU C 3 84  ? 50.131  -0.608  62.232  1.00 595.29 ?  83   LEU Q CG    1 
ATOM 7662  C CD1   . LEU C 3 84  ? 49.821  -1.692  61.223  1.00 593.25 ?  83   LEU Q CD1   1 
ATOM 7663  C CD2   . LEU C 3 84  ? 48.956  0.344   62.315  1.00 594.05 ?  83   LEU Q CD2   1 
ATOM 7664  N N     . GLN C 3 85  ? 52.176  -1.743  66.290  1.00 596.00 ?  84   GLN Q N     1 
ATOM 7665  C CA    . GLN C 3 85  ? 52.338  -2.560  67.465  1.00 596.76 ?  84   GLN Q CA    1 
ATOM 7666  C C     . GLN C 3 85  ? 52.286  -1.711  68.741  1.00 596.37 ?  84   GLN Q C     1 
ATOM 7667  O O     . GLN C 3 85  ? 51.372  -1.897  69.572  1.00 596.00 ?  84   GLN Q O     1 
ATOM 7668  C CB    . GLN C 3 85  ? 53.601  -3.430  67.349  1.00 597.26 ?  84   GLN Q CB    1 
ATOM 7669  C CG    . GLN C 3 85  ? 54.056  -4.144  68.638  1.00 599.64 ?  84   GLN Q CG    1 
ATOM 7670  C CD    . GLN C 3 85  ? 53.136  -5.285  69.124  1.00 602.85 ?  84   GLN Q CD    1 
ATOM 7671  O OE1   . GLN C 3 85  ? 53.578  -6.116  69.914  1.00 606.33 ?  84   GLN Q OE1   1 
ATOM 7672  N NE2   . GLN C 3 85  ? 51.883  -5.329  68.668  1.00 599.63 ?  84   GLN Q NE2   1 
ATOM 7673  N N     . LEU C 3 86  ? 53.213  -0.755  68.856  1.00 592.07 ?  85   LEU Q N     1 
ATOM 7674  C CA    . LEU C 3 86  ? 53.144  0.310   69.884  1.00 591.62 ?  85   LEU Q CA    1 
ATOM 7675  C C     . LEU C 3 86  ? 51.710  0.861   70.092  1.00 591.33 ?  85   LEU Q C     1 
ATOM 7676  O O     . LEU C 3 86  ? 51.219  0.940   71.247  1.00 590.61 ?  85   LEU Q O     1 
ATOM 7677  C CB    . LEU C 3 86  ? 54.092  1.467   69.541  1.00 591.24 ?  85   LEU Q CB    1 
ATOM 7678  C CG    . LEU C 3 86  ? 55.585  1.149   69.351  1.00 591.58 ?  85   LEU Q CG    1 
ATOM 7679  C CD1   . LEU C 3 86  ? 56.399  2.397   69.323  1.00 589.79 ?  85   LEU Q CD1   1 
ATOM 7680  C CD2   . LEU C 3 86  ? 56.097  0.278   70.474  1.00 594.68 ?  85   LEU Q CD2   1 
ATOM 7681  N N     . ALA C 3 87  ? 51.055  1.235   68.989  1.00 591.21 ?  86   ALA Q N     1 
ATOM 7682  C CA    . ALA C 3 87  ? 49.678  1.632   69.043  1.00 591.57 ?  86   ALA Q CA    1 
ATOM 7683  C C     . ALA C 3 87  ? 48.839  0.573   69.808  1.00 592.93 ?  86   ALA Q C     1 
ATOM 7684  O O     . ALA C 3 87  ? 48.397  0.825   70.923  1.00 593.05 ?  86   ALA Q O     1 
ATOM 7685  C CB    . ALA C 3 87  ? 49.173  1.826   67.695  1.00 590.98 ?  86   ALA Q CB    1 
ATOM 7686  N N     . VAL C 3 88  ? 48.717  -0.628  69.243  1.00 581.74 ?  87   VAL Q N     1 
ATOM 7687  C CA    . VAL C 3 88  ? 47.876  -1.682  69.779  1.00 582.79 ?  87   VAL Q CA    1 
ATOM 7688  C C     . VAL C 3 88  ? 48.095  -2.081  71.246  1.00 583.38 ?  87   VAL Q C     1 
ATOM 7689  O O     . VAL C 3 88  ? 47.126  -2.218  71.986  1.00 583.21 ?  87   VAL Q O     1 
ATOM 7690  C CB    . VAL C 3 88  ? 47.914  -2.925  68.874  1.00 583.41 ?  87   VAL Q CB    1 
ATOM 7691  C CG1   . VAL C 3 88  ? 46.774  -3.905  69.256  1.00 582.36 ?  87   VAL Q CG1   1 
ATOM 7692  C CG2   . VAL C 3 88  ? 47.781  -2.481  67.398  1.00 582.82 ?  87   VAL Q CG2   1 
ATOM 7693  N N     . ARG C 3 89  ? 49.340  -2.262  71.671  1.00 582.51 ?  88   ARG Q N     1 
ATOM 7694  C CA    . ARG C 3 89  ? 49.578  -2.813  72.996  1.00 583.86 ?  88   ARG Q CA    1 
ATOM 7695  C C     . ARG C 3 89  ? 49.598  -1.718  74.045  1.00 584.28 ?  88   ARG Q C     1 
ATOM 7696  O O     . ARG C 3 89  ? 49.522  -1.980  75.243  1.00 584.80 ?  88   ARG Q O     1 
ATOM 7697  C CB    . ARG C 3 89  ? 50.863  -3.655  73.044  1.00 584.11 ?  88   ARG Q CB    1 
ATOM 7698  C CG    . ARG C 3 89  ? 51.189  -4.380  71.735  1.00 585.17 ?  88   ARG Q CG    1 
ATOM 7699  C CD    . ARG C 3 89  ? 50.966  -5.907  71.717  1.00 583.38 ?  88   ARG Q CD    1 
ATOM 7700  N NE    . ARG C 3 89  ? 49.590  -6.401  71.642  1.00 581.11 ?  88   ARG Q NE    1 
ATOM 7701  C CZ    . ARG C 3 89  ? 49.067  -7.126  70.649  1.00 579.92 ?  88   ARG Q CZ    1 
ATOM 7702  N NH1   . ARG C 3 89  ? 49.756  -7.413  69.560  1.00 580.78 1  88   ARG Q NH1   1 
ATOM 7703  N NH2   . ARG C 3 89  ? 47.812  -7.553  70.735  1.00 578.77 ?  88   ARG Q NH2   1 
ATOM 7704  N N     . ASN C 3 90  ? 49.674  -0.472  73.597  1.00 606.09 ?  89   ASN Q N     1 
ATOM 7705  C CA    . ASN C 3 90  ? 49.497  0.654   74.524  1.00 605.93 ?  89   ASN Q CA    1 
ATOM 7706  C C     . ASN C 3 90  ? 48.029  0.978   74.844  1.00 606.52 ?  89   ASN Q C     1 
ATOM 7707  O O     . ASN C 3 90  ? 47.743  1.483   75.924  1.00 606.87 ?  89   ASN Q O     1 
ATOM 7708  C CB    . ASN C 3 90  ? 50.259  1.861   74.039  1.00 604.77 ?  89   ASN Q CB    1 
ATOM 7709  C CG    . ASN C 3 90  ? 51.737  1.719   74.271  1.00 603.10 ?  89   ASN Q CG    1 
ATOM 7710  O OD1   . ASN C 3 90  ? 52.167  1.397   75.381  1.00 599.73 ?  89   ASN Q OD1   1 
ATOM 7711  N ND2   . ASN C 3 90  ? 52.536  1.956   73.224  1.00 602.05 ?  89   ASN Q ND2   1 
ATOM 7712  N N     . ASP C 3 91  ? 47.116  0.642   73.937  1.00 580.68 ?  90   ASP Q N     1 
ATOM 7713  C CA    . ASP C 3 91  ? 45.714  0.814   74.203  1.00 582.09 ?  90   ASP Q CA    1 
ATOM 7714  C C     . ASP C 3 91  ? 45.014  -0.376  74.898  1.00 582.86 ?  90   ASP Q C     1 
ATOM 7715  O O     . ASP C 3 91  ? 44.600  -1.337  74.235  1.00 583.23 ?  90   ASP Q O     1 
ATOM 7716  C CB    . ASP C 3 91  ? 44.992  1.122   72.913  1.00 582.46 ?  90   ASP Q CB    1 
ATOM 7717  C CG    . ASP C 3 91  ? 43.523  1.449   73.145  1.00 584.32 ?  90   ASP Q CG    1 
ATOM 7718  O OD1   . ASP C 3 91  ? 43.220  2.587   73.561  1.00 583.75 ?  90   ASP Q OD1   1 
ATOM 7719  O OD2   . ASP C 3 91  ? 42.677  0.554   72.928  1.00 587.81 -1 90   ASP Q OD2   1 
ATOM 7720  N N     . GLU C 3 92  ? 44.844  -0.310  76.214  1.00 549.62 ?  91   GLU Q N     1 
ATOM 7721  C CA    . GLU C 3 92  ? 44.151  -1.386  76.930  1.00 551.02 ?  91   GLU Q CA    1 
ATOM 7722  C C     . GLU C 3 92  ? 43.202  -2.122  76.011  1.00 551.18 ?  91   GLU Q C     1 
ATOM 7723  O O     . GLU C 3 92  ? 43.387  -3.310  75.779  1.00 552.43 ?  91   GLU Q O     1 
ATOM 7724  C CB    . GLU C 3 92  ? 43.367  -0.875  78.140  1.00 551.38 ?  91   GLU Q CB    1 
ATOM 7725  C CG    . GLU C 3 92  ? 43.341  -1.855  79.279  1.00 554.69 ?  91   GLU Q CG    1 
ATOM 7726  C CD    . GLU C 3 92  ? 42.222  -1.597  80.302  1.00 559.78 ?  91   GLU Q CD    1 
ATOM 7727  O OE1   . GLU C 3 92  ? 41.026  -1.502  79.900  1.00 560.17 ?  91   GLU Q OE1   1 
ATOM 7728  O OE2   . GLU C 3 92  ? 42.549  -1.521  81.514  1.00 560.71 -1 91   GLU Q OE2   1 
ATOM 7729  N N     . GLU C 3 93  ? 42.230  -1.409  75.447  1.00 581.92 ?  92   GLU Q N     1 
ATOM 7730  C CA    . GLU C 3 93  ? 41.130  -2.016  74.685  1.00 581.75 ?  92   GLU Q CA    1 
ATOM 7731  C C     . GLU C 3 93  ? 41.457  -2.627  73.308  1.00 581.07 ?  92   GLU Q C     1 
ATOM 7732  O O     . GLU C 3 93  ? 41.003  -3.730  73.012  1.00 580.89 ?  92   GLU Q O     1 
ATOM 7733  C CB    . GLU C 3 93  ? 40.003  -1.006  74.528  1.00 582.17 ?  92   GLU Q CB    1 
ATOM 7734  C CG    . GLU C 3 93  ? 38.987  -1.003  75.657  1.00 585.46 ?  92   GLU Q CG    1 
ATOM 7735  C CD    . GLU C 3 93  ? 37.740  -0.222  75.269  1.00 590.46 ?  92   GLU Q CD    1 
ATOM 7736  O OE1   . GLU C 3 93  ? 37.797  0.489   74.228  1.00 592.79 ?  92   GLU Q OE1   1 
ATOM 7737  O OE2   . GLU C 3 93  ? 36.712  -0.325  75.986  1.00 591.53 -1 92   GLU Q OE2   1 
ATOM 7738  N N     . LEU C 3 94  ? 42.175  -1.897  72.449  1.00 586.46 ?  93   LEU Q N     1 
ATOM 7739  C CA    . LEU C 3 94  ? 42.601  -2.438  71.148  1.00 585.83 ?  93   LEU Q CA    1 
ATOM 7740  C C     . LEU C 3 94  ? 43.428  -3.678  71.383  1.00 586.12 ?  93   LEU Q C     1 
ATOM 7741  O O     . LEU C 3 94  ? 43.217  -4.715  70.737  1.00 585.86 ?  93   LEU Q O     1 
ATOM 7742  C CB    . LEU C 3 94  ? 43.446  -1.439  70.355  1.00 585.45 ?  93   LEU Q CB    1 
ATOM 7743  C CG    . LEU C 3 94  ? 42.821  -0.533  69.291  1.00 584.83 ?  93   LEU Q CG    1 
ATOM 7744  C CD1   . LEU C 3 94  ? 43.962  0.154   68.521  1.00 584.32 ?  93   LEU Q CD1   1 
ATOM 7745  C CD2   . LEU C 3 94  ? 41.865  -1.259  68.301  1.00 581.09 ?  93   LEU Q CD2   1 
ATOM 7746  N N     . ASN C 3 95  ? 44.351  -3.561  72.343  1.00 580.57 ?  94   ASN Q N     1 
ATOM 7747  C CA    . ASN C 3 95  ? 45.199  -4.666  72.761  1.00 580.58 ?  94   ASN Q CA    1 
ATOM 7748  C C     . ASN C 3 95  ? 44.463  -5.943  73.120  1.00 580.30 ?  94   ASN Q C     1 
ATOM 7749  O O     . ASN C 3 95  ? 45.074  -7.003  73.097  1.00 582.00 ?  94   ASN Q O     1 
ATOM 7750  C CB    . ASN C 3 95  ? 46.037  -4.276  73.969  1.00 580.64 ?  94   ASN Q CB    1 
ATOM 7751  C CG    . ASN C 3 95  ? 46.703  -5.487  74.629  1.00 580.82 ?  94   ASN Q CG    1 
ATOM 7752  O OD1   . ASN C 3 95  ? 47.682  -6.032  74.112  1.00 579.03 ?  94   ASN Q OD1   1 
ATOM 7753  N ND2   . ASN C 3 95  ? 46.152  -5.921  75.757  1.00 580.14 ?  94   ASN Q ND2   1 
ATOM 7754  N N     . LYS C 3 96  ? 43.191  -5.846  73.496  1.00 577.24 ?  95   LYS Q N     1 
ATOM 7755  C CA    . LYS C 3 96  ? 42.419  -7.000  73.931  1.00 576.18 ?  95   LYS Q CA    1 
ATOM 7756  C C     . LYS C 3 96  ? 41.696  -7.563  72.725  1.00 575.66 ?  95   LYS Q C     1 
ATOM 7757  O O     . LYS C 3 96  ? 41.690  -8.776  72.500  1.00 575.76 ?  95   LYS Q O     1 
ATOM 7758  C CB    . LYS C 3 96  ? 41.429  -6.640  75.036  1.00 576.34 ?  95   LYS Q CB    1 
ATOM 7759  C CG    . LYS C 3 96  ? 40.603  -7.811  75.509  1.00 577.48 ?  95   LYS Q CG    1 
ATOM 7760  C CD    . LYS C 3 96  ? 39.380  -7.328  76.235  1.00 583.51 ?  95   LYS Q CD    1 
ATOM 7761  C CE    . LYS C 3 96  ? 38.705  -8.443  77.096  1.00 587.26 ?  95   LYS Q CE    1 
ATOM 7762  N NZ    . LYS C 3 96  ? 37.497  -7.921  77.841  1.00 588.26 1  95   LYS Q NZ    1 
ATOM 7763  N N     . LEU C 3 97  ? 41.091  -6.691  71.931  1.00 586.86 ?  96   LEU Q N     1 
ATOM 7764  C CA    . LEU C 3 97  ? 40.624  -7.111  70.601  1.00 585.88 ?  96   LEU Q CA    1 
ATOM 7765  C C     . LEU C 3 97  ? 41.674  -7.955  69.852  1.00 584.45 ?  96   LEU Q C     1 
ATOM 7766  O O     . LEU C 3 97  ? 41.335  -8.967  69.225  1.00 584.60 ?  96   LEU Q O     1 
ATOM 7767  C CB    . LEU C 3 97  ? 40.234  -5.904  69.750  1.00 585.72 ?  96   LEU Q CB    1 
ATOM 7768  C CG    . LEU C 3 97  ? 39.418  -6.262  68.512  1.00 586.45 ?  96   LEU Q CG    1 
ATOM 7769  C CD1   . LEU C 3 97  ? 38.069  -6.879  68.900  1.00 585.96 ?  96   LEU Q CD1   1 
ATOM 7770  C CD2   . LEU C 3 97  ? 39.254  -5.035  67.600  1.00 586.26 ?  96   LEU Q CD2   1 
ATOM 7771  N N     . LEU C 3 98  ? 42.939  -7.546  69.925  1.00 581.68 ?  97   LEU Q N     1 
ATOM 7772  C CA    . LEU C 3 98  ? 44.015  -8.278  69.245  1.00 580.68 ?  97   LEU Q CA    1 
ATOM 7773  C C     . LEU C 3 98  ? 44.942  -8.957  70.249  1.00 579.94 ?  97   LEU Q C     1 
ATOM 7774  O O     . LEU C 3 98  ? 46.196  -8.976  70.065  1.00 580.39 ?  97   LEU Q O     1 
ATOM 7775  C CB    . LEU C 3 98  ? 44.839  -7.363  68.342  1.00 579.94 ?  97   LEU Q CB    1 
ATOM 7776  C CG    . LEU C 3 98  ? 44.119  -6.351  67.484  1.00 580.09 ?  97   LEU Q CG    1 
ATOM 7777  C CD1   . LEU C 3 98  ? 45.109  -5.846  66.448  1.00 583.00 ?  97   LEU Q CD1   1 
ATOM 7778  C CD2   . LEU C 3 98  ? 42.934  -6.961  66.811  1.00 579.42 ?  97   LEU Q CD2   1 
ATOM 7779  N N     . GLY C 3 99  ? 44.336  -9.523  71.286  1.00 565.67 ?  98   GLY Q N     1 
ATOM 7780  C CA    . GLY C 3 99  ? 45.088  -10.157 72.337  1.00 564.04 ?  98   GLY Q CA    1 
ATOM 7781  C C     . GLY C 3 99  ? 45.665  -11.490 71.924  1.00 563.23 ?  98   GLY Q C     1 
ATOM 7782  O O     . GLY C 3 99  ? 46.612  -11.946 72.542  1.00 563.29 ?  98   GLY Q O     1 
ATOM 7783  N N     . ARG C 3 100 ? 45.093  -12.127 70.907  1.00 535.23 ?  99   ARG Q N     1 
ATOM 7784  C CA    . ARG C 3 100 ? 45.695  -13.328 70.322  1.00 536.39 ?  99   ARG Q CA    1 
ATOM 7785  C C     . ARG C 3 100 ? 46.218  -13.086 68.898  1.00 536.69 ?  99   ARG Q C     1 
ATOM 7786  O O     . ARG C 3 100 ? 46.007  -13.942 68.030  1.00 536.98 ?  99   ARG Q O     1 
ATOM 7787  C CB    . ARG C 3 100 ? 44.738  -14.521 70.308  1.00 536.35 ?  99   ARG Q CB    1 
ATOM 7788  C CG    . ARG C 3 100 ? 44.032  -14.715 71.638  1.00 542.17 ?  99   ARG Q CG    1 
ATOM 7789  C CD    . ARG C 3 100 ? 43.840  -16.193 72.045  1.00 548.82 ?  99   ARG Q CD    1 
ATOM 7790  N NE    . ARG C 3 100 ? 43.862  -16.315 73.509  1.00 552.01 ?  99   ARG Q NE    1 
ATOM 7791  C CZ    . ARG C 3 100 ? 44.975  -16.286 74.250  1.00 554.99 ?  99   ARG Q CZ    1 
ATOM 7792  N NH1   . ARG C 3 100 ? 46.172  -16.155 73.664  1.00 554.07 1  99   ARG Q NH1   1 
ATOM 7793  N NH2   . ARG C 3 100 ? 44.896  -16.395 75.582  1.00 555.74 ?  99   ARG Q NH2   1 
ATOM 7794  N N     . VAL C 3 101 ? 46.927  -11.973 68.650  1.00 553.80 ?  100  VAL Q N     1 
ATOM 7795  C CA    . VAL C 3 101 ? 47.326  -11.691 67.266  1.00 554.88 ?  100  VAL Q CA    1 
ATOM 7796  C C     . VAL C 3 101 ? 48.762  -11.211 67.117  1.00 555.46 ?  100  VAL Q C     1 
ATOM 7797  O O     . VAL C 3 101 ? 49.333  -10.543 67.993  1.00 556.57 ?  100  VAL Q O     1 
ATOM 7798  C CB    . VAL C 3 101 ? 46.404  -10.675 66.575  1.00 554.47 ?  100  VAL Q CB    1 
ATOM 7799  C CG1   . VAL C 3 101 ? 47.011  -10.252 65.246  1.00 555.68 ?  100  VAL Q CG1   1 
ATOM 7800  C CG2   . VAL C 3 101 ? 45.045  -11.261 66.350  1.00 554.75 ?  100  VAL Q CG2   1 
ATOM 7801  N N     . THR C 3 102 ? 49.371  -11.545 66.008  1.00 568.60 ?  101  THR Q N     1 
ATOM 7802  C CA    . THR C 3 102 ? 50.762  -11.205 65.902  1.00 569.03 ?  101  THR Q CA    1 
ATOM 7803  C C     . THR C 3 102 ? 50.936  -10.298 64.764  1.00 568.37 ?  101  THR Q C     1 
ATOM 7804  O O     . THR C 3 102 ? 50.333  -10.487 63.715  1.00 569.35 ?  101  THR Q O     1 
ATOM 7805  C CB    . THR C 3 102 ? 51.648  -12.445 65.809  1.00 569.26 ?  101  THR Q CB    1 
ATOM 7806  O OG1   . THR C 3 102 ? 51.536  -13.126 67.064  1.00 571.93 ?  101  THR Q OG1   1 
ATOM 7807  C CG2   . THR C 3 102 ? 53.157  -12.072 65.546  1.00 566.95 ?  101  THR Q CG2   1 
ATOM 7808  N N     . ILE C 3 103 ? 51.728  -9.275  64.989  1.00 572.23 ?  102  ILE Q N     1 
ATOM 7809  C CA    . ILE C 3 103 ? 52.024  -8.362  63.901  1.00 571.71 ?  102  ILE Q CA    1 
ATOM 7810  C C     . ILE C 3 103 ? 53.416  -8.590  63.407  1.00 571.04 ?  102  ILE Q C     1 
ATOM 7811  O O     . ILE C 3 103 ? 54.383  -8.284  64.104  1.00 570.34 ?  102  ILE Q O     1 
ATOM 7812  C CB    . ILE C 3 103 ? 51.798  -6.877  64.344  1.00 572.00 ?  102  ILE Q CB    1 
ATOM 7813  C CG1   . ILE C 3 103 ? 50.316  -6.661  64.662  1.00 567.67 ?  102  ILE Q CG1   1 
ATOM 7814  C CG2   . ILE C 3 103 ? 52.381  -5.833  63.289  1.00 571.94 ?  102  ILE Q CG2   1 
ATOM 7815  C CD1   . ILE C 3 103 ? 50.111  -5.421  65.398  1.00 565.27 ?  102  ILE Q CD1   1 
ATOM 7816  N N     . ALA C 3 104 ? 53.528  -9.159  62.217  1.00 576.39 ?  103  ALA Q N     1 
ATOM 7817  C CA    . ALA C 3 104 ? 54.847  -9.181  61.516  1.00 577.97 ?  103  ALA Q CA    1 
ATOM 7818  C C     . ALA C 3 104 ? 55.681  -7.900  61.794  1.00 578.74 ?  103  ALA Q C     1 
ATOM 7819  O O     . ALA C 3 104 ? 55.190  -6.798  61.608  1.00 579.77 ?  103  ALA Q O     1 
ATOM 7820  C CB    . ALA C 3 104 ? 54.645  -9.352  60.030  1.00 577.24 ?  103  ALA Q CB    1 
ATOM 7821  N N     . GLN C 3 105 ? 56.906  -8.026  62.280  1.00 574.47 ?  104  GLN Q N     1 
ATOM 7822  C CA    . GLN C 3 105 ? 57.752  -6.858  62.535  1.00 576.42 ?  104  GLN Q CA    1 
ATOM 7823  C C     . GLN C 3 105 ? 57.325  -5.893  63.682  1.00 577.18 ?  104  GLN Q C     1 
ATOM 7824  O O     . GLN C 3 105 ? 58.019  -4.926  63.985  1.00 576.72 ?  104  GLN Q O     1 
ATOM 7825  C CB    . GLN C 3 105 ? 58.048  -6.118  61.222  1.00 577.03 ?  104  GLN Q CB    1 
ATOM 7826  C CG    . GLN C 3 105 ? 58.968  -6.921  60.297  1.00 579.45 ?  104  GLN Q CG    1 
ATOM 7827  C CD    . GLN C 3 105 ? 60.305  -7.223  60.987  1.00 585.33 ?  104  GLN Q CD    1 
ATOM 7828  O OE1   . GLN C 3 105 ? 61.104  -6.300  61.260  1.00 588.04 ?  104  GLN Q OE1   1 
ATOM 7829  N NE2   . GLN C 3 105 ? 60.542  -8.509  61.309  1.00 585.32 ?  104  GLN Q NE2   1 
ATOM 7830  N N     . GLY C 3 106 ? 56.209  -6.192  64.344  1.00 583.88 ?  105  GLY Q N     1 
ATOM 7831  C CA    . GLY C 3 106 ? 55.884  -5.590  65.628  1.00 584.45 ?  105  GLY Q CA    1 
ATOM 7832  C C     . GLY C 3 106 ? 57.003  -5.390  66.637  1.00 585.47 ?  105  GLY Q C     1 
ATOM 7833  O O     . GLY C 3 106 ? 57.284  -4.267  67.016  1.00 587.21 ?  105  GLY Q O     1 
ATOM 7834  N N     . GLY C 3 107 ? 57.666  -6.442  67.094  1.00 576.54 ?  106  GLY Q N     1 
ATOM 7835  C CA    . GLY C 3 107 ? 58.603  -6.281  68.216  1.00 576.58 ?  106  GLY Q CA    1 
ATOM 7836  C C     . GLY C 3 107 ? 57.746  -6.348  69.469  1.00 577.44 ?  106  GLY Q C     1 
ATOM 7837  O O     . GLY C 3 107 ? 56.552  -6.650  69.375  1.00 576.30 ?  106  GLY Q O     1 
ATOM 7838  N N     . VAL C 3 108 ? 58.333  -6.071  70.636  1.00 588.89 ?  107  VAL Q N     1 
ATOM 7839  C CA    . VAL C 3 108 ? 57.534  -6.007  71.892  1.00 590.26 ?  107  VAL Q CA    1 
ATOM 7840  C C     . VAL C 3 108 ? 57.627  -4.646  72.622  1.00 591.36 ?  107  VAL Q C     1 
ATOM 7841  O O     . VAL C 3 108 ? 58.485  -3.813  72.278  1.00 591.67 ?  107  VAL Q O     1 
ATOM 7842  C CB    . VAL C 3 108 ? 57.880  -7.146  72.869  1.00 589.94 ?  107  VAL Q CB    1 
ATOM 7843  C CG1   . VAL C 3 108 ? 57.888  -8.468  72.155  1.00 591.03 ?  107  VAL Q CG1   1 
ATOM 7844  C CG2   . VAL C 3 108 ? 59.212  -6.905  73.554  1.00 588.98 ?  107  VAL Q CG2   1 
ATOM 7845  N N     . LEU C 3 109 ? 56.765  -4.417  73.622  1.00 599.59 ?  108  LEU Q N     1 
ATOM 7846  C CA    . LEU C 3 109 ? 56.863  -3.179  74.431  1.00 600.20 ?  108  LEU Q CA    1 
ATOM 7847  C C     . LEU C 3 109 ? 58.034  -3.202  75.390  1.00 601.45 ?  108  LEU Q C     1 
ATOM 7848  O O     . LEU C 3 109 ? 58.250  -4.221  76.046  1.00 601.15 ?  108  LEU Q O     1 
ATOM 7849  C CB    . LEU C 3 109 ? 55.584  -2.878  75.214  1.00 599.29 ?  108  LEU Q CB    1 
ATOM 7850  C CG    . LEU C 3 109 ? 54.404  -2.429  74.366  1.00 597.32 ?  108  LEU Q CG    1 
ATOM 7851  C CD1   . LEU C 3 109 ? 53.231  -2.050  75.255  1.00 595.41 ?  108  LEU Q CD1   1 
ATOM 7852  C CD2   . LEU C 3 109 ? 54.816  -1.333  73.382  1.00 593.60 ?  108  LEU Q CD2   1 
ATOM 7853  N N     . PRO C 3 110 ? 58.801  -2.082  75.466  1.00 610.27 ?  109  PRO Q N     1 
ATOM 7854  C CA    . PRO C 3 110 ? 59.899  -2.010  76.428  1.00 611.50 ?  109  PRO Q CA    1 
ATOM 7855  C C     . PRO C 3 110 ? 59.340  -2.042  77.834  1.00 612.83 ?  109  PRO Q C     1 
ATOM 7856  O O     . PRO C 3 110 ? 58.660  -1.122  78.247  1.00 612.89 ?  109  PRO Q O     1 
ATOM 7857  C CB    . PRO C 3 110 ? 60.574  -0.672  76.107  1.00 610.64 ?  109  PRO Q CB    1 
ATOM 7858  C CG    . PRO C 3 110 ? 60.151  -0.354  74.714  1.00 610.48 ?  109  PRO Q CG    1 
ATOM 7859  C CD    . PRO C 3 110 ? 58.728  -0.844  74.669  1.00 610.35 ?  109  PRO Q CD    1 
ATOM 7860  N N     . ASN C 3 111 ? 59.597  -3.151  78.513  1.00 602.86 ?  110  ASN Q N     1 
ATOM 7861  C CA    . ASN C 3 111 ? 59.191  -3.393  79.883  1.00 604.22 ?  110  ASN Q CA    1 
ATOM 7862  C C     . ASN C 3 111 ? 60.211  -4.367  80.478  1.00 604.22 ?  110  ASN Q C     1 
ATOM 7863  O O     . ASN C 3 111 ? 60.372  -5.481  79.983  1.00 604.22 ?  110  ASN Q O     1 
ATOM 7864  C CB    . ASN C 3 111 ? 57.760  -3.965  79.935  1.00 604.22 ?  110  ASN Q CB    1 
ATOM 7865  C CG    . ASN C 3 111 ? 57.313  -4.349  81.355  1.00 604.22 ?  110  ASN Q CG    1 
ATOM 7866  O OD1   . ASN C 3 111 ? 58.002  -4.060  82.346  1.00 604.22 ?  110  ASN Q OD1   1 
ATOM 7867  N ND2   . ASN C 3 111 ? 56.145  -5.000  81.457  1.00 604.22 ?  110  ASN Q ND2   1 
ATOM 7868  N N     . ILE C 3 112 ? 60.922  -3.908  81.508  1.00 619.81 ?  111  ILE Q N     1 
ATOM 7869  C CA    . ILE C 3 112 ? 61.930  -4.688  82.223  1.00 619.81 ?  111  ILE Q CA    1 
ATOM 7870  C C     . ILE C 3 112 ? 61.488  -4.827  83.660  1.00 619.81 ?  111  ILE Q C     1 
ATOM 7871  O O     . ILE C 3 112 ? 61.196  -3.830  84.321  1.00 619.81 ?  111  ILE Q O     1 
ATOM 7872  C CB    . ILE C 3 112 ? 63.306  -3.988  82.242  1.00 619.81 ?  111  ILE Q CB    1 
ATOM 7873  C CG1   . ILE C 3 112 ? 63.894  -3.909  80.825  1.00 619.81 ?  111  ILE Q CG1   1 
ATOM 7874  C CG2   . ILE C 3 112 ? 64.253  -4.676  83.238  1.00 619.81 ?  111  ILE Q CG2   1 
ATOM 7875  C CD1   . ILE C 3 112 ? 65.331  -3.377  80.750  1.00 619.81 ?  111  ILE Q CD1   1 
ATOM 7876  N N     . GLN C 3 113 ? 61.458  -6.061  84.151  1.00 645.78 ?  112  GLN Q N     1 
ATOM 7877  C CA    . GLN C 3 113 ? 60.949  -6.343  85.491  1.00 645.78 ?  112  GLN Q CA    1 
ATOM 7878  C C     . GLN C 3 113 ? 61.830  -5.692  86.542  1.00 645.78 ?  112  GLN Q C     1 
ATOM 7879  O O     . GLN C 3 113 ? 63.045  -5.534  86.329  1.00 645.78 ?  112  GLN Q O     1 
ATOM 7880  C CB    . GLN C 3 113 ? 60.846  -7.852  85.715  1.00 645.78 ?  112  GLN Q CB    1 
ATOM 7881  C CG    . GLN C 3 113 ? 59.747  -8.515  84.896  1.00 645.78 ?  112  GLN Q CG    1 
ATOM 7882  C CD    . GLN C 3 113 ? 58.379  -8.375  85.540  1.00 645.78 ?  112  GLN Q CD    1 
ATOM 7883  O OE1   . GLN C 3 113 ? 58.204  -8.669  86.734  1.00 645.78 ?  112  GLN Q OE1   1 
ATOM 7884  N NE2   . GLN C 3 113 ? 57.393  -7.938  84.751  1.00 645.78 ?  112  GLN Q NE2   1 
ATOM 7885  N N     . SER C 3 114 ? 61.194  -5.314  87.658  1.00 641.80 ?  113  SER Q N     1 
ATOM 7886  C CA    . SER C 3 114 ? 61.834  -4.609  88.778  1.00 641.80 ?  113  SER Q CA    1 
ATOM 7887  C C     . SER C 3 114 ? 63.063  -5.324  89.293  1.00 641.80 ?  113  SER Q C     1 
ATOM 7888  O O     . SER C 3 114 ? 64.169  -4.788  89.238  1.00 641.80 ?  113  SER Q O     1 
ATOM 7889  C CB    . SER C 3 114 ? 60.858  -4.467  89.942  1.00 641.80 ?  113  SER Q CB    1 
ATOM 7890  O OG    . SER C 3 114 ? 59.770  -3.650  89.581  1.00 641.80 ?  113  SER Q OG    1 
ATOM 7891  N N     . VAL C 3 115 ? 62.847  -6.542  89.790  1.00 658.53 ?  114  VAL Q N     1 
ATOM 7892  C CA    . VAL C 3 115 ? 63.870  -7.338  90.470  1.00 658.53 ?  114  VAL Q CA    1 
ATOM 7893  C C     . VAL C 3 115 ? 65.136  -7.575  89.634  1.00 658.53 ?  114  VAL Q C     1 
ATOM 7894  O O     . VAL C 3 115 ? 66.139  -8.057  90.155  1.00 658.53 ?  114  VAL Q O     1 
ATOM 7895  C CB    . VAL C 3 115 ? 63.288  -8.690  90.980  1.00 658.53 ?  114  VAL Q CB    1 
ATOM 7896  C CG1   . VAL C 3 115 ? 62.788  -8.568  92.416  1.00 658.53 ?  114  VAL Q CG1   1 
ATOM 7897  C CG2   . VAL C 3 115 ? 62.165  -9.168  90.074  1.00 658.53 ?  114  VAL Q CG2   1 
ATOM 7898  N N     . LEU C 3 116 ? 65.094  -7.219  88.355  1.00 649.67 ?  115  LEU Q N     1 
ATOM 7899  C CA    . LEU C 3 116 ? 66.248  -7.389  87.466  1.00 649.67 ?  115  LEU Q CA    1 
ATOM 7900  C C     . LEU C 3 116 ? 67.077  -6.108  87.359  1.00 649.67 ?  115  LEU Q C     1 
ATOM 7901  O O     . LEU C 3 116 ? 68.171  -6.112  86.774  1.00 649.67 ?  115  LEU Q O     1 
ATOM 7902  C CB    . LEU C 3 116 ? 65.807  -7.858  86.071  1.00 649.67 ?  115  LEU Q CB    1 
ATOM 7903  C CG    . LEU C 3 116 ? 64.631  -8.835  85.920  1.00 649.67 ?  115  LEU Q CG    1 
ATOM 7904  C CD1   . LEU C 3 116 ? 64.432  -9.151  84.460  1.00 649.67 ?  115  LEU Q CD1   1 
ATOM 7905  C CD2   . LEU C 3 116 ? 64.800  -10.118 86.738  1.00 649.67 ?  115  LEU Q CD2   1 
ATOM 7906  N N     . LEU C 3 117 ? 66.539  -5.021  87.926  1.00 615.62 ?  116  LEU Q N     1 
ATOM 7907  C CA    . LEU C 3 117 ? 67.200  -3.707  87.969  1.00 615.62 ?  116  LEU Q CA    1 
ATOM 7908  C C     . LEU C 3 117 ? 68.176  -3.600  89.139  1.00 615.62 ?  116  LEU Q C     1 
ATOM 7909  O O     . LEU C 3 117 ? 67.843  -4.008  90.257  1.00 615.62 ?  116  LEU Q O     1 
ATOM 7910  C CB    . LEU C 3 117 ? 66.165  -2.583  88.066  1.00 615.62 ?  116  LEU Q CB    1 
ATOM 7911  C CG    . LEU C 3 117 ? 65.344  -2.247  86.823  1.00 615.62 ?  116  LEU Q CG    1 
ATOM 7912  C CD1   . LEU C 3 117 ? 64.084  -1.465  87.210  1.00 615.62 ?  116  LEU Q CD1   1 
ATOM 7913  C CD2   . LEU C 3 117 ? 66.177  -1.478  85.794  1.00 615.62 ?  116  LEU Q CD2   1 
ATOM 7914  N N     . PRO C 3 118 ? 69.380  -3.039  88.889  1.00 614.50 ?  117  PRO Q N     1 
ATOM 7915  C CA    . PRO C 3 118 ? 70.403  -2.845  89.937  1.00 614.50 ?  117  PRO Q CA    1 
ATOM 7916  C C     . PRO C 3 118 ? 69.936  -1.893  91.052  1.00 614.50 ?  117  PRO Q C     1 
ATOM 7917  O O     . PRO C 3 118 ? 69.108  -1.007  90.806  1.00 614.50 ?  117  PRO Q O     1 
ATOM 7918  C CB    . PRO C 3 118 ? 71.583  -2.232  89.170  1.00 614.50 ?  117  PRO Q CB    1 
ATOM 7919  C CG    . PRO C 3 118 ? 70.972  -1.640  87.921  1.00 614.50 ?  117  PRO Q CG    1 
ATOM 7920  C CD    . PRO C 3 118 ? 69.837  -2.547  87.573  1.00 614.50 ?  117  PRO Q CD    1 
ATOM 7921  N N     . LYS C 3 119 ? 70.461  -2.075  92.263  1.00 582.67 ?  118  LYS Q N     1 
ATOM 7922  C CA    . LYS C 3 119 ? 70.038  -1.273  93.423  1.00 582.67 ?  118  LYS Q CA    1 
ATOM 7923  C C     . LYS C 3 119 ? 71.079  -0.225  93.832  1.00 582.67 ?  118  LYS Q C     1 
ATOM 7924  O O     . LYS C 3 119 ? 72.286  -0.423  93.653  1.00 582.67 ?  118  LYS Q O     1 
ATOM 7925  C CB    . LYS C 3 119 ? 69.662  -2.174  94.616  1.00 582.67 ?  118  LYS Q CB    1 
ATOM 7926  C CG    . LYS C 3 119 ? 70.741  -3.192  95.026  1.00 582.67 ?  118  LYS Q CG    1 
ATOM 7927  C CD    . LYS C 3 119 ? 70.235  -4.140  96.104  1.00 582.67 ?  118  LYS Q CD    1 
ATOM 7928  C CE    . LYS C 3 119 ? 71.168  -5.336  96.282  1.00 582.67 ?  118  LYS Q CE    1 
ATOM 7929  N NZ    . LYS C 3 119 ? 70.667  -6.295  97.320  1.00 582.67 1  118  LYS Q NZ    1 
ATOM 7930  N N     . ASN D 4 25  ? 25.500  -10.858 99.774  1.00 652.36 ?  25   ASN P N     1 
ATOM 7931  C CA    . ASN D 4 25  ? 25.353  -11.508 98.435  1.00 652.36 ?  25   ASN P CA    1 
ATOM 7932  C C     . ASN D 4 25  ? 26.593  -12.265 97.944  1.00 652.36 ?  25   ASN P C     1 
ATOM 7933  O O     . ASN D 4 25  ? 26.606  -13.498 97.943  1.00 652.36 ?  25   ASN P O     1 
ATOM 7934  C CB    . ASN D 4 25  ? 24.903  -10.486 97.391  1.00 652.36 ?  25   ASN P CB    1 
ATOM 7935  C CG    . ASN D 4 25  ? 23.500  -10.745 96.886  1.00 652.36 ?  25   ASN P CG    1 
ATOM 7936  O OD1   . ASN D 4 25  ? 22.969  -11.850 97.027  1.00 652.36 ?  25   ASN P OD1   1 
ATOM 7937  N ND2   . ASN D 4 25  ? 22.894  -9.732  96.278  1.00 652.36 ?  25   ASN P ND2   1 
ATOM 7938  N N     . ILE D 4 26  ? 27.621  -11.525 97.520  1.00 686.34 ?  26   ILE P N     1 
ATOM 7939  C CA    . ILE D 4 26  ? 28.888  -12.134 97.127  1.00 686.34 ?  26   ILE P CA    1 
ATOM 7940  C C     . ILE D 4 26  ? 29.423  -12.930 98.311  1.00 686.34 ?  26   ILE P C     1 
ATOM 7941  O O     . ILE D 4 26  ? 29.773  -14.099 98.170  1.00 686.34 ?  26   ILE P O     1 
ATOM 7942  C CB    . ILE D 4 26  ? 29.930  -11.079 96.593  1.00 686.34 ?  26   ILE P CB    1 
ATOM 7943  C CG1   . ILE D 4 26  ? 30.687  -11.592 95.351  1.00 686.34 ?  26   ILE P CG1   1 
ATOM 7944  C CG2   . ILE D 4 26  ? 30.876  -10.559 97.690  1.00 686.34 ?  26   ILE P CG2   1 
ATOM 7945  C CD1   . ILE D 4 26  ? 31.486  -12.881 95.519  1.00 686.34 ?  26   ILE P CD1   1 
ATOM 7946  N N     . GLN D 4 27  ? 29.438  -12.307 99.488  1.00 692.38 ?  27   GLN P N     1 
ATOM 7947  C CA    . GLN D 4 27  ? 29.879  -12.969 100.712 1.00 692.38 ?  27   GLN P CA    1 
ATOM 7948  C C     . GLN D 4 27  ? 29.013  -14.194 101.016 1.00 692.38 ?  27   GLN P C     1 
ATOM 7949  O O     . GLN D 4 27  ? 29.290  -14.940 101.958 1.00 692.38 ?  27   GLN P O     1 
ATOM 7950  C CB    . GLN D 4 27  ? 29.889  -11.986 101.887 1.00 692.38 ?  27   GLN P CB    1 
ATOM 7951  C CG    . GLN D 4 27  ? 30.738  -10.730 101.645 1.00 692.38 ?  27   GLN P CG    1 
ATOM 7952  C CD    . GLN D 4 27  ? 32.243  -10.967 101.778 1.00 692.38 ?  27   GLN P CD    1 
ATOM 7953  O OE1   . GLN D 4 27  ? 32.701  -12.077 102.066 1.00 692.38 ?  27   GLN P OE1   1 
ATOM 7954  N NE2   . GLN D 4 27  ? 33.021  -9.910  101.573 1.00 692.38 ?  27   GLN P NE2   1 
ATOM 7955  N N     . GLY D 4 28  ? 27.982  -14.402 100.195 1.00 691.20 ?  28   GLY P N     1 
ATOM 7956  C CA    . GLY D 4 28  ? 27.167  -15.623 100.227 1.00 691.20 ?  28   GLY P CA    1 
ATOM 7957  C C     . GLY D 4 28  ? 27.940  -16.837 99.738  1.00 691.20 ?  28   GLY P C     1 
ATOM 7958  O O     . GLY D 4 28  ? 27.568  -17.977 100.026 1.00 691.20 ?  28   GLY P O     1 
ATOM 7959  N N     . ILE D 4 29  ? 29.006  -16.584 98.979  1.00 690.44 ?  29   ILE P N     1 
ATOM 7960  C CA    . ILE D 4 29  ? 29.972  -17.607 98.600  1.00 690.44 ?  29   ILE P CA    1 
ATOM 7961  C C     . ILE D 4 29  ? 30.824  -17.873 99.842  1.00 690.44 ?  29   ILE P C     1 
ATOM 7962  O O     . ILE D 4 29  ? 31.817  -17.184 100.098 1.00 690.44 ?  29   ILE P O     1 
ATOM 7963  C CB    . ILE D 4 29  ? 30.845  -17.155 97.388  1.00 690.44 ?  29   ILE P CB    1 
ATOM 7964  C CG1   . ILE D 4 29  ? 29.969  -16.710 96.206  1.00 690.44 ?  29   ILE P CG1   1 
ATOM 7965  C CG2   . ILE D 4 29  ? 31.821  -18.246 96.958  1.00 690.44 ?  29   ILE P CG2   1 
ATOM 7966  C CD1   . ILE D 4 29  ? 28.958  -17.740 95.713  1.00 690.44 ?  29   ILE P CD1   1 
ATOM 7967  N N     . THR D 4 30  ? 30.403  -18.866 100.619 1.00 697.98 ?  30   THR P N     1 
ATOM 7968  C CA    . THR D 4 30  ? 30.962  -19.111 101.947 1.00 697.98 ?  30   THR P CA    1 
ATOM 7969  C C     . THR D 4 30  ? 32.399  -19.638 101.904 1.00 697.98 ?  30   THR P C     1 
ATOM 7970  O O     . THR D 4 30  ? 32.791  -20.339 100.964 1.00 697.98 ?  30   THR P O     1 
ATOM 7971  C CB    . THR D 4 30  ? 30.063  -20.070 102.782 1.00 697.98 ?  30   THR P CB    1 
ATOM 7972  O OG1   . THR D 4 30  ? 30.000  -21.356 102.152 1.00 697.98 ?  30   THR P OG1   1 
ATOM 7973  C CG2   . THR D 4 30  ? 28.653  -19.521 102.914 1.00 697.98 ?  30   THR P CG2   1 
ATOM 7974  N N     . LYS D 4 31  ? 33.170  -19.277 102.925 1.00 700.98 ?  31   LYS P N     1 
ATOM 7975  C CA    . LYS D 4 31  ? 34.508  -19.819 103.154 1.00 700.98 ?  31   LYS P CA    1 
ATOM 7976  C C     . LYS D 4 31  ? 34.558  -21.353 102.994 1.00 700.98 ?  31   LYS P C     1 
ATOM 7977  O O     . LYS D 4 31  ? 35.376  -21.859 102.228 1.00 700.98 ?  31   LYS P O     1 
ATOM 7978  C CB    . LYS D 4 31  ? 35.016  -19.370 104.534 1.00 700.98 ?  31   LYS P CB    1 
ATOM 7979  C CG    . LYS D 4 31  ? 36.396  -19.867 104.944 1.00 700.98 ?  31   LYS P CG    1 
ATOM 7980  C CD    . LYS D 4 31  ? 36.529  -19.891 106.468 1.00 700.98 ?  31   LYS P CD    1 
ATOM 7981  C CE    . LYS D 4 31  ? 37.990  -19.839 106.932 1.00 700.98 ?  31   LYS P CE    1 
ATOM 7982  N NZ    . LYS D 4 31  ? 38.491  -18.446 107.185 1.00 700.98 1  31   LYS P NZ    1 
ATOM 7983  N N     . PRO D 4 32  ? 33.680  -22.101 103.698 1.00 715.37 ?  32   PRO P N     1 
ATOM 7984  C CA    . PRO D 4 32  ? 33.716  -23.557 103.522 1.00 715.37 ?  32   PRO P CA    1 
ATOM 7985  C C     . PRO D 4 32  ? 33.461  -24.027 102.089 1.00 715.37 ?  32   PRO P C     1 
ATOM 7986  O O     . PRO D 4 32  ? 34.075  -25.003 101.650 1.00 715.37 ?  32   PRO P O     1 
ATOM 7987  C CB    . PRO D 4 32  ? 32.594  -24.059 104.446 1.00 715.37 ?  32   PRO P CB    1 
ATOM 7988  C CG    . PRO D 4 32  ? 31.729  -22.879 104.679 1.00 715.37 ?  32   PRO P CG    1 
ATOM 7989  C CD    . PRO D 4 32  ? 32.654  -21.709 104.681 1.00 715.37 ?  32   PRO P CD    1 
ATOM 7990  N N     . ALA D 4 33  ? 32.563  -23.349 101.376 1.00 711.27 ?  33   ALA P N     1 
ATOM 7991  C CA    . ALA D 4 33  ? 32.279  -23.697 99.984  1.00 711.27 ?  33   ALA P CA    1 
ATOM 7992  C C     . ALA D 4 33  ? 33.534  -23.523 99.125  1.00 711.27 ?  33   ALA P C     1 
ATOM 7993  O O     . ALA D 4 33  ? 33.911  -24.422 98.368  1.00 711.27 ?  33   ALA P O     1 
ATOM 7994  C CB    . ALA D 4 33  ? 31.128  -22.864 99.448  1.00 711.27 ?  33   ALA P CB    1 
ATOM 7995  N N     . ILE D 4 34  ? 34.187  -22.370 99.280  1.00 704.38 ?  34   ILE P N     1 
ATOM 7996  C CA    . ILE D 4 34  ? 35.455  -22.076 98.622  1.00 704.38 ?  34   ILE P CA    1 
ATOM 7997  C C     . ILE D 4 34  ? 36.516  -23.102 99.012  1.00 704.38 ?  34   ILE P C     1 
ATOM 7998  O O     . ILE D 4 34  ? 37.385  -23.447 98.207  1.00 704.38 ?  34   ILE P O     1 
ATOM 7999  C CB    . ILE D 4 34  ? 35.934  -20.637 98.957  1.00 704.38 ?  34   ILE P CB    1 
ATOM 8000  C CG1   . ILE D 4 34  ? 34.902  -19.612 98.467  1.00 704.38 ?  34   ILE P CG1   1 
ATOM 8001  C CG2   . ILE D 4 34  ? 37.324  -20.359 98.356  1.00 704.38 ?  34   ILE P CG2   1 
ATOM 8002  C CD1   . ILE D 4 34  ? 35.101  -18.197 98.992  1.00 704.38 ?  34   ILE P CD1   1 
ATOM 8003  N N     . ARG D 4 35  ? 36.430  -23.598 100.242 1.00 708.92 ?  35   ARG P N     1 
ATOM 8004  C CA    . ARG D 4 35  ? 37.388  -24.570 100.740 1.00 708.92 ?  35   ARG P CA    1 
ATOM 8005  C C     . ARG D 4 35  ? 37.219  -25.895 99.994  1.00 708.92 ?  35   ARG P C     1 
ATOM 8006  O O     . ARG D 4 35  ? 38.202  -26.497 99.541  1.00 708.92 ?  35   ARG P O     1 
ATOM 8007  C CB    . ARG D 4 35  ? 37.217  -24.762 102.246 1.00 708.92 ?  35   ARG P CB    1 
ATOM 8008  C CG    . ARG D 4 35  ? 38.517  -24.698 103.039 1.00 708.92 ?  35   ARG P CG    1 
ATOM 8009  C CD    . ARG D 4 35  ? 38.245  -24.627 104.549 1.00 708.92 ?  35   ARG P CD    1 
ATOM 8010  N NE    . ARG D 4 35  ? 38.312  -25.943 105.193 1.00 708.92 ?  35   ARG P NE    1 
ATOM 8011  C CZ    . ARG D 4 35  ? 37.310  -26.825 105.256 1.00 708.92 ?  35   ARG P CZ    1 
ATOM 8012  N NH1   . ARG D 4 35  ? 36.122  -26.562 104.713 1.00 708.92 1  35   ARG P NH1   1 
ATOM 8013  N NH2   . ARG D 4 35  ? 37.503  -27.989 105.869 1.00 708.92 ?  35   ARG P NH2   1 
ATOM 8014  N N     . ARG D 4 36  ? 35.968  -26.329 99.850  1.00 694.75 ?  36   ARG P N     1 
ATOM 8015  C CA    . ARG D 4 36  ? 35.648  -27.568 99.146  1.00 694.75 ?  36   ARG P CA    1 
ATOM 8016  C C     . ARG D 4 36  ? 36.154  -27.543 97.709  1.00 694.75 ?  36   ARG P C     1 
ATOM 8017  O O     . ARG D 4 36  ? 36.745  -28.511 97.238  1.00 694.75 ?  36   ARG P O     1 
ATOM 8018  C CB    . ARG D 4 36  ? 34.145  -27.831 99.168  1.00 694.75 ?  36   ARG P CB    1 
ATOM 8019  C CG    . ARG D 4 36  ? 33.600  -28.111 100.557 1.00 694.75 ?  36   ARG P CG    1 
ATOM 8020  C CD    . ARG D 4 36  ? 32.155  -28.613 100.519 1.00 694.75 ?  36   ARG P CD    1 
ATOM 8021  N NE    . ARG D 4 36  ? 31.176  -27.555 100.268 1.00 694.75 ?  36   ARG P NE    1 
ATOM 8022  C CZ    . ARG D 4 36  ? 30.742  -26.690 101.186 1.00 694.75 ?  36   ARG P CZ    1 
ATOM 8023  N NH1   . ARG D 4 36  ? 31.213  -26.732 102.432 1.00 694.75 1  36   ARG P NH1   1 
ATOM 8024  N NH2   . ARG D 4 36  ? 29.843  -25.771 100.855 1.00 694.75 ?  36   ARG P NH2   1 
ATOM 8025  N N     . LEU D 4 37  ? 35.929  -26.426 97.023  1.00 698.65 ?  37   LEU P N     1 
ATOM 8026  C CA    . LEU D 4 37  ? 36.343  -26.274 95.632  1.00 698.65 ?  37   LEU P CA    1 
ATOM 8027  C C     . LEU D 4 37  ? 37.854  -26.409 95.514  1.00 698.65 ?  37   LEU P C     1 
ATOM 8028  O O     . LEU D 4 37  ? 38.362  -27.046 94.594  1.00 698.65 ?  37   LEU P O     1 
ATOM 8029  C CB    . LEU D 4 37  ? 35.875  -24.934 95.072  1.00 698.65 ?  37   LEU P CB    1 
ATOM 8030  C CG    . LEU D 4 37  ? 34.366  -24.714 95.011  1.00 698.65 ?  37   LEU P CG    1 
ATOM 8031  C CD1   . LEU D 4 37  ? 34.065  -23.236 94.960  1.00 698.65 ?  37   LEU P CD1   1 
ATOM 8032  C CD2   . LEU D 4 37  ? 33.726  -25.443 93.833  1.00 698.65 ?  37   LEU P CD2   1 
ATOM 8033  N N     . ALA D 4 38  ? 38.576  -25.831 96.463  1.00 698.40 ?  38   ALA P N     1 
ATOM 8034  C CA    . ALA D 4 38  ? 40.021  -25.952 96.450  1.00 698.40 ?  38   ALA P CA    1 
ATOM 8035  C C     . ALA D 4 38  ? 40.469  -27.383 96.772  1.00 698.40 ?  38   ALA P C     1 
ATOM 8036  O O     . ALA D 4 38  ? 41.510  -27.821 96.289  1.00 698.40 ?  38   ALA P O     1 
ATOM 8037  C CB    . ALA D 4 38  ? 40.649  -24.950 97.398  1.00 698.40 ?  38   ALA P CB    1 
ATOM 8038  N N     . ARG D 4 39  ? 39.683  -28.106 97.571  1.00 688.78 ?  39   ARG P N     1 
ATOM 8039  C CA    . ARG D 4 39  ? 39.995  -29.505 97.889  1.00 688.78 ?  39   ARG P CA    1 
ATOM 8040  C C     . ARG D 4 39  ? 39.873  -30.373 96.648  1.00 688.78 ?  39   ARG P C     1 
ATOM 8041  O O     . ARG D 4 39  ? 40.809  -31.086 96.299  1.00 688.78 ?  39   ARG P O     1 
ATOM 8042  C CB    . ARG D 4 39  ? 39.100  -30.051 99.009  1.00 688.78 ?  39   ARG P CB    1 
ATOM 8043  C CG    . ARG D 4 39  ? 39.451  -29.561 100.410 1.00 688.78 ?  39   ARG P CG    1 
ATOM 8044  C CD    . ARG D 4 39  ? 40.715  -30.222 100.964 1.00 688.78 ?  39   ARG P CD    1 
ATOM 8045  N NE    . ARG D 4 39  ? 40.969  -29.839 102.354 1.00 688.78 ?  39   ARG P NE    1 
ATOM 8046  C CZ    . ARG D 4 39  ? 41.608  -28.732 102.729 1.00 688.78 ?  39   ARG P CZ    1 
ATOM 8047  N NH1   . ARG D 4 39  ? 42.065  -27.882 101.822 1.00 688.78 1  39   ARG P NH1   1 
ATOM 8048  N NH2   . ARG D 4 39  ? 41.792  -28.471 104.019 1.00 688.78 ?  39   ARG P NH2   1 
ATOM 8049  N N     . ARG D 4 40  ? 38.719  -30.305 95.985  1.00 674.42 ?  40   ARG P N     1 
ATOM 8050  C CA    . ARG D 4 40  ? 38.521  -30.914 94.672  1.00 674.42 ?  40   ARG P CA    1 
ATOM 8051  C C     . ARG D 4 40  ? 39.571  -30.386 93.700  1.00 674.42 ?  40   ARG P C     1 
ATOM 8052  O O     . ARG D 4 40  ? 39.882  -31.023 92.697  1.00 674.42 ?  40   ARG P O     1 
ATOM 8053  C CB    . ARG D 4 40  ? 37.116  -30.581 94.168  1.00 674.42 ?  40   ARG P CB    1 
ATOM 8054  C CG    . ARG D 4 40  ? 36.810  -30.966 92.740  1.00 674.42 ?  40   ARG P CG    1 
ATOM 8055  C CD    . ARG D 4 40  ? 35.322  -30.871 92.487  1.00 674.42 ?  40   ARG P CD    1 
ATOM 8056  N NE    . ARG D 4 40  ? 34.594  -31.934 93.180  1.00 674.42 ?  40   ARG P NE    1 
ATOM 8057  C CZ    . ARG D 4 40  ? 33.274  -31.973 93.349  1.00 674.42 ?  40   ARG P CZ    1 
ATOM 8058  N NH1   . ARG D 4 40  ? 32.503  -30.995 92.881  1.00 674.42 1  40   ARG P NH1   1 
ATOM 8059  N NH2   . ARG D 4 40  ? 32.721  -32.996 93.996  1.00 674.42 ?  40   ARG P NH2   1 
ATOM 8060  N N     . GLY D 4 41  ? 40.116  -29.216 94.026  1.00 674.19 ?  41   GLY P N     1 
ATOM 8061  C CA    . GLY D 4 41  ? 41.172  -28.585 93.242  1.00 674.19 ?  41   GLY P CA    1 
ATOM 8062  C C     . GLY D 4 41  ? 42.544  -29.189 93.456  1.00 674.19 ?  41   GLY P C     1 
ATOM 8063  O O     . GLY D 4 41  ? 43.441  -28.974 92.648  1.00 674.19 ?  41   GLY P O     1 
ATOM 8064  N N     . GLY D 4 42  ? 42.705  -29.940 94.543  1.00 678.51 ?  42   GLY P N     1 
ATOM 8065  C CA    . GLY D 4 42  ? 43.976  -30.588 94.862  1.00 678.51 ?  42   GLY P CA    1 
ATOM 8066  C C     . GLY D 4 42  ? 44.804  -29.834 95.884  1.00 678.51 ?  42   GLY P C     1 
ATOM 8067  O O     . GLY D 4 42  ? 45.943  -30.212 96.170  1.00 678.51 ?  42   GLY P O     1 
ATOM 8068  N N     . VAL D 4 43  ? 44.214  -28.776 96.441  1.00 694.43 ?  43   VAL P N     1 
ATOM 8069  C CA    . VAL D 4 43  ? 44.893  -27.854 97.359  1.00 694.43 ?  43   VAL P CA    1 
ATOM 8070  C C     . VAL D 4 43  ? 44.841  -28.331 98.810  1.00 694.43 ?  43   VAL P C     1 
ATOM 8071  O O     . VAL D 4 43  ? 43.773  -28.701 99.298  1.00 694.43 ?  43   VAL P O     1 
ATOM 8072  C CB    . VAL D 4 43  ? 44.251  -26.452 97.295  1.00 694.43 ?  43   VAL P CB    1 
ATOM 8073  C CG1   . VAL D 4 43  ? 44.859  -25.534 98.341  1.00 694.43 ?  43   VAL P CG1   1 
ATOM 8074  C CG2   . VAL D 4 43  ? 44.384  -25.854 95.888  1.00 694.43 ?  43   VAL P CG2   1 
ATOM 8075  N N     . LYS D 4 44  ? 45.983  -28.292 99.498  1.00 704.72 ?  44   LYS P N     1 
ATOM 8076  C CA    . LYS D 4 44  ? 46.050  -28.757 100.883 1.00 704.72 ?  44   LYS P CA    1 
ATOM 8077  C C     . LYS D 4 44  ? 45.884  -27.638 101.915 1.00 704.72 ?  44   LYS P C     1 
ATOM 8078  O O     . LYS D 4 44  ? 45.130  -27.786 102.890 1.00 704.72 ?  44   LYS P O     1 
ATOM 8079  C CB    . LYS D 4 44  ? 47.345  -29.533 101.148 1.00 704.72 ?  44   LYS P CB    1 
ATOM 8080  C CG    . LYS D 4 44  ? 47.380  -30.209 102.518 1.00 704.72 ?  44   LYS P CG    1 
ATOM 8081  C CD    . LYS D 4 44  ? 48.693  -30.941 102.767 1.00 704.72 ?  44   LYS P CD    1 
ATOM 8082  C CE    . LYS D 4 44  ? 48.827  -31.365 104.233 1.00 704.72 ?  44   LYS P CE    1 
ATOM 8083  N NZ    . LYS D 4 44  ? 49.682  -32.589 104.391 1.00 704.72 1  44   LYS P NZ    1 
ATOM 8084  N N     . ARG D 4 45  ? 46.584  -26.524 101.697 1.00 706.84 ?  45   ARG P N     1 
ATOM 8085  C CA    . ARG D 4 45  ? 46.618  -25.438 102.673 1.00 706.84 ?  45   ARG P CA    1 
ATOM 8086  C C     . ARG D 4 45  ? 46.220  -24.085 102.069 1.00 706.84 ?  45   ARG P C     1 
ATOM 8087  O O     . ARG D 4 45  ? 46.722  -23.691 101.014 1.00 706.84 ?  45   ARG P O     1 
ATOM 8088  C CB    . ARG D 4 45  ? 48.005  -25.370 103.329 1.00 706.84 ?  45   ARG P CB    1 
ATOM 8089  C CG    . ARG D 4 45  ? 48.012  -24.734 104.720 1.00 706.84 ?  45   ARG P CG    1 
ATOM 8090  C CD    . ARG D 4 45  ? 49.380  -24.849 105.388 1.00 706.84 ?  45   ARG P CD    1 
ATOM 8091  N NE    . ARG D 4 45  ? 49.391  -24.234 106.715 1.00 706.84 ?  45   ARG P NE    1 
ATOM 8092  C CZ    . ARG D 4 45  ? 49.576  -22.935 106.951 1.00 706.84 ?  45   ARG P CZ    1 
ATOM 8093  N NH1   . ARG D 4 45  ? 49.775  -22.087 105.948 1.00 706.84 1  45   ARG P NH1   1 
ATOM 8094  N NH2   . ARG D 4 45  ? 49.561  -22.474 108.196 1.00 706.84 ?  45   ARG P NH2   1 
ATOM 8095  N N     . ILE D 4 46  ? 45.328  -23.372 102.754 1.00 699.86 ?  46   ILE P N     1 
ATOM 8096  C CA    . ILE D 4 46  ? 44.747  -22.137 102.214 1.00 699.86 ?  46   ILE P CA    1 
ATOM 8097  C C     . ILE D 4 46  ? 44.947  -20.888 103.095 1.00 699.86 ?  46   ILE P C     1 
ATOM 8098  O O     . ILE D 4 46  ? 44.474  -20.841 104.235 1.00 699.86 ?  46   ILE P O     1 
ATOM 8099  C CB    . ILE D 4 46  ? 43.234  -22.333 101.898 1.00 699.86 ?  46   ILE P CB    1 
ATOM 8100  C CG1   . ILE D 4 46  ? 43.040  -23.409 100.825 1.00 699.86 ?  46   ILE P CG1   1 
ATOM 8101  C CG2   . ILE D 4 46  ? 42.566  -21.019 101.465 1.00 699.86 ?  46   ILE P CG2   1 
ATOM 8102  C CD1   . ILE D 4 46  ? 41.608  -23.904 100.713 1.00 699.86 ?  46   ILE P CD1   1 
ATOM 8103  N N     . SER D 4 47  ? 45.635  -19.884 102.542 1.00 699.90 ?  47   SER P N     1 
ATOM 8104  C CA    . SER D 4 47  ? 45.752  -18.552 103.144 1.00 699.90 ?  47   SER P CA    1 
ATOM 8105  C C     . SER D 4 47  ? 44.394  -17.870 103.323 1.00 699.90 ?  47   SER P C     1 
ATOM 8106  O O     . SER D 4 47  ? 43.454  -18.154 102.590 1.00 699.90 ?  47   SER P O     1 
ATOM 8107  C CB    . SER D 4 47  ? 46.647  -17.663 102.279 1.00 699.90 ?  47   SER P CB    1 
ATOM 8108  O OG    . SER D 4 47  ? 46.301  -16.292 102.427 1.00 699.90 ?  47   SER P OG    1 
ATOM 8109  N N     . GLY D 4 48  ? 44.308  -16.954 104.283 1.00 700.88 ?  48   GLY P N     1 
ATOM 8110  C CA    . GLY D 4 48  ? 43.067  -16.234 104.561 1.00 700.88 ?  48   GLY P CA    1 
ATOM 8111  C C     . GLY D 4 48  ? 42.615  -15.314 103.440 1.00 700.88 ?  48   GLY P C     1 
ATOM 8112  O O     . GLY D 4 48  ? 41.420  -15.194 103.159 1.00 700.88 ?  48   GLY P O     1 
ATOM 8113  N N     . LEU D 4 49  ? 43.579  -14.677 102.786 1.00 690.68 ?  49   LEU P N     1 
ATOM 8114  C CA    . LEU D 4 49  ? 43.298  -13.657 101.773 1.00 690.68 ?  49   LEU P CA    1 
ATOM 8115  C C     . LEU D 4 49  ? 42.756  -14.242 100.464 1.00 690.68 ?  49   LEU P C     1 
ATOM 8116  O O     . LEU D 4 49  ? 42.126  -13.533 99.669  1.00 690.68 ?  49   LEU P O     1 
ATOM 8117  C CB    . LEU D 4 49  ? 44.559  -12.847 101.507 1.00 690.68 ?  49   LEU P CB    1 
ATOM 8118  C CG    . LEU D 4 49  ? 45.074  -12.019 102.676 1.00 690.68 ?  49   LEU P CG    1 
ATOM 8119  C CD1   . LEU D 4 49  ? 46.512  -12.377 102.982 1.00 690.68 ?  49   LEU P CD1   1 
ATOM 8120  C CD2   . LEU D 4 49  ? 44.922  -10.547 102.351 1.00 690.68 ?  49   LEU P CD2   1 
ATOM 8121  N N     . ILE D 4 50  ? 43.020  -15.529 100.256 1.00 696.26 ?  50   ILE P N     1 
ATOM 8122  C CA    . ILE D 4 50  ? 42.496  -16.298 99.131  1.00 696.26 ?  50   ILE P CA    1 
ATOM 8123  C C     . ILE D 4 50  ? 40.988  -16.126 98.964  1.00 696.26 ?  50   ILE P C     1 
ATOM 8124  O O     . ILE D 4 50  ? 40.517  -15.786 97.882  1.00 696.26 ?  50   ILE P O     1 
ATOM 8125  C CB    . ILE D 4 50  ? 42.803  -17.808 99.322  1.00 696.26 ?  50   ILE P CB    1 
ATOM 8126  C CG1   . ILE D 4 50  ? 44.299  -18.099 99.122  1.00 696.26 ?  50   ILE P CG1   1 
ATOM 8127  C CG2   . ILE D 4 50  ? 41.913  -18.685 98.423  1.00 696.26 ?  50   ILE P CG2   1 
ATOM 8128  C CD1   . ILE D 4 50  ? 44.766  -18.102 97.672  1.00 696.26 ?  50   ILE P CD1   1 
ATOM 8129  N N     . TYR D 4 51  ? 40.245  -16.354 100.044 1.00 690.51 ?  51   TYR P N     1 
ATOM 8130  C CA    . TYR D 4 51  ? 38.779  -16.390 100.007 1.00 690.51 ?  51   TYR P CA    1 
ATOM 8131  C C     . TYR D 4 51  ? 38.185  -15.199 99.277  1.00 690.51 ?  51   TYR P C     1 
ATOM 8132  O O     . TYR D 4 51  ? 37.404  -15.367 98.343  1.00 690.51 ?  51   TYR P O     1 
ATOM 8133  C CB    . TYR D 4 51  ? 38.210  -16.526 101.421 1.00 690.51 ?  51   TYR P CB    1 
ATOM 8134  C CG    . TYR D 4 51  ? 38.646  -17.811 102.089 1.00 690.51 ?  51   TYR P CG    1 
ATOM 8135  C CD1   . TYR D 4 51  ? 38.045  -19.027 101.760 1.00 690.51 ?  51   TYR P CD1   1 
ATOM 8136  C CD2   . TYR D 4 51  ? 39.685  -17.821 103.024 1.00 690.51 ?  51   TYR P CD2   1 
ATOM 8137  C CE1   . TYR D 4 51  ? 38.457  -20.216 102.351 1.00 690.51 ?  51   TYR P CE1   1 
ATOM 8138  C CE2   . TYR D 4 51  ? 40.105  -19.012 103.629 1.00 690.51 ?  51   TYR P CE2   1 
ATOM 8139  C CZ    . TYR D 4 51  ? 39.482  -20.205 103.288 1.00 690.51 ?  51   TYR P CZ    1 
ATOM 8140  O OH    . TYR D 4 51  ? 39.879  -21.389 103.875 1.00 690.51 ?  51   TYR P OH    1 
ATOM 8141  N N     . GLU D 4 52  ? 38.588  -14.002 99.695  1.00 695.07 ?  52   GLU P N     1 
ATOM 8142  C CA    . GLU D 4 52  ? 38.182  -12.765 99.037  1.00 695.07 ?  52   GLU P CA    1 
ATOM 8143  C C     . GLU D 4 52  ? 38.676  -12.721 97.602  1.00 695.07 ?  52   GLU P C     1 
ATOM 8144  O O     . GLU D 4 52  ? 37.916  -12.359 96.707  1.00 695.07 ?  52   GLU P O     1 
ATOM 8145  C CB    . GLU D 4 52  ? 38.687  -11.539 99.808  1.00 695.07 ?  52   GLU P CB    1 
ATOM 8146  C CG    . GLU D 4 52  ? 37.694  -10.989 100.829 1.00 695.07 ?  52   GLU P CG    1 
ATOM 8147  C CD    . GLU D 4 52  ? 36.393  -10.540 100.187 1.00 695.07 ?  52   GLU P CD    1 
ATOM 8148  O OE1   . GLU D 4 52  ? 36.396  -9.497  99.498  1.00 695.07 ?  52   GLU P OE1   1 
ATOM 8149  O OE2   . GLU D 4 52  ? 35.367  -11.234 100.372 1.00 695.07 -1 52   GLU P OE2   1 
ATOM 8150  N N     . GLU D 4 53  ? 39.934  -13.095 97.377  1.00 693.47 ?  53   GLU P N     1 
ATOM 8151  C CA    . GLU D 4 53  ? 40.479  -13.126 96.019  1.00 693.47 ?  53   GLU P CA    1 
ATOM 8152  C C     . GLU D 4 53  ? 39.627  -13.995 95.091  1.00 693.47 ?  53   GLU P C     1 
ATOM 8153  O O     . GLU D 4 53  ? 39.230  -13.559 94.005  1.00 693.47 ?  53   GLU P O     1 
ATOM 8154  C CB    . GLU D 4 53  ? 41.930  -13.585 96.026  1.00 693.47 ?  53   GLU P CB    1 
ATOM 8155  C CG    . GLU D 4 53  ? 42.911  -12.439 95.946  1.00 693.47 ?  53   GLU P CG    1 
ATOM 8156  C CD    . GLU D 4 53  ? 43.233  -12.020 94.511  1.00 693.47 ?  53   GLU P CD    1 
ATOM 8157  O OE1   . GLU D 4 53  ? 44.297  -11.398 94.315  1.00 693.47 ?  53   GLU P OE1   1 
ATOM 8158  O OE2   . GLU D 4 53  ? 42.434  -12.308 93.583  1.00 693.47 -1 53   GLU P OE2   1 
ATOM 8159  N N     . THR D 4 54  ? 39.330  -15.205 95.549  1.00 687.25 ?  54   THR P N     1 
ATOM 8160  C CA    . THR D 4 54  ? 38.408  -16.109 94.882  1.00 687.25 ?  54   THR P CA    1 
ATOM 8161  C C     . THR D 4 54  ? 37.126  -15.404 94.448  1.00 687.25 ?  54   THR P C     1 
ATOM 8162  O O     . THR D 4 54  ? 36.636  -15.618 93.330  1.00 687.25 ?  54   THR P O     1 
ATOM 8163  C CB    . THR D 4 54  ? 38.062  -17.290 95.817  1.00 687.25 ?  54   THR P CB    1 
ATOM 8164  O OG1   . THR D 4 54  ? 39.145  -18.229 95.816  1.00 687.25 ?  54   THR P OG1   1 
ATOM 8165  C CG2   . THR D 4 54  ? 36.772  -18.003 95.395  1.00 687.25 ?  54   THR P CG2   1 
ATOM 8166  N N     . ARG D 4 55  ? 36.598  -14.559 95.337  1.00 691.40 ?  55   ARG P N     1 
ATOM 8167  C CA    . ARG D 4 55  ? 35.327  -13.883 95.110  1.00 691.40 ?  55   ARG P CA    1 
ATOM 8168  C C     . ARG D 4 55  ? 35.392  -12.912 93.951  1.00 691.40 ?  55   ARG P C     1 
ATOM 8169  O O     . ARG D 4 55  ? 34.554  -12.950 93.064  1.00 691.40 ?  55   ARG P O     1 
ATOM 8170  C CB    . ARG D 4 55  ? 34.848  -13.197 96.379  1.00 691.40 ?  55   ARG P CB    1 
ATOM 8171  C CG    . ARG D 4 55  ? 34.496  -14.186 97.461  1.00 691.40 ?  55   ARG P CG    1 
ATOM 8172  C CD    . ARG D 4 55  ? 33.726  -13.558 98.615  1.00 691.40 ?  55   ARG P CD    1 
ATOM 8173  N NE    . ARG D 4 55  ? 33.447  -14.573 99.624  1.00 691.40 ?  55   ARG P NE    1 
ATOM 8174  C CZ    . ARG D 4 55  ? 34.053  -14.658 100.805 1.00 691.40 ?  55   ARG P CZ    1 
ATOM 8175  N NH1   . ARG D 4 55  ? 34.961  -13.762 101.172 1.00 691.40 1  55   ARG P NH1   1 
ATOM 8176  N NH2   . ARG D 4 55  ? 33.722  -15.633 101.633 1.00 691.40 ?  55   ARG P NH2   1 
ATOM 8177  N N     . GLY D 4 56  ? 36.393  -12.049 93.943  1.00 681.60 ?  56   GLY P N     1 
ATOM 8178  C CA    . GLY D 4 56  ? 36.592  -11.150 92.797  1.00 681.60 ?  56   GLY P CA    1 
ATOM 8179  C C     . GLY D 4 56  ? 36.695  -11.937 91.500  1.00 681.60 ?  56   GLY P C     1 
ATOM 8180  O O     . GLY D 4 56  ? 36.035  -11.618 90.497  1.00 681.60 ?  56   GLY P O     1 
ATOM 8181  N N     . VAL D 4 57  ? 37.515  -12.986 91.554  1.00 684.57 ?  57   VAL P N     1 
ATOM 8182  C CA    . VAL D 4 57  ? 37.708  -13.922 90.461  1.00 684.57 ?  57   VAL P CA    1 
ATOM 8183  C C     . VAL D 4 57  ? 36.399  -14.498 89.937  1.00 684.57 ?  57   VAL P C     1 
ATOM 8184  O O     . VAL D 4 57  ? 36.124  -14.439 88.733  1.00 684.57 ?  57   VAL P O     1 
ATOM 8185  C CB    . VAL D 4 57  ? 38.613  -15.057 90.904  1.00 684.57 ?  57   VAL P CB    1 
ATOM 8186  C CG1   . VAL D 4 57  ? 38.724  -16.098 89.808  1.00 684.57 ?  57   VAL P CG1   1 
ATOM 8187  C CG2   . VAL D 4 57  ? 39.972  -14.513 91.248  1.00 684.57 ?  57   VAL P CG2   1 
ATOM 8188  N N     . LEU D 4 58  ? 35.596  -15.040 90.849  1.00 677.74 ?  58   LEU P N     1 
ATOM 8189  C CA    . LEU D 4 58  ? 34.340  -15.670 90.484  1.00 677.74 ?  58   LEU P CA    1 
ATOM 8190  C C     . LEU D 4 58  ? 33.408  -14.639 89.894  1.00 677.74 ?  58   LEU P C     1 
ATOM 8191  O O     . LEU D 4 58  ? 32.700  -14.918 88.922  1.00 677.74 ?  58   LEU P O     1 
ATOM 8192  C CB    . LEU D 4 58  ? 33.698  -16.319 91.710  1.00 677.74 ?  58   LEU P CB    1 
ATOM 8193  C CG    . LEU D 4 58  ? 32.253  -16.826 91.667  1.00 677.74 ?  58   LEU P CG    1 
ATOM 8194  C CD1   . LEU D 4 58  ? 32.015  -17.784 90.523  1.00 677.74 ?  58   LEU P CD1   1 
ATOM 8195  C CD2   . LEU D 4 58  ? 31.918  -17.505 92.990  1.00 677.74 ?  58   LEU P CD2   1 
ATOM 8196  N N     . LYS D 4 59  ? 33.421  -13.450 90.492  1.00 671.02 ?  59   LYS P N     1 
ATOM 8197  C CA    . LYS D 4 59  ? 32.571  -12.344 90.084  1.00 671.02 ?  59   LYS P CA    1 
ATOM 8198  C C     . LYS D 4 59  ? 32.869  -11.994 88.625  1.00 671.02 ?  59   LYS P C     1 
ATOM 8199  O O     . LYS D 4 59  ? 31.960  -12.043 87.783  1.00 671.02 ?  59   LYS P O     1 
ATOM 8200  C CB    . LYS D 4 59  ? 32.818  -11.139 91.010  1.00 671.02 ?  59   LYS P CB    1 
ATOM 8201  C CG    . LYS D 4 59  ? 31.765  -10.018 90.971  1.00 671.02 ?  59   LYS P CG    1 
ATOM 8202  C CD    . LYS D 4 59  ? 32.379  -8.710  91.475  1.00 671.02 ?  59   LYS P CD    1 
ATOM 8203  C CE    . LYS D 4 59  ? 31.469  -7.484  91.234  1.00 671.02 ?  59   LYS P CE    1 
ATOM 8204  N NZ    . LYS D 4 59  ? 30.177  -7.494  92.012  1.00 671.02 1  59   LYS P NZ    1 
ATOM 8205  N N     . VAL D 4 60  ? 34.145  -11.693 88.340  1.00 658.64 ?  60   VAL P N     1 
ATOM 8206  C CA    . VAL D 4 60  ? 34.611  -11.365 86.986  1.00 658.64 ?  60   VAL P CA    1 
ATOM 8207  C C     . VAL D 4 60  ? 34.115  -12.409 86.015  1.00 658.64 ?  60   VAL P C     1 
ATOM 8208  O O     . VAL D 4 60  ? 33.589  -12.086 84.948  1.00 658.64 ?  60   VAL P O     1 
ATOM 8209  C CB    . VAL D 4 60  ? 36.155  -11.324 86.886  1.00 658.64 ?  60   VAL P CB    1 
ATOM 8210  C CG1   . VAL D 4 60  ? 36.592  -11.297 85.431  1.00 658.64 ?  60   VAL P CG1   1 
ATOM 8211  C CG2   . VAL D 4 60  ? 36.722  -10.138 87.614  1.00 658.64 ?  60   VAL P CG2   1 
ATOM 8212  N N     . PHE D 4 61  ? 34.268  -13.669 86.413  1.00 655.28 ?  61   PHE P N     1 
ATOM 8213  C CA    . PHE D 4 61  ? 33.854  -14.790 85.600  1.00 655.40 ?  61   PHE P CA    1 
ATOM 8214  C C     . PHE D 4 61  ? 32.383  -14.710 85.211  1.00 655.60 ?  61   PHE P C     1 
ATOM 8215  O O     . PHE D 4 61  ? 32.060  -14.590 84.025  1.00 655.61 ?  61   PHE P O     1 
ATOM 8216  C CB    . PHE D 4 61  ? 34.139  -16.098 86.322  1.00 655.70 ?  61   PHE P CB    1 
ATOM 8217  C CG    . PHE D 4 61  ? 33.806  -17.306 85.514  1.00 656.20 ?  61   PHE P CG    1 
ATOM 8218  C CD1   . PHE D 4 61  ? 34.649  -17.719 84.489  1.00 655.57 ?  61   PHE P CD1   1 
ATOM 8219  C CD2   . PHE D 4 61  ? 32.641  -18.019 85.759  1.00 655.70 ?  61   PHE P CD2   1 
ATOM 8220  C CE1   . PHE D 4 61  ? 34.338  -18.822 83.725  1.00 656.14 ?  61   PHE P CE1   1 
ATOM 8221  C CE2   . PHE D 4 61  ? 32.322  -19.125 84.999  1.00 655.73 ?  61   PHE P CE2   1 
ATOM 8222  C CZ    . PHE D 4 61  ? 33.173  -19.532 83.980  1.00 656.33 ?  61   PHE P CZ    1 
ATOM 8223  N N     . LEU D 4 62  ? 31.494  -14.763 86.207  1.00 643.87 ?  62   LEU P N     1 
ATOM 8224  C CA    . LEU D 4 62  ? 30.060  -14.653 85.948  1.00 643.73 ?  62   LEU P CA    1 
ATOM 8225  C C     . LEU D 4 62  ? 29.713  -13.406 85.134  1.00 644.05 ?  62   LEU P C     1 
ATOM 8226  O O     . LEU D 4 62  ? 28.985  -13.487 84.142  1.00 644.01 ?  62   LEU P O     1 
ATOM 8227  C CB    . LEU D 4 62  ? 29.275  -14.668 87.247  1.00 643.18 ?  62   LEU P CB    1 
ATOM 8228  C CG    . LEU D 4 62  ? 29.308  -16.021 87.934  1.00 643.01 ?  62   LEU P CG    1 
ATOM 8229  C CD1   . LEU D 4 62  ? 29.075  -15.828 89.403  1.00 643.10 ?  62   LEU P CD1   1 
ATOM 8230  C CD2   . LEU D 4 62  ? 28.285  -16.973 87.339  1.00 642.05 ?  62   LEU P CD2   1 
ATOM 8231  N N     . GLU D 4 63  ? 30.241  -12.261 85.544  1.00 645.01 ?  63   GLU P N     1 
ATOM 8232  C CA    . GLU D 4 63  ? 29.958  -11.043 84.826  1.00 645.67 ?  63   GLU P CA    1 
ATOM 8233  C C     . GLU D 4 63  ? 30.119  -11.295 83.340  1.00 645.89 ?  63   GLU P C     1 
ATOM 8234  O O     . GLU D 4 63  ? 29.131  -11.224 82.598  1.00 645.72 ?  63   GLU P O     1 
ATOM 8235  C CB    . GLU D 4 63  ? 30.867  -9.905  85.270  1.00 646.11 ?  63   GLU P CB    1 
ATOM 8236  C CG    . GLU D 4 63  ? 30.494  -9.280  86.600  1.00 647.06 ?  63   GLU P CG    1 
ATOM 8237  C CD    . GLU D 4 63  ? 31.602  -8.404  87.159  1.00 649.36 ?  63   GLU P CD    1 
ATOM 8238  O OE1   . GLU D 4 63  ? 32.557  -8.071  86.400  1.00 650.85 ?  63   GLU P OE1   1 
ATOM 8239  O OE2   . GLU D 4 63  ? 31.519  -8.054  88.358  1.00 648.76 -1 63   GLU P OE2   1 
ATOM 8240  N N     . ASN D 4 64  ? 31.344  -11.618 82.913  1.00 637.46 ?  64   ASN P N     1 
ATOM 8241  C CA    . ASN D 4 64  ? 31.621  -11.774 81.484  1.00 638.09 ?  64   ASN P CA    1 
ATOM 8242  C C     . ASN D 4 64  ? 30.658  -12.752 80.804  1.00 638.31 ?  64   ASN P C     1 
ATOM 8243  O O     . ASN D 4 64  ? 30.152  -12.491 79.707  1.00 638.61 ?  64   ASN P O     1 
ATOM 8244  C CB    . ASN D 4 64  ? 33.068  -12.197 81.248  1.00 638.08 ?  64   ASN P CB    1 
ATOM 8245  C CG    . ASN D 4 64  ? 34.062  -11.184 81.765  1.00 638.31 ?  64   ASN P CG    1 
ATOM 8246  O OD1   . ASN D 4 64  ? 34.869  -11.482 82.646  1.00 640.23 ?  64   ASN P OD1   1 
ATOM 8247  N ND2   . ASN D 4 64  ? 33.999  -9.970  81.232  1.00 637.94 ?  64   ASN P ND2   1 
ATOM 8248  N N     . VAL D 4 65  ? 30.389  -13.864 81.486  1.00 625.70 ?  65   VAL P N     1 
ATOM 8249  C CA    . VAL D 4 65  ? 29.537  -14.917 80.945  1.00 625.77 ?  65   VAL P CA    1 
ATOM 8250  C C     . VAL D 4 65  ? 28.098  -14.458 80.894  1.00 625.91 ?  65   VAL P C     1 
ATOM 8251  O O     . VAL D 4 65  ? 27.402  -14.681 79.893  1.00 626.12 ?  65   VAL P O     1 
ATOM 8252  C CB    . VAL D 4 65  ? 29.642  -16.204 81.767  1.00 625.67 ?  65   VAL P CB    1 
ATOM 8253  C CG1   . VAL D 4 65  ? 28.610  -17.209 81.329  1.00 625.46 ?  65   VAL P CG1   1 
ATOM 8254  C CG2   . VAL D 4 65  ? 31.007  -16.800 81.592  1.00 626.20 ?  65   VAL P CG2   1 
ATOM 8255  N N     . ILE D 4 66  ? 27.659  -13.801 81.964  1.00 627.01 ?  66   ILE P N     1 
ATOM 8256  C CA    . ILE D 4 66  ? 26.295  -13.279 82.015  1.00 626.90 ?  66   ILE P CA    1 
ATOM 8257  C C     . ILE D 4 66  ? 26.088  -12.054 81.113  1.00 626.65 ?  66   ILE P C     1 
ATOM 8258  O O     . ILE D 4 66  ? 25.010  -11.873 80.551  1.00 626.23 ?  66   ILE P O     1 
ATOM 8259  C CB    . ILE D 4 66  ? 25.844  -13.034 83.452  1.00 626.71 ?  66   ILE P CB    1 
ATOM 8260  C CG1   . ILE D 4 66  ? 25.828  -14.372 84.207  1.00 627.29 ?  66   ILE P CG1   1 
ATOM 8261  C CG2   . ILE D 4 66  ? 24.467  -12.429 83.462  1.00 626.94 ?  66   ILE P CG2   1 
ATOM 8262  C CD1   . ILE D 4 66  ? 25.840  -14.257 85.726  1.00 627.89 ?  66   ILE P CD1   1 
ATOM 8263  N N     . ARG D 4 67  ? 27.119  -11.237 80.950  1.00 624.68 ?  67   ARG P N     1 
ATOM 8264  C CA    . ARG D 4 67  ? 27.045  -10.131 80.002  1.00 625.25 ?  67   ARG P CA    1 
ATOM 8265  C C     . ARG D 4 67  ? 26.740  -10.660 78.605  1.00 625.26 ?  67   ARG P C     1 
ATOM 8266  O O     . ARG D 4 67  ? 25.801  -10.203 77.953  1.00 625.01 ?  67   ARG P O     1 
ATOM 8267  C CB    . ARG D 4 67  ? 28.342  -9.332  79.993  1.00 625.32 ?  67   ARG P CB    1 
ATOM 8268  C CG    . ARG D 4 67  ? 28.347  -8.171  79.011  1.00 626.40 ?  67   ARG P CG    1 
ATOM 8269  C CD    . ARG D 4 67  ? 29.740  -7.559  78.912  1.00 629.38 ?  67   ARG P CD    1 
ATOM 8270  N NE    . ARG D 4 67  ? 30.063  -6.785  80.116  1.00 632.14 ?  67   ARG P NE    1 
ATOM 8271  C CZ    . ARG D 4 67  ? 30.795  -7.222  81.144  1.00 632.36 ?  67   ARG P CZ    1 
ATOM 8272  N NH1   . ARG D 4 67  ? 31.316  -8.447  81.142  1.00 632.40 1  67   ARG P NH1   1 
ATOM 8273  N NH2   . ARG D 4 67  ? 31.003  -6.423  82.183  1.00 631.91 ?  67   ARG P NH2   1 
ATOM 8274  N N     . ASP D 4 68  ? 27.538  -11.631 78.166  1.00 623.21 ?  68   ASP P N     1 
ATOM 8275  C CA    . ASP D 4 68  ? 27.355  -12.292 76.872  1.00 623.75 ?  68   ASP P CA    1 
ATOM 8276  C C     . ASP D 4 68  ? 25.992  -13.006 76.812  1.00 623.85 ?  68   ASP P C     1 
ATOM 8277  O O     . ASP D 4 68  ? 25.260  -12.903 75.811  1.00 623.32 ?  68   ASP P O     1 
ATOM 8278  C CB    . ASP D 4 68  ? 28.475  -13.308 76.644  1.00 623.90 ?  68   ASP P CB    1 
ATOM 8279  C CG    . ASP D 4 68  ? 29.720  -12.708 75.982  1.00 625.63 ?  68   ASP P CG    1 
ATOM 8280  O OD1   . ASP D 4 68  ? 29.903  -11.459 75.947  1.00 626.72 ?  68   ASP P OD1   1 
ATOM 8281  O OD2   . ASP D 4 68  ? 30.540  -13.527 75.485  1.00 626.08 -1 68   ASP P OD2   1 
ATOM 8282  N N     . ALA D 4 69  ? 25.658  -13.726 77.890  1.00 617.41 ?  69   ALA P N     1 
ATOM 8283  C CA    . ALA D 4 69  ? 24.380  -14.422 77.979  1.00 617.56 ?  69   ALA P CA    1 
ATOM 8284  C C     . ALA D 4 69  ? 23.249  -13.442 77.724  1.00 617.84 ?  69   ALA P C     1 
ATOM 8285  O O     . ALA D 4 69  ? 22.482  -13.597 76.770  1.00 617.88 ?  69   ALA P O     1 
ATOM 8286  C CB    . ALA D 4 69  ? 24.211  -15.106 79.343  1.00 617.30 ?  69   ALA P CB    1 
ATOM 8287  N N     . VAL D 4 70  ? 23.166  -12.416 78.565  1.00 611.17 ?  70   VAL P N     1 
ATOM 8288  C CA    . VAL D 4 70  ? 22.072  -11.470 78.493  1.00 611.37 ?  70   VAL P CA    1 
ATOM 8289  C C     . VAL D 4 70  ? 21.994  -10.907 77.071  1.00 611.49 ?  70   VAL P C     1 
ATOM 8290  O O     . VAL D 4 70  ? 20.938  -10.952 76.450  1.00 611.61 ?  70   VAL P O     1 
ATOM 8291  C CB    . VAL D 4 70  ? 22.185  -10.403 79.602  1.00 611.50 ?  70   VAL P CB    1 
ATOM 8292  C CG1   . VAL D 4 70  ? 21.363  -9.174  79.285  1.00 612.20 ?  70   VAL P CG1   1 
ATOM 8293  C CG2   . VAL D 4 70  ? 21.732  -10.990 80.934  1.00 611.69 ?  70   VAL P CG2   1 
ATOM 8294  N N     . THR D 4 71  ? 23.118  -10.442 76.536  1.00 593.95 ?  71   THR P N     1 
ATOM 8295  C CA    . THR D 4 71  ? 23.160  -9.968  75.154  1.00 594.05 ?  71   THR P CA    1 
ATOM 8296  C C     . THR D 4 71  ? 22.420  -10.894 74.200  1.00 594.78 ?  71   THR P C     1 
ATOM 8297  O O     . THR D 4 71  ? 21.764  -10.424 73.276  1.00 594.99 ?  71   THR P O     1 
ATOM 8298  C CB    . THR D 4 71  ? 24.577  -9.835  74.675  1.00 593.77 ?  71   THR P CB    1 
ATOM 8299  O OG1   . THR D 4 71  ? 25.314  -9.053  75.619  1.00 593.81 ?  71   THR P OG1   1 
ATOM 8300  C CG2   . THR D 4 71  ? 24.634  -9.196  73.279  1.00 593.44 ?  71   THR P CG2   1 
ATOM 8301  N N     . TYR D 4 72  ? 22.524  -12.208 74.419  1.00 608.03 ?  72   TYR P N     1 
ATOM 8302  C CA    . TYR D 4 72  ? 21.779  -13.160 73.598  1.00 608.59 ?  72   TYR P CA    1 
ATOM 8303  C C     . TYR D 4 72  ? 20.283  -13.013 73.881  1.00 610.06 ?  72   TYR P C     1 
ATOM 8304  O O     . TYR D 4 72  ? 19.490  -12.906 72.936  1.00 610.36 ?  72   TYR P O     1 
ATOM 8305  C CB    . TYR D 4 72  ? 22.291  -14.617 73.746  1.00 607.62 ?  72   TYR P CB    1 
ATOM 8306  C CG    . TYR D 4 72  ? 23.587  -14.898 72.977  1.00 605.88 ?  72   TYR P CG    1 
ATOM 8307  C CD1   . TYR D 4 72  ? 23.659  -14.679 71.606  1.00 604.76 ?  72   TYR P CD1   1 
ATOM 8308  C CD2   . TYR D 4 72  ? 24.738  -15.362 73.625  1.00 603.98 ?  72   TYR P CD2   1 
ATOM 8309  C CE1   . TYR D 4 72  ? 24.831  -14.907 70.894  1.00 604.76 ?  72   TYR P CE1   1 
ATOM 8310  C CE2   . TYR D 4 72  ? 25.921  -15.601 72.919  1.00 603.24 ?  72   TYR P CE2   1 
ATOM 8311  C CZ    . TYR D 4 72  ? 25.957  -15.367 71.544  1.00 604.67 ?  72   TYR P CZ    1 
ATOM 8312  O OH    . TYR D 4 72  ? 27.098  -15.572 70.794  1.00 603.26 ?  72   TYR P OH    1 
ATOM 8313  N N     . THR D 4 73  ? 19.908  -12.961 75.165  1.00 607.81 ?  73   THR P N     1 
ATOM 8314  C CA    . THR D 4 73  ? 18.509  -12.744 75.549  1.00 609.16 ?  73   THR P CA    1 
ATOM 8315  C C     . THR D 4 73  ? 17.976  -11.419 75.002  1.00 610.22 ?  73   THR P C     1 
ATOM 8316  O O     . THR D 4 73  ? 16.927  -11.396 74.356  1.00 610.27 ?  73   THR P O     1 
ATOM 8317  C CB    . THR D 4 73  ? 18.293  -12.800 77.073  1.00 609.15 ?  73   THR P CB    1 
ATOM 8318  O OG1   . THR D 4 73  ? 19.216  -13.723 77.657  1.00 610.09 ?  73   THR P OG1   1 
ATOM 8319  C CG2   . THR D 4 73  ? 16.874  -13.259 77.393  1.00 608.83 ?  73   THR P CG2   1 
ATOM 8320  N N     . GLU D 4 74  ? 18.704  -10.325 75.228  1.00 597.99 ?  74   GLU P N     1 
ATOM 8321  C CA    . GLU D 4 74  ? 18.319  -9.018  74.670  1.00 599.53 ?  74   GLU P CA    1 
ATOM 8322  C C     . GLU D 4 74  ? 18.080  -9.121  73.174  1.00 599.87 ?  74   GLU P C     1 
ATOM 8323  O O     . GLU D 4 74  ? 17.195  -8.448  72.651  1.00 600.51 ?  74   GLU P O     1 
ATOM 8324  C CB    . GLU D 4 74  ? 19.375  -7.925  74.918  1.00 600.05 ?  74   GLU P CB    1 
ATOM 8325  C CG    . GLU D 4 74  ? 19.772  -7.674  76.381  1.00 602.45 ?  74   GLU P CG    1 
ATOM 8326  C CD    . GLU D 4 74  ? 18.966  -6.577  77.069  1.00 605.51 ?  74   GLU P CD    1 
ATOM 8327  O OE1   . GLU D 4 74  ? 19.590  -5.781  77.801  1.00 606.66 ?  74   GLU P OE1   1 
ATOM 8328  O OE2   . GLU D 4 74  ? 17.721  -6.506  76.897  1.00 607.46 -1 74   GLU P OE2   1 
ATOM 8329  N N     . HIS D 4 75  ? 18.862  -9.949  72.484  1.00 566.73 ?  75   HIS P N     1 
ATOM 8330  C CA    . HIS D 4 75  ? 18.730  -10.066 71.030  1.00 567.17 ?  75   HIS P CA    1 
ATOM 8331  C C     . HIS D 4 75  ? 17.616  -11.030 70.634  1.00 567.63 ?  75   HIS P C     1 
ATOM 8332  O O     . HIS D 4 75  ? 17.118  -10.998 69.509  1.00 567.31 ?  75   HIS P O     1 
ATOM 8333  C CB    . HIS D 4 75  ? 20.058  -10.443 70.367  1.00 566.97 ?  75   HIS P CB    1 
ATOM 8334  C CG    . HIS D 4 75  ? 19.984  -10.503 68.876  1.00 566.45 ?  75   HIS P CG    1 
ATOM 8335  N ND1   . HIS D 4 75  ? 19.475  -11.588 68.201  1.00 566.41 ?  75   HIS P ND1   1 
ATOM 8336  C CD2   . HIS D 4 75  ? 20.324  -9.598  67.927  1.00 566.54 ?  75   HIS P CD2   1 
ATOM 8337  C CE1   . HIS D 4 75  ? 19.519  -11.361 66.901  1.00 566.29 ?  75   HIS P CE1   1 
ATOM 8338  N NE2   . HIS D 4 75  ? 20.034  -10.160 66.707  1.00 566.37 ?  75   HIS P NE2   1 
ATOM 8339  N N     . ALA D 4 76  ? 17.229  -11.890 71.571  1.00 589.86 ?  76   ALA P N     1 
ATOM 8340  C CA    . ALA D 4 76  ? 16.150  -12.840 71.348  1.00 590.35 ?  76   ALA P CA    1 
ATOM 8341  C C     . ALA D 4 76  ? 14.832  -12.231 71.790  1.00 590.88 ?  76   ALA P C     1 
ATOM 8342  O O     . ALA D 4 76  ? 13.787  -12.892 71.747  1.00 591.06 ?  76   ALA P O     1 
ATOM 8343  C CB    . ALA D 4 76  ? 16.414  -14.110 72.112  1.00 590.35 ?  76   ALA P CB    1 
ATOM 8344  N N     . LYS D 4 77  ? 14.897  -10.972 72.221  1.00 594.59 ?  77   LYS P N     1 
ATOM 8345  C CA    . LYS D 4 77  ? 13.738  -10.237 72.720  1.00 595.04 ?  77   LYS P CA    1 
ATOM 8346  C C     . LYS D 4 77  ? 12.971  -11.052 73.759  1.00 595.05 ?  77   LYS P C     1 
ATOM 8347  O O     . LYS D 4 77  ? 11.780  -11.285 73.621  1.00 595.08 ?  77   LYS P O     1 
ATOM 8348  C CB    . LYS D 4 77  ? 12.819  -9.806  71.566  1.00 595.06 ?  77   LYS P CB    1 
ATOM 8349  C CG    . LYS D 4 77  ? 13.431  -8.777  70.629  1.00 595.69 ?  77   LYS P CG    1 
ATOM 8350  C CD    . LYS D 4 77  ? 12.561  -8.588  69.401  1.00 597.15 ?  77   LYS P CD    1 
ATOM 8351  C CE    . LYS D 4 77  ? 13.209  -7.656  68.382  1.00 598.43 ?  77   LYS P CE    1 
ATOM 8352  N NZ    . LYS D 4 77  ? 12.485  -7.687  67.060  1.00 599.53 1  77   LYS P NZ    1 
ATOM 8353  N N     . ARG D 4 78  ? 13.666  -11.495 74.793  1.00 634.65 ?  78   ARG P N     1 
ATOM 8354  C CA    . ARG D 4 78  ? 13.021  -12.262 75.833  1.00 635.49 ?  78   ARG P CA    1 
ATOM 8355  C C     . ARG D 4 78  ? 13.322  -11.672 77.202  1.00 636.03 ?  78   ARG P C     1 
ATOM 8356  O O     . ARG D 4 78  ? 14.377  -11.084 77.417  1.00 635.81 ?  78   ARG P O     1 
ATOM 8357  C CB    . ARG D 4 78  ? 13.463  -13.725 75.770  1.00 635.68 ?  78   ARG P CB    1 
ATOM 8358  C CG    . ARG D 4 78  ? 12.743  -14.575 74.707  1.00 635.89 ?  78   ARG P CG    1 
ATOM 8359  C CD    . ARG D 4 78  ? 13.130  -16.055 74.803  1.00 635.60 ?  78   ARG P CD    1 
ATOM 8360  N NE    . ARG D 4 78  ? 14.417  -16.354 74.160  1.00 636.43 ?  78   ARG P NE    1 
ATOM 8361  C CZ    . ARG D 4 78  ? 15.596  -16.415 74.783  1.00 636.37 ?  78   ARG P CZ    1 
ATOM 8362  N NH1   . ARG D 4 78  ? 15.696  -16.191 76.086  1.00 636.54 1  78   ARG P NH1   1 
ATOM 8363  N NH2   . ARG D 4 78  ? 16.693  -16.697 74.092  1.00 636.14 ?  78   ARG P NH2   1 
ATOM 8364  N N     . LYS D 4 79  ? 12.377  -11.820 78.124  1.00 660.67 ?  79   LYS P N     1 
ATOM 8365  C CA    . LYS D 4 79  ? 12.594  -11.406 79.507  1.00 661.26 ?  79   LYS P CA    1 
ATOM 8366  C C     . LYS D 4 79  ? 13.089  -12.593 80.332  1.00 661.41 ?  79   LYS P C     1 
ATOM 8367  O O     . LYS D 4 79  ? 13.282  -12.490 81.550  1.00 661.72 ?  79   LYS P O     1 
ATOM 8368  C CB    . LYS D 4 79  ? 11.323  -10.795 80.111  1.00 661.42 ?  79   LYS P CB    1 
ATOM 8369  C CG    . LYS D 4 79  ? 10.963  -9.427  79.545  1.00 662.32 ?  79   LYS P CG    1 
ATOM 8370  C CD    . LYS D 4 79  ? 10.263  -8.576  80.594  1.00 664.31 ?  79   LYS P CD    1 
ATOM 8371  C CE    . LYS D 4 79  ? 9.506   -7.409  79.964  1.00 665.24 ?  79   LYS P CE    1 
ATOM 8372  N NZ    . LYS D 4 79  ? 8.355   -6.980  80.817  1.00 666.19 1  79   LYS P NZ    1 
ATOM 8373  N N     . THR D 4 80  ? 13.319  -13.717 79.659  1.00 656.34 ?  80   THR P N     1 
ATOM 8374  C CA    . THR D 4 80  ? 13.806  -14.912 80.339  1.00 656.25 ?  80   THR P CA    1 
ATOM 8375  C C     . THR D 4 80  ? 15.078  -15.501 79.704  1.00 655.90 ?  80   THR P C     1 
ATOM 8376  O O     . THR D 4 80  ? 15.020  -16.190 78.681  1.00 655.90 ?  80   THR P O     1 
ATOM 8377  C CB    . THR D 4 80  ? 12.686  -15.971 80.483  1.00 656.36 ?  80   THR P CB    1 
ATOM 8378  O OG1   . THR D 4 80  ? 11.526  -15.357 81.062  1.00 656.29 ?  80   THR P OG1   1 
ATOM 8379  C CG2   . THR D 4 80  ? 13.143  -17.126 81.367  1.00 656.70 ?  80   THR P CG2   1 
ATOM 8380  N N     . VAL D 4 81  ? 16.218  -15.194 80.325  1.00 649.07 ?  81   VAL P N     1 
ATOM 8381  C CA    . VAL D 4 81  ? 17.506  -15.820 80.012  1.00 648.45 ?  81   VAL P CA    1 
ATOM 8382  C C     . VAL D 4 81  ? 17.376  -17.350 80.051  1.00 648.31 ?  81   VAL P C     1 
ATOM 8383  O O     . VAL D 4 81  ? 16.969  -17.938 81.072  1.00 648.33 ?  81   VAL P O     1 
ATOM 8384  C CB    . VAL D 4 81  ? 18.602  -15.360 81.004  1.00 648.22 ?  81   VAL P CB    1 
ATOM 8385  C CG1   . VAL D 4 81  ? 19.856  -16.196 80.859  1.00 647.71 ?  81   VAL P CG1   1 
ATOM 8386  C CG2   . VAL D 4 81  ? 18.909  -13.902 80.805  1.00 647.76 ?  81   VAL P CG2   1 
ATOM 8387  N N     . THR D 4 82  ? 17.712  -17.979 78.927  1.00 652.83 ?  82   THR P N     1 
ATOM 8388  C CA    . THR D 4 82  ? 17.577  -19.429 78.771  1.00 652.16 ?  82   THR P CA    1 
ATOM 8389  C C     . THR D 4 82  ? 18.888  -20.118 79.113  1.00 651.31 ?  82   THR P C     1 
ATOM 8390  O O     . THR D 4 82  ? 19.864  -19.453 79.449  1.00 651.37 ?  82   THR P O     1 
ATOM 8391  C CB    . THR D 4 82  ? 17.170  -19.795 77.334  1.00 652.36 ?  82   THR P CB    1 
ATOM 8392  O OG1   . THR D 4 82  ? 17.998  -19.076 76.407  1.00 652.91 ?  82   THR P OG1   1 
ATOM 8393  C CG2   . THR D 4 82  ? 15.711  -19.439 77.088  1.00 652.54 ?  82   THR P CG2   1 
ATOM 8394  N N     . ALA D 4 83  ? 18.909  -21.449 79.046  1.00 638.00 ?  83   ALA P N     1 
ATOM 8395  C CA    . ALA D 4 83  ? 20.159  -22.197 79.178  1.00 636.88 ?  83   ALA P CA    1 
ATOM 8396  C C     . ALA D 4 83  ? 21.022  -22.003 77.926  1.00 636.26 ?  83   ALA P C     1 
ATOM 8397  O O     . ALA D 4 83  ? 22.240  -21.891 78.006  1.00 636.18 ?  83   ALA P O     1 
ATOM 8398  C CB    . ALA D 4 83  ? 19.882  -23.658 79.419  1.00 636.51 ?  83   ALA P CB    1 
ATOM 8399  N N     . MET D 4 84  ? 20.371  -21.925 76.777  1.00 630.24 ?  84   MET P N     1 
ATOM 8400  C CA    . MET D 4 84  ? 21.056  -21.818 75.510  1.00 629.88 ?  84   MET P CA    1 
ATOM 8401  C C     . MET D 4 84  ? 21.830  -20.511 75.343  1.00 629.84 ?  84   MET P C     1 
ATOM 8402  O O     . MET D 4 84  ? 22.863  -20.477 74.665  1.00 629.39 ?  84   MET P O     1 
ATOM 8403  C CB    . MET D 4 84  ? 20.061  -22.031 74.368  1.00 629.90 ?  84   MET P CB    1 
ATOM 8404  C CG    . MET D 4 84  ? 19.398  -23.412 74.401  1.00 629.35 ?  84   MET P CG    1 
ATOM 8405  S SD    . MET D 4 84  ? 20.640  -24.721 74.423  1.00 628.25 ?  84   MET P SD    1 
ATOM 8406  C CE    . MET D 4 84  ? 21.490  -24.334 72.873  1.00 627.59 ?  84   MET P CE    1 
ATOM 8407  N N     . ASP D 4 85  ? 21.337  -19.444 75.972  1.00 631.20 ?  85   ASP P N     1 
ATOM 8408  C CA    . ASP D 4 85  ? 22.065  -18.177 76.002  1.00 630.92 ?  85   ASP P CA    1 
ATOM 8409  C C     . ASP D 4 85  ? 23.338  -18.374 76.799  1.00 630.06 ?  85   ASP P C     1 
ATOM 8410  O O     . ASP D 4 85  ? 24.425  -18.036 76.325  1.00 630.33 ?  85   ASP P O     1 
ATOM 8411  C CB    . ASP D 4 85  ? 21.221  -17.058 76.610  1.00 631.46 ?  85   ASP P CB    1 
ATOM 8412  C CG    . ASP D 4 85  ? 20.005  -16.710 75.763  1.00 633.11 ?  85   ASP P CG    1 
ATOM 8413  O OD1   . ASP D 4 85  ? 19.978  -17.047 74.550  1.00 634.63 ?  85   ASP P OD1   1 
ATOM 8414  O OD2   . ASP D 4 85  ? 19.069  -16.094 76.321  1.00 635.36 -1 85   ASP P OD2   1 
ATOM 8415  N N     . VAL D 4 86  ? 23.201  -18.950 77.993  1.00 637.67 ?  86   VAL P N     1 
ATOM 8416  C CA    . VAL D 4 86  ? 24.354  -19.329 78.799  1.00 636.48 ?  86   VAL P CA    1 
ATOM 8417  C C     . VAL D 4 86  ? 25.312  -20.164 77.953  1.00 635.73 ?  86   VAL P C     1 
ATOM 8418  O O     . VAL D 4 86  ? 26.432  -19.737 77.675  1.00 636.08 ?  86   VAL P O     1 
ATOM 8419  C CB    . VAL D 4 86  ? 23.954  -20.145 80.030  1.00 636.49 ?  86   VAL P CB    1 
ATOM 8420  C CG1   . VAL D 4 86  ? 25.148  -20.314 80.946  1.00 636.69 ?  86   VAL P CG1   1 
ATOM 8421  C CG2   . VAL D 4 86  ? 22.799  -19.488 80.777  1.00 636.70 ?  86   VAL P CG2   1 
ATOM 8422  N N     . VAL D 4 87  ? 24.858  -21.338 77.518  1.00 636.46 ?  87   VAL P N     1 
ATOM 8423  C CA    . VAL D 4 87  ? 25.672  -22.228 76.697  1.00 634.79 ?  87   VAL P CA    1 
ATOM 8424  C C     . VAL D 4 87  ? 26.354  -21.484 75.543  1.00 633.87 ?  87   VAL P C     1 
ATOM 8425  O O     . VAL D 4 87  ? 27.543  -21.686 75.307  1.00 633.99 ?  87   VAL P O     1 
ATOM 8426  C CB    . VAL D 4 87  ? 24.874  -23.466 76.187  1.00 634.59 ?  87   VAL P CB    1 
ATOM 8427  C CG1   . VAL D 4 87  ? 25.643  -24.214 75.117  1.00 633.80 ?  87   VAL P CG1   1 
ATOM 8428  C CG2   . VAL D 4 87  ? 24.557  -24.402 77.339  1.00 633.98 ?  87   VAL P CG2   1 
ATOM 8429  N N     . TYR D 4 88  ? 25.626  -20.618 74.845  1.00 598.50 ?  88   TYR P N     1 
ATOM 8430  C CA    . TYR D 4 88  ? 26.250  -19.880 73.749  1.00 597.80 ?  88   TYR P CA    1 
ATOM 8431  C C     . TYR D 4 88  ? 27.338  -18.961 74.264  1.00 597.38 ?  88   TYR P C     1 
ATOM 8432  O O     . TYR D 4 88  ? 28.313  -18.670 73.552  1.00 597.80 ?  88   TYR P O     1 
ATOM 8433  C CB    . TYR D 4 88  ? 25.246  -19.064 72.941  1.00 597.57 ?  88   TYR P CB    1 
ATOM 8434  C CG    . TYR D 4 88  ? 24.308  -19.883 72.115  1.00 597.42 ?  88   TYR P CG    1 
ATOM 8435  C CD1   . TYR D 4 88  ? 24.673  -21.148 71.660  1.00 597.26 ?  88   TYR P CD1   1 
ATOM 8436  C CD2   . TYR D 4 88  ? 23.041  -19.409 71.803  1.00 597.88 ?  88   TYR P CD2   1 
ATOM 8437  C CE1   . TYR D 4 88  ? 23.803  -21.924 70.916  1.00 597.77 ?  88   TYR P CE1   1 
ATOM 8438  C CE2   . TYR D 4 88  ? 22.156  -20.178 71.051  1.00 599.02 ?  88   TYR P CE2   1 
ATOM 8439  C CZ    . TYR D 4 88  ? 22.545  -21.436 70.610  1.00 598.33 ?  88   TYR P CZ    1 
ATOM 8440  O OH    . TYR D 4 88  ? 21.684  -22.203 69.854  1.00 598.60 ?  88   TYR P OH    1 
ATOM 8441  N N     . ALA D 4 89  ? 27.171  -18.505 75.498  1.00 617.71 ?  89   ALA P N     1 
ATOM 8442  C CA    . ALA D 4 89  ? 28.094  -17.546 76.062  1.00 616.99 ?  89   ALA P CA    1 
ATOM 8443  C C     . ALA D 4 89  ? 29.405  -18.245 76.356  1.00 616.29 ?  89   ALA P C     1 
ATOM 8444  O O     . ALA D 4 89  ? 30.478  -17.793 75.948  1.00 615.99 ?  89   ALA P O     1 
ATOM 8445  C CB    . ALA D 4 89  ? 27.509  -16.948 77.322  1.00 617.32 ?  89   ALA P CB    1 
ATOM 8446  N N     . LEU D 4 90  ? 29.298  -19.372 77.056  1.00 635.90 ?  90   LEU P N     1 
ATOM 8447  C CA    . LEU D 4 90  ? 30.443  -20.186 77.410  1.00 634.59 ?  90   LEU P CA    1 
ATOM 8448  C C     . LEU D 4 90  ? 31.229  -20.590 76.163  1.00 634.62 ?  90   LEU P C     1 
ATOM 8449  O O     . LEU D 4 90  ? 32.461  -20.582 76.179  1.00 634.83 ?  90   LEU P O     1 
ATOM 8450  C CB    . LEU D 4 90  ? 29.985  -21.383 78.221  1.00 633.57 ?  90   LEU P CB    1 
ATOM 8451  C CG    . LEU D 4 90  ? 29.312  -20.946 79.528  1.00 632.56 ?  90   LEU P CG    1 
ATOM 8452  C CD1   . LEU D 4 90  ? 28.347  -22.001 80.095  1.00 631.70 ?  90   LEU P CD1   1 
ATOM 8453  C CD2   . LEU D 4 90  ? 30.348  -20.538 80.568  1.00 629.49 ?  90   LEU P CD2   1 
ATOM 8454  N N     . LYS D 4 91  ? 30.528  -20.901 75.075  1.00 623.18 ?  91   LYS P N     1 
ATOM 8455  C CA    . LYS D 4 91  ? 31.204  -21.179 73.807  1.00 623.45 ?  91   LYS P CA    1 
ATOM 8456  C C     . LYS D 4 91  ? 32.026  -19.970 73.373  1.00 623.53 ?  91   LYS P C     1 
ATOM 8457  O O     . LYS D 4 91  ? 33.248  -20.053 73.318  1.00 623.78 ?  91   LYS P O     1 
ATOM 8458  C CB    . LYS D 4 91  ? 30.222  -21.584 72.717  1.00 623.65 ?  91   LYS P CB    1 
ATOM 8459  C CG    . LYS D 4 91  ? 30.863  -22.387 71.591  1.00 624.49 ?  91   LYS P CG    1 
ATOM 8460  C CD    . LYS D 4 91  ? 29.822  -23.182 70.813  1.00 626.27 ?  91   LYS P CD    1 
ATOM 8461  C CE    . LYS D 4 91  ? 30.477  -24.208 69.906  1.00 628.38 ?  91   LYS P CE    1 
ATOM 8462  N NZ    . LYS D 4 91  ? 29.842  -25.584 70.031  1.00 630.39 1  91   LYS P NZ    1 
ATOM 8463  N N     . ARG D 4 92  ? 31.353  -18.853 73.093  1.00 609.68 ?  92   ARG P N     1 
ATOM 8464  C CA    . ARG D 4 92  ? 32.009  -17.563 72.879  1.00 609.41 ?  92   ARG P CA    1 
ATOM 8465  C C     . ARG D 4 92  ? 33.297  -17.410 73.666  1.00 609.33 ?  92   ARG P C     1 
ATOM 8466  O O     . ARG D 4 92  ? 34.309  -16.974 73.114  1.00 609.60 ?  92   ARG P O     1 
ATOM 8467  C CB    . ARG D 4 92  ? 31.094  -16.425 73.316  1.00 609.44 ?  92   ARG P CB    1 
ATOM 8468  C CG    . ARG D 4 92  ? 30.175  -15.912 72.262  1.00 609.49 ?  92   ARG P CG    1 
ATOM 8469  C CD    . ARG D 4 92  ? 30.185  -14.395 72.269  1.00 607.63 ?  92   ARG P CD    1 
ATOM 8470  N NE    . ARG D 4 92  ? 31.363  -13.839 71.590  1.00 605.79 ?  92   ARG P NE    1 
ATOM 8471  C CZ    . ARG D 4 92  ? 32.352  -13.234 72.225  1.00 605.88 ?  92   ARG P CZ    1 
ATOM 8472  N NH1   . ARG D 4 92  ? 32.306  -13.097 73.538  1.00 606.75 1  92   ARG P NH1   1 
ATOM 8473  N NH2   . ARG D 4 92  ? 33.387  -12.748 71.563  1.00 607.88 ?  92   ARG P NH2   1 
ATOM 8474  N N     . GLN D 4 93  ? 33.246  -17.747 74.955  1.00 614.34 ?  93   GLN P N     1 
ATOM 8475  C CA    . GLN D 4 93  ? 34.372  -17.531 75.872  1.00 614.66 ?  93   GLN P CA    1 
ATOM 8476  C C     . GLN D 4 93  ? 35.359  -18.700 75.947  1.00 614.57 ?  93   GLN P C     1 
ATOM 8477  O O     . GLN D 4 93  ? 36.307  -18.668 76.740  1.00 614.88 ?  93   GLN P O     1 
ATOM 8478  C CB    . GLN D 4 93  ? 33.872  -17.224 77.282  1.00 614.76 ?  93   GLN P CB    1 
ATOM 8479  C CG    . GLN D 4 93  ? 32.811  -16.137 77.362  1.00 615.93 ?  93   GLN P CG    1 
ATOM 8480  C CD    . GLN D 4 93  ? 33.376  -14.753 77.612  1.00 616.99 ?  93   GLN P CD    1 
ATOM 8481  O OE1   . GLN D 4 93  ? 34.520  -14.592 78.058  1.00 617.00 ?  93   GLN P OE1   1 
ATOM 8482  N NE2   . GLN D 4 93  ? 32.565  -13.736 77.337  1.00 617.42 ?  93   GLN P NE2   1 
ATOM 8483  N N     . GLY D 4 94  ? 35.134  -19.736 75.148  1.00 626.44 ?  94   GLY P N     1 
ATOM 8484  C CA    . GLY D 4 94  ? 36.029  -20.876 75.144  1.00 626.34 ?  94   GLY P CA    1 
ATOM 8485  C C     . GLY D 4 94  ? 35.989  -21.681 76.423  1.00 626.32 ?  94   GLY P C     1 
ATOM 8486  O O     . GLY D 4 94  ? 37.019  -22.198 76.870  1.00 625.26 ?  94   GLY P O     1 
ATOM 8487  N N     . ARG D 4 95  ? 34.797  -21.764 77.014  1.00 628.13 ?  95   ARG P N     1 
ATOM 8488  C CA    . ARG D 4 95  ? 34.570  -22.578 78.196  1.00 629.19 ?  95   ARG P CA    1 
ATOM 8489  C C     . ARG D 4 95  ? 33.334  -23.451 77.992  1.00 629.76 ?  95   ARG P C     1 
ATOM 8490  O O     . ARG D 4 95  ? 32.492  -23.589 78.889  1.00 629.72 ?  95   ARG P O     1 
ATOM 8491  C CB    . ARG D 4 95  ? 34.457  -21.709 79.452  1.00 629.51 ?  95   ARG P CB    1 
ATOM 8492  C CG    . ARG D 4 95  ? 35.557  -20.634 79.582  1.00 630.77 ?  95   ARG P CG    1 
ATOM 8493  C CD    . ARG D 4 95  ? 36.089  -20.489 81.009  1.00 633.37 ?  95   ARG P CD    1 
ATOM 8494  N NE    . ARG D 4 95  ? 36.908  -21.634 81.449  1.00 635.71 ?  95   ARG P NE    1 
ATOM 8495  C CZ    . ARG D 4 95  ? 36.461  -22.688 82.150  1.00 635.37 ?  95   ARG P CZ    1 
ATOM 8496  N NH1   . ARG D 4 95  ? 35.177  -22.793 82.519  1.00 633.14 1  95   ARG P NH1   1 
ATOM 8497  N NH2   . ARG D 4 95  ? 37.315  -23.645 82.491  1.00 634.75 ?  95   ARG P NH2   1 
ATOM 8498  N N     . THR D 4 96  ? 33.267  -24.055 76.801  1.00 617.01 ?  96   THR P N     1 
ATOM 8499  C CA    . THR D 4 96  ? 32.168  -24.917 76.351  1.00 617.76 ?  96   THR P CA    1 
ATOM 8500  C C     . THR D 4 96  ? 31.681  -25.872 77.413  1.00 618.41 ?  96   THR P C     1 
ATOM 8501  O O     . THR D 4 96  ? 32.486  -26.513 78.079  1.00 619.16 ?  96   THR P O     1 
ATOM 8502  C CB    . THR D 4 96  ? 32.605  -25.772 75.158  1.00 617.68 ?  96   THR P CB    1 
ATOM 8503  O OG1   . THR D 4 96  ? 32.884  -24.927 74.038  1.00 617.51 ?  96   THR P OG1   1 
ATOM 8504  C CG2   . THR D 4 96  ? 31.503  -26.744 74.778  1.00 617.80 ?  96   THR P CG2   1 
ATOM 8505  N N     . LEU D 4 97  ? 30.366  -25.978 77.553  1.00 624.22 ?  97   LEU P N     1 
ATOM 8506  C CA    . LEU D 4 97  ? 29.757  -26.880 78.525  1.00 624.67 ?  97   LEU P CA    1 
ATOM 8507  C C     . LEU D 4 97  ? 28.758  -27.842 77.859  1.00 625.09 ?  97   LEU P C     1 
ATOM 8508  O O     . LEU D 4 97  ? 27.979  -27.463 76.969  1.00 625.01 ?  97   LEU P O     1 
ATOM 8509  C CB    . LEU D 4 97  ? 29.089  -26.071 79.630  1.00 624.76 ?  97   LEU P CB    1 
ATOM 8510  C CG    . LEU D 4 97  ? 28.099  -26.741 80.584  1.00 625.90 ?  97   LEU P CG    1 
ATOM 8511  C CD1   . LEU D 4 97  ? 28.794  -27.627 81.630  1.00 626.51 ?  97   LEU P CD1   1 
ATOM 8512  C CD2   . LEU D 4 97  ? 27.257  -25.686 81.265  1.00 626.33 ?  97   LEU P CD2   1 
ATOM 8513  N N     . TYR D 4 98  ? 28.803  -29.093 78.304  1.00 622.95 ?  98   TYR P N     1 
ATOM 8514  C CA    . TYR D 4 98  ? 27.975  -30.156 77.761  1.00 623.26 ?  98   TYR P CA    1 
ATOM 8515  C C     . TYR D 4 98  ? 26.893  -30.529 78.755  1.00 624.02 ?  98   TYR P C     1 
ATOM 8516  O O     . TYR D 4 98  ? 27.157  -30.646 79.959  1.00 624.08 ?  98   TYR P O     1 
ATOM 8517  C CB    . TYR D 4 98  ? 28.830  -31.390 77.513  1.00 622.95 ?  98   TYR P CB    1 
ATOM 8518  C CG    . TYR D 4 98  ? 29.648  -31.373 76.239  1.00 622.41 ?  98   TYR P CG    1 
ATOM 8519  C CD1   . TYR D 4 98  ? 29.698  -30.245 75.425  1.00 621.50 ?  98   TYR P CD1   1 
ATOM 8520  C CD2   . TYR D 4 98  ? 30.395  -32.483 75.869  1.00 621.00 ?  98   TYR P CD2   1 
ATOM 8521  C CE1   . TYR D 4 98  ? 30.445  -30.238 74.263  1.00 621.74 ?  98   TYR P CE1   1 
ATOM 8522  C CE2   . TYR D 4 98  ? 31.155  -32.477 74.723  1.00 622.06 ?  98   TYR P CE2   1 
ATOM 8523  C CZ    . TYR D 4 98  ? 31.169  -31.352 73.926  1.00 621.95 ?  98   TYR P CZ    1 
ATOM 8524  O OH    . TYR D 4 98  ? 31.920  -31.349 72.791  1.00 622.65 ?  98   TYR P OH    1 
ATOM 8525  N N     . GLY D 4 99  ? 25.676  -30.718 78.254  1.00 632.83 ?  99   GLY P N     1 
ATOM 8526  C CA    . GLY D 4 99  ? 24.611  -31.240 79.089  1.00 633.48 ?  99   GLY P CA    1 
ATOM 8527  C C     . GLY D 4 99  ? 23.468  -30.287 79.329  1.00 633.79 ?  99   GLY P C     1 
ATOM 8528  O O     . GLY D 4 99  ? 22.704  -30.463 80.279  1.00 634.40 ?  99   GLY P O     1 
ATOM 8529  N N     . PHE D 4 100 ? 23.343  -29.281 78.471  1.00 636.62 ?  100  PHE P N     1 
ATOM 8530  C CA    . PHE D 4 100 ? 22.237  -28.342 78.564  1.00 636.51 ?  100  PHE P CA    1 
ATOM 8531  C C     . PHE D 4 100 ? 21.739  -27.985 77.165  1.00 636.83 ?  100  PHE P C     1 
ATOM 8532  O O     . PHE D 4 100 ? 21.273  -26.879 76.907  1.00 637.36 ?  100  PHE P O     1 
ATOM 8533  C CB    . PHE D 4 100 ? 22.644  -27.123 79.401  1.00 635.93 ?  100  PHE P CB    1 
ATOM 8534  C CG    . PHE D 4 100 ? 23.011  -27.470 80.829  1.00 635.99 ?  100  PHE P CG    1 
ATOM 8535  C CD1   . PHE D 4 100 ? 22.014  -27.639 81.808  1.00 635.49 ?  100  PHE P CD1   1 
ATOM 8536  C CD2   . PHE D 4 100 ? 24.338  -27.662 81.198  1.00 635.14 ?  100  PHE P CD2   1 
ATOM 8537  C CE1   . PHE D 4 100 ? 22.338  -27.979 83.134  1.00 634.08 ?  100  PHE P CE1   1 
ATOM 8538  C CE2   . PHE D 4 100 ? 24.670  -28.000 82.526  1.00 636.00 ?  100  PHE P CE2   1 
ATOM 8539  C CZ    . PHE D 4 100 ? 23.660  -28.162 83.496  1.00 634.74 ?  100  PHE P CZ    1 
ATOM 8540  N N     . GLY D 4 101 ? 21.810  -28.961 76.274  1.00 604.04 ?  101  GLY P N     1 
ATOM 8541  C CA    . GLY D 4 101 ? 21.432  -28.759 74.888  1.00 604.04 ?  101  GLY P CA    1 
ATOM 8542  C C     . GLY D 4 101 ? 22.611  -28.223 74.100  1.00 604.04 ?  101  GLY P C     1 
ATOM 8543  O O     . GLY D 4 101 ? 22.586  -27.095 73.657  1.00 604.04 ?  101  GLY P O     1 
ATOM 8544  N N     . GLY D 4 102 ? 23.655  -29.032 73.934  1.00 587.88 ?  102  GLY P N     1 
ATOM 8545  C CA    . GLY D 4 102 ? 24.805  -28.654 73.097  1.00 587.88 ?  102  GLY P CA    1 
ATOM 8546  C C     . GLY D 4 102 ? 24.333  -28.333 71.686  1.00 587.88 ?  102  GLY P C     1 
ATOM 8547  O O     . GLY D 4 102 ? 24.315  -27.183 71.261  1.00 587.88 ?  102  GLY P O     1 
ATOM 8548  O OXT   . GLY D 4 102 ? 23.913  -29.215 70.946  1.00 587.88 -1 102  GLY P OXT   1 
ATOM 8549  N N     . HIS E 5 39  ? 41.068  -38.561 120.260 1.00 721.85 ?  39   HIS O N     1 
ATOM 8550  C CA    . HIS E 5 39  ? 42.357  -37.811 120.130 1.00 721.85 ?  39   HIS O CA    1 
ATOM 8551  C C     . HIS E 5 39  ? 42.311  -36.731 119.036 1.00 721.85 ?  39   HIS O C     1 
ATOM 8552  O O     . HIS E 5 39  ? 41.234  -36.302 118.608 1.00 721.85 ?  39   HIS O O     1 
ATOM 8553  C CB    . HIS E 5 39  ? 43.538  -38.773 119.889 1.00 721.85 ?  39   HIS O CB    1 
ATOM 8554  C CG    . HIS E 5 39  ? 43.422  -39.589 118.632 1.00 721.85 ?  39   HIS O CG    1 
ATOM 8555  N ND1   . HIS E 5 39  ? 42.826  -39.114 117.479 1.00 721.85 ?  39   HIS O ND1   1 
ATOM 8556  C CD2   . HIS E 5 39  ? 43.848  -40.843 118.345 1.00 721.85 ?  39   HIS O CD2   1 
ATOM 8557  C CE1   . HIS E 5 39  ? 42.877  -40.045 116.543 1.00 721.85 ?  39   HIS O CE1   1 
ATOM 8558  N NE2   . HIS E 5 39  ? 43.493  -41.103 117.041 1.00 721.85 ?  39   HIS O NE2   1 
ATOM 8559  N N     . ARG E 5 40  ? 43.494  -36.315 118.585 1.00 713.25 ?  40   ARG O N     1 
ATOM 8560  C CA    . ARG E 5 40  ? 43.641  -35.219 117.632 1.00 713.25 ?  40   ARG O CA    1 
ATOM 8561  C C     . ARG E 5 40  ? 44.414  -35.666 116.391 1.00 713.25 ?  40   ARG O C     1 
ATOM 8562  O O     . ARG E 5 40  ? 45.492  -36.261 116.504 1.00 713.25 ?  40   ARG O O     1 
ATOM 8563  C CB    . ARG E 5 40  ? 44.368  -34.046 118.305 1.00 713.25 ?  40   ARG O CB    1 
ATOM 8564  C CG    . ARG E 5 40  ? 44.159  -32.696 117.646 1.00 713.25 ?  40   ARG O CG    1 
ATOM 8565  C CD    . ARG E 5 40  ? 43.062  -31.887 118.333 1.00 713.25 ?  40   ARG O CD    1 
ATOM 8566  N NE    . ARG E 5 40  ? 42.774  -30.653 117.601 1.00 713.25 ?  40   ARG O NE    1 
ATOM 8567  C CZ    . ARG E 5 40  ? 43.473  -29.523 117.714 1.00 713.25 ?  40   ARG O CZ    1 
ATOM 8568  N NH1   . ARG E 5 40  ? 44.515  -29.440 118.534 1.00 713.25 1  40   ARG O NH1   1 
ATOM 8569  N NH2   . ARG E 5 40  ? 43.129  -28.463 116.998 1.00 713.25 ?  40   ARG O NH2   1 
ATOM 8570  N N     . TYR E 5 41  ? 43.856  -35.378 115.215 1.00 716.19 ?  41   TYR O N     1 
ATOM 8571  C CA    . TYR E 5 41  ? 44.537  -35.634 113.944 1.00 716.19 ?  41   TYR O CA    1 
ATOM 8572  C C     . TYR E 5 41  ? 45.506  -34.510 113.609 1.00 716.19 ?  41   TYR O C     1 
ATOM 8573  O O     . TYR E 5 41  ? 45.163  -33.330 113.712 1.00 716.19 ?  41   TYR O O     1 
ATOM 8574  C CB    . TYR E 5 41  ? 43.532  -35.820 112.802 1.00 716.19 ?  41   TYR O CB    1 
ATOM 8575  C CG    . TYR E 5 41  ? 42.922  -37.204 112.720 1.00 716.19 ?  41   TYR O CG    1 
ATOM 8576  C CD1   . TYR E 5 41  ? 43.700  -38.315 112.386 1.00 716.19 ?  41   TYR O CD1   1 
ATOM 8577  C CD2   . TYR E 5 41  ? 41.566  -37.403 112.975 1.00 716.19 ?  41   TYR O CD2   1 
ATOM 8578  C CE1   . TYR E 5 41  ? 43.141  -39.586 112.312 1.00 716.19 ?  41   TYR O CE1   1 
ATOM 8579  C CE2   . TYR E 5 41  ? 41.002  -38.670 112.905 1.00 716.19 ?  41   TYR O CE2   1 
ATOM 8580  C CZ    . TYR E 5 41  ? 41.793  -39.754 112.572 1.00 716.19 ?  41   TYR O CZ    1 
ATOM 8581  O OH    . TYR E 5 41  ? 41.233  -41.003 112.499 1.00 716.19 ?  41   TYR O OH    1 
ATOM 8582  N N     . ARG E 5 42  ? 46.714  -34.891 113.207 1.00 714.75 ?  42   ARG O N     1 
ATOM 8583  C CA    . ARG E 5 42  ? 47.776  -33.936 112.894 1.00 714.75 ?  42   ARG O CA    1 
ATOM 8584  C C     . ARG E 5 42  ? 47.351  -32.974 111.782 1.00 714.75 ?  42   ARG O C     1 
ATOM 8585  O O     . ARG E 5 42  ? 46.884  -33.420 110.731 1.00 714.75 ?  42   ARG O O     1 
ATOM 8586  C CB    . ARG E 5 42  ? 49.057  -34.668 112.479 1.00 714.75 ?  42   ARG O CB    1 
ATOM 8587  C CG    . ARG E 5 42  ? 49.550  -35.731 113.464 1.00 714.75 ?  42   ARG O CG    1 
ATOM 8588  C CD    . ARG E 5 42  ? 50.912  -36.264 113.052 1.00 714.75 ?  42   ARG O CD    1 
ATOM 8589  N NE    . ARG E 5 42  ? 51.928  -35.211 113.097 1.00 714.75 ?  42   ARG O NE    1 
ATOM 8590  C CZ    . ARG E 5 42  ? 53.148  -35.299 112.567 1.00 714.75 ?  42   ARG O CZ    1 
ATOM 8591  N NH1   . ARG E 5 42  ? 53.540  -36.401 111.929 1.00 714.75 1  42   ARG O NH1   1 
ATOM 8592  N NH2   . ARG E 5 42  ? 53.985  -34.272 112.677 1.00 714.75 ?  42   ARG O NH2   1 
ATOM 8593  N N     . PRO E 5 43  ? 47.499  -31.654 112.019 1.00 720.81 ?  43   PRO O N     1 
ATOM 8594  C CA    . PRO E 5 43  ? 47.228  -30.595 111.040 1.00 720.81 ?  43   PRO O CA    1 
ATOM 8595  C C     . PRO E 5 43  ? 47.620  -30.969 109.606 1.00 720.81 ?  43   PRO O C     1 
ATOM 8596  O O     . PRO E 5 43  ? 48.807  -31.151 109.308 1.00 720.81 ?  43   PRO O O     1 
ATOM 8597  C CB    . PRO E 5 43  ? 48.094  -29.419 111.532 1.00 720.81 ?  43   PRO O CB    1 
ATOM 8598  C CG    . PRO E 5 43  ? 48.699  -29.866 112.861 1.00 720.81 ?  43   PRO O CG    1 
ATOM 8599  C CD    . PRO E 5 43  ? 47.944  -31.085 113.300 1.00 720.81 ?  43   PRO O CD    1 
ATOM 8600  N N     . GLY E 5 44  ? 46.611  -31.097 108.743 1.00 713.79 ?  44   GLY O N     1 
ATOM 8601  C CA    . GLY E 5 44  ? 46.820  -31.389 107.329 1.00 713.79 ?  44   GLY O CA    1 
ATOM 8602  C C     . GLY E 5 44  ? 46.363  -32.766 106.893 1.00 713.79 ?  44   GLY O C     1 
ATOM 8603  O O     . GLY E 5 44  ? 46.391  -33.086 105.707 1.00 713.79 ?  44   GLY O O     1 
ATOM 8604  N N     . THR E 5 45  ? 45.922  -33.580 107.842 1.00 716.46 ?  45   THR O N     1 
ATOM 8605  C CA    . THR E 5 45  ? 45.653  -34.984 107.560 1.00 716.46 ?  45   THR O CA    1 
ATOM 8606  C C     . THR E 5 45  ? 44.197  -35.233 107.190 1.00 716.46 ?  45   THR O C     1 
ATOM 8607  O O     . THR E 5 45  ? 43.880  -36.186 106.469 1.00 716.46 ?  45   THR O O     1 
ATOM 8608  C CB    . THR E 5 45  ? 46.103  -35.861 108.723 1.00 716.46 ?  45   THR O CB    1 
ATOM 8609  O OG1   . THR E 5 45  ? 47.418  -35.451 109.112 1.00 716.46 ?  45   THR O OG1   1 
ATOM 8610  C CG2   . THR E 5 45  ? 46.143  -37.331 108.313 1.00 716.46 ?  45   THR O CG2   1 
ATOM 8611  N N     . VAL E 5 46  ? 43.317  -34.365 107.679 1.00 723.75 ?  46   VAL O N     1 
ATOM 8612  C CA    . VAL E 5 46  ? 41.926  -34.354 107.232 1.00 723.75 ?  46   VAL O CA    1 
ATOM 8613  C C     . VAL E 5 46  ? 41.850  -33.639 105.882 1.00 723.75 ?  46   VAL O C     1 
ATOM 8614  O O     . VAL E 5 46  ? 40.978  -33.938 105.061 1.00 723.75 ?  46   VAL O O     1 
ATOM 8615  C CB    . VAL E 5 46  ? 40.993  -33.656 108.237 1.00 723.75 ?  46   VAL O CB    1 
ATOM 8616  C CG1   . VAL E 5 46  ? 39.540  -34.048 107.975 1.00 723.75 ?  46   VAL O CG1   1 
ATOM 8617  C CG2   . VAL E 5 46  ? 41.387  -34.008 109.662 1.00 723.75 ?  46   VAL O CG2   1 
ATOM 8618  N N     . ALA E 5 47  ? 42.779  -32.703 105.664 1.00 716.82 ?  47   ALA O N     1 
ATOM 8619  C CA    . ALA E 5 47  ? 42.923  -32.018 104.384 1.00 716.82 ?  47   ALA O CA    1 
ATOM 8620  C C     . ALA E 5 47  ? 43.118  -33.041 103.274 1.00 716.82 ?  47   ALA O C     1 
ATOM 8621  O O     . ALA E 5 47  ? 42.337  -33.086 102.323 1.00 716.82 ?  47   ALA O O     1 
ATOM 8622  C CB    . ALA E 5 47  ? 44.089  -31.042 104.425 1.00 716.82 ?  47   ALA O CB    1 
ATOM 8623  N N     . LEU E 5 48  ? 44.144  -33.875 103.417 1.00 715.37 ?  48   LEU O N     1 
ATOM 8624  C CA    . LEU E 5 48  ? 44.389  -34.961 102.476 1.00 715.37 ?  48   LEU O CA    1 
ATOM 8625  C C     . LEU E 5 48  ? 43.160  -35.866 102.338 1.00 715.37 ?  48   LEU O C     1 
ATOM 8626  O O     . LEU E 5 48  ? 42.763  -36.215 101.225 1.00 715.37 ?  48   LEU O O     1 
ATOM 8627  C CB    . LEU E 5 48  ? 45.626  -35.760 102.888 1.00 715.37 ?  48   LEU O CB    1 
ATOM 8628  C CG    . LEU E 5 48  ? 46.957  -35.042 102.662 1.00 715.37 ?  48   LEU O CG    1 
ATOM 8629  C CD1   . LEU E 5 48  ? 47.948  -35.396 103.742 1.00 715.37 ?  48   LEU O CD1   1 
ATOM 8630  C CD2   . LEU E 5 48  ? 47.524  -35.361 101.291 1.00 715.37 ?  48   LEU O CD2   1 
ATOM 8631  N N     . ARG E 5 49  ? 42.547  -36.217 103.465 1.00 712.87 ?  49   ARG O N     1 
ATOM 8632  C CA    . ARG E 5 49  ? 41.339  -37.038 103.462 1.00 712.87 ?  49   ARG O CA    1 
ATOM 8633  C C     . ARG E 5 49  ? 40.172  -36.392 102.714 1.00 712.87 ?  49   ARG O C     1 
ATOM 8634  O O     . ARG E 5 49  ? 39.448  -37.076 101.987 1.00 712.87 ?  49   ARG O O     1 
ATOM 8635  C CB    . ARG E 5 49  ? 40.914  -37.398 104.884 1.00 712.87 ?  49   ARG O CB    1 
ATOM 8636  C CG    . ARG E 5 49  ? 41.497  -38.710 105.413 1.00 712.87 ?  49   ARG O CG    1 
ATOM 8637  C CD    . ARG E 5 49  ? 40.446  -39.500 106.211 1.00 712.87 ?  49   ARG O CD    1 
ATOM 8638  N NE    . ARG E 5 49  ? 39.678  -38.644 107.120 1.00 712.87 ?  49   ARG O NE    1 
ATOM 8639  C CZ    . ARG E 5 49  ? 40.030  -38.366 108.374 1.00 712.87 ?  49   ARG O CZ    1 
ATOM 8640  N NH1   . ARG E 5 49  ? 41.138  -38.887 108.887 1.00 712.87 1  49   ARG O NH1   1 
ATOM 8641  N NH2   . ARG E 5 49  ? 39.271  -37.572 109.120 1.00 712.87 ?  49   ARG O NH2   1 
ATOM 8642  N N     . GLU E 5 50  ? 39.996  -35.085 102.893 1.00 708.62 ?  50   GLU O N     1 
ATOM 8643  C CA    . GLU E 5 50  ? 38.950  -34.339 102.189 1.00 708.62 ?  50   GLU O CA    1 
ATOM 8644  C C     . GLU E 5 50  ? 39.200  -34.264 100.692 1.00 708.62 ?  50   GLU O C     1 
ATOM 8645  O O     . GLU E 5 50  ? 38.270  -34.437 99.915  1.00 708.62 ?  50   GLU O O     1 
ATOM 8646  C CB    . GLU E 5 50  ? 38.791  -32.928 102.752 1.00 708.62 ?  50   GLU O CB    1 
ATOM 8647  C CG    . GLU E 5 50  ? 37.976  -32.851 104.028 1.00 708.62 ?  50   GLU O CG    1 
ATOM 8648  C CD    . GLU E 5 50  ? 37.915  -31.452 104.609 1.00 708.62 ?  50   GLU O CD    1 
ATOM 8649  O OE1   . GLU E 5 50  ? 37.162  -31.265 105.587 1.00 708.62 ?  50   GLU O OE1   1 
ATOM 8650  O OE2   . GLU E 5 50  ? 38.612  -30.543 104.099 1.00 708.62 -1 50   GLU O OE2   1 
ATOM 8651  N N     . ILE E 5 51  ? 40.445  -34.006 100.287 1.00 702.51 ?  51   ILE O N     1 
ATOM 8652  C CA    . ILE E 5 51  ? 40.794  -33.998 98.866  1.00 702.51 ?  51   ILE O CA    1 
ATOM 8653  C C     . ILE E 5 51  ? 40.270  -35.282 98.233  1.00 702.51 ?  51   ILE O C     1 
ATOM 8654  O O     . ILE E 5 51  ? 39.538  -35.239 97.240  1.00 702.51 ?  51   ILE O O     1 
ATOM 8655  C CB    . ILE E 5 51  ? 42.324  -33.872 98.619  1.00 702.51 ?  51   ILE O CB    1 
ATOM 8656  C CG1   . ILE E 5 51  ? 42.845  -32.503 99.058  1.00 702.51 ?  51   ILE O CG1   1 
ATOM 8657  C CG2   . ILE E 5 51  ? 42.653  -34.071 97.152  1.00 702.51 ?  51   ILE O CG2   1 
ATOM 8658  C CD1   . ILE E 5 51  ? 44.356  -32.400 99.122  1.00 702.51 ?  51   ILE O CD1   1 
ATOM 8659  N N     . ARG E 5 52  ? 40.620  -36.417 98.840  1.00 682.55 ?  52   ARG O N     1 
ATOM 8660  C CA    . ARG E 5 52  ? 40.224  -37.736 98.344  1.00 682.55 ?  52   ARG O CA    1 
ATOM 8661  C C     . ARG E 5 52  ? 38.719  -37.832 98.142  1.00 682.55 ?  52   ARG O C     1 
ATOM 8662  O O     . ARG E 5 52  ? 38.250  -38.327 97.117  1.00 682.55 ?  52   ARG O O     1 
ATOM 8663  C CB    . ARG E 5 52  ? 40.691  -38.834 99.302  1.00 682.55 ?  52   ARG O CB    1 
ATOM 8664  C CG    . ARG E 5 52  ? 42.190  -38.836 99.542  1.00 682.55 ?  52   ARG O CG    1 
ATOM 8665  C CD    . ARG E 5 52  ? 42.681  -40.084 100.276 1.00 682.55 ?  52   ARG O CD    1 
ATOM 8666  N NE    . ARG E 5 52  ? 44.069  -39.926 100.723 1.00 682.55 ?  52   ARG O NE    1 
ATOM 8667  C CZ    . ARG E 5 52  ? 45.140  -40.039 99.935  1.00 682.55 ?  52   ARG O CZ    1 
ATOM 8668  N NH1   . ARG E 5 52  ? 44.999  -40.319 98.640  1.00 682.55 1  52   ARG O NH1   1 
ATOM 8669  N NH2   . ARG E 5 52  ? 46.360  -39.870 100.439 1.00 682.55 ?  52   ARG O NH2   1 
ATOM 8670  N N     . ARG E 5 53  ? 37.982  -37.335 99.130  1.00 684.48 ?  53   ARG O N     1 
ATOM 8671  C CA    . ARG E 5 53  ? 36.525  -37.399 99.161  1.00 684.48 ?  53   ARG O CA    1 
ATOM 8672  C C     . ARG E 5 53  ? 35.855  -36.600 98.040  1.00 684.48 ?  53   ARG O C     1 
ATOM 8673  O O     . ARG E 5 53  ? 34.833  -37.041 97.482  1.00 684.48 ?  53   ARG O O     1 
ATOM 8674  C CB    . ARG E 5 53  ? 36.029  -36.915 100.522 1.00 684.48 ?  53   ARG O CB    1 
ATOM 8675  C CG    . ARG E 5 53  ? 34.595  -36.445 100.544 1.00 684.48 ?  53   ARG O CG    1 
ATOM 8676  C CD    . ARG E 5 53  ? 34.327  -35.679 101.808 1.00 684.48 ?  53   ARG O CD    1 
ATOM 8677  N NE    . ARG E 5 53  ? 32.910  -35.367 101.969 1.00 684.48 ?  53   ARG O NE    1 
ATOM 8678  C CZ    . ARG E 5 53  ? 32.376  -34.927 103.104 1.00 684.48 ?  53   ARG O CZ    1 
ATOM 8679  N NH1   . ARG E 5 53  ? 33.148  -34.755 104.172 1.00 684.48 1  53   ARG O NH1   1 
ATOM 8680  N NH2   . ARG E 5 53  ? 31.075  -34.664 103.177 1.00 684.48 ?  53   ARG O NH2   1 
ATOM 8681  N N     . TYR E 5 54  ? 36.428  -35.436 97.719  1.00 685.84 ?  54   TYR O N     1 
ATOM 8682  C CA    . TYR E 5 54  ? 35.836  -34.518 96.743  1.00 685.84 ?  54   TYR O CA    1 
ATOM 8683  C C     . TYR E 5 54  ? 36.201  -34.835 95.308  1.00 685.84 ?  54   TYR O C     1 
ATOM 8684  O O     . TYR E 5 54  ? 35.400  -34.614 94.402  1.00 685.84 ?  54   TYR O O     1 
ATOM 8685  C CB    . TYR E 5 54  ? 36.158  -33.068 97.084  1.00 685.84 ?  54   TYR O CB    1 
ATOM 8686  C CG    . TYR E 5 54  ? 35.398  -32.597 98.292  1.00 685.84 ?  54   TYR O CG    1 
ATOM 8687  C CD1   . TYR E 5 54  ? 34.005  -32.528 98.273  1.00 685.84 ?  54   TYR O CD1   1 
ATOM 8688  C CD2   . TYR E 5 54  ? 36.060  -32.254 99.471  1.00 685.84 ?  54   TYR O CD2   1 
ATOM 8689  C CE1   . TYR E 5 54  ? 33.283  -32.111 99.388  1.00 685.84 ?  54   TYR O CE1   1 
ATOM 8690  C CE2   . TYR E 5 54  ? 35.347  -31.835 100.599 1.00 685.84 ?  54   TYR O CE2   1 
ATOM 8691  C CZ    . TYR E 5 54  ? 33.958  -31.766 100.547 1.00 685.84 ?  54   TYR O CZ    1 
ATOM 8692  O OH    . TYR E 5 54  ? 33.239  -31.352 101.645 1.00 685.84 ?  54   TYR O OH    1 
ATOM 8693  N N     . GLN E 5 55  ? 37.403  -35.357 95.104  1.00 683.19 ?  55   GLN O N     1 
ATOM 8694  C CA    . GLN E 5 55  ? 37.824  -35.792 93.776  1.00 683.19 ?  55   GLN O CA    1 
ATOM 8695  C C     . GLN E 5 55  ? 37.098  -37.082 93.389  1.00 683.19 ?  55   GLN O C     1 
ATOM 8696  O O     . GLN E 5 55  ? 36.995  -37.418 92.206  1.00 683.19 ?  55   GLN O O     1 
ATOM 8697  C CB    . GLN E 5 55  ? 39.341  -35.965 93.717  1.00 683.19 ?  55   GLN O CB    1 
ATOM 8698  C CG    . GLN E 5 55  ? 40.107  -34.747 94.208  1.00 683.19 ?  55   GLN O CG    1 
ATOM 8699  C CD    . GLN E 5 55  ? 41.585  -34.800 93.887  1.00 683.19 ?  55   GLN O CD    1 
ATOM 8700  O OE1   . GLN E 5 55  ? 42.218  -35.853 93.962  1.00 683.19 ?  55   GLN O OE1   1 
ATOM 8701  N NE2   . GLN E 5 55  ? 42.150  -33.655 93.530  1.00 683.19 ?  55   GLN O NE2   1 
ATOM 8702  N N     . LYS E 5 56  ? 36.587  -37.789 94.394  1.00 672.21 ?  56   LYS O N     1 
ATOM 8703  C CA    . LYS E 5 56  ? 35.785  -38.984 94.166  1.00 672.21 ?  56   LYS O CA    1 
ATOM 8704  C C     . LYS E 5 56  ? 34.322  -38.674 93.862  1.00 672.21 ?  56   LYS O C     1 
ATOM 8705  O O     . LYS E 5 56  ? 33.615  -39.511 93.303  1.00 672.21 ?  56   LYS O O     1 
ATOM 8706  C CB    . LYS E 5 56  ? 35.887  -39.956 95.349  1.00 672.21 ?  56   LYS O CB    1 
ATOM 8707  C CG    . LYS E 5 56  ? 36.816  -41.128 95.074  1.00 672.21 ?  56   LYS O CG    1 
ATOM 8708  C CD    . LYS E 5 56  ? 37.333  -41.767 96.354  1.00 672.21 ?  56   LYS O CD    1 
ATOM 8709  C CE    . LYS E 5 56  ? 38.740  -42.345 96.150  1.00 672.21 ?  56   LYS O CE    1 
ATOM 8710  N NZ    . LYS E 5 56  ? 39.755  -41.295 95.810  1.00 672.21 1  56   LYS O NZ    1 
ATOM 8711  N N     . SER E 5 57  ? 33.874  -37.479 94.231  1.00 671.17 ?  57   SER O N     1 
ATOM 8712  C CA    . SER E 5 57  ? 32.480  -37.097 94.038  1.00 671.17 ?  57   SER O CA    1 
ATOM 8713  C C     . SER E 5 57  ? 32.335  -36.052 92.935  1.00 671.17 ?  57   SER O C     1 
ATOM 8714  O O     . SER E 5 57  ? 33.305  -35.382 92.570  1.00 671.17 ?  57   SER O O     1 
ATOM 8715  C CB    . SER E 5 57  ? 31.886  -36.580 95.350  1.00 671.17 ?  57   SER O CB    1 
ATOM 8716  O OG    . SER E 5 57  ? 32.180  -35.208 95.545  1.00 671.17 ?  57   SER O OG    1 
ATOM 8717  N N     . THR E 5 58  ? 31.120  -35.917 92.412  1.00 647.91 ?  58   THR O N     1 
ATOM 8718  C CA    . THR E 5 58  ? 30.848  -34.972 91.335  1.00 647.91 ?  58   THR O CA    1 
ATOM 8719  C C     . THR E 5 58  ? 29.758  -33.979 91.706  1.00 647.91 ?  58   THR O C     1 
ATOM 8720  O O     . THR E 5 58  ? 29.328  -33.182 90.878  1.00 647.91 ?  58   THR O O     1 
ATOM 8721  C CB    . THR E 5 58  ? 30.433  -35.684 90.037  1.00 647.91 ?  58   THR O CB    1 
ATOM 8722  O OG1   . THR E 5 58  ? 29.217  -36.399 90.263  1.00 647.91 ?  58   THR O OG1   1 
ATOM 8723  C CG2   . THR E 5 58  ? 31.506  -36.650 89.576  1.00 647.91 ?  58   THR O CG2   1 
ATOM 8724  N N     . GLU E 5 59  ? 29.317  -34.026 92.956  1.00 662.03 ?  59   GLU O N     1 
ATOM 8725  C CA    . GLU E 5 59  ? 28.288  -33.099 93.427  1.00 662.03 ?  59   GLU O CA    1 
ATOM 8726  C C     . GLU E 5 59  ? 28.841  -31.684 93.598  1.00 662.03 ?  59   GLU O C     1 
ATOM 8727  O O     . GLU E 5 59  ? 30.024  -31.509 93.903  1.00 662.03 ?  59   GLU O O     1 
ATOM 8728  C CB    . GLU E 5 59  ? 27.597  -33.612 94.702  1.00 662.03 ?  59   GLU O CB    1 
ATOM 8729  C CG    . GLU E 5 59  ? 28.379  -34.652 95.504  1.00 662.03 ?  59   GLU O CG    1 
ATOM 8730  C CD    . GLU E 5 59  ? 29.153  -34.054 96.665  1.00 662.03 ?  59   GLU O CD    1 
ATOM 8731  O OE1   . GLU E 5 59  ? 28.827  -32.921 97.072  1.00 662.03 ?  59   GLU O OE1   1 
ATOM 8732  O OE2   . GLU E 5 59  ? 30.075  -34.724 97.184  1.00 662.03 -1 59   GLU O OE2   1 
ATOM 8733  N N     . LEU E 5 60  ? 27.981  -30.690 93.376  1.00 671.35 ?  60   LEU O N     1 
ATOM 8734  C CA    . LEU E 5 60  ? 28.371  -29.277 93.398  1.00 671.35 ?  60   LEU O CA    1 
ATOM 8735  C C     . LEU E 5 60  ? 28.625  -28.778 94.804  1.00 671.35 ?  60   LEU O C     1 
ATOM 8736  O O     . LEU E 5 60  ? 27.979  -29.214 95.757  1.00 671.35 ?  60   LEU O O     1 
ATOM 8737  C CB    . LEU E 5 60  ? 27.317  -28.409 92.713  1.00 671.35 ?  60   LEU O CB    1 
ATOM 8738  C CG    . LEU E 5 60  ? 26.996  -28.770 91.260  1.00 671.35 ?  60   LEU O CG    1 
ATOM 8739  C CD1   . LEU E 5 60  ? 25.885  -27.885 90.732  1.00 671.35 ?  60   LEU O CD1   1 
ATOM 8740  C CD2   . LEU E 5 60  ? 28.241  -28.693 90.367  1.00 671.35 ?  60   LEU O CD2   1 
ATOM 8741  N N     . LEU E 5 61  ? 29.559  -27.843 94.924  1.00 679.65 ?  61   LEU O N     1 
ATOM 8742  C CA    . LEU E 5 61  ? 30.139  -27.515 96.220  1.00 679.65 ?  61   LEU O CA    1 
ATOM 8743  C C     . LEU E 5 61  ? 29.702  -26.172 96.802  1.00 679.65 ?  61   LEU O C     1 
ATOM 8744  O O     . LEU E 5 61  ? 29.900  -25.914 97.992  1.00 679.65 ?  61   LEU O O     1 
ATOM 8745  C CB    . LEU E 5 61  ? 31.668  -27.646 96.162  1.00 679.65 ?  61   LEU O CB    1 
ATOM 8746  C CG    . LEU E 5 61  ? 32.175  -29.011 95.680  1.00 679.65 ?  61   LEU O CG    1 
ATOM 8747  C CD1   . LEU E 5 61  ? 33.667  -28.993 95.473  1.00 679.65 ?  61   LEU O CD1   1 
ATOM 8748  C CD2   . LEU E 5 61  ? 31.780  -30.131 96.635  1.00 679.65 ?  61   LEU O CD2   1 
ATOM 8749  N N     . ILE E 5 62  ? 29.111  -25.321 95.969  1.00 688.52 ?  62   ILE O N     1 
ATOM 8750  C CA    . ILE E 5 62  ? 28.456  -24.120 96.470  1.00 688.52 ?  62   ILE O CA    1 
ATOM 8751  C C     . ILE E 5 62  ? 26.976  -24.418 96.523  1.00 688.52 ?  62   ILE O C     1 
ATOM 8752  O O     . ILE E 5 62  ? 26.388  -24.798 95.506  1.00 688.52 ?  62   ILE O O     1 
ATOM 8753  C CB    . ILE E 5 62  ? 28.667  -22.902 95.554  1.00 688.52 ?  62   ILE O CB    1 
ATOM 8754  C CG1   . ILE E 5 62  ? 30.150  -22.556 95.442  1.00 688.52 ?  62   ILE O CG1   1 
ATOM 8755  C CG2   . ILE E 5 62  ? 27.856  -21.708 96.062  1.00 688.52 ?  62   ILE O CG2   1 
ATOM 8756  C CD1   . ILE E 5 62  ? 30.493  -21.781 94.190  1.00 688.52 ?  62   ILE O CD1   1 
ATOM 8757  N N     . ARG E 5 63  ? 26.375  -24.252 97.699  1.00 685.66 ?  63   ARG O N     1 
ATOM 8758  C CA    . ARG E 5 63  ? 24.933  -24.442 97.843  1.00 685.66 ?  63   ARG O CA    1 
ATOM 8759  C C     . ARG E 5 63  ? 24.170  -23.473 96.934  1.00 685.66 ?  63   ARG O C     1 
ATOM 8760  O O     . ARG E 5 63  ? 24.521  -22.297 96.821  1.00 685.66 ?  63   ARG O O     1 
ATOM 8761  C CB    . ARG E 5 63  ? 24.507  -24.291 99.297  1.00 685.66 ?  63   ARG O CB    1 
ATOM 8762  C CG    . ARG E 5 63  ? 25.073  -25.365 100.216 1.00 685.66 ?  63   ARG O CG    1 
ATOM 8763  C CD    . ARG E 5 63  ? 25.057  -24.902 101.660 1.00 685.66 ?  63   ARG O CD    1 
ATOM 8764  N NE    . ARG E 5 63  ? 25.084  -23.439 101.780 1.00 685.66 ?  63   ARG O NE    1 
ATOM 8765  C CZ    . ARG E 5 63  ? 26.159  -22.667 101.595 1.00 685.66 ?  63   ARG O CZ    1 
ATOM 8766  N NH1   . ARG E 5 63  ? 27.333  -23.197 101.263 1.00 685.66 1  63   ARG O NH1   1 
ATOM 8767  N NH2   . ARG E 5 63  ? 26.059  -21.348 101.733 1.00 685.66 ?  63   ARG O NH2   1 
ATOM 8768  N N     . LYS E 5 64  ? 23.129  -23.998 96.296  1.00 670.95 ?  64   LYS O N     1 
ATOM 8769  C CA    . LYS E 5 64  ? 22.498  -23.377 95.134  1.00 670.95 ?  64   LYS O CA    1 
ATOM 8770  C C     . LYS E 5 64  ? 21.980  -21.961 95.340  1.00 670.95 ?  64   LYS O C     1 
ATOM 8771  O O     . LYS E 5 64  ? 22.148  -21.112 94.468  1.00 670.95 ?  64   LYS O O     1 
ATOM 8772  C CB    . LYS E 5 64  ? 21.369  -24.270 94.606  1.00 670.95 ?  64   LYS O CB    1 
ATOM 8773  C CG    . LYS E 5 64  ? 21.792  -25.723 94.374  1.00 670.95 ?  64   LYS O CG    1 
ATOM 8774  C CD    . LYS E 5 64  ? 20.698  -26.538 93.686  1.00 670.95 ?  64   LYS O CD    1 
ATOM 8775  C CE    . LYS E 5 64  ? 21.161  -27.969 93.421  1.00 670.95 ?  64   LYS O CE    1 
ATOM 8776  N NZ    . LYS E 5 64  ? 20.177  -28.723 92.592  1.00 670.95 1  64   LYS O NZ    1 
ATOM 8777  N N     . LEU E 5 65  ? 21.364  -21.702 96.487  1.00 657.65 ?  65   LEU O N     1 
ATOM 8778  C CA    . LEU E 5 65  ? 20.609  -20.464 96.666  1.00 657.24 ?  65   LEU O CA    1 
ATOM 8779  C C     . LEU E 5 65  ? 21.450  -19.198 96.853  1.00 656.85 ?  65   LEU O C     1 
ATOM 8780  O O     . LEU E 5 65  ? 21.123  -18.171 96.252  1.00 657.09 ?  65   LEU O O     1 
ATOM 8781  C CB    . LEU E 5 65  ? 19.562  -20.596 97.775  1.00 657.38 ?  65   LEU O CB    1 
ATOM 8782  C CG    . LEU E 5 65  ? 18.346  -19.712 97.499  1.00 657.57 ?  65   LEU O CG    1 
ATOM 8783  C CD1   . LEU E 5 65  ? 17.283  -20.502 96.739  1.00 657.49 ?  65   LEU O CD1   1 
ATOM 8784  C CD2   . LEU E 5 65  ? 17.790  -19.132 98.790  1.00 658.18 ?  65   LEU O CD2   1 
ATOM 8785  N N     . PRO E 5 66  ? 22.509  -19.248 97.689  1.00 658.87 ?  66   PRO O N     1 
ATOM 8786  C CA    . PRO E 5 66  ? 23.424  -18.102 97.714  1.00 658.87 ?  66   PRO O CA    1 
ATOM 8787  C C     . PRO E 5 66  ? 23.927  -17.810 96.309  1.00 658.87 ?  66   PRO O C     1 
ATOM 8788  O O     . PRO E 5 66  ? 23.847  -16.664 95.841  1.00 658.87 ?  66   PRO O O     1 
ATOM 8789  C CB    . PRO E 5 66  ? 24.583  -18.596 98.578  1.00 658.87 ?  66   PRO O CB    1 
ATOM 8790  C CG    . PRO E 5 66  ? 23.991  -19.630 99.441  1.00 658.87 ?  66   PRO O CG    1 
ATOM 8791  C CD    . PRO E 5 66  ? 22.921  -20.293 98.643  1.00 658.87 ?  66   PRO O CD    1 
ATOM 8792  N N     . PHE E 5 67  ? 24.406  -18.863 95.643  1.00 657.84 ?  67   PHE O N     1 
ATOM 8793  C CA    . PHE E 5 67  ? 24.887  -18.778 94.275  1.00 657.84 ?  67   PHE O CA    1 
ATOM 8794  C C     . PHE E 5 67  ? 23.819  -18.183 93.378  1.00 657.84 ?  67   PHE O C     1 
ATOM 8795  O O     . PHE E 5 67  ? 24.078  -17.235 92.629  1.00 657.84 ?  67   PHE O O     1 
ATOM 8796  C CB    . PHE E 5 67  ? 25.301  -20.153 93.741  1.00 657.84 ?  67   PHE O CB    1 
ATOM 8797  C CG    . PHE E 5 67  ? 25.951  -20.095 92.385  1.00 657.84 ?  67   PHE O CG    1 
ATOM 8798  C CD1   . PHE E 5 67  ? 27.307  -19.808 92.262  1.00 657.84 ?  67   PHE O CD1   1 
ATOM 8799  C CD2   . PHE E 5 67  ? 25.204  -20.293 91.230  1.00 657.84 ?  67   PHE O CD2   1 
ATOM 8800  C CE1   . PHE E 5 67  ? 27.913  -19.732 91.011  1.00 657.84 ?  67   PHE O CE1   1 
ATOM 8801  C CE2   . PHE E 5 67  ? 25.800  -20.219 89.976  1.00 657.84 ?  67   PHE O CE2   1 
ATOM 8802  C CZ    . PHE E 5 67  ? 27.158  -19.937 89.868  1.00 657.84 ?  67   PHE O CZ    1 
ATOM 8803  N N     . GLN E 5 68  ? 22.618  -18.739 93.469  1.00 654.05 ?  68   GLN O N     1 
ATOM 8804  C CA    . GLN E 5 68  ? 21.515  -18.267 92.657  1.00 653.84 ?  68   GLN O CA    1 
ATOM 8805  C C     . GLN E 5 68  ? 21.275  -16.783 92.889  1.00 653.54 ?  68   GLN O C     1 
ATOM 8806  O O     . GLN E 5 68  ? 21.051  -16.032 91.936  1.00 653.43 ?  68   GLN O O     1 
ATOM 8807  C CB    . GLN E 5 68  ? 20.245  -19.053 92.950  1.00 653.92 ?  68   GLN O CB    1 
ATOM 8808  C CG    . GLN E 5 68  ? 19.199  -18.891 91.866  1.00 654.13 ?  68   GLN O CG    1 
ATOM 8809  C CD    . GLN E 5 68  ? 17.821  -19.276 92.329  1.00 654.40 ?  68   GLN O CD    1 
ATOM 8810  O OE1   . GLN E 5 68  ? 17.656  -19.978 93.334  1.00 654.92 ?  68   GLN O OE1   1 
ATOM 8811  N NE2   . GLN E 5 68  ? 16.810  -18.815 91.601  1.00 654.61 ?  68   GLN O NE2   1 
ATOM 8812  N N     . ARG E 5 69  ? 21.332  -16.362 94.152  1.00 670.67 ?  69   ARG O N     1 
ATOM 8813  C CA    . ARG E 5 69  ? 21.132  -14.959 94.473  1.00 670.67 ?  69   ARG O CA    1 
ATOM 8814  C C     . ARG E 5 69  ? 22.264  -14.099 93.949  1.00 670.67 ?  69   ARG O C     1 
ATOM 8815  O O     . ARG E 5 69  ? 22.043  -12.961 93.534  1.00 670.67 ?  69   ARG O O     1 
ATOM 8816  C CB    . ARG E 5 69  ? 20.897  -14.742 95.966  1.00 670.67 ?  69   ARG O CB    1 
ATOM 8817  C CG    . ARG E 5 69  ? 19.406  -14.634 96.297  1.00 670.67 ?  69   ARG O CG    1 
ATOM 8818  C CD    . ARG E 5 69  ? 19.133  -14.359 97.766  1.00 670.67 ?  69   ARG O CD    1 
ATOM 8819  N NE    . ARG E 5 69  ? 19.405  -15.516 98.618  1.00 670.67 ?  69   ARG O NE    1 
ATOM 8820  C CZ    . ARG E 5 69  ? 20.515  -15.675 99.334  1.00 670.67 ?  69   ARG O CZ    1 
ATOM 8821  N NH1   . ARG E 5 69  ? 21.476  -14.756 99.306  1.00 670.67 1  69   ARG O NH1   1 
ATOM 8822  N NH2   . ARG E 5 69  ? 20.667  -16.761 100.081 1.00 670.67 ?  69   ARG O NH2   1 
ATOM 8823  N N     . LEU E 5 70  ? 23.472  -14.654 93.939  1.00 668.37 ?  70   LEU O N     1 
ATOM 8824  C CA    . LEU E 5 70  ? 24.599  -13.941 93.359  1.00 668.37 ?  70   LEU O CA    1 
ATOM 8825  C C     . LEU E 5 70  ? 24.404  -13.730 91.860  1.00 668.37 ?  70   LEU O C     1 
ATOM 8826  O O     . LEU E 5 70  ? 24.749  -12.673 91.324  1.00 668.37 ?  70   LEU O O     1 
ATOM 8827  C CB    . LEU E 5 70  ? 25.918  -14.665 93.632  1.00 668.37 ?  70   LEU O CB    1 
ATOM 8828  C CG    . LEU E 5 70  ? 27.157  -14.043 92.971  1.00 668.37 ?  70   LEU O CG    1 
ATOM 8829  C CD1   . LEU E 5 70  ? 27.380  -12.597 93.397  1.00 668.37 ?  70   LEU O CD1   1 
ATOM 8830  C CD2   . LEU E 5 70  ? 28.382  -14.887 93.259  1.00 668.37 ?  70   LEU O CD2   1 
ATOM 8831  N N     . VAL E 5 71  ? 23.833  -14.732 91.198  1.00 667.64 ?  71   VAL O N     1 
ATOM 8832  C CA    . VAL E 5 71  ? 23.631  -14.694 89.752  1.00 667.70 ?  71   VAL O CA    1 
ATOM 8833  C C     . VAL E 5 71  ? 22.647  -13.601 89.348  1.00 667.71 ?  71   VAL O C     1 
ATOM 8834  O O     . VAL E 5 71  ? 22.929  -12.798 88.467  1.00 667.58 ?  71   VAL O O     1 
ATOM 8835  C CB    . VAL E 5 71  ? 23.152  -16.059 89.218  1.00 667.75 ?  71   VAL O CB    1 
ATOM 8836  C CG1   . VAL E 5 71  ? 23.158  -16.067 87.699  1.00 667.81 ?  71   VAL O CG1   1 
ATOM 8837  C CG2   . VAL E 5 71  ? 24.031  -17.175 89.750  1.00 667.32 ?  71   VAL O CG2   1 
ATOM 8838  N N     . ARG E 5 72  ? 21.499  -13.577 90.016  1.00 660.16 ?  72   ARG O N     1 
ATOM 8839  C CA    . ARG E 5 72  ? 20.441  -12.591 89.759  1.00 660.16 ?  72   ARG O CA    1 
ATOM 8840  C C     . ARG E 5 72  ? 20.924  -11.161 89.985  1.00 660.16 ?  72   ARG O C     1 
ATOM 8841  O O     . ARG E 5 72  ? 20.645  -10.272 89.173  1.00 660.16 ?  72   ARG O O     1 
ATOM 8842  C CB    . ARG E 5 72  ? 19.225  -12.887 90.637  1.00 660.16 ?  72   ARG O CB    1 
ATOM 8843  C CG    . ARG E 5 72  ? 18.668  -14.285 90.442  1.00 660.16 ?  72   ARG O CG    1 
ATOM 8844  C CD    . ARG E 5 72  ? 17.389  -14.497 91.233  1.00 660.16 ?  72   ARG O CD    1 
ATOM 8845  N NE    . ARG E 5 72  ? 16.703  -15.736 90.864  1.00 660.16 ?  72   ARG O NE    1 
ATOM 8846  C CZ    . ARG E 5 72  ? 16.022  -15.919 89.735  1.00 660.16 ?  72   ARG O CZ    1 
ATOM 8847  N NH1   . ARG E 5 72  ? 15.934  -14.949 88.832  1.00 660.16 1  72   ARG O NH1   1 
ATOM 8848  N NH2   . ARG E 5 72  ? 15.431  -17.083 89.502  1.00 660.16 ?  72   ARG O NH2   1 
ATOM 8849  N N     . GLU E 5 73  ? 21.655  -10.955 91.082  1.00 639.89 ?  73   GLU O N     1 
ATOM 8850  C CA    . GLU E 5 73  ? 22.272  -9.671  91.384  1.00 640.25 ?  73   GLU O CA    1 
ATOM 8851  C C     . GLU E 5 73  ? 23.103  -9.167  90.204  1.00 640.51 ?  73   GLU O C     1 
ATOM 8852  O O     . GLU E 5 73  ? 22.889  -8.053  89.718  1.00 640.59 ?  73   GLU O O     1 
ATOM 8853  C CB    . GLU E 5 73  ? 23.151  -9.763  92.634  1.00 640.21 ?  73   GLU O CB    1 
ATOM 8854  C CG    . GLU E 5 73  ? 23.433  -8.404  93.261  1.00 640.81 ?  73   GLU O CG    1 
ATOM 8855  C CD    . GLU E 5 73  ? 24.797  -8.304  93.913  1.00 641.40 ?  73   GLU O CD    1 
ATOM 8856  O OE1   . GLU E 5 73  ? 25.119  -9.152  94.772  1.00 641.15 ?  73   GLU O OE1   1 
ATOM 8857  O OE2   . GLU E 5 73  ? 25.543  -7.356  93.567  1.00 642.14 -1 73   GLU O OE2   1 
ATOM 8858  N N     . ILE E 5 74  ? 24.029  -10.006 89.737  1.00 635.63 ?  74   ILE O N     1 
ATOM 8859  C CA    . ILE E 5 74  ? 24.984  -9.623  88.696  1.00 635.84 ?  74   ILE O CA    1 
ATOM 8860  C C     . ILE E 5 74  ? 24.303  -9.291  87.372  1.00 636.08 ?  74   ILE O C     1 
ATOM 8861  O O     . ILE E 5 74  ? 24.736  -8.377  86.658  1.00 636.06 ?  74   ILE O O     1 
ATOM 8862  C CB    . ILE E 5 74  ? 26.050  -10.713 88.476  1.00 635.73 ?  74   ILE O CB    1 
ATOM 8863  C CG1   . ILE E 5 74  ? 26.839  -10.941 89.766  1.00 635.78 ?  74   ILE O CG1   1 
ATOM 8864  C CG2   . ILE E 5 74  ? 26.990  -10.320 87.337  1.00 635.94 ?  74   ILE O CG2   1 
ATOM 8865  C CD1   . ILE E 5 74  ? 27.941  -11.975 89.661  1.00 636.11 ?  74   ILE O CD1   1 
ATOM 8866  N N     . ALA E 5 75  ? 23.242  -10.033 87.061  1.00 638.55 ?  75   ALA O N     1 
ATOM 8867  C CA    . ALA E 5 75  ? 22.498  -9.859  85.815  1.00 638.87 ?  75   ALA O CA    1 
ATOM 8868  C C     . ALA E 5 75  ? 21.631  -8.603  85.838  1.00 639.17 ?  75   ALA O C     1 
ATOM 8869  O O     . ALA E 5 75  ? 21.511  -7.907  84.818  1.00 639.01 ?  75   ALA O O     1 
ATOM 8870  C CB    . ALA E 5 75  ? 21.648  -11.080 85.532  1.00 638.91 ?  75   ALA O CB    1 
ATOM 8871  N N     . GLN E 5 76  ? 21.032  -8.322  86.999  1.00 629.99 ?  76   GLN O N     1 
ATOM 8872  C CA    . GLN E 5 76  ? 20.240  -7.107  87.197  1.00 630.26 ?  76   GLN O CA    1 
ATOM 8873  C C     . GLN E 5 76  ? 21.028  -5.873  86.757  1.00 630.04 ?  76   GLN O C     1 
ATOM 8874  O O     . GLN E 5 76  ? 20.464  -4.958  86.156  1.00 630.02 ?  76   GLN O O     1 
ATOM 8875  C CB    . GLN E 5 76  ? 19.787  -6.987  88.657  1.00 630.27 ?  76   GLN O CB    1 
ATOM 8876  C CG    . GLN E 5 76  ? 18.804  -5.832  88.956  1.00 630.27 ?  76   GLN O CG    1 
ATOM 8877  C CD    . GLN E 5 76  ? 17.472  -5.909  88.186  1.00 630.27 ?  76   GLN O CD    1 
ATOM 8878  O OE1   . GLN E 5 76  ? 16.832  -4.890  87.905  1.00 630.27 ?  76   GLN O OE1   1 
ATOM 8879  N NE2   . GLN E 5 76  ? 17.071  -7.128  87.831  1.00 630.27 ?  76   GLN O NE2   1 
ATOM 8880  N N     . ASP E 5 77  ? 22.332  -5.876  87.032  1.00 618.46 ?  77   ASP O N     1 
ATOM 8881  C CA    . ASP E 5 77  ? 23.235  -4.808  86.608  1.00 618.34 ?  77   ASP O CA    1 
ATOM 8882  C C     . ASP E 5 77  ? 23.339  -4.674  85.088  1.00 618.06 ?  77   ASP O C     1 
ATOM 8883  O O     . ASP E 5 77  ? 23.809  -3.656  84.589  1.00 618.16 ?  77   ASP O O     1 
ATOM 8884  C CB    . ASP E 5 77  ? 24.630  -5.002  87.218  1.00 618.46 ?  77   ASP O CB    1 
ATOM 8885  C CG    . ASP E 5 77  ? 24.645  -4.837  88.740  1.00 619.46 ?  77   ASP O CG    1 
ATOM 8886  O OD1   . ASP E 5 77  ? 23.564  -4.903  89.375  1.00 620.64 ?  77   ASP O OD1   1 
ATOM 8887  O OD2   . ASP E 5 77  ? 25.748  -4.645  89.311  1.00 620.22 -1 77   ASP O OD2   1 
ATOM 8888  N N     . PHE E 5 78  ? 22.906  -5.693  84.352  1.00 617.31 ?  78   PHE O N     1 
ATOM 8889  C CA    . PHE E 5 78  ? 22.953  -5.638  82.892  1.00 617.11 ?  78   PHE O CA    1 
ATOM 8890  C C     . PHE E 5 78  ? 21.576  -5.410  82.292  1.00 617.36 ?  78   PHE O C     1 
ATOM 8891  O O     . PHE E 5 78  ? 21.454  -4.769  81.251  1.00 617.18 ?  78   PHE O O     1 
ATOM 8892  C CB    . PHE E 5 78  ? 23.569  -6.914  82.303  1.00 616.91 ?  78   PHE O CB    1 
ATOM 8893  C CG    . PHE E 5 78  ? 25.037  -7.086  82.599  1.00 615.91 ?  78   PHE O CG    1 
ATOM 8894  C CD1   . PHE E 5 78  ? 25.993  -6.391  81.873  1.00 615.08 ?  78   PHE O CD1   1 
ATOM 8895  C CD2   . PHE E 5 78  ? 25.459  -7.960  83.591  1.00 614.76 ?  78   PHE O CD2   1 
ATOM 8896  C CE1   . PHE E 5 78  ? 27.344  -6.552  82.145  1.00 614.73 ?  78   PHE O CE1   1 
ATOM 8897  C CE2   . PHE E 5 78  ? 26.801  -8.122  83.867  1.00 614.49 ?  78   PHE O CE2   1 
ATOM 8898  C CZ    . PHE E 5 78  ? 27.747  -7.420  83.138  1.00 614.93 ?  78   PHE O CZ    1 
ATOM 8899  N N     . LYS E 5 79  ? 20.550  -5.963  82.937  1.00 621.31 ?  79   LYS O N     1 
ATOM 8900  C CA    . LYS E 5 79  ? 19.168  -5.755  82.514  1.00 621.31 ?  79   LYS O CA    1 
ATOM 8901  C C     . LYS E 5 79  ? 18.166  -6.042  83.623  1.00 621.31 ?  79   LYS O C     1 
ATOM 8902  O O     . LYS E 5 79  ? 18.316  -6.993  84.400  1.00 621.31 ?  79   LYS O O     1 
ATOM 8903  C CB    . LYS E 5 79  ? 18.839  -6.584  81.277  1.00 621.31 ?  79   LYS O CB    1 
ATOM 8904  C CG    . LYS E 5 79  ? 17.894  -5.898  80.310  1.00 621.31 ?  79   LYS O CG    1 
ATOM 8905  C CD    . LYS E 5 79  ? 16.452  -6.375  80.431  1.00 621.31 ?  79   LYS O CD    1 
ATOM 8906  C CE    . LYS E 5 79  ? 15.543  -5.548  79.515  1.00 621.31 ?  79   LYS O CE    1 
ATOM 8907  N NZ    . LYS E 5 79  ? 14.164  -6.126  79.366  1.00 621.31 1  79   LYS O NZ    1 
ATOM 8908  N N     . THR E 5 80  ? 17.132  -5.209  83.672  1.00 642.30 ?  80   THR O N     1 
ATOM 8909  C CA    . THR E 5 80  ? 16.128  -5.235  84.739  1.00 642.30 ?  80   THR O CA    1 
ATOM 8910  C C     . THR E 5 80  ? 14.969  -6.167  84.410  1.00 642.30 ?  80   THR O C     1 
ATOM 8911  O O     . THR E 5 80  ? 14.716  -6.459  83.235  1.00 642.30 ?  80   THR O O     1 
ATOM 8912  C CB    . THR E 5 80  ? 15.563  -3.819  84.976  1.00 642.30 ?  80   THR O CB    1 
ATOM 8913  O OG1   . THR E 5 80  ? 14.989  -3.333  83.757  1.00 642.30 ?  80   THR O OG1   1 
ATOM 8914  C CG2   . THR E 5 80  ? 16.660  -2.855  85.412  1.00 642.30 ?  80   THR O CG2   1 
ATOM 8915  N N     . ASP E 5 81  ? 14.265  -6.618  85.453  1.00 663.92 ?  81   ASP O N     1 
ATOM 8916  C CA    . ASP E 5 81  ? 13.035  -7.418  85.305  1.00 663.92 ?  81   ASP O CA    1 
ATOM 8917  C C     . ASP E 5 81  ? 13.331  -8.624  84.416  1.00 663.92 ?  81   ASP O C     1 
ATOM 8918  O O     . ASP E 5 81  ? 12.800  -8.743  83.301  1.00 663.92 ?  81   ASP O O     1 
ATOM 8919  C CB    . ASP E 5 81  ? 11.888  -6.546  84.728  1.00 663.92 ?  81   ASP O CB    1 
ATOM 8920  C CG    . ASP E 5 81  ? 10.488  -7.131  84.979  1.00 663.92 ?  81   ASP O CG    1 
ATOM 8921  O OD1   . ASP E 5 81  ? 10.213  -7.664  86.083  1.00 663.92 ?  81   ASP O OD1   1 
ATOM 8922  O OD2   . ASP E 5 81  ? 9.648   -7.034  84.055  1.00 663.92 -1 81   ASP O OD2   1 
ATOM 8923  N N     . LEU E 5 82  ? 14.216  -9.494  84.906  1.00 657.13 ?  82   LEU O N     1 
ATOM 8924  C CA    . LEU E 5 82  ? 14.677  -10.670 84.157  1.00 657.13 ?  82   LEU O CA    1 
ATOM 8925  C C     . LEU E 5 82  ? 14.328  -11.960 84.865  1.00 657.13 ?  82   LEU O C     1 
ATOM 8926  O O     . LEU E 5 82  ? 14.252  -12.002 86.090  1.00 657.13 ?  82   LEU O O     1 
ATOM 8927  C CB    . LEU E 5 82  ? 16.191  -10.628 83.922  1.00 657.13 ?  82   LEU O CB    1 
ATOM 8928  C CG    . LEU E 5 82  ? 16.725  -9.871  82.701  1.00 657.13 ?  82   LEU O CG    1 
ATOM 8929  C CD1   . LEU E 5 82  ? 18.236  -9.849  82.738  1.00 657.13 ?  82   LEU O CD1   1 
ATOM 8930  C CD2   . LEU E 5 82  ? 16.229  -10.472 81.387  1.00 657.13 ?  82   LEU O CD2   1 
ATOM 8931  N N     . ARG E 5 83  ? 14.128  -13.013 84.081  1.00 666.91 ?  83   ARG O N     1 
ATOM 8932  C CA    . ARG E 5 83  ? 13.855  -14.341 84.619  1.00 666.91 ?  83   ARG O CA    1 
ATOM 8933  C C     . ARG E 5 83  ? 14.904  -15.347 84.152  1.00 666.91 ?  83   ARG O C     1 
ATOM 8934  O O     . ARG E 5 83  ? 15.426  -15.246 83.042  1.00 666.91 ?  83   ARG O O     1 
ATOM 8935  C CB    . ARG E 5 83  ? 12.466  -14.799 84.191  1.00 666.91 ?  83   ARG O CB    1 
ATOM 8936  C CG    . ARG E 5 83  ? 11.337  -13.916 84.692  1.00 666.91 ?  83   ARG O CG    1 
ATOM 8937  C CD    . ARG E 5 83  ? 10.097  -14.079 83.826  1.00 666.91 ?  83   ARG O CD    1 
ATOM 8938  N NE    . ARG E 5 83  ? 8.952   -13.357 84.382  1.00 666.91 ?  83   ARG O NE    1 
ATOM 8939  C CZ    . ARG E 5 83  ? 8.067   -13.889 85.227  1.00 666.91 ?  83   ARG O CZ    1 
ATOM 8940  N NH1   . ARG E 5 83  ? 8.184   -15.160 85.621  1.00 666.91 1  83   ARG O NH1   1 
ATOM 8941  N NH2   . ARG E 5 83  ? 7.059   -13.146 85.674  1.00 666.91 ?  83   ARG O NH2   1 
ATOM 8942  N N     . PHE E 5 84  ? 15.209  -16.320 84.998  1.00 669.74 ?  84   PHE O N     1 
ATOM 8943  C CA    . PHE E 5 84  ? 16.188  -17.339 84.650  1.00 668.89 ?  84   PHE O CA    1 
ATOM 8944  C C     . PHE E 5 84  ? 15.556  -18.709 84.608  1.00 668.21 ?  84   PHE O C     1 
ATOM 8945  O O     . PHE E 5 84  ? 14.777  -19.055 85.494  1.00 668.43 ?  84   PHE O O     1 
ATOM 8946  C CB    . PHE E 5 84  ? 17.319  -17.345 85.672  1.00 668.90 ?  84   PHE O CB    1 
ATOM 8947  C CG    . PHE E 5 84  ? 18.359  -16.288 85.433  1.00 669.13 ?  84   PHE O CG    1 
ATOM 8948  C CD1   . PHE E 5 84  ? 18.208  -15.011 85.955  1.00 668.93 ?  84   PHE O CD1   1 
ATOM 8949  C CD2   . PHE E 5 84  ? 19.500  -16.575 84.688  1.00 668.93 ?  84   PHE O CD2   1 
ATOM 8950  C CE1   . PHE E 5 84  ? 19.176  -14.035 85.737  1.00 668.65 ?  84   PHE O CE1   1 
ATOM 8951  C CE2   . PHE E 5 84  ? 20.466  -15.609 84.469  1.00 668.61 ?  84   PHE O CE2   1 
ATOM 8952  C CZ    . PHE E 5 84  ? 20.302  -14.335 84.993  1.00 668.48 ?  84   PHE O CZ    1 
ATOM 8953  N N     . GLN E 5 85  ? 15.892  -19.490 83.587  1.00 669.59 ?  85   GLN O N     1 
ATOM 8954  C CA    . GLN E 5 85  ? 15.554  -20.913 83.599  1.00 669.59 ?  85   GLN O CA    1 
ATOM 8955  C C     . GLN E 5 85  ? 16.421  -21.618 84.639  1.00 669.59 ?  85   GLN O C     1 
ATOM 8956  O O     . GLN E 5 85  ? 17.618  -21.336 84.748  1.00 669.59 ?  85   GLN O O     1 
ATOM 8957  C CB    . GLN E 5 85  ? 15.751  -21.543 82.223  1.00 669.59 ?  85   GLN O CB    1 
ATOM 8958  C CG    . GLN E 5 85  ? 14.717  -21.106 81.200  1.00 669.59 ?  85   GLN O CG    1 
ATOM 8959  C CD    . GLN E 5 85  ? 14.979  -21.655 79.807  1.00 669.59 ?  85   GLN O CD    1 
ATOM 8960  O OE1   . GLN E 5 85  ? 16.102  -22.049 79.473  1.00 669.59 ?  85   GLN O OE1   1 
ATOM 8961  N NE2   . GLN E 5 85  ? 13.936  -21.673 78.980  1.00 669.59 ?  85   GLN O NE2   1 
ATOM 8962  N N     . SER E 5 86  ? 15.817  -22.513 85.419  1.00 658.87 ?  86   SER O N     1 
ATOM 8963  C CA    . SER E 5 86  ? 16.546  -23.239 86.470  1.00 657.95 ?  86   SER O CA    1 
ATOM 8964  C C     . SER E 5 86  ? 17.729  -24.016 85.896  1.00 657.29 ?  86   SER O C     1 
ATOM 8965  O O     . SER E 5 86  ? 18.745  -24.185 86.563  1.00 657.26 ?  86   SER O O     1 
ATOM 8966  C CB    . SER E 5 86  ? 15.618  -24.179 87.237  1.00 657.95 ?  86   SER O CB    1 
ATOM 8967  O OG    . SER E 5 86  ? 15.056  -25.152 86.373  1.00 658.21 ?  86   SER O OG    1 
ATOM 8968  N N     . SER E 5 87  ? 17.588  -24.478 84.656  1.00 638.30 ?  87   SER O N     1 
ATOM 8969  C CA    . SER E 5 87  ? 18.700  -25.078 83.931  1.00 637.57 ?  87   SER O CA    1 
ATOM 8970  C C     . SER E 5 87  ? 19.742  -24.030 83.559  1.00 636.87 ?  87   SER O C     1 
ATOM 8971  O O     . SER E 5 87  ? 20.920  -24.347 83.443  1.00 636.85 ?  87   SER O O     1 
ATOM 8972  C CB    . SER E 5 87  ? 18.218  -25.780 82.664  1.00 637.71 ?  87   SER O CB    1 
ATOM 8973  O OG    . SER E 5 87  ? 18.096  -24.863 81.592  1.00 637.62 ?  87   SER O OG    1 
ATOM 8974  N N     . ALA E 5 88  ? 19.306  -22.789 83.366  1.00 655.06 ?  88   ALA O N     1 
ATOM 8975  C CA    . ALA E 5 88  ? 20.228  -21.712 83.016  1.00 654.66 ?  88   ALA O CA    1 
ATOM 8976  C C     . ALA E 5 88  ? 21.128  -21.392 84.190  1.00 654.27 ?  88   ALA O C     1 
ATOM 8977  O O     . ALA E 5 88  ? 22.286  -21.017 84.003  1.00 654.45 ?  88   ALA O O     1 
ATOM 8978  C CB    . ALA E 5 88  ? 19.483  -20.475 82.570  1.00 654.67 ?  88   ALA O CB    1 
ATOM 8979  N N     . VAL E 5 89  ? 20.599  -21.558 85.397  1.00 662.39 ?  89   VAL O N     1 
ATOM 8980  C CA    . VAL E 5 89  ? 21.368  -21.306 86.610  1.00 661.87 ?  89   VAL O CA    1 
ATOM 8981  C C     . VAL E 5 89  ? 22.334  -22.466 86.880  1.00 661.68 ?  89   VAL O C     1 
ATOM 8982  O O     . VAL E 5 89  ? 23.514  -22.237 87.206  1.00 661.79 ?  89   VAL O O     1 
ATOM 8983  C CB    . VAL E 5 89  ? 20.445  -21.003 87.830  1.00 662.02 ?  89   VAL O CB    1 
ATOM 8984  C CG1   . VAL E 5 89  ? 21.255  -20.644 89.074  1.00 661.78 ?  89   VAL O CG1   1 
ATOM 8985  C CG2   . VAL E 5 89  ? 19.480  -19.866 87.501  1.00 661.70 ?  89   VAL O CG2   1 
ATOM 8986  N N     . MET E 5 90  ? 21.849  -23.700 86.721  1.00 650.63 ?  90   MET O N     1 
ATOM 8987  C CA    . MET E 5 90  ? 22.705  -24.884 86.854  1.00 650.16 ?  90   MET O CA    1 
ATOM 8988  C C     . MET E 5 90  ? 23.883  -24.794 85.897  1.00 649.37 ?  90   MET O C     1 
ATOM 8989  O O     . MET E 5 90  ? 25.024  -24.953 86.318  1.00 649.30 ?  90   MET O O     1 
ATOM 8990  C CB    . MET E 5 90  ? 21.938  -26.191 86.615  1.00 650.55 ?  90   MET O CB    1 
ATOM 8991  C CG    . MET E 5 90  ? 20.734  -26.432 87.523  1.00 652.39 ?  90   MET O CG    1 
ATOM 8992  S SD    . MET E 5 90  ? 20.872  -25.663 89.152  1.00 656.59 ?  90   MET O SD    1 
ATOM 8993  C CE    . MET E 5 90  ? 22.007  -26.790 89.974  1.00 655.22 ?  90   MET O CE    1 
ATOM 8994  N N     . ALA E 5 91  ? 23.595  -24.519 84.622  1.00 644.05 ?  91   ALA O N     1 
ATOM 8995  C CA    . ALA E 5 91  ? 24.623  -24.363 83.587  1.00 643.28 ?  91   ALA O CA    1 
ATOM 8996  C C     . ALA E 5 91  ? 25.733  -23.429 84.051  1.00 642.86 ?  91   ALA O C     1 
ATOM 8997  O O     . ALA E 5 91  ? 26.913  -23.807 84.071  1.00 642.80 ?  91   ALA O O     1 
ATOM 8998  C CB    . ALA E 5 91  ? 24.012  -23.862 82.294  1.00 643.07 ?  91   ALA O CB    1 
ATOM 8999  N N     . LEU E 5 92  ? 25.345  -22.222 84.453  1.00 664.03 ?  92   LEU O N     1 
ATOM 9000  C CA    . LEU E 5 92  ? 26.279  -21.276 85.044  1.00 663.32 ?  92   LEU O CA    1 
ATOM 9001  C C     . LEU E 5 92  ? 27.038  -21.899 86.202  1.00 663.22 ?  92   LEU O C     1 
ATOM 9002  O O     . LEU E 5 92  ? 28.270  -21.821 86.241  1.00 663.16 ?  92   LEU O O     1 
ATOM 9003  C CB    . LEU E 5 92  ? 25.555  -20.019 85.501  1.00 663.02 ?  92   LEU O CB    1 
ATOM 9004  C CG    . LEU E 5 92  ? 25.239  -19.065 84.357  1.00 662.80 ?  92   LEU O CG    1 
ATOM 9005  C CD1   . LEU E 5 92  ? 24.135  -18.118 84.769  1.00 662.47 ?  92   LEU O CD1   1 
ATOM 9006  C CD2   . LEU E 5 92  ? 26.485  -18.306 83.900  1.00 661.93 ?  92   LEU O CD2   1 
ATOM 9007  N N     . GLN E 5 93  ? 26.313  -22.541 87.123  1.00 659.92 ?  93   GLN O N     1 
ATOM 9008  C CA    . GLN E 5 93  ? 26.955  -23.124 88.302  1.00 659.92 ?  93   GLN O CA    1 
ATOM 9009  C C     . GLN E 5 93  ? 28.031  -24.124 87.955  1.00 659.92 ?  93   GLN O C     1 
ATOM 9010  O O     . GLN E 5 93  ? 29.140  -24.034 88.467  1.00 659.92 ?  93   GLN O O     1 
ATOM 9011  C CB    . GLN E 5 93  ? 25.944  -23.757 89.251  1.00 659.92 ?  93   GLN O CB    1 
ATOM 9012  C CG    . GLN E 5 93  ? 26.618  -24.478 90.404  1.00 659.92 ?  93   GLN O CG    1 
ATOM 9013  C CD    . GLN E 5 93  ? 25.996  -24.168 91.731  1.00 659.92 ?  93   GLN O CD    1 
ATOM 9014  O OE1   . GLN E 5 93  ? 25.057  -23.378 91.829  1.00 659.92 ?  93   GLN O OE1   1 
ATOM 9015  N NE2   . GLN E 5 93  ? 26.525  -24.785 92.777  1.00 659.92 ?  93   GLN O NE2   1 
ATOM 9016  N N     . GLU E 5 94  ? 27.698  -25.071 87.087  1.00 652.13 ?  94   GLU O N     1 
ATOM 9017  C CA    . GLU E 5 94  ? 28.652  -26.069 86.629  1.00 652.03 ?  94   GLU O CA    1 
ATOM 9018  C C     . GLU E 5 94  ? 29.874  -25.382 86.019  1.00 651.73 ?  94   GLU O C     1 
ATOM 9019  O O     . GLU E 5 94  ? 31.012  -25.625 86.441  1.00 651.43 ?  94   GLU O O     1 
ATOM 9020  C CB    . GLU E 5 94  ? 28.009  -27.004 85.595  1.00 652.30 ?  94   GLU O CB    1 
ATOM 9021  C CG    . GLU E 5 94  ? 26.828  -27.852 86.090  1.00 652.90 ?  94   GLU O CG    1 
ATOM 9022  C CD    . GLU E 5 94  ? 27.241  -29.014 86.986  1.00 654.32 ?  94   GLU O CD    1 
ATOM 9023  O OE1   . GLU E 5 94  ? 28.423  -29.427 86.941  1.00 654.72 ?  94   GLU O OE1   1 
ATOM 9024  O OE2   . GLU E 5 94  ? 26.373  -29.517 87.738  1.00 655.09 -1 94   GLU O OE2   1 
ATOM 9025  N N     . ALA E 5 95  ? 29.616  -24.506 85.048  1.00 658.63 ?  95   ALA O N     1 
ATOM 9026  C CA    . ALA E 5 95  ? 30.670  -23.813 84.309  1.00 658.57 ?  95   ALA O CA    1 
ATOM 9027  C C     . ALA E 5 95  ? 31.633  -23.088 85.237  1.00 658.47 ?  95   ALA O C     1 
ATOM 9028  O O     . ALA E 5 95  ? 32.844  -23.088 85.014  1.00 658.41 ?  95   ALA O O     1 
ATOM 9029  C CB    . ALA E 5 95  ? 30.060  -22.843 83.309  1.00 658.47 ?  95   ALA O CB    1 
ATOM 9030  N N     . SER E 5 96  ? 31.076  -22.503 86.295  1.00 672.68 ?  96   SER O N     1 
ATOM 9031  C CA    . SER E 5 96  ? 31.819  -21.673 87.235  1.00 672.68 ?  96   SER O CA    1 
ATOM 9032  C C     . SER E 5 96  ? 32.665  -22.511 88.168  1.00 672.68 ?  96   SER O C     1 
ATOM 9033  O O     . SER E 5 96  ? 33.860  -22.270 88.321  1.00 672.68 ?  96   SER O O     1 
ATOM 9034  C CB    . SER E 5 96  ? 30.854  -20.811 88.047  1.00 672.68 ?  96   SER O CB    1 
ATOM 9035  O OG    . SER E 5 96  ? 29.976  -20.090 87.194  1.00 672.68 ?  96   SER O OG    1 
ATOM 9036  N N     . GLU E 5 97  ? 32.044  -23.494 88.801  1.00 670.23 ?  97   GLU O N     1 
ATOM 9037  C CA    . GLU E 5 97  ? 32.782  -24.379 89.685  1.00 670.23 ?  97   GLU O CA    1 
ATOM 9038  C C     . GLU E 5 97  ? 33.910  -25.080 88.918  1.00 670.23 ?  97   GLU O C     1 
ATOM 9039  O O     . GLU E 5 97  ? 35.092  -24.852 89.212  1.00 670.23 ?  97   GLU O O     1 
ATOM 9040  C CB    . GLU E 5 97  ? 31.848  -25.375 90.341  1.00 670.23 ?  97   GLU O CB    1 
ATOM 9041  C CG    . GLU E 5 97  ? 30.777  -24.722 91.190  1.00 670.23 ?  97   GLU O CG    1 
ATOM 9042  C CD    . GLU E 5 97  ? 30.269  -25.636 92.290  1.00 670.23 ?  97   GLU O CD    1 
ATOM 9043  O OE1   . GLU E 5 97  ? 30.581  -26.849 92.259  1.00 670.23 ?  97   GLU O OE1   1 
ATOM 9044  O OE2   . GLU E 5 97  ? 29.560  -25.132 93.188  1.00 670.23 -1 97   GLU O OE2   1 
ATOM 9045  N N     . ALA E 5 98  ? 33.552  -25.882 87.915  1.00 664.72 ?  98   ALA O N     1 
ATOM 9046  C CA    . ALA E 5 98  ? 34.545  -26.545 87.073  1.00 664.72 ?  98   ALA O CA    1 
ATOM 9047  C C     . ALA E 5 98  ? 35.743  -25.635 86.803  1.00 664.72 ?  98   ALA O C     1 
ATOM 9048  O O     . ALA E 5 98  ? 36.896  -26.074 86.902  1.00 664.72 ?  98   ALA O O     1 
ATOM 9049  C CB    . ALA E 5 98  ? 33.918  -26.996 85.778  1.00 664.72 ?  98   ALA O CB    1 
ATOM 9050  N N     . TYR E 5 99  ? 35.451  -24.368 86.487  1.00 666.53 ?  99   TYR O N     1 
ATOM 9051  C CA    . TYR E 5 99  ? 36.457  -23.336 86.191  1.00 666.53 ?  99   TYR O CA    1 
ATOM 9052  C C     . TYR E 5 99  ? 37.353  -23.016 87.376  1.00 666.53 ?  99   TYR O C     1 
ATOM 9053  O O     . TYR E 5 99  ? 38.569  -22.790 87.222  1.00 666.53 ?  99   TYR O O     1 
ATOM 9054  C CB    . TYR E 5 99  ? 35.769  -22.036 85.749  1.00 666.53 ?  99   TYR O CB    1 
ATOM 9055  C CG    . TYR E 5 99  ? 36.654  -20.811 85.848  1.00 666.53 ?  99   TYR O CG    1 
ATOM 9056  C CD1   . TYR E 5 99  ? 36.725  -20.073 87.027  1.00 666.53 ?  99   TYR O CD1   1 
ATOM 9057  C CD2   . TYR E 5 99  ? 37.433  -20.403 84.764  1.00 666.53 ?  99   TYR O CD2   1 
ATOM 9058  C CE1   . TYR E 5 99  ? 37.541  -18.963 87.121  1.00 666.53 ?  99   TYR O CE1   1 
ATOM 9059  C CE2   . TYR E 5 99  ? 38.255  -19.296 84.849  1.00 666.53 ?  99   TYR O CE2   1 
ATOM 9060  C CZ    . TYR E 5 99  ? 38.304  -18.585 86.025  1.00 666.53 ?  99   TYR O CZ    1 
ATOM 9061  O OH    . TYR E 5 99  ? 39.117  -17.492 86.114  1.00 666.53 ?  99   TYR O OH    1 
ATOM 9062  N N     . LEU E 5 100 ? 36.735  -22.955 88.553  1.00 679.15 ?  100  LEU O N     1 
ATOM 9063  C CA    . LEU E 5 100 ? 37.417  -22.523 89.765  1.00 679.15 ?  100  LEU O CA    1 
ATOM 9064  C C     . LEU E 5 100 ? 38.329  -23.621 90.240  1.00 679.15 ?  100  LEU O C     1 
ATOM 9065  O O     . LEU E 5 100 ? 39.371  -23.359 90.840  1.00 679.15 ?  100  LEU O O     1 
ATOM 9066  C CB    . LEU E 5 100 ? 36.409  -22.180 90.859  1.00 679.15 ?  100  LEU O CB    1 
ATOM 9067  C CG    . LEU E 5 100 ? 35.654  -20.845 90.856  1.00 679.15 ?  100  LEU O CG    1 
ATOM 9068  C CD1   . LEU E 5 100 ? 34.654  -20.836 92.007  1.00 679.15 ?  100  LEU O CD1   1 
ATOM 9069  C CD2   . LEU E 5 100 ? 36.577  -19.642 90.967  1.00 679.15 ?  100  LEU O CD2   1 
ATOM 9070  N N     . VAL E 5 101 ? 37.922  -24.856 89.960  1.00 675.66 ?  101  VAL O N     1 
ATOM 9071  C CA    . VAL E 5 101 ? 38.635  -26.052 90.398  1.00 675.66 ?  101  VAL O CA    1 
ATOM 9072  C C     . VAL E 5 101 ? 39.898  -26.157 89.557  1.00 675.66 ?  101  VAL O C     1 
ATOM 9073  O O     . VAL E 5 101 ? 41.015  -26.114 90.078  1.00 675.66 ?  101  VAL O O     1 
ATOM 9074  C CB    . VAL E 5 101 ? 37.730  -27.288 90.278  1.00 675.66 ?  101  VAL O CB    1 
ATOM 9075  C CG1   . VAL E 5 101 ? 38.493  -28.546 90.595  1.00 675.66 ?  101  VAL O CG1   1 
ATOM 9076  C CG2   . VAL E 5 101 ? 36.523  -27.137 91.208  1.00 675.66 ?  101  VAL O CG2   1 
ATOM 9077  N N     . ALA E 5 102 ? 39.699  -26.239 88.248  1.00 679.77 ?  102  ALA O N     1 
ATOM 9078  C CA    . ALA E 5 102 ? 40.763  -26.023 87.290  1.00 679.77 ?  102  ALA O CA    1 
ATOM 9079  C C     . ALA E 5 102 ? 41.695  -24.940 87.807  1.00 679.77 ?  102  ALA O C     1 
ATOM 9080  O O     . ALA E 5 102 ? 42.886  -25.182 87.970  1.00 679.77 ?  102  ALA O O     1 
ATOM 9081  C CB    . ALA E 5 102 ? 40.181  -25.632 85.955  1.00 679.77 ?  102  ALA O CB    1 
ATOM 9082  N N     . LEU E 5 103 ? 41.144  -23.766 88.117  1.00 683.62 ?  103  LEU O N     1 
ATOM 9083  C CA    . LEU E 5 103 ? 41.965  -22.656 88.617  1.00 683.62 ?  103  LEU O CA    1 
ATOM 9084  C C     . LEU E 5 103 ? 42.782  -22.956 89.869  1.00 683.62 ?  103  LEU O C     1 
ATOM 9085  O O     . LEU E 5 103 ? 43.959  -22.605 89.936  1.00 683.62 ?  103  LEU O O     1 
ATOM 9086  C CB    . LEU E 5 103 ? 41.144  -21.390 88.832  1.00 683.62 ?  103  LEU O CB    1 
ATOM 9087  C CG    . LEU E 5 103 ? 41.987  -20.154 89.161  1.00 683.62 ?  103  LEU O CG    1 
ATOM 9088  C CD1   . LEU E 5 103 ? 42.833  -19.710 87.964  1.00 683.62 ?  103  LEU O CD1   1 
ATOM 9089  C CD2   . LEU E 5 103 ? 41.073  -19.051 89.609  1.00 683.62 ?  103  LEU O CD2   1 
ATOM 9090  N N     . PHE E 5 104 ? 42.175  -23.600 90.858  1.00 697.46 ?  104  PHE O N     1 
ATOM 9091  C CA    . PHE E 5 104 ? 42.917  -23.970 92.046  1.00 697.46 ?  104  PHE O CA    1 
ATOM 9092  C C     . PHE E 5 104 ? 44.053  -24.934 91.702  1.00 697.46 ?  104  PHE O C     1 
ATOM 9093  O O     . PHE E 5 104 ? 45.187  -24.735 92.137  1.00 697.46 ?  104  PHE O O     1 
ATOM 9094  C CB    . PHE E 5 104 ? 41.975  -24.535 93.101  1.00 697.46 ?  104  PHE O CB    1 
ATOM 9095  C CG    . PHE E 5 104 ? 41.212  -23.478 93.837  1.00 697.46 ?  104  PHE O CG    1 
ATOM 9096  C CD1   . PHE E 5 104 ? 41.883  -22.541 94.627  1.00 697.46 ?  104  PHE O CD1   1 
ATOM 9097  C CD2   . PHE E 5 104 ? 39.834  -23.389 93.725  1.00 697.46 ?  104  PHE O CD2   1 
ATOM 9098  C CE1   . PHE E 5 104 ? 41.192  -21.544 95.298  1.00 697.46 ?  104  PHE O CE1   1 
ATOM 9099  C CE2   . PHE E 5 104 ? 39.127  -22.391 94.401  1.00 697.46 ?  104  PHE O CE2   1 
ATOM 9100  C CZ    . PHE E 5 104 ? 39.811  -21.467 95.190  1.00 697.46 ?  104  PHE O CZ    1 
ATOM 9101  N N     . GLU E 5 105 ? 43.745  -25.956 90.901  1.00 679.82 ?  105  GLU O N     1 
ATOM 9102  C CA    . GLU E 5 105 ? 44.754  -26.833 90.318  1.00 679.82 ?  105  GLU O CA    1 
ATOM 9103  C C     . GLU E 5 105 ? 45.961  -26.013 89.899  1.00 679.82 ?  105  GLU O C     1 
ATOM 9104  O O     . GLU E 5 105 ? 47.046  -26.216 90.420  1.00 679.82 ?  105  GLU O O     1 
ATOM 9105  C CB    . GLU E 5 105 ? 44.207  -27.544 89.074  1.00 679.82 ?  105  GLU O CB    1 
ATOM 9106  C CG    . GLU E 5 105 ? 43.695  -28.975 89.240  1.00 679.82 ?  105  GLU O CG    1 
ATOM 9107  C CD    . GLU E 5 105 ? 42.719  -29.367 88.116  1.00 679.82 ?  105  GLU O CD    1 
ATOM 9108  O OE1   . GLU E 5 105 ? 43.014  -29.043 86.934  1.00 679.82 ?  105  GLU O OE1   1 
ATOM 9109  O OE2   . GLU E 5 105 ? 41.650  -29.983 88.410  1.00 679.82 -1 105  GLU O OE2   1 
ATOM 9110  N N     . ASP E 5 106 ? 45.773  -25.082 88.971  1.00 686.78 ?  106  ASP O N     1 
ATOM 9111  C CA    . ASP E 5 106 ? 46.905  -24.342 88.434  1.00 686.78 ?  106  ASP O CA    1 
ATOM 9112  C C     . ASP E 5 106 ? 47.494  -23.409 89.487  1.00 686.78 ?  106  ASP O C     1 
ATOM 9113  O O     . ASP E 5 106 ? 48.700  -23.129 89.484  1.00 686.78 ?  106  ASP O O     1 
ATOM 9114  C CB    . ASP E 5 106 ? 46.520  -23.549 87.188  1.00 686.78 ?  106  ASP O CB    1 
ATOM 9115  C CG    . ASP E 5 106 ? 45.566  -24.298 86.291  1.00 686.78 ?  106  ASP O CG    1 
ATOM 9116  O OD1   . ASP E 5 106 ? 45.739  -25.521 86.109  1.00 686.78 ?  106  ASP O OD1   1 
ATOM 9117  O OD2   . ASP E 5 106 ? 44.635  -23.656 85.762  1.00 686.78 -1 106  ASP O OD2   1 
ATOM 9118  N N     . THR E 5 107 ? 46.642  -22.921 90.380  1.00 685.11 ?  107  THR O N     1 
ATOM 9119  C CA    . THR E 5 107 ? 47.096  -22.064 91.458  1.00 685.11 ?  107  THR O CA    1 
ATOM 9120  C C     . THR E 5 107 ? 48.082  -22.874 92.270  1.00 685.11 ?  107  THR O C     1 
ATOM 9121  O O     . THR E 5 107 ? 49.258  -22.513 92.405  1.00 685.11 ?  107  THR O O     1 
ATOM 9122  C CB    . THR E 5 107 ? 45.931  -21.635 92.344  1.00 685.11 ?  107  THR O CB    1 
ATOM 9123  O OG1   . THR E 5 107 ? 45.008  -20.861 91.569  1.00 685.11 ?  107  THR O OG1   1 
ATOM 9124  C CG2   . THR E 5 107 ? 46.429  -20.814 93.518  1.00 685.11 ?  107  THR O CG2   1 
ATOM 9125  N N     . ASN E 5 108 ? 47.577  -23.994 92.777  1.00 696.45 ?  108  ASN O N     1 
ATOM 9126  C CA    . ASN E 5 108 ? 48.332  -24.944 93.573  1.00 696.45 ?  108  ASN O CA    1 
ATOM 9127  C C     . ASN E 5 108 ? 49.707  -25.311 93.016  1.00 696.45 ?  108  ASN O C     1 
ATOM 9128  O O     . ASN E 5 108 ? 50.643  -25.520 93.777  1.00 696.45 ?  108  ASN O O     1 
ATOM 9129  C CB    . ASN E 5 108 ? 47.498  -26.201 93.743  1.00 696.45 ?  108  ASN O CB    1 
ATOM 9130  C CG    . ASN E 5 108 ? 47.985  -27.063 94.855  1.00 696.45 ?  108  ASN O CG    1 
ATOM 9131  O OD1   . ASN E 5 108 ? 48.642  -26.591 95.779  1.00 696.45 ?  108  ASN O OD1   1 
ATOM 9132  N ND2   . ASN E 5 108 ? 47.657  -28.347 94.788  1.00 696.45 ?  108  ASN O ND2   1 
ATOM 9133  N N     . LEU E 5 109 ? 49.828  -25.383 91.695  1.00 685.43 ?  109  LEU O N     1 
ATOM 9134  C CA    . LEU E 5 109 ? 51.118  -25.666 91.077  1.00 685.43 ?  109  LEU O CA    1 
ATOM 9135  C C     . LEU E 5 109 ? 52.083  -24.515 91.291  1.00 685.43 ?  109  LEU O C     1 
ATOM 9136  O O     . LEU E 5 109 ? 53.266  -24.738 91.553  1.00 685.43 ?  109  LEU O O     1 
ATOM 9137  C CB    . LEU E 5 109 ? 50.968  -26.008 89.596  1.00 685.43 ?  109  LEU O CB    1 
ATOM 9138  C CG    . LEU E 5 109 ? 50.315  -27.386 89.394  1.00 685.43 ?  109  LEU O CG    1 
ATOM 9139  C CD1   . LEU E 5 109 ? 49.263  -27.357 88.297  1.00 685.43 ?  109  LEU O CD1   1 
ATOM 9140  C CD2   . LEU E 5 109 ? 51.345  -28.489 89.154  1.00 685.43 ?  109  LEU O CD2   1 
ATOM 9141  N N     . CYS E 5 110 ? 51.575  -23.291 91.211  1.00 679.59 ?  110  CYS O N     1 
ATOM 9142  C CA    . CYS E 5 110 ? 52.410  -22.118 91.453  1.00 679.59 ?  110  CYS O CA    1 
ATOM 9143  C C     . CYS E 5 110 ? 52.907  -22.085 92.902  1.00 679.59 ?  110  CYS O C     1 
ATOM 9144  O O     . CYS E 5 110 ? 54.080  -21.818 93.159  1.00 679.59 ?  110  CYS O O     1 
ATOM 9145  C CB    . CYS E 5 110 ? 51.644  -20.844 91.132  1.00 679.59 ?  110  CYS O CB    1 
ATOM 9146  S SG    . CYS E 5 110 ? 51.048  -20.754 89.464  1.00 679.59 ?  110  CYS O SG    1 
ATOM 9147  N N     . ALA E 5 111 ? 52.002  -22.351 93.843  1.00 693.57 ?  111  ALA O N     1 
ATOM 9148  C CA    . ALA E 5 111 ? 52.364  -22.481 95.249  1.00 693.57 ?  111  ALA O CA    1 
ATOM 9149  C C     . ALA E 5 111 ? 53.552  -23.405 95.327  1.00 693.57 ?  111  ALA O C     1 
ATOM 9150  O O     . ALA E 5 111 ? 54.629  -23.017 95.802  1.00 693.57 ?  111  ALA O O     1 
ATOM 9151  C CB    . ALA E 5 111 ? 51.218  -23.047 96.035  1.00 693.57 ?  111  ALA O CB    1 
ATOM 9152  N N     . ILE E 5 112 ? 53.359  -24.615 94.806  1.00 692.19 ?  112  ILE O N     1 
ATOM 9153  C CA    . ILE E 5 112 ? 54.409  -25.624 94.756  1.00 692.19 ?  112  ILE O CA    1 
ATOM 9154  C C     . ILE E 5 112 ? 55.670  -25.132 94.038  1.00 692.19 ?  112  ILE O C     1 
ATOM 9155  O O     . ILE E 5 112 ? 56.778  -25.407 94.483  1.00 692.19 ?  112  ILE O O     1 
ATOM 9156  C CB    . ILE E 5 112 ? 53.878  -26.942 94.168  1.00 692.19 ?  112  ILE O CB    1 
ATOM 9157  C CG1   . ILE E 5 112 ? 53.083  -27.685 95.239  1.00 692.19 ?  112  ILE O CG1   1 
ATOM 9158  C CG2   . ILE E 5 112 ? 55.014  -27.830 93.700  1.00 692.19 ?  112  ILE O CG2   1 
ATOM 9159  C CD1   . ILE E 5 112 ? 51.952  -28.543 94.713  1.00 692.19 ?  112  ILE O CD1   1 
ATOM 9160  N N     . HIS E 5 113 ? 55.508  -24.377 92.956  1.00 672.93 ?  113  HIS O N     1 
ATOM 9161  C CA    . HIS E 5 113 ? 56.674  -23.881 92.237  1.00 672.93 ?  113  HIS O CA    1 
ATOM 9162  C C     . HIS E 5 113 ? 57.556  -23.014 93.137  1.00 672.93 ?  113  HIS O C     1 
ATOM 9163  O O     . HIS E 5 113 ? 58.782  -22.926 92.934  1.00 672.93 ?  113  HIS O O     1 
ATOM 9164  C CB    . HIS E 5 113 ? 56.257  -23.089 91.010  1.00 672.93 ?  113  HIS O CB    1 
ATOM 9165  C CG    . HIS E 5 113 ? 57.407  -22.666 90.163  1.00 672.93 ?  113  HIS O CG    1 
ATOM 9166  N ND1   . HIS E 5 113 ? 57.963  -23.488 89.214  1.00 672.93 ?  113  HIS O ND1   1 
ATOM 9167  C CD2   . HIS E 5 113 ? 58.120  -21.517 90.127  1.00 672.93 ?  113  HIS O CD2   1 
ATOM 9168  C CE1   . HIS E 5 113 ? 58.957  -22.860 88.611  1.00 672.93 ?  113  HIS O CE1   1 
ATOM 9169  N NE2   . HIS E 5 113 ? 59.080  -21.664 89.154  1.00 672.93 ?  113  HIS O NE2   1 
ATOM 9170  N N     . ALA E 5 114 ? 56.918  -22.382 94.129  1.00 675.74 ?  114  ALA O N     1 
ATOM 9171  C CA    . ALA E 5 114 ? 57.581  -21.473 95.060  1.00 675.74 ?  114  ALA O CA    1 
ATOM 9172  C C     . ALA E 5 114 ? 57.997  -22.186 96.363  1.00 675.74 ?  114  ALA O C     1 
ATOM 9173  O O     . ALA E 5 114 ? 58.126  -21.559 97.423  1.00 675.74 ?  114  ALA O O     1 
ATOM 9174  C CB    . ALA E 5 114 ? 56.674  -20.297 95.356  1.00 675.74 ?  114  ALA O CB    1 
ATOM 9175  N N     . LYS E 5 115 ? 58.202  -23.500 96.263  1.00 666.82 ?  115  LYS O N     1 
ATOM 9176  C CA    . LYS E 5 115 ? 58.583  -24.354 97.393  1.00 666.82 ?  115  LYS O CA    1 
ATOM 9177  C C     . LYS E 5 115 ? 57.604  -24.233 98.570  1.00 666.82 ?  115  LYS O C     1 
ATOM 9178  O O     . LYS E 5 115 ? 57.913  -24.639 99.687  1.00 666.82 ?  115  LYS O O     1 
ATOM 9179  C CB    . LYS E 5 115 ? 60.036  -24.095 97.829  1.00 666.82 ?  115  LYS O CB    1 
ATOM 9180  C CG    . LYS E 5 115 ? 61.051  -23.993 96.682  1.00 666.82 ?  115  LYS O CG    1 
ATOM 9181  C CD    . LYS E 5 115 ? 61.794  -25.296 96.352  1.00 666.82 ?  115  LYS O CD    1 
ATOM 9182  C CE    . LYS E 5 115 ? 63.177  -24.947 95.735  1.00 666.82 ?  115  LYS O CE    1 
ATOM 9183  N NZ    . LYS E 5 115 ? 63.937  -26.062 95.060  1.00 666.82 1  115  LYS O NZ    1 
ATOM 9184  N N     . ARG E 5 116 ? 56.426  -23.681 98.294  1.00 689.40 ?  116  ARG O N     1 
ATOM 9185  C CA    . ARG E 5 116 ? 55.367  -23.523 99.286  1.00 689.40 ?  116  ARG O CA    1 
ATOM 9186  C C     . ARG E 5 116 ? 54.358  -24.690 99.267  1.00 689.40 ?  116  ARG O C     1 
ATOM 9187  O O     . ARG E 5 116 ? 54.465  -25.600 98.446  1.00 689.40 ?  116  ARG O O     1 
ATOM 9188  C CB    . ARG E 5 116 ? 54.650  -22.191 99.077  1.00 689.40 ?  116  ARG O CB    1 
ATOM 9189  C CG    . ARG E 5 116 ? 55.440  -20.992 99.538  1.00 689.40 ?  116  ARG O CG    1 
ATOM 9190  C CD    . ARG E 5 116 ? 54.559  -19.756 99.626  1.00 689.40 ?  116  ARG O CD    1 
ATOM 9191  N NE    . ARG E 5 116 ? 54.441  -19.039 98.354  1.00 689.40 ?  116  ARG O NE    1 
ATOM 9192  C CZ    . ARG E 5 116 ? 53.395  -19.111 97.528  1.00 689.40 ?  116  ARG O CZ    1 
ATOM 9193  N NH1   . ARG E 5 116 ? 52.358  -19.881 97.812  1.00 689.40 1  116  ARG O NH1   1 
ATOM 9194  N NH2   . ARG E 5 116 ? 53.392  -18.407 96.403  1.00 689.40 ?  116  ARG O NH2   1 
ATOM 9195  N N     . VAL E 5 117 ? 53.399  -24.673 100.185 1.00 699.00 ?  117  VAL O N     1 
ATOM 9196  C CA    . VAL E 5 117 ? 52.384  -25.728 100.268 1.00 699.00 ?  117  VAL O CA    1 
ATOM 9197  C C     . VAL E 5 117 ? 51.012  -25.100 100.513 1.00 699.00 ?  117  VAL O C     1 
ATOM 9198  O O     . VAL E 5 117 ? 49.973  -25.763 100.465 1.00 699.00 ?  117  VAL O O     1 
ATOM 9199  C CB    . VAL E 5 117 ? 52.779  -26.800 101.322 1.00 699.00 ?  117  VAL O CB    1 
ATOM 9200  C CG1   . VAL E 5 117 ? 51.628  -27.152 102.277 1.00 699.00 ?  117  VAL O CG1   1 
ATOM 9201  C CG2   . VAL E 5 117 ? 53.329  -28.028 100.630 1.00 699.00 ?  117  VAL O CG2   1 
ATOM 9202  N N     . THR E 5 118 ? 51.039  -23.794 100.741 1.00 701.76 ?  118  THR O N     1 
ATOM 9203  C CA    . THR E 5 118 ? 49.854  -22.991 100.943 1.00 701.76 ?  118  THR O CA    1 
ATOM 9204  C C     . THR E 5 118 ? 49.646  -22.133 99.705  1.00 701.76 ?  118  THR O C     1 
ATOM 9205  O O     . THR E 5 118 ? 50.563  -21.440 99.280  1.00 701.76 ?  118  THR O O     1 
ATOM 9206  C CB    . THR E 5 118 ? 50.057  -22.053 102.158 1.00 701.76 ?  118  THR O CB    1 
ATOM 9207  O OG1   . THR E 5 118 ? 50.581  -22.796 103.268 1.00 701.76 ?  118  THR O OG1   1 
ATOM 9208  C CG2   . THR E 5 118 ? 48.752  -21.381 102.560 1.00 701.76 ?  118  THR O CG2   1 
ATOM 9209  N N     . ILE E 5 119 ? 48.452  -22.178 99.125  1.00 686.93 ?  119  ILE O N     1 
ATOM 9210  C CA    . ILE E 5 119 ? 48.127  -21.265 98.029  1.00 686.93 ?  119  ILE O CA    1 
ATOM 9211  C C     . ILE E 5 119 ? 47.859  -19.856 98.562  1.00 686.93 ?  119  ILE O C     1 
ATOM 9212  O O     . ILE E 5 119 ? 47.335  -19.681 99.672  1.00 686.93 ?  119  ILE O O     1 
ATOM 9213  C CB    . ILE E 5 119 ? 46.957  -21.756 97.132  1.00 686.93 ?  119  ILE O CB    1 
ATOM 9214  C CG1   . ILE E 5 119 ? 45.652  -21.895 97.912  1.00 686.93 ?  119  ILE O CG1   1 
ATOM 9215  C CG2   . ILE E 5 119 ? 47.299  -23.075 96.482  1.00 686.93 ?  119  ILE O CG2   1 
ATOM 9216  C CD1   . ILE E 5 119 ? 44.455  -22.084 97.013  1.00 686.93 ?  119  ILE O CD1   1 
ATOM 9217  N N     . MET E 5 120 ? 48.242  -18.856 97.777  1.00 688.06 ?  120  MET O N     1 
ATOM 9218  C CA    . MET E 5 120 ? 48.164  -17.469 98.199  1.00 688.06 ?  120  MET O CA    1 
ATOM 9219  C C     . MET E 5 120 ? 47.705  -16.641 97.019  1.00 688.06 ?  120  MET O C     1 
ATOM 9220  O O     . MET E 5 120 ? 47.891  -17.059 95.873  1.00 688.06 ?  120  MET O O     1 
ATOM 9221  C CB    . MET E 5 120 ? 49.528  -16.985 98.679  1.00 688.06 ?  120  MET O CB    1 
ATOM 9222  C CG    . MET E 5 120 ? 49.893  -17.468 100.063 1.00 688.06 ?  120  MET O CG    1 
ATOM 9223  S SD    . MET E 5 120 ? 51.633  -17.233 100.481 1.00 688.06 ?  120  MET O SD    1 
ATOM 9224  C CE    . MET E 5 120 ? 51.736  -18.310 101.916 1.00 688.06 ?  120  MET O CE    1 
ATOM 9225  N N     . PRO E 5 121 ? 47.088  -15.471 97.281  1.00 689.90 ?  121  PRO O N     1 
ATOM 9226  C CA    . PRO E 5 121 ? 46.570  -14.694 96.164  1.00 689.90 ?  121  PRO O CA    1 
ATOM 9227  C C     . PRO E 5 121 ? 47.609  -14.433 95.077  1.00 689.90 ?  121  PRO O C     1 
ATOM 9228  O O     . PRO E 5 121 ? 47.244  -14.320 93.906  1.00 689.90 ?  121  PRO O O     1 
ATOM 9229  C CB    . PRO E 5 121 ? 46.112  -13.392 96.832  1.00 689.90 ?  121  PRO O CB    1 
ATOM 9230  C CG    . PRO E 5 121 ? 45.713  -13.827 98.203  1.00 689.90 ?  121  PRO O CG    1 
ATOM 9231  C CD    . PRO E 5 121 ? 46.793  -14.813 98.572  1.00 689.90 ?  121  PRO O CD    1 
ATOM 9232  N N     . LYS E 5 122 ? 48.886  -14.368 95.448  1.00 690.58 ?  122  LYS O N     1 
ATOM 9233  C CA    . LYS E 5 122 ? 49.938  -14.063 94.472  1.00 690.58 ?  122  LYS O CA    1 
ATOM 9234  C C     . LYS E 5 122 ? 50.093  -15.175 93.425  1.00 690.58 ?  122  LYS O C     1 
ATOM 9235  O O     . LYS E 5 122 ? 50.626  -14.942 92.324  1.00 690.58 ?  122  LYS O O     1 
ATOM 9236  C CB    . LYS E 5 122 ? 51.271  -13.754 95.163  1.00 690.58 ?  122  LYS O CB    1 
ATOM 9237  C CG    . LYS E 5 122 ? 51.904  -14.917 95.898  1.00 690.58 ?  122  LYS O CG    1 
ATOM 9238  C CD    . LYS E 5 122 ? 53.382  -14.664 96.152  1.00 690.58 ?  122  LYS O CD    1 
ATOM 9239  C CE    . LYS E 5 122 ? 53.625  -14.007 97.508  1.00 690.58 ?  122  LYS O CE    1 
ATOM 9240  N NZ    . LYS E 5 122 ? 55.039  -13.536 97.643  1.00 690.58 1  122  LYS O NZ    1 
ATOM 9241  N N     . ASP E 5 123 ? 49.613  -16.366 93.780  1.00 685.47 ?  123  ASP O N     1 
ATOM 9242  C CA    . ASP E 5 123 ? 49.646  -17.535 92.904  1.00 685.47 ?  123  ASP O CA    1 
ATOM 9243  C C     . ASP E 5 123 ? 48.567  -17.400 91.843  1.00 685.47 ?  123  ASP O C     1 
ATOM 9244  O O     . ASP E 5 123 ? 48.866  -17.369 90.647  1.00 685.47 ?  123  ASP O O     1 
ATOM 9245  C CB    . ASP E 5 123 ? 49.435  -18.826 93.706  1.00 685.47 ?  123  ASP O CB    1 
ATOM 9246  C CG    . ASP E 5 123 ? 50.554  -19.094 94.712  1.00 685.47 ?  123  ASP O CG    1 
ATOM 9247  O OD1   . ASP E 5 123 ? 51.756  -18.982 94.347  1.00 685.47 ?  123  ASP O OD1   1 
ATOM 9248  O OD2   . ASP E 5 123 ? 50.215  -19.440 95.870  1.00 685.47 -1 123  ASP O OD2   1 
ATOM 9249  N N     . ILE E 5 124 ? 47.316  -17.312 92.300  1.00 687.18 ?  124  ILE O N     1 
ATOM 9250  C CA    . ILE E 5 124 ? 46.165  -17.021 91.451  1.00 687.18 ?  124  ILE O CA    1 
ATOM 9251  C C     . ILE E 5 124 ? 46.477  -15.942 90.414  1.00 687.18 ?  124  ILE O C     1 
ATOM 9252  O O     . ILE E 5 124 ? 46.198  -16.123 89.232  1.00 687.18 ?  124  ILE O O     1 
ATOM 9253  C CB    . ILE E 5 124 ? 44.945  -16.596 92.300  1.00 687.18 ?  124  ILE O CB    1 
ATOM 9254  C CG1   . ILE E 5 124 ? 44.510  -17.756 93.212  1.00 687.18 ?  124  ILE O CG1   1 
ATOM 9255  C CG2   . ILE E 5 124 ? 43.806  -16.139 91.404  1.00 687.18 ?  124  ILE O CG2   1 
ATOM 9256  C CD1   . ILE E 5 124 ? 43.386  -17.440 94.210  1.00 687.18 ?  124  ILE O CD1   1 
ATOM 9257  N N     . GLN E 5 125 ? 47.058  -14.831 90.860  1.00 678.27 ?  125  GLN O N     1 
ATOM 9258  C CA    . GLN E 5 125 ? 47.420  -13.728 89.966  1.00 678.27 ?  125  GLN O CA    1 
ATOM 9259  C C     . GLN E 5 125 ? 48.390  -14.200 88.881  1.00 678.27 ?  125  GLN O C     1 
ATOM 9260  O O     . GLN E 5 125 ? 48.219  -13.872 87.711  1.00 678.27 ?  125  GLN O O     1 
ATOM 9261  C CB    . GLN E 5 125 ? 48.018  -12.549 90.741  1.00 678.27 ?  125  GLN O CB    1 
ATOM 9262  C CG    . GLN E 5 125 ? 47.029  -11.788 91.618  1.00 678.27 ?  125  GLN O CG    1 
ATOM 9263  C CD    . GLN E 5 125 ? 47.662  -11.249 92.901  1.00 678.27 ?  125  GLN O CD    1 
ATOM 9264  O OE1   . GLN E 5 125 ? 48.866  -10.959 92.956  1.00 678.27 ?  125  GLN O OE1   1 
ATOM 9265  N NE2   . GLN E 5 125 ? 46.850  -11.129 93.946  1.00 678.27 ?  125  GLN O NE2   1 
ATOM 9266  N N     . LEU E 5 126 ? 49.390  -14.983 89.269  1.00 680.80 ?  126  LEU O N     1 
ATOM 9267  C CA    . LEU E 5 126 ? 50.324  -15.568 88.302  1.00 680.80 ?  126  LEU O CA    1 
ATOM 9268  C C     . LEU E 5 126 ? 49.641  -16.580 87.382  1.00 680.80 ?  126  LEU O C     1 
ATOM 9269  O O     . LEU E 5 126 ? 49.924  -16.620 86.183  1.00 680.80 ?  126  LEU O O     1 
ATOM 9270  C CB    . LEU E 5 126 ? 51.480  -16.243 89.027  1.00 680.80 ?  126  LEU O CB    1 
ATOM 9271  C CG    . LEU E 5 126 ? 52.436  -17.077 88.195  1.00 680.80 ?  126  LEU O CG    1 
ATOM 9272  C CD1   . LEU E 5 126 ? 53.511  -16.212 87.576  1.00 680.80 ?  126  LEU O CD1   1 
ATOM 9273  C CD2   . LEU E 5 126 ? 53.054  -18.126 89.087  1.00 680.80 ?  126  LEU O CD2   1 
ATOM 9274  N N     . ALA E 5 127 ? 48.754  -17.403 87.944  1.00 673.37 ?  127  ALA O N     1 
ATOM 9275  C CA    . ALA E 5 127 ? 48.064  -18.413 87.161  1.00 673.37 ?  127  ALA O CA    1 
ATOM 9276  C C     . ALA E 5 127 ? 47.291  -17.718 86.062  1.00 673.37 ?  127  ALA O C     1 
ATOM 9277  O O     . ALA E 5 127 ? 47.556  -17.915 84.881  1.00 673.37 ?  127  ALA O O     1 
ATOM 9278  C CB    . ALA E 5 127 ? 47.143  -19.220 88.031  1.00 673.37 ?  127  ALA O CB    1 
ATOM 9279  N N     . ARG E 5 128 ? 46.363  -16.868 86.477  1.00 666.76 ?  128  ARG O N     1 
ATOM 9280  C CA    . ARG E 5 128 ? 45.542  -16.082 85.577  1.00 666.76 ?  128  ARG O CA    1 
ATOM 9281  C C     . ARG E 5 128 ? 46.358  -15.245 84.601  1.00 666.76 ?  128  ARG O C     1 
ATOM 9282  O O     . ARG E 5 128 ? 46.028  -15.168 83.420  1.00 666.76 ?  128  ARG O O     1 
ATOM 9283  C CB    . ARG E 5 128 ? 44.631  -15.178 86.382  1.00 666.76 ?  128  ARG O CB    1 
ATOM 9284  C CG    . ARG E 5 128 ? 43.458  -15.884 86.996  1.00 666.76 ?  128  ARG O CG    1 
ATOM 9285  C CD    . ARG E 5 128 ? 42.201  -15.069 86.771  1.00 666.76 ?  128  ARG O CD    1 
ATOM 9286  N NE    . ARG E 5 128 ? 42.296  -13.725 87.337  1.00 666.76 ?  128  ARG O NE    1 
ATOM 9287  C CZ    . ARG E 5 128 ? 41.571  -12.689 86.932  1.00 666.76 ?  128  ARG O CZ    1 
ATOM 9288  N NH1   . ARG E 5 128 ? 40.696  -12.820 85.934  1.00 666.76 1  128  ARG O NH1   1 
ATOM 9289  N NH2   . ARG E 5 128 ? 41.734  -11.513 87.526  1.00 666.76 ?  128  ARG O NH2   1 
ATOM 9290  N N     . ARG E 5 129 ? 47.418  -14.620 85.093  1.00 658.41 ?  129  ARG O N     1 
ATOM 9291  C CA    . ARG E 5 129 ? 48.270  -13.818 84.232  1.00 658.41 ?  129  ARG O CA    1 
ATOM 9292  C C     . ARG E 5 129 ? 48.719  -14.660 83.060  1.00 658.41 ?  129  ARG O C     1 
ATOM 9293  O O     . ARG E 5 129 ? 48.591  -14.233 81.916  1.00 658.41 ?  129  ARG O O     1 
ATOM 9294  C CB    . ARG E 5 129 ? 49.462  -13.236 84.997  1.00 658.41 ?  129  ARG O CB    1 
ATOM 9295  C CG    . ARG E 5 129 ? 50.706  -12.907 84.154  1.00 658.41 ?  129  ARG O CG    1 
ATOM 9296  C CD    . ARG E 5 129 ? 50.456  -11.876 83.060  1.00 658.41 ?  129  ARG O CD    1 
ATOM 9297  N NE    . ARG E 5 129 ? 51.559  -10.918 82.942  1.00 658.41 ?  129  ARG O NE    1 
ATOM 9298  C CZ    . ARG E 5 129 ? 51.704  -9.822  83.698  1.00 658.41 ?  129  ARG O CZ    1 
ATOM 9299  N NH1   . ARG E 5 129 ? 50.818  -9.523  84.646  1.00 658.41 1  129  ARG O NH1   1 
ATOM 9300  N NH2   . ARG E 5 129 ? 52.750  -9.018  83.513  1.00 658.41 ?  129  ARG O NH2   1 
ATOM 9301  N N     . ILE E 5 130 ? 49.194  -15.870 83.344  1.00 654.92 ?  130  ILE O N     1 
ATOM 9302  C CA    . ILE E 5 130 ? 49.776  -16.718 82.313  1.00 655.69 ?  130  ILE O CA    1 
ATOM 9303  C C     . ILE E 5 130 ? 48.729  -17.336 81.407  1.00 656.17 ?  130  ILE O C     1 
ATOM 9304  O O     . ILE E 5 130 ? 48.951  -17.472 80.197  1.00 656.10 ?  130  ILE O O     1 
ATOM 9305  C CB    . ILE E 5 130 ? 50.730  -17.747 82.911  1.00 656.07 ?  130  ILE O CB    1 
ATOM 9306  C CG1   . ILE E 5 130 ? 51.959  -17.009 83.471  1.00 656.68 ?  130  ILE O CG1   1 
ATOM 9307  C CG2   . ILE E 5 130 ? 51.168  -18.761 81.853  1.00 655.82 ?  130  ILE O CG2   1 
ATOM 9308  C CD1   . ILE E 5 130 ? 52.791  -17.802 84.447  1.00 656.86 ?  130  ILE O CD1   1 
ATOM 9309  N N     . ARG E 5 131 ? 47.578  -17.669 81.984  1.00 650.07 ?  131  ARG O N     1 
ATOM 9310  C CA    . ARG E 5 131 ? 46.402  -18.036 81.206  1.00 650.78 ?  131  ARG O CA    1 
ATOM 9311  C C     . ARG E 5 131 ? 46.050  -16.949 80.214  1.00 651.79 ?  131  ARG O C     1 
ATOM 9312  O O     . ARG E 5 131 ? 45.492  -17.223 79.160  1.00 651.79 ?  131  ARG O O     1 
ATOM 9313  C CB    . ARG E 5 131 ? 45.205  -18.234 82.115  1.00 650.53 ?  131  ARG O CB    1 
ATOM 9314  C CG    . ARG E 5 131 ? 45.278  -19.424 83.030  1.00 648.99 ?  131  ARG O CG    1 
ATOM 9315  C CD    . ARG E 5 131 ? 43.930  -19.595 83.615  1.00 648.55 ?  131  ARG O CD    1 
ATOM 9316  N NE    . ARG E 5 131 ? 43.737  -20.844 84.340  1.00 648.95 ?  131  ARG O NE    1 
ATOM 9317  C CZ    . ARG E 5 131 ? 42.538  -21.263 84.736  1.00 648.88 ?  131  ARG O CZ    1 
ATOM 9318  N NH1   . ARG E 5 131 ? 41.481  -20.520 84.456  1.00 648.27 1  131  ARG O NH1   1 
ATOM 9319  N NH2   . ARG E 5 131 ? 42.386  -22.411 85.396  1.00 648.38 ?  131  ARG O NH2   1 
ATOM 9320  N N     . GLY E 5 132 ? 46.391  -15.710 80.557  1.00 652.80 ?  132  GLY O N     1 
ATOM 9321  C CA    . GLY E 5 132 ? 46.002  -14.545 79.768  1.00 654.70 ?  132  GLY O CA    1 
ATOM 9322  C C     . GLY E 5 132 ? 44.569  -14.134 80.075  1.00 655.55 ?  132  GLY O C     1 
ATOM 9323  O O     . GLY E 5 132 ? 43.890  -13.565 79.226  1.00 655.55 ?  132  GLY O O     1 
ATOM 9324  N N     . GLU E 5 133 ? 44.104  -14.438 81.284  1.00 651.51 ?  133  GLU O N     1 
ATOM 9325  C CA    . GLU E 5 133 ? 42.778  -14.031 81.722  1.00 651.51 ?  133  GLU O CA    1 
ATOM 9326  C C     . GLU E 5 133 ? 42.882  -12.579 82.175  1.00 651.51 ?  133  GLU O C     1 
ATOM 9327  O O     . GLU E 5 133 ? 42.415  -11.656 81.498  1.00 651.51 ?  133  GLU O O     1 
ATOM 9328  C CB    . GLU E 5 133 ? 42.305  -14.908 82.882  1.00 651.51 ?  133  GLU O CB    1 
ATOM 9329  C CG    . GLU E 5 133 ? 42.067  -16.362 82.536  1.00 651.51 ?  133  GLU O CG    1 
ATOM 9330  C CD    . GLU E 5 133 ? 41.228  -17.087 83.588  1.00 651.51 ?  133  GLU O CD    1 
ATOM 9331  O OE1   . GLU E 5 133 ? 40.876  -16.474 84.611  1.00 651.51 ?  133  GLU O OE1   1 
ATOM 9332  O OE2   . GLU E 5 133 ? 40.916  -18.276 83.398  1.00 651.51 -1 133  GLU O OE2   1 
ATOM 9333  N N     . ARG E 5 134 ? 43.498  -12.401 83.343  1.00 631.96 ?  134  ARG O N     1 
ATOM 9334  C CA    . ARG E 5 134 ? 43.963  -11.108 83.800  1.00 633.07 ?  134  ARG O CA    1 
ATOM 9335  C C     . ARG E 5 134 ? 45.106  -10.601 82.871  1.00 633.07 ?  134  ARG O C     1 
ATOM 9336  O O     . ARG E 5 134 ? 45.713  -11.376 82.111  1.00 633.07 ?  134  ARG O O     1 
ATOM 9337  C CB    . ARG E 5 134 ? 44.414  -11.217 85.268  1.00 633.07 ?  134  ARG O CB    1 
ATOM 9338  C CG    . ARG E 5 134 ? 45.153  -9.997  85.863  1.00 633.07 ?  134  ARG O CG    1 
ATOM 9339  C CD    . ARG E 5 134 ? 44.238  -8.756  86.089  1.00 633.07 ?  134  ARG O CD    1 
ATOM 9340  N NE    . ARG E 5 134 ? 43.247  -8.975  87.150  1.00 633.07 ?  134  ARG O NE    1 
ATOM 9341  C CZ    . ARG E 5 134 ? 42.792  -8.035  87.979  1.00 633.07 ?  134  ARG O CZ    1 
ATOM 9342  N NH1   . ARG E 5 134 ? 43.241  -6.782  87.895  1.00 633.07 1  134  ARG O NH1   1 
ATOM 9343  N NH2   . ARG E 5 134 ? 41.886  -8.355  88.906  1.00 633.07 ?  134  ARG O NH2   1 
ATOM 9344  N N     . ALA E 5 135 ? 45.348  -9.287  82.933  1.00 628.48 ?  135  ALA O N     1 
ATOM 9345  C CA    . ALA E 5 135 ? 46.368  -8.599  82.148  1.00 628.48 ?  135  ALA O CA    1 
ATOM 9346  C C     . ALA E 5 135 ? 47.782  -9.050  82.520  1.00 628.48 ?  135  ALA O C     1 
ATOM 9347  O O     . ALA E 5 135 ? 48.335  -9.902  81.814  1.00 628.48 ?  135  ALA O O     1 
ATOM 9348  C CB    . ALA E 5 135 ? 46.220  -7.091  82.319  1.00 628.48 ?  135  ALA O CB    1 
ATOM 9349  O OXT   . ALA E 5 135 ? 48.393  -8.596  83.502  1.00 628.48 -1 135  ALA O OXT   1 
ATOM 9350  N N     . LYS F 2 32  ? 2.769   -29.968 71.368  1.00 618.90 ?  28   LYS N N     1 
ATOM 9351  C CA    . LYS F 2 32  ? 3.963   -30.141 72.255  1.00 618.96 ?  28   LYS N CA    1 
ATOM 9352  C C     . LYS F 2 32  ? 5.204   -30.411 71.390  1.00 618.85 ?  28   LYS N C     1 
ATOM 9353  O O     . LYS F 2 32  ? 5.475   -31.560 71.008  1.00 619.01 ?  28   LYS N O     1 
ATOM 9354  C CB    . LYS F 2 32  ? 3.735   -31.278 73.270  1.00 619.03 ?  28   LYS N CB    1 
ATOM 9355  C CG    . LYS F 2 32  ? 2.255   -31.620 73.559  1.00 619.30 ?  28   LYS N CG    1 
ATOM 9356  C CD    . LYS F 2 32  ? 1.539   -30.559 74.404  1.00 619.38 ?  28   LYS N CD    1 
ATOM 9357  C CE    . LYS F 2 32  ? 0.068   -30.909 74.617  1.00 619.27 ?  28   LYS N CE    1 
ATOM 9358  N NZ    . LYS F 2 32  ? -0.699  -30.990 73.338  1.00 619.25 1  28   LYS N NZ    1 
ATOM 9359  N N     . THR F 2 33  ? 5.945   -29.336 71.097  1.00 640.75 ?  29   THR N N     1 
ATOM 9360  C CA    . THR F 2 33  ? 7.028   -29.303 70.093  1.00 640.75 ?  29   THR N CA    1 
ATOM 9361  C C     . THR F 2 33  ? 7.923   -30.542 69.996  1.00 640.75 ?  29   THR N C     1 
ATOM 9362  O O     . THR F 2 33  ? 8.279   -31.165 71.003  1.00 640.75 ?  29   THR N O     1 
ATOM 9363  C CB    . THR F 2 33  ? 7.924   -28.060 70.271  1.00 640.75 ?  29   THR N CB    1 
ATOM 9364  O OG1   . THR F 2 33  ? 7.109   -26.936 70.620  1.00 640.75 ?  29   THR N OG1   1 
ATOM 9365  C CG2   . THR F 2 33  ? 8.696   -27.751 68.979  1.00 640.75 ?  29   THR N CG2   1 
ATOM 9366  N N     . ARG F 2 34  ? 8.311   -30.845 68.758  1.00 629.95 ?  30   ARG N N     1 
ATOM 9367  C CA    . ARG F 2 34  ? 8.949   -32.099 68.386  1.00 629.95 ?  30   ARG N CA    1 
ATOM 9368  C C     . ARG F 2 34  ? 10.476  -31.978 68.315  1.00 629.95 ?  30   ARG N C     1 
ATOM 9369  O O     . ARG F 2 34  ? 11.070  -32.193 67.251  1.00 629.95 ?  30   ARG N O     1 
ATOM 9370  C CB    . ARG F 2 34  ? 8.396   -32.522 67.025  1.00 629.95 ?  30   ARG N CB    1 
ATOM 9371  C CG    . ARG F 2 34  ? 8.384   -34.006 66.765  1.00 629.95 ?  30   ARG N CG    1 
ATOM 9372  C CD    . ARG F 2 34  ? 8.668   -34.255 65.303  1.00 629.95 ?  30   ARG N CD    1 
ATOM 9373  N NE    . ARG F 2 34  ? 10.061  -33.941 64.984  1.00 629.95 ?  30   ARG N NE    1 
ATOM 9374  C CZ    . ARG F 2 34  ? 10.472  -33.390 63.846  1.00 629.95 ?  30   ARG N CZ    1 
ATOM 9375  N NH1   . ARG F 2 34  ? 9.596   -33.056 62.901  1.00 629.95 1  30   ARG N NH1   1 
ATOM 9376  N NH2   . ARG F 2 34  ? 11.764  -33.153 63.659  1.00 629.95 ?  30   ARG N NH2   1 
ATOM 9377  N N     . LYS F 2 35  ? 11.107  -31.650 69.445  1.00 634.46 ?  31   LYS N N     1 
ATOM 9378  C CA    . LYS F 2 35  ? 12.562  -31.417 69.485  1.00 634.46 ?  31   LYS N CA    1 
ATOM 9379  C C     . LYS F 2 35  ? 13.419  -32.658 69.179  1.00 634.46 ?  31   LYS N C     1 
ATOM 9380  O O     . LYS F 2 35  ? 13.291  -33.706 69.827  1.00 634.46 ?  31   LYS N O     1 
ATOM 9381  C CB    . LYS F 2 35  ? 12.988  -30.756 70.810  1.00 634.46 ?  31   LYS N CB    1 
ATOM 9382  C CG    . LYS F 2 35  ? 12.322  -31.309 72.079  1.00 634.46 ?  31   LYS N CG    1 
ATOM 9383  C CD    . LYS F 2 35  ? 13.038  -32.552 72.621  1.00 634.46 ?  31   LYS N CD    1 
ATOM 9384  C CE    . LYS F 2 35  ? 12.187  -33.301 73.644  1.00 634.46 ?  31   LYS N CE    1 
ATOM 9385  N NZ    . LYS F 2 35  ? 12.610  -34.724 73.784  1.00 634.46 1  31   LYS N NZ    1 
ATOM 9386  N N     . GLU F 2 36  ? 14.289  -32.518 68.181  1.00 637.68 ?  32   GLU N N     1 
ATOM 9387  C CA    . GLU F 2 36  ? 15.179  -33.592 67.731  1.00 637.68 ?  32   GLU N CA    1 
ATOM 9388  C C     . GLU F 2 36  ? 16.387  -33.818 68.637  1.00 637.68 ?  32   GLU N C     1 
ATOM 9389  O O     . GLU F 2 36  ? 16.708  -32.982 69.484  1.00 637.68 ?  32   GLU N O     1 
ATOM 9390  C CB    . GLU F 2 36  ? 15.713  -33.244 66.349  1.00 637.68 ?  32   GLU N CB    1 
ATOM 9391  C CG    . GLU F 2 36  ? 14.681  -33.425 65.216  1.00 637.68 ?  32   GLU N CG    1 
ATOM 9392  C CD    . GLU F 2 36  ? 15.369  -33.245 63.867  1.00 637.68 ?  32   GLU N CD    1 
ATOM 9393  O OE1   . GLU F 2 36  ? 16.530  -32.768 63.865  1.00 637.68 ?  32   GLU N OE1   1 
ATOM 9394  O OE2   . GLU F 2 36  ? 14.754  -33.574 62.815  1.00 637.68 -1 32   GLU N OE2   1 
ATOM 9395  N N     . SER F 2 37  ? 17.063  -34.950 68.437  1.00 648.84 ?  33   SER N N     1 
ATOM 9396  C CA    . SER F 2 37  ? 18.381  -35.196 69.030  1.00 648.84 ?  33   SER N CA    1 
ATOM 9397  C C     . SER F 2 37  ? 19.044  -36.372 68.327  1.00 648.84 ?  33   SER N C     1 
ATOM 9398  O O     . SER F 2 37  ? 18.540  -36.847 67.315  1.00 648.84 ?  33   SER N O     1 
ATOM 9399  C CB    . SER F 2 37  ? 18.284  -35.460 70.539  1.00 648.84 ?  33   SER N CB    1 
ATOM 9400  O OG    . SER F 2 37  ? 18.023  -36.824 70.805  1.00 648.84 ?  33   SER N OG    1 
ATOM 9401  N N     . TYR F 2 38  ? 20.174  -36.826 68.866  1.00 643.67 ?  34   TYR N N     1 
ATOM 9402  C CA    . TYR F 2 38  ? 20.845  -38.039 68.393  1.00 643.67 ?  34   TYR N CA    1 
ATOM 9403  C C     . TYR F 2 38  ? 20.615  -39.238 69.318  1.00 643.67 ?  34   TYR N C     1 
ATOM 9404  O O     . TYR F 2 38  ? 21.158  -40.317 69.075  1.00 643.67 ?  34   TYR N O     1 
ATOM 9405  C CB    . TYR F 2 38  ? 22.346  -37.802 68.255  1.00 643.67 ?  34   TYR N CB    1 
ATOM 9406  C CG    . TYR F 2 38  ? 22.754  -36.878 67.136  1.00 643.67 ?  34   TYR N CG    1 
ATOM 9407  C CD1   . TYR F 2 38  ? 22.983  -37.368 65.859  1.00 643.67 ?  34   TYR N CD1   1 
ATOM 9408  C CD2   . TYR F 2 38  ? 22.934  -35.516 67.360  1.00 643.67 ?  34   TYR N CD2   1 
ATOM 9409  C CE1   . TYR F 2 38  ? 23.361  -36.531 64.829  1.00 643.67 ?  34   TYR N CE1   1 
ATOM 9410  C CE2   . TYR F 2 38  ? 23.316  -34.669 66.334  1.00 643.67 ?  34   TYR N CE2   1 
ATOM 9411  C CZ    . TYR F 2 38  ? 23.527  -35.187 65.069  1.00 643.67 ?  34   TYR N CZ    1 
ATOM 9412  O OH    . TYR F 2 38  ? 23.917  -34.364 64.039  1.00 643.67 ?  34   TYR N OH    1 
ATOM 9413  N N     . ALA F 2 39  ? 19.798  -39.045 70.355  1.00 654.37 ?  35   ALA N N     1 
ATOM 9414  C CA    . ALA F 2 39  ? 19.611  -40.013 71.447  1.00 654.37 ?  35   ALA N CA    1 
ATOM 9415  C C     . ALA F 2 39  ? 19.533  -41.484 71.050  1.00 654.37 ?  35   ALA N C     1 
ATOM 9416  O O     . ALA F 2 39  ? 20.324  -42.288 71.533  1.00 654.37 ?  35   ALA N O     1 
ATOM 9417  C CB    . ALA F 2 39  ? 18.401  -39.632 72.298  1.00 654.37 ?  35   ALA N CB    1 
ATOM 9418  N N     . ILE F 2 40  ? 18.589  -41.831 70.178  1.00 652.04 ?  36   ILE N N     1 
ATOM 9419  C CA    . ILE F 2 40  ? 18.339  -43.235 69.813  1.00 652.04 ?  36   ILE N CA    1 
ATOM 9420  C C     . ILE F 2 40  ? 19.523  -43.907 69.121  1.00 652.04 ?  36   ILE N C     1 
ATOM 9421  O O     . ILE F 2 40  ? 19.724  -45.113 69.281  1.00 652.04 ?  36   ILE N O     1 
ATOM 9422  C CB    . ILE F 2 40  ? 17.052  -43.428 68.932  1.00 652.04 ?  36   ILE N CB    1 
ATOM 9423  C CG1   . ILE F 2 40  ? 17.170  -42.684 67.587  1.00 652.04 ?  36   ILE N CG1   1 
ATOM 9424  C CG2   . ILE F 2 40  ? 15.786  -43.042 69.719  1.00 652.04 ?  36   ILE N CG2   1 
ATOM 9425  C CD1   . ILE F 2 40  ? 16.175  -43.132 66.539  1.00 652.04 ?  36   ILE N CD1   1 
ATOM 9426  N N     . TYR F 2 41  ? 20.290  -43.128 68.354  1.00 645.79 ?  37   TYR N N     1 
ATOM 9427  C CA    . TYR F 2 41  ? 21.433  -43.646 67.598  1.00 645.79 ?  37   TYR N CA    1 
ATOM 9428  C C     . TYR F 2 41  ? 22.647  -43.848 68.491  1.00 645.79 ?  37   TYR N C     1 
ATOM 9429  O O     . TYR F 2 41  ? 23.407  -44.805 68.325  1.00 645.79 ?  37   TYR N O     1 
ATOM 9430  C CB    . TYR F 2 41  ? 21.806  -42.704 66.468  1.00 645.79 ?  37   TYR N CB    1 
ATOM 9431  C CG    . TYR F 2 41  ? 20.641  -42.107 65.739  1.00 645.79 ?  37   TYR N CG    1 
ATOM 9432  C CD1   . TYR F 2 41  ? 20.000  -42.810 64.718  1.00 645.79 ?  37   TYR N CD1   1 
ATOM 9433  C CD2   . TYR F 2 41  ? 20.185  -40.831 66.056  1.00 645.79 ?  37   TYR N CD2   1 
ATOM 9434  C CE1   . TYR F 2 41  ? 18.927  -42.256 64.036  1.00 645.79 ?  37   TYR N CE1   1 
ATOM 9435  C CE2   . TYR F 2 41  ? 19.113  -40.268 65.384  1.00 645.79 ?  37   TYR N CE2   1 
ATOM 9436  C CZ    . TYR F 2 41  ? 18.492  -40.982 64.375  1.00 645.79 ?  37   TYR N CZ    1 
ATOM 9437  O OH    . TYR F 2 41  ? 17.437  -40.420 63.708  1.00 645.79 ?  37   TYR N OH    1 
ATOM 9438  N N     . VAL F 2 42  ? 22.834  -42.921 69.424  1.00 654.79 ?  38   VAL N N     1 
ATOM 9439  C CA    . VAL F 2 42  ? 23.798  -43.081 70.496  1.00 654.79 ?  38   VAL N CA    1 
ATOM 9440  C C     . VAL F 2 42  ? 23.568  -44.445 71.152  1.00 654.79 ?  38   VAL N C     1 
ATOM 9441  O O     . VAL F 2 42  ? 24.500  -45.236 71.297  1.00 654.79 ?  38   VAL N O     1 
ATOM 9442  C CB    . VAL F 2 42  ? 23.679  -41.924 71.522  1.00 654.79 ?  38   VAL N CB    1 
ATOM 9443  C CG1   . VAL F 2 42  ? 24.465  -42.217 72.786  1.00 654.79 ?  38   VAL N CG1   1 
ATOM 9444  C CG2   . VAL F 2 42  ? 24.142  -40.615 70.899  1.00 654.79 ?  38   VAL N CG2   1 
ATOM 9445  N N     . TYR F 2 43  ? 22.315  -44.720 71.503  1.00 655.84 ?  39   TYR N N     1 
ATOM 9446  C CA    . TYR F 2 43  ? 21.915  -45.983 72.115  1.00 655.84 ?  39   TYR N CA    1 
ATOM 9447  C C     . TYR F 2 43  ? 22.282  -47.211 71.273  1.00 655.84 ?  39   TYR N C     1 
ATOM 9448  O O     . TYR F 2 43  ? 23.025  -48.087 71.725  1.00 655.84 ?  39   TYR N O     1 
ATOM 9449  C CB    . TYR F 2 43  ? 20.412  -45.969 72.364  1.00 655.84 ?  39   TYR N CB    1 
ATOM 9450  C CG    . TYR F 2 43  ? 20.059  -46.322 73.775  1.00 655.84 ?  39   TYR N CG    1 
ATOM 9451  C CD1   . TYR F 2 43  ? 20.209  -47.628 74.238  1.00 655.84 ?  39   TYR N CD1   1 
ATOM 9452  C CD2   . TYR F 2 43  ? 19.600  -45.344 74.661  1.00 655.84 ?  39   TYR N CD2   1 
ATOM 9453  C CE1   . TYR F 2 43  ? 19.897  -47.960 75.545  1.00 655.84 ?  39   TYR N CE1   1 
ATOM 9454  C CE2   . TYR F 2 43  ? 19.282  -45.660 75.975  1.00 655.84 ?  39   TYR N CE2   1 
ATOM 9455  C CZ    . TYR F 2 43  ? 19.434  -46.972 76.409  1.00 655.84 ?  39   TYR N CZ    1 
ATOM 9456  O OH    . TYR F 2 43  ? 19.125  -47.313 77.706  1.00 655.84 ?  39   TYR N OH    1 
ATOM 9457  N N     . LYS F 2 44  ? 21.753  -47.269 70.053  1.00 640.81 ?  40   LYS N N     1 
ATOM 9458  C CA    . LYS F 2 44  ? 22.091  -48.330 69.114  1.00 640.81 ?  40   LYS N CA    1 
ATOM 9459  C C     . LYS F 2 44  ? 23.599  -48.587 69.034  1.00 640.81 ?  40   LYS N C     1 
ATOM 9460  O O     . LYS F 2 44  ? 24.030  -49.741 69.042  1.00 640.81 ?  40   LYS N O     1 
ATOM 9461  C CB    . LYS F 2 44  ? 21.523  -48.022 67.729  1.00 640.81 ?  40   LYS N CB    1 
ATOM 9462  C CG    . LYS F 2 44  ? 20.012  -48.129 67.658  1.00 640.81 ?  40   LYS N CG    1 
ATOM 94