data_5OY0
# 
_entry.id   5OY0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5OY0         
WWPDB D_1200005874 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5OY0 
_pdbx_database_status.recvd_initial_deposition_date   2017-09-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Nelson, N.'   1 ? 
'Malavath, T.' 2 ? 
'Caspy, I.'    3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   NE 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Biochim. Biophys. Acta' 
_citation.journal_id_ASTM           BBACAQ 
_citation.journal_id_CSD            0113 
_citation.journal_id_ISSN           0006-3002 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            1859 
_citation.language                  ? 
_citation.page_first                645 
_citation.page_last                 654 
_citation.title                     'Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.' 
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bbabio.2018.02.002 
_citation.pdbx_database_id_PubMed   29414678 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Malavath, T.'    1 ? 
primary 'Caspy, I.'       2 ? 
primary 'Netzer-El, S.Y.' 3 ? 
primary 'Klaiman, D.'     4 ? 
primary 'Nelson, N.'      5 ? 
# 
_cell.entry_id           5OY0 
_cell.length_a           212.170 
_cell.length_b           137.622 
_cell.length_c           225.095 
_cell.angle_alpha        90.00 
_cell.angle_beta         116.74 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5OY0 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'Photosystem I P700 chlorophyll a apoprotein A1' 83036.398 2   1.97.1.12 ? ? ? 
2  polymer     nat 'Photosystem I P700 chlorophyll a apoprotein A2' 81369.531 2   1.97.1.12 ? ? ? 
3  polymer     nat 'Photosystem I iron-sulfur center' 8706.064  2   1.97.1.12 ? ? ? 
4  polymer     nat 'Photosystem I reaction center subunit II' 15663.749 2   ?         ? ? ? 
5  polymer     nat 'Photosystem I reaction center subunit IV' 7680.478  2   ?         ? ? ? 
6  polymer     nat 'Photosystem I reaction center subunit III' 15791.086 3   ?         ? ? ? 
7  polymer     nat 'Photosystem I reaction center subunit VIII' 4414.148  2   ?         ? ? ? 
8  polymer     nat 'Photosystem I reaction center subunit IX' 4535.415  3   ?         ? ? ? 
9  polymer     nat 'Photosystem I reaction center subunit PsaK 2' 8237.783  1   ?         ? ? ? 
10 polymer     nat 'Photosystem I reaction center subunit XI' 16631.795 2   ?         ? ? ? 
11 polymer     nat 'Photosystem I reaction center subunit XII' 3382.063  3   ?         ? ? ? 
12 polymer     nat 'Photosystem I P700 chlorophyll a apoprotein A2' 81167.258 1   1.97.1.12 ? ? ? 
13 polymer     nat 'Photosystem I iron-sulfur center' 8837.261  1   1.97.1.12 ? ? ? 
14 polymer     nat 'Photosystem I reaction center subunit IV' 7552.350  1   ?         ? ? ? 
15 polymer     nat 'Photosystem I reaction center subunit PsaK 2' 8037.548  1   ?         ? ? ? 
16 polymer     nat 'Photosystem I P700 chlorophyll a apoprotein A1' 82280.516 1   1.97.1.12 ? ? ? 
17 polymer     nat 'Photosystem I reaction center subunit II' 15532.552 1   ?         ? ? ? 
18 polymer     nat 'Photosystem I reaction center subunit VIII' 4227.982  1   ?         ? ? ? 
19 polymer     nat 'Photosystem I reaction center subunit PsaK 2' 8124.626  1   ?         ? ? ? 
20 polymer     nat 'Photosystem I reaction center subunit XI' 16300.407 1   ?         ? ? ? 
21 non-polymer syn 'CHLOROPHYLL A' 893.489   285 ?         ? ? ? 
22 non-polymer syn PHYLLOQUINONE 450.696   6   ?         ? ? ? 
23 non-polymer syn 'IRON/SULFUR CLUSTER' 351.640   9   ?         ? ? ? 
24 non-polymer syn BETA-CAROTENE 536.873   58  ?         ? ? ? 
25 non-polymer syn 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE 722.970   27  ?         ? ? ? 
26 non-polymer syn 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE 787.158   16  ?         ? ? ? 
27 non-polymer syn 'ACETATE ION' 59.044    4   ?         ? ? ? 
28 non-polymer syn "beta,beta-carotene-4,4'-dione" 564.840   2   ?         ? ? ? 
29 non-polymer syn 'CHLORIDE ION' 35.453    3   ?         ? ? ? 
30 non-polymer syn beta,beta-caroten-4-one 550.856   7   ?         ? ? ? 
31 non-polymer syn '1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL' 795.116   7   ?         ? ? ? 
32 non-polymer syn 'CALCIUM ION' 40.078    6   ?         ? ? ? 
33 non-polymer syn 'MAGNESIUM ION' 24.305    2   ?         ? ? ? 
34 non-polymer syn 
;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol
;
568.871   4   ?         ? ? ? 
35 non-polymer syn DODECYL-BETA-D-MALTOSIDE 510.615   5   ?         ? ? ? 
36 non-polymer syn "(3'R)-3'-hydroxy-beta,beta-caroten-4-one" 566.856   1   ?         ? ? ? 
37 non-polymer syn 'DIGALACTOSYL DIACYL GLYCEROL (DGDG)' 949.299   1   ?         ? ? ? 
38 water       nat water 18.015    889 ?         ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  PsaA                                                     
2  PsaB                                                     
3  '9 kDa polypeptide,PSI-C,Photosystem I subunit VII,PsaC' 
4  'Photosystem I 16 kDa polypeptide,PSI-D'                 
5  'Photosystem I 8.1 kDa protein,p30 protein'              
6  PSI-F                                                    
9  'Photosystem I subunit X 2'                              
10 'PSI subunit V,PSI-L'                                    
11 PSI-M                                                    
12 PsaB                                                     
13 '9 kDa polypeptide,PSI-C,Photosystem I subunit VII,PsaC' 
14 'Photosystem I 8.1 kDa protein,p30 protein'              
15 'Photosystem I subunit X 2'                              
16 PsaA                                                     
17 'Photosystem I 16 kDa polypeptide,PSI-D'                 
19 'Photosystem I subunit X 2'                              
20 'PSI subunit V,PSI-L'                                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)' no no 
;MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHL
AVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYC
TAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPH
EFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHS
MKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFL
IVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQP
IFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSR
LVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAI
TINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSI
IQGRAVGVAHYLLGGIVTTWAFFLARSLSIG
;
;MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHL
AVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYC
TAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPH
EFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHS
MKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFL
IVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQP
IFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSR
LVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAI
TINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSI
IQGRAVGVAHYLLGGIVTTWAFFLARSLSIG
;
A,a   ? 
2  'polypeptide(L)' no no 
;MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKD
PLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPK
FRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTA
GHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNL
YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVA
NKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPD
SIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPG
RGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNL
SVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAA
FLIASTAGKFG
;
;MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKD
PLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPK
FRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTA
GHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNL
YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVA
NKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPD
SIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPG
RGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNL
SVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAA
FLIASTAGKFG
;
B,2   ? 
3  'polypeptide(L)' no no SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY 
SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY C,3   ? 
4  'polypeptide(L)' no no 
;MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKI
QDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
;MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKI
QDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
D,d   ? 
5  'polypeptide(L)' no no ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQ 
ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQ E,5   ? 
6  'polypeptide(L)' no no 
;ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIG
WVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
;
;ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIG
WVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
;
F,f,6 ? 
7  'polypeptide(L)' no no MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG I,i   ? 
8  'polypeptide(L)' no no MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP J,j,7 ? 
9  'polypeptide(L)' no no LAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS 
LAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS K     ? 
10 'polypeptide(L)' no no 
;MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIG
GLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
;MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIG
GLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
L,l   ? 
11 'polypeptide(L)' no no MALSDTQILAALVVALLPAFLAFRLSTELYK MALSDTQILAALVVALLPAFLAFRLSTELYK M,m,9 ? 
12 'polypeptide(L)' no no 
;TKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPL
NIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFR
PSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGH
IFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYD
TINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANK
DNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSI
ASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRG
GTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSV
WAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFL
IASTAGKFG
;
;TKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPL
NIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFR
PSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGH
IFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYD
TINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANK
DNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSI
ASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRG
GTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSV
WAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFL
IASTAGKFG
;
b     ? 
13 'polypeptide(L)' no no 
;MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLA
Y
;
;MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLA
Y
;
c     ? 
14 'polypeptide(L)' no no ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV 
ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV e     ? 
15 'polypeptide(L)' no no AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLAS 
AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLAS k     ? 
16 'polypeptide(L)' no no 
;REAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWL
SGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLV
MAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPS
KMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEA
HKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAH
GAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQ
HLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKAN
LGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLR
DFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVG
VAHYLLGGIVTTWAFFLARSLSIG
;
;REAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWL
SGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLV
MAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPS
KMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEA
HKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAH
GAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQ
HLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKAN
LGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLR
DFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVG
VAHYLLGGIVTTWAFFLARSLSIG
;
1     ? 
17 'polypeptide(L)' no no 
;TELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQ
DYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
;TELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQ
DYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
4     ? 
18 'polypeptide(L)' no no MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEG MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEG h     ? 
19 'polypeptide(L)' no no AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS 
AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS 8     ? 
20 'polypeptide(L)' no no 
;SNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLI
GALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
;SNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLI
GALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
0     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1   MET n 
1  2   THR n 
1  3   ILE n 
1  4   SER n 
1  5   PRO n 
1  6   PRO n 
1  7   GLU n 
1  8   ARG n 
1  9   GLU n 
1  10  ALA n 
1  11  LYS n 
1  12  ALA n 
1  13  LYS n 
1  14  VAL n 
1  15  SER n 
1  16  VAL n 
1  17  ASP n 
1  18  ASN n 
1  19  ASN n 
1  20  PRO n 
1  21  VAL n 
1  22  PRO n 
1  23  THR n 
1  24  SER n 
1  25  PHE n 
1  26  GLU n 
1  27  LYS n 
1  28  TRP n 
1  29  GLY n 
1  30  LYS n 
1  31  PRO n 
1  32  GLY n 
1  33  HIS n 
1  34  PHE n 
1  35  ASP n 
1  36  ARG n 
1  37  THR n 
1  38  LEU n 
1  39  ALA n 
1  40  ARG n 
1  41  GLY n 
1  42  PRO n 
1  43  LYS n 
1  44  THR n 
1  45  THR n 
1  46  THR n 
1  47  TRP n 
1  48  ILE n 
1  49  TRP n 
1  50  ASN n 
1  51  LEU n 
1  52  HIS n 
1  53  ALA n 
1  54  ASN n 
1  55  ALA n 
1  56  HIS n 
1  57  ASP n 
1  58  PHE n 
1  59  ASP n 
1  60  SER n 
1  61  GLN n 
1  62  THR n 
1  63  SER n 
1  64  ASP n 
1  65  LEU n 
1  66  GLU n 
1  67  ASP n 
1  68  VAL n 
1  69  SER n 
1  70  ARG n 
1  71  LYS n 
1  72  ILE n 
1  73  PHE n 
1  74  SER n 
1  75  ALA n 
1  76  HIS n 
1  77  PHE n 
1  78  GLY n 
1  79  HIS n 
1  80  LEU n 
1  81  ALA n 
1  82  VAL n 
1  83  VAL n 
1  84  PHE n 
1  85  VAL n 
1  86  TRP n 
1  87  LEU n 
1  88  SER n 
1  89  GLY n 
1  90  MET n 
1  91  TYR n 
1  92  PHE n 
1  93  HIS n 
1  94  GLY n 
1  95  ALA n 
1  96  LYS n 
1  97  PHE n 
1  98  SER n 
1  99  ASN n 
1  100 TYR n 
1  101 GLU n 
1  102 GLY n 
1  103 TRP n 
1  104 LEU n 
1  105 ALA n 
1  106 ASP n 
1  107 PRO n 
1  108 THR n 
1  109 HIS n 
1  110 ILE n 
1  111 LYS n 
1  112 PRO n 
1  113 SER n 
1  114 ALA n 
1  115 GLN n 
1  116 VAL n 
1  117 VAL n 
1  118 TRP n 
1  119 PRO n 
1  120 ILE n 
1  121 VAL n 
1  122 GLY n 
1  123 GLN n 
1  124 GLY n 
1  125 ILE n 
1  126 LEU n 
1  127 ASN n 
1  128 GLY n 
1  129 ASP n 
1  130 VAL n 
1  131 GLY n 
1  132 GLY n 
1  133 GLY n 
1  134 PHE n 
1  135 HIS n 
1  136 GLY n 
1  137 ILE n 
1  138 GLN n 
1  139 ILE n 
1  140 THR n 
1  141 SER n 
1  142 GLY n 
1  143 LEU n 
1  144 PHE n 
1  145 TYR n 
1  146 LEU n 
1  147 TRP n 
1  148 ARG n 
1  149 ALA n 
1  150 SER n 
1  151 GLY n 
1  152 PHE n 
1  153 THR n 
1  154 ASP n 
1  155 SER n 
1  156 TYR n 
1  157 GLN n 
1  158 LEU n 
1  159 TYR n 
1  160 CYS n 
1  161 THR n 
1  162 ALA n 
1  163 ILE n 
1  164 GLY n 
1  165 GLY n 
1  166 LEU n 
1  167 VAL n 
1  168 MET n 
1  169 ALA n 
1  170 ALA n 
1  171 LEU n 
1  172 MET n 
1  173 LEU n 
1  174 PHE n 
1  175 ALA n 
1  176 GLY n 
1  177 TRP n 
1  178 PHE n 
1  179 HIS n 
1  180 TYR n 
1  181 HIS n 
1  182 VAL n 
1  183 LYS n 
1  184 ALA n 
1  185 PRO n 
1  186 LYS n 
1  187 LEU n 
1  188 GLU n 
1  189 TRP n 
1  190 PHE n 
1  191 GLN n 
1  192 ASN n 
1  193 VAL n 
1  194 GLU n 
1  195 SER n 
1  196 MET n 
1  197 MET n 
1  198 ASN n 
1  199 HIS n 
1  200 HIS n 
1  201 LEU n 
1  202 ALA n 
1  203 GLY n 
1  204 LEU n 
1  205 LEU n 
1  206 GLY n 
1  207 LEU n 
1  208 GLY n 
1  209 SER n 
1  210 LEU n 
1  211 GLY n 
1  212 TRP n 
1  213 ALA n 
1  214 GLY n 
1  215 HIS n 
1  216 GLN n 
1  217 ILE n 
1  218 HIS n 
1  219 VAL n 
1  220 SER n 
1  221 MET n 
1  222 PRO n 
1  223 ILE n 
1  224 ASN n 
1  225 LYS n 
1  226 LEU n 
1  227 LEU n 
1  228 ASP n 
1  229 ALA n 
1  230 GLY n 
1  231 VAL n 
1  232 ALA n 
1  233 PRO n 
1  234 LYS n 
1  235 ASP n 
1  236 ILE n 
1  237 PRO n 
1  238 LEU n 
1  239 PRO n 
1  240 HIS n 
1  241 GLU n 
1  242 PHE n 
1  243 ILE n 
1  244 LEU n 
1  245 GLU n 
1  246 PRO n 
1  247 SER n 
1  248 LYS n 
1  249 MET n 
1  250 ALA n 
1  251 GLU n 
1  252 LEU n 
1  253 TYR n 
1  254 PRO n 
1  255 SER n 
1  256 PHE n 
1  257 ALA n 
1  258 GLN n 
1  259 GLY n 
1  260 LEU n 
1  261 THR n 
1  262 PRO n 
1  263 PHE n 
1  264 PHE n 
1  265 THR n 
1  266 LEU n 
1  267 ASN n 
1  268 TRP n 
1  269 GLY n 
1  270 VAL n 
1  271 TYR n 
1  272 SER n 
1  273 ASP n 
1  274 PHE n 
1  275 LEU n 
1  276 THR n 
1  277 PHE n 
1  278 LYS n 
1  279 GLY n 
1  280 GLY n 
1  281 LEU n 
1  282 ASN n 
1  283 PRO n 
1  284 VAL n 
1  285 THR n 
1  286 GLY n 
1  287 GLY n 
1  288 LEU n 
1  289 TRP n 
1  290 LEU n 
1  291 SER n 
1  292 ASP n 
1  293 THR n 
1  294 ALA n 
1  295 HIS n 
1  296 HIS n 
1  297 HIS n 
1  298 LEU n 
1  299 ALA n 
1  300 ILE n 
1  301 ALA n 
1  302 VAL n 
1  303 LEU n 
1  304 PHE n 
1  305 ILE n 
1  306 ILE n 
1  307 ALA n 
1  308 GLY n 
1  309 HIS n 
1  310 MET n 
1  311 TYR n 
1  312 ARG n 
1  313 THR n 
1  314 ASN n 
1  315 TRP n 
1  316 GLY n 
1  317 ILE n 
1  318 GLY n 
1  319 HIS n 
1  320 SER n 
1  321 MET n 
1  322 LYS n 
1  323 GLU n 
1  324 ILE n 
1  325 LEU n 
1  326 GLU n 
1  327 ALA n 
1  328 HIS n 
1  329 LYS n 
1  330 GLY n 
1  331 PRO n 
1  332 PHE n 
1  333 THR n 
1  334 GLY n 
1  335 GLU n 
1  336 GLY n 
1  337 HIS n 
1  338 LYS n 
1  339 GLY n 
1  340 LEU n 
1  341 TYR n 
1  342 GLU n 
1  343 ILE n 
1  344 LEU n 
1  345 THR n 
1  346 THR n 
1  347 SER n 
1  348 TRP n 
1  349 HIS n 
1  350 ALA n 
1  351 GLN n 
1  352 LEU n 
1  353 ALA n 
1  354 ILE n 
1  355 ASN n 
1  356 LEU n 
1  357 ALA n 
1  358 LEU n 
1  359 LEU n 
1  360 GLY n 
1  361 SER n 
1  362 LEU n 
1  363 THR n 
1  364 ILE n 
1  365 ILE n 
1  366 VAL n 
1  367 ALA n 
1  368 GLN n 
1  369 HIS n 
1  370 MET n 
1  371 TYR n 
1  372 ALA n 
1  373 MET n 
1  374 PRO n 
1  375 PRO n 
1  376 TYR n 
1  377 PRO n 
1  378 TYR n 
1  379 GLN n 
1  380 ALA n 
1  381 ILE n 
1  382 ASP n 
1  383 TYR n 
1  384 ALA n 
1  385 THR n 
1  386 GLN n 
1  387 LEU n 
1  388 SER n 
1  389 LEU n 
1  390 PHE n 
1  391 THR n 
1  392 HIS n 
1  393 HIS n 
1  394 MET n 
1  395 TRP n 
1  396 ILE n 
1  397 GLY n 
1  398 GLY n 
1  399 PHE n 
1  400 LEU n 
1  401 ILE n 
1  402 VAL n 
1  403 GLY n 
1  404 ALA n 
1  405 GLY n 
1  406 ALA n 
1  407 HIS n 
1  408 GLY n 
1  409 ALA n 
1  410 ILE n 
1  411 PHE n 
1  412 MET n 
1  413 VAL n 
1  414 ARG n 
1  415 ASP n 
1  416 TYR n 
1  417 ASP n 
1  418 PRO n 
1  419 ALA n 
1  420 LYS n 
1  421 ASN n 
1  422 VAL n 
1  423 ASN n 
1  424 ASN n 
1  425 LEU n 
1  426 LEU n 
1  427 ASP n 
1  428 ARG n 
1  429 MET n 
1  430 LEU n 
1  431 ARG n 
1  432 HIS n 
1  433 ARG n 
1  434 ASP n 
1  435 ALA n 
1  436 ILE n 
1  437 ILE n 
1  438 SER n 
1  439 HIS n 
1  440 LEU n 
1  441 ASN n 
1  442 TRP n 
1  443 VAL n 
1  444 CYS n 
1  445 ILE n 
1  446 PHE n 
1  447 LEU n 
1  448 GLY n 
1  449 PHE n 
1  450 HIS n 
1  451 SER n 
1  452 PHE n 
1  453 GLY n 
1  454 LEU n 
1  455 TYR n 
1  456 ILE n 
1  457 HIS n 
1  458 ASN n 
1  459 ASP n 
1  460 THR n 
1  461 MET n 
1  462 ARG n 
1  463 ALA n 
1  464 LEU n 
1  465 GLY n 
1  466 ARG n 
1  467 PRO n 
1  468 GLN n 
1  469 ASP n 
1  470 MET n 
1  471 PHE n 
1  472 SER n 
1  473 ASP n 
1  474 THR n 
1  475 ALA n 
1  476 ILE n 
1  477 GLN n 
1  478 LEU n 
1  479 GLN n 
1  480 PRO n 
1  481 ILE n 
1  482 PHE n 
1  483 ALA n 
1  484 GLN n 
1  485 TRP n 
1  486 VAL n 
1  487 GLN n 
1  488 HIS n 
1  489 LEU n 
1  490 HIS n 
1  491 THR n 
1  492 LEU n 
1  493 ALA n 
1  494 PRO n 
1  495 GLY n 
1  496 ALA n 
1  497 THR n 
1  498 ALA n 
1  499 PRO n 
1  500 ASN n 
1  501 ALA n 
1  502 LEU n 
1  503 ALA n 
1  504 THR n 
1  505 ALA n 
1  506 SER n 
1  507 TYR n 
1  508 ALA n 
1  509 PHE n 
1  510 GLY n 
1  511 GLY n 
1  512 GLU n 
1  513 THR n 
1  514 ILE n 
1  515 ALA n 
1  516 VAL n 
1  517 ALA n 
1  518 GLY n 
1  519 LYS n 
1  520 VAL n 
1  521 ALA n 
1  522 MET n 
1  523 MET n 
1  524 PRO n 
1  525 ILE n 
1  526 THR n 
1  527 LEU n 
1  528 GLY n 
1  529 THR n 
1  530 ALA n 
1  531 ASP n 
1  532 PHE n 
1  533 MET n 
1  534 VAL n 
1  535 HIS n 
1  536 HIS n 
1  537 ILE n 
1  538 HIS n 
1  539 ALA n 
1  540 PHE n 
1  541 THR n 
1  542 ILE n 
1  543 HIS n 
1  544 VAL n 
1  545 THR n 
1  546 ALA n 
1  547 LEU n 
1  548 ILE n 
1  549 LEU n 
1  550 LEU n 
1  551 LYS n 
1  552 GLY n 
1  553 VAL n 
1  554 LEU n 
1  555 TYR n 
1  556 ALA n 
1  557 ARG n 
1  558 SER n 
1  559 SER n 
1  560 ARG n 
1  561 LEU n 
1  562 VAL n 
1  563 PRO n 
1  564 ASP n 
1  565 LYS n 
1  566 ALA n 
1  567 ASN n 
1  568 LEU n 
1  569 GLY n 
1  570 PHE n 
1  571 ARG n 
1  572 PHE n 
1  573 PRO n 
1  574 CYS n 
1  575 ASP n 
1  576 GLY n 
1  577 PRO n 
1  578 GLY n 
1  579 ARG n 
1  580 GLY n 
1  581 GLY n 
1  582 THR n 
1  583 CYS n 
1  584 GLN n 
1  585 VAL n 
1  586 SER n 
1  587 GLY n 
1  588 TRP n 
1  589 ASP n 
1  590 HIS n 
1  591 VAL n 
1  592 PHE n 
1  593 LEU n 
1  594 GLY n 
1  595 LEU n 
1  596 PHE n 
1  597 TRP n 
1  598 MET n 
1  599 TYR n 
1  600 ASN n 
1  601 SER n 
1  602 LEU n 
1  603 SER n 
1  604 ILE n 
1  605 VAL n 
1  606 ILE n 
1  607 PHE n 
1  608 HIS n 
1  609 PHE n 
1  610 SER n 
1  611 TRP n 
1  612 LYS n 
1  613 MET n 
1  614 GLN n 
1  615 SER n 
1  616 ASP n 
1  617 VAL n 
1  618 TRP n 
1  619 GLY n 
1  620 THR n 
1  621 VAL n 
1  622 SER n 
1  623 PRO n 
1  624 ASP n 
1  625 GLY n 
1  626 SER n 
1  627 VAL n 
1  628 THR n 
1  629 HIS n 
1  630 VAL n 
1  631 THR n 
1  632 LEU n 
1  633 GLY n 
1  634 ASN n 
1  635 PHE n 
1  636 ALA n 
1  637 GLN n 
1  638 SER n 
1  639 ALA n 
1  640 ILE n 
1  641 THR n 
1  642 ILE n 
1  643 ASN n 
1  644 GLY n 
1  645 TRP n 
1  646 LEU n 
1  647 ARG n 
1  648 ASP n 
1  649 PHE n 
1  650 LEU n 
1  651 TRP n 
1  652 ALA n 
1  653 GLN n 
1  654 ALA n 
1  655 ALA n 
1  656 ASN n 
1  657 VAL n 
1  658 ILE n 
1  659 ASN n 
1  660 SER n 
1  661 TYR n 
1  662 GLY n 
1  663 SER n 
1  664 ALA n 
1  665 LEU n 
1  666 SER n 
1  667 ALA n 
1  668 TYR n 
1  669 GLY n 
1  670 ILE n 
1  671 MET n 
1  672 PHE n 
1  673 LEU n 
1  674 ALA n 
1  675 GLY n 
1  676 HIS n 
1  677 PHE n 
1  678 VAL n 
1  679 PHE n 
1  680 ALA n 
1  681 PHE n 
1  682 SER n 
1  683 LEU n 
1  684 MET n 
1  685 PHE n 
1  686 LEU n 
1  687 PHE n 
1  688 SER n 
1  689 GLY n 
1  690 ARG n 
1  691 GLY n 
1  692 TYR n 
1  693 TRP n 
1  694 GLN n 
1  695 GLU n 
1  696 LEU n 
1  697 ILE n 
1  698 GLU n 
1  699 SER n 
1  700 ILE n 
1  701 VAL n 
1  702 TRP n 
1  703 ALA n 
1  704 HIS n 
1  705 ASN n 
1  706 LYS n 
1  707 LEU n 
1  708 ASN n 
1  709 VAL n 
1  710 ALA n 
1  711 PRO n 
1  712 ALA n 
1  713 ILE n 
1  714 GLN n 
1  715 PRO n 
1  716 ARG n 
1  717 ALA n 
1  718 LEU n 
1  719 SER n 
1  720 ILE n 
1  721 ILE n 
1  722 GLN n 
1  723 GLY n 
1  724 ARG n 
1  725 ALA n 
1  726 VAL n 
1  727 GLY n 
1  728 VAL n 
1  729 ALA n 
1  730 HIS n 
1  731 TYR n 
1  732 LEU n 
1  733 LEU n 
1  734 GLY n 
1  735 GLY n 
1  736 ILE n 
1  737 VAL n 
1  738 THR n 
1  739 THR n 
1  740 TRP n 
1  741 ALA n 
1  742 PHE n 
1  743 PHE n 
1  744 LEU n 
1  745 ALA n 
1  746 ARG n 
1  747 SER n 
1  748 LEU n 
1  749 SER n 
1  750 ILE n 
1  751 GLY n 
2  1   MET n 
2  2   ALA n 
2  3   THR n 
2  4   LYS n 
2  5   PHE n 
2  6   PRO n 
2  7   LYS n 
2  8   PHE n 
2  9   SER n 
2  10  GLN n 
2  11  ASP n 
2  12  LEU n 
2  13  ALA n 
2  14  GLN n 
2  15  ASP n 
2  16  PRO n 
2  17  THR n 
2  18  THR n 
2  19  ARG n 
2  20  ARG n 
2  21  ILE n 
2  22  TRP n 
2  23  TYR n 
2  24  GLY n 
2  25  ILE n 
2  26  ALA n 
2  27  THR n 
2  28  ALA n 
2  29  HIS n 
2  30  ASP n 
2  31  PHE n 
2  32  GLU n 
2  33  THR n 
2  34  HIS n 
2  35  ASP n 
2  36  GLY n 
2  37  MET n 
2  38  THR n 
2  39  GLU n 
2  40  GLU n 
2  41  ASN n 
2  42  LEU n 
2  43  TYR n 
2  44  GLN n 
2  45  LYS n 
2  46  ILE n 
2  47  PHE n 
2  48  ALA n 
2  49  SER n 
2  50  HIS n 
2  51  PHE n 
2  52  GLY n 
2  53  HIS n 
2  54  ILE n 
2  55  ALA n 
2  56  ILE n 
2  57  ILE n 
2  58  PHE n 
2  59  LEU n 
2  60  TRP n 
2  61  THR n 
2  62  SER n 
2  63  GLY n 
2  64  THR n 
2  65  LEU n 
2  66  PHE n 
2  67  HIS n 
2  68  VAL n 
2  69  ALA n 
2  70  TRP n 
2  71  GLN n 
2  72  GLY n 
2  73  ASN n 
2  74  PHE n 
2  75  GLU n 
2  76  GLN n 
2  77  TRP n 
2  78  ILE n 
2  79  LYS n 
2  80  ASP n 
2  81  PRO n 
2  82  LEU n 
2  83  ASN n 
2  84  ILE n 
2  85  ARG n 
2  86  PRO n 
2  87  ILE n 
2  88  ALA n 
2  89  HIS n 
2  90  ALA n 
2  91  ILE n 
2  92  TRP n 
2  93  ASP n 
2  94  PRO n 
2  95  HIS n 
2  96  PHE n 
2  97  GLY n 
2  98  GLU n 
2  99  GLY n 
2  100 ALA n 
2  101 VAL n 
2  102 ASN n 
2  103 ALA n 
2  104 PHE n 
2  105 THR n 
2  106 GLN n 
2  107 ALA n 
2  108 GLY n 
2  109 ALA n 
2  110 SER n 
2  111 ASN n 
2  112 PRO n 
2  113 VAL n 
2  114 ASN n 
2  115 ILE n 
2  116 ALA n 
2  117 TYR n 
2  118 SER n 
2  119 GLY n 
2  120 VAL n 
2  121 TYR n 
2  122 HIS n 
2  123 TRP n 
2  124 PHE n 
2  125 TYR n 
2  126 THR n 
2  127 ILE n 
2  128 GLY n 
2  129 MET n 
2  130 THR n 
2  131 THR n 
2  132 ASN n 
2  133 GLN n 
2  134 GLU n 
2  135 LEU n 
2  136 TYR n 
2  137 SER n 
2  138 GLY n 
2  139 ALA n 
2  140 VAL n 
2  141 PHE n 
2  142 LEU n 
2  143 LEU n 
2  144 VAL n 
2  145 LEU n 
2  146 ALA n 
2  147 SER n 
2  148 LEU n 
2  149 PHE n 
2  150 LEU n 
2  151 PHE n 
2  152 ALA n 
2  153 GLY n 
2  154 TRP n 
2  155 LEU n 
2  156 HIS n 
2  157 LEU n 
2  158 GLN n 
2  159 PRO n 
2  160 LYS n 
2  161 PHE n 
2  162 ARG n 
2  163 PRO n 
2  164 SER n 
2  165 LEU n 
2  166 ALA n 
2  167 TRP n 
2  168 PHE n 
2  169 LYS n 
2  170 ASN n 
2  171 ALA n 
2  172 GLU n 
2  173 SER n 
2  174 ARG n 
2  175 LEU n 
2  176 ASN n 
2  177 HIS n 
2  178 HIS n 
2  179 LEU n 
2  180 ALA n 
2  181 GLY n 
2  182 LEU n 
2  183 PHE n 
2  184 GLY n 
2  185 VAL n 
2  186 SER n 
2  187 SER n 
2  188 LEU n 
2  189 ALA n 
2  190 TRP n 
2  191 ALA n 
2  192 GLY n 
2  193 HIS n 
2  194 LEU n 
2  195 VAL n 
2  196 HIS n 
2  197 VAL n 
2  198 ALA n 
2  199 ILE n 
2  200 PRO n 
2  201 GLU n 
2  202 ALA n 
2  203 ARG n 
2  204 GLY n 
2  205 GLN n 
2  206 HIS n 
2  207 VAL n 
2  208 GLY n 
2  209 TRP n 
2  210 ASP n 
2  211 ASN n 
2  212 PHE n 
2  213 LEU n 
2  214 SER n 
2  215 THR n 
2  216 PRO n 
2  217 PRO n 
2  218 HIS n 
2  219 PRO n 
2  220 ALA n 
2  221 GLY n 
2  222 LEU n 
2  223 MET n 
2  224 PRO n 
2  225 PHE n 
2  226 PHE n 
2  227 THR n 
2  228 GLY n 
2  229 ASN n 
2  230 TRP n 
2  231 GLY n 
2  232 VAL n 
2  233 TYR n 
2  234 ALA n 
2  235 ALA n 
2  236 ASP n 
2  237 PRO n 
2  238 ASP n 
2  239 THR n 
2  240 ALA n 
2  241 GLY n 
2  242 HIS n 
2  243 ILE n 
2  244 PHE n 
2  245 GLY n 
2  246 THR n 
2  247 SER n 
2  248 GLU n 
2  249 GLY n 
2  250 ALA n 
2  251 GLY n 
2  252 THR n 
2  253 ALA n 
2  254 ILE n 
2  255 LEU n 
2  256 THR n 
2  257 PHE n 
2  258 LEU n 
2  259 GLY n 
2  260 GLY n 
2  261 PHE n 
2  262 HIS n 
2  263 PRO n 
2  264 GLN n 
2  265 THR n 
2  266 GLU n 
2  267 SER n 
2  268 LEU n 
2  269 TRP n 
2  270 LEU n 
2  271 THR n 
2  272 ASP n 
2  273 ILE n 
2  274 ALA n 
2  275 HIS n 
2  276 HIS n 
2  277 HIS n 
2  278 LEU n 
2  279 ALA n 
2  280 ILE n 
2  281 ALA n 
2  282 VAL n 
2  283 ILE n 
2  284 PHE n 
2  285 ILE n 
2  286 ILE n 
2  287 ALA n 
2  288 GLY n 
2  289 HIS n 
2  290 MET n 
2  291 TYR n 
2  292 ARG n 
2  293 THR n 
2  294 ASN n 
2  295 TRP n 
2  296 GLY n 
2  297 ILE n 
2  298 GLY n 
2  299 HIS n 
2  300 SER n 
2  301 ILE n 
2  302 LYS n 
2  303 GLU n 
2  304 ILE n 
2  305 LEU n 
2  306 ASN n 
2  307 ALA n 
2  308 HIS n 
2  309 LYS n 
2  310 GLY n 
2  311 PRO n 
2  312 LEU n 
2  313 THR n 
2  314 GLY n 
2  315 ALA n 
2  316 GLY n 
2  317 HIS n 
2  318 THR n 
2  319 ASN n 
2  320 LEU n 
2  321 TYR n 
2  322 ASP n 
2  323 THR n 
2  324 ILE n 
2  325 ASN n 
2  326 ASN n 
2  327 SER n 
2  328 LEU n 
2  329 HIS n 
2  330 PHE n 
2  331 GLN n 
2  332 LEU n 
2  333 GLY n 
2  334 LEU n 
2  335 ALA n 
2  336 LEU n 
2  337 ALA n 
2  338 SER n 
2  339 LEU n 
2  340 GLY n 
2  341 VAL n 
2  342 ILE n 
2  343 THR n 
2  344 SER n 
2  345 LEU n 
2  346 VAL n 
2  347 ALA n 
2  348 GLN n 
2  349 HIS n 
2  350 MET n 
2  351 TYR n 
2  352 SER n 
2  353 LEU n 
2  354 PRO n 
2  355 SER n 
2  356 TYR n 
2  357 ALA n 
2  358 PHE n 
2  359 ILE n 
2  360 ALA n 
2  361 GLN n 
2  362 ASP n 
2  363 HIS n 
2  364 THR n 
2  365 THR n 
2  366 GLN n 
2  367 ALA n 
2  368 ALA n 
2  369 LEU n 
2  370 TYR n 
2  371 THR n 
2  372 HIS n 
2  373 HIS n 
2  374 GLN n 
2  375 TYR n 
2  376 ILE n 
2  377 ALA n 
2  378 GLY n 
2  379 PHE n 
2  380 LEU n 
2  381 MET n 
2  382 VAL n 
2  383 GLY n 
2  384 ALA n 
2  385 PHE n 
2  386 ALA n 
2  387 HIS n 
2  388 GLY n 
2  389 ALA n 
2  390 ILE n 
2  391 PHE n 
2  392 PHE n 
2  393 VAL n 
2  394 ARG n 
2  395 ASP n 
2  396 TYR n 
2  397 ASP n 
2  398 PRO n 
2  399 VAL n 
2  400 ALA n 
2  401 ASN n 
2  402 LYS n 
2  403 ASP n 
2  404 ASN n 
2  405 VAL n 
2  406 LEU n 
2  407 ALA n 
2  408 ARG n 
2  409 MET n 
2  410 LEU n 
2  411 GLU n 
2  412 HIS n 
2  413 LYS n 
2  414 GLU n 
2  415 ALA n 
2  416 LEU n 
2  417 ILE n 
2  418 SER n 
2  419 HIS n 
2  420 LEU n 
2  421 SER n 
2  422 TRP n 
2  423 VAL n 
2  424 SER n 
2  425 LEU n 
2  426 PHE n 
2  427 LEU n 
2  428 GLY n 
2  429 PHE n 
2  430 HIS n 
2  431 THR n 
2  432 LEU n 
2  433 GLY n 
2  434 LEU n 
2  435 TYR n 
2  436 VAL n 
2  437 HIS n 
2  438 ASN n 
2  439 ASP n 
2  440 VAL n 
2  441 VAL n 
2  442 VAL n 
2  443 ALA n 
2  444 PHE n 
2  445 GLY n 
2  446 THR n 
2  447 PRO n 
2  448 GLU n 
2  449 LYS n 
2  450 GLN n 
2  451 ILE n 
2  452 LEU n 
2  453 ILE n 
2  454 GLU n 
2  455 PRO n 
2  456 VAL n 
2  457 PHE n 
2  458 ALA n 
2  459 GLN n 
2  460 TRP n 
2  461 ILE n 
2  462 GLN n 
2  463 ALA n 
2  464 THR n 
2  465 SER n 
2  466 GLY n 
2  467 LYS n 
2  468 ALA n 
2  469 LEU n 
2  470 TYR n 
2  471 GLY n 
2  472 PHE n 
2  473 ASP n 
2  474 VAL n 
2  475 LEU n 
2  476 LEU n 
2  477 SER n 
2  478 ASN n 
2  479 PRO n 
2  480 ASP n 
2  481 SER n 
2  482 ILE n 
2  483 ALA n 
2  484 SER n 
2  485 THR n 
2  486 THR n 
2  487 GLY n 
2  488 ALA n 
2  489 ALA n 
2  490 TRP n 
2  491 LEU n 
2  492 PRO n 
2  493 GLY n 
2  494 TRP n 
2  495 LEU n 
2  496 ASP n 
2  497 ALA n 
2  498 ILE n 
2  499 ASN n 
2  500 SER n 
2  501 GLY n 
2  502 THR n 
2  503 ASN n 
2  504 SER n 
2  505 LEU n 
2  506 PHE n 
2  507 LEU n 
2  508 THR n 
2  509 ILE n 
2  510 GLY n 
2  511 PRO n 
2  512 GLY n 
2  513 ASP n 
2  514 PHE n 
2  515 LEU n 
2  516 VAL n 
2  517 HIS n 
2  518 HIS n 
2  519 ALA n 
2  520 ILE n 
2  521 ALA n 
2  522 LEU n 
2  523 GLY n 
2  524 LEU n 
2  525 HIS n 
2  526 THR n 
2  527 THR n 
2  528 ALA n 
2  529 LEU n 
2  530 ILE n 
2  531 LEU n 
2  532 ILE n 
2  533 LYS n 
2  534 GLY n 
2  535 ALA n 
2  536 LEU n 
2  537 ASP n 
2  538 ALA n 
2  539 ARG n 
2  540 GLY n 
2  541 SER n 
2  542 LYS n 
2  543 LEU n 
2  544 MET n 
2  545 PRO n 
2  546 ASP n 
2  547 LYS n 
2  548 LYS n 
2  549 ASP n 
2  550 PHE n 
2  551 GLY n 
2  552 TYR n 
2  553 SER n 
2  554 PHE n 
2  555 PRO n 
2  556 CYS n 
2  557 ASP n 
2  558 GLY n 
2  559 PRO n 
2  560 GLY n 
2  561 ARG n 
2  562 GLY n 
2  563 GLY n 
2  564 THR n 
2  565 CYS n 
2  566 ASP n 
2  567 ILE n 
2  568 SER n 
2  569 ALA n 
2  570 TRP n 
2  571 ASP n 
2  572 ALA n 
2  573 PHE n 
2  574 TYR n 
2  575 LEU n 
2  576 ALA n 
2  577 MET n 
2  578 PHE n 
2  579 TRP n 
2  580 MET n 
2  581 LEU n 
2  582 ASN n 
2  583 THR n 
2  584 LEU n 
2  585 GLY n 
2  586 TRP n 
2  587 LEU n 
2  588 THR n 
2  589 PHE n 
2  590 TYR n 
2  591 TRP n 
2  592 HIS n 
2  593 TRP n 
2  594 LYS n 
2  595 HIS n 
2  596 LEU n 
2  597 GLY n 
2  598 VAL n 
2  599 TRP n 
2  600 SER n 
2  601 GLY n 
2  602 ASN n 
2  603 VAL n 
2  604 ALA n 
2  605 GLN n 
2  606 PHE n 
2  607 ASN n 
2  608 GLU n 
2  609 ASN n 
2  610 SER n 
2  611 THR n 
2  612 TYR n 
2  613 LEU n 
2  614 MET n 
2  615 GLY n 
2  616 TRP n 
2  617 PHE n 
2  618 ARG n 
2  619 ASP n 
2  620 TYR n 
2  621 LEU n 
2  622 TRP n 
2  623 ALA n 
2  624 ASN n 
2  625 SER n 
2  626 ALA n 
2  627 GLN n 
2  628 LEU n 
2  629 ILE n 
2  630 ASN n 
2  631 GLY n 
2  632 TYR n 
2  633 ASN n 
2  634 PRO n 
2  635 TYR n 
2  636 GLY n 
2  637 VAL n 
2  638 ASN n 
2  639 ASN n 
2  640 LEU n 
2  641 SER n 
2  642 VAL n 
2  643 TRP n 
2  644 ALA n 
2  645 TRP n 
2  646 MET n 
2  647 PHE n 
2  648 LEU n 
2  649 PHE n 
2  650 GLY n 
2  651 HIS n 
2  652 LEU n 
2  653 VAL n 
2  654 TRP n 
2  655 ALA n 
2  656 THR n 
2  657 GLY n 
2  658 PHE n 
2  659 MET n 
2  660 PHE n 
2  661 LEU n 
2  662 ILE n 
2  663 SER n 
2  664 TRP n 
2  665 ARG n 
2  666 GLY n 
2  667 TYR n 
2  668 TRP n 
2  669 GLN n 
2  670 GLU n 
2  671 LEU n 
2  672 ILE n 
2  673 GLU n 
2  674 THR n 
2  675 ILE n 
2  676 VAL n 
2  677 TRP n 
2  678 ALA n 
2  679 HIS n 
2  680 GLU n 
2  681 ARG n 
2  682 THR n 
2  683 PRO n 
2  684 LEU n 
2  685 ALA n 
2  686 ASN n 
2  687 LEU n 
2  688 VAL n 
2  689 ARG n 
2  690 TRP n 
2  691 LYS n 
2  692 ASP n 
2  693 LYS n 
2  694 PRO n 
2  695 VAL n 
2  696 ALA n 
2  697 LEU n 
2  698 SER n 
2  699 ILE n 
2  700 VAL n 
2  701 GLN n 
2  702 ALA n 
2  703 ARG n 
2  704 LEU n 
2  705 VAL n 
2  706 GLY n 
2  707 LEU n 
2  708 ALA n 
2  709 HIS n 
2  710 PHE n 
2  711 THR n 
2  712 VAL n 
2  713 GLY n 
2  714 TYR n 
2  715 VAL n 
2  716 LEU n 
2  717 THR n 
2  718 TYR n 
2  719 ALA n 
2  720 ALA n 
2  721 PHE n 
2  722 LEU n 
2  723 ILE n 
2  724 ALA n 
2  725 SER n 
2  726 THR n 
2  727 ALA n 
2  728 GLY n 
2  729 LYS n 
2  730 PHE n 
2  731 GLY n 
3  1   SER n 
3  2   HIS n 
3  3   SER n 
3  4   VAL n 
3  5   LYS n 
3  6   ILE n 
3  7   TYR n 
3  8   ASP n 
3  9   THR n 
3  10  CYS n 
3  11  ILE n 
3  12  GLY n 
3  13  CYS n 
3  14  THR n 
3  15  GLN n 
3  16  CYS n 
3  17  VAL n 
3  18  ARG n 
3  19  ALA n 
3  20  CYS n 
3  21  PRO n 
3  22  LEU n 
3  23  ASP n 
3  24  VAL n 
3  25  LEU n 
3  26  GLU n 
3  27  MET n 
3  28  VAL n 
3  29  PRO n 
3  30  TRP n 
3  31  ASP n 
3  32  GLY n 
3  33  CYS n 
3  34  LYS n 
3  35  ALA n 
3  36  ALA n 
3  37  GLN n 
3  38  ILE n 
3  39  ALA n 
3  40  SER n 
3  41  SER n 
3  42  PRO n 
3  43  ARG n 
3  44  THR n 
3  45  GLU n 
3  46  ASP n 
3  47  CYS n 
3  48  VAL n 
3  49  GLY n 
3  50  CYS n 
3  51  LYS n 
3  52  ARG n 
3  53  CYS n 
3  54  GLU n 
3  55  THR n 
3  56  ALA n 
3  57  CYS n 
3  58  PRO n 
3  59  THR n 
3  60  ASP n 
3  61  PHE n 
3  62  LEU n 
3  63  SER n 
3  64  ILE n 
3  65  ARG n 
3  66  VAL n 
3  67  TYR n 
3  68  LEU n 
3  69  GLY n 
3  70  ALA n 
3  71  GLU n 
3  72  THR n 
3  73  THR n 
3  74  ARG n 
3  75  SER n 
3  76  MET n 
3  77  GLY n 
3  78  LEU n 
3  79  ALA n 
3  80  TYR n 
4  1   MET n 
4  2   THR n 
4  3   GLU n 
4  4   LEU n 
4  5   SER n 
4  6   GLY n 
4  7   GLN n 
4  8   PRO n 
4  9   PRO n 
4  10  LYS n 
4  11  PHE n 
4  12  GLY n 
4  13  GLY n 
4  14  SER n 
4  15  THR n 
4  16  GLY n 
4  17  GLY n 
4  18  LEU n 
4  19  LEU n 
4  20  SER n 
4  21  LYS n 
4  22  ALA n 
4  23  ASN n 
4  24  ARG n 
4  25  GLU n 
4  26  GLU n 
4  27  LYS n 
4  28  TYR n 
4  29  ALA n 
4  30  ILE n 
4  31  THR n 
4  32  TRP n 
4  33  THR n 
4  34  SER n 
4  35  ALA n 
4  36  SER n 
4  37  GLU n 
4  38  GLN n 
4  39  VAL n 
4  40  PHE n 
4  41  GLU n 
4  42  MET n 
4  43  PRO n 
4  44  THR n 
4  45  GLY n 
4  46  GLY n 
4  47  ALA n 
4  48  ALA n 
4  49  ILE n 
4  50  MET n 
4  51  ASN n 
4  52  GLU n 
4  53  GLY n 
4  54  GLU n 
4  55  ASN n 
4  56  LEU n 
4  57  LEU n 
4  58  TYR n 
4  59  LEU n 
4  60  ALA n 
4  61  ARG n 
4  62  LYS n 
4  63  GLU n 
4  64  GLN n 
4  65  CYS n 
4  66  LEU n 
4  67  ALA n 
4  68  LEU n 
4  69  GLY n 
4  70  THR n 
4  71  GLN n 
4  72  LEU n 
4  73  ARG n 
4  74  THR n 
4  75  LYS n 
4  76  PHE n 
4  77  LYS n 
4  78  PRO n 
4  79  LYS n 
4  80  ILE n 
4  81  GLN n 
4  82  ASP n 
4  83  TYR n 
4  84  LYS n 
4  85  ILE n 
4  86  TYR n 
4  87  ARG n 
4  88  VAL n 
4  89  TYR n 
4  90  PRO n 
4  91  SER n 
4  92  GLY n 
4  93  GLU n 
4  94  VAL n 
4  95  GLN n 
4  96  TYR n 
4  97  LEU n 
4  98  HIS n 
4  99  PRO n 
4  100 ALA n 
4  101 ASP n 
4  102 GLY n 
4  103 VAL n 
4  104 PHE n 
4  105 PRO n 
4  106 GLU n 
4  107 LYS n 
4  108 VAL n 
4  109 ASN n 
4  110 GLU n 
4  111 GLY n 
4  112 ARG n 
4  113 GLU n 
4  114 ALA n 
4  115 GLN n 
4  116 GLY n 
4  117 THR n 
4  118 LYS n 
4  119 THR n 
4  120 ARG n 
4  121 ARG n 
4  122 ILE n 
4  123 GLY n 
4  124 GLN n 
4  125 ASN n 
4  126 PRO n 
4  127 GLU n 
4  128 PRO n 
4  129 VAL n 
4  130 THR n 
4  131 ILE n 
4  132 LYS n 
4  133 PHE n 
4  134 SER n 
4  135 GLY n 
4  136 LYS n 
4  137 ALA n 
4  138 PRO n 
4  139 TYR n 
4  140 GLU n 
4  141 VAL n 
5  1   ALA n 
5  2   LEU n 
5  3   ASN n 
5  4   ARG n 
5  5   GLY n 
5  6   ASP n 
5  7   LYS n 
5  8   VAL n 
5  9   ARG n 
5  10  ILE n 
5  11  LYS n 
5  12  ARG n 
5  13  THR n 
5  14  GLU n 
5  15  SER n 
5  16  TYR n 
5  17  TRP n 
5  18  TYR n 
5  19  GLY n 
5  20  ASP n 
5  21  VAL n 
5  22  GLY n 
5  23  THR n 
5  24  VAL n 
5  25  ALA n 
5  26  SER n 
5  27  VAL n 
5  28  GLU n 
5  29  LYS n 
5  30  SER n 
5  31  GLY n 
5  32  ILE n 
5  33  LEU n 
5  34  TYR n 
5  35  PRO n 
5  36  VAL n 
5  37  ILE n 
5  38  VAL n 
5  39  ARG n 
5  40  PHE n 
5  41  ASP n 
5  42  ARG n 
5  43  VAL n 
5  44  ASN n 
5  45  TYR n 
5  46  ASN n 
5  47  GLY n 
5  48  PHE n 
5  49  SER n 
5  50  GLY n 
5  51  SER n 
5  52  ALA n 
5  53  SER n 
5  54  GLY n 
5  55  VAL n 
5  56  ASN n 
5  57  THR n 
5  58  ASN n 
5  59  ASN n 
5  60  PHE n 
5  61  ALA n 
5  62  GLU n 
5  63  ASN n 
5  64  GLU n 
5  65  LEU n 
5  66  GLU n 
5  67  LEU n 
5  68  VAL n 
5  69  GLN n 
6  1   ALA n 
6  2   ASP n 
6  3   ASP n 
6  4   PHE n 
6  5   ALA n 
6  6   ASN n 
6  7   LEU n 
6  8   THR n 
6  9   PRO n 
6  10  CYS n 
6  11  SER n 
6  12  GLU n 
6  13  ASN n 
6  14  PRO n 
6  15  ALA n 
6  16  TYR n 
6  17  LEU n 
6  18  ALA n 
6  19  LYS n 
6  20  SER n 
6  21  LYS n 
6  22  ASN n 
6  23  PHE n 
6  24  LEU n 
6  25  ASN n 
6  26  THR n 
6  27  THR n 
6  28  ASN n 
6  29  ASP n 
6  30  PRO n 
6  31  ASN n 
6  32  SER n 
6  33  GLY n 
6  34  LYS n 
6  35  ILE n 
6  36  ARG n 
6  37  ALA n 
6  38  GLU n 
6  39  ARG n 
6  40  TYR n 
6  41  ALA n 
6  42  SER n 
6  43  ALA n 
6  44  LEU n 
6  45  CYS n 
6  46  GLY n 
6  47  PRO n 
6  48  GLU n 
6  49  GLY n 
6  50  TYR n 
6  51  PRO n 
6  52  HIS n 
6  53  LEU n 
6  54  ILE n 
6  55  VAL n 
6  56  ASP n 
6  57  GLY n 
6  58  ARG n 
6  59  PHE n 
6  60  THR n 
6  61  HIS n 
6  62  ALA n 
6  63  GLY n 
6  64  ASP n 
6  65  PHE n 
6  66  LEU n 
6  67  ILE n 
6  68  PRO n 
6  69  SER n 
6  70  ILE n 
6  71  LEU n 
6  72  PHE n 
6  73  LEU n 
6  74  TYR n 
6  75  ILE n 
6  76  ALA n 
6  77  GLY n 
6  78  TRP n 
6  79  ILE n 
6  80  GLY n 
6  81  TRP n 
6  82  VAL n 
6  83  GLY n 
6  84  ARG n 
6  85  SER n 
6  86  TYR n 
6  87  LEU n 
6  88  ILE n 
6  89  GLU n 
6  90  ILE n 
6  91  ARG n 
6  92  GLU n 
6  93  SER n 
6  94  LYS n 
6  95  ASN n 
6  96  PRO n 
6  97  GLU n 
6  98  MET n 
6  99  GLN n 
6  100 GLU n 
6  101 VAL n 
6  102 VAL n 
6  103 ILE n 
6  104 ASN n 
6  105 VAL n 
6  106 PRO n 
6  107 LEU n 
6  108 ALA n 
6  109 ILE n 
6  110 LYS n 
6  111 LYS n 
6  112 MET n 
6  113 LEU n 
6  114 GLY n 
6  115 GLY n 
6  116 PHE n 
6  117 LEU n 
6  118 TRP n 
6  119 PRO n 
6  120 LEU n 
6  121 ALA n 
6  122 ALA n 
6  123 VAL n 
6  124 GLY n 
6  125 GLU n 
6  126 TYR n 
6  127 THR n 
6  128 SER n 
6  129 GLY n 
6  130 LYS n 
6  131 LEU n 
6  132 VAL n 
6  133 MET n 
6  134 LYS n 
6  135 ASP n 
6  136 SER n 
6  137 GLU n 
6  138 ILE n 
6  139 PRO n 
6  140 THR n 
6  141 SER n 
6  142 PRO n 
6  143 ARG n 
7  1   MET n 
7  2   ASP n 
7  3   GLY n 
7  4   SER n 
7  5   TYR n 
7  6   ALA n 
7  7   ALA n 
7  8   SER n 
7  9   TYR n 
7  10  LEU n 
7  11  PRO n 
7  12  TRP n 
7  13  ILE n 
7  14  LEU n 
7  15  ILE n 
7  16  PRO n 
7  17  MET n 
7  18  VAL n 
7  19  GLY n 
7  20  TRP n 
7  21  LEU n 
7  22  PHE n 
7  23  PRO n 
7  24  ALA n 
7  25  VAL n 
7  26  THR n 
7  27  MET n 
7  28  GLY n 
7  29  LEU n 
7  30  LEU n 
7  31  PHE n 
7  32  ILE n 
7  33  HIS n 
7  34  ILE n 
7  35  GLU n 
7  36  SER n 
7  37  GLU n 
7  38  GLY n 
7  39  GLU n 
7  40  GLY n 
8  1   MET n 
8  2   ASP n 
8  3   GLY n 
8  4   LEU n 
8  5   LYS n 
8  6   SER n 
8  7   PHE n 
8  8   LEU n 
8  9   SER n 
8  10  THR n 
8  11  ALA n 
8  12  PRO n 
8  13  VAL n 
8  14  MET n 
8  15  ILE n 
8  16  MET n 
8  17  ALA n 
8  18  LEU n 
8  19  LEU n 
8  20  THR n 
8  21  PHE n 
8  22  THR n 
8  23  ALA n 
8  24  GLY n 
8  25  ILE n 
8  26  LEU n 
8  27  ILE n 
8  28  GLU n 
8  29  PHE n 
8  30  ASN n 
8  31  ARG n 
8  32  PHE n 
8  33  TYR n 
8  34  PRO n 
8  35  ASP n 
8  36  LEU n 
8  37  LEU n 
8  38  PHE n 
8  39  HIS n 
8  40  PRO n 
9  1   LEU n 
9  2   ALA n 
9  3   GLN n 
9  4   ALA n 
9  5   SER n 
9  6   PRO n 
9  7   THR n 
9  8   THR n 
9  9   ALA n 
9  10  GLY n 
9  11  TRP n 
9  12  SER n 
9  13  LEU n 
9  14  SER n 
9  15  VAL n 
9  16  GLY n 
9  17  ILE n 
9  18  ILE n 
9  19  MET n 
9  20  CYS n 
9  21  LEU n 
9  22  CYS n 
9  23  ASN n 
9  24  VAL n 
9  25  PHE n 
9  26  ALA n 
9  27  PHE n 
9  28  VAL n 
9  29  ILE n 
9  30  GLY n 
9  31  TYR n 
9  32  PHE n 
9  33  ALA n 
9  34  ILE n 
9  35  GLN n 
9  36  LYS n 
9  37  THR n 
9  38  GLY n 
9  39  LYS n 
9  40  GLY n 
9  41  LYS n 
9  42  ASP n 
9  43  LEU n 
9  44  ALA n 
9  45  LEU n 
9  46  PRO n 
9  47  GLN n 
9  48  LEU n 
9  49  ALA n 
9  50  SER n 
9  51  LYS n 
9  52  LYS n 
9  53  THR n 
9  54  PHE n 
9  55  GLY n 
9  56  LEU n 
9  57  PRO n 
9  58  GLU n 
9  59  LEU n 
9  60  LEU n 
9  61  ALA n 
9  62  THR n 
9  63  MET n 
9  64  SER n 
9  65  PHE n 
9  66  GLY n 
9  67  HIS n 
9  68  ILE n 
9  69  LEU n 
9  70  GLY n 
9  71  ALA n 
9  72  GLY n 
9  73  MET n 
9  74  VAL n 
9  75  LEU n 
9  76  GLY n 
9  77  LEU n 
9  78  ALA n 
9  79  SER n 
9  80  SER n 
10 1   MET n 
10 2   ALA n 
10 3   GLU n 
10 4   SER n 
10 5   ASN n 
10 6   GLN n 
10 7   VAL n 
10 8   VAL n 
10 9   GLN n 
10 10  ALA n 
10 11  TYR n 
10 12  ASN n 
10 13  GLY n 
10 14  ASP n 
10 15  PRO n 
10 16  PHE n 
10 17  VAL n 
10 18  GLY n 
10 19  HIS n 
10 20  LEU n 
10 21  SER n 
10 22  THR n 
10 23  PRO n 
10 24  ILE n 
10 25  SER n 
10 26  ASP n 
10 27  SER n 
10 28  ALA n 
10 29  PHE n 
10 30  THR n 
10 31  ARG n 
10 32  THR n 
10 33  PHE n 
10 34  ILE n 
10 35  GLY n 
10 36  ASN n 
10 37  LEU n 
10 38  PRO n 
10 39  ALA n 
10 40  TYR n 
10 41  ARG n 
10 42  LYS n 
10 43  GLY n 
10 44  LEU n 
10 45  SER n 
10 46  PRO n 
10 47  ILE n 
10 48  LEU n 
10 49  ARG n 
10 50  GLY n 
10 51  LEU n 
10 52  GLU n 
10 53  VAL n 
10 54  GLY n 
10 55  MET n 
10 56  ALA n 
10 57  HIS n 
10 58  GLY n 
10 59  TYR n 
10 60  PHE n 
10 61  LEU n 
10 62  ILE n 
10 63  GLY n 
10 64  PRO n 
10 65  TRP n 
10 66  THR n 
10 67  LEU n 
10 68  LEU n 
10 69  GLY n 
10 70  PRO n 
10 71  LEU n 
10 72  ARG n 
10 73  ASP n 
10 74  SER n 
10 75  GLU n 
10 76  TYR n 
10 77  GLN n 
10 78  TYR n 
10 79  ILE n 
10 80  GLY n 
10 81  GLY n 
10 82  LEU n 
10 83  ILE n 
10 84  GLY n 
10 85  ALA n 
10 86  LEU n 
10 87  ALA n 
10 88  LEU n 
10 89  ILE n 
10 90  LEU n 
10 91  VAL n 
10 92  ALA n 
10 93  THR n 
10 94  ALA n 
10 95  ALA n 
10 96  LEU n 
10 97  SER n 
10 98  SER n 
10 99  TYR n 
10 100 GLY n 
10 101 LEU n 
10 102 VAL n 
10 103 THR n 
10 104 PHE n 
10 105 GLN n 
10 106 GLY n 
10 107 GLU n 
10 108 GLN n 
10 109 GLY n 
10 110 SER n 
10 111 GLY n 
10 112 ASP n 
10 113 THR n 
10 114 LEU n 
10 115 GLN n 
10 116 THR n 
10 117 ALA n 
10 118 ASP n 
10 119 GLY n 
10 120 TRP n 
10 121 SER n 
10 122 GLN n 
10 123 PHE n 
10 124 ALA n 
10 125 ALA n 
10 126 GLY n 
10 127 PHE n 
10 128 PHE n 
10 129 VAL n 
10 130 GLY n 
10 131 GLY n 
10 132 MET n 
10 133 GLY n 
10 134 GLY n 
10 135 ALA n 
10 136 PHE n 
10 137 VAL n 
10 138 ALA n 
10 139 TYR n 
10 140 PHE n 
10 141 LEU n 
10 142 LEU n 
10 143 GLU n 
10 144 ASN n 
10 145 LEU n 
10 146 SER n 
10 147 VAL n 
10 148 VAL n 
10 149 ASP n 
10 150 GLY n 
10 151 ILE n 
10 152 PHE n 
10 153 ARG n 
10 154 GLY n 
10 155 LEU n 
10 156 PHE n 
10 157 ASN n 
11 1   MET n 
11 2   ALA n 
11 3   LEU n 
11 4   SER n 
11 5   ASP n 
11 6   THR n 
11 7   GLN n 
11 8   ILE n 
11 9   LEU n 
11 10  ALA n 
11 11  ALA n 
11 12  LEU n 
11 13  VAL n 
11 14  VAL n 
11 15  ALA n 
11 16  LEU n 
11 17  LEU n 
11 18  PRO n 
11 19  ALA n 
11 20  PHE n 
11 21  LEU n 
11 22  ALA n 
11 23  PHE n 
11 24  ARG n 
11 25  LEU n 
11 26  SER n 
11 27  THR n 
11 28  GLU n 
11 29  LEU n 
11 30  TYR n 
11 31  LYS n 
12 1   THR n 
12 2   LYS n 
12 3   PHE n 
12 4   PRO n 
12 5   LYS n 
12 6   PHE n 
12 7   SER n 
12 8   GLN n 
12 9   ASP n 
12 10  LEU n 
12 11  ALA n 
12 12  GLN n 
12 13  ASP n 
12 14  PRO n 
12 15  THR n 
12 16  THR n 
12 17  ARG n 
12 18  ARG n 
12 19  ILE n 
12 20  TRP n 
12 21  TYR n 
12 22  GLY n 
12 23  ILE n 
12 24  ALA n 
12 25  THR n 
12 26  ALA n 
12 27  HIS n 
12 28  ASP n 
12 29  PHE n 
12 30  GLU n 
12 31  THR n 
12 32  HIS n 
12 33  ASP n 
12 34  GLY n 
12 35  MET n 
12 36  THR n 
12 37  GLU n 
12 38  GLU n 
12 39  ASN n 
12 40  LEU n 
12 41  TYR n 
12 42  GLN n 
12 43  LYS n 
12 44  ILE n 
12 45  PHE n 
12 46  ALA n 
12 47  SER n 
12 48  HIS n 
12 49  PHE n 
12 50  GLY n 
12 51  HIS n 
12 52  ILE n 
12 53  ALA n 
12 54  ILE n 
12 55  ILE n 
12 56  PHE n 
12 57  LEU n 
12 58  TRP n 
12 59  THR n 
12 60  SER n 
12 61  GLY n 
12 62  THR n 
12 63  LEU n 
12 64  PHE n 
12 65  HIS n 
12 66  VAL n 
12 67  ALA n 
12 68  TRP n 
12 69  GLN n 
12 70  GLY n 
12 71  ASN n 
12 72  PHE n 
12 73  GLU n 
12 74  GLN n 
12 75  TRP n 
12 76  ILE n 
12 77  LYS n 
12 78  ASP n 
12 79  PRO n 
12 80  LEU n 
12 81  ASN n 
12 82  ILE n 
12 83  ARG n 
12 84  PRO n 
12 85  ILE n 
12 86  ALA n 
12 87  HIS n 
12 88  ALA n 
12 89  ILE n 
12 90  TRP n 
12 91  ASP n 
12 92  PRO n 
12 93  HIS n 
12 94  PHE n 
12 95  GLY n 
12 96  GLU n 
12 97  GLY n 
12 98  ALA n 
12 99  VAL n 
12 100 ASN n 
12 101 ALA n 
12 102 PHE n 
12 103 THR n 
12 104 GLN n 
12 105 ALA n 
12 106 GLY n 
12 107 ALA n 
12 108 SER n 
12 109 ASN n 
12 110 PRO n 
12 111 VAL n 
12 112 ASN n 
12 113 ILE n 
12 114 ALA n 
12 115 TYR n 
12 116 SER n 
12 117 GLY n 
12 118 VAL n 
12 119 TYR n 
12 120 HIS n 
12 121 TRP n 
12 122 PHE n 
12 123 TYR n 
12 124 THR n 
12 125 ILE n 
12 126 GLY n 
12 127 MET n 
12 128 THR n 
12 129 THR n 
12 130 ASN n 
12 131 GLN n 
12 132 GLU n 
12 133 LEU n 
12 134 TYR n 
12 135 SER n 
12 136 GLY n 
12 137 ALA n 
12 138 VAL n 
12 139 PHE n 
12 140 LEU n 
12 141 LEU n 
12 142 VAL n 
12 143 LEU n 
12 144 ALA n 
12 145 SER n 
12 146 LEU n 
12 147 PHE n 
12 148 LEU n 
12 149 PHE n 
12 150 ALA n 
12 151 GLY n 
12 152 TRP n 
12 153 LEU n 
12 154 HIS n 
12 155 LEU n 
12 156 GLN n 
12 157 PRO n 
12 158 LYS n 
12 159 PHE n 
12 160 ARG n 
12 161 PRO n 
12 162 SER n 
12 163 LEU n 
12 164 ALA n 
12 165 TRP n 
12 166 PHE n 
12 167 LYS n 
12 168 ASN n 
12 169 ALA n 
12 170 GLU n 
12 171 SER n 
12 172 ARG n 
12 173 LEU n 
12 174 ASN n 
12 175 HIS n 
12 176 HIS n 
12 177 LEU n 
12 178 ALA n 
12 179 GLY n 
12 180 LEU n 
12 181 PHE n 
12 182 GLY n 
12 183 VAL n 
12 184 SER n 
12 185 SER n 
12 186 LEU n 
12 187 ALA n 
12 188 TRP n 
12 189 ALA n 
12 190 GLY n 
12 191 HIS n 
12 192 LEU n 
12 193 VAL n 
12 194 HIS n 
12 195 VAL n 
12 196 ALA n 
12 197 ILE n 
12 198 PRO n 
12 199 GLU n 
12 200 ALA n 
12 201 ARG n 
12 202 GLY n 
12 203 GLN n 
12 204 HIS n 
12 205 VAL n 
12 206 GLY n 
12 207 TRP n 
12 208 ASP n 
12 209 ASN n 
12 210 PHE n 
12 211 LEU n 
12 212 SER n 
12 213 THR n 
12 214 PRO n 
12 215 PRO n 
12 216 HIS n 
12 217 PRO n 
12 218 ALA n 
12 219 GLY n 
12 220 LEU n 
12 221 MET n 
12 222 PRO n 
12 223 PHE n 
12 224 PHE n 
12 225 THR n 
12 226 GLY n 
12 227 ASN n 
12 228 TRP n 
12 229 GLY n 
12 230 VAL n 
12 231 TYR n 
12 232 ALA n 
12 233 ALA n 
12 234 ASP n 
12 235 PRO n 
12 236 ASP n 
12 237 THR n 
12 238 ALA n 
12 239 GLY n 
12 240 HIS n 
12 241 ILE n 
12 242 PHE n 
12 243 GLY n 
12 244 THR n 
12 245 SER n 
12 246 GLU n 
12 247 GLY n 
12 248 ALA n 
12 249 GLY n 
12 250 THR n 
12 251 ALA n 
12 252 ILE n 
12 253 LEU n 
12 254 THR n 
12 255 PHE n 
12 256 LEU n 
12 257 GLY n 
12 258 GLY n 
12 259 PHE n 
12 260 HIS n 
12 261 PRO n 
12 262 GLN n 
12 263 THR n 
12 264 GLU n 
12 265 SER n 
12 266 LEU n 
12 267 TRP n 
12 268 LEU n 
12 269 THR n 
12 270 ASP n 
12 271 ILE n 
12 272 ALA n 
12 273 HIS n 
12 274 HIS n 
12 275 HIS n 
12 276 LEU n 
12 277 ALA n 
12 278 ILE n 
12 279 ALA n 
12 280 VAL n 
12 281 ILE n 
12 282 PHE n 
12 283 ILE n 
12 284 ILE n 
12 285 ALA n 
12 286 GLY n 
12 287 HIS n 
12 288 MET n 
12 289 TYR n 
12 290 ARG n 
12 291 THR n 
12 292 ASN n 
12 293 TRP n 
12 294 GLY n 
12 295 ILE n 
12 296 GLY n 
12 297 HIS n 
12 298 SER n 
12 299 ILE n 
12 300 LYS n 
12 301 GLU n 
12 302 ILE n 
12 303 LEU n 
12 304 ASN n 
12 305 ALA n 
12 306 HIS n 
12 307 LYS n 
12 308 GLY n 
12 309 PRO n 
12 310 LEU n 
12 311 THR n 
12 312 GLY n 
12 313 ALA n 
12 314 GLY n 
12 315 HIS n 
12 316 THR n 
12 317 ASN n 
12 318 LEU n 
12 319 TYR n 
12 320 ASP n 
12 321 THR n 
12 322 ILE n 
12 323 ASN n 
12 324 ASN n 
12 325 SER n 
12 326 LEU n 
12 327 HIS n 
12 328 PHE n 
12 329 GLN n 
12 330 LEU n 
12 331 GLY n 
12 332 LEU n 
12 333 ALA n 
12 334 LEU n 
12 335 ALA n 
12 336 SER n 
12 337 LEU n 
12 338 GLY n 
12 339 VAL n 
12 340 ILE n 
12 341 THR n 
12 342 SER n 
12 343 LEU n 
12 344 VAL n 
12 345 ALA n 
12 346 GLN n 
12 347 HIS n 
12 348 MET n 
12 349 TYR n 
12 350 SER n 
12 351 LEU n 
12 352 PRO n 
12 353 SER n 
12 354 TYR n 
12 355 ALA n 
12 356 PHE n 
12 357 ILE n 
12 358 ALA n 
12 359 GLN n 
12 360 ASP n 
12 361 HIS n 
12 362 THR n 
12 363 THR n 
12 364 GLN n 
12 365 ALA n 
12 366 ALA n 
12 367 LEU n 
12 368 TYR n 
12 369 THR n 
12 370 HIS n 
12 371 HIS n 
12 372 GLN n 
12 373 TYR n 
12 374 ILE n 
12 375 ALA n 
12 376 GLY n 
12 377 PHE n 
12 378 LEU n 
12 379 MET n 
12 380 VAL n 
12 381 GLY n 
12 382 ALA n 
12 383 PHE n 
12 384 ALA n 
12 385 HIS n 
12 386 GLY n 
12 387 ALA n 
12 388 ILE n 
12 389 PHE n 
12 390 PHE n 
12 391 VAL n 
12 392 ARG n 
12 393 ASP n 
12 394 TYR n 
12 395 ASP n 
12 396 PRO n 
12 397 VAL n 
12 398 ALA n 
12 399 ASN n 
12 400 LYS n 
12 401 ASP n 
12 402 ASN n 
12 403 VAL n 
12 404 LEU n 
12 405 ALA n 
12 406 ARG n 
12 407 MET n 
12 408 LEU n 
12 409 GLU n 
12 410 HIS n 
12 411 LYS n 
12 412 GLU n 
12 413 ALA n 
12 414 LEU n 
12 415 ILE n 
12 416 SER n 
12 417 HIS n 
12 418 LEU n 
12 419 SER n 
12 420 TRP n 
12 421 VAL n 
12 422 SER n 
12 423 LEU n 
12 424 PHE n 
12 425 LEU n 
12 426 GLY n 
12 427 PHE n 
12 428 HIS n 
12 429 THR n 
12 430 LEU n 
12 431 GLY n 
12 432 LEU n 
12 433 TYR n 
12 434 VAL n 
12 435 HIS n 
12 436 ASN n 
12 437 ASP n 
12 438 VAL n 
12 439 VAL n 
12 440 VAL n 
12 441 ALA n 
12 442 PHE n 
12 443 GLY n 
12 444 THR n 
12 445 PRO n 
12 446 GLU n 
12 447 LYS n 
12 448 GLN n 
12 449 ILE n 
12 450 LEU n 
12 451 ILE n 
12 452 GLU n 
12 453 PRO n 
12 454 VAL n 
12 455 PHE n 
12 456 ALA n 
12 457 GLN n 
12 458 TRP n 
12 459 ILE n 
12 460 GLN n 
12 461 ALA n 
12 462 THR n 
12 463 SER n 
12 464 GLY n 
12 465 LYS n 
12 466 ALA n 
12 467 LEU n 
12 468 TYR n 
12 469 GLY n 
12 470 PHE n 
12 471 ASP n 
12 472 VAL n 
12 473 LEU n 
12 474 LEU n 
12 475 SER n 
12 476 ASN n 
12 477 PRO n 
12 478 ASP n 
12 479 SER n 
12 480 ILE n 
12 481 ALA n 
12 482 SER n 
12 483 THR n 
12 484 THR n 
12 485 GLY n 
12 486 ALA n 
12 487 ALA n 
12 488 TRP n 
12 489 LEU n 
12 490 PRO n 
12 491 GLY n 
12 492 TRP n 
12 493 LEU n 
12 494 ASP n 
12 495 ALA n 
12 496 ILE n 
12 497 ASN n 
12 498 SER n 
12 499 GLY n 
12 500 THR n 
12 501 ASN n 
12 502 SER n 
12 503 LEU n 
12 504 PHE n 
12 505 LEU n 
12 506 THR n 
12 507 ILE n 
12 508 GLY n 
12 509 PRO n 
12 510 GLY n 
12 511 ASP n 
12 512 PHE n 
12 513 LEU n 
12 514 VAL n 
12 515 HIS n 
12 516 HIS n 
12 517 ALA n 
12 518 ILE n 
12 519 ALA n 
12 520 LEU n 
12 521 GLY n 
12 522 LEU n 
12 523 HIS n 
12 524 THR n 
12 525 THR n 
12 526 ALA n 
12 527 LEU n 
12 528 ILE n 
12 529 LEU n 
12 530 ILE n 
12 531 LYS n 
12 532 GLY n 
12 533 ALA n 
12 534 LEU n 
12 535 ASP n 
12 536 ALA n 
12 537 ARG n 
12 538 GLY n 
12 539 SER n 
12 540 LYS n 
12 541 LEU n 
12 542 MET n 
12 543 PRO n 
12 544 ASP n 
12 545 LYS n 
12 546 LYS n 
12 547 ASP n 
12 548 PHE n 
12 549 GLY n 
12 550 TYR n 
12 551 SER n 
12 552 PHE n 
12 553 PRO n 
12 554 CYS n 
12 555 ASP n 
12 556 GLY n 
12 557 PRO n 
12 558 GLY n 
12 559 ARG n 
12 560 GLY n 
12 561 GLY n 
12 562 THR n 
12 563 CYS n 
12 564 ASP n 
12 565 ILE n 
12 566 SER n 
12 567 ALA n 
12 568 TRP n 
12 569 ASP n 
12 570 ALA n 
12 571 PHE n 
12 572 TYR n 
12 573 LEU n 
12 574 ALA n 
12 575 MET n 
12 576 PHE n 
12 577 TRP n 
12 578 MET n 
12 579 LEU n 
12 580 ASN n 
12 581 THR n 
12 582 LEU n 
12 583 GLY n 
12 584 TRP n 
12 585 LEU n 
12 586 THR n 
12 587 PHE n 
12 588 TYR n 
12 589 TRP n 
12 590 HIS n 
12 591 TRP n 
12 592 LYS n 
12 593 HIS n 
12 594 LEU n 
12 595 GLY n 
12 596 VAL n 
12 597 TRP n 
12 598 SER n 
12 599 GLY n 
12 600 ASN n 
12 601 VAL n 
12 602 ALA n 
12 603 GLN n 
12 604 PHE n 
12 605 ASN n 
12 606 GLU n 
12 607 ASN n 
12 608 SER n 
12 609 THR n 
12 610 TYR n 
12 611 LEU n 
12 612 MET n 
12 613 GLY n 
12 614 TRP n 
12 615 PHE n 
12 616 ARG n 
12 617 ASP n 
12 618 TYR n 
12 619 LEU n 
12 620 TRP n 
12 621 ALA n 
12 622 ASN n 
12 623 SER n 
12 624 ALA n 
12 625 GLN n 
12 626 LEU n 
12 627 ILE n 
12 628 ASN n 
12 629 GLY n 
12 630 TYR n 
12 631 ASN n 
12 632 PRO n 
12 633 TYR n 
12 634 GLY n 
12 635 VAL n 
12 636 ASN n 
12 637 ASN n 
12 638 LEU n 
12 639 SER n 
12 640 VAL n 
12 641 TRP n 
12 642 ALA n 
12 643 TRP n 
12 644 MET n 
12 645 PHE n 
12 646 LEU n 
12 647 PHE n 
12 648 GLY n 
12 649 HIS n 
12 650 LEU n 
12 651 VAL n 
12 652 TRP n 
12 653 ALA n 
12 654 THR n 
12 655 GLY n 
12 656 PHE n 
12 657 MET n 
12 658 PHE n 
12 659 LEU n 
12 660 ILE n 
12 661 SER n 
12 662 TRP n 
12 663 ARG n 
12 664 GLY n 
12 665 TYR n 
12 666 TRP n 
12 667 GLN n 
12 668 GLU n 
12 669 LEU n 
12 670 ILE n 
12 671 GLU n 
12 672 THR n 
12 673 ILE n 
12 674 VAL n 
12 675 TRP n 
12 676 ALA n 
12 677 HIS n 
12 678 GLU n 
12 679 ARG n 
12 680 THR n 
12 681 PRO n 
12 682 LEU n 
12 683 ALA n 
12 684 ASN n 
12 685 LEU n 
12 686 VAL n 
12 687 ARG n 
12 688 TRP n 
12 689 LYS n 
12 690 ASP n 
12 691 LYS n 
12 692 PRO n 
12 693 VAL n 
12 694 ALA n 
12 695 LEU n 
12 696 SER n 
12 697 ILE n 
12 698 VAL n 
12 699 GLN n 
12 700 ALA n 
12 701 ARG n 
12 702 LEU n 
12 703 VAL n 
12 704 GLY n 
12 705 LEU n 
12 706 ALA n 
12 707 HIS n 
12 708 PHE n 
12 709 THR n 
12 710 VAL n 
12 711 GLY n 
12 712 TYR n 
12 713 VAL n 
12 714 LEU n 
12 715 THR n 
12 716 TYR n 
12 717 ALA n 
12 718 ALA n 
12 719 PHE n 
12 720 LEU n 
12 721 ILE n 
12 722 ALA n 
12 723 SER n 
12 724 THR n 
12 725 ALA n 
12 726 GLY n 
12 727 LYS n 
12 728 PHE n 
12 729 GLY n 
13 1   MET n 
13 2   SER n 
13 3   HIS n 
13 4   SER n 
13 5   VAL n 
13 6   LYS n 
13 7   ILE n 
13 8   TYR n 
13 9   ASP n 
13 10  THR n 
13 11  CYS n 
13 12  ILE n 
13 13  GLY n 
13 14  CYS n 
13 15  THR n 
13 16  GLN n 
13 17  CYS n 
13 18  VAL n 
13 19  ARG n 
13 20  ALA n 
13 21  CYS n 
13 22  PRO n 
13 23  LEU n 
13 24  ASP n 
13 25  VAL n 
13 26  LEU n 
13 27  GLU n 
13 28  MET n 
13 29  VAL n 
13 30  PRO n 
13 31  TRP n 
13 32  ASP n 
13 33  GLY n 
13 34  CYS n 
13 35  LYS n 
13 36  ALA n 
13 37  ALA n 
13 38  GLN n 
13 39  ILE n 
13 40  ALA n 
13 41  SER n 
13 42  SER n 
13 43  PRO n 
13 44  ARG n 
13 45  THR n 
13 46  GLU n 
13 47  ASP n 
13 48  CYS n 
13 49  VAL n 
13 50  GLY n 
13 51  CYS n 
13 52  LYS n 
13 53  ARG n 
13 54  CYS n 
13 55  GLU n 
13 56  THR n 
13 57  ALA n 
13 58  CYS n 
13 59  PRO n 
13 60  THR n 
13 61  ASP n 
13 62  PHE n 
13 63  LEU n 
13 64  SER n 
13 65  ILE n 
13 66  ARG n 
13 67  VAL n 
13 68  TYR n 
13 69  LEU n 
13 70  GLY n 
13 71  ALA n 
13 72  GLU n 
13 73  THR n 
13 74  THR n 
13 75  ARG n 
13 76  SER n 
13 77  MET n 
13 78  GLY n 
13 79  LEU n 
13 80  ALA n 
13 81  TYR n 
14 1   ALA n 
14 2   LEU n 
14 3   ASN n 
14 4   ARG n 
14 5   GLY n 
14 6   ASP n 
14 7   LYS n 
14 8   VAL n 
14 9   ARG n 
14 10  ILE n 
14 11  LYS n 
14 12  ARG n 
14 13  THR n 
14 14  GLU n 
14 15  SER n 
14 16  TYR n 
14 17  TRP n 
14 18  TYR n 
14 19  GLY n 
14 20  ASP n 
14 21  VAL n 
14 22  GLY n 
14 23  THR n 
14 24  VAL n 
14 25  ALA n 
14 26  SER n 
14 27  VAL n 
14 28  GLU n 
14 29  LYS n 
14 30  SER n 
14 31  GLY n 
14 32  ILE n 
14 33  LEU n 
14 34  TYR n 
14 35  PRO n 
14 36  VAL n 
14 37  ILE n 
14 38  VAL n 
14 39  ARG n 
14 40  PHE n 
14 41  ASP n 
14 42  ARG n 
14 43  VAL n 
14 44  ASN n 
14 45  TYR n 
14 46  ASN n 
14 47  GLY n 
14 48  PHE n 
14 49  SER n 
14 50  GLY n 
14 51  SER n 
14 52  ALA n 
14 53  SER n 
14 54  GLY n 
14 55  VAL n 
14 56  ASN n 
14 57  THR n 
14 58  ASN n 
14 59  ASN n 
14 60  PHE n 
14 61  ALA n 
14 62  GLU n 
14 63  ASN n 
14 64  GLU n 
14 65  LEU n 
14 66  GLU n 
14 67  LEU n 
14 68  VAL n 
15 1   ALA n 
15 2   GLN n 
15 3   ALA n 
15 4   SER n 
15 5   PRO n 
15 6   THR n 
15 7   THR n 
15 8   ALA n 
15 9   GLY n 
15 10  TRP n 
15 11  SER n 
15 12  LEU n 
15 13  SER n 
15 14  VAL n 
15 15  GLY n 
15 16  ILE n 
15 17  ILE n 
15 18  MET n 
15 19  CYS n 
15 20  LEU n 
15 21  CYS n 
15 22  ASN n 
15 23  VAL n 
15 24  PHE n 
15 25  ALA n 
15 26  PHE n 
15 27  VAL n 
15 28  ILE n 
15 29  GLY n 
15 30  TYR n 
15 31  PHE n 
15 32  ALA n 
15 33  ILE n 
15 34  GLN n 
15 35  LYS n 
15 36  THR n 
15 37  GLY n 
15 38  LYS n 
15 39  GLY n 
15 40  LYS n 
15 41  ASP n 
15 42  LEU n 
15 43  ALA n 
15 44  LEU n 
15 45  PRO n 
15 46  GLN n 
15 47  LEU n 
15 48  ALA n 
15 49  SER n 
15 50  LYS n 
15 51  LYS n 
15 52  THR n 
15 53  PHE n 
15 54  GLY n 
15 55  LEU n 
15 56  PRO n 
15 57  GLU n 
15 58  LEU n 
15 59  LEU n 
15 60  ALA n 
15 61  THR n 
15 62  MET n 
15 63  SER n 
15 64  PHE n 
15 65  GLY n 
15 66  HIS n 
15 67  ILE n 
15 68  LEU n 
15 69  GLY n 
15 70  ALA n 
15 71  GLY n 
15 72  MET n 
15 73  VAL n 
15 74  LEU n 
15 75  GLY n 
15 76  LEU n 
15 77  ALA n 
15 78  SER n 
16 1   ARG n 
16 2   GLU n 
16 3   ALA n 
16 4   LYS n 
16 5   ALA n 
16 6   LYS n 
16 7   VAL n 
16 8   SER n 
16 9   VAL n 
16 10  ASP n 
16 11  ASN n 
16 12  ASN n 
16 13  PRO n 
16 14  VAL n 
16 15  PRO n 
16 16  THR n 
16 17  SER n 
16 18  PHE n 
16 19  GLU n 
16 20  LYS n 
16 21  TRP n 
16 22  GLY n 
16 23  LYS n 
16 24  PRO n 
16 25  GLY n 
16 26  HIS n 
16 27  PHE n 
16 28  ASP n 
16 29  ARG n 
16 30  THR n 
16 31  LEU n 
16 32  ALA n 
16 33  ARG n 
16 34  GLY n 
16 35  PRO n 
16 36  LYS n 
16 37  THR n 
16 38  THR n 
16 39  THR n 
16 40  TRP n 
16 41  ILE n 
16 42  TRP n 
16 43  ASN n 
16 44  LEU n 
16 45  HIS n 
16 46  ALA n 
16 47  ASN n 
16 48  ALA n 
16 49  HIS n 
16 50  ASP n 
16 51  PHE n 
16 52  ASP n 
16 53  SER n 
16 54  GLN n 
16 55  THR n 
16 56  SER n 
16 57  ASP n 
16 58  LEU n 
16 59  GLU n 
16 60  ASP n 
16 61  VAL n 
16 62  SER n 
16 63  ARG n 
16 64  LYS n 
16 65  ILE n 
16 66  PHE n 
16 67  SER n 
16 68  ALA n 
16 69  HIS n 
16 70  PHE n 
16 71  GLY n 
16 72  HIS n 
16 73  LEU n 
16 74  ALA n 
16 75  VAL n 
16 76  VAL n 
16 77  PHE n 
16 78  VAL n 
16 79  TRP n 
16 80  LEU n 
16 81  SER n 
16 82  GLY n 
16 83  MET n 
16 84  TYR n 
16 85  PHE n 
16 86  HIS n 
16 87  GLY n 
16 88  ALA n 
16 89  LYS n 
16 90  PHE n 
16 91  SER n 
16 92  ASN n 
16 93  TYR n 
16 94  GLU n 
16 95  GLY n 
16 96  TRP n 
16 97  LEU n 
16 98  ALA n 
16 99  ASP n 
16 100 PRO n 
16 101 THR n 
16 102 HIS n 
16 103 ILE n 
16 104 LYS n 
16 105 PRO n 
16 106 SER n 
16 107 ALA n 
16 108 GLN n 
16 109 VAL n 
16 110 VAL n 
16 111 TRP n 
16 112 PRO n 
16 113 ILE n 
16 114 VAL n 
16 115 GLY n 
16 116 GLN n 
16 117 GLY n 
16 118 ILE n 
16 119 LEU n 
16 120 ASN n 
16 121 GLY n 
16 122 ASP n 
16 123 VAL n 
16 124 GLY n 
16 125 GLY n 
16 126 GLY n 
16 127 PHE n 
16 128 HIS n 
16 129 GLY n 
16 130 ILE n 
16 131 GLN n 
16 132 ILE n 
16 133 THR n 
16 134 SER n 
16 135 GLY n 
16 136 LEU n 
16 137 PHE n 
16 138 TYR n 
16 139 LEU n 
16 140 TRP n 
16 141 ARG n 
16 142 ALA n 
16 143 SER n 
16 144 GLY n 
16 145 PHE n 
16 146 THR n 
16 147 ASP n 
16 148 SER n 
16 149 TYR n 
16 150 GLN n 
16 151 LEU n 
16 152 TYR n 
16 153 CYS n 
16 154 THR n 
16 155 ALA n 
16 156 ILE n 
16 157 GLY n 
16 158 GLY n 
16 159 LEU n 
16 160 VAL n 
16 161 MET n 
16 162 ALA n 
16 163 ALA n 
16 164 LEU n 
16 165 MET n 
16 166 LEU n 
16 167 PHE n 
16 168 ALA n 
16 169 GLY n 
16 170 TRP n 
16 171 PHE n 
16 172 HIS n 
16 173 TYR n 
16 174 HIS n 
16 175 VAL n 
16 176 LYS n 
16 177 ALA n 
16 178 PRO n 
16 179 LYS n 
16 180 LEU n 
16 181 GLU n 
16 182 TRP n 
16 183 PHE n 
16 184 GLN n 
16 185 ASN n 
16 186 VAL n 
16 187 GLU n 
16 188 SER n 
16 189 MET n 
16 190 MET n 
16 191 ASN n 
16 192 HIS n 
16 193 HIS n 
16 194 LEU n 
16 195 ALA n 
16 196 GLY n 
16 197 LEU n 
16 198 LEU n 
16 199 GLY n 
16 200 LEU n 
16 201 GLY n 
16 202 SER n 
16 203 LEU n 
16 204 GLY n 
16 205 TRP n 
16 206 ALA n 
16 207 GLY n 
16 208 HIS n 
16 209 GLN n 
16 210 ILE n 
16 211 HIS n 
16 212 VAL n 
16 213 SER n 
16 214 MET n 
16 215 PRO n 
16 216 ILE n 
16 217 ASN n 
16 218 LYS n 
16 219 LEU n 
16 220 LEU n 
16 221 ASP n 
16 222 ALA n 
16 223 GLY n 
16 224 VAL n 
16 225 ALA n 
16 226 PRO n 
16 227 LYS n 
16 228 ASP n 
16 229 ILE n 
16 230 PRO n 
16 231 LEU n 
16 232 PRO n 
16 233 HIS n 
16 234 GLU n 
16 235 PHE n 
16 236 ILE n 
16 237 LEU n 
16 238 GLU n 
16 239 PRO n 
16 240 SER n 
16 241 LYS n 
16 242 MET n 
16 243 ALA n 
16 244 GLU n 
16 245 LEU n 
16 246 TYR n 
16 247 PRO n 
16 248 SER n 
16 249 PHE n 
16 250 ALA n 
16 251 GLN n 
16 252 GLY n 
16 253 LEU n 
16 254 THR n 
16 255 PRO n 
16 256 PHE n 
16 257 PHE n 
16 258 THR n 
16 259 LEU n 
16 260 ASN n 
16 261 TRP n 
16 262 GLY n 
16 263 VAL n 
16 264 TYR n 
16 265 SER n 
16 266 ASP n 
16 267 PHE n 
16 268 LEU n 
16 269 THR n 
16 270 PHE n 
16 271 LYS n 
16 272 GLY n 
16 273 GLY n 
16 274 LEU n 
16 275 ASN n 
16 276 PRO n 
16 277 VAL n 
16 278 THR n 
16 279 GLY n 
16 280 GLY n 
16 281 LEU n 
16 282 TRP n 
16 283 LEU n 
16 284 SER n 
16 285 ASP n 
16 286 THR n 
16 287 ALA n 
16 288 HIS n 
16 289 HIS n 
16 290 HIS n 
16 291 LEU n 
16 292 ALA n 
16 293 ILE n 
16 294 ALA n 
16 295 VAL n 
16 296 LEU n 
16 297 PHE n 
16 298 ILE n 
16 299 ILE n 
16 300 ALA n 
16 301 GLY n 
16 302 HIS n 
16 303 MET n 
16 304 TYR n 
16 305 ARG n 
16 306 THR n 
16 307 ASN n 
16 308 TRP n 
16 309 GLY n 
16 310 ILE n 
16 311 GLY n 
16 312 HIS n 
16 313 SER n 
16 314 MET n 
16 315 LYS n 
16 316 GLU n 
16 317 ILE n 
16 318 LEU n 
16 319 GLU n 
16 320 ALA n 
16 321 HIS n 
16 322 LYS n 
16 323 GLY n 
16 324 PRO n 
16 325 PHE n 
16 326 THR n 
16 327 GLY n 
16 328 GLU n 
16 329 GLY n 
16 330 HIS n 
16 331 LYS n 
16 332 GLY n 
16 333 LEU n 
16 334 TYR n 
16 335 GLU n 
16 336 ILE n 
16 337 LEU n 
16 338 THR n 
16 339 THR n 
16 340 SER n 
16 341 TRP n 
16 342 HIS n 
16 343 ALA n 
16 344 GLN n 
16 345 LEU n 
16 346 ALA n 
16 347 ILE n 
16 348 ASN n 
16 349 LEU n 
16 350 ALA n 
16 351 LEU n 
16 352 LEU n 
16 353 GLY n 
16 354 SER n 
16 355 LEU n 
16 356 THR n 
16 357 ILE n 
16 358 ILE n 
16 359 VAL n 
16 360 ALA n 
16 361 GLN n 
16 362 HIS n 
16 363 MET n 
16 364 TYR n 
16 365 ALA n 
16 366 MET n 
16 367 PRO n 
16 368 PRO n 
16 369 TYR n 
16 370 PRO n 
16 371 TYR n 
16 372 GLN n 
16 373 ALA n 
16 374 ILE n 
16 375 ASP n 
16 376 TYR n 
16 377 ALA n 
16 378 THR n 
16 379 GLN n 
16 380 LEU n 
16 381 SER n 
16 382 LEU n 
16 383 PHE n 
16 384 THR n 
16 385 HIS n 
16 386 HIS n 
16 387 MET n 
16 388 TRP n 
16 389 ILE n 
16 390 GLY n 
16 391 GLY n 
16 392 PHE n 
16 393 LEU n 
16 394 ILE n 
16 395 VAL n 
16 396 GLY n 
16 397 ALA n 
16 398 GLY n 
16 399 ALA n 
16 400 HIS n 
16 401 GLY n 
16 402 ALA n 
16 403 ILE n 
16 404 PHE n 
16 405 MET n 
16 406 VAL n 
16 407 ARG n 
16 408 ASP n 
16 409 TYR n 
16 410 ASP n 
16 411 PRO n 
16 412 ALA n 
16 413 LYS n 
16 414 ASN n 
16 415 VAL n 
16 416 ASN n 
16 417 ASN n 
16 418 LEU n 
16 419 LEU n 
16 420 ASP n 
16 421 ARG n 
16 422 MET n 
16 423 LEU n 
16 424 ARG n 
16 425 HIS n 
16 426 ARG n 
16 427 ASP n 
16 428 ALA n 
16 429 ILE n 
16 430 ILE n 
16 431 SER n 
16 432 HIS n 
16 433 LEU n 
16 434 ASN n 
16 435 TRP n 
16 436 VAL n 
16 437 CYS n 
16 438 ILE n 
16 439 PHE n 
16 440 LEU n 
16 441 GLY n 
16 442 PHE n 
16 443 HIS n 
16 444 SER n 
16 445 PHE n 
16 446 GLY n 
16 447 LEU n 
16 448 TYR n 
16 449 ILE n 
16 450 HIS n 
16 451 ASN n 
16 452 ASP n 
16 453 THR n 
16 454 MET n 
16 455 ARG n 
16 456 ALA n 
16 457 LEU n 
16 458 GLY n 
16 459 ARG n 
16 460 PRO n 
16 461 GLN n 
16 462 ASP n 
16 463 MET n 
16 464 PHE n 
16 465 SER n 
16 466 ASP n 
16 467 THR n 
16 468 ALA n 
16 469 ILE n 
16 470 GLN n 
16 471 LEU n 
16 472 GLN n 
16 473 PRO n 
16 474 ILE n 
16 475 PHE n 
16 476 ALA n 
16 477 GLN n 
16 478 TRP n 
16 479 VAL n 
16 480 GLN n 
16 481 HIS n 
16 482 LEU n 
16 483 HIS n 
16 484 THR n 
16 485 LEU n 
16 486 ALA n 
16 487 PRO n 
16 488 GLY n 
16 489 ALA n 
16 490 THR n 
16 491 ALA n 
16 492 PRO n 
16 493 ASN n 
16 494 ALA n 
16 495 LEU n 
16 496 ALA n 
16 497 THR n 
16 498 ALA n 
16 499 SER n 
16 500 TYR n 
16 501 ALA n 
16 502 PHE n 
16 503 GLY n 
16 504 GLY n 
16 505 GLU n 
16 506 THR n 
16 507 ILE n 
16 508 ALA n 
16 509 VAL n 
16 510 ALA n 
16 511 GLY n 
16 512 LYS n 
16 513 VAL n 
16 514 ALA n 
16 515 MET n 
16 516 MET n 
16 517 PRO n 
16 518 ILE n 
16 519 THR n 
16 520 LEU n 
16 521 GLY n 
16 522 THR n 
16 523 ALA n 
16 524 ASP n 
16 525 PHE n 
16 526 MET n 
16 527 VAL n 
16 528 HIS n 
16 529 HIS n 
16 530 ILE n 
16 531 HIS n 
16 532 ALA n 
16 533 PHE n 
16 534 THR n 
16 535 ILE n 
16 536 HIS n 
16 537 VAL n 
16 538 THR n 
16 539 ALA n 
16 540 LEU n 
16 541 ILE n 
16 542 LEU n 
16 543 LEU n 
16 544 LYS n 
16 545 GLY n 
16 546 VAL n 
16 547 LEU n 
16 548 TYR n 
16 549 ALA n 
16 550 ARG n 
16 551 SER n 
16 552 SER n 
16 553 ARG n 
16 554 LEU n 
16 555 VAL n 
16 556 PRO n 
16 557 ASP n 
16 558 LYS n 
16 559 ALA n 
16 560 ASN n 
16 561 LEU n 
16 562 GLY n 
16 563 PHE n 
16 564 ARG n 
16 565 PHE n 
16 566 PRO n 
16 567 CYS n 
16 568 ASP n 
16 569 GLY n 
16 570 PRO n 
16 571 GLY n 
16 572 ARG n 
16 573 GLY n 
16 574 GLY n 
16 575 THR n 
16 576 CYS n 
16 577 GLN n 
16 578 VAL n 
16 579 SER n 
16 580 GLY n 
16 581 TRP n 
16 582 ASP n 
16 583 HIS n 
16 584 VAL n 
16 585 PHE n 
16 586 LEU n 
16 587 GLY n 
16 588 LEU n 
16 589 PHE n 
16 590 TRP n 
16 591 MET n 
16 592 TYR n 
16 593 ASN n 
16 594 SER n 
16 595 LEU n 
16 596 SER n 
16 597 ILE n 
16 598 VAL n 
16 599 ILE n 
16 600 PHE n 
16 601 HIS n 
16 602 PHE n 
16 603 SER n 
16 604 TRP n 
16 605 LYS n 
16 606 MET n 
16 607 GLN n 
16 608 SER n 
16 609 ASP n 
16 610 VAL n 
16 611 TRP n 
16 612 GLY n 
16 613 THR n 
16 614 VAL n 
16 615 SER n 
16 616 PRO n 
16 617 ASP n 
16 618 GLY n 
16 619 SER n 
16 620 VAL n 
16 621 THR n 
16 622 HIS n 
16 623 VAL n 
16 624 THR n 
16 625 LEU n 
16 626 GLY n 
16 627 ASN n 
16 628 PHE n 
16 629 ALA n 
16 630 GLN n 
16 631 SER n 
16 632 ALA n 
16 633 ILE n 
16 634 THR n 
16 635 ILE n 
16 636 ASN n 
16 637 GLY n 
16 638 TRP n 
16 639 LEU n 
16 640 ARG n 
16 641 ASP n 
16 642 PHE n 
16 643 LEU n 
16 644 TRP n 
16 645 ALA n 
16 646 GLN n 
16 647 ALA n 
16 648 ALA n 
16 649 ASN n 
16 650 VAL n 
16 651 ILE n 
16 652 ASN n 
16 653 SER n 
16 654 TYR n 
16 655 GLY n 
16 656 SER n 
16 657 ALA n 
16 658 LEU n 
16 659 SER n 
16 660 ALA n 
16 661 TYR n 
16 662 GLY n 
16 663 ILE n 
16 664 MET n 
16 665 PHE n 
16 666 LEU n 
16 667 ALA n 
16 668 GLY n 
16 669 HIS n 
16 670 PHE n 
16 671 VAL n 
16 672 PHE n 
16 673 ALA n 
16 674 PHE n 
16 675 SER n 
16 676 LEU n 
16 677 MET n 
16 678 PHE n 
16 679 LEU n 
16 680 PHE n 
16 681 SER n 
16 682 GLY n 
16 683 ARG n 
16 684 GLY n 
16 685 TYR n 
16 686 TRP n 
16 687 GLN n 
16 688 GLU n 
16 689 LEU n 
16 690 ILE n 
16 691 GLU n 
16 692 SER n 
16 693 ILE n 
16 694 VAL n 
16 695 TRP n 
16 696 ALA n 
16 697 HIS n 
16 698 ASN n 
16 699 LYS n 
16 700 LEU n 
16 701 ASN n 
16 702 VAL n 
16 703 ALA n 
16 704 PRO n 
16 705 ALA n 
16 706 ILE n 
16 707 GLN n 
16 708 PRO n 
16 709 ARG n 
16 710 ALA n 
16 711 LEU n 
16 712 SER n 
16 713 ILE n 
16 714 ILE n 
16 715 GLN n 
16 716 GLY n 
16 717 ARG n 
16 718 ALA n 
16 719 VAL n 
16 720 GLY n 
16 721 VAL n 
16 722 ALA n 
16 723 HIS n 
16 724 TYR n 
16 725 LEU n 
16 726 LEU n 
16 727 GLY n 
16 728 GLY n 
16 729 ILE n 
16 730 VAL n 
16 731 THR n 
16 732 THR n 
16 733 TRP n 
16 734 ALA n 
16 735 PHE n 
16 736 PHE n 
16 737 LEU n 
16 738 ALA n 
16 739 ARG n 
16 740 SER n 
16 741 LEU n 
16 742 SER n 
16 743 ILE n 
16 744 GLY n 
17 1   THR n 
17 2   GLU n 
17 3   LEU n 
17 4   SER n 
17 5   GLY n 
17 6   GLN n 
17 7   PRO n 
17 8   PRO n 
17 9   LYS n 
17 10  PHE n 
17 11  GLY n 
17 12  GLY n 
17 13  SER n 
17 14  THR n 
17 15  GLY n 
17 16  GLY n 
17 17  LEU n 
17 18  LEU n 
17 19  SER n 
17 20  LYS n 
17 21  ALA n 
17 22  ASN n 
17 23  ARG n 
17 24  GLU n 
17 25  GLU n 
17 26  LYS n 
17 27  TYR n 
17 28  ALA n 
17 29  ILE n 
17 30  THR n 
17 31  TRP n 
17 32  THR n 
17 33  SER n 
17 34  ALA n 
17 35  SER n 
17 36  GLU n 
17 37  GLN n 
17 38  VAL n 
17 39  PHE n 
17 40  GLU n 
17 41  MET n 
17 42  PRO n 
17 43  THR n 
17 44  GLY n 
17 45  GLY n 
17 46  ALA n 
17 47  ALA n 
17 48  ILE n 
17 49  MET n 
17 50  ASN n 
17 51  GLU n 
17 52  GLY n 
17 53  GLU n 
17 54  ASN n 
17 55  LEU n 
17 56  LEU n 
17 57  TYR n 
17 58  LEU n 
17 59  ALA n 
17 60  ARG n 
17 61  LYS n 
17 62  GLU n 
17 63  GLN n 
17 64  CYS n 
17 65  LEU n 
17 66  ALA n 
17 67  LEU n 
17 68  GLY n 
17 69  THR n 
17 70  GLN n 
17 71  LEU n 
17 72  ARG n 
17 73  THR n 
17 74  LYS n 
17 75  PHE n 
17 76  LYS n 
17 77  PRO n 
17 78  LYS n 
17 79  ILE n 
17 80  GLN n 
17 81  ASP n 
17 82  TYR n 
17 83  LYS n 
17 84  ILE n 
17 85  TYR n 
17 86  ARG n 
17 87  VAL n 
17 88  TYR n 
17 89  PRO n 
17 90  SER n 
17 91  GLY n 
17 92  GLU n 
17 93  VAL n 
17 94  GLN n 
17 95  TYR n 
17 96  LEU n 
17 97  HIS n 
17 98  PRO n 
17 99  ALA n 
17 100 ASP n 
17 101 GLY n 
17 102 VAL n 
17 103 PHE n 
17 104 PRO n 
17 105 GLU n 
17 106 LYS n 
17 107 VAL n 
17 108 ASN n 
17 109 GLU n 
17 110 GLY n 
17 111 ARG n 
17 112 GLU n 
17 113 ALA n 
17 114 GLN n 
17 115 GLY n 
17 116 THR n 
17 117 LYS n 
17 118 THR n 
17 119 ARG n 
17 120 ARG n 
17 121 ILE n 
17 122 GLY n 
17 123 GLN n 
17 124 ASN n 
17 125 PRO n 
17 126 GLU n 
17 127 PRO n 
17 128 VAL n 
17 129 THR n 
17 130 ILE n 
17 131 LYS n 
17 132 PHE n 
17 133 SER n 
17 134 GLY n 
17 135 LYS n 
17 136 ALA n 
17 137 PRO n 
17 138 TYR n 
17 139 GLU n 
17 140 VAL n 
18 1   MET n 
18 2   ASP n 
18 3   GLY n 
18 4   SER n 
18 5   TYR n 
18 6   ALA n 
18 7   ALA n 
18 8   SER n 
18 9   TYR n 
18 10  LEU n 
18 11  PRO n 
18 12  TRP n 
18 13  ILE n 
18 14  LEU n 
18 15  ILE n 
18 16  PRO n 
18 17  MET n 
18 18  VAL n 
18 19  GLY n 
18 20  TRP n 
18 21  LEU n 
18 22  PHE n 
18 23  PRO n 
18 24  ALA n 
18 25  VAL n 
18 26  THR n 
18 27  MET n 
18 28  GLY n 
18 29  LEU n 
18 30  LEU n 
18 31  PHE n 
18 32  ILE n 
18 33  HIS n 
18 34  ILE n 
18 35  GLU n 
18 36  SER n 
18 37  GLU n 
18 38  GLY n 
19 1   ALA n 
19 2   GLN n 
19 3   ALA n 
19 4   SER n 
19 5   PRO n 
19 6   THR n 
19 7   THR n 
19 8   ALA n 
19 9   GLY n 
19 10  TRP n 
19 11  SER n 
19 12  LEU n 
19 13  SER n 
19 14  VAL n 
19 15  GLY n 
19 16  ILE n 
19 17  ILE n 
19 18  MET n 
19 19  CYS n 
19 20  LEU n 
19 21  CYS n 
19 22  ASN n 
19 23  VAL n 
19 24  PHE n 
19 25  ALA n 
19 26  PHE n 
19 27  VAL n 
19 28  ILE n 
19 29  GLY n 
19 30  TYR n 
19 31  PHE n 
19 32  ALA n 
19 33  ILE n 
19 34  GLN n 
19 35  LYS n 
19 36  THR n 
19 37  GLY n 
19 38  LYS n 
19 39  GLY n 
19 40  LYS n 
19 41  ASP n 
19 42  LEU n 
19 43  ALA n 
19 44  LEU n 
19 45  PRO n 
19 46  GLN n 
19 47  LEU n 
19 48  ALA n 
19 49  SER n 
19 50  LYS n 
19 51  LYS n 
19 52  THR n 
19 53  PHE n 
19 54  GLY n 
19 55  LEU n 
19 56  PRO n 
19 57  GLU n 
19 58  LEU n 
19 59  LEU n 
19 60  ALA n 
19 61  THR n 
19 62  MET n 
19 63  SER n 
19 64  PHE n 
19 65  GLY n 
19 66  HIS n 
19 67  ILE n 
19 68  LEU n 
19 69  GLY n 
19 70  ALA n 
19 71  GLY n 
19 72  MET n 
19 73  VAL n 
19 74  LEU n 
19 75  GLY n 
19 76  LEU n 
19 77  ALA n 
19 78  SER n 
19 79  SER n 
20 1   SER n 
20 2   ASN n 
20 3   GLN n 
20 4   VAL n 
20 5   VAL n 
20 6   GLN n 
20 7   ALA n 
20 8   TYR n 
20 9   ASN n 
20 10  GLY n 
20 11  ASP n 
20 12  PRO n 
20 13  PHE n 
20 14  VAL n 
20 15  GLY n 
20 16  HIS n 
20 17  LEU n 
20 18  SER n 
20 19  THR n 
20 20  PRO n 
20 21  ILE n 
20 22  SER n 
20 23  ASP n 
20 24  SER n 
20 25  ALA n 
20 26  PHE n 
20 27  THR n 
20 28  ARG n 
20 29  THR n 
20 30  PHE n 
20 31  ILE n 
20 32  GLY n 
20 33  ASN n 
20 34  LEU n 
20 35  PRO n 
20 36  ALA n 
20 37  TYR n 
20 38  ARG n 
20 39  LYS n 
20 40  GLY n 
20 41  LEU n 
20 42  SER n 
20 43  PRO n 
20 44  ILE n 
20 45  LEU n 
20 46  ARG n 
20 47  GLY n 
20 48  LEU n 
20 49  GLU n 
20 50  VAL n 
20 51  GLY n 
20 52  MET n 
20 53  ALA n 
20 54  HIS n 
20 55  GLY n 
20 56  TYR n 
20 57  PHE n 
20 58  LEU n 
20 59  ILE n 
20 60  GLY n 
20 61  PRO n 
20 62  TRP n 
20 63  THR n 
20 64  LEU n 
20 65  LEU n 
20 66  GLY n 
20 67  PRO n 
20 68  LEU n 
20 69  ARG n 
20 70  ASP n 
20 71  SER n 
20 72  GLU n 
20 73  TYR n 
20 74  GLN n 
20 75  TYR n 
20 76  ILE n 
20 77  GLY n 
20 78  GLY n 
20 79  LEU n 
20 80  ILE n 
20 81  GLY n 
20 82  ALA n 
20 83  LEU n 
20 84  ALA n 
20 85  LEU n 
20 86  ILE n 
20 87  LEU n 
20 88  VAL n 
20 89  ALA n 
20 90  THR n 
20 91  ALA n 
20 92  ALA n 
20 93  LEU n 
20 94  SER n 
20 95  SER n 
20 96  TYR n 
20 97  GLY n 
20 98  LEU n 
20 99  VAL n 
20 100 THR n 
20 101 PHE n 
20 102 GLN n 
20 103 GLY n 
20 104 GLU n 
20 105 GLN n 
20 106 GLY n 
20 107 SER n 
20 108 GLY n 
20 109 ASP n 
20 110 THR n 
20 111 LEU n 
20 112 GLN n 
20 113 THR n 
20 114 ALA n 
20 115 ASP n 
20 116 GLY n 
20 117 TRP n 
20 118 SER n 
20 119 GLN n 
20 120 PHE n 
20 121 ALA n 
20 122 ALA n 
20 123 GLY n 
20 124 PHE n 
20 125 PHE n 
20 126 VAL n 
20 127 GLY n 
20 128 GLY n 
20 129 MET n 
20 130 GLY n 
20 131 GLY n 
20 132 ALA n 
20 133 PHE n 
20 134 VAL n 
20 135 ALA n 
20 136 TYR n 
20 137 PHE n 
20 138 LEU n 
20 139 LEU n 
20 140 GLU n 
20 141 ASN n 
20 142 LEU n 
20 143 SER n 
20 144 VAL n 
20 145 VAL n 
20 146 ASP n 
20 147 GLY n 
20 148 ILE n 
20 149 PHE n 
20 150 ARG n 
20 151 GLY n 
20 152 LEU n 
20 153 PHE n 
20 154 ASN n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 751 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 731 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 80  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 141 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 69  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 143 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 40  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 40  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 80  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 157 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 31  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 729 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 81  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 68  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample 1 78  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample 1 744 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample 1 140 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample 1 38  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample 1 79  ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample 1 154 ? 'Synechocystis sp. PCC 6803' 1148 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP PSAA_SYNY3  P29254 ? 1  
;MTISPPEREAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHL
AVVFVWLSGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYC
TAIGGLVMAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPH
EFILEPSKMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHS
MKEILEAHKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFL
IVGAGAHGAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQP
IFAQWVQHLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSR
LVPDKANLGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAI
TINGWLRDFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSI
IQGRAVGVAHYLLGGIVTTWAFFLARSLSIG
;
1  
2  UNP PSAB_SYNY3  P29255 ? 2  
;MATKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKD
PLNIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPK
FRPSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTA
GHIFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNL
YDTINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVA
NKDNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPD
SIASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPG
RGGTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNL
SVWAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAA
FLIASTAGKFG
;
1  
3  UNP PSAC_SYNY3  P32422 ? 3  
;SHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLAY

;
2  
4  UNP PSAD_SYNY3  P19569 ? 4  
;MTELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKI
QDYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
1  
5  UNP PSAE_SYNY3  P12975 ? 5  ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELVQ 2  
6  UNP PSAF_SYNY3  P29256 ? 6  
;ADDFANLTPCSENPAYLAKSKNFLNTTNDPNSGKIRAERYASALCGPEGYPHLIVDGRFTHAGDFLIPSILFLYIAGWIG
WVGRSYLIEIRESKNPEMQEVVINVPLAIKKMLGGFLWPLAAVGEYTSGKLVMKDSEIPTSPR
;
23 
7  UNP PSAI_SYNY3  Q55330 ? 7  MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEGEG 1  
8  UNP PSAJ_SYNY3  Q55329 ? 8  MDGLKSFLSTAPVMIMALLTFTAGILIEFNRFYPDLLFHP 1  
9  UNP PSAK2_SYNY3 P74564 ? 9  
;LAQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS

;
8  
10 UNP PSAL_SYNY3  P37277 ? 10 
;MAESNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIG
GLIGALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
1  
11 UNP PSAM_SYNY3  P72986 ? 11 MALSDTQILAALVVALLPAFLAFRLSTELYK 1  
12 UNP PSAB_SYNY3  P29255 ? 12 
;TKFPKFSQDLAQDPTTRRIWYGIATAHDFETHDGMTEENLYQKIFASHFGHIAIIFLWTSGTLFHVAWQGNFEQWIKDPL
NIRPIAHAIWDPHFGEGAVNAFTQAGASNPVNIAYSGVYHWFYTIGMTTNQELYSGAVFLLVLASLFLFAGWLHLQPKFR
PSLAWFKNAESRLNHHLAGLFGVSSLAWAGHLVHVAIPEARGQHVGWDNFLSTPPHPAGLMPFFTGNWGVYAADPDTAGH
IFGTSEGAGTAILTFLGGFHPQTESLWLTDIAHHHLAIAVIFIIAGHMYRTNWGIGHSIKEILNAHKGPLTGAGHTNLYD
TINNSLHFQLGLALASLGVITSLVAQHMYSLPSYAFIAQDHTTQAALYTHHQYIAGFLMVGAFAHGAIFFVRDYDPVANK
DNVLARMLEHKEALISHLSWVSLFLGFHTLGLYVHNDVVVAFGTPEKQILIEPVFAQWIQATSGKALYGFDVLLSNPDSI
ASTTGAAWLPGWLDAINSGTNSLFLTIGPGDFLVHHAIALGLHTTALILIKGALDARGSKLMPDKKDFGYSFPCDGPGRG
GTCDISAWDAFYLAMFWMLNTLGWLTFYWHWKHLGVWSGNVAQFNENSTYLMGWFRDYLWANSAQLINGYNPYGVNNLSV
WAWMFLFGHLVWATGFMFLISWRGYWQELIETIVWAHERTPLANLVRWKDKPVALSIVQARLVGLAHFTVGYVLTYAAFL
IASTAGKFG
;
3  
13 UNP PSAC_SYNY3  P32422 ? 13 
;MSHSVKIYDTCIGCTQCVRACPLDVLEMVPWDGCKAAQIASSPRTEDCVGCKRCETACPTDFLSIRVYLGAETTRSMGLA
Y
;
1  
14 UNP PSAE_SYNY3  P12975 ? 14 ALNRGDKVRIKRTESYWYGDVGTVASVEKSGILYPVIVRFDRVNYNGFSGSASGVNTNNFAENELELV 2  
15 UNP PSAK2_SYNY3 P74564 ? 15 AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLAS 9  
16 UNP PSAA_SYNY3  P29254 ? 16 
;REAKAKVSVDNNPVPTSFEKWGKPGHFDRTLARGPKTTTWIWNLHANAHDFDSQTSDLEDVSRKIFSAHFGHLAVVFVWL
SGMYFHGAKFSNYEGWLADPTHIKPSAQVVWPIVGQGILNGDVGGGFHGIQITSGLFYLWRASGFTDSYQLYCTAIGGLV
MAALMLFAGWFHYHVKAPKLEWFQNVESMMNHHLAGLLGLGSLGWAGHQIHVSMPINKLLDAGVAPKDIPLPHEFILEPS
KMAELYPSFAQGLTPFFTLNWGVYSDFLTFKGGLNPVTGGLWLSDTAHHHLAIAVLFIIAGHMYRTNWGIGHSMKEILEA
HKGPFTGEGHKGLYEILTTSWHAQLAINLALLGSLTIIVAQHMYAMPPYPYQAIDYATQLSLFTHHMWIGGFLIVGAGAH
GAIFMVRDYDPAKNVNNLLDRMLRHRDAIISHLNWVCIFLGFHSFGLYIHNDTMRALGRPQDMFSDTAIQLQPIFAQWVQ
HLHTLAPGATAPNALATASYAFGGETIAVAGKVAMMPITLGTADFMVHHIHAFTIHVTALILLKGVLYARSSRLVPDKAN
LGFRFPCDGPGRGGTCQVSGWDHVFLGLFWMYNSLSIVIFHFSWKMQSDVWGTVSPDGSVTHVTLGNFAQSAITINGWLR
DFLWAQAANVINSYGSALSAYGIMFLAGHFVFAFSLMFLFSGRGYWQELIESIVWAHNKLNVAPAIQPRALSIIQGRAVG
VAHYLLGGIVTTWAFFLARSLSIG
;
8  
17 UNP PSAD_SYNY3  P19569 ? 17 
;TELSGQPPKFGGSTGGLLSKANREEKYAITWTSASEQVFEMPTGGAAIMNEGENLLYLARKEQCLALGTQLRTKFKPKIQ
DYKIYRVYPSGEVQYLHPADGVFPEKVNEGREAQGTKTRRIGQNPEPVTIKFSGKAPYEV
;
2  
18 UNP PSAI_SYNY3  Q55330 ? 18 MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEG 1  
19 UNP PSAK2_SYNY3 P74564 ? 19 AQASPTTAGWSLSVGIIMCLCNVFAFVIGYFAIQKTGKGKDLALPQLASKKTFGLPELLATMSFGHILGAGMVLGLASS 9  
20 UNP PSAL_SYNY3  P37277 ? 20 
;SNQVVQAYNGDPFVGHLSTPISDSAFTRTFIGNLPAYRKGLSPILRGLEVGMAHGYFLIGPWTLLGPLRDSEYQYIGGLI
GALALILVATAALSSYGLVTFQGEQGSGDTLQTADGWSQFAAGFFVGGMGGAFVAYFLLENLSVVDGIFRGLFN
;
4  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5OY0 A 1 ? 751 ? P29254 1  ? 751 ? 1 751 
2  2  5OY0 B 1 ? 731 ? P29255 1  ? 731 ? 1 731 
3  3  5OY0 C 1 ? 80  ? P32422 2  ? 81  ? 2 81  
4  4  5OY0 D 1 ? 141 ? P19569 1  ? 141 ? 1 141 
5  5  5OY0 E 1 ? 69  ? P12975 2  ? 70  ? 2 70  
6  6  5OY0 F 1 ? 143 ? P29256 23 ? 165 ? 1 143 
7  7  5OY0 I 1 ? 40  ? Q55330 1  ? 40  ? 1 40  
8  8  5OY0 J 1 ? 40  ? Q55329 1  ? 40  ? 1 40  
9  9  5OY0 K 1 ? 80  ? P74564 8  ? 87  ? 8 87  
10 10 5OY0 L 1 ? 157 ? P37277 1  ? 157 ? 1 157 
11 11 5OY0 M 1 ? 31  ? P72986 1  ? 31  ? 1 31  
12 1  5OY0 a 1 ? 751 ? P29254 1  ? 751 ? 1 751 
13 12 5OY0 b 1 ? 729 ? P29255 3  ? 731 ? 3 731 
14 13 5OY0 c 1 ? 81  ? P32422 1  ? 81  ? 1 81  
15 4  5OY0 d 1 ? 141 ? P19569 1  ? 141 ? 1 141 
16 14 5OY0 e 1 ? 68  ? P12975 2  ? 69  ? 2 69  
17 6  5OY0 f 1 ? 143 ? P29256 23 ? 165 ? 1 143 
18 7  5OY0 i 1 ? 40  ? Q55330 1  ? 40  ? 1 40  
19 8  5OY0 j 1 ? 40  ? Q55329 1  ? 40  ? 1 40  
20 15 5OY0 k 1 ? 78  ? P74564 9  ? 86  ? 9 86  
21 10 5OY0 l 1 ? 157 ? P37277 1  ? 157 ? 1 157 
22 11 5OY0 m 1 ? 31  ? P72986 1  ? 31  ? 1 31  
23 16 5OY0 1 1 ? 744 ? P29254 8  ? 751 ? 8 751 
24 2  5OY0 2 1 ? 731 ? P29255 1  ? 731 ? 1 731 
25 3  5OY0 3 1 ? 80  ? P32422 2  ? 81  ? 2 81  
26 17 5OY0 4 1 ? 140 ? P19569 2  ? 141 ? 2 141 
27 5  5OY0 5 1 ? 69  ? P12975 2  ? 70  ? 2 70  
28 6  5OY0 6 1 ? 143 ? P29256 23 ? 165 ? 1 143 
29 18 5OY0 h 1 ? 38  ? Q55330 1  ? 38  ? 1 38  
30 8  5OY0 7 1 ? 40  ? Q55329 1  ? 40  ? 1 40  
31 19 5OY0 8 1 ? 79  ? P74564 9  ? 87  ? 9 87  
32 20 5OY0 0 1 ? 154 ? P37277 4  ? 157 ? 4 157 
33 11 5OY0 9 1 ? 31  ? P72986 1  ? 31  ? 1 31  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
45D non-polymer         . "beta,beta-carotene-4,4'-dione" 'Isomer of Canthaxanthin'                          'C40 H52 O2'         
564.840 
ACT non-polymer         . 'ACETATE ION' ?                                                  'C2 H3 O2 -1'        59.044  
ALA 'L-peptide linking' y ALANINE ?                                                  'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ?                                                  'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                                                  'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                  'C4 H7 N O4'         133.103 
BCR non-polymer         . BETA-CAROTENE ?                                                  'C40 H56'            536.873 
CA  non-polymer         . 'CALCIUM ION' ?                                                  'Ca 2'               40.078  
CL  non-polymer         . 'CHLORIDE ION' ?                                                  'Cl -1'              35.453  
CLA non-polymer         . 'CHLOROPHYLL A' ?                                                  'C55 H72 Mg N4 O5 2' 893.489 
CYS 'L-peptide linking' y CYSTEINE ?                                                  'C3 H7 N O2 S'       121.158 
DGD saccharide          . 'DIGALACTOSYL DIACYL GLYCEROL (DGDG)' ?                                                  'C51 H96 O15' 
949.299 
ECH non-polymer         . beta,beta-caroten-4-one echinenone                                         'C40 H54 O'          550.856 
EQ3 non-polymer         . "(3'R)-3'-hydroxy-beta,beta-caroten-4-one" 
;3'-Hydroxyechinenone, 3'-OH-Echinenone
;
'C40 H54 O2'         566.856 
GLN 'L-peptide linking' y GLUTAMINE ?                                                  'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                  'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ?                                                  'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ?                                                  'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ?                                                  'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                                                  'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ?                                                  'C6 H13 N O2'        131.173 
LHG non-polymer         . 1,2-DIPALMITOYL-PHOSPHATIDYL-GLYCEROLE ?                                                  
'C38 H75 O10 P'      722.970 
LMG non-polymer         . 1,2-DISTEAROYL-MONOGALACTOSYL-DIGLYCERIDE ?                                                  
'C45 H86 O10'        787.158 
LMT D-saccharide        . DODECYL-BETA-D-MALTOSIDE ?                                                  'C24 H46 O11'        510.615 
LYS 'L-peptide linking' y LYSINE ?                                                  'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE ?                                                  'C5 H11 N O2 S'      149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                                                  'Mg 2'               24.305  
PHE 'L-peptide linking' y PHENYLALANINE ?                                                  'C9 H11 N O2'        165.189 
PQN non-polymer         . PHYLLOQUINONE 'VITAMIN K1; 2-METHYL-3-PHYTYL-1,4-NAPHTHOQUINONE' 'C31 H46 O2'         450.696 
PRO 'L-peptide linking' y PROLINE ?                                                  'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE ?                                                  'C3 H7 N O3'         105.093 
SF4 non-polymer         . 'IRON/SULFUR CLUSTER' ?                                                  'Fe4 S4'             351.640 
SQD non-polymer         . '1,2-DI-O-ACYL-3-O-[6-DEOXY-6-SULFO-ALPHA-D-GLUCOPYRANOSYL]-SN-GLYCEROL' SULFOQUINOVOSYLDIACYLGLYCEROL 
'C41 H78 O12 S'      795.116 
THR 'L-peptide linking' y THREONINE ?                                                  'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                                                  'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ?                                                  'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ?                                                  'C5 H11 N O2'        117.146 
ZEX non-polymer         . 
;(1R,2S)-4-{(1E,3E,5E,7E,9E,11E,13E,15E,17E)-18-[(4S)-4-hydroxy-2,6,6-trimethylcyclohex-1-en-1-yl]-3,7,12,16-tetramethyloctadeca-1,3,5,7,9,11,13,15,17-nonaen-1-yl}-2,5,5-trimethylcyclohex-3-en-1-ol
;
?                                                  'C40 H56 O2'         568.871 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5OY0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.22 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         44.65 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG 3350, magnesium chloride, tricine, glycine, magnesium acetate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           77 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 2M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.999 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X06DA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.999 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X06DA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5OY0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.5 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       395994 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  23.3 
_reflns.pdbx_Rmerge_I_obs                0.078 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.5 
_reflns_shell.d_res_low                   2.54 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             21.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5OY0 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     395994 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.481 
_refine.ls_d_res_high                            2.501 
_refine.ls_percent_reflns_obs                    99.44 
_refine.ls_R_factor_obs                          0.2283 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2276 
_refine.ls_R_factor_R_free                       0.2644 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 1.99 
_refine.ls_number_reflns_R_free                  7881 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.44 
_refine.pdbx_overall_phase_error                 31.11 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        52782 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         23440 
_refine_hist.number_atoms_solvent             889 
_refine_hist.number_atoms_total               77111 
_refine_hist.d_res_high                       2.501 
_refine_hist.d_res_low                        49.481 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 80232  'X-RAY DIFFRACTION' ? 
f_angle_d          1.412  ? ? 112844 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 25.833 ? ? 32578  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.063  ? ? 9961   'X-RAY DIFFRACTION' ? 
f_plane_restr      0.018  ? ? 13267  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.5008 2.5292  12420 0.3569 96.00  0.3882 . . 265 . . 
'X-RAY DIFFRACTION' . 2.5292 2.5590  12724 0.3424 98.00  0.3560 . . 250 . . 
'X-RAY DIFFRACTION' . 2.5590 2.5902  12773 0.3440 99.00  0.3733 . . 280 . . 
'X-RAY DIFFRACTION' . 2.5902 2.6230  12791 0.3402 99.00  0.3581 . . 273 . . 
'X-RAY DIFFRACTION' . 2.6230 2.6575  12866 0.3451 99.00  0.4168 . . 269 . . 
'X-RAY DIFFRACTION' . 2.6575 2.6939  12928 0.3378 100.00 0.3443 . . 264 . . 
'X-RAY DIFFRACTION' . 2.6939 2.7324  12840 0.3261 100.00 0.3701 . . 267 . . 
'X-RAY DIFFRACTION' . 2.7324 2.7732  12904 0.3175 100.00 0.3457 . . 268 . . 
'X-RAY DIFFRACTION' . 2.7732 2.8165  12959 0.3132 100.00 0.3669 . . 257 . . 
'X-RAY DIFFRACTION' . 2.8165 2.8627  12924 0.3059 100.00 0.3344 . . 265 . . 
'X-RAY DIFFRACTION' . 2.8627 2.9120  12996 0.3018 100.00 0.3416 . . 235 . . 
'X-RAY DIFFRACTION' . 2.9120 2.9650  12905 0.2948 100.00 0.3403 . . 260 . . 
'X-RAY DIFFRACTION' . 2.9650 3.0220  12927 0.2925 100.00 0.3587 . . 263 . . 
'X-RAY DIFFRACTION' . 3.0220 3.0837  13012 0.2828 100.00 0.3102 . . 231 . . 
'X-RAY DIFFRACTION' . 3.0837 3.1507  12967 0.2710 100.00 0.3065 . . 251 . . 
'X-RAY DIFFRACTION' . 3.1507 3.2240  12933 0.2685 100.00 0.3033 . . 292 . . 
'X-RAY DIFFRACTION' . 3.2240 3.3046  12893 0.2552 100.00 0.2837 . . 305 . . 
'X-RAY DIFFRACTION' . 3.3046 3.3939  12916 0.2513 100.00 0.3121 . . 291 . . 
'X-RAY DIFFRACTION' . 3.3939 3.4938  12894 0.2451 100.00 0.2955 . . 282 . . 
'X-RAY DIFFRACTION' . 3.4938 3.6065  13009 0.2268 100.00 0.2773 . . 265 . . 
'X-RAY DIFFRACTION' . 3.6065 3.7353  12909 0.2213 100.00 0.2602 . . 281 . . 
'X-RAY DIFFRACTION' . 3.7353 3.8848  12927 0.2105 100.00 0.2463 . . 283 . . 
'X-RAY DIFFRACTION' . 3.8848 4.0616  12929 0.2009 99.00  0.2434 . . 265 . . 
'X-RAY DIFFRACTION' . 4.0616 4.2756  12964 0.1856 100.00 0.2163 . . 261 . . 
'X-RAY DIFFRACTION' . 4.2756 4.5433  12982 0.1797 100.00 0.2231 . . 277 . . 
'X-RAY DIFFRACTION' . 4.5433 4.8938  13046 0.1752 100.00 0.1965 . . 259 . . 
'X-RAY DIFFRACTION' . 4.8938 5.3858  13034 0.1818 100.00 0.2487 . . 267 . . 
'X-RAY DIFFRACTION' . 5.3858 6.1638  13102 0.1955 100.00 0.2180 . . 232 . . 
'X-RAY DIFFRACTION' . 6.1638 7.7609  13221 0.1775 100.00 0.1812 . . 214 . . 
'X-RAY DIFFRACTION' . 7.7609 49.4910 13418 0.2168 100.00 0.2461 . . 209 . . 
# 
_struct.entry_id                     5OY0 
_struct.title                        'Structure of synechocystis photosystem I trimer at 2.5A resolution' 
_struct.pdbx_descriptor              
;Photosystem I P700 chlorophyll a apoprotein A1 (E.C.1.97.1.12), Photosystem I P700 chlorophyll a apoprotein A2 (E.C.1.97.1.12), Photosystem I iron-sulfur center (E.C.1.97.1.12), Photosystem I reaction center subunit II, Photosystem I reaction center subunit IV, Photosystem I reaction center subunit III, Photosystem I reaction center subunit VIII, Photosystem I reaction center subunit IX, Photosystem I reaction center subunit PsaK 2, Photosystem I reaction center subunit XI, Photosystem I reaction center subunit XII
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5OY0 
_struct_keywords.text            
'photosystem I, reaction center, photosynthesis, cyanobacteria, electron transfer chain, synechocystis' 
_struct_keywords.pdbx_keywords   PHOTOSYNTHESIS 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 1  ? 
M  N N 12 ? 
N  N N 13 ? 
O  N N 4  ? 
P  N N 14 ? 
Q  N N 6  ? 
R  N N 7  ? 
S  N N 8  ? 
T  N N 15 ? 
U  N N 10 ? 
V  N N 11 ? 
W  N N 16 ? 
X  N N 2  ? 
Y  N N 3  ? 
Z  N N 17 ? 
AA N N 5  ? 
BA N N 6  ? 
CA N N 18 ? 
DA N N 8  ? 
EA N N 19 ? 
FA N N 20 ? 
GA N N 11 ? 
HA N N 21 ? 
IA N N 21 ? 
JA N N 21 ? 
KA N N 21 ? 
LA N N 21 ? 
MA N N 21 ? 
NA N N 21 ? 
OA N N 21 ? 
PA N N 21 ? 
QA N N 21 ? 
RA N N 21 ? 
SA N N 21 ? 
TA N N 21 ? 
UA N N 21 ? 
VA N N 21 ? 
WA N N 21 ? 
XA N N 21 ? 
YA N N 21 ? 
ZA N N 21 ? 
AB N N 21 ? 
BB N N 21 ? 
CB N N 21 ? 
DB N N 21 ? 
EB N N 21 ? 
FB N N 21 ? 
GB N N 21 ? 
HB N N 21 ? 
IB N N 21 ? 
JB N N 21 ? 
KB N N 21 ? 
LB N N 21 ? 
MB N N 21 ? 
NB N N 21 ? 
OB N N 21 ? 
PB N N 21 ? 
QB N N 21 ? 
RB N N 21 ? 
SB N N 21 ? 
TB N N 21 ? 
UB N N 21 ? 
VB N N 22 ? 
WB N N 23 ? 
XB N N 24 ? 
YB N N 24 ? 
ZB N N 24 ? 
AC N N 24 ? 
BC N N 24 ? 
CC N N 24 ? 
DC N N 25 ? 
EC N N 26 ? 
FC N N 25 ? 
GC N N 26 ? 
HC N N 27 ? 
IC N N 21 ? 
JC N N 21 ? 
KC N N 24 ? 
LC N N 26 ? 
MC N N 21 ? 
NC N N 25 ? 
OC N N 25 ? 
PC N N 25 ? 
QC N N 21 ? 
RC N N 21 ? 
SC N N 21 ? 
TC N N 28 ? 
UC N N 29 ? 
VC N N 21 ? 
WC N N 21 ? 
XC N N 21 ? 
YC N N 21 ? 
ZC N N 21 ? 
AD N N 21 ? 
BD N N 21 ? 
CD N N 21 ? 
DD N N 21 ? 
ED N N 21 ? 
FD N N 21 ? 
GD N N 21 ? 
HD N N 21 ? 
ID N N 21 ? 
JD N N 21 ? 
KD N N 21 ? 
LD N N 21 ? 
MD N N 21 ? 
ND N N 21 ? 
OD N N 21 ? 
PD N N 21 ? 
QD N N 21 ? 
RD N N 21 ? 
SD N N 21 ? 
TD N N 21 ? 
UD N N 21 ? 
VD N N 21 ? 
WD N N 21 ? 
XD N N 21 ? 
YD N N 21 ? 
ZD N N 21 ? 
AE N N 21 ? 
BE N N 21 ? 
CE N N 21 ? 
DE N N 21 ? 
EE N N 21 ? 
FE N N 21 ? 
GE N N 21 ? 
HE N N 22 ? 
IE N N 24 ? 
JE N N 24 ? 
KE N N 30 ? 
LE N N 24 ? 
ME N N 24 ? 
NE N N 24 ? 
OE N N 26 ? 
PE N N 25 ? 
QE N N 26 ? 
RE N N 25 ? 
SE N N 31 ? 
TE N N 32 ? 
UE N N 33 ? 
VE N N 27 ? 
WE N N 24 ? 
XE N N 21 ? 
YE N N 21 ? 
ZE N N 27 ? 
AF N N 23 ? 
BF N N 23 ? 
CF N N 25 ? 
DF N N 21 ? 
EF N N 21 ? 
FF N N 34 ? 
GF N N 31 ? 
HF N N 35 ? 
IF N N 24 ? 
JF N N 36 ? 
KF N N 34 ? 
LF N N 21 ? 
MF N N 21 ? 
NF N N 24 ? 
OF N N 21 ? 
PF N N 21 ? 
QF N N 24 ? 
RF N N 26 ? 
SF N N 32 ? 
TF N N 21 ? 
UF N N 21 ? 
VF N N 21 ? 
WF N N 24 ? 
XF N N 24 ? 
YF N N 31 ? 
ZF N N 37 ? 
AG N N 25 ? 
BG N N 35 ? 
CG N N 31 ? 
DG N N 30 ? 
EG N N 25 ? 
FG N N 21 ? 
GG N N 21 ? 
HG N N 21 ? 
IG N N 21 ? 
JG N N 21 ? 
KG N N 21 ? 
LG N N 21 ? 
MG N N 21 ? 
NG N N 21 ? 
OG N N 21 ? 
PG N N 21 ? 
QG N N 21 ? 
RG N N 21 ? 
SG N N 21 ? 
TG N N 21 ? 
UG N N 21 ? 
VG N N 21 ? 
WG N N 21 ? 
XG N N 21 ? 
YG N N 21 ? 
ZG N N 21 ? 
AH N N 21 ? 
BH N N 21 ? 
CH N N 21 ? 
DH N N 21 ? 
EH N N 21 ? 
FH N N 21 ? 
GH N N 21 ? 
HH N N 21 ? 
IH N N 21 ? 
JH N N 21 ? 
KH N N 21 ? 
LH N N 21 ? 
MH N N 21 ? 
NH N N 21 ? 
OH N N 21 ? 
PH N N 21 ? 
QH N N 21 ? 
RH N N 21 ? 
SH N N 22 ? 
TH N N 23 ? 
UH N N 24 ? 
VH N N 24 ? 
WH N N 24 ? 
XH N N 24 ? 
YH N N 24 ? 
ZH N N 24 ? 
AI N N 25 ? 
BI N N 26 ? 
CI N N 25 ? 
DI N N 26 ? 
EI N N 25 ? 
FI N N 27 ? 
GI N N 21 ? 
HI N N 21 ? 
II N N 21 ? 
JI N N 24 ? 
KI N N 21 ? 
LI N N 25 ? 
MI N N 21 ? 
NI N N 21 ? 
OI N N 21 ? 
PI N N 30 ? 
QI N N 29 ? 
RI N N 21 ? 
SI N N 21 ? 
TI N N 21 ? 
UI N N 21 ? 
VI N N 21 ? 
WI N N 21 ? 
XI N N 21 ? 
YI N N 21 ? 
ZI N N 21 ? 
AJ N N 21 ? 
BJ N N 21 ? 
CJ N N 21 ? 
DJ N N 21 ? 
EJ N N 21 ? 
FJ N N 21 ? 
GJ N N 21 ? 
HJ N N 21 ? 
IJ N N 21 ? 
JJ N N 21 ? 
KJ N N 21 ? 
LJ N N 21 ? 
MJ N N 21 ? 
NJ N N 21 ? 
OJ N N 21 ? 
PJ N N 21 ? 
QJ N N 21 ? 
RJ N N 21 ? 
SJ N N 21 ? 
TJ N N 21 ? 
UJ N N 21 ? 
VJ N N 21 ? 
WJ N N 21 ? 
XJ N N 21 ? 
YJ N N 21 ? 
ZJ N N 21 ? 
AK N N 21 ? 
BK N N 21 ? 
CK N N 21 ? 
DK N N 22 ? 
EK N N 24 ? 
FK N N 24 ? 
GK N N 30 ? 
HK N N 24 ? 
IK N N 24 ? 
JK N N 24 ? 
KK N N 26 ? 
LK N N 25 ? 
MK N N 26 ? 
NK N N 31 ? 
OK N N 26 ? 
PK N N 32 ? 
QK N N 33 ? 
RK N N 24 ? 
SK N N 21 ? 
TK N N 21 ? 
UK N N 23 ? 
VK N N 23 ? 
WK N N 21 ? 
XK N N 21 ? 
YK N N 24 ? 
ZK N N 31 ? 
AL N N 24 ? 
BL N N 30 ? 
CL N N 24 ? 
DL N N 34 ? 
EL N N 21 ? 
FL N N 21 ? 
GL N N 21 ? 
HL N N 21 ? 
IL N N 24 ? 
JL N N 32 ? 
KL N N 21 ? 
LL N N 21 ? 
ML N N 21 ? 
NL N N 24 ? 
OL N N 24 ? 
PL N N 25 ? 
QL N N 25 ? 
RL N N 25 ? 
SL N N 35 ? 
TL N N 25 ? 
UL N N 30 ? 
VL N N 25 ? 
WL N N 25 ? 
XL N N 21 ? 
YL N N 21 ? 
ZL N N 21 ? 
AM N N 21 ? 
BM N N 21 ? 
CM N N 21 ? 
DM N N 21 ? 
EM N N 21 ? 
FM N N 21 ? 
GM N N 21 ? 
HM N N 21 ? 
IM N N 21 ? 
JM N N 21 ? 
KM N N 21 ? 
LM N N 21 ? 
MM N N 21 ? 
NM N N 21 ? 
OM N N 21 ? 
PM N N 21 ? 
QM N N 21 ? 
RM N N 21 ? 
SM N N 21 ? 
TM N N 21 ? 
UM N N 21 ? 
VM N N 21 ? 
WM N N 21 ? 
XM N N 21 ? 
YM N N 21 ? 
ZM N N 21 ? 
AN N N 21 ? 
BN N N 21 ? 
CN N N 21 ? 
DN N N 21 ? 
EN N N 21 ? 
FN N N 21 ? 
GN N N 21 ? 
HN N N 21 ? 
IN N N 21 ? 
JN N N 21 ? 
KN N N 21 ? 
LN N N 22 ? 
MN N N 23 ? 
NN N N 24 ? 
ON N N 24 ? 
PN N N 24 ? 
QN N N 24 ? 
RN N N 24 ? 
SN N N 24 ? 
TN N N 25 ? 
UN N N 26 ? 
VN N N 25 ? 
WN N N 26 ? 
XN N N 35 ? 
YN N N 21 ? 
ZN N N 21 ? 
AO N N 21 ? 
BO N N 24 ? 
CO N N 21 ? 
DO N N 21 ? 
EO N N 21 ? 
FO N N 24 ? 
GO N N 29 ? 
HO N N 21 ? 
IO N N 21 ? 
JO N N 21 ? 
KO N N 21 ? 
LO N N 21 ? 
MO N N 21 ? 
NO N N 21 ? 
OO N N 21 ? 
PO N N 21 ? 
QO N N 21 ? 
RO N N 21 ? 
SO N N 21 ? 
TO N N 21 ? 
UO N N 21 ? 
VO N N 21 ? 
WO N N 21 ? 
XO N N 21 ? 
YO N N 21 ? 
ZO N N 21 ? 
AP N N 21 ? 
BP N N 21 ? 
CP N N 21 ? 
DP N N 21 ? 
EP N N 21 ? 
FP N N 21 ? 
GP N N 21 ? 
HP N N 21 ? 
IP N N 21 ? 
JP N N 21 ? 
KP N N 21 ? 
LP N N 21 ? 
MP N N 21 ? 
NP N N 21 ? 
OP N N 21 ? 
PP N N 21 ? 
QP N N 21 ? 
RP N N 21 ? 
SP N N 21 ? 
TP N N 21 ? 
UP N N 22 ? 
VP N N 24 ? 
WP N N 24 ? 
XP N N 30 ? 
YP N N 24 ? 
ZP N N 24 ? 
AQ N N 24 ? 
BQ N N 26 ? 
CQ N N 25 ? 
DQ N N 26 ? 
EQ N N 32 ? 
FQ N N 24 ? 
GQ N N 21 ? 
HQ N N 23 ? 
IQ N N 23 ? 
JQ N N 21 ? 
KQ N N 21 ? 
LQ N N 24 ? 
MQ N N 25 ? 
NQ N N 28 ? 
OQ N N 24 ? 
PQ N N 24 ? 
QQ N N 34 ? 
RQ N N 21 ? 
SQ N N 21 ? 
TQ N N 21 ? 
UQ N N 21 ? 
VQ N N 24 ? 
WQ N N 25 ? 
XQ N N 25 ? 
YQ N N 32 ? 
ZQ N N 21 ? 
AR N N 21 ? 
BR N N 21 ? 
CR N N 24 ? 
DR N N 24 ? 
ER N N 26 ? 
FR N N 31 ? 
GR N N 35 ? 
HR N N 24 ? 
IR N N 38 ? 
JR N N 38 ? 
KR N N 38 ? 
LR N N 38 ? 
MR N N 38 ? 
NR N N 38 ? 
OR N N 38 ? 
PR N N 38 ? 
QR N N 38 ? 
RR N N 38 ? 
SR N N 38 ? 
TR N N 38 ? 
UR N N 38 ? 
VR N N 38 ? 
WR N N 38 ? 
XR N N 38 ? 
YR N N 38 ? 
ZR N N 38 ? 
AS N N 38 ? 
BS N N 38 ? 
CS N N 38 ? 
DS N N 38 ? 
ES N N 38 ? 
FS N N 38 ? 
GS N N 38 ? 
HS N N 38 ? 
IS N N 38 ? 
JS N N 38 ? 
KS N N 38 ? 
LS N N 38 ? 
MS N N 38 ? 
NS N N 38 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 PHE A  25  ? LYS A  30  ? PHE A 25  LYS A 30  5 ? 6  
HELX_P HELX_P2   AA2 ASP A  35  ? ARG A  40  ? ASP A 35  ARG A 40  1 ? 6  
HELX_P HELX_P3   AA3 THR A  45  ? ASN A  54  ? THR A 45  ASN A 54  1 ? 10 
HELX_P HELX_P4   AA4 ASP A  57  ? THR A  62  ? ASP A 57  THR A 62  1 ? 6  
HELX_P HELX_P5   AA5 ASP A  64  ? PHE A  97  ? ASP A 64  PHE A 97  1 ? 34 
HELX_P HELX_P6   AA6 ASN A  99  ? ASP A  106 ? ASN A 99  ASP A 106 1 ? 8  
HELX_P HELX_P7   AA7 GLY A  122 ? ASN A  127 ? GLY A 122 ASN A 127 5 ? 6  
HELX_P HELX_P8   AA8 GLY A  142 ? GLY A  151 ? GLY A 142 GLY A 151 1 ? 10 
HELX_P HELX_P9   AA9 ASP A  154 ? VAL A  182 ? ASP A 154 VAL A 182 1 ? 29 
HELX_P HELX_P10  AB1 LYS A  186 ? GLN A  191 ? LYS A 186 GLN A 191 1 ? 6  
HELX_P HELX_P11  AB2 ASN A  192 ? GLY A  203 ? ASN A 192 GLY A 203 1 ? 12 
HELX_P HELX_P12  AB3 LEU A  205 ? VAL A  219 ? LEU A 205 VAL A 219 1 ? 15 
HELX_P HELX_P13  AB4 VAL A  219 ? ALA A  229 ? VAL A 219 ALA A 229 1 ? 11 
HELX_P HELX_P14  AB5 HIS A  240 ? GLU A  245 ? HIS A 240 GLU A 245 1 ? 6  
HELX_P HELX_P15  AB6 GLU A  245 ? TYR A  253 ? GLU A 245 TYR A 253 1 ? 9  
HELX_P HELX_P16  AB7 PRO A  254 ? GLN A  258 ? PRO A 254 GLN A 258 5 ? 5  
HELX_P HELX_P17  AB8 LEU A  260 ? THR A  265 ? LEU A 260 THR A 265 1 ? 6  
HELX_P HELX_P18  AB9 ASN A  267 ? PHE A  274 ? ASN A 267 PHE A 274 5 ? 8  
HELX_P HELX_P19  AC1 TRP A  289 ? GLY A  308 ? TRP A 289 GLY A 308 1 ? 20 
HELX_P HELX_P20  AC2 SER A  320 ? HIS A  328 ? SER A 320 HIS A 328 1 ? 9  
HELX_P HELX_P21  AC3 GLY A  339 ? SER A  347 ? GLY A 339 SER A 347 1 ? 9  
HELX_P HELX_P22  AC4 SER A  347 ? MET A  373 ? SER A 347 MET A 373 1 ? 27 
HELX_P HELX_P23  AC5 ASP A  382 ? ASP A  415 ? ASP A 382 ASP A 415 1 ? 34 
HELX_P HELX_P24  AC6 ASP A  417 ? ASN A  421 ? ASP A 417 ASN A 421 5 ? 5  
HELX_P HELX_P25  AC7 ASN A  424 ? HIS A  432 ? ASN A 424 HIS A 432 1 ? 9  
HELX_P HELX_P26  AC8 HIS A  432 ? HIS A  450 ? HIS A 432 HIS A 450 1 ? 19 
HELX_P HELX_P27  AC9 SER A  451 ? LEU A  464 ? SER A 451 LEU A 464 1 ? 14 
HELX_P HELX_P28  AD1 ARG A  466 ? MET A  470 ? ARG A 466 MET A 470 5 ? 5  
HELX_P HELX_P29  AD2 PRO A  480 ? ALA A  493 ? PRO A 480 ALA A 493 1 ? 14 
HELX_P HELX_P30  AD3 PRO A  494 ? ALA A  496 ? PRO A 494 ALA A 496 5 ? 3  
HELX_P HELX_P31  AD4 SER A  506 ? GLY A  510 ? SER A 506 GLY A 510 5 ? 5  
HELX_P HELX_P32  AD5 GLY A  528 ? TYR A  555 ? GLY A 528 TYR A 555 1 ? 28 
HELX_P HELX_P33  AD6 ASP A  564 ? GLY A  569 ? ASP A 564 GLY A 569 1 ? 6  
HELX_P HELX_P34  AD7 SER A  586 ? VAL A  617 ? SER A 586 VAL A 617 1 ? 32 
HELX_P HELX_P35  AD8 ASN A  634 ? ALA A  639 ? ASN A 634 ALA A 639 1 ? 6  
HELX_P HELX_P36  AD9 THR A  641 ? ASP A  648 ? THR A 641 ASP A 648 1 ? 8  
HELX_P HELX_P37  AE1 PHE A  649 ? ALA A  654 ? PHE A 649 ALA A 654 1 ? 6  
HELX_P HELX_P38  AE2 ALA A  654 ? ASN A  659 ? ALA A 654 ASN A 659 1 ? 6  
HELX_P HELX_P39  AE3 LEU A  665 ? SER A  688 ? LEU A 665 SER A 688 1 ? 24 
HELX_P HELX_P40  AE4 GLY A  689 ? LEU A  707 ? GLY A 689 LEU A 707 1 ? 19 
HELX_P HELX_P41  AE5 SER A  719 ? SER A  749 ? SER A 719 SER A 749 1 ? 31 
HELX_P HELX_P42  AE6 SER B  9   ? GLN B  14  ? SER B 9   GLN B 14  1 ? 6  
HELX_P HELX_P43  AE7 THR B  18  ? THR B  27  ? THR B 18  THR B 27  1 ? 10 
HELX_P HELX_P44  AE8 ASP B  30  ? HIS B  34  ? ASP B 30  HIS B 34  5 ? 5  
HELX_P HELX_P45  AE9 THR B  38  ? GLY B  72  ? THR B 38  GLY B 72  1 ? 35 
HELX_P HELX_P46  AF1 ASN B  73  ? ASP B  80  ? ASN B 73  ASP B 80  1 ? 8  
HELX_P HELX_P47  AF2 GLY B  97  ? THR B  105 ? GLY B 97  THR B 105 1 ? 9  
HELX_P HELX_P48  AF3 GLY B  119 ? GLY B  128 ? GLY B 119 GLY B 128 1 ? 10 
HELX_P HELX_P49  AF4 THR B  131 ? HIS B  156 ? THR B 131 HIS B 156 1 ? 26 
HELX_P HELX_P50  AF5 SER B  164 ? LYS B  169 ? SER B 164 LYS B 169 1 ? 6  
HELX_P HELX_P51  AF6 ASN B  170 ? GLY B  181 ? ASN B 170 GLY B 181 1 ? 12 
HELX_P HELX_P52  AF7 PHE B  183 ? VAL B  197 ? PHE B 183 VAL B 197 1 ? 15 
HELX_P HELX_P53  AF8 VAL B  197 ? ALA B  202 ? VAL B 197 ALA B 202 1 ? 6  
HELX_P HELX_P54  AF9 LEU B  222 ? THR B  227 ? LEU B 222 THR B 227 1 ? 6  
HELX_P HELX_P55  AG1 TRP B  230 ? ALA B  234 ? TRP B 230 ALA B 234 5 ? 5  
HELX_P HELX_P56  AG2 TRP B  269 ? GLY B  288 ? TRP B 269 GLY B 288 1 ? 20 
HELX_P HELX_P57  AG3 SER B  300 ? ALA B  307 ? SER B 300 ALA B 307 1 ? 8  
HELX_P HELX_P58  AG4 ASN B  319 ? ASN B  326 ? ASN B 319 ASN B 326 1 ? 8  
HELX_P HELX_P59  AG5 SER B  327 ? TYR B  351 ? SER B 327 TYR B 351 1 ? 25 
HELX_P HELX_P60  AG6 ASP B  362 ? ASP B  395 ? ASP B 362 ASP B 395 1 ? 34 
HELX_P HELX_P61  AG7 ASN B  404 ? HIS B  412 ? ASN B 404 HIS B 412 1 ? 9  
HELX_P HELX_P62  AG8 HIS B  412 ? PHE B  444 ? HIS B 412 PHE B 444 1 ? 33 
HELX_P HELX_P63  AG9 THR B  446 ? GLN B  450 ? THR B 446 GLN B 450 5 ? 5  
HELX_P HELX_P64  AH1 PRO B  455 ? SER B  465 ? PRO B 455 SER B 465 1 ? 11 
HELX_P HELX_P65  AH2 VAL B  474 ? ASN B  478 ? VAL B 474 ASN B 478 5 ? 5  
HELX_P HELX_P66  AH3 TRP B  490 ? ASN B  499 ? TRP B 490 ASN B 499 1 ? 10 
HELX_P HELX_P67  AH4 GLY B  510 ? ASP B  537 ? GLY B 510 ASP B 537 1 ? 28 
HELX_P HELX_P68  AH5 ASP B  546 ? GLY B  551 ? ASP B 546 GLY B 551 5 ? 6  
HELX_P HELX_P69  AH6 SER B  568 ? GLY B  601 ? SER B 568 GLY B 601 1 ? 34 
HELX_P HELX_P70  AH7 VAL B  603 ? SER B  610 ? VAL B 603 SER B 610 1 ? 8  
HELX_P HELX_P71  AH8 TYR B  612 ? TYR B  620 ? TYR B 612 TYR B 620 1 ? 9  
HELX_P HELX_P72  AH9 TRP B  622 ? ALA B  626 ? TRP B 622 ALA B 626 5 ? 5  
HELX_P HELX_P73  AI1 GLN B  627 ? ASN B  630 ? GLN B 627 ASN B 630 5 ? 4  
HELX_P HELX_P74  AI2 LEU B  640 ? SER B  663 ? LEU B 640 SER B 663 1 ? 24 
HELX_P HELX_P75  AI3 TRP B  664 ? ARG B  681 ? TRP B 664 ARG B 681 1 ? 18 
HELX_P HELX_P76  AI4 LEU B  684 ? VAL B  688 ? LEU B 684 VAL B 688 5 ? 5  
HELX_P HELX_P77  AI5 SER B  698 ? PHE B  730 ? SER B 698 PHE B 730 1 ? 33 
HELX_P HELX_P78  AI6 THR C  14  ? CYS C  20  ? THR C 15  CYS C 21  1 ? 7  
HELX_P HELX_P79  AI7 ARG C  43  ? CYS C  47  ? ARG C 44  CYS C 48  5 ? 5  
HELX_P HELX_P80  AI8 LYS C  51  ? CYS C  57  ? LYS C 52  CYS C 58  1 ? 7  
HELX_P HELX_P81  AI9 LEU D  19  ? GLU D  25  ? LEU D 19  GLU D 25  1 ? 7  
HELX_P HELX_P82  AJ1 ARG D  61  ? LYS D  75  ? ARG D 61  LYS D 75  1 ? 15 
HELX_P HELX_P83  AJ2 ARG D  121 ? ASN D  125 ? ARG D 121 ASN D 125 5 ? 5  
HELX_P HELX_P84  AJ3 GLU D  127 ? LYS D  132 ? GLU D 127 LYS D 132 5 ? 6  
HELX_P HELX_P85  AJ4 ALA E  61  ? ASN E  63  ? ALA E 62  ASN E 64  5 ? 3  
HELX_P HELX_P86  AJ5 ASN F  13  ? LYS F  21  ? ASN F 13  LYS F 21  1 ? 9  
HELX_P HELX_P87  AJ6 ASN F  31  ? ALA F  41  ? ASN F 31  ALA F 41  1 ? 11 
HELX_P HELX_P88  AJ7 ARG F  58  ? ASP F  64  ? ARG F 58  ASP F 64  5 ? 7  
HELX_P HELX_P89  AJ8 PHE F  65  ? GLU F  92  ? PHE F 65  GLU F 92  1 ? 28 
HELX_P HELX_P90  AJ9 ASN F  95  ? VAL F  102 ? ASN F 95  VAL F 102 1 ? 8  
HELX_P HELX_P91  AK1 ASN F  104 ? GLY F  114 ? ASN F 104 GLY F 114 1 ? 11 
HELX_P HELX_P92  AK2 LEU F  117 ? SER F  128 ? LEU F 117 SER F 128 1 ? 12 
HELX_P HELX_P93  AK3 LYS F  134 ? ILE F  138 ? LYS F 134 ILE F 138 5 ? 5  
HELX_P HELX_P94  AK4 SER G  8   ? TRP G  20  ? SER I 8   TRP I 20  1 ? 13 
HELX_P HELX_P95  AK5 TRP G  20  ? GLU G  35  ? TRP I 20  GLU I 35  1 ? 16 
HELX_P HELX_P96  AK6 ASP H  2   ? SER H  9   ? ASP J 2   SER J 9   1 ? 8  
HELX_P HELX_P97  AK7 THR H  10  ? TYR H  33  ? THR J 10  TYR J 33  1 ? 24 
HELX_P HELX_P98  AK8 ILE I  18  ? PHE I  32  ? ILE K 25  PHE K 39  1 ? 15 
HELX_P HELX_P99  AK9 GLY I  55  ? ALA I  78  ? GLY K 62  ALA K 85  1 ? 24 
HELX_P HELX_P100 AL1 ASN J  12  ? ASP J  14  ? ASN L 12  ASP L 14  5 ? 3  
HELX_P HELX_P101 AL2 THR J  22  ? SER J  27  ? THR L 22  SER L 27  1 ? 6  
HELX_P HELX_P102 AL3 SER J  27  ? GLY J  35  ? SER L 27  GLY L 35  1 ? 9  
HELX_P HELX_P103 AL4 SER J  45  ? ILE J  62  ? SER L 45  ILE L 62  1 ? 18 
HELX_P HELX_P104 AL5 ILE J  62  ? GLY J  69  ? ILE L 62  GLY L 69  1 ? 8  
HELX_P HELX_P105 AL6 PRO J  70  ? SER J  74  ? PRO L 70  SER L 74  5 ? 5  
HELX_P HELX_P106 AL7 TYR J  76  ? PHE J  104 ? TYR L 76  PHE L 104 1 ? 29 
HELX_P HELX_P107 AL8 THR J  116 ? ASN J  144 ? THR L 116 ASN L 144 1 ? 29 
HELX_P HELX_P108 AL9 ASN J  144 ? GLY J  154 ? ASN L 144 GLY L 154 1 ? 11 
HELX_P HELX_P109 AM1 SER K  4   ? TYR K  30  ? SER M 4   TYR M 30  1 ? 27 
HELX_P HELX_P110 AM2 PHE L  25  ? GLY L  29  ? PHE a 25  GLY a 29  5 ? 5  
HELX_P HELX_P111 AM3 ASP L  35  ? ARG L  40  ? ASP a 35  ARG a 40  1 ? 6  
HELX_P HELX_P112 AM4 THR L  45  ? ASN L  54  ? THR a 45  ASN a 54  1 ? 10 
HELX_P HELX_P113 AM5 ASP L  57  ? THR L  62  ? ASP a 57  THR a 62  1 ? 6  
HELX_P HELX_P114 AM6 ASP L  64  ? PHE L  97  ? ASP a 64  PHE a 97  1 ? 34 
HELX_P HELX_P115 AM7 ASN L  99  ? ASP L  106 ? ASN a 99  ASP a 106 1 ? 8  
HELX_P HELX_P116 AM8 GLY L  122 ? ASN L  127 ? GLY a 122 ASN a 127 5 ? 6  
HELX_P HELX_P117 AM9 GLY L  142 ? GLY L  151 ? GLY a 142 GLY a 151 1 ? 10 
HELX_P HELX_P118 AN1 ASP L  154 ? VAL L  182 ? ASP a 154 VAL a 182 1 ? 29 
HELX_P HELX_P119 AN2 LYS L  186 ? GLN L  191 ? LYS a 186 GLN a 191 1 ? 6  
HELX_P HELX_P120 AN3 ASN L  192 ? GLY L  203 ? ASN a 192 GLY a 203 1 ? 12 
HELX_P HELX_P121 AN4 LEU L  205 ? VAL L  219 ? LEU a 205 VAL a 219 1 ? 15 
HELX_P HELX_P122 AN5 VAL L  219 ? ALA L  229 ? VAL a 219 ALA a 229 1 ? 11 
HELX_P HELX_P123 AN6 HIS L  240 ? GLU L  245 ? HIS a 240 GLU a 245 1 ? 6  
HELX_P HELX_P124 AN7 GLU L  245 ? TYR L  253 ? GLU a 245 TYR a 253 1 ? 9  
HELX_P HELX_P125 AN8 PRO L  254 ? GLN L  258 ? PRO a 254 GLN a 258 5 ? 5  
HELX_P HELX_P126 AN9 LEU L  260 ? THR L  265 ? LEU a 260 THR a 265 1 ? 6  
HELX_P HELX_P127 AO1 ASN L  267 ? PHE L  274 ? ASN a 267 PHE a 274 5 ? 8  
HELX_P HELX_P128 AO2 TRP L  289 ? GLY L  308 ? TRP a 289 GLY a 308 1 ? 20 
HELX_P HELX_P129 AO3 SER L  320 ? HIS L  328 ? SER a 320 HIS a 328 1 ? 9  
HELX_P HELX_P130 AO4 GLY L  339 ? SER L  347 ? GLY a 339 SER a 347 1 ? 9  
HELX_P HELX_P131 AO5 SER L  347 ? MET L  373 ? SER a 347 MET a 373 1 ? 27 
HELX_P HELX_P132 AO6 ASP L  382 ? ASP L  415 ? ASP a 382 ASP a 415 1 ? 34 
HELX_P HELX_P133 AO7 ASN L  424 ? HIS L  432 ? ASN a 424 HIS a 432 1 ? 9  
HELX_P HELX_P134 AO8 HIS L  432 ? HIS L  450 ? HIS a 432 HIS a 450 1 ? 19 
HELX_P HELX_P135 AO9 SER L  451 ? LEU L  464 ? SER a 451 LEU a 464 1 ? 14 
HELX_P HELX_P136 AP1 ARG L  466 ? MET L  470 ? ARG a 466 MET a 470 5 ? 5  
HELX_P HELX_P137 AP2 PRO L  480 ? LEU L  492 ? PRO a 480 LEU a 492 1 ? 13 
HELX_P HELX_P138 AP3 GLY L  528 ? TYR L  555 ? GLY a 528 TYR a 555 1 ? 28 
HELX_P HELX_P139 AP4 ASP L  564 ? GLY L  569 ? ASP a 564 GLY a 569 1 ? 6  
HELX_P HELX_P140 AP5 SER L  586 ? VAL L  617 ? SER a 586 VAL a 617 1 ? 32 
HELX_P HELX_P141 AP6 ASN L  634 ? ALA L  639 ? ASN a 634 ALA a 639 1 ? 6  
HELX_P HELX_P142 AP7 THR L  641 ? ASP L  648 ? THR a 641 ASP a 648 1 ? 8  
HELX_P HELX_P143 AP8 PHE L  649 ? ALA L  654 ? PHE a 649 ALA a 654 1 ? 6  
HELX_P HELX_P144 AP9 ALA L  654 ? ASN L  659 ? ALA a 654 ASN a 659 1 ? 6  
HELX_P HELX_P145 AQ1 LEU L  665 ? SER L  688 ? LEU a 665 SER a 688 1 ? 24 
HELX_P HELX_P146 AQ2 GLY L  689 ? LEU L  707 ? GLY a 689 LEU a 707 1 ? 19 
HELX_P HELX_P147 AQ3 SER L  719 ? ILE L  750 ? SER a 719 ILE a 750 1 ? 32 
HELX_P HELX_P148 AQ4 SER M  7   ? GLN M  12  ? SER b 9   GLN b 14  1 ? 6  
HELX_P HELX_P149 AQ5 THR M  16  ? THR M  25  ? THR b 18  THR b 27  1 ? 10 
HELX_P HELX_P150 AQ6 ASP M  28  ? HIS M  32  ? ASP b 30  HIS b 34  5 ? 5  
HELX_P HELX_P151 AQ7 THR M  36  ? GLY M  70  ? THR b 38  GLY b 72  1 ? 35 
HELX_P HELX_P152 AQ8 ASN M  71  ? ASP M  78  ? ASN b 73  ASP b 80  1 ? 8  
HELX_P HELX_P153 AQ9 GLY M  95  ? THR M  103 ? GLY b 97  THR b 105 1 ? 9  
HELX_P HELX_P154 AR1 GLY M  117 ? ILE M  125 ? GLY b 119 ILE b 127 1 ? 9  
HELX_P HELX_P155 AR2 THR M  129 ? HIS M  154 ? THR b 131 HIS b 156 1 ? 26 
HELX_P HELX_P156 AR3 LEU M  155 ? ARG M  160 ? LEU b 157 ARG b 162 5 ? 6  
HELX_P HELX_P157 AR4 SER M  162 ? LYS M  167 ? SER b 164 LYS b 169 1 ? 6  
HELX_P HELX_P158 AR5 ASN M  168 ? GLY M  179 ? ASN b 170 GLY b 181 1 ? 12 
HELX_P HELX_P159 AR6 PHE M  181 ? VAL M  195 ? PHE b 183 VAL b 197 1 ? 15 
HELX_P HELX_P160 AR7 VAL M  195 ? ARG M  201 ? VAL b 197 ARG b 203 1 ? 7  
HELX_P HELX_P161 AR8 LEU M  220 ? THR M  225 ? LEU b 222 THR b 227 1 ? 6  
HELX_P HELX_P162 AR9 ASN M  227 ? ALA M  232 ? ASN b 229 ALA b 234 5 ? 6  
HELX_P HELX_P163 AS1 TRP M  267 ? GLY M  286 ? TRP b 269 GLY b 288 1 ? 20 
HELX_P HELX_P164 AS2 SER M  298 ? ALA M  305 ? SER b 300 ALA b 307 1 ? 8  
HELX_P HELX_P165 AS3 ASN M  317 ? ASN M  324 ? ASN b 319 ASN b 326 1 ? 8  
HELX_P HELX_P166 AS4 SER M  325 ? TYR M  349 ? SER b 327 TYR b 351 1 ? 25 
HELX_P HELX_P167 AS5 PHE M  356 ? GLN M  359 ? PHE b 358 GLN b 361 5 ? 4  
HELX_P HELX_P168 AS6 ASP M  360 ? ASP M  393 ? ASP b 362 ASP b 395 1 ? 34 
HELX_P HELX_P169 AS7 ASN M  402 ? HIS M  410 ? ASN b 404 HIS b 412 1 ? 9  
HELX_P HELX_P170 AS8 HIS M  410 ? PHE M  442 ? HIS b 412 PHE b 444 1 ? 33 
HELX_P HELX_P171 AS9 THR M  444 ? GLN M  448 ? THR b 446 GLN b 450 5 ? 5  
HELX_P HELX_P172 AT1 PRO M  453 ? SER M  463 ? PRO b 455 SER b 465 1 ? 11 
HELX_P HELX_P173 AT2 VAL M  472 ? ASN M  476 ? VAL b 474 ASN b 478 5 ? 5  
HELX_P HELX_P174 AT3 TRP M  488 ? ASN M  497 ? TRP b 490 ASN b 499 1 ? 10 
HELX_P HELX_P175 AT4 GLY M  508 ? ALA M  536 ? GLY b 510 ALA b 538 1 ? 29 
HELX_P HELX_P176 AT5 ASP M  544 ? GLY M  549 ? ASP b 546 GLY b 551 5 ? 6  
HELX_P HELX_P177 AT6 SER M  566 ? GLY M  599 ? SER b 568 GLY b 601 1 ? 34 
HELX_P HELX_P178 AT7 VAL M  601 ? SER M  608 ? VAL b 603 SER b 610 1 ? 8  
HELX_P HELX_P179 AT8 TYR M  610 ? TYR M  618 ? TYR b 612 TYR b 620 1 ? 9  
HELX_P HELX_P180 AT9 ASN M  622 ? ASN M  628 ? ASN b 624 ASN b 630 1 ? 7  
HELX_P HELX_P181 AU1 LEU M  638 ? SER M  661 ? LEU b 640 SER b 663 1 ? 24 
HELX_P HELX_P182 AU2 TRP M  662 ? ARG M  679 ? TRP b 664 ARG b 681 1 ? 18 
HELX_P HELX_P183 AU3 LEU M  682 ? VAL M  686 ? LEU b 684 VAL b 688 5 ? 5  
HELX_P HELX_P184 AU4 SER M  696 ? PHE M  728 ? SER b 698 PHE b 730 1 ? 33 
HELX_P HELX_P185 AU5 THR N  15  ? CYS N  21  ? THR c 15  CYS c 21  1 ? 7  
HELX_P HELX_P186 AU6 ARG N  44  ? CYS N  48  ? ARG c 44  CYS c 48  5 ? 5  
HELX_P HELX_P187 AU7 LYS N  52  ? CYS N  58  ? LYS c 52  CYS c 58  1 ? 7  
HELX_P HELX_P188 AU8 LEU O  19  ? GLU O  25  ? LEU d 19  GLU d 25  1 ? 7  
HELX_P HELX_P189 AU9 ARG O  61  ? LYS O  75  ? ARG d 61  LYS d 75  1 ? 15 
HELX_P HELX_P190 AV1 ARG O  121 ? ASN O  125 ? ARG d 121 ASN d 125 5 ? 5  
HELX_P HELX_P191 AV2 GLU O  127 ? ILE O  131 ? GLU d 127 ILE d 131 5 ? 5  
HELX_P HELX_P192 AV3 ALA P  61  ? ASN P  63  ? ALA e 62  ASN e 64  5 ? 3  
HELX_P HELX_P193 AV4 ASN Q  13  ? LYS Q  21  ? ASN f 13  LYS f 21  1 ? 9  
HELX_P HELX_P194 AV5 ASN Q  31  ? TYR Q  40  ? ASN f 31  TYR f 40  1 ? 10 
HELX_P HELX_P195 AV6 ALA Q  41  ? ALA Q  43  ? ALA f 41  ALA f 43  5 ? 3  
HELX_P HELX_P196 AV7 ARG Q  58  ? THR Q  60  ? ARG f 58  THR f 60  5 ? 3  
HELX_P HELX_P197 AV8 HIS Q  61  ? GLU Q  92  ? HIS f 61  GLU f 92  1 ? 32 
HELX_P HELX_P198 AV9 ASN Q  95  ? VAL Q  102 ? ASN f 95  VAL f 102 1 ? 8  
HELX_P HELX_P199 AW1 ASN Q  104 ? GLY Q  114 ? ASN f 104 GLY f 114 1 ? 11 
HELX_P HELX_P200 AW2 LEU Q  117 ? SER Q  128 ? LEU f 117 SER f 128 1 ? 12 
HELX_P HELX_P201 AW3 LYS Q  134 ? ILE Q  138 ? LYS f 134 ILE f 138 5 ? 5  
HELX_P HELX_P202 AW4 TYR R  9   ? TRP R  20  ? TYR i 9   TRP i 20  1 ? 12 
HELX_P HELX_P203 AW5 TRP R  20  ? GLU R  35  ? TRP i 20  GLU i 35  1 ? 16 
HELX_P HELX_P204 AW6 ASP S  2   ? SER S  9   ? ASP j 2   SER j 9   1 ? 8  
HELX_P HELX_P205 AW7 THR S  10  ? TYR S  33  ? THR j 10  TYR j 33  1 ? 24 
HELX_P HELX_P206 AW8 GLY T  9   ? VAL T  14  ? GLY k 17  VAL k 22  1 ? 6  
HELX_P HELX_P207 AW9 ILE T  17  ? ILE T  33  ? ILE k 25  ILE k 41  1 ? 17 
HELX_P HELX_P208 AX1 GLY T  54  ? ALA T  77  ? GLY k 62  ALA k 85  1 ? 24 
HELX_P HELX_P209 AX2 ASN U  12  ? ASP U  14  ? ASN l 12  ASP l 14  5 ? 3  
HELX_P HELX_P210 AX3 SER U  27  ? GLY U  35  ? SER l 27  GLY l 35  1 ? 9  
HELX_P HELX_P211 AX4 SER U  45  ? LEU U  61  ? SER l 45  LEU l 61  1 ? 17 
HELX_P HELX_P212 AX5 ILE U  62  ? GLY U  69  ? ILE l 62  GLY l 69  1 ? 8  
HELX_P HELX_P213 AX6 PRO U  70  ? SER U  74  ? PRO l 70  SER l 74  5 ? 5  
HELX_P HELX_P214 AX7 TYR U  76  ? PHE U  104 ? TYR l 76  PHE l 104 1 ? 29 
HELX_P HELX_P215 AX8 ASP U  112 ? GLN U  115 ? ASP l 112 GLN l 115 5 ? 4  
HELX_P HELX_P216 AX9 THR U  116 ? ASN U  144 ? THR l 116 ASN l 144 1 ? 29 
HELX_P HELX_P217 AY1 ASN U  144 ? ARG U  153 ? ASN l 144 ARG l 153 1 ? 10 
HELX_P HELX_P218 AY2 SER V  4   ? LYS V  31  ? SER m 4   LYS m 31  1 ? 28 
HELX_P HELX_P219 AY3 PHE W  18  ? LYS W  23  ? PHE 1 25  LYS 1 30  5 ? 6  
HELX_P HELX_P220 AY4 ASP W  28  ? ARG W  33  ? ASP 1 35  ARG 1 40  1 ? 6  
HELX_P HELX_P221 AY5 THR W  38  ? ASN W  47  ? THR 1 45  ASN 1 54  1 ? 10 
HELX_P HELX_P222 AY6 ASP W  57  ? PHE W  90  ? ASP 1 64  PHE 1 97  1 ? 34 
HELX_P HELX_P223 AY7 ASN W  92  ? ASP W  99  ? ASN 1 99  ASP 1 106 1 ? 8  
HELX_P HELX_P224 AY8 PRO W  100 ? ILE W  103 ? PRO 1 107 ILE 1 110 5 ? 4  
HELX_P HELX_P225 AY9 GLY W  115 ? ASN W  120 ? GLY 1 122 ASN 1 127 5 ? 6  
HELX_P HELX_P226 AZ1 GLY W  135 ? GLY W  144 ? GLY 1 142 GLY 1 151 1 ? 10 
HELX_P HELX_P227 AZ2 ASP W  147 ? VAL W  175 ? ASP 1 154 VAL 1 182 1 ? 29 
HELX_P HELX_P228 AZ3 LYS W  179 ? GLN W  184 ? LYS 1 186 GLN 1 191 1 ? 6  
HELX_P HELX_P229 AZ4 ASN W  185 ? GLY W  196 ? ASN 1 192 GLY 1 203 1 ? 12 
HELX_P HELX_P230 AZ5 LEU W  197 ? VAL W  212 ? LEU 1 204 VAL 1 219 1 ? 16 
HELX_P HELX_P231 AZ6 VAL W  212 ? ALA W  222 ? VAL 1 219 ALA 1 229 1 ? 11 
HELX_P HELX_P232 AZ7 ALA W  225 ? ILE W  229 ? ALA 1 232 ILE 1 236 5 ? 5  
HELX_P HELX_P233 AZ8 HIS W  233 ? GLU W  238 ? HIS 1 240 GLU 1 245 1 ? 6  
HELX_P HELX_P234 AZ9 GLU W  238 ? GLU W  244 ? GLU 1 245 GLU 1 251 1 ? 7  
HELX_P HELX_P235 BA1 TYR W  246 ? GLY W  252 ? TYR 1 253 GLY 1 259 5 ? 7  
HELX_P HELX_P236 BA2 LEU W  253 ? THR W  258 ? LEU 1 260 THR 1 265 1 ? 6  
HELX_P HELX_P237 BA3 ASN W  260 ? PHE W  267 ? ASN 1 267 PHE 1 274 5 ? 8  
HELX_P HELX_P238 BA4 TRP W  282 ? GLY W  301 ? TRP 1 289 GLY 1 308 1 ? 20 
HELX_P HELX_P239 BA5 SER W  313 ? ALA W  320 ? SER 1 320 ALA 1 327 1 ? 8  
HELX_P HELX_P240 BA6 GLY W  332 ? SER W  340 ? GLY 1 339 SER 1 347 1 ? 9  
HELX_P HELX_P241 BA7 SER W  340 ? MET W  366 ? SER 1 347 MET 1 373 1 ? 27 
HELX_P HELX_P242 BA8 ASP W  375 ? ASP W  408 ? ASP 1 382 ASP 1 415 1 ? 34 
HELX_P HELX_P243 BA9 ASP W  410 ? ASN W  414 ? ASP 1 417 ASN 1 421 5 ? 5  
HELX_P HELX_P244 BB1 ASN W  417 ? HIS W  425 ? ASN 1 424 HIS 1 432 1 ? 9  
HELX_P HELX_P245 BB2 HIS W  425 ? SER W  444 ? HIS 1 432 SER 1 451 1 ? 20 
HELX_P HELX_P246 BB3 SER W  444 ? LEU W  457 ? SER 1 451 LEU 1 464 1 ? 14 
HELX_P HELX_P247 BB4 ARG W  459 ? MET W  463 ? ARG 1 466 MET 1 470 5 ? 5  
HELX_P HELX_P248 BB5 PRO W  473 ? LEU W  485 ? PRO 1 480 LEU 1 492 1 ? 13 
HELX_P HELX_P249 BB6 GLY W  521 ? TYR W  548 ? GLY 1 528 TYR 1 555 1 ? 28 
HELX_P HELX_P250 BB7 ASP W  557 ? GLY W  562 ? ASP 1 564 GLY 1 569 1 ? 6  
HELX_P HELX_P251 BB8 SER W  579 ? VAL W  610 ? SER 1 586 VAL 1 617 1 ? 32 
HELX_P HELX_P252 BB9 ASN W  627 ? ALA W  632 ? ASN 1 634 ALA 1 639 1 ? 6  
HELX_P HELX_P253 BC1 THR W  634 ? ASP W  641 ? THR 1 641 ASP 1 648 1 ? 8  
HELX_P HELX_P254 BC2 PHE W  642 ? ALA W  647 ? PHE 1 649 ALA 1 654 1 ? 6  
HELX_P HELX_P255 BC3 ALA W  647 ? ASN W  652 ? ALA 1 654 ASN 1 659 1 ? 6  
HELX_P HELX_P256 BC4 LEU W  658 ? SER W  681 ? LEU 1 665 SER 1 688 1 ? 24 
HELX_P HELX_P257 BC5 GLY W  682 ? LEU W  700 ? GLY 1 689 LEU 1 707 1 ? 19 
HELX_P HELX_P258 BC6 SER W  712 ? SER W  742 ? SER 1 719 SER 1 749 1 ? 31 
HELX_P HELX_P259 BC7 SER X  9   ? GLN X  14  ? SER 2 9   GLN 2 14  1 ? 6  
HELX_P HELX_P260 BC8 THR X  18  ? THR X  27  ? THR 2 18  THR 2 27  1 ? 10 
HELX_P HELX_P261 BC9 ASP X  30  ? HIS X  34  ? ASP 2 30  HIS 2 34  5 ? 5  
HELX_P HELX_P262 BD1 THR X  38  ? GLY X  72  ? THR 2 38  GLY 2 72  1 ? 35 
HELX_P HELX_P263 BD2 ASN X  73  ? ASP X  80  ? ASN 2 73  ASP 2 80  1 ? 8  
HELX_P HELX_P264 BD3 GLY X  97  ? THR X  105 ? GLY 2 97  THR 2 105 1 ? 9  
HELX_P HELX_P265 BD4 GLY X  119 ? GLY X  128 ? GLY 2 119 GLY 2 128 1 ? 10 
HELX_P HELX_P266 BD5 THR X  131 ? HIS X  156 ? THR 2 131 HIS 2 156 1 ? 26 
HELX_P HELX_P267 BD6 SER X  164 ? LYS X  169 ? SER 2 164 LYS 2 169 1 ? 6  
HELX_P HELX_P268 BD7 ASN X  170 ? GLY X  181 ? ASN 2 170 GLY 2 181 1 ? 12 
HELX_P HELX_P269 BD8 PHE X  183 ? VAL X  197 ? PHE 2 183 VAL 2 197 1 ? 15 
HELX_P HELX_P270 BD9 VAL X  197 ? ARG X  203 ? VAL 2 197 ARG 2 203 1 ? 7  
HELX_P HELX_P271 BE1 LEU X  222 ? GLY X  228 ? LEU 2 222 GLY 2 228 1 ? 7  
HELX_P HELX_P272 BE2 ASN X  229 ? ALA X  234 ? ASN 2 229 ALA 2 234 5 ? 6  
HELX_P HELX_P273 BE3 TRP X  269 ? GLY X  288 ? TRP 2 269 GLY 2 288 1 ? 20 
HELX_P HELX_P274 BE4 SER X  300 ? HIS X  308 ? SER 2 300 HIS 2 308 1 ? 9  
HELX_P HELX_P275 BE5 ASN X  319 ? ASN X  326 ? ASN 2 319 ASN 2 326 1 ? 8  
HELX_P HELX_P276 BE6 SER X  327 ? LEU X  353 ? SER 2 327 LEU 2 353 1 ? 27 
HELX_P HELX_P277 BE7 ASP X  362 ? ASP X  395 ? ASP 2 362 ASP 2 395 1 ? 34 
HELX_P HELX_P278 BE8 ASN X  404 ? HIS X  412 ? ASN 2 404 HIS 2 412 1 ? 9  
HELX_P HELX_P279 BE9 HIS X  412 ? PHE X  444 ? HIS 2 412 PHE 2 444 1 ? 33 
HELX_P HELX_P280 BF1 THR X  446 ? GLN X  450 ? THR 2 446 GLN 2 450 5 ? 5  
HELX_P HELX_P281 BF2 PRO X  455 ? SER X  465 ? PRO 2 455 SER 2 465 1 ? 11 
HELX_P HELX_P282 BF3 VAL X  474 ? ASN X  478 ? VAL 2 474 ASN 2 478 5 ? 5  
HELX_P HELX_P283 BF4 SER X  481 ? THR X  485 ? SER 2 481 THR 2 485 5 ? 5  
HELX_P HELX_P284 BF5 TRP X  490 ? ASN X  499 ? TRP 2 490 ASN 2 499 1 ? 10 
HELX_P HELX_P285 BF6 GLY X  510 ? ASP X  537 ? GLY 2 510 ASP 2 537 1 ? 28 
HELX_P HELX_P286 BF7 ASP X  546 ? GLY X  551 ? ASP 2 546 GLY 2 551 1 ? 6  
HELX_P HELX_P287 BF8 SER X  568 ? GLY X  601 ? SER 2 568 GLY 2 601 1 ? 34 
HELX_P HELX_P288 BF9 ASN X  602 ? SER X  610 ? ASN 2 602 SER 2 610 1 ? 9  
HELX_P HELX_P289 BG1 TYR X  612 ? TYR X  620 ? TYR 2 612 TYR 2 620 1 ? 9  
HELX_P HELX_P290 BG2 TYR X  620 ? ILE X  629 ? TYR 2 620 ILE 2 629 1 ? 10 
HELX_P HELX_P291 BG3 LEU X  640 ? SER X  663 ? LEU 2 640 SER 2 663 1 ? 24 
HELX_P HELX_P292 BG4 ARG X  665 ? THR X  682 ? ARG 2 665 THR 2 682 1 ? 18 
HELX_P HELX_P293 BG5 LEU X  684 ? VAL X  688 ? LEU 2 684 VAL 2 688 5 ? 5  
HELX_P HELX_P294 BG6 SER X  698 ? PHE X  730 ? SER 2 698 PHE 2 730 1 ? 33 
HELX_P HELX_P295 BG7 THR Y  14  ? CYS Y  20  ? THR 3 15  CYS 3 21  1 ? 7  
HELX_P HELX_P296 BG8 ARG Y  43  ? CYS Y  47  ? ARG 3 44  CYS 3 48  5 ? 5  
HELX_P HELX_P297 BG9 LYS Y  51  ? ALA Y  56  ? LYS 3 52  ALA 3 57  1 ? 6  
HELX_P HELX_P298 BH1 SER Z  19  ? GLU Z  24  ? SER 4 20  GLU 4 25  1 ? 6  
HELX_P HELX_P299 BH2 ARG Z  60  ? LYS Z  74  ? ARG 4 61  LYS 4 75  1 ? 15 
HELX_P HELX_P300 BH3 ARG Z  120 ? ASN Z  124 ? ARG 4 121 ASN 4 125 5 ? 5  
HELX_P HELX_P301 BH4 GLU Z  126 ? LYS Z  131 ? GLU 4 127 LYS 4 132 5 ? 6  
HELX_P HELX_P302 BH5 ALA AA 61  ? ASN AA 63  ? ALA 5 62  ASN 5 64  5 ? 3  
HELX_P HELX_P303 BH6 ASN BA 13  ? LYS BA 21  ? ASN 6 13  LYS 6 21  1 ? 9  
HELX_P HELX_P304 BH7 ASN BA 31  ? TYR BA 40  ? ASN 6 31  TYR 6 40  1 ? 10 
HELX_P HELX_P305 BH8 ARG BA 58  ? ALA BA 62  ? ARG 6 58  ALA 6 62  5 ? 5  
HELX_P HELX_P306 BH9 PHE BA 65  ? ARG BA 91  ? PHE 6 65  ARG 6 91  1 ? 27 
HELX_P HELX_P307 BI1 ASN BA 95  ? VAL BA 102 ? ASN 6 95  VAL 6 102 1 ? 8  
HELX_P HELX_P308 BI2 ASN BA 104 ? GLY BA 114 ? ASN 6 104 GLY 6 114 1 ? 11 
HELX_P HELX_P309 BI3 LEU BA 117 ? GLY BA 129 ? LEU 6 117 GLY 6 129 1 ? 13 
HELX_P HELX_P310 BI4 LYS BA 134 ? ILE BA 138 ? LYS 6 134 ILE 6 138 5 ? 5  
HELX_P HELX_P311 BI5 SER CA 8   ? TRP CA 20  ? SER h 8   TRP h 20  1 ? 13 
HELX_P HELX_P312 BI6 TRP CA 20  ? GLU CA 35  ? TRP h 20  GLU h 35  1 ? 16 
HELX_P HELX_P313 BI7 ASP DA 2   ? SER DA 9   ? ASP 7 2   SER 7 9   1 ? 8  
HELX_P HELX_P314 BI8 THR DA 10  ? TYR DA 33  ? THR 7 10  TYR 7 33  1 ? 24 
HELX_P HELX_P315 BI9 GLY EA 9   ? VAL EA 14  ? GLY 8 17  VAL 8 22  1 ? 6  
HELX_P HELX_P316 BJ1 ILE EA 17  ? ILE EA 33  ? ILE 8 25  ILE 8 41  1 ? 17 
HELX_P HELX_P317 BJ2 GLY EA 54  ? ALA EA 77  ? GLY 8 62  ALA 8 85  1 ? 24 
HELX_P HELX_P318 BJ3 ASN FA 9   ? ASP FA 11  ? ASN 0 12  ASP 0 14  5 ? 3  
HELX_P HELX_P319 BJ4 SER FA 24  ? LEU FA 34  ? SER 0 27  LEU 0 37  1 ? 11 
HELX_P HELX_P320 BJ5 SER FA 42  ? LEU FA 58  ? SER 0 45  LEU 0 61  1 ? 17 
HELX_P HELX_P321 BJ6 ILE FA 59  ? GLY FA 66  ? ILE 0 62  GLY 0 69  1 ? 8  
HELX_P HELX_P322 BJ7 PRO FA 67  ? SER FA 71  ? PRO 0 70  SER 0 74  5 ? 5  
HELX_P HELX_P323 BJ8 TYR FA 73  ? PHE FA 101 ? TYR 0 76  PHE 0 104 1 ? 29 
HELX_P HELX_P324 BJ9 ASP FA 109 ? GLN FA 112 ? ASP 0 112 GLN 0 115 5 ? 4  
HELX_P HELX_P325 BK1 THR FA 113 ? ASN FA 141 ? THR 0 116 ASN 0 144 1 ? 29 
HELX_P HELX_P326 BK2 ASN FA 141 ? GLY FA 151 ? ASN 0 144 GLY 0 154 1 ? 11 
HELX_P HELX_P327 BK3 SER GA 4   ? LEU GA 9   ? SER 9 4   LEU 9 9   1 ? 6  
HELX_P HELX_P328 BK4 ALA GA 10  ? LYS GA 31  ? ALA 9 10  LYS 9 31  1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1   disulf ?    ? F  CYS 10  SG  ? ? ? 1_555 F  CYS 45 SG  ? ? F CYS 10   F CYS 45   1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf2   disulf ?    ? Q  CYS 10  SG  ? ? ? 1_555 Q  CYS 45 SG  ? ? f CYS 10   f CYS 45   1_555 ? ? ? ? ? ? ? 2.029 ? 
disulf3   disulf ?    ? BA CYS 10  SG  ? ? ? 1_555 BA CYS 45 SG  ? ? 6 CYS 10   6 CYS 45   1_555 ? ? ? ? ? ? ? 2.032 ? 
metalc1   metalc ?    ? A  GLN 115 OE1 ? ? ? 1_555 NA CLA .  MG  ? ? A GLN 115  A CLA 1106 1_555 ? ? ? ? ? ? ? 2.830 ? 
metalc2   metalc ?    ? A  GLN 123 OE1 ? ? ? 1_555 OA CLA .  MG  ? ? A GLN 123  A CLA 1107 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc3   metalc ?    ? A  THR 497 O   ? ? ? 1_555 OB CLA .  MG  ? ? A THR 497  A CLA 1134 1_555 ? ? ? ? ? ? ? 2.750 ? 
metalc4   metalc ?    ? A  CYS 574 SG  ? ? ? 1_555 WB SF4 .  FE3 ? ? A CYS 574  A SF4 3001 1_555 ? ? ? ? ? ? ? 2.422 ? 
metalc5   metalc ?    ? A  CYS 583 SG  ? ? ? 1_555 WB SF4 .  FE2 ? ? A CYS 583  A SF4 3001 1_555 ? ? ? ? ? ? ? 2.432 ? 
metalc6   metalc ?    ? B  ASP 93  OD2 ? ? ? 1_555 CD CLA .  MG  ? ? B ASP 93   B CLA 1206 1_555 ? ? ? ? ? ? ? 2.690 ? 
metalc7   metalc ?    ? B  GLU 134 OE2 ? ? ? 1_555 TE CA  .  CA  ? ? B GLU 134  B CA  6001 1_555 ? ? ? ? ? ? ? 2.978 ? 
metalc8   metalc ?    ? B  GLU 201 OE1 ? ? ? 1_555 TE CA  .  CA  ? ? B GLU 201  B CA  6001 1_555 ? ? ? ? ? ? ? 3.071 ? 
metalc9   metalc ?    ? B  GLU 201 OE2 ? ? ? 1_555 TE CA  .  CA  ? ? B GLU 201  B CA  6001 1_555 ? ? ? ? ? ? ? 2.445 ? 
metalc10  metalc ?    ? B  LEU 353 O   ? ? ? 1_555 UE MG  .  MG  ? ? B LEU 353  B MG  6002 1_555 ? ? ? ? ? ? ? 2.888 ? 
metalc11  metalc ?    ? B  SER 355 OG  ? ? ? 1_555 UE MG  .  MG  ? ? B SER 355  B MG  6002 1_555 ? ? ? ? ? ? ? 2.314 ? 
metalc12  metalc ?    ? B  CYS 556 SG  ? ? ? 1_555 WB SF4 .  FE4 ? ? B CYS 556  A SF4 3001 1_555 ? ? ? ? ? ? ? 2.433 ? 
metalc13  metalc ?    ? B  CYS 565 SG  ? ? ? 1_555 WB SF4 .  FE1 ? ? B CYS 565  A SF4 3001 1_555 ? ? ? ? ? ? ? 2.421 ? 
metalc14  metalc ?    ? C  CYS 13  SG  ? ? ? 1_555 BF SF4 .  FE3 ? ? C CYS 14   C SF4 3003 1_555 ? ? ? ? ? ? ? 2.677 ? 
metalc15  metalc ?    ? C  CYS 16  N   ? ? ? 1_555 BF SF4 .  FE2 ? ? C CYS 17   C SF4 3003 1_555 ? ? ? ? ? ? ? 2.654 ? 
covale1   covale none ? C  CYS 16  SG  ? ? ? 1_555 BF SF4 .  S3  ? ? C CYS 17   C SF4 3003 1_555 ? ? ? ? ? ? ? 2.036 ? 
metalc16  metalc ?    ? C  CYS 16  SG  ? ? ? 1_555 BF SF4 .  FE4 ? ? C CYS 17   C SF4 3003 1_555 ? ? ? ? ? ? ? 2.201 ? 
metalc17  metalc ?    ? C  CYS 47  SG  ? ? ? 1_555 AF SF4 .  FE4 ? ? C CYS 48   C SF4 3002 1_555 ? ? ? ? ? ? ? 2.671 ? 
metalc18  metalc ?    ? C  CYS 50  SG  ? ? ? 1_555 AF SF4 .  FE1 ? ? C CYS 51   C SF4 3002 1_555 ? ? ? ? ? ? ? 2.667 ? 
metalc19  metalc ?    ? C  CYS 53  SG  ? ? ? 1_555 AF SF4 .  FE3 ? ? C CYS 54   C SF4 3002 1_555 ? ? ? ? ? ? ? 2.672 ? 
metalc20  metalc ?    ? F  ASP 56  O   ? ? ? 1_555 EF CLA .  MG  ? ? F ASP 56   F CLA 1302 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc21  metalc ?    ? H  GLU 28  OE2 ? ? ? 1_555 LF CLA .  MG  ? ? J GLU 28   J CLA 1302 1_555 ? ? ? ? ? ? ? 2.869 ? 
metalc22  metalc ?    ? J  GLU 52  OE2 ? ? ? 1_555 TF CLA .  MG  ? ? L GLU 52   L CLA 1501 1_555 ? ? ? ? ? ? ? 2.707 ? 
metalc23  metalc ?    ? J  PRO 70  O   ? ? ? 1_555 SF CA  .  CA  ? ? L PRO 70   L CA  1001 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc24  metalc ?    ? J  ASP 73  OD1 ? ? ? 1_555 SF CA  .  CA  ? ? L ASP 73   L CA  1001 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc25  metalc ?    ? J  PHE 156 O   ? ? ? 1_555 JL CA  .  CA  ? ? L PHE 156  l CA  1001 1_555 ? ? ? ? ? ? ? 2.465 ? 
metalc26  metalc ?    ? L  GLN 123 OE1 ? ? ? 1_555 MG CLA .  MG  ? ? a GLN 123  a CLA 1107 1_555 ? ? ? ? ? ? ? 2.911 ? 
covale2   covale none ? L  THR 345 O   ? ? ? 1_555 CH CLA .  C20 ? ? a THR 345  a CLA 1123 1_555 ? ? ? ? ? ? ? 1.374 ? 
metalc27  metalc ?    ? L  THR 497 O   ? ? ? 1_555 LH CLA .  MG  ? ? a THR 497  a CLA 1134 1_555 ? ? ? ? ? ? ? 2.738 ? 
metalc28  metalc ?    ? L  CYS 583 SG  ? ? ? 1_555 TH SF4 .  FE2 ? ? a CYS 583  a SF4 3001 1_555 ? ? ? ? ? ? ? 2.442 ? 
metalc29  metalc ?    ? M  ASP 91  OD2 ? ? ? 1_555 XI CLA .  MG  ? ? b ASP 93   b CLA 1206 1_555 ? ? ? ? ? ? ? 2.708 ? 
metalc30  metalc ?    ? M  GLU 199 OE1 ? ? ? 1_555 PK CA  .  CA  ? ? b GLU 201  b CA  6001 1_555 ? ? ? ? ? ? ? 2.931 ? 
metalc31  metalc ?    ? M  GLU 199 OE2 ? ? ? 1_555 PK CA  .  CA  ? ? b GLU 201  b CA  6001 1_555 ? ? ? ? ? ? ? 2.653 ? 
metalc32  metalc ?    ? M  LEU 351 O   ? ? ? 1_555 QK MG  .  MG  ? ? b LEU 353  b MG  6002 1_555 ? ? ? ? ? ? ? 2.522 ? 
metalc33  metalc ?    ? M  SER 353 OG  ? ? ? 1_555 QK MG  .  MG  ? ? b SER 355  b MG  6002 1_555 ? ? ? ? ? ? ? 2.750 ? 
metalc34  metalc ?    ? M  CYS 554 SG  ? ? ? 1_555 TH SF4 .  FE4 ? ? b CYS 556  a SF4 3001 1_555 ? ? ? ? ? ? ? 2.674 ? 
metalc35  metalc ?    ? M  CYS 563 SG  ? ? ? 1_555 TH SF4 .  FE1 ? ? b CYS 565  a SF4 3001 1_555 ? ? ? ? ? ? ? 2.429 ? 
metalc36  metalc ?    ? N  CYS 11  SG  ? ? ? 1_555 VK SF4 .  FE4 ? ? c CYS 11   c SF4 3003 1_555 ? ? ? ? ? ? ? 2.696 ? 
metalc37  metalc ?    ? N  SER 64  OG  ? ? ? 1_555 VK SF4 .  FE1 ? ? c SER 64   c SF4 3003 1_555 ? ? ? ? ? ? ? 2.680 ? 
metalc38  metalc ?    ? U  GLU 52  OE2 ? ? ? 1_555 KL CLA .  MG  ? ? l GLU 52   l CLA 1501 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc39  metalc ?    ? U  PRO 70  O   ? ? ? 1_555 JL CA  .  CA  ? ? l PRO 70   l CA  1001 1_555 ? ? ? ? ? ? ? 2.303 ? 
metalc40  metalc ?    ? U  ASP 73  OD1 ? ? ? 1_555 JL CA  .  CA  ? ? l ASP 73   l CA  1001 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc41  metalc ?    ? U  PHE 156 O   ? ? ? 1_555 YQ CA  .  CA  ? ? l PHE 156  0 CA  1001 1_555 ? ? ? ? ? ? ? 2.646 ? 
covale3   covale none ? W  HIS 26  NE2 ? ? ? 1_555 GM CLA .  O1A ? ? 1 HIS 33   1 CLA 1109 1_555 ? ? ? ? ? ? ? 1.298 ? 
metalc42  metalc ?    ? W  GLN 108 OE1 ? ? ? 1_555 DM CLA .  MG  ? ? 1 GLN 115  1 CLA 1106 1_555 ? ? ? ? ? ? ? 2.956 ? 
metalc43  metalc ?    ? W  THR 490 O   ? ? ? 1_555 EN CLA .  MG  ? ? 1 THR 497  1 CLA 1134 1_555 ? ? ? ? ? ? ? 2.848 ? 
metalc44  metalc ?    ? W  CYS 567 SG  ? ? ? 1_555 MN SF4 .  FE3 ? ? 1 CYS 574  1 SF4 3001 1_555 ? ? ? ? ? ? ? 2.662 ? 
metalc45  metalc ?    ? X  ASP 93  OD2 ? ? ? 1_555 OO CLA .  MG  ? ? 2 ASP 93   2 CLA 1206 1_555 ? ? ? ? ? ? ? 2.767 ? 
metalc46  metalc ?    ? X  GLU 134 OE2 ? ? ? 1_555 EQ CA  .  CA  ? ? 2 GLU 134  2 CA  6001 1_555 ? ? ? ? ? ? ? 2.854 ? 
metalc47  metalc ?    ? X  GLU 201 OE1 ? ? ? 1_555 EQ CA  .  CA  ? ? 2 GLU 201  2 CA  6001 1_555 ? ? ? ? ? ? ? 3.181 ? 
metalc48  metalc ?    ? X  CYS 556 SG  ? ? ? 1_555 MN SF4 .  FE4 ? ? 2 CYS 556  1 SF4 3001 1_555 ? ? ? ? ? ? ? 2.628 ? 
metalc49  metalc ?    ? BA ASP 56  O   ? ? ? 1_555 KQ CLA .  MG  ? ? 6 ASP 56   6 CLA 1302 1_555 ? ? ? ? ? ? ? 2.986 ? 
metalc50  metalc ?    ? DA GLU 28  OE2 ? ? ? 1_555 RQ CLA .  MG  ? ? 7 GLU 28   7 CLA 1302 1_555 ? ? ? ? ? ? ? 2.904 ? 
metalc51  metalc ?    ? FA GLU 49  OE2 ? ? ? 1_555 ZQ CLA .  MG  ? ? 0 GLU 52   0 CLA 1501 1_555 ? ? ? ? ? ? ? 2.660 ? 
metalc52  metalc ?    ? FA PRO 67  O   ? ? ? 1_555 YQ CA  .  CA  ? ? 0 PRO 70   0 CA  1001 1_555 ? ? ? ? ? ? ? 2.478 ? 
metalc53  metalc ?    ? FA ASP 70  OD1 ? ? ? 1_555 YQ CA  .  CA  ? ? 0 ASP 73   0 CA  1001 1_555 ? ? ? ? ? ? ? 2.529 ? 
metalc54  metalc ?    ? FA ASP 70  OD2 ? ? ? 1_555 YQ CA  .  CA  ? ? 0 ASP 73   0 CA  1001 1_555 ? ? ? ? ? ? ? 2.979 ? 
metalc55  metalc ?    ? FA PHE 153 O   ? ? ? 1_555 SF CA  .  CA  ? ? 0 PHE 156  L CA  1001 1_555 ? ? ? ? ? ? ? 2.288 ? 
metalc56  metalc ?    ? JA CLA .   O1A ? ? ? 1_555 QA CLA .  MG  ? ? A CLA 1102 A CLA 1109 1_555 ? ? ? ? ? ? ? 2.802 ? 
metalc57  metalc ?    ? VA CLA .   MG  ? ? ? 1_555 IR HOH .  O   ? ? A CLA 1114 A HOH 8002 1_555 ? ? ? ? ? ? ? 2.879 ? 
metalc58  metalc ?    ? AB CLA .   MG  ? ? ? 1_555 IR HOH .  O   ? ? A CLA 1119 A HOH 8034 1_555 ? ? ? ? ? ? ? 2.725 ? 
metalc59  metalc ?    ? EB CLA .   MG  ? ? ? 1_555 IR HOH .  O   ? ? A CLA 1123 A HOH 8015 1_555 ? ? ? ? ? ? ? 2.764 ? 
metalc60  metalc ?    ? FB CLA .   MG  ? ? ? 1_555 IR HOH .  O   ? ? A CLA 1124 A HOH 8068 1_555 ? ? ? ? ? ? ? 2.716 ? 
metalc61  metalc ?    ? TB CLA .   MG  ? ? ? 1_555 IR HOH .  O   ? ? A CLA 1139 A HOH 8016 1_555 ? ? ? ? ? ? ? 2.889 ? 
metalc62  metalc ?    ? FC LHG .   O5  ? ? ? 1_555 MC CLA .  MG  ? ? A LHG 5003 A CLA 1801 1_555 ? ? ? ? ? ? ? 2.728 ? 
metalc63  metalc ?    ? QC CLA .   MG  ? ? ? 1_555 JR HOH .  O   ? ? A CLA 1012 B HOH 8030 1_555 ? ? ? ? ? ? ? 2.768 ? 
metalc64  metalc ?    ? RC CLA .   MG  ? ? ? 1_555 IR HOH .  O   ? ? B CLA 1022 A HOH 8009 1_555 ? ? ? ? ? ? ? 2.732 ? 
metalc65  metalc ?    ? SC CLA .   MG  ? ? ? 1_555 JR HOH .  O   ? ? B CLA 1237 B HOH 8008 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc66  metalc ?    ? LD CLA .   MG  ? ? ? 1_555 JR HOH .  O   ? ? B CLA 1216 B HOH 8081 1_555 ? ? ? ? ? ? ? 2.901 ? 
metalc67  metalc ?    ? RD CLA .   MG  ? ? ? 1_555 JR HOH .  O   ? ? B CLA 1222 B HOH 8100 1_555 ? ? ? ? ? ? ? 2.840 ? 
metalc68  metalc ?    ? ZD CLA .   MG  ? ? ? 1_555 JR HOH .  O   ? ? B CLA 1231 B HOH 8020 1_555 ? ? ? ? ? ? ? 2.862 ? 
metalc69  metalc ?    ? EE CLA .   MG  ? ? ? 1_555 JR HOH .  O   ? ? B CLA 1238 B HOH 8003 1_555 ? ? ? ? ? ? ? 2.796 ? 
metalc70  metalc ?    ? TE CA  .   CA  ? ? ? 1_555 JR HOH .  O   ? ? B CA  6001 B HOH 8004 1_555 ? ? ? ? ? ? ? 2.665 ? 
metalc71  metalc ?    ? TE CA  .   CA  ? ? ? 1_555 JR HOH .  O   ? ? B CA  6001 B HOH 8026 1_555 ? ? ? ? ? ? ? 2.461 ? 
metalc72  metalc ?    ? TE CA  .   CA  ? ? ? 1_555 JR HOH .  O   ? ? B CA  6001 B HOH 8040 1_555 ? ? ? ? ? ? ? 2.988 ? 
metalc73  metalc ?    ? TE CA  .   CA  ? ? ? 1_555 JR HOH .  O   ? ? B CA  6001 B HOH 8045 1_555 ? ? ? ? ? ? ? 2.387 ? 
metalc74  metalc ?    ? DF CLA .   MG  ? ? ? 1_555 PR HOH .  O   ? ? F CLA 1301 J HOH 8001 1_555 ? ? ? ? ? ? ? 2.965 ? 
metalc75  metalc ?    ? OF CLA .   MG  ? ? ? 1_555 QR HOH .  O   ? ? K CLA 1401 K HOH 8001 1_555 ? ? ? ? ? ? ? 2.834 ? 
metalc76  metalc ?    ? SF CA  .   CA  ? ? ? 1_555 RR HOH .  O   ? ? L CA  1001 L HOH 8020 1_555 ? ? ? ? ? ? ? 2.451 ? 
metalc77  metalc ?    ? SF CA  .   CA  ? ? ? 1_555 MS HOH .  O   ? ? L CA  1001 0 HOH 8029 1_555 ? ? ? ? ? ? ? 2.489 ? 
metalc78  metalc ?    ? SF CA  .   CA  ? ? ? 1_555 IR HOH .  O   ? ? L CA  1001 A HOH 8043 1_555 ? ? ? ? ? ? ? 2.417 ? 
metalc79  metalc ?    ? SF CA  .   CA  ? ? ? 1_555 MS HOH .  O   ? ? L CA  1001 0 HOH 8017 1_555 ? ? ? ? ? ? ? 2.582 ? 
metalc80  metalc ?    ? VF CLA .   MG  ? ? ? 1_555 RR HOH .  O   ? ? L CLA 1503 L HOH 8001 1_555 ? ? ? ? ? ? ? 2.747 ? 
metalc81  metalc ?    ? PH CLA .   MG  ? ? ? 1_555 TR HOH .  O   ? ? a CLA 1139 a HOH 8024 1_555 ? ? ? ? ? ? ? 2.890 ? 
metalc82  metalc ?    ? RH CLA .   MG  ? ? ? 1_555 CI LHG .  O5  ? ? a CLA 1801 a LHG 5003 1_555 ? ? ? ? ? ? ? 2.982 ? 
metalc83  metalc ?    ? MI CLA .   MG  ? ? ? 1_555 UR HOH .  O   ? ? a CLA 1012 b HOH 8007 1_555 ? ? ? ? ? ? ? 2.861 ? 
metalc84  metalc ?    ? OI CLA .   MG  ? ? ? 1_555 UR HOH .  O   ? ? b CLA 1237 b HOH 8003 1_555 ? ? ? ? ? ? ? 2.843 ? 
metalc85  metalc ?    ? HJ CLA .   MG  ? ? ? 1_555 UR HOH .  O   ? ? b CLA 1216 b HOH 8042 1_555 ? ? ? ? ? ? ? 2.797 ? 
metalc86  metalc ?    ? MJ CLA .   MG  ? ? ? 1_555 UR HOH .  O   ? ? b CLA 1221 b HOH 8122 1_555 ? ? ? ? ? ? ? 2.806 ? 
metalc87  metalc ?    ? NJ CLA .   MG  ? ? ? 1_555 UR HOH .  O   ? ? b CLA 1222 b HOH 8116 1_555 ? ? ? ? ? ? ? 2.841 ? 
metalc88  metalc ?    ? VJ CLA .   MG  ? ? ? 1_555 UR HOH .  O   ? ? b CLA 1231 b HOH 8002 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc89  metalc ?    ? AK CLA .   MG  ? ? ? 1_555 UR HOH .  O   ? ? b CLA 1238 b HOH 8040 1_555 ? ? ? ? ? ? ? 2.784 ? 
metalc90  metalc ?    ? PK CA  .   CA  ? ? ? 1_555 UR HOH .  O   ? ? b CA  6001 b HOH 8088 1_555 ? ? ? ? ? ? ? 2.394 ? 
metalc91  metalc ?    ? PK CA  .   CA  ? ? ? 1_555 UR HOH .  O   ? ? b CA  6001 b HOH 8103 1_555 ? ? ? ? ? ? ? 2.897 ? 
metalc92  metalc ?    ? PK CA  .   CA  ? ? ? 1_555 UR HOH .  O   ? ? b CA  6001 b HOH 8022 1_555 ? ? ? ? ? ? ? 2.327 ? 
metalc93  metalc ?    ? PK CA  .   CA  ? ? ? 1_555 UR HOH .  O   ? ? b CA  6001 b HOH 8017 1_555 ? ? ? ? ? ? ? 2.585 ? 
metalc94  metalc ?    ? WK CLA .   MG  ? ? ? 1_555 AS HOH .  O   ? ? f CLA 1301 j HOH 8001 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc95  metalc ?    ? JL CA  .   CA  ? ? ? 1_555 RR HOH .  O   ? ? l CA  1001 L HOH 8013 1_555 ? ? ? ? ? ? ? 2.484 ? 
metalc96  metalc ?    ? JL CA  .   CA  ? ? ? 1_555 RR HOH .  O   ? ? l CA  1001 L HOH 8007 1_555 ? ? ? ? ? ? ? 2.393 ? 
metalc97  metalc ?    ? JL CA  .   CA  ? ? ? 1_555 BS HOH .  O   ? ? l CA  1001 l HOH 8003 1_555 ? ? ? ? ? ? ? 2.501 ? 
metalc98  metalc ?    ? JL CA  .   CA  ? ? ? 1_555 TR HOH .  O   ? ? l CA  1001 a HOH 8012 1_555 ? ? ? ? ? ? ? 2.449 ? 
metalc99  metalc ?    ? QM CLA .   MG  ? ? ? 1_555 DS HOH .  O   ? ? 1 CLA 1119 1 HOH 8027 1_555 ? ? ? ? ? ? ? 2.890 ? 
metalc100 metalc ?    ? KN CLA .   MG  ? ? ? 1_555 VN LHG .  O5  ? ? 1 CLA 1801 1 LHG 5003 1_555 ? ? ? ? ? ? ? 2.874 ? 
metalc101 metalc ?    ? CO CLA .   MG  ? ? ? 1_555 ES HOH .  O   ? ? 1 CLA 1012 2 HOH 8001 1_555 ? ? ? ? ? ? ? 2.948 ? 
metalc102 metalc ?    ? DO CLA .   MG  ? ? ? 1_555 DS HOH .  O   ? ? 2 CLA 1022 1 HOH 8002 1_555 ? ? ? ? ? ? ? 2.824 ? 
metalc103 metalc ?    ? EO CLA .   MG  ? ? ? 1_555 ES HOH .  O   ? ? 2 CLA 1237 2 HOH 8019 1_555 ? ? ? ? ? ? ? 2.777 ? 
metalc104 metalc ?    ? MP CLA .   MG  ? ? ? 1_555 ES HOH .  O   ? ? 2 CLA 1231 2 HOH 8002 1_555 ? ? ? ? ? ? ? 2.934 ? 
metalc105 metalc ?    ? RP CLA .   MG  ? ? ? 1_555 ES HOH .  O   ? ? 2 CLA 1238 2 HOH 8011 1_555 ? ? ? ? ? ? ? 2.850 ? 
metalc106 metalc ?    ? JQ CLA .   MG  ? ? ? 1_555 KS HOH .  O   ? ? 6 CLA 1301 7 HOH 8001 1_555 ? ? ? ? ? ? ? 2.990 ? 
metalc107 metalc ?    ? NQ 45D .   O02 ? ? ? 1_555 AR CLA .  MG  ? ? h 45D 4020 0 CLA 1502 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc108 metalc ?    ? YQ CA  .   CA  ? ? ? 1_555 BS HOH .  O   ? ? 0 CA  1001 l HOH 8002 1_555 ? ? ? ? ? ? ? 2.873 ? 
metalc109 metalc ?    ? YQ CA  .   CA  ? ? ? 1_555 DS HOH .  O   ? ? 0 CA  1001 1 HOH 8011 1_555 ? ? ? ? ? ? ? 2.608 ? 
metalc110 metalc ?    ? BR CLA .   MG  ? ? ? 1_555 MS HOH .  O   ? ? 0 CLA 1503 0 HOH 8011 1_555 ? ? ? ? ? ? ? 2.835 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PHE 5  B . ? PHE 5  B PRO 6  B ? PRO 6  B 1 -3.77 
2 HIS 98 D . ? HIS 98 D PRO 99 D ? PRO 99 D 1 -4.89 
3 PHE 3  M . ? PHE 5  b PRO 4  M ? PRO 6  b 1 -5.18 
4 HIS 98 O . ? HIS 98 d PRO 99 O ? PRO 99 d 1 -8.11 
5 PHE 5  X . ? PHE 5  2 PRO 6  X ? PRO 6  2 1 -2.37 
6 HIS 97 Z . ? HIS 98 4 PRO 98 Z ? PRO 99 4 1 -5.38 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 4 ? 
AB1 ? 2 ? 
AB2 ? 5 ? 
AB3 ? 3 ? 
AB4 ? 2 ? 
AB5 ? 2 ? 
AB6 ? 3 ? 
AB7 ? 2 ? 
AB8 ? 2 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 2 ? 
AC4 ? 4 ? 
AC5 ? 2 ? 
AC6 ? 5 ? 
AC7 ? 2 ? 
AC8 ? 2 ? 
AC9 ? 3 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
AD4 ? 4 ? 
AD5 ? 2 ? 
AD6 ? 2 ? 
AD7 ? 2 ? 
AD8 ? 4 ? 
AD9 ? 2 ? 
AE1 ? 5 ? 
AE2 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? parallel      
AC3 1 2 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE1 4 5 ? anti-parallel 
AE2 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A  16  ? ASN A  18  ? VAL A 16  ASN A 18  
AA1 2 LYS A  183 ? PRO A  185 ? LYS A 183 PRO A 185 
AA2 1 GLY A  128 ? GLY A  131 ? GLY A 128 GLY A 131 
AA2 2 PHE A  134 ? GLY A  136 ? PHE A 134 GLY A 136 
AA3 1 ILE A  514 ? VAL A  516 ? ILE A 514 VAL A 516 
AA3 2 LYS A  519 ? MET A  522 ? LYS A 519 MET A 522 
AA4 1 GLY A  619 ? VAL A  621 ? GLY A 619 VAL A 621 
AA4 2 VAL A  627 ? HIS A  629 ? VAL A 627 HIS A 629 
AA5 1 ILE B  87  ? ALA B  90  ? ILE B 87  ALA B 90  
AA5 2 VAL B  113 ? ILE B  115 ? VAL B 113 ILE B 115 
AA6 1 TYR B  632 ? ASN B  633 ? TYR B 632 ASN B 633 
AA6 2 GLY B  636 ? VAL B  637 ? GLY B 636 VAL B 637 
AA7 1 SER C  3   ? ILE C  6   ? SER C 4   ILE C 7   
AA7 2 ILE C  64  ? TYR C  67  ? ILE C 65  TYR C 68  
AA8 1 GLU C  26  ? PRO C  29  ? GLU C 27  PRO C 30  
AA8 2 GLN C  37  ? SER C  40  ? GLN C 38  SER C 41  
AA9 1 GLY D  53  ? LEU D  59  ? GLY D 53  LEU D 59  
AA9 2 LYS D  27  ? SER D  34  ? LYS D 27  SER D 34  
AA9 3 LYS D  84  ? VAL D  88  ? LYS D 84  VAL D 88  
AA9 4 VAL D  94  ? HIS D  98  ? VAL D 94  HIS D 98  
AB1 1 GLN D  38  ? GLU D  41  ? GLN D 38  GLU D 41  
AB1 2 ALA D  47  ? MET D  50  ? ALA D 47  MET D 50  
AB2 1 THR E  57  ? PHE E  60  ? THR E 58  PHE E 61  
AB2 2 VAL E  36  ? ARG E  39  ? VAL E 37  ARG E 40  
AB2 3 VAL E  21  ? VAL E  27  ? VAL E 22  VAL E 28  
AB2 4 LYS E  7   ? ILE E  10  ? LYS E 8   ILE E 11  
AB2 5 LEU E  65  ? LEU E  67  ? LEU E 66  LEU E 68  
AB3 1 THR F  8   ? PRO F  9   ? THR F 8   PRO F 9   
AB3 2 LEU F  44  ? CYS F  45  ? LEU F 44  CYS F 45  
AB3 3 PRO F  51  ? HIS F  52  ? PRO F 51  HIS F 52  
AB4 1 GLN J  9   ? ALA J  10  ? GLN L 9   ALA L 10  
AB4 2 LEU J  20  ? SER J  21  ? LEU L 20  SER L 21  
AB5 1 VAL L  16  ? ASP L  17  ? VAL a 16  ASP a 17  
AB5 2 ALA L  184 ? PRO L  185 ? ALA a 184 PRO a 185 
AB6 1 SER L  113 ? ALA L  114 ? SER a 113 ALA a 114 
AB6 2 PHE L  134 ? GLN L  138 ? PHE a 134 GLN a 138 
AB6 3 GLY L  128 ? GLY L  131 ? GLY a 128 GLY a 131 
AB7 1 ILE L  514 ? VAL L  516 ? ILE a 514 VAL a 516 
AB7 2 LYS L  519 ? MET L  522 ? LYS a 519 MET a 522 
AB8 1 GLY L  619 ? VAL L  621 ? GLY a 619 VAL a 621 
AB8 2 VAL L  627 ? HIS L  629 ? VAL a 627 HIS a 629 
AB9 1 ILE M  85  ? ALA M  88  ? ILE b 87  ALA b 90  
AB9 2 VAL M  111 ? ILE M  113 ? VAL b 113 ILE b 115 
AC1 1 TYR M  630 ? ASN M  631 ? TYR b 632 ASN b 633 
AC1 2 GLY M  634 ? VAL M  635 ? GLY b 636 VAL b 637 
AC2 1 ILE N  65  ? ALA N  71  ? ILE c 65  ALA c 71  
AC2 2 SER N  2   ? TYR N  8   ? SER c 2   TYR c 8   
AC2 3 THR O  117 ? LYS O  118 ? THR d 117 LYS d 118 
AC3 1 GLU N  27  ? PRO N  30  ? GLU c 27  PRO c 30  
AC3 2 GLN N  38  ? SER N  41  ? GLN c 38  SER c 41  
AC4 1 GLY O  53  ? LEU O  59  ? GLY d 53  LEU d 59  
AC4 2 LYS O  27  ? SER O  34  ? LYS d 27  SER d 34  
AC4 3 LYS O  84  ? VAL O  88  ? LYS d 84  VAL d 88  
AC4 4 VAL O  94  ? HIS O  98  ? VAL d 94  HIS d 98  
AC5 1 GLN O  38  ? GLU O  41  ? GLN d 38  GLU d 41  
AC5 2 ALA O  47  ? MET O  50  ? ALA d 47  MET d 50  
AC6 1 THR P  57  ? PHE P  60  ? THR e 58  PHE e 61  
AC6 2 VAL P  36  ? ARG P  39  ? VAL e 37  ARG e 40  
AC6 3 VAL P  21  ? VAL P  27  ? VAL e 22  VAL e 28  
AC6 4 LYS P  7   ? ILE P  10  ? LYS e 8   ILE e 11  
AC6 5 LEU P  65  ? LEU P  67  ? LEU e 66  LEU e 68  
AC7 1 GLN U  9   ? ALA U  10  ? GLN l 9   ALA l 10  
AC7 2 LEU U  20  ? SER U  21  ? LEU l 20  SER l 21  
AC8 1 VAL W  9   ? ASP W  10  ? VAL 1 16  ASP 1 17  
AC8 2 ALA W  177 ? PRO W  178 ? ALA 1 184 PRO 1 185 
AC9 1 SER W  106 ? ALA W  107 ? SER 1 113 ALA 1 114 
AC9 2 PHE W  127 ? GLN W  131 ? PHE 1 134 GLN 1 138 
AC9 3 GLY W  121 ? GLY W  124 ? GLY 1 128 GLY 1 131 
AD1 1 ILE W  507 ? VAL W  509 ? ILE 1 514 VAL 1 516 
AD1 2 LYS W  512 ? MET W  515 ? LYS 1 519 MET 1 522 
AD2 1 GLY W  612 ? VAL W  614 ? GLY 1 619 VAL 1 621 
AD2 2 VAL W  620 ? HIS W  622 ? VAL 1 627 HIS 1 629 
AD3 1 ILE X  87  ? ALA X  90  ? ILE 2 87  ALA 2 90  
AD3 2 VAL X  113 ? ILE X  115 ? VAL 2 113 ILE 2 115 
AD4 1 LEU X  452 ? ILE X  453 ? LEU 2 452 ILE 2 453 
AD4 2 PRO BA 51  ? LEU BA 53  ? PRO 6 51  LEU 6 53  
AD4 3 LEU BA 44  ? CYS BA 45  ? LEU 6 44  CYS 6 45  
AD4 4 THR BA 8   ? PRO BA 9   ? THR 6 8   PRO 6 9   
AD5 1 TYR X  632 ? ASN X  633 ? TYR 2 632 ASN 2 633 
AD5 2 GLY X  636 ? VAL X  637 ? GLY 2 636 VAL 2 637 
AD6 1 SER Y  3   ? ILE Y  6   ? SER 3 4   ILE 3 7   
AD6 2 ILE Y  64  ? TYR Y  67  ? ILE 3 65  TYR 3 68  
AD7 1 GLU Y  26  ? PRO Y  29  ? GLU 3 27  PRO 3 30  
AD7 2 GLN Y  37  ? SER Y  40  ? GLN 3 38  SER 3 41  
AD8 1 GLY Z  52  ? LEU Z  58  ? GLY 4 53  LEU 4 59  
AD8 2 LYS Z  26  ? SER Z  33  ? LYS 4 27  SER 4 34  
AD8 3 LYS Z  83  ? VAL Z  87  ? LYS 4 84  VAL 4 88  
AD8 4 VAL Z  93  ? HIS Z  97  ? VAL 4 94  HIS 4 98  
AD9 1 GLN Z  37  ? GLU Z  40  ? GLN 4 38  GLU 4 41  
AD9 2 ALA Z  46  ? MET Z  49  ? ALA 4 47  MET 4 50  
AE1 1 THR AA 57  ? PHE AA 60  ? THR 5 58  PHE 5 61  
AE1 2 VAL AA 36  ? ARG AA 39  ? VAL 5 37  ARG 5 40  
AE1 3 VAL AA 21  ? VAL AA 27  ? VAL 5 22  VAL 5 28  
AE1 4 LYS AA 7   ? ILE AA 10  ? LYS 5 8   ILE 5 11  
AE1 5 LEU AA 65  ? LEU AA 67  ? LEU 5 66  LEU 5 68  
AE2 1 GLN FA 6   ? ALA FA 7   ? GLN 0 9   ALA 0 10  
AE2 2 LEU FA 17  ? SER FA 18  ? LEU 0 20  SER 0 21  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASP A  17  ? N ASP A 17  O ALA A  184 ? O ALA A 184 
AA2 1 2 N GLY A  128 ? N GLY A 128 O GLY A  136 ? O GLY A 136 
AA3 1 2 N ILE A  514 ? N ILE A 514 O ALA A  521 ? O ALA A 521 
AA4 1 2 N THR A  620 ? N THR A 620 O THR A  628 ? O THR A 628 
AA5 1 2 N ALA B  88  ? N ALA B 88  O ASN B  114 ? O ASN B 114 
AA6 1 2 N ASN B  633 ? N ASN B 633 O GLY B  636 ? O GLY B 636 
AA7 1 2 N SER C  3   ? N SER C 4   O TYR C  67  ? O TYR C 68  
AA8 1 2 N VAL C  28  ? N VAL C 29  O ILE C  38  ? O ILE C 39  
AA9 1 2 O GLY D  53  ? O GLY D 53  N SER D  34  ? N SER D 34  
AA9 2 3 N LYS D  27  ? N LYS D 27  O VAL D  88  ? O VAL D 88  
AA9 3 4 N ARG D  87  ? N ARG D 87  O GLN D  95  ? O GLN D 95  
AB1 1 2 N GLN D  38  ? N GLN D 38  O MET D  50  ? O MET D 50  
AB2 1 2 O ASN E  58  ? O ASN E 59  N VAL E  38  ? N VAL E 39  
AB2 2 3 O ILE E  37  ? O ILE E 38  N SER E  26  ? N SER E 27  
AB2 3 4 O GLY E  22  ? O GLY E 23  N VAL E  8   ? N VAL E 9   
AB2 4 5 N ARG E  9   ? N ARG E 10  O GLU E  66  ? O GLU E 67  
AB3 1 2 N THR F  8   ? N THR F 8   O CYS F  45  ? O CYS F 45  
AB3 2 3 N LEU F  44  ? N LEU F 44  O HIS F  52  ? O HIS F 52  
AB4 1 2 N GLN J  9   ? N GLN L 9   O SER J  21  ? O SER L 21  
AB5 1 2 N ASP L  17  ? N ASP a 17  O ALA L  184 ? O ALA a 184 
AB6 1 2 N ALA L  114 ? N ALA a 114 O ILE L  137 ? O ILE a 137 
AB6 2 3 O GLY L  136 ? O GLY a 136 N GLY L  128 ? N GLY a 128 
AB7 1 2 N ILE L  514 ? N ILE a 514 O MET L  522 ? O MET a 522 
AB8 1 2 N THR L  620 ? N THR a 620 O THR L  628 ? O THR a 628 
AB9 1 2 N ALA M  86  ? N ALA b 88  O ASN M  112 ? O ASN b 114 
AC1 1 2 N ASN M  631 ? N ASN b 633 O GLY M  634 ? O GLY b 636 
AC2 1 2 O TYR N  68  ? O TYR c 68  N SER N  4   ? N SER c 4   
AC2 2 3 N ILE N  7   ? N ILE c 7   O LYS O  118 ? O LYS d 118 
AC3 1 2 N VAL N  29  ? N VAL c 29  O ILE N  39  ? O ILE c 39  
AC4 1 2 O GLY O  53  ? O GLY d 53  N SER O  34  ? N SER d 34  
AC4 2 3 N ALA O  29  ? N ALA d 29  O TYR O  86  ? O TYR d 86  
AC4 3 4 N ARG O  87  ? N ARG d 87  O GLN O  95  ? O GLN d 95  
AC5 1 2 N GLN O  38  ? N GLN d 38  O MET O  50  ? O MET d 50  
AC6 1 2 O ASN P  58  ? O ASN e 59  N VAL P  38  ? N VAL e 39  
AC6 2 3 O ILE P  37  ? O ILE e 38  N SER P  26  ? N SER e 27  
AC6 3 4 O GLY P  22  ? O GLY e 23  N VAL P  8   ? N VAL e 9   
AC6 4 5 N ARG P  9   ? N ARG e 10  O GLU P  66  ? O GLU e 67  
AC7 1 2 N GLN U  9   ? N GLN l 9   O SER U  21  ? O SER l 21  
AC8 1 2 N ASP W  10  ? N ASP 1 17  O ALA W  177 ? O ALA 1 184 
AC9 1 2 N ALA W  107 ? N ALA 1 114 O ILE W  130 ? O ILE 1 137 
AC9 2 3 O PHE W  127 ? O PHE 1 134 N VAL W  123 ? N VAL 1 130 
AD1 1 2 N ILE W  507 ? N ILE 1 514 O MET W  515 ? O MET 1 522 
AD2 1 2 N THR W  613 ? N THR 1 620 O THR W  621 ? O THR 1 628 
AD3 1 2 N HIS X  89  ? N HIS 2 89  O ASN X  114 ? O ASN 2 114 
AD4 1 2 N LEU X  452 ? N LEU 2 452 O LEU BA 53  ? O LEU 6 53  
AD4 2 3 O HIS BA 52  ? O HIS 6 52  N LEU BA 44  ? N LEU 6 44  
AD4 3 4 O CYS BA 45  ? O CYS 6 45  N THR BA 8   ? N THR 6 8   
AD5 1 2 N ASN X  633 ? N ASN 2 633 O GLY X  636 ? O GLY 2 636 
AD6 1 2 N SER Y  3   ? N SER 3 4   O TYR Y  67  ? O TYR 3 68  
AD7 1 2 N VAL Y  28  ? N VAL 3 29  O ILE Y  38  ? O ILE 3 39  
AD8 1 2 O LEU Z  56  ? O LEU 4 57  N ILE Z  29  ? N ILE 4 30  
AD8 2 3 N THR Z  30  ? N THR 4 31  O LYS Z  83  ? O LYS 4 84  
AD8 3 4 N ARG Z  86  ? N ARG 4 87  O GLN Z  94  ? O GLN 4 95  
AD9 1 2 N PHE Z  39  ? N PHE 4 40  O ALA Z  47  ? O ALA 4 48  
AE1 1 2 O ASN AA 58  ? O ASN 5 59  N VAL AA 38  ? N VAL 5 39  
AE1 2 3 O ILE AA 37  ? O ILE 5 38  N SER AA 26  ? N SER 5 27  
AE1 3 4 O GLY AA 22  ? O GLY 5 23  N VAL AA 8   ? N VAL 5 9   
AE1 4 5 N ARG AA 9   ? N ARG 5 10  O GLU AA 66  ? O GLU 5 67  
AE2 1 2 N GLN FA 6   ? N GLN 0 9   O SER FA 18  ? O SER 0 21  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CLA 1011 ? 19 'binding site for residue CLA A 1011'                 
AC2 Software A CLA 1013 ? 25 'binding site for residue CLA A 1013'                 
AC3 Software A CLA 1102 ? 15 'binding site for residue CLA A 1102'                 
AC4 Software A CLA 1103 ? 21 'binding site for residue CLA A 1103'                 
AC5 Software A CLA 1104 ? 10 'binding site for residue CLA A 1104'                 
AC6 Software A CLA 1105 ? 16 'binding site for residue CLA A 1105'                 
AC7 Software A CLA 1106 ? 19 'binding site for residue CLA A 1106'                 
AC8 Software A CLA 1107 ? 16 'binding site for residue CLA A 1107'                 
AC9 Software A CLA 1108 ? 13 'binding site for residue CLA A 1108'                 
AD1 Software A CLA 1109 ? 16 'binding site for residue CLA A 1109'                 
AD2 Software A CLA 1110 ? 17 'binding site for residue CLA A 1110'                 
AD3 Software A CLA 1111 ? 18 'binding site for residue CLA A 1111'                 
AD4 Software A CLA 1112 ? 19 'binding site for residue CLA A 1112'                 
AD5 Software A CLA 1113 ? 14 'binding site for residue CLA A 1113'                 
AD6 Software A CLA 1114 ? 10 'binding site for residue CLA A 1114'                 
AD7 Software A CLA 1115 ? 16 'binding site for residue CLA A 1115'                 
AD8 Software A CLA 1116 ? 19 'binding site for residue CLA A 1116'                 
AD9 Software A CLA 1117 ? 21 'binding site for residue CLA A 1117'                 
AE1 Software A CLA 1118 ? 18 'binding site for residue CLA A 1118'                 
AE2 Software A CLA 1119 ? 18 'binding site for residue CLA A 1119'                 
AE3 Software A CLA 1120 ? 14 'binding site for residue CLA A 1120'                 
AE4 Software A CLA 1121 ? 13 'binding site for residue CLA A 1121'                 
AE5 Software A CLA 1122 ? 17 'binding site for residue CLA A 1122'                 
AE6 Software A CLA 1123 ? 21 'binding site for residue CLA A 1123'                 
AE7 Software A CLA 1124 ? 20 'binding site for residue CLA A 1124'                 
AE8 Software A CLA 1125 ? 15 'binding site for residue CLA A 1125'                 
AE9 Software A CLA 1126 ? 17 'binding site for residue CLA A 1126'                 
AF1 Software A CLA 1127 ? 16 'binding site for residue CLA A 1127'                 
AF2 Software A CLA 1128 ? 20 'binding site for residue CLA A 1128'                 
AF3 Software A CLA 1129 ? 18 'binding site for residue CLA A 1129'                 
AF4 Software A CLA 1131 ? 14 'binding site for residue CLA A 1131'                 
AF5 Software A CLA 1132 ? 24 'binding site for residue CLA A 1132'                 
AF6 Software A CLA 1133 ? 18 'binding site for residue CLA A 1133'                 
AF7 Software A CLA 1134 ? 11 'binding site for residue CLA A 1134'                 
AF8 Software A CLA 1135 ? 22 'binding site for residue CLA A 1135'                 
AF9 Software A CLA 1136 ? 19 'binding site for residue CLA A 1136'                 
AG1 Software A CLA 1137 ? 17 'binding site for residue CLA A 1137'                 
AG2 Software A CLA 1138 ? 15 'binding site for residue CLA A 1138'                 
AG3 Software A CLA 1139 ? 22 'binding site for residue CLA A 1139'                 
AG4 Software A CLA 1140 ? 15 'binding site for residue CLA A 1140'                 
AG5 Software A PQN 2001 ? 11 'binding site for residue PQN A 2001'                 
AG6 Software A SF4 3001 ? 8  'binding site for residue SF4 A 3001'                 
AG7 Software A BCR 4001 ? 15 'binding site for residue BCR A 4001'                 
AG8 Software A BCR 4002 ? 10 'binding site for residue BCR A 4002'                 
AG9 Software A BCR 4003 ? 8  'binding site for residue BCR A 4003'                 
AH1 Software A BCR 4007 ? 13 'binding site for residue BCR A 4007'                 
AH2 Software A BCR 4008 ? 10 'binding site for residue BCR A 4008'                 
AH3 Software A BCR 4019 ? 5  'binding site for residue BCR A 4019'                 
AH4 Software A LHG 5001 ? 17 'binding site for residue LHG A 5001'                 
AH5 Software A LMG 5002 ? 9  'binding site for residue LMG A 5002'                 
AH6 Software A LHG 5003 ? 19 'binding site for residue LHG A 5003'                 
AH7 Software A LMG 5004 ? 11 'binding site for residue LMG A 5004'                 
AH8 Software A ACT 7001 ? 4  'binding site for residue ACT A 7001'                 
AH9 Software B CLA 1022 ? 23 'binding site for residue CLA B 1022'                 
AI1 Software A CLA 1130 ? 21 'binding site for residue CLA A 1130'                 
AI2 Software A CLA 1101 ? 14 'binding site for residue CLA A 1101'                 
AI3 Software A BCR 4012 ? 13 'binding site for residue BCR A 4012'                 
AI4 Software A LMG 5008 ? 8  'binding site for residue LMG A 5008'                 
AI5 Software A CLA 1801 ? 18 'binding site for residue CLA A 1801'                 
AI6 Software A LHG 5005 ? 11 'binding site for residue LHG A 5005'                 
AI7 Software A LHG 5007 ? 13 'binding site for residue LHG A 5007'                 
AI8 Software A LHG 5006 ? 9  'binding site for residue LHG A 5006'                 
AI9 Software A CLA 1012 ? 22 'binding site for residue CLA A 1012'                 
AJ1 Software B CLA 1237 ? 18 'binding site for residue CLA B 1237'                 
AJ2 Software B 45D 4011 ? 14 'binding site for residue 45D B 4011'                 
AJ3 Software B CL  6000 ? 4  'binding site for residue CL B 6000'                  
AJ4 Software B CLA 1021 ? 20 'binding site for residue CLA B 1021'                 
AJ5 Software B CLA 1023 ? 21 'binding site for residue CLA B 1023'                 
AJ6 Software B CLA 1201 ? 23 'binding site for residue CLA B 1201'                 
AJ7 Software B CLA 1202 ? 21 'binding site for residue CLA B 1202'                 
AJ8 Software B CLA 1203 ? 13 'binding site for residue CLA B 1203'                 
AJ9 Software B CLA 1204 ? 21 'binding site for residue CLA B 1204'                 
AK1 Software B CLA 1205 ? 17 'binding site for residue CLA B 1205'                 
AK2 Software B CLA 1206 ? 24 'binding site for residue CLA B 1206'                 
AK3 Software B CLA 1208 ? 14 'binding site for residue CLA B 1208'                 
AK4 Software B CLA 1209 ? 10 'binding site for residue CLA B 1209'                 
AK5 Software B CLA 1210 ? 19 'binding site for residue CLA B 1210'                 
AK6 Software B CLA 1211 ? 18 'binding site for residue CLA B 1211'                 
AK7 Software B CLA 1212 ? 13 'binding site for residue CLA B 1212'                 
AK8 Software B CLA 1213 ? 11 'binding site for residue CLA B 1213'                 
AK9 Software B CLA 1214 ? 18 'binding site for residue CLA B 1214'                 
AL1 Software B CLA 1215 ? 19 'binding site for residue CLA B 1215'                 
AL2 Software B CLA 1216 ? 16 'binding site for residue CLA B 1216'                 
AL3 Software B CLA 1217 ? 12 'binding site for residue CLA B 1217'                 
AL4 Software B CLA 1218 ? 10 'binding site for residue CLA B 1218'                 
AL5 Software B CLA 1219 ? 9  'binding site for residue CLA B 1219'                 
AL6 Software B CLA 1220 ? 13 'binding site for residue CLA B 1220'                 
AL7 Software B CLA 1221 ? 19 'binding site for residue CLA B 1221'                 
AL8 Software B CLA 1222 ? 17 'binding site for residue CLA B 1222'                 
AL9 Software B CLA 1223 ? 15 'binding site for residue CLA B 1223'                 
AM1 Software B CLA 1224 ? 17 'binding site for residue CLA B 1224'                 
AM2 Software B CLA 1225 ? 20 'binding site for residue CLA B 1225'                 
AM3 Software B CLA 1226 ? 20 'binding site for residue CLA B 1226'                 
AM4 Software B CLA 1227 ? 14 'binding site for residue CLA B 1227'                 
AM5 Software B CLA 1228 ? 15 'binding site for residue CLA B 1228'                 
AM6 Software B CLA 1229 ? 14 'binding site for residue CLA B 1229'                 
AM7 Software B CLA 1231 ? 14 'binding site for residue CLA B 1231'                 
AM8 Software B CLA 1232 ? 7  'binding site for residue CLA B 1232'                 
AM9 Software B CLA 1234 ? 21 'binding site for residue CLA B 1234'                 
AN1 Software B CLA 1235 ? 17 'binding site for residue CLA B 1235'                 
AN2 Software B CLA 1236 ? 14 'binding site for residue CLA B 1236'                 
AN3 Software B CLA 1238 ? 24 'binding site for residue CLA B 1238'                 
AN4 Software B CLA 1239 ? 19 'binding site for residue CLA B 1239'                 
AN5 Software B CLA 1240 ? 10 'binding site for residue CLA B 1240'                 
AN6 Software B PQN 2002 ? 11 'binding site for residue PQN B 2002'                 
AN7 Software B BCR 4004 ? 10 'binding site for residue BCR B 4004'                 
AN8 Software B BCR 4005 ? 10 'binding site for residue BCR B 4005'                 
AN9 Software B ECH 4006 ? 10 'binding site for residue ECH B 4006'                 
AO1 Software B BCR 4010 ? 13 'binding site for residue BCR B 4010'                 
AO2 Software B BCR 4017 ? 12 'binding site for residue BCR B 4017'                 
AO3 Software B BCR 4018 ? 11 'binding site for residue BCR B 4018'                 
AO4 Software B LMG 5002 ? 15 'binding site for residue LMG B 5002'                 
AO5 Software B LHG 5004 ? 16 'binding site for residue LHG B 5004'                 
AO6 Software B LMG 5005 ? 2  'binding site for residue LMG B 5005'                 
AO7 Software B LHG 5006 ? 6  'binding site for residue LHG B 5006'                 
AO8 Software B SQD 5008 ? 12 'binding site for residue SQD B 5008'                 
AO9 Software B CA  6001 ? 7  'binding site for residue CA B 6001'                  
AP1 Software B MG  6002 ? 4  'binding site for residue MG B 6002'                  
AP2 Software B ACT 7002 ? 3  'binding site for residue ACT B 7002'                 
AP3 Software B BCR 4014 ? 9  'binding site for residue BCR B 4014'                 
AP4 Software B CLA 1207 ? 18 'binding site for residue CLA B 1207'                 
AP5 Software B CLA 1230 ? 21 'binding site for residue CLA B 1230'                 
AP6 Software B ACT 7001 ? 4  'binding site for residue ACT B 7001'                 
AP7 Software C SF4 3002 ? 10 'binding site for residue SF4 C 3002'                 
AP8 Software C SF4 3003 ? 10 'binding site for residue SF4 C 3003'                 
AP9 Software F LHG 5002 ? 4  'binding site for residue LHG F 5002'                 
AQ1 Software F CLA 1301 ? 14 'binding site for residue CLA F 1301'                 
AQ2 Software F CLA 1302 ? 15 'binding site for residue CLA F 1302'                 
AQ3 Software F ZEX 4016 ? 9  'binding site for residue ZEX F 4016'                 
AQ4 Software F SQD 5001 ? 13 'binding site for residue SQD F 5001'                 
AQ5 Software F LMT 6001 ? 6  'binding site for residue LMT F 6001'                 
AQ6 Software I BCR 4018 ? 12 'binding site for residue BCR I 4018'                 
AQ7 Software I EQ3 4020 ? 15 'binding site for residue EQ3 I 4020'                 
AQ8 Software J ZEX 4015 ? 16 'binding site for residue ZEX J 4015'                 
AQ9 Software J CLA 1302 ? 12 'binding site for residue CLA J 1302'                 
AR1 Software J CLA 1303 ? 6  'binding site for residue CLA J 1303'                 
AR2 Software J BCR 4013 ? 11 'binding site for residue BCR J 4013'                 
AR3 Software K CLA 1401 ? 17 'binding site for residue CLA K 1401'                 
AR4 Software K CLA 1402 ? 14 'binding site for residue CLA K 1402'                 
AR5 Software K BCR 4001 ? 9  'binding site for residue BCR K 4001'                 
AR6 Software K LMG 5009 ? 15 'binding site for residue LMG K 5009'                 
AR7 Software L CA  1001 ? 7  'binding site for residue CA L 1001'                  
AR8 Software L CLA 1501 ? 17 'binding site for residue CLA L 1501'                 
AR9 Software L CLA 1502 ? 19 'binding site for residue CLA L 1502'                 
AS1 Software L CLA 1503 ? 17 'binding site for residue CLA L 1503'                 
AS2 Software L BCR 4019 ? 13 'binding site for residue BCR L 4019'                 
AS3 Software L BCR 4022 ? 17 'binding site for residue BCR L 4022'                 
AS4 Software L SQD 5001 ? 11 'binding site for residue SQD L 5001'                 
AS5 Software L DGD 5004 ? 10 'binding site for residue DGD L 5004'                 
AS6 Software L LHG 5005 ? 15 'binding site for residue LHG L 5005'                 
AS7 Software L LMT 6001 ? 8  'binding site for residue LMT L 6001'                 
AS8 Software L SQD 5002 ? 14 'binding site for residue SQD L 5002'                 
AS9 Software M ECH 4021 ? 9  'binding site for residue ECH M 4021'                 
AT1 Software M LHG 5001 ? 8  'binding site for residue LHG M 5001'                 
AT2 Software a CLA 1011 ? 22 'binding site for residue CLA a 1011'                 
AT3 Software a CLA 1013 ? 23 'binding site for residue CLA a 1013'                 
AT4 Software b CLA 1022 ? 22 'binding site for residue CLA b 1022'                 
AT5 Software a CLA 1102 ? 16 'binding site for residue CLA a 1102'                 
AT6 Software a CLA 1103 ? 23 'binding site for residue CLA a 1103'                 
AT7 Software a CLA 1104 ? 10 'binding site for residue CLA a 1104'                 
AT8 Software a CLA 1105 ? 16 'binding site for residue CLA a 1105'                 
AT9 Software a CLA 1106 ? 17 'binding site for residue CLA a 1106'                 
AU1 Software a CLA 1107 ? 15 'binding site for residue CLA a 1107'                 
AU2 Software a CLA 1108 ? 12 'binding site for residue CLA a 1108'                 
AU3 Software a CLA 1109 ? 18 'binding site for residue CLA a 1109'                 
AU4 Software a CLA 1110 ? 12 'binding site for residue CLA a 1110'                 
AU5 Software a CLA 1111 ? 16 'binding site for residue CLA a 1111'                 
AU6 Software a CLA 1112 ? 20 'binding site for residue CLA a 1112'                 
AU7 Software a CLA 1113 ? 12 'binding site for residue CLA a 1113'                 
AU8 Software a CLA 1114 ? 6  'binding site for residue CLA a 1114'                 
AU9 Software a CLA 1115 ? 15 'binding site for residue CLA a 1115'                 
AV1 Software a CLA 1116 ? 16 'binding site for residue CLA a 1116'                 
AV2 Software a CLA 1117 ? 18 'binding site for residue CLA a 1117'                 
AV3 Software a CLA 1118 ? 17 'binding site for residue CLA a 1118'                 
AV4 Software a CLA 1119 ? 18 'binding site for residue CLA a 1119'                 
AV5 Software a CLA 1120 ? 13 'binding site for residue CLA a 1120'                 
AV6 Software a CLA 1121 ? 9  'binding site for residue CLA a 1121'                 
AV7 Software a CLA 1122 ? 14 'binding site for residue CLA a 1122'                 
AV8 Software a CLA 1123 ? 18 'binding site for residue CLA a 1123'                 
AV9 Software a CLA 1124 ? 12 'binding site for residue CLA a 1124'                 
AW1 Software a CLA 1125 ? 17 'binding site for residue CLA a 1125'                 
AW2 Software a CLA 1126 ? 18 'binding site for residue CLA a 1126'                 
AW3 Software a CLA 1127 ? 16 'binding site for residue CLA a 1127'                 
AW4 Software a CLA 1128 ? 19 'binding site for residue CLA a 1128'                 
AW5 Software a CLA 1129 ? 17 'binding site for residue CLA a 1129'                 
AW6 Software a CLA 1131 ? 14 'binding site for residue CLA a 1131'                 
AW7 Software a CLA 1133 ? 12 'binding site for residue CLA a 1133'                 
AW8 Software a CLA 1134 ? 9  'binding site for residue CLA a 1134'                 
AW9 Software a CLA 1135 ? 19 'binding site for residue CLA a 1135'                 
AX1 Software a CLA 1136 ? 16 'binding site for residue CLA a 1136'                 
AX2 Software a CLA 1137 ? 10 'binding site for residue CLA a 1137'                 
AX3 Software a CLA 1139 ? 24 'binding site for residue CLA a 1139'                 
AX4 Software a CLA 1140 ? 17 'binding site for residue CLA a 1140'                 
AX5 Software a CLA 1801 ? 12 'binding site for residue CLA a 1801'                 
AX6 Software a PQN 2001 ? 11 'binding site for residue PQN a 2001'                 
AX7 Software a SF4 3001 ? 7  'binding site for residue SF4 a 3001'                 
AX8 Software a BCR 4001 ? 15 'binding site for residue BCR a 4001'                 
AX9 Software a BCR 4002 ? 11 'binding site for residue BCR a 4002'                 
AY1 Software a BCR 4003 ? 11 'binding site for residue BCR a 4003'                 
AY2 Software a BCR 4007 ? 8  'binding site for residue BCR a 4007'                 
AY3 Software a BCR 4008 ? 11 'binding site for residue BCR a 4008'                 
AY4 Software a BCR 4019 ? 5  'binding site for residue BCR a 4019'                 
AY5 Software a LHG 5001 ? 20 'binding site for residue LHG a 5001'                 
AY6 Software a LMG 5002 ? 12 'binding site for residue LMG a 5002'                 
AY7 Software a LHG 5003 ? 13 'binding site for residue LHG a 5003'                 
AY8 Software a LMG 5004 ? 8  'binding site for residue LMG a 5004'                 
AY9 Software a LHG 5005 ? 8  'binding site for residue LHG a 5005'                 
AZ1 Software a ACT 7001 ? 1  'binding site for residue ACT a 7001'                 
AZ2 Software a CLA 1130 ? 20 'binding site for residue CLA a 1130'                 
AZ3 Software a CLA 1138 ? 16 'binding site for residue CLA a 1138'                 
AZ4 Software a CLA 1101 ? 19 'binding site for residue CLA a 1101'                 
AZ5 Software a BCR 4012 ? 14 'binding site for residue BCR a 4012'                 
AZ6 Software a CLA 1132 ? 24 'binding site for residue CLA a 1132'                 
AZ7 Software a LHG 5007 ? 2  'binding site for residue LHG a 5007'                 
AZ8 Software a CLA 1012 ? 19 'binding site for residue CLA a 1012'                 
AZ9 Software b CLA 1237 ? 16 'binding site for residue CLA b 1237'                 
BC1 Software b ECH 4011 ? 17 'binding site for residue ECH b 4011'                 
BC2 Software b CL  6000 ? 5  'binding site for residue CL b 6000'                  
BC3 Software b CLA 1021 ? 20 'binding site for residue CLA b 1021'                 
BC4 Software b CLA 1023 ? 23 'binding site for residue CLA b 1023'                 
BC5 Software b CLA 1202 ? 23 'binding site for residue CLA b 1202'                 
BC6 Software b CLA 1203 ? 13 'binding site for residue CLA b 1203'                 
BC7 Software b CLA 1204 ? 22 'binding site for residue CLA b 1204'                 
BC8 Software b CLA 1205 ? 14 'binding site for residue CLA b 1205'                 
BC9 Software b CLA 1206 ? 21 'binding site for residue CLA b 1206'                 
BD1 Software b CLA 1207 ? 14 'binding site for residue CLA b 1207'                 
BD2 Software b CLA 1208 ? 14 'binding site for residue CLA b 1208'                 
BD3 Software b CLA 1209 ? 12 'binding site for residue CLA b 1209'                 
BD4 Software b CLA 1210 ? 22 'binding site for residue CLA b 1210'                 
BD5 Software b CLA 1211 ? 19 'binding site for residue CLA b 1211'                 
BD6 Software b CLA 1212 ? 22 'binding site for residue CLA b 1212'                 
BD7 Software b CLA 1213 ? 14 'binding site for residue CLA b 1213'                 
BD8 Software b CLA 1214 ? 21 'binding site for residue CLA b 1214'                 
BD9 Software b CLA 1215 ? 23 'binding site for residue CLA b 1215'                 
BE1 Software b CLA 1216 ? 17 'binding site for residue CLA b 1216'                 
BE2 Software b CLA 1217 ? 11 'binding site for residue CLA b 1217'                 
BE3 Software b CLA 1218 ? 10 'binding site for residue CLA b 1218'                 
BE4 Software b CLA 1219 ? 9  'binding site for residue CLA b 1219'                 
BE5 Software b CLA 1220 ? 13 'binding site for residue CLA b 1220'                 
BE6 Software b CLA 1221 ? 21 'binding site for residue CLA b 1221'                 
BE7 Software b CLA 1222 ? 17 'binding site for residue CLA b 1222'                 
BE8 Software b CLA 1223 ? 18 'binding site for residue CLA b 1223'                 
BE9 Software b CLA 1224 ? 16 'binding site for residue CLA b 1224'                 
BF1 Software b CLA 1225 ? 18 'binding site for residue CLA b 1225'                 
BF2 Software b CLA 1226 ? 22 'binding site for residue CLA b 1226'                 
BF3 Software b CLA 1227 ? 14 'binding site for residue CLA b 1227'                 
BF4 Software b CLA 1228 ? 17 'binding site for residue CLA b 1228'                 
BF5 Software b CLA 1229 ? 17 'binding site for residue CLA b 1229'                 
BF6 Software b CLA 1231 ? 13 'binding site for residue CLA b 1231'                 
BF7 Software b CLA 1232 ? 10 'binding site for residue CLA b 1232'                 
BF8 Software b CLA 1234 ? 20 'binding site for residue CLA b 1234'                 
BF9 Software b CLA 1235 ? 17 'binding site for residue CLA b 1235'                 
BG1 Software b CLA 1236 ? 17 'binding site for residue CLA b 1236'                 
BG2 Software b CLA 1238 ? 22 'binding site for residue CLA b 1238'                 
BG3 Software b CLA 1239 ? 14 'binding site for residue CLA b 1239'                 
BG4 Software b CLA 1240 ? 9  'binding site for residue CLA b 1240'                 
BG5 Software b PQN 2002 ? 12 'binding site for residue PQN b 2002'                 
BG6 Software b BCR 4004 ? 8  'binding site for residue BCR b 4004'                 
BG7 Software b BCR 4005 ? 9  'binding site for residue BCR b 4005'                 
BG8 Software b ECH 4006 ? 10 'binding site for residue ECH b 4006'                 
BG9 Software b BCR 4010 ? 16 'binding site for residue BCR b 4010'                 
BH1 Software b BCR 4017 ? 8  'binding site for residue BCR b 4017'                 
BH2 Software b BCR 4018 ? 10 'binding site for residue BCR b 4018'                 
BH3 Software b LMG 5002 ? 21 'binding site for residue LMG b 5002'                 
BH4 Software b LHG 5004 ? 14 'binding site for residue LHG b 5004'                 
BH5 Software b LMG 5005 ? 5  'binding site for residue LMG b 5005'                 
BH6 Software b SQD 5006 ? 6  'binding site for residue SQD b 5006'                 
BH7 Software b LMG 5007 ? 8  'binding site for residue LMG b 5007'                 
BH8 Software b CA  6001 ? 7  'binding site for residue CA b 6001'                  
BH9 Software b MG  6002 ? 5  'binding site for residue MG b 6002'                  
BI1 Software b BCR 4014 ? 14 'binding site for residue BCR b 4014'                 
BI2 Software b CLA 1230 ? 19 'binding site for residue CLA b 1230'                 
BI3 Software b CLA 1201 ? 18 'binding site for residue CLA b 1201'                 
BI4 Software c SF4 3002 ? 11 'binding site for residue SF4 c 3002'                 
BI5 Software c SF4 3003 ? 9  'binding site for residue SF4 c 3003'                 
BI6 Software f CLA 1301 ? 12 'binding site for residue CLA f 1301'                 
BI7 Software f CLA 1302 ? 9  'binding site for residue CLA f 1302'                 
BI8 Software f BCR 4016 ? 8  'binding site for residue BCR f 4016'                 
BI9 Software f SQD 5001 ? 15 'binding site for residue SQD f 5001'                 
BJ1 Software i BCR 4018 ? 12 'binding site for residue BCR i 4018'                 
BJ2 Software i ECH 4020 ? 11 'binding site for residue ECH i 4020'                 
BJ3 Software j BCR 4013 ? 14 'binding site for residue BCR j 4013'                 
BJ4 Software j ZEX 4015 ? 17 'binding site for residue ZEX j 4015'                 
BJ5 Software j CLA 1302 ? 7  'binding site for residue CLA j 1302'                 
BJ6 Software j CLA 1303 ? 5  'binding site for residue CLA j 1303'                 
BJ7 Software k CLA 1401 ? 3  'binding site for residue CLA k 1401'                 
BJ8 Software k CLA 1402 ? 11 'binding site for residue CLA k 1402'                 
BJ9 Software k BCR 4001 ? 12 'binding site for residue BCR k 4001'                 
BK1 Software l CA  1001 ? 7  'binding site for residue CA l 1001'                  
BK2 Software l CLA 1501 ? 13 'binding site for residue CLA l 1501'                 
BK3 Software l CLA 1502 ? 19 'binding site for residue CLA l 1502'                 
BK4 Software l CLA 1503 ? 15 'binding site for residue CLA l 1503'                 
BK5 Software l BCR 4019 ? 15 'binding site for residue BCR l 4019'                 
BK6 Software l BCR 4022 ? 13 'binding site for residue BCR l 4022'                 
BK7 Software l LHG 5001 ? 14 'binding site for residue LHG l 5001'                 
BK8 Software l LHG 5003 ? 10 'binding site for residue LHG l 5003'                 
BK9 Software l LHG 5004 ? 8  'binding site for residue LHG l 5004'                 
BL1 Software l LMT 6001 ? 6  'binding site for residue LMT l 6001'                 
BL2 Software l LHG 5002 ? 11 'binding site for residue LHG l 5002'                 
BL3 Software m ECH 4021 ? 8  'binding site for residue ECH m 4021'                 
BL4 Software 1 LHG 5005 ? 5  'binding site for residue LHG 1 5005'                 
BL5 Software 1 LHG 5007 ? 5  'binding site for residue LHG 1 5007'                 
BL6 Software 1 CLA 1011 ? 22 'binding site for residue CLA 1 1011'                 
BL7 Software 1 CLA 1013 ? 25 'binding site for residue CLA 1 1013'                 
BL8 Software 2 CLA 1022 ? 23 'binding site for residue CLA 2 1022'                 
BL9 Software 1 CLA 1102 ? 16 'binding site for residue CLA 1 1102'                 
BM1 Software 1 CLA 1103 ? 23 'binding site for residue CLA 1 1103'                 
BM2 Software 1 CLA 1104 ? 11 'binding site for residue CLA 1 1104'                 
BM3 Software 1 CLA 1105 ? 12 'binding site for residue CLA 1 1105'                 
BM4 Software 1 CLA 1106 ? 19 'binding site for residue CLA 1 1106'                 
BM5 Software 1 CLA 1107 ? 16 'binding site for residue CLA 1 1107'                 
BM6 Software 1 CLA 1108 ? 11 'binding site for residue CLA 1 1108'                 
BM7 Software 1 CLA 1110 ? 13 'binding site for residue CLA 1 1110'                 
BM8 Software 1 CLA 1111 ? 19 'binding site for residue CLA 1 1111'                 
BM9 Software 1 CLA 1112 ? 14 'binding site for residue CLA 1 1112'                 
BN1 Software 1 CLA 1113 ? 10 'binding site for residue CLA 1 1113'                 
BN2 Software 1 CLA 1114 ? 6  'binding site for residue CLA 1 1114'                 
BN3 Software 1 CLA 1115 ? 15 'binding site for residue CLA 1 1115'                 
BN4 Software 1 CLA 1116 ? 14 'binding site for residue CLA 1 1116'                 
BN5 Software 1 CLA 1117 ? 20 'binding site for residue CLA 1 1117'                 
BN6 Software 1 CLA 1118 ? 17 'binding site for residue CLA 1 1118'                 
BN7 Software 1 CLA 1119 ? 20 'binding site for residue CLA 1 1119'                 
BN8 Software 1 CLA 1120 ? 13 'binding site for residue CLA 1 1120'                 
BN9 Software 1 CLA 1121 ? 8  'binding site for residue CLA 1 1121'                 
BO1 Software 1 CLA 1122 ? 15 'binding site for residue CLA 1 1122'                 
BO2 Software 1 CLA 1123 ? 21 'binding site for residue CLA 1 1123'                 
BO3 Software 1 CLA 1124 ? 11 'binding site for residue CLA 1 1124'                 
BO4 Software 1 CLA 1125 ? 14 'binding site for residue CLA 1 1125'                 
BO5 Software 1 CLA 1126 ? 18 'binding site for residue CLA 1 1126'                 
BO6 Software 1 CLA 1127 ? 19 'binding site for residue CLA 1 1127'                 
BO7 Software 1 CLA 1128 ? 20 'binding site for residue CLA 1 1128'                 
BO8 Software 1 CLA 1129 ? 13 'binding site for residue CLA 1 1129'                 
BO9 Software 1 CLA 1131 ? 16 'binding site for residue CLA 1 1131'                 
BP1 Software 1 CLA 1132 ? 22 'binding site for residue CLA 1 1132'                 
BP2 Software 1 CLA 1133 ? 13 'binding site for residue CLA 1 1133'                 
BP3 Software 1 CLA 1134 ? 12 'binding site for residue CLA 1 1134'                 
BP4 Software 1 CLA 1135 ? 20 'binding site for residue CLA 1 1135'                 
BP5 Software 1 CLA 1136 ? 15 'binding site for residue CLA 1 1136'                 
BP6 Software 1 CLA 1137 ? 13 'binding site for residue CLA 1 1137'                 
BP7 Software 1 CLA 1138 ? 14 'binding site for residue CLA 1 1138'                 
BP8 Software 1 CLA 1140 ? 17 'binding site for residue CLA 1 1140'                 
BP9 Software 1 CLA 1801 ? 13 'binding site for residue CLA 1 1801'                 
BQ1 Software 1 PQN 2001 ? 14 'binding site for residue PQN 1 2001'                 
BQ2 Software 1 SF4 3001 ? 9  'binding site for residue SF4 1 3001'                 
BQ3 Software 1 BCR 4001 ? 16 'binding site for residue BCR 1 4001'                 
BQ4 Software 1 BCR 4002 ? 13 'binding site for residue BCR 1 4002'                 
BQ5 Software 1 BCR 4003 ? 9  'binding site for residue BCR 1 4003'                 
BQ6 Software 1 BCR 4007 ? 10 'binding site for residue BCR 1 4007'                 
BQ7 Software 1 BCR 4008 ? 11 'binding site for residue BCR 1 4008'                 
BQ8 Software 1 BCR 4019 ? 6  'binding site for residue BCR 1 4019'                 
BQ9 Software 1 LHG 5001 ? 19 'binding site for residue LHG 1 5001'                 
BR1 Software 1 LMG 5002 ? 11 'binding site for residue LMG 1 5002'                 
BR2 Software 1 LHG 5003 ? 15 'binding site for residue LHG 1 5003'                 
BR3 Software 1 LMG 5004 ? 7  'binding site for residue LMG 1 5004'                 
BR4 Software 1 LMT 6001 ? 6  'binding site for residue LMT 1 6001'                 
BR5 Software 1 CLA 1130 ? 18 'binding site for residue CLA 1 1130'                 
BR6 Software 1 CLA 1139 ? 22 'binding site for residue CLA 1 1139'                 
BR7 Software 1 CLA 1101 ? 19 'binding site for residue CLA 1 1101'                 
BR8 Software 1 BCR 4012 ? 13 'binding site for residue BCR 1 4012'                 
BR9 Software 2 CLA 1237 ? 20 'binding site for residue CLA 2 1237'                 
BS1 Software 2 BCR 4011 ? 16 'binding site for residue BCR 2 4011'                 
BS2 Software 2 CL  6000 ? 5  'binding site for residue CL 2 6000'                  
BS3 Software 1 CLA 1012 ? 20 'binding site for residue CLA 1 1012'                 
BS4 Software 2 CLA 1021 ? 23 'binding site for residue CLA 2 1021'                 
BS5 Software 2 CLA 1023 ? 23 'binding site for residue CLA 2 1023'                 
BS6 Software 2 CLA 1201 ? 18 'binding site for residue CLA 2 1201'                 
BS7 Software 2 CLA 1202 ? 21 'binding site for residue CLA 2 1202'                 
BS8 Software 2 CLA 1203 ? 14 'binding site for residue CLA 2 1203'                 
BS9 Software 2 CLA 1204 ? 18 'binding site for residue CLA 2 1204'                 
BT1 Software 2 CLA 1205 ? 14 'binding site for residue CLA 2 1205'                 
BT2 Software 2 CLA 1206 ? 24 'binding site for residue CLA 2 1206'                 
BT3 Software 2 CLA 1207 ? 14 'binding site for residue CLA 2 1207'                 
BT4 Software 2 CLA 1208 ? 10 'binding site for residue CLA 2 1208'                 
BT5 Software 2 CLA 1209 ? 10 'binding site for residue CLA 2 1209'                 
BT6 Software 2 CLA 1210 ? 18 'binding site for residue CLA 2 1210'                 
BT7 Software 2 CLA 1211 ? 17 'binding site for residue CLA 2 1211'                 
BT8 Software 2 CLA 1212 ? 13 'binding site for residue CLA 2 1212'                 
BT9 Software 2 CLA 1213 ? 7  'binding site for residue CLA 2 1213'                 
BU1 Software 2 CLA 1214 ? 16 'binding site for residue CLA 2 1214'                 
BU2 Software 2 CLA 1215 ? 19 'binding site for residue CLA 2 1215'                 
BU3 Software 2 CLA 1216 ? 15 'binding site for residue CLA 2 1216'                 
BU4 Software 2 CLA 1217 ? 9  'binding site for residue CLA 2 1217'                 
BU5 Software 2 CLA 1218 ? 9  'binding site for residue CLA 2 1218'                 
BU6 Software 2 CLA 1219 ? 9  'binding site for residue CLA 2 1219'                 
BU7 Software 2 CLA 1220 ? 12 'binding site for residue CLA 2 1220'                 
BU8 Software 2 CLA 1221 ? 19 'binding site for residue CLA 2 1221'                 
BU9 Software 2 CLA 1222 ? 16 'binding site for residue CLA 2 1222'                 
BV1 Software 2 CLA 1223 ? 18 'binding site for residue CLA 2 1223'                 
BV2 Software 2 CLA 1224 ? 14 'binding site for residue CLA 2 1224'                 
BV3 Software 2 CLA 1225 ? 21 'binding site for residue CLA 2 1225'                 
BV4 Software 2 CLA 1226 ? 16 'binding site for residue CLA 2 1226'                 
BV5 Software 2 CLA 1227 ? 12 'binding site for residue CLA 2 1227'                 
BV6 Software 2 CLA 1228 ? 13 'binding site for residue CLA 2 1228'                 
BV7 Software 2 CLA 1229 ? 16 'binding site for residue CLA 2 1229'                 
BV8 Software 2 CLA 1231 ? 8  'binding site for residue CLA 2 1231'                 
BV9 Software 2 CLA 1232 ? 8  'binding site for residue CLA 2 1232'                 
BW1 Software 2 CLA 1234 ? 18 'binding site for residue CLA 2 1234'                 
BW2 Software 2 CLA 1235 ? 16 'binding site for residue CLA 2 1235'                 
BW3 Software 2 CLA 1236 ? 14 'binding site for residue CLA 2 1236'                 
BW4 Software 2 CLA 1238 ? 24 'binding site for residue CLA 2 1238'                 
BW5 Software 2 CLA 1239 ? 15 'binding site for residue CLA 2 1239'                 
BW6 Software 2 CLA 1240 ? 7  'binding site for residue CLA 2 1240'                 
BW7 Software 2 PQN 2002 ? 14 'binding site for residue PQN 2 2002'                 
BW8 Software 2 BCR 4004 ? 8  'binding site for residue BCR 2 4004'                 
BW9 Software 2 BCR 4005 ? 8  'binding site for residue BCR 2 4005'                 
BX1 Software 2 ECH 4006 ? 12 'binding site for residue ECH 2 4006'                 
BX2 Software 2 BCR 4010 ? 13 'binding site for residue BCR 2 4010'                 
BX3 Software 2 BCR 4017 ? 12 'binding site for residue BCR 2 4017'                 
BX4 Software 2 BCR 4018 ? 5  'binding site for residue BCR 2 4018'                 
BX5 Software 2 LMG 5002 ? 15 'binding site for residue LMG 2 5002'                 
BX6 Software 2 LHG 5004 ? 11 'binding site for residue LHG 2 5004'                 
BX7 Software 2 LMG 5005 ? 6  'binding site for residue LMG 2 5005'                 
BX8 Software 2 CA  6001 ? 4  'binding site for residue CA 2 6001'                  
BX9 Software 2 BCR 4014 ? 9  'binding site for residue BCR 2 4014'                 
BY1 Software 2 CLA 1230 ? 14 'binding site for residue CLA 2 1230'                 
BY2 Software 3 SF4 3002 ? 9  'binding site for residue SF4 3 3002'                 
BY3 Software 3 SF4 3003 ? 11 'binding site for residue SF4 3 3003'                 
BY4 Software 6 CLA 1301 ? 12 'binding site for residue CLA 6 1301'                 
BY5 Software 6 CLA 1302 ? 7  'binding site for residue CLA 6 1302'                 
BY6 Software 6 BCR 4016 ? 7  'binding site for residue BCR 6 4016'                 
BY7 Software 6 LHG 5001 ? 3  'binding site for residue LHG 6 5001'                 
BY8 Software h 45D 4020 ? 15 'binding site for residue 45D h 4020'                 
BY9 Software h BCR 4018 ? 12 'binding site for residue BCR h 4018'                 
BZ1 Software 7 BCR 4013 ? 16 'binding site for residue BCR 7 4013'                 
BZ2 Software 7 ZEX 4015 ? 14 'binding site for residue ZEX 7 4015'                 
BZ3 Software 7 CLA 1302 ? 5  'binding site for residue CLA 7 1302'                 
BZ4 Software 7 CLA 1303 ? 5  'binding site for residue CLA 7 1303'                 
BZ5 Software 8 CLA 1401 ? 9  'binding site for residue CLA 8 1401'                 
BZ6 Software 8 CLA 1402 ? 9  'binding site for residue CLA 8 1402'                 
BZ7 Software 8 BCR 4001 ? 10 'binding site for residue BCR 8 4001'                 
BZ8 Software 0 LHG 5002 ? 11 'binding site for residue LHG 0 5002'                 
BZ9 Software 0 LHG 5004 ? 6  'binding site for residue LHG 0 5004'                 
CC1 Software 0 CA  1001 ? 5  'binding site for residue CA 0 1001'                  
CC2 Software 0 CLA 1501 ? 13 'binding site for residue CLA 0 1501'                 
CC3 Software 0 CLA 1502 ? 17 'binding site for residue CLA 0 1502'                 
CC4 Software 0 CLA 1503 ? 18 'binding site for residue CLA 0 1503'                 
CC5 Software 0 BCR 4019 ? 14 'binding site for residue BCR 0 4019'                 
CC6 Software 0 BCR 4022 ? 8  'binding site for residue BCR 0 4022'                 
CC7 Software 0 LMG 5001 ? 11 'binding site for residue LMG 0 5001'                 
CC8 Software 0 SQD 5005 ? 10 'binding site for residue SQD 0 5005'                 
CC9 Software 0 LMT 6001 ? 10 'binding site for residue LMT 0 6001'                 
CD1 Software 9 BCR 4021 ? 11 'binding site for residue BCR 9 4021'                 
CD2 Software 1 HIS 33   ? 20 'binding site for Di-peptide CLA 1 1109 and HIS 1 33' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1    AC1 19 TYR A  599 ? TYR A 599  . ? 1_555 ? 
2    AC1 19 ASN A  600 ? ASN A 600  . ? 1_555 ? 
3    AC1 19 ILE A  604 ? ILE A 604  . ? 1_555 ? 
4    AC1 19 PHE A  607 ? PHE A 607  . ? 1_555 ? 
5    AC1 19 ILE A  642 ? ILE A 642  . ? 1_555 ? 
6    AC1 19 LEU A  650 ? LEU A 650  . ? 1_555 ? 
7    AC1 19 PHE A  672 ? PHE A 672  . ? 1_555 ? 
8    AC1 19 HIS A  676 ? HIS A 676  . ? 1_555 ? 
9    AC1 19 PHE A  679 ? PHE A 679  . ? 1_555 ? 
10   AC1 19 TYR A  731 ? TYR A 731  . ? 1_555 ? 
11   AC1 19 THR A  739 ? THR A 739  . ? 1_555 ? 
12   AC1 19 PHE A  742 ? PHE A 742  . ? 1_555 ? 
13   AC1 19 CLA RC .   ? CLA B 1022 . ? 1_555 ? 
14   AC1 19 HOH IR .   ? HOH A 8009 . ? 1_555 ? 
15   AC1 19 HOH IR .   ? HOH A 8111 . ? 1_555 ? 
16   AC1 19 PHE B  617 ? PHE B 617  . ? 1_555 ? 
17   AC1 19 TRP B  622 ? TRP B 622  . ? 1_555 ? 
18   AC1 19 CLA QC .   ? CLA A 1012 . ? 1_555 ? 
19   AC1 19 CLA VC .   ? CLA B 1021 . ? 1_555 ? 
20   AC2 25 PHE A  677 ? PHE A 677  . ? 1_555 ? 
21   AC2 25 ALA A  680 ? ALA A 680  . ? 1_555 ? 
22   AC2 25 PHE A  681 ? PHE A 681  . ? 1_555 ? 
23   AC2 25 LEU A  683 ? LEU A 683  . ? 1_555 ? 
24   AC2 25 MET A  684 ? MET A 684  . ? 1_555 ? 
25   AC2 25 PHE A  687 ? PHE A 687  . ? 1_555 ? 
26   AC2 25 TYR A  692 ? TYR A 692  . ? 1_555 ? 
27   AC2 25 TRP A  693 ? TRP A 693  . ? 1_555 ? 
28   AC2 25 LEU A  696 ? LEU A 696  . ? 1_555 ? 
29   AC2 25 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
30   AC2 25 SER B  421 ? SER B 421  . ? 1_555 ? 
31   AC2 25 SER B  424 ? SER B 424  . ? 1_555 ? 
32   AC2 25 LEU B  425 ? LEU B 425  . ? 1_555 ? 
33   AC2 25 GLY B  428 ? GLY B 428  . ? 1_555 ? 
34   AC2 25 PHE B  429 ? PHE B 429  . ? 1_555 ? 
35   AC2 25 LEU B  432 ? LEU B 432  . ? 1_555 ? 
36   AC2 25 LEU B  522 ? LEU B 522  . ? 1_555 ? 
37   AC2 25 LEU B  529 ? LEU B 529  . ? 1_555 ? 
38   AC2 25 ILE B  530 ? ILE B 530  . ? 1_555 ? 
39   AC2 25 LEU B  575 ? LEU B 575  . ? 1_555 ? 
40   AC2 25 PHE B  578 ? PHE B 578  . ? 1_555 ? 
41   AC2 25 TRP B  579 ? TRP B 579  . ? 1_555 ? 
42   AC2 25 CLA QC .   ? CLA A 1012 . ? 1_555 ? 
43   AC2 25 45D TC .   ? 45D B 4011 . ? 1_555 ? 
44   AC2 25 BCR WE .   ? BCR B 4014 . ? 1_555 ? 
45   AC3 15 TRP A  28  ? TRP A 28   . ? 1_555 ? 
46   AC3 15 HIS A  33  ? HIS A 33   . ? 1_555 ? 
47   AC3 15 PHE A  34  ? PHE A 34   . ? 1_555 ? 
48   AC3 15 LEU A  51  ? LEU A 51   . ? 1_555 ? 
49   AC3 15 ALA A  55  ? ALA A 55   . ? 1_555 ? 
50   AC3 15 HIS A  56  ? HIS A 56   . ? 1_555 ? 
51   AC3 15 PHE A  58  ? PHE A 58   . ? 1_555 ? 
52   AC3 15 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
53   AC3 15 CLA KA .   ? CLA A 1103 . ? 1_555 ? 
54   AC3 15 CLA LA .   ? CLA A 1104 . ? 1_555 ? 
55   AC3 15 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
56   AC3 15 CLA OA .   ? CLA A 1107 . ? 1_555 ? 
57   AC3 15 CLA QA .   ? CLA A 1109 . ? 1_555 ? 
58   AC3 15 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
59   AC3 15 HOH IR .   ? HOH A 8072 . ? 1_555 ? 
60   AC4 21 HIS A  56  ? HIS A 56   . ? 1_555 ? 
61   AC4 21 PHE A  58  ? PHE A 58   . ? 1_555 ? 
62   AC4 21 ILE A  72  ? ILE A 72   . ? 1_555 ? 
63   AC4 21 ALA A  75  ? ALA A 75   . ? 1_555 ? 
64   AC4 21 HIS A  76  ? HIS A 76   . ? 1_555 ? 
65   AC4 21 HIS A  79  ? HIS A 79   . ? 1_555 ? 
66   AC4 21 LEU A  80  ? LEU A 80   . ? 1_555 ? 
67   AC4 21 VAL A  83  ? VAL A 83   . ? 1_555 ? 
68   AC4 21 MET A  168 ? MET A 168  . ? 1_555 ? 
69   AC4 21 TRP A  348 ? TRP A 348  . ? 1_555 ? 
70   AC4 21 HIS A  349 ? HIS A 349  . ? 1_555 ? 
71   AC4 21 LEU A  352 ? LEU A 352  . ? 1_555 ? 
72   AC4 21 ASN A  355 ? ASN A 355  . ? 1_555 ? 
73   AC4 21 LEU A  356 ? LEU A 356  . ? 1_555 ? 
74   AC4 21 CLA JA .   ? CLA A 1102 . ? 1_555 ? 
75   AC4 21 CLA LA .   ? CLA A 1104 . ? 1_555 ? 
76   AC4 21 CLA SA .   ? CLA A 1111 . ? 1_555 ? 
77   AC4 21 CLA TA .   ? CLA A 1112 . ? 1_555 ? 
78   AC4 21 CLA EB .   ? CLA A 1123 . ? 1_555 ? 
79   AC4 21 CLA JB .   ? CLA A 1128 . ? 1_555 ? 
80   AC4 21 BCR ZB .   ? BCR A 4003 . ? 1_555 ? 
81   AC5 10 HIS A  56  ? HIS A 56   . ? 1_555 ? 
82   AC5 10 HIS A  79  ? HIS A 79   . ? 1_555 ? 
83   AC5 10 TRP A  86  ? TRP A 86   . ? 1_555 ? 
84   AC5 10 CLA JA .   ? CLA A 1102 . ? 1_555 ? 
85   AC5 10 CLA KA .   ? CLA A 1103 . ? 1_555 ? 
86   AC5 10 CLA HB .   ? CLA A 1126 . ? 1_555 ? 
87   AC5 10 CLA IB .   ? CLA A 1127 . ? 1_555 ? 
88   AC5 10 CLA JB .   ? CLA A 1128 . ? 1_555 ? 
89   AC5 10 BCR ZB .   ? BCR A 4003 . ? 1_555 ? 
90   AC5 10 LHG DC .   ? LHG A 5001 . ? 1_555 ? 
91   AC6 16 VAL A  85  ? VAL A 85   . ? 1_555 ? 
92   AC6 16 TRP A  86  ? TRP A 86   . ? 1_555 ? 
93   AC6 16 GLY A  89  ? GLY A 89   . ? 1_555 ? 
94   AC6 16 PHE A  92  ? PHE A 92   . ? 1_555 ? 
95   AC6 16 HIS A  93  ? HIS A 93   . ? 1_555 ? 
96   AC6 16 PHE A  97  ? PHE A 97   . ? 1_555 ? 
97   AC6 16 TRP A  118 ? TRP A 118  . ? 1_555 ? 
98   AC6 16 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
99   AC6 16 CLA OA .   ? CLA A 1107 . ? 1_555 ? 
100  AC6 16 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
101  AC6 16 BCR CC .   ? BCR A 4019 . ? 1_555 ? 
102  AC6 16 LMT HF .   ? LMT F 6001 . ? 1_555 ? 
103  AC6 16 VAL H  13  ? VAL J 13   . ? 1_555 ? 
104  AC6 16 THR H  20  ? THR J 20   . ? 1_555 ? 
105  AC6 16 CLA LF .   ? CLA J 1302 . ? 1_555 ? 
106  AC6 16 BCR NF .   ? BCR J 4013 . ? 1_555 ? 
107  AC7 19 TRP A  86  ? TRP A 86   . ? 1_555 ? 
108  AC7 19 MET A  90  ? MET A 90   . ? 1_555 ? 
109  AC7 19 GLN A  115 ? GLN A 115  . ? 1_555 ? 
110  AC7 19 GLN A  138 ? GLN A 138  . ? 1_555 ? 
111  AC7 19 ILE A  139 ? ILE A 139  . ? 1_555 ? 
112  AC7 19 THR A  140 ? THR A 140  . ? 1_555 ? 
113  AC7 19 SER A  141 ? SER A 141  . ? 1_555 ? 
114  AC7 19 LEU A  143 ? LEU A 143  . ? 1_555 ? 
115  AC7 19 TYR A  668 ? TYR A 668  . ? 1_555 ? 
116  AC7 19 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
117  AC7 19 CLA JA .   ? CLA A 1102 . ? 1_555 ? 
118  AC7 19 CLA MA .   ? CLA A 1105 . ? 1_555 ? 
119  AC7 19 CLA OA .   ? CLA A 1107 . ? 1_555 ? 
120  AC7 19 CLA HB .   ? CLA A 1126 . ? 1_555 ? 
121  AC7 19 CLA JB .   ? CLA A 1128 . ? 1_555 ? 
122  AC7 19 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
123  AC7 19 LHG DC .   ? LHG A 5001 . ? 1_555 ? 
124  AC7 19 CLA QC .   ? CLA A 1012 . ? 1_555 ? 
125  AC7 19 45D TC .   ? 45D B 4011 . ? 1_555 ? 
126  AC8 16 GLN A  115 ? GLN A 115  . ? 1_555 ? 
127  AC8 16 VAL A  116 ? VAL A 116  . ? 1_555 ? 
128  AC8 16 VAL A  117 ? VAL A 117  . ? 1_555 ? 
129  AC8 16 TRP A  118 ? TRP A 118  . ? 1_555 ? 
130  AC8 16 GLN A  123 ? GLN A 123  . ? 1_555 ? 
131  AC8 16 LEU A  126 ? LEU A 126  . ? 1_555 ? 
132  AC8 16 ILE A  137 ? ILE A 137  . ? 1_555 ? 
133  AC8 16 ALA A  667 ? ALA A 667  . ? 1_555 ? 
134  AC8 16 CLA JA .   ? CLA A 1102 . ? 1_555 ? 
135  AC8 16 CLA MA .   ? CLA A 1105 . ? 1_555 ? 
136  AC8 16 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
137  AC8 16 CLA HB .   ? CLA A 1126 . ? 1_555 ? 
138  AC8 16 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
139  AC8 16 PHE B  444 ? PHE B 444  . ? 1_555 ? 
140  AC8 16 ILE H  27  ? ILE J 27   . ? 1_555 ? 
141  AC8 16 BCR NF .   ? BCR J 4013 . ? 1_555 ? 
142  AC9 13 GLU A  7   ? GLU A 7    . ? 1_555 ? 
143  AC9 13 ARG A  8   ? ARG A 8    . ? 1_555 ? 
144  AC9 13 VAL A  14  ? VAL A 14   . ? 1_555 ? 
145  AC9 13 VAL A  16  ? VAL A 16   . ? 1_555 ? 
146  AC9 13 PHE A  77  ? PHE A 77   . ? 1_555 ? 
147  AC9 13 LEU A  171 ? LEU A 171  . ? 1_555 ? 
148  AC9 13 PHE A  174 ? PHE A 174  . ? 1_555 ? 
149  AC9 13 PHE A  178 ? PHE A 178  . ? 1_555 ? 
150  AC9 13 HIS A  179 ? HIS A 179  . ? 1_555 ? 
151  AC9 13 LYS A  183 ? LYS A 183  . ? 1_555 ? 
152  AC9 13 TRP A  189 ? TRP A 189  . ? 1_555 ? 
153  AC9 13 CLA RA .   ? CLA A 1110 . ? 1_555 ? 
154  AC9 13 CLA SA .   ? CLA A 1111 . ? 1_555 ? 
155  AD1 16 THR A  23  ? THR A 23   . ? 1_555 ? 
156  AD1 16 SER A  24  ? SER A 24   . ? 1_555 ? 
157  AD1 16 PHE A  25  ? PHE A 25   . ? 1_555 ? 
158  AD1 16 TRP A  28  ? TRP A 28   . ? 1_555 ? 
159  AD1 16 HIS A  33  ? HIS A 33   . ? 1_555 ? 
160  AD1 16 LYS A  71  ? LYS A 71   . ? 1_555 ? 
161  AD1 16 SER A  74  ? SER A 74   . ? 1_555 ? 
162  AD1 16 VAL A  82  ? VAL A 82   . ? 1_555 ? 
163  AD1 16 LEU A  173 ? LEU A 173  . ? 1_555 ? 
164  AD1 16 GLY A  176 ? GLY A 176  . ? 1_555 ? 
165  AD1 16 TRP A  177 ? TRP A 177  . ? 1_555 ? 
166  AD1 16 TYR A  180 ? TYR A 180  . ? 1_555 ? 
167  AD1 16 HIS A  181 ? HIS A 181  . ? 1_555 ? 
168  AD1 16 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
169  AD1 16 CLA JA .   ? CLA A 1102 . ? 1_555 ? 
170  AD1 16 HOH IR .   ? HOH A 8048 . ? 1_555 ? 
171  AD2 17 ALA A  10  ? ALA A 10   . ? 1_555 ? 
172  AD2 17 LYS A  11  ? LYS A 11   . ? 1_555 ? 
173  AD2 17 ALA A  12  ? ALA A 12   . ? 1_555 ? 
174  AD2 17 LYS A  13  ? LYS A 13   . ? 1_555 ? 
175  AD2 17 VAL A  14  ? VAL A 14   . ? 1_555 ? 
176  AD2 17 TRP A  189 ? TRP A 189  . ? 1_555 ? 
177  AD2 17 ASN A  192 ? ASN A 192  . ? 1_555 ? 
178  AD2 17 SER A  195 ? SER A 195  . ? 1_555 ? 
179  AD2 17 HIS A  199 ? HIS A 199  . ? 1_555 ? 
180  AD2 17 THR A  313 ? THR A 313  . ? 1_555 ? 
181  AD2 17 ASN A  314 ? ASN A 314  . ? 1_555 ? 
182  AD2 17 TRP A  315 ? TRP A 315  . ? 1_555 ? 
183  AD2 17 CLA PA .   ? CLA A 1108 . ? 1_555 ? 
184  AD2 17 CLA SA .   ? CLA A 1111 . ? 1_555 ? 
185  AD2 17 CLA ZA .   ? CLA A 1118 . ? 1_555 ? 
186  AD2 17 LMG LC .   ? LMG A 5008 . ? 1_555 ? 
187  AD2 17 LYS I  41  ? LYS K 48   . ? 1_555 ? 
188  AD3 18 PHE A  73  ? PHE A 73   . ? 1_555 ? 
189  AD3 18 HIS A  76  ? HIS A 76   . ? 1_555 ? 
190  AD3 18 PHE A  77  ? PHE A 77   . ? 1_555 ? 
191  AD3 18 LEU A  80  ? LEU A 80   . ? 1_555 ? 
192  AD3 18 TRP A  189 ? TRP A 189  . ? 1_555 ? 
193  AD3 18 PHE A  190 ? PHE A 190  . ? 1_555 ? 
194  AD3 18 ASN A  192 ? ASN A 192  . ? 1_555 ? 
195  AD3 18 MET A  196 ? MET A 196  . ? 1_555 ? 
196  AD3 18 HIS A  199 ? HIS A 199  . ? 1_555 ? 
197  AD3 18 HIS A  200 ? HIS A 200  . ? 1_555 ? 
198  AD3 18 GLY A  203 ? GLY A 203  . ? 1_555 ? 
199  AD3 18 CLA KA .   ? CLA A 1103 . ? 1_555 ? 
200  AD3 18 CLA PA .   ? CLA A 1108 . ? 1_555 ? 
201  AD3 18 CLA RA .   ? CLA A 1110 . ? 1_555 ? 
202  AD3 18 CLA VA .   ? CLA A 1114 . ? 1_555 ? 
203  AD3 18 CLA EB .   ? CLA A 1123 . ? 1_555 ? 
204  AD3 18 BCR YB .   ? BCR A 4002 . ? 1_555 ? 
205  AD3 18 BCR ZB .   ? BCR A 4003 . ? 1_555 ? 
206  AD4 19 GLY A  151 ? GLY A 151  . ? 1_555 ? 
207  AD4 19 PHE A  152 ? PHE A 152  . ? 1_555 ? 
208  AD4 19 GLN A  157 ? GLN A 157  . ? 1_555 ? 
209  AD4 19 CYS A  160 ? CYS A 160  . ? 1_555 ? 
210  AD4 19 THR A  161 ? THR A 161  . ? 1_555 ? 
211  AD4 19 GLY A  164 ? GLY A 164  . ? 1_555 ? 
212  AD4 19 VAL A  167 ? VAL A 167  . ? 1_555 ? 
213  AD4 19 MET A  168 ? MET A 168  . ? 1_555 ? 
214  AD4 19 GLY A  208 ? GLY A 208  . ? 1_555 ? 
215  AD4 19 GLY A  211 ? GLY A 211  . ? 1_555 ? 
216  AD4 19 TRP A  212 ? TRP A 212  . ? 1_555 ? 
217  AD4 19 HIS A  215 ? HIS A 215  . ? 1_555 ? 
218  AD4 19 VAL A  219 ? VAL A 219  . ? 1_555 ? 
219  AD4 19 PRO A  239 ? PRO A 239  . ? 1_555 ? 
220  AD4 19 CLA KA .   ? CLA A 1103 . ? 1_555 ? 
221  AD4 19 CLA UA .   ? CLA A 1113 . ? 1_555 ? 
222  AD4 19 CLA VA .   ? CLA A 1114 . ? 1_555 ? 
223  AD4 19 BCR YB .   ? BCR A 4002 . ? 1_555 ? 
224  AD4 19 HOH IR .   ? HOH A 8002 . ? 1_555 ? 
225  AD5 14 LEU A  210 ? LEU A 210  . ? 1_555 ? 
226  AD5 14 GLY A  211 ? GLY A 211  . ? 1_555 ? 
227  AD5 14 GLY A  214 ? GLY A 214  . ? 1_555 ? 
228  AD5 14 ILE A  217 ? ILE A 217  . ? 1_555 ? 
229  AD5 14 HIS A  218 ? HIS A 218  . ? 1_555 ? 
230  AD5 14 PHE A  256 ? PHE A 256  . ? 1_555 ? 
231  AD5 14 GLY A  259 ? GLY A 259  . ? 1_555 ? 
232  AD5 14 LEU A  260 ? LEU A 260  . ? 1_555 ? 
233  AD5 14 PHE A  264 ? PHE A 264  . ? 1_555 ? 
234  AD5 14 CLA TA .   ? CLA A 1112 . ? 1_555 ? 
235  AD5 14 BCR XB .   ? BCR A 4001 . ? 1_555 ? 
236  AD5 14 BCR YB .   ? BCR A 4002 . ? 1_555 ? 
237  AD5 14 TRP I  11  ? TRP K 18   . ? 1_555 ? 
238  AD5 14 CLA PF .   ? CLA K 1402 . ? 1_555 ? 
239  AD6 10 TYR A  156 ? TYR A 156  . ? 1_555 ? 
240  AD6 10 MET A  168 ? MET A 168  . ? 1_555 ? 
241  AD6 10 LEU A  171 ? LEU A 171  . ? 1_555 ? 
242  AD6 10 LEU A  238 ? LEU A 238  . ? 1_555 ? 
243  AD6 10 HIS A  240 ? HIS A 240  . ? 1_555 ? 
244  AD6 10 LEU A  244 ? LEU A 244  . ? 1_555 ? 
245  AD6 10 CLA SA .   ? CLA A 1111 . ? 1_555 ? 
246  AD6 10 CLA TA .   ? CLA A 1112 . ? 1_555 ? 
247  AD6 10 BCR YB .   ? BCR A 4002 . ? 1_555 ? 
248  AD6 10 HOH IR .   ? HOH A 8002 . ? 1_555 ? 
249  AD7 16 PHE A  263 ? PHE A 263  . ? 1_555 ? 
250  AD7 16 TRP A  268 ? TRP A 268  . ? 1_555 ? 
251  AD7 16 PHE A  277 ? PHE A 277  . ? 1_555 ? 
252  AD7 16 HIS A  295 ? HIS A 295  . ? 1_555 ? 
253  AD7 16 LEU A  298 ? LEU A 298  . ? 1_555 ? 
254  AD7 16 VAL A  302 ? VAL A 302  . ? 1_555 ? 
255  AD7 16 ILE A  306 ? ILE A 306  . ? 1_555 ? 
256  AD7 16 ASN A  500 ? ASN A 500  . ? 1_555 ? 
257  AD7 16 CLA XA .   ? CLA A 1116 . ? 1_555 ? 
258  AD7 16 CLA BB .   ? CLA A 1120 . ? 1_555 ? 
259  AD7 16 CLA OB .   ? CLA A 1134 . ? 1_555 ? 
260  AD7 16 ALA I  4   ? ALA K 11   . ? 1_555 ? 
261  AD7 16 LEU I  75  ? LEU K 82   . ? 1_555 ? 
262  AD7 16 SER I  80  ? SER K 87   . ? 1_555 ? 
263  AD7 16 CLA OF .   ? CLA K 1401 . ? 1_555 ? 
264  AD7 16 BCR QF .   ? BCR K 4001 . ? 1_555 ? 
265  AD8 19 THR A  276 ? THR A 276  . ? 1_555 ? 
266  AD8 19 PHE A  277 ? PHE A 277  . ? 1_555 ? 
267  AD8 19 GLY A  279 ? GLY A 279  . ? 1_555 ? 
268  AD8 19 LEU A  288 ? LEU A 288  . ? 1_555 ? 
269  AD8 19 ASP A  292 ? ASP A 292  . ? 1_555 ? 
270  AD8 19 HIS A  295 ? HIS A 295  . ? 1_555 ? 
271  AD8 19 HIS A  296 ? HIS A 296  . ? 1_555 ? 
272  AD8 19 ALA A  299 ? ALA A 299  . ? 1_555 ? 
273  AD8 19 ILE A  300 ? ILE A 300  . ? 1_555 ? 
274  AD8 19 HIS A  369 ? HIS A 369  . ? 1_555 ? 
275  AD8 19 MET A  373 ? MET A 373  . ? 1_555 ? 
276  AD8 19 ALA A  505 ? ALA A 505  . ? 1_555 ? 
277  AD8 19 CLA WA .   ? CLA A 1115 . ? 1_555 ? 
278  AD8 19 CLA YA .   ? CLA A 1117 . ? 1_555 ? 
279  AD8 19 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
280  AD8 19 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
281  AD8 19 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
282  AD8 19 CLA OB .   ? CLA A 1134 . ? 1_555 ? 
283  AD8 19 HOH IR .   ? HOH A 8096 . ? 1_555 ? 
284  AD9 21 LEU A  205 ? LEU A 205  . ? 1_555 ? 
285  AD9 21 GLY A  208 ? GLY A 208  . ? 1_555 ? 
286  AD9 21 SER A  209 ? SER A 209  . ? 1_555 ? 
287  AD9 21 TRP A  212 ? TRP A 212  . ? 1_555 ? 
288  AD9 21 GLN A  216 ? GLN A 216  . ? 1_555 ? 
289  AD9 21 HIS A  296 ? HIS A 296  . ? 1_555 ? 
290  AD9 21 HIS A  297 ? HIS A 297  . ? 1_555 ? 
291  AD9 21 PHE A  304 ? PHE A 304  . ? 1_555 ? 
292  AD9 21 LEU A  362 ? LEU A 362  . ? 1_555 ? 
293  AD9 21 VAL A  366 ? VAL A 366  . ? 1_555 ? 
294  AD9 21 HIS A  369 ? HIS A 369  . ? 1_555 ? 
295  AD9 21 MET A  370 ? MET A 370  . ? 1_555 ? 
296  AD9 21 PRO A  375 ? PRO A 375  . ? 1_555 ? 
297  AD9 21 TYR A  376 ? TYR A 376  . ? 1_555 ? 
298  AD9 21 CLA XA .   ? CLA A 1116 . ? 1_555 ? 
299  AD9 21 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
300  AD9 21 CLA IB .   ? CLA A 1127 . ? 1_555 ? 
301  AD9 21 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
302  AD9 21 BCR ZB .   ? BCR A 4003 . ? 1_555 ? 
303  AD9 21 HOH IR .   ? HOH A 8058 . ? 1_555 ? 
304  AD9 21 HOH IR .   ? HOH A 8128 . ? 1_555 ? 
305  AE1 18 ASN A  198 ? ASN A 198  . ? 1_555 ? 
306  AE1 18 HIS A  199 ? HIS A 199  . ? 1_555 ? 
307  AE1 18 ALA A  202 ? ALA A 202  . ? 1_555 ? 
308  AE1 18 LEU A  207 ? LEU A 207  . ? 1_555 ? 
309  AE1 18 HIS A  309 ? HIS A 309  . ? 1_555 ? 
310  AE1 18 THR A  313 ? THR A 313  . ? 1_555 ? 
311  AE1 18 TRP A  315 ? TRP A 315  . ? 1_555 ? 
312  AE1 18 ILE A  317 ? ILE A 317  . ? 1_555 ? 
313  AE1 18 CLA RA .   ? CLA A 1110 . ? 1_555 ? 
314  AE1 18 BCR XB .   ? BCR A 4001 . ? 1_555 ? 
315  AE1 18 BCR YB .   ? BCR A 4002 . ? 1_555 ? 
316  AE1 18 LMG LC .   ? LMG A 5008 . ? 1_555 ? 
317  AE1 18 LEU I  56  ? LEU K 63   . ? 1_555 ? 
318  AE1 18 PRO I  57  ? PRO K 64   . ? 1_555 ? 
319  AE1 18 LEU I  60  ? LEU K 67   . ? 1_555 ? 
320  AE1 18 ALA I  61  ? ALA K 68   . ? 1_555 ? 
321  AE1 18 CLA PF .   ? CLA K 1402 . ? 1_555 ? 
322  AE1 18 BCR QF .   ? BCR K 4001 . ? 1_555 ? 
323  AE2 18 LEU A  201 ? LEU A 201  . ? 1_555 ? 
324  AE2 18 LEU A  303 ? LEU A 303  . ? 1_555 ? 
325  AE2 18 PHE A  304 ? PHE A 304  . ? 1_555 ? 
326  AE2 18 ALA A  307 ? ALA A 307  . ? 1_555 ? 
327  AE2 18 MET A  310 ? MET A 310  . ? 1_555 ? 
328  AE2 18 TYR A  311 ? TYR A 311  . ? 1_555 ? 
329  AE2 18 ILE A  324 ? ILE A 324  . ? 1_555 ? 
330  AE2 18 VAL A  553 ? VAL A 553  . ? 1_555 ? 
331  AE2 18 CLA BB .   ? CLA A 1120 . ? 1_555 ? 
332  AE2 18 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
333  AE2 18 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
334  AE2 18 CLA EB .   ? CLA A 1123 . ? 1_555 ? 
335  AE2 18 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
336  AE2 18 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
337  AE2 18 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
338  AE2 18 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
339  AE2 18 BCR BC .   ? BCR A 4008 . ? 1_555 ? 
340  AE2 18 HOH IR .   ? HOH A 8034 . ? 1_555 ? 
341  AE3 14 ILE A  306 ? ILE A 306  . ? 1_555 ? 
342  AE3 14 HIS A  309 ? HIS A 309  . ? 1_555 ? 
343  AE3 14 MET A  310 ? MET A 310  . ? 1_555 ? 
344  AE3 14 ILE A  317 ? ILE A 317  . ? 1_555 ? 
345  AE3 14 GLY A  318 ? GLY A 318  . ? 1_555 ? 
346  AE3 14 HIS A  319 ? HIS A 319  . ? 1_555 ? 
347  AE3 14 CLA WA .   ? CLA A 1115 . ? 1_555 ? 
348  AE3 14 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
349  AE3 14 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
350  AE3 14 BCR XB .   ? BCR A 4001 . ? 1_555 ? 
351  AE3 14 PHE I  25  ? PHE K 32   . ? 1_555 ? 
352  AE3 14 ALA I  33  ? ALA K 40   . ? 1_555 ? 
353  AE3 14 GLN I  35  ? GLN K 42   . ? 1_555 ? 
354  AE3 14 LMG RF .   ? LMG K 5009 . ? 1_555 ? 
355  AE4 13 HIS A  319 ? HIS A 319  . ? 1_555 ? 
356  AE4 13 ILE A  324 ? ILE A 324  . ? 1_555 ? 
357  AE4 13 ALA A  327 ? ALA A 327  . ? 1_555 ? 
358  AE4 13 HIS A  328 ? HIS A 328  . ? 1_555 ? 
359  AE4 13 CLA XA .   ? CLA A 1116 . ? 1_555 ? 
360  AE4 13 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
361  AE4 13 CLA BB .   ? CLA A 1120 . ? 1_555 ? 
362  AE4 13 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
363  AE4 13 CLA OB .   ? CLA A 1134 . ? 1_555 ? 
364  AE4 13 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
365  AE4 13 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
366  AE4 13 LHG OC .   ? LHG A 5007 . ? 1_555 ? 
367  AE4 13 CLA OF .   ? CLA K 1401 . ? 1_555 ? 
368  AE5 17 LEU A  325 ? LEU A 325  . ? 1_555 ? 
369  AE5 17 HIS A  328 ? HIS A 328  . ? 1_555 ? 
370  AE5 17 HIS A  337 ? HIS A 337  . ? 1_555 ? 
371  AE5 17 LEU A  340 ? LEU A 340  . ? 1_555 ? 
372  AE5 17 LEU A  425 ? LEU A 425  . ? 1_555 ? 
373  AE5 17 LEU A  426 ? LEU A 426  . ? 1_555 ? 
374  AE5 17 MET A  429 ? MET A 429  . ? 1_555 ? 
375  AE5 17 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
376  AE5 17 CLA EB .   ? CLA A 1123 . ? 1_555 ? 
377  AE5 17 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
378  AE5 17 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
379  AE5 17 CLA PB .   ? CLA A 1135 . ? 1_555 ? 
380  AE5 17 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
381  AE5 17 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
382  AE5 17 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
383  AE5 17 BCR BC .   ? BCR A 4008 . ? 1_555 ? 
384  AE5 17 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
385  AE6 21 HIS A  76  ? HIS A 76   . ? 1_555 ? 
386  AE6 21 PHE A  190 ? PHE A 190  . ? 1_555 ? 
387  AE6 21 MET A  196 ? MET A 196  . ? 1_555 ? 
388  AE6 21 MET A  197 ? MET A 197  . ? 1_555 ? 
389  AE6 21 HIS A  200 ? HIS A 200  . ? 1_555 ? 
390  AE6 21 MET A  321 ? MET A 321  . ? 1_555 ? 
391  AE6 21 LEU A  344 ? LEU A 344  . ? 1_555 ? 
392  AE6 21 THR A  346 ? THR A 346  . ? 1_555 ? 
393  AE6 21 SER A  347 ? SER A 347  . ? 1_555 ? 
394  AE6 21 TRP A  348 ? TRP A 348  . ? 1_555 ? 
395  AE6 21 GLN A  351 ? GLN A 351  . ? 1_555 ? 
396  AE6 21 ILE A  354 ? ILE A 354  . ? 1_555 ? 
397  AE6 21 ASN A  355 ? ASN A 355  . ? 1_555 ? 
398  AE6 21 CLA KA .   ? CLA A 1103 . ? 1_555 ? 
399  AE6 21 CLA SA .   ? CLA A 1111 . ? 1_555 ? 
400  AE6 21 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
401  AE6 21 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
402  AE6 21 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
403  AE6 21 CLA IB .   ? CLA A 1127 . ? 1_555 ? 
404  AE6 21 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
405  AE6 21 HOH IR .   ? HOH A 8015 . ? 1_555 ? 
406  AE7 20 ILE A  364 ? ILE A 364  . ? 1_555 ? 
407  AE7 20 GLN A  368 ? GLN A 368  . ? 1_555 ? 
408  AE7 20 MET A  394 ? MET A 394  . ? 1_555 ? 
409  AE7 20 ILE A  401 ? ILE A 401  . ? 1_555 ? 
410  AE7 20 ILE A  542 ? ILE A 542  . ? 1_555 ? 
411  AE7 20 THR A  545 ? THR A 545  . ? 1_555 ? 
412  AE7 20 SER A  601 ? SER A 601  . ? 1_555 ? 
413  AE7 20 LEU A  602 ? LEU A 602  . ? 1_555 ? 
414  AE7 20 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
415  AE7 20 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
416  AE7 20 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
417  AE7 20 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
418  AE7 20 CLA PB .   ? CLA A 1135 . ? 1_555 ? 
419  AE7 20 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
420  AE7 20 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
421  AE7 20 BCR BC .   ? BCR A 4008 . ? 1_555 ? 
422  AE7 20 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
423  AE7 20 LMG GC .   ? LMG A 5004 . ? 1_555 ? 
424  AE7 20 HOH IR .   ? HOH A 8047 . ? 1_555 ? 
425  AE7 20 HOH IR .   ? HOH A 8068 . ? 1_555 ? 
426  AE8 15 ILE A  365 ? ILE A 365  . ? 1_555 ? 
427  AE8 15 HIS A  369 ? HIS A 369  . ? 1_555 ? 
428  AE8 15 TYR A  371 ? TYR A 371  . ? 1_555 ? 
429  AE8 15 ALA A  372 ? ALA A 372  . ? 1_555 ? 
430  AE8 15 MET A  373 ? MET A 373  . ? 1_555 ? 
431  AE8 15 SER A  506 ? SER A 506  . ? 1_555 ? 
432  AE8 15 PHE A  509 ? PHE A 509  . ? 1_555 ? 
433  AE8 15 CLA XA .   ? CLA A 1116 . ? 1_555 ? 
434  AE8 15 CLA YA .   ? CLA A 1117 . ? 1_555 ? 
435  AE8 15 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
436  AE8 15 CLA EB .   ? CLA A 1123 . ? 1_555 ? 
437  AE8 15 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
438  AE8 15 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
439  AE8 15 CLA PB .   ? CLA A 1135 . ? 1_555 ? 
440  AE8 15 CLA OF .   ? CLA K 1401 . ? 1_555 ? 
441  AE9 17 TRP A  86  ? TRP A 86   . ? 1_555 ? 
442  AE9 17 MET A  90  ? MET A 90   . ? 1_555 ? 
443  AE9 17 THR A  140 ? THR A 140  . ? 1_555 ? 
444  AE9 17 SER A  141 ? SER A 141  . ? 1_555 ? 
445  AE9 17 SER A  388 ? SER A 388  . ? 1_555 ? 
446  AE9 17 THR A  391 ? THR A 391  . ? 1_555 ? 
447  AE9 17 HIS A  392 ? HIS A 392  . ? 1_555 ? 
448  AE9 17 TRP A  395 ? TRP A 395  . ? 1_555 ? 
449  AE9 17 ILE A  396 ? ILE A 396  . ? 1_555 ? 
450  AE9 17 ILE A  736 ? ILE A 736  . ? 1_555 ? 
451  AE9 17 TRP A  740 ? TRP A 740  . ? 1_555 ? 
452  AE9 17 CLA LA .   ? CLA A 1104 . ? 1_555 ? 
453  AE9 17 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
454  AE9 17 CLA OA .   ? CLA A 1107 . ? 1_555 ? 
455  AE9 17 CLA IB .   ? CLA A 1127 . ? 1_555 ? 
456  AE9 17 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
457  AE9 17 45D TC .   ? 45D B 4011 . ? 1_555 ? 
458  AF1 16 LEU A  87  ? LEU A 87   . ? 1_555 ? 
459  AF1 16 SER A  141 ? SER A 141  . ? 1_555 ? 
460  AF1 16 GLY A  142 ? GLY A 142  . ? 1_555 ? 
461  AF1 16 LEU A  146 ? LEU A 146  . ? 1_555 ? 
462  AF1 16 LEU A  362 ? LEU A 362  . ? 1_555 ? 
463  AF1 16 THR A  363 ? THR A 363  . ? 1_555 ? 
464  AF1 16 MET A  370 ? MET A 370  . ? 1_555 ? 
465  AF1 16 TYR A  376 ? TYR A 376  . ? 1_555 ? 
466  AF1 16 LEU A  389 ? LEU A 389  . ? 1_555 ? 
467  AF1 16 HIS A  392 ? HIS A 392  . ? 1_555 ? 
468  AF1 16 HIS A  393 ? HIS A 393  . ? 1_555 ? 
469  AF1 16 CLA LA .   ? CLA A 1104 . ? 1_555 ? 
470  AF1 16 CLA YA .   ? CLA A 1117 . ? 1_555 ? 
471  AF1 16 CLA EB .   ? CLA A 1123 . ? 1_555 ? 
472  AF1 16 CLA HB .   ? CLA A 1126 . ? 1_555 ? 
473  AF1 16 BCR ZB .   ? BCR A 4003 . ? 1_555 ? 
474  AF2 20 HIS A  52  ? HIS A 52   . ? 1_555 ? 
475  AF2 20 ALA A  53  ? ALA A 53   . ? 1_555 ? 
476  AF2 20 HIS A  56  ? HIS A 56   . ? 1_555 ? 
477  AF2 20 ASP A  57  ? ASP A 57   . ? 1_555 ? 
478  AF2 20 LEU A  352 ? LEU A 352  . ? 1_555 ? 
479  AF2 20 LEU A  356 ? LEU A 356  . ? 1_555 ? 
480  AF2 20 PHE A  399 ? PHE A 399  . ? 1_555 ? 
481  AF2 20 GLY A  403 ? GLY A 403  . ? 1_555 ? 
482  AF2 20 HIS A  407 ? HIS A 407  . ? 1_555 ? 
483  AF2 20 ILE A  410 ? ILE A 410  . ? 1_555 ? 
484  AF2 20 PHE A  570 ? PHE A 570  . ? 1_555 ? 
485  AF2 20 ARG A  571 ? ARG A 571  . ? 1_555 ? 
486  AF2 20 TRP A  588 ? TRP A 588  . ? 1_555 ? 
487  AF2 20 CLA KA .   ? CLA A 1103 . ? 1_555 ? 
488  AF2 20 CLA LA .   ? CLA A 1104 . ? 1_555 ? 
489  AF2 20 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
490  AF2 20 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
491  AF2 20 LHG DC .   ? LHG A 5001 . ? 1_555 ? 
492  AF2 20 HOH IR .   ? HOH A 8093 . ? 1_555 ? 
493  AF2 20 45D TC .   ? 45D B 4011 . ? 1_555 ? 
494  AF3 18 PHE A  332 ? PHE A 332  . ? 1_555 ? 
495  AF3 18 THR A  333 ? THR A 333  . ? 1_555 ? 
496  AF3 18 LEU A  425 ? LEU A 425  . ? 1_555 ? 
497  AF3 18 ARG A  428 ? ARG A 428  . ? 1_555 ? 
498  AF3 18 MET A  429 ? MET A 429  . ? 1_555 ? 
499  AF3 18 HIS A  432 ? HIS A 432  . ? 1_555 ? 
500  AF3 18 HIS A  439 ? HIS A 439  . ? 1_555 ? 
501  AF3 18 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
502  AF3 18 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
503  AF3 18 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
504  AF3 18 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
505  AF3 18 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
506  AF3 18 LHG OC .   ? LHG A 5007 . ? 1_555 ? 
507  AF3 18 VAL J  8   ? VAL L 8    . ? 1_555 ? 
508  AF3 18 THR J  22  ? THR L 22   . ? 1_555 ? 
509  AF3 18 PRO J  23  ? PRO L 23   . ? 1_555 ? 
510  AF3 18 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
511  AF3 18 LHG AG .   ? LHG L 5005 . ? 1_555 ? 
512  AF4 14 TRP A  442 ? TRP A 442  . ? 1_555 ? 
513  AF4 14 ILE A  445 ? ILE A 445  . ? 1_555 ? 
514  AF4 14 PHE A  446 ? PHE A 446  . ? 1_555 ? 
515  AF4 14 HIS A  450 ? HIS A 450  . ? 1_555 ? 
516  AF4 14 CLA MB .   ? CLA A 1132 . ? 1_555 ? 
517  AF4 14 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
518  AF4 14 CLA SC .   ? CLA B 1237 . ? 1_555 ? 
519  AF4 14 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
520  AF4 14 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
521  AF4 14 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
522  AF4 14 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
523  AF4 14 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
524  AF4 14 CLA VF .   ? CLA L 1503 . ? 1_555 ? 
525  AF4 14 BCR WF .   ? BCR L 4019 . ? 1_555 ? 
526  AF5 24 PHE A  449 ? PHE A 449  . ? 1_555 ? 
527  AF5 24 HIS A  450 ? HIS A 450  . ? 1_555 ? 
528  AF5 24 GLY A  453 ? GLY A 453  . ? 1_555 ? 
529  AF5 24 LEU A  454 ? LEU A 454  . ? 1_555 ? 
530  AF5 24 ILE A  456 ? ILE A 456  . ? 1_555 ? 
531  AF5 24 HIS A  457 ? HIS A 457  . ? 1_555 ? 
532  AF5 24 THR A  460 ? THR A 460  . ? 1_555 ? 
533  AF5 24 MET A  461 ? MET A 461  . ? 1_555 ? 
534  AF5 24 ARG A  466 ? ARG A 466  . ? 1_555 ? 
535  AF5 24 PHE A  471 ? PHE A 471  . ? 1_555 ? 
536  AF5 24 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
537  AF5 24 HOH IR .   ? HOH A 8033 . ? 1_555 ? 
538  AF5 24 HIS B  95  ? HIS B 95   . ? 1_555 ? 
539  AF5 24 CLA WC .   ? CLA B 1023 . ? 1_555 ? 
540  AF5 24 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
541  AF5 24 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
542  AF5 24 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
543  AF5 24 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
544  AF5 24 PRO J  64  ? PRO L 64   . ? 1_555 ? 
545  AF5 24 TRP J  65  ? TRP L 65   . ? 1_555 ? 
546  AF5 24 LEU J  68  ? LEU L 68   . ? 1_555 ? 
547  AF5 24 PRO J  70  ? PRO L 70   . ? 1_555 ? 
548  AF5 24 ARG J  72  ? ARG L 72   . ? 1_555 ? 
549  AF5 24 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
550  AF6 18 VAL A  486 ? VAL A 486  . ? 1_555 ? 
551  AF6 18 HIS A  490 ? HIS A 490  . ? 1_555 ? 
552  AF6 18 ALA A  493 ? ALA A 493  . ? 1_555 ? 
553  AF6 18 THR A  497 ? THR A 497  . ? 1_555 ? 
554  AF6 18 ALA A  498 ? ALA A 498  . ? 1_555 ? 
555  AF6 18 CLA XA .   ? CLA A 1116 . ? 1_555 ? 
556  AF6 18 CLA YA .   ? CLA A 1117 . ? 1_555 ? 
557  AF6 18 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
558  AF6 18 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
559  AF6 18 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
560  AF6 18 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
561  AF6 18 CLA OB .   ? CLA A 1134 . ? 1_555 ? 
562  AF6 18 CLA PB .   ? CLA A 1135 . ? 1_555 ? 
563  AF6 18 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
564  AF6 18 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
565  AF6 18 BCR BC .   ? BCR A 4008 . ? 1_555 ? 
566  AF6 18 HOH IR .   ? HOH A 8095 . ? 1_555 ? 
567  AF6 18 CLA OF .   ? CLA K 1401 . ? 1_555 ? 
568  AF7 11 THR A  497 ? THR A 497  . ? 1_555 ? 
569  AF7 11 ALA A  498 ? ALA A 498  . ? 1_555 ? 
570  AF7 11 PRO A  499 ? PRO A 499  . ? 1_555 ? 
571  AF7 11 ASN A  500 ? ASN A 500  . ? 1_555 ? 
572  AF7 11 CLA WA .   ? CLA A 1115 . ? 1_555 ? 
573  AF7 11 CLA XA .   ? CLA A 1116 . ? 1_555 ? 
574  AF7 11 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
575  AF7 11 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
576  AF7 11 BCR BC .   ? BCR A 4008 . ? 1_555 ? 
577  AF7 11 CLA OF .   ? CLA K 1401 . ? 1_555 ? 
578  AF7 11 CLA CJ .   ? CLA b 1211 . ? 1_555 ? 
579  AF8 22 GLN A  368 ? GLN A 368  . ? 1_555 ? 
580  AF8 22 TYR A  371 ? TYR A 371  . ? 1_555 ? 
581  AF8 22 PHE A  482 ? PHE A 482  . ? 1_555 ? 
582  AF8 22 ALA A  483 ? ALA A 483  . ? 1_555 ? 
583  AF8 22 VAL A  486 ? VAL A 486  . ? 1_555 ? 
584  AF8 22 GLN A  487 ? GLN A 487  . ? 1_555 ? 
585  AF8 22 HIS A  490 ? HIS A 490  . ? 1_555 ? 
586  AF8 22 PHE A  509 ? PHE A 509  . ? 1_555 ? 
587  AF8 22 HIS A  535 ? HIS A 535  . ? 1_555 ? 
588  AF8 22 HIS A  538 ? HIS A 538  . ? 1_555 ? 
589  AF8 22 ILE A  542 ? ILE A 542  . ? 1_555 ? 
590  AF8 22 VAL A  605 ? VAL A 605  . ? 1_555 ? 
591  AF8 22 HIS A  608 ? HIS A 608  . ? 1_555 ? 
592  AF8 22 LYS A  612 ? LYS A 612  . ? 1_555 ? 
593  AF8 22 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
594  AF8 22 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
595  AF8 22 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
596  AF8 22 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
597  AF8 22 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
598  AF8 22 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
599  AF8 22 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
600  AF8 22 LHG PC .   ? LHG A 5006 . ? 1_555 ? 
601  AF9 19 LEU A  447 ? LEU A 447  . ? 1_555 ? 
602  AF9 19 GLN A  479 ? GLN A 479  . ? 1_555 ? 
603  AF9 19 PRO A  480 ? PRO A 480  . ? 1_555 ? 
604  AF9 19 ILE A  481 ? ILE A 481  . ? 1_555 ? 
605  AF9 19 PHE A  482 ? PHE A 482  . ? 1_555 ? 
606  AF9 19 ALA A  483 ? ALA A 483  . ? 1_555 ? 
607  AF9 19 PHE A  532 ? PHE A 532  . ? 1_555 ? 
608  AF9 19 HIS A  535 ? HIS A 535  . ? 1_555 ? 
609  AF9 19 HIS A  536 ? HIS A 536  . ? 1_555 ? 
610  AF9 19 HIS A  543 ? HIS A 543  . ? 1_555 ? 
611  AF9 19 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
612  AF9 19 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
613  AF9 19 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
614  AF9 19 CLA PB .   ? CLA A 1135 . ? 1_555 ? 
615  AF9 19 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
616  AF9 19 LMG EC .   ? LMG A 5002 . ? 1_555 ? 
617  AF9 19 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
618  AF9 19 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
619  AF9 19 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
620  AG1 17 ILE A  436 ? ILE A 436  . ? 1_555 ? 
621  AG1 17 LEU A  440 ? LEU A 440  . ? 1_555 ? 
622  AG1 17 VAL A  443 ? VAL A 443  . ? 1_555 ? 
623  AG1 17 ALA A  539 ? ALA A 539  . ? 1_555 ? 
624  AG1 17 ILE A  542 ? ILE A 542  . ? 1_555 ? 
625  AG1 17 HIS A  543 ? HIS A 543  . ? 1_555 ? 
626  AG1 17 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
627  AG1 17 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
628  AG1 17 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
629  AG1 17 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
630  AG1 17 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
631  AG1 17 CLA PB .   ? CLA A 1135 . ? 1_555 ? 
632  AG1 17 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
633  AG1 17 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
634  AG1 17 BCR BC .   ? BCR A 4008 . ? 1_555 ? 
635  AG1 17 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
636  AG1 17 CLA OF .   ? CLA K 1401 . ? 1_555 ? 
637  AG2 15 ILE A  700 ? ILE A 700  . ? 1_555 ? 
638  AG2 15 ALA A  703 ? ALA A 703  . ? 1_555 ? 
639  AG2 15 HIS A  704 ? HIS A 704  . ? 1_555 ? 
640  AG2 15 LEU A  707 ? LEU A 707  . ? 1_555 ? 
641  AG2 15 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
642  AG2 15 CLA TB .   ? CLA A 1139 . ? 1_555 ? 
643  AG2 15 SER B  418 ? SER B 418  . ? 1_555 ? 
644  AG2 15 SER B  421 ? SER B 421  . ? 1_555 ? 
645  AG2 15 TRP B  422 ? TRP B 422  . ? 1_555 ? 
646  AG2 15 CLA YD .   ? CLA B 1229 . ? 1_555 ? 
647  AG2 15 GLY F  80  ? GLY F 80   . ? 1_555 ? 
648  AG2 15 GLY F  83  ? GLY F 83   . ? 1_555 ? 
649  AG2 15 ARG F  84  ? ARG F 84   . ? 1_555 ? 
650  AG2 15 TYR F  86  ? TYR F 86   . ? 1_555 ? 
651  AG2 15 CLA DF .   ? CLA F 1301 . ? 1_555 ? 
652  AG3 22 THR A  45  ? THR A 45   . ? 1_555 ? 
653  AG3 22 ILE A  48  ? ILE A 48   . ? 1_555 ? 
654  AG3 22 TRP A  49  ? TRP A 49   . ? 1_555 ? 
655  AG3 22 VAL A  701 ? VAL A 701  . ? 1_555 ? 
656  AG3 22 HIS A  704 ? HIS A 704  . ? 1_555 ? 
657  AG3 22 VAL A  709 ? VAL A 709  . ? 1_555 ? 
658  AG3 22 PRO A  711 ? PRO A 711  . ? 1_555 ? 
659  AG3 22 PRO A  715 ? PRO A 715  . ? 1_555 ? 
660  AG3 22 ARG A  716 ? ARG A 716  . ? 1_555 ? 
661  AG3 22 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
662  AG3 22 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
663  AG3 22 PQN VB .   ? PQN A 2001 . ? 1_555 ? 
664  AG3 22 HOH IR .   ? HOH A 8016 . ? 1_555 ? 
665  AG3 22 LEU F  87  ? LEU F 87   . ? 1_555 ? 
666  AG3 22 GLU F  100 ? GLU F 100  . ? 1_555 ? 
667  AG3 22 ILE F  103 ? ILE F 103  . ? 1_555 ? 
668  AG3 22 MET F  112 ? MET F 112  . ? 1_555 ? 
669  AG3 22 MET H  14  ? MET J 14   . ? 1_555 ? 
670  AG3 22 ILE H  15  ? ILE J 15   . ? 1_555 ? 
671  AG3 22 ALA H  17  ? ALA J 17   . ? 1_555 ? 
672  AG3 22 LEU H  18  ? LEU J 18   . ? 1_555 ? 
673  AG3 22 CLA LF .   ? CLA J 1302 . ? 1_555 ? 
674  AG4 15 TRP A  49  ? TRP A 49   . ? 1_555 ? 
675  AG4 15 PHE A  681 ? PHE A 681  . ? 1_555 ? 
676  AG4 15 LEU A  718 ? LEU A 718  . ? 1_555 ? 
677  AG4 15 GLN A  722 ? GLN A 722  . ? 1_555 ? 
678  AG4 15 VAL A  726 ? VAL A 726  . ? 1_555 ? 
679  AG4 15 HIS A  730 ? HIS A 730  . ? 1_555 ? 
680  AG4 15 LEU A  733 ? LEU A 733  . ? 1_555 ? 
681  AG4 15 CLA IA .   ? CLA A 1013 . ? 1_555 ? 
682  AG4 15 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
683  AG4 15 CLA JB .   ? CLA A 1128 . ? 1_555 ? 
684  AG4 15 PQN VB .   ? PQN A 2001 . ? 1_555 ? 
685  AG4 15 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
686  AG4 15 LHG DC .   ? LHG A 5001 . ? 1_555 ? 
687  AG4 15 45D TC .   ? 45D B 4011 . ? 1_555 ? 
688  AG4 15 BCR NF .   ? BCR J 4013 . ? 1_555 ? 
689  AG5 11 MET A  684 ? MET A 684  . ? 1_555 ? 
690  AG5 11 PHE A  685 ? PHE A 685  . ? 1_555 ? 
691  AG5 11 SER A  688 ? SER A 688  . ? 1_555 ? 
692  AG5 11 ARG A  690 ? ARG A 690  . ? 1_555 ? 
693  AG5 11 TRP A  693 ? TRP A 693  . ? 1_555 ? 
694  AG5 11 ALA A  717 ? ALA A 717  . ? 1_555 ? 
695  AG5 11 LEU A  718 ? LEU A 718  . ? 1_555 ? 
696  AG5 11 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
697  AG5 11 CLA TB .   ? CLA A 1139 . ? 1_555 ? 
698  AG5 11 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
699  AG5 11 ILE H  15  ? ILE J 15   . ? 1_555 ? 
700  AG6 8  CYS A  574 ? CYS A 574  . ? 1_555 ? 
701  AG6 8  GLY A  576 ? GLY A 576  . ? 1_555 ? 
702  AG6 8  PRO A  577 ? PRO A 577  . ? 1_555 ? 
703  AG6 8  CYS A  583 ? CYS A 583  . ? 1_555 ? 
704  AG6 8  ARG A  724 ? ARG A 724  . ? 1_555 ? 
705  AG6 8  CYS B  556 ? CYS B 556  . ? 1_555 ? 
706  AG6 8  GLY B  558 ? GLY B 558  . ? 1_555 ? 
707  AG6 8  CYS B  565 ? CYS B 565  . ? 1_555 ? 
708  AG7 15 LEU A  260 ? LEU A 260  . ? 1_555 ? 
709  AG7 15 PHE A  263 ? PHE A 263  . ? 1_555 ? 
710  AG7 15 ILE A  305 ? ILE A 305  . ? 1_555 ? 
711  AG7 15 HIS A  309 ? HIS A 309  . ? 1_555 ? 
712  AG7 15 CLA UA .   ? CLA A 1113 . ? 1_555 ? 
713  AG7 15 CLA ZA .   ? CLA A 1118 . ? 1_555 ? 
714  AG7 15 CLA BB .   ? CLA A 1120 . ? 1_555 ? 
715  AG7 15 BCR YB .   ? BCR A 4002 . ? 1_555 ? 
716  AG7 15 ILE I  29  ? ILE K 36   . ? 1_555 ? 
717  AG7 15 ILE I  34  ? ILE K 41   . ? 1_555 ? 
718  AG7 15 ALA I  61  ? ALA K 68   . ? 1_555 ? 
719  AG7 15 THR I  62  ? THR K 69   . ? 1_555 ? 
720  AG7 15 SER I  64  ? SER K 71   . ? 1_555 ? 
721  AG7 15 PHE I  65  ? PHE K 72   . ? 1_555 ? 
722  AG7 15 BCR QF .   ? BCR K 4001 . ? 1_555 ? 
723  AG8 10 THR A  161 ? THR A 161  . ? 1_555 ? 
724  AG8 10 GLY A  164 ? GLY A 164  . ? 1_555 ? 
725  AG8 10 GLY A  165 ? GLY A 165  . ? 1_555 ? 
726  AG8 10 CLA SA .   ? CLA A 1111 . ? 1_555 ? 
727  AG8 10 CLA TA .   ? CLA A 1112 . ? 1_555 ? 
728  AG8 10 CLA UA .   ? CLA A 1113 . ? 1_555 ? 
729  AG8 10 CLA VA .   ? CLA A 1114 . ? 1_555 ? 
730  AG8 10 CLA ZA .   ? CLA A 1118 . ? 1_555 ? 
731  AG8 10 BCR XB .   ? BCR A 4001 . ? 1_555 ? 
732  AG8 10 BCR ZB .   ? BCR A 4003 . ? 1_555 ? 
733  AG9 8  LEU A  207 ? LEU A 207  . ? 1_555 ? 
734  AG9 8  GLY A  208 ? GLY A 208  . ? 1_555 ? 
735  AG9 8  CLA KA .   ? CLA A 1103 . ? 1_555 ? 
736  AG9 8  CLA LA .   ? CLA A 1104 . ? 1_555 ? 
737  AG9 8  CLA SA .   ? CLA A 1111 . ? 1_555 ? 
738  AG9 8  CLA YA .   ? CLA A 1117 . ? 1_555 ? 
739  AG9 8  CLA IB .   ? CLA A 1127 . ? 1_555 ? 
740  AG9 8  BCR YB .   ? BCR A 4002 . ? 1_555 ? 
741  AH1 13 ALA A  350 ? ALA A 350  . ? 1_555 ? 
742  AH1 13 ILE A  354 ? ILE A 354  . ? 1_555 ? 
743  AH1 13 GLY A  408 ? GLY A 408  . ? 1_555 ? 
744  AH1 13 PHE A  411 ? PHE A 411  . ? 1_555 ? 
745  AH1 13 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
746  AH1 13 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
747  AH1 13 CLA EB .   ? CLA A 1123 . ? 1_555 ? 
748  AH1 13 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
749  AH1 13 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
750  AH1 13 BCR BC .   ? BCR A 4008 . ? 1_555 ? 
751  AH1 13 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
752  AH1 13 LHG OC .   ? LHG A 5007 . ? 1_555 ? 
753  AH1 13 LHG AG .   ? LHG L 5005 . ? 1_555 ? 
754  AH2 10 SER A  361 ? SER A 361  . ? 1_555 ? 
755  AH2 10 ILE A  401 ? ILE A 401  . ? 1_555 ? 
756  AH2 10 LEU A  549 ? LEU A 549  . ? 1_555 ? 
757  AH2 10 CLA AB .   ? CLA A 1119 . ? 1_555 ? 
758  AH2 10 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
759  AH2 10 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
760  AH2 10 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
761  AH2 10 CLA OB .   ? CLA A 1134 . ? 1_555 ? 
762  AH2 10 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
763  AH2 10 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
764  AH3 5  TRP A  118 ? TRP A 118  . ? 1_555 ? 
765  AH3 5  LEU A  166 ? LEU A 166  . ? 1_555 ? 
766  AH3 5  VAL A  167 ? VAL A 167  . ? 1_555 ? 
767  AH3 5  CLA MA .   ? CLA A 1105 . ? 1_555 ? 
768  AH3 5  CLA LF .   ? CLA J 1302 . ? 1_555 ? 
769  AH4 17 TRP A  49  ? TRP A 49   . ? 1_555 ? 
770  AH4 17 ASN A  50  ? ASN A 50   . ? 1_555 ? 
771  AH4 17 ALA A  53  ? ALA A 53   . ? 1_555 ? 
772  AH4 17 ASN A  54  ? ASN A 54   . ? 1_555 ? 
773  AH4 17 PHE A  399 ? PHE A 399  . ? 1_555 ? 
774  AH4 17 ARG A  571 ? ARG A 571  . ? 1_555 ? 
775  AH4 17 SER A  719 ? SER A 719  . ? 1_555 ? 
776  AH4 17 ILE A  721 ? ILE A 721  . ? 1_555 ? 
777  AH4 17 GLN A  722 ? GLN A 722  . ? 1_555 ? 
778  AH4 17 ALA A  725 ? ALA A 725  . ? 1_555 ? 
779  AH4 17 ALA A  729 ? ALA A 729  . ? 1_555 ? 
780  AH4 17 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
781  AH4 17 CLA LA .   ? CLA A 1104 . ? 1_555 ? 
782  AH4 17 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
783  AH4 17 CLA JB .   ? CLA A 1128 . ? 1_555 ? 
784  AH4 17 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
785  AH4 17 GLY E  50  ? GLY E 51   . ? 1_555 ? 
786  AH5 9  HIS A  450 ? HIS A 450  . ? 1_555 ? 
787  AH5 9  PHE A  471 ? PHE A 471  . ? 1_555 ? 
788  AH5 9  ALA A  475 ? ALA A 475  . ? 1_555 ? 
789  AH5 9  ILE A  476 ? ILE A 476  . ? 1_555 ? 
790  AH5 9  GLN A  477 ? GLN A 477  . ? 1_555 ? 
791  AH5 9  HIS A  536 ? HIS A 536  . ? 1_555 ? 
792  AH5 9  CLA QB .   ? CLA A 1136 . ? 1_555 ? 
793  AH5 9  ARG J  72  ? ARG L 72   . ? 1_555 ? 
794  AH5 9  DGD ZF .   ? DGD L 5004 . ? 1_555 ? 
795  AH6 19 HIS A  328 ? HIS A 328  . ? 1_555 ? 
796  AH6 19 LYS A  329 ? LYS A 329  . ? 1_555 ? 
797  AH6 19 GLY A  330 ? GLY A 330  . ? 1_555 ? 
798  AH6 19 PRO A  331 ? PRO A 331  . ? 1_555 ? 
799  AH6 19 PHE A  332 ? PHE A 332  . ? 1_555 ? 
800  AH6 19 THR A  333 ? THR A 333  . ? 1_555 ? 
801  AH6 19 GLY A  336 ? GLY A 336  . ? 1_555 ? 
802  AH6 19 HIS A  337 ? HIS A 337  . ? 1_555 ? 
803  AH6 19 LEU A  425 ? LEU A 425  . ? 1_555 ? 
804  AH6 19 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
805  AH6 19 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
806  AH6 19 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
807  AH6 19 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
808  AH6 19 CLA PB .   ? CLA A 1135 . ? 1_555 ? 
809  AH6 19 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
810  AH6 19 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
811  AH6 19 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
812  AH6 19 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
813  AH6 19 LHG OC .   ? LHG A 5007 . ? 1_555 ? 
814  AH7 11 ILE A  481 ? ILE A 481  . ? 1_555 ? 
815  AH7 11 GLN A  484 ? GLN A 484  . ? 1_555 ? 
816  AH7 11 TRP A  485 ? TRP A 485  . ? 1_555 ? 
817  AH7 11 HIS A  488 ? HIS A 488  . ? 1_555 ? 
818  AH7 11 LEU A  489 ? LEU A 489  . ? 1_555 ? 
819  AH7 11 LEU A  492 ? LEU A 492  . ? 1_555 ? 
820  AH7 11 CLA FB .   ? CLA A 1124 . ? 1_555 ? 
821  AH7 11 LHG NC .   ? LHG A 5005 . ? 1_555 ? 
822  AH7 11 LHG PC .   ? LHG A 5006 . ? 1_555 ? 
823  AH7 11 HOH IR .   ? HOH A 8078 . ? 1_555 ? 
824  AH7 11 HOH IR .   ? HOH A 8123 . ? 1_555 ? 
825  AH8 4  ARG A  414 ? ARG A 414  . ? 1_555 ? 
826  AH8 4  GLY A  569 ? GLY A 569  . ? 1_555 ? 
827  AH8 4  PHE A  570 ? PHE A 570  . ? 1_555 ? 
828  AH8 4  ARG A  571 ? ARG A 571  . ? 1_555 ? 
829  AH9 23 PHE A  452 ? PHE A 452  . ? 1_555 ? 
830  AH9 23 ILE A  456 ? ILE A 456  . ? 1_555 ? 
831  AH9 23 PHE A  540 ? PHE A 540  . ? 1_555 ? 
832  AH9 23 PHE A  596 ? PHE A 596  . ? 1_555 ? 
833  AH9 23 TRP A  597 ? TRP A 597  . ? 1_555 ? 
834  AH9 23 ASN A  600 ? ASN A 600  . ? 1_555 ? 
835  AH9 23 ILE A  642 ? ILE A 642  . ? 1_555 ? 
836  AH9 23 TYR A  731 ? TYR A 731  . ? 1_555 ? 
837  AH9 23 CLA HA .   ? CLA A 1011 . ? 1_555 ? 
838  AH9 23 HOH IR .   ? HOH A 8009 . ? 1_555 ? 
839  AH9 23 TRP B  645 ? TRP B 645  . ? 1_555 ? 
840  AH9 23 LEU B  648 ? LEU B 648  . ? 1_555 ? 
841  AH9 23 PHE B  649 ? PHE B 649  . ? 1_555 ? 
842  AH9 23 HIS B  651 ? HIS B 651  . ? 1_555 ? 
843  AH9 23 LEU B  652 ? LEU B 652  . ? 1_555 ? 
844  AH9 23 TRP B  654 ? TRP B 654  . ? 1_555 ? 
845  AH9 23 ALA B  655 ? ALA B 655  . ? 1_555 ? 
846  AH9 23 CLA VC .   ? CLA B 1021 . ? 1_555 ? 
847  AH9 23 CLA WC .   ? CLA B 1023 . ? 1_555 ? 
848  AH9 23 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
849  AH9 23 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
850  AH9 23 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
851  AH9 23 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
852  AI1 21 ALA A  435 ? ALA A 435  . ? 1_555 ? 
853  AI1 21 HIS A  439 ? HIS A 439  . ? 1_555 ? 
854  AI1 21 TRP A  442 ? TRP A 442  . ? 1_555 ? 
855  AI1 21 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
856  AI1 21 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
857  AI1 21 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
858  AI1 21 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
859  AI1 21 ALA B  678 ? ALA B 678  . ? 1_555 ? 
860  AI1 21 ARG B  681 ? ARG B 681  . ? 1_555 ? 
861  AI1 21 THR B  682 ? THR B 682  . ? 1_555 ? 
862  AI1 21 PRO B  683 ? PRO B 683  . ? 1_555 ? 
863  AI1 21 CLA SC .   ? CLA B 1237 . ? 1_555 ? 
864  AI1 21 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
865  AI1 21 HIS J  19  ? HIS L 19   . ? 1_555 ? 
866  AI1 21 THR J  22  ? THR L 22   . ? 1_555 ? 
867  AI1 21 ILE J  24  ? ILE L 24   . ? 1_555 ? 
868  AI1 21 SER J  25  ? SER L 25   . ? 1_555 ? 
869  AI1 21 ILE J  34  ? ILE L 34   . ? 1_555 ? 
870  AI1 21 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
871  AI1 21 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
872  AI1 21 DGD ZF .   ? DGD L 5004 . ? 1_555 ? 
873  AI2 14 ILE A  48  ? ILE A 48   . ? 1_555 ? 
874  AI2 14 HIS A  52  ? HIS A 52   . ? 1_555 ? 
875  AI2 14 CLA JA .   ? CLA A 1102 . ? 1_555 ? 
876  AI2 14 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
877  AI2 14 CLA QA .   ? CLA A 1109 . ? 1_555 ? 
878  AI2 14 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
879  AI2 14 CLA TB .   ? CLA A 1139 . ? 1_555 ? 
880  AI2 14 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
881  AI2 14 PQN VB .   ? PQN A 2001 . ? 1_555 ? 
882  AI2 14 LHG DC .   ? LHG A 5001 . ? 1_555 ? 
883  AI2 14 BCR WE .   ? BCR B 4014 . ? 1_555 ? 
884  AI2 14 ALA H  11  ? ALA J 11   . ? 1_555 ? 
885  AI2 14 PRO H  12  ? PRO J 12   . ? 1_555 ? 
886  AI2 14 BCR NF .   ? BCR J 4013 . ? 1_555 ? 
887  AI3 13 VAL A  82  ? VAL A 82   . ? 1_555 ? 
888  AI3 13 CLA JA .   ? CLA A 1102 . ? 1_555 ? 
889  AI3 13 CLA MA .   ? CLA A 1105 . ? 1_555 ? 
890  AI3 13 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
891  AI3 13 CLA OA .   ? CLA A 1107 . ? 1_555 ? 
892  AI3 13 CLA HB .   ? CLA A 1126 . ? 1_555 ? 
893  AI3 13 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
894  AI3 13 CLA QC .   ? CLA A 1012 . ? 1_555 ? 
895  AI3 13 CLA YE .   ? CLA B 1230 . ? 1_555 ? 
896  AI3 13 45D TC .   ? 45D B 4011 . ? 1_555 ? 
897  AI3 13 ALA H  23  ? ALA J 23   . ? 1_555 ? 
898  AI3 13 LEU H  26  ? LEU J 26   . ? 1_555 ? 
899  AI3 13 BCR NF .   ? BCR J 4013 . ? 1_555 ? 
900  AI4 8  GLU A  9   ? GLU A 9    . ? 1_555 ? 
901  AI4 8  ALA A  10  ? ALA A 10   . ? 1_555 ? 
902  AI4 8  LYS A  11  ? LYS A 11   . ? 1_555 ? 
903  AI4 8  CLA RA .   ? CLA A 1110 . ? 1_555 ? 
904  AI4 8  CLA ZA .   ? CLA A 1118 . ? 1_555 ? 
905  AI4 8  LYS I  41  ? LYS K 48   . ? 1_555 ? 
906  AI4 8  ASP I  42  ? ASP K 49   . ? 1_555 ? 
907  AI4 8  CLA PF .   ? CLA K 1402 . ? 1_555 ? 
908  AI5 18 LYS A  329 ? LYS A 329  . ? 1_555 ? 
909  AI5 18 PRO A  331 ? PRO A 331  . ? 1_555 ? 
910  AI5 18 PHE A  332 ? PHE A 332  . ? 1_555 ? 
911  AI5 18 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
912  AI5 18 CLA DB .   ? CLA A 1122 . ? 1_555 ? 
913  AI5 18 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
914  AI5 18 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
915  AI5 18 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
916  AI5 18 LHG NC .   ? LHG A 5005 . ? 1_555 ? 
917  AI5 18 LHG OC .   ? LHG A 5007 . ? 1_555 ? 
918  AI5 18 LHG AG .   ? LHG L 5005 . ? 1_555 ? 
919  AI5 18 PHE M  149 ? PHE b 151  . ? 1_555 ? 
920  AI5 18 TRP M  152 ? TRP b 154  . ? 1_555 ? 
921  AI5 18 LEU M  153 ? LEU b 155  . ? 1_555 ? 
922  AI5 18 SQD NK .   ? SQD b 5006 . ? 1_555 ? 
923  AI5 18 HOH UR .   ? HOH b 8108 . ? 1_555 ? 
924  AI5 18 LEU V  21  ? LEU m 21   . ? 1_555 ? 
925  AI5 18 HOH CS .   ? HOH m 8004 . ? 1_555 ? 
926  AI6 11 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
927  AI6 11 LMG GC .   ? LMG A 5004 . ? 1_555 ? 
928  AI6 11 LHG PC .   ? LHG A 5006 . ? 1_555 ? 
929  AI6 11 LHG AG .   ? LHG L 5005 . ? 1_555 ? 
930  AI6 11 GLN M  131 ? GLN b 133  . ? 1_555 ? 
931  AI6 11 SER M  135 ? SER b 137  . ? 1_555 ? 
932  AI6 11 PHE M  139 ? PHE b 141  . ? 1_555 ? 
933  AI6 11 SQD NK .   ? SQD b 5006 . ? 1_555 ? 
934  AI6 11 MET V  1   ? MET m 1    . ? 1_555 ? 
935  AI6 11 THR V  6   ? THR m 6    . ? 1_555 ? 
936  AI6 11 GLN V  7   ? GLN m 7    . ? 1_555 ? 
937  AI7 13 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
938  AI7 13 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
939  AI7 13 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
940  AI7 13 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
941  AI7 13 LHG FC .   ? LHG A 5003 . ? 1_555 ? 
942  AI7 13 HOH IR .   ? HOH A 8018 . ? 1_555 ? 
943  AI7 13 ASN J  5   ? ASN L 5    . ? 1_555 ? 
944  AI7 13 LHG AG .   ? LHG L 5005 . ? 1_555 ? 
945  AI7 13 LYS M  158 ? LYS b 160  . ? 1_555 ? 
946  AI7 13 PHE M  159 ? PHE b 161  . ? 1_555 ? 
947  AI7 13 CLA ZI .   ? CLA b 1208 . ? 1_555 ? 
948  AI7 13 SQD NK .   ? SQD b 5006 . ? 1_555 ? 
949  AI7 13 HOH UR .   ? HOH b 8041 . ? 1_555 ? 
950  AI8 9  CLA PB .   ? CLA A 1135 . ? 1_555 ? 
951  AI8 9  LMG GC .   ? LMG A 5004 . ? 1_555 ? 
952  AI8 9  LHG NC .   ? LHG A 5005 . ? 1_555 ? 
953  AI8 9  TYR R  9   ? TYR i 9    . ? 1_555 ? 
954  AI8 9  THR V  6   ? THR m 6    . ? 1_555 ? 
955  AI8 9  LEU V  9   ? LEU m 9    . ? 1_555 ? 
956  AI8 9  VAL V  13  ? VAL m 13   . ? 1_555 ? 
957  AI8 9  HOH CS .   ? HOH m 8007 . ? 1_555 ? 
958  AI8 9  HOH CS .   ? HOH m 8008 . ? 1_555 ? 
959  AI9 22 ILE A  670 ? ILE A 670  . ? 1_555 ? 
960  AI9 22 LEU A  673 ? LEU A 673  . ? 1_555 ? 
961  AI9 22 ALA A  674 ? ALA A 674  . ? 1_555 ? 
962  AI9 22 HIS A  676 ? HIS A 676  . ? 1_555 ? 
963  AI9 22 PHE A  677 ? PHE A 677  . ? 1_555 ? 
964  AI9 22 PHE A  679 ? PHE A 679  . ? 1_555 ? 
965  AI9 22 ALA A  680 ? ALA A 680  . ? 1_555 ? 
966  AI9 22 CLA HA .   ? CLA A 1011 . ? 1_555 ? 
967  AI9 22 CLA IA .   ? CLA A 1013 . ? 1_555 ? 
968  AI9 22 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
969  AI9 22 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
970  AI9 22 PHE B  578 ? PHE B 578  . ? 1_555 ? 
971  AI9 22 TRP B  579 ? TRP B 579  . ? 1_555 ? 
972  AI9 22 ASN B  582 ? ASN B 582  . ? 1_555 ? 
973  AI9 22 TRP B  586 ? TRP B 586  . ? 1_555 ? 
974  AI9 22 LEU B  613 ? LEU B 613  . ? 1_555 ? 
975  AI9 22 PHE B  617 ? PHE B 617  . ? 1_555 ? 
976  AI9 22 TRP B  654 ? TRP B 654  . ? 1_555 ? 
977  AI9 22 CLA VC .   ? CLA B 1021 . ? 1_555 ? 
978  AI9 22 CLA YE .   ? CLA B 1230 . ? 1_555 ? 
979  AI9 22 45D TC .   ? 45D B 4011 . ? 1_555 ? 
980  AI9 22 HOH JR .   ? HOH B 8030 . ? 1_555 ? 
981  AJ1 18 ASN A  441 ? ASN A 441  . ? 1_555 ? 
982  AJ1 18 TRP A  442 ? TRP A 442  . ? 1_555 ? 
983  AJ1 18 ILE A  445 ? ILE A 445  . ? 1_555 ? 
984  AJ1 18 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
985  AJ1 18 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
986  AJ1 18 HIS B  679 ? HIS B 679  . ? 1_555 ? 
987  AJ1 18 ALA B  685 ? ALA B 685  . ? 1_555 ? 
988  AJ1 18 VAL B  688 ? VAL B 688  . ? 1_555 ? 
989  AJ1 18 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
990  AJ1 18 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
991  AJ1 18 HOH JR .   ? HOH B 8008 . ? 1_555 ? 
992  AJ1 18 HOH JR .   ? HOH B 8058 . ? 1_555 ? 
993  AJ1 18 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
994  AJ1 18 HIS J  57  ? HIS L 57   . ? 1_555 ? 
995  AJ1 18 LEU J  88  ? LEU L 88   . ? 1_555 ? 
996  AJ1 18 ALA J  92  ? ALA L 92   . ? 1_555 ? 
997  AJ1 18 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
998  AJ1 18 BCR WF .   ? BCR L 4019 . ? 1_555 ? 
999  AJ2 14 ALA A  674 ? ALA A 674  . ? 1_555 ? 
1000 AJ2 14 PHE A  677 ? PHE A 677  . ? 1_555 ? 
1001 AJ2 14 VAL A  678 ? VAL A 678  . ? 1_555 ? 
1002 AJ2 14 TRP A  740 ? TRP A 740  . ? 1_555 ? 
1003 AJ2 14 CLA IA .   ? CLA A 1013 . ? 1_555 ? 
1004 AJ2 14 CLA NA .   ? CLA A 1106 . ? 1_555 ? 
1005 AJ2 14 CLA HB .   ? CLA A 1126 . ? 1_555 ? 
1006 AJ2 14 CLA JB .   ? CLA A 1128 . ? 1_555 ? 
1007 AJ2 14 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
1008 AJ2 14 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
1009 AJ2 14 CLA QC .   ? CLA A 1012 . ? 1_555 ? 
1010 AJ2 14 CLA YD .   ? CLA B 1229 . ? 1_555 ? 
1011 AJ2 14 CLA YE .   ? CLA B 1230 . ? 1_555 ? 
1012 AJ2 14 BCR WE .   ? BCR B 4014 . ? 1_555 ? 
1013 AJ3 4  ARG A  462 ? ARG A 462  . ? 1_555 ? 
1014 AJ3 4  THR A  641 ? THR A 641  . ? 1_555 ? 
1015 AJ3 4  GLY A  644 ? GLY A 644  . ? 1_555 ? 
1016 AJ3 4  ARG A  647 ? ARG A 647  . ? 1_555 ? 
1017 AJ4 20 LEU A  646 ? LEU A 646  . ? 1_555 ? 
1018 AJ4 20 LEU A  650 ? LEU A 650  . ? 1_555 ? 
1019 AJ4 20 TRP A  651 ? TRP A 651  . ? 1_555 ? 
1020 AJ4 20 CLA HA .   ? CLA A 1011 . ? 1_555 ? 
1021 AJ4 20 CLA RC .   ? CLA B 1022 . ? 1_555 ? 
1022 AJ4 20 ALA B  519 ? ALA B 519  . ? 1_555 ? 
1023 AJ4 20 TRP B  586 ? TRP B 586  . ? 1_555 ? 
1024 AJ4 20 PHE B  589 ? PHE B 589  . ? 1_555 ? 
1025 AJ4 20 TRP B  616 ? TRP B 616  . ? 1_555 ? 
1026 AJ4 20 LEU B  621 ? LEU B 621  . ? 1_555 ? 
1027 AJ4 20 SER B  625 ? SER B 625  . ? 1_555 ? 
1028 AJ4 20 PHE B  647 ? PHE B 647  . ? 1_555 ? 
1029 AJ4 20 HIS B  651 ? HIS B 651  . ? 1_555 ? 
1030 AJ4 20 TRP B  654 ? TRP B 654  . ? 1_555 ? 
1031 AJ4 20 TYR B  714 ? TYR B 714  . ? 1_555 ? 
1032 AJ4 20 THR B  717 ? THR B 717  . ? 1_555 ? 
1033 AJ4 20 TYR B  718 ? TYR B 718  . ? 1_555 ? 
1034 AJ4 20 PHE B  721 ? PHE B 721  . ? 1_555 ? 
1035 AJ4 20 CLA QC .   ? CLA A 1012 . ? 1_555 ? 
1036 AJ4 20 HOH JR .   ? HOH B 8030 . ? 1_555 ? 
1037 AJ5 21 ASN A  441 ? ASN A 441  . ? 1_555 ? 
1038 AJ5 21 ILE A  445 ? ILE A 445  . ? 1_555 ? 
1039 AJ5 21 GLY A  448 ? GLY A 448  . ? 1_555 ? 
1040 AJ5 21 PHE A  449 ? PHE A 449  . ? 1_555 ? 
1041 AJ5 21 PHE A  540 ? PHE A 540  . ? 1_555 ? 
1042 AJ5 21 LEU A  547 ? LEU A 547  . ? 1_555 ? 
1043 AJ5 21 ILE A  548 ? ILE A 548  . ? 1_555 ? 
1044 AJ5 21 PHE A  596 ? PHE A 596  . ? 1_555 ? 
1045 AJ5 21 TRP A  597 ? TRP A 597  . ? 1_555 ? 
1046 AJ5 21 CLA RC .   ? CLA B 1022 . ? 1_555 ? 
1047 AJ5 21 CLA MB .   ? CLA A 1132 . ? 1_555 ? 
1048 AJ5 21 LEU B  652 ? LEU B 652  . ? 1_555 ? 
1049 AJ5 21 ALA B  655 ? ALA B 655  . ? 1_555 ? 
1050 AJ5 21 THR B  656 ? THR B 656  . ? 1_555 ? 
1051 AJ5 21 PHE B  658 ? PHE B 658  . ? 1_555 ? 
1052 AJ5 21 MET B  659 ? MET B 659  . ? 1_555 ? 
1053 AJ5 21 TYR B  667 ? TYR B 667  . ? 1_555 ? 
1054 AJ5 21 TRP B  668 ? TRP B 668  . ? 1_555 ? 
1055 AJ5 21 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
1056 AJ5 21 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1057 AJ5 21 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
1058 AJ6 23 LMG ER .   ? LMG 0 5001 . ? 1_555 ? 
1059 AJ6 23 LHG WQ .   ? LHG 0 5002 . ? 1_555 ? 
1060 AJ6 23 PHE B  5   ? PHE B 5    . ? 1_555 ? 
1061 AJ6 23 PHE B  8   ? PHE B 8    . ? 1_555 ? 
1062 AJ6 23 GLY B  24  ? GLY B 24   . ? 1_555 ? 
1063 AJ6 23 ILE B  25  ? ILE B 25   . ? 1_555 ? 
1064 AJ6 23 ALA B  28  ? ALA B 28   . ? 1_555 ? 
1065 AJ6 23 HIS B  29  ? HIS B 29   . ? 1_555 ? 
1066 AJ6 23 SER B  49  ? SER B 49   . ? 1_555 ? 
1067 AJ6 23 ILE B  56  ? ILE B 56   . ? 1_555 ? 
1068 AJ6 23 CLA YC .   ? CLA B 1202 . ? 1_555 ? 
1069 AJ6 23 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1070 AJ6 23 CLA AD .   ? CLA B 1204 . ? 1_555 ? 
1071 AJ6 23 LMG OE .   ? LMG B 5002 . ? 1_555 ? 
1072 AJ6 23 HOH JR .   ? HOH B 8072 . ? 1_555 ? 
1073 AJ6 23 MET G  17  ? MET I 17   . ? 1_555 ? 
1074 AJ6 23 PHE G  22  ? PHE I 22   . ? 1_555 ? 
1075 AJ6 23 BCR WF .   ? BCR L 4019 . ? 1_555 ? 
1076 AJ6 23 ALA K  22  ? ALA M 22   . ? 1_555 ? 
1077 AJ6 23 SER K  26  ? SER M 26   . ? 1_555 ? 
1078 AJ6 23 LEU K  29  ? LEU M 29   . ? 1_555 ? 
1079 AJ6 23 TYR K  30  ? TYR M 30   . ? 1_555 ? 
1080 AJ6 23 ECH DG .   ? ECH M 4021 . ? 1_555 ? 
1081 AJ7 21 HIS B  29  ? HIS B 29   . ? 1_555 ? 
1082 AJ7 21 PHE B  31  ? PHE B 31   . ? 1_555 ? 
1083 AJ7 21 TYR B  43  ? TYR B 43   . ? 1_555 ? 
1084 AJ7 21 ILE B  46  ? ILE B 46   . ? 1_555 ? 
1085 AJ7 21 HIS B  50  ? HIS B 50   . ? 1_555 ? 
1086 AJ7 21 HIS B  53  ? HIS B 53   . ? 1_555 ? 
1087 AJ7 21 ILE B  54  ? ILE B 54   . ? 1_555 ? 
1088 AJ7 21 PHE B  168 ? PHE B 168  . ? 1_555 ? 
1089 AJ7 21 ARG B  174 ? ARG B 174  . ? 1_555 ? 
1090 AJ7 21 LEU B  328 ? LEU B 328  . ? 1_555 ? 
1091 AJ7 21 HIS B  329 ? HIS B 329  . ? 1_555 ? 
1092 AJ7 21 LEU B  332 ? LEU B 332  . ? 1_555 ? 
1093 AJ7 21 ALA B  335 ? ALA B 335  . ? 1_555 ? 
1094 AJ7 21 LEU B  336 ? LEU B 336  . ? 1_555 ? 
1095 AJ7 21 CLA XC .   ? CLA B 1201 . ? 1_555 ? 
1096 AJ7 21 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1097 AJ7 21 CLA FD .   ? CLA B 1210 . ? 1_555 ? 
1098 AJ7 21 CLA QD .   ? CLA B 1221 . ? 1_555 ? 
1099 AJ7 21 CLA VD .   ? CLA B 1226 . ? 1_555 ? 
1100 AJ7 21 BCR JE .   ? BCR B 4005 . ? 1_555 ? 
1101 AJ7 21 HOH JR .   ? HOH B 8046 . ? 1_555 ? 
1102 AJ8 13 HIS B  29  ? HIS B 29   . ? 1_555 ? 
1103 AJ8 13 HIS B  53  ? HIS B 53   . ? 1_555 ? 
1104 AJ8 13 TRP B  60  ? TRP B 60   . ? 1_555 ? 
1105 AJ8 13 LEU B  339 ? LEU B 339  . ? 1_555 ? 
1106 AJ8 13 CLA XC .   ? CLA B 1201 . ? 1_555 ? 
1107 AJ8 13 CLA YC .   ? CLA B 1202 . ? 1_555 ? 
1108 AJ8 13 CLA AD .   ? CLA B 1204 . ? 1_555 ? 
1109 AJ8 13 CLA BD .   ? CLA B 1205 . ? 1_555 ? 
1110 AJ8 13 CLA TD .   ? CLA B 1224 . ? 1_555 ? 
1111 AJ8 13 CLA UD .   ? CLA B 1225 . ? 1_555 ? 
1112 AJ8 13 CLA VD .   ? CLA B 1226 . ? 1_555 ? 
1113 AJ8 13 BCR JE .   ? BCR B 4005 . ? 1_555 ? 
1114 AJ8 13 LMG OE .   ? LMG B 5002 . ? 1_555 ? 
1115 AJ9 21 LMG ER .   ? LMG 0 5001 . ? 1_555 ? 
1116 AJ9 21 LEU B  59  ? LEU B 59   . ? 1_555 ? 
1117 AJ9 21 SER B  62  ? SER B 62   . ? 1_555 ? 
1118 AJ9 21 GLY B  63  ? GLY B 63   . ? 1_555 ? 
1119 AJ9 21 PHE B  66  ? PHE B 66   . ? 1_555 ? 
1120 AJ9 21 HIS B  67  ? HIS B 67   . ? 1_555 ? 
1121 AJ9 21 TRP B  70  ? TRP B 70   . ? 1_555 ? 
1122 AJ9 21 GLN B  71  ? GLN B 71   . ? 1_555 ? 
1123 AJ9 21 ALA B  90  ? ALA B 90   . ? 1_555 ? 
1124 AJ9 21 CLA XC .   ? CLA B 1201 . ? 1_555 ? 
1125 AJ9 21 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1126 AJ9 21 CLA BD .   ? CLA B 1205 . ? 1_555 ? 
1127 AJ9 21 LEU G  10  ? LEU I 10   . ? 1_555 ? 
1128 AJ9 21 PRO G  11  ? PRO I 11   . ? 1_555 ? 
1129 AJ9 21 LEU G  14  ? LEU I 14   . ? 1_555 ? 
1130 AJ9 21 ILE G  15  ? ILE I 15   . ? 1_555 ? 
1131 AJ9 21 VAL G  18  ? VAL I 18   . ? 1_555 ? 
1132 AJ9 21 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
1133 AJ9 21 ALA K  11  ? ALA M 11   . ? 1_555 ? 
1134 AJ9 21 LEU K  12  ? LEU M 12   . ? 1_555 ? 
1135 AJ9 21 ECH DG .   ? ECH M 4021 . ? 1_555 ? 
1136 AK1 17 VAL B  68  ? VAL B 68   . ? 1_555 ? 
1137 AK1 17 ALA B  88  ? ALA B 88   . ? 1_555 ? 
1138 AK1 17 HIS B  89  ? HIS B 89   . ? 1_555 ? 
1139 AK1 17 ASN B  114 ? ASN B 114  . ? 1_555 ? 
1140 AK1 17 ILE B  115 ? ILE B 115  . ? 1_555 ? 
1141 AK1 17 ALA B  116 ? ALA B 116  . ? 1_555 ? 
1142 AK1 17 TYR B  117 ? TYR B 117  . ? 1_555 ? 
1143 AK1 17 SER B  118 ? SER B 118  . ? 1_555 ? 
1144 AK1 17 VAL B  642 ? VAL B 642  . ? 1_555 ? 
1145 AK1 17 TRP B  643 ? TRP B 643  . ? 1_555 ? 
1146 AK1 17 MET B  646 ? MET B 646  . ? 1_555 ? 
1147 AK1 17 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1148 AK1 17 CLA AD .   ? CLA B 1204 . ? 1_555 ? 
1149 AK1 17 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
1150 AK1 17 CLA TD .   ? CLA B 1224 . ? 1_555 ? 
1151 AK1 17 CLA VD .   ? CLA B 1226 . ? 1_555 ? 
1152 AK1 17 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
1153 AK2 24 ALA A  463 ? ALA A 463  . ? 1_555 ? 
1154 AK2 24 LEU A  464 ? LEU A 464  . ? 1_555 ? 
1155 AK2 24 CLA RC .   ? CLA B 1022 . ? 1_555 ? 
1156 AK2 24 CLA MB .   ? CLA A 1132 . ? 1_555 ? 
1157 AK2 24 HIS B  89  ? HIS B 89   . ? 1_555 ? 
1158 AK2 24 ALA B  90  ? ALA B 90   . ? 1_555 ? 
1159 AK2 24 ILE B  91  ? ILE B 91   . ? 1_555 ? 
1160 AK2 24 TRP B  92  ? TRP B 92   . ? 1_555 ? 
1161 AK2 24 ASP B  93  ? ASP B 93   . ? 1_555 ? 
1162 AK2 24 HIS B  95  ? HIS B 95   . ? 1_555 ? 
1163 AK2 24 PHE B  96  ? PHE B 96   . ? 1_555 ? 
1164 AK2 24 ASN B  114 ? ASN B 114  . ? 1_555 ? 
1165 AK2 24 SER B  641 ? SER B 641  . ? 1_555 ? 
1166 AK2 24 VAL B  642 ? VAL B 642  . ? 1_555 ? 
1167 AK2 24 TRP B  645 ? TRP B 645  . ? 1_555 ? 
1168 AK2 24 CLA BD .   ? CLA B 1205 . ? 1_555 ? 
1169 AK2 24 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
1170 AK2 24 CLA TD .   ? CLA B 1224 . ? 1_555 ? 
1171 AK2 24 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1172 AK2 24 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
1173 AK2 24 LMG OE .   ? LMG B 5002 . ? 1_555 ? 
1174 AK2 24 PHE G  22  ? PHE I 22   . ? 1_555 ? 
1175 AK2 24 THR G  26  ? THR I 26   . ? 1_555 ? 
1176 AK2 24 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
1177 AK3 14 PHE B  47  ? PHE B 47   . ? 1_555 ? 
1178 AK3 14 PHE B  51  ? PHE B 51   . ? 1_555 ? 
1179 AK3 14 LEU B  148 ? LEU B 148  . ? 1_555 ? 
1180 AK3 14 PHE B  151 ? PHE B 151  . ? 1_555 ? 
1181 AK3 14 ALA B  152 ? ALA B 152  . ? 1_555 ? 
1182 AK3 14 LEU B  155 ? LEU B 155  . ? 1_555 ? 
1183 AK3 14 HIS B  156 ? HIS B 156  . ? 1_555 ? 
1184 AK3 14 PHE B  161 ? PHE B 161  . ? 1_555 ? 
1185 AK3 14 TRP B  167 ? TRP B 167  . ? 1_555 ? 
1186 AK3 14 CLA ED .   ? CLA B 1209 . ? 1_555 ? 
1187 AK3 14 CLA FD .   ? CLA B 1210 . ? 1_555 ? 
1188 AK3 14 CLA GD .   ? CLA B 1211 . ? 1_555 ? 
1189 AK3 14 BCR JE .   ? BCR B 4005 . ? 1_555 ? 
1190 AK3 14 SQD SE .   ? SQD B 5008 . ? 1_555 ? 
1191 AK4 10 TRP B  167 ? TRP B 167  . ? 1_555 ? 
1192 AK4 10 ASN B  170 ? ASN B 170  . ? 1_555 ? 
1193 AK4 10 SER B  173 ? SER B 173  . ? 1_555 ? 
1194 AK4 10 HIS B  177 ? HIS B 177  . ? 1_555 ? 
1195 AK4 10 THR B  293 ? THR B 293  . ? 1_555 ? 
1196 AK4 10 ASN B  294 ? ASN B 294  . ? 1_555 ? 
1197 AK4 10 TRP B  295 ? TRP B 295  . ? 1_555 ? 
1198 AK4 10 CLA DD .   ? CLA B 1208 . ? 1_555 ? 
1199 AK4 10 CLA FD .   ? CLA B 1210 . ? 1_555 ? 
1200 AK4 10 CLA MD .   ? CLA B 1217 . ? 1_555 ? 
1201 AK5 19 PHE B  47  ? PHE B 47   . ? 1_555 ? 
1202 AK5 19 HIS B  50  ? HIS B 50   . ? 1_555 ? 
1203 AK5 19 PHE B  51  ? PHE B 51   . ? 1_555 ? 
1204 AK5 19 ILE B  54  ? ILE B 54   . ? 1_555 ? 
1205 AK5 19 TRP B  123 ? TRP B 123  . ? 1_555 ? 
1206 AK5 19 TRP B  167 ? TRP B 167  . ? 1_555 ? 
1207 AK5 19 ASN B  170 ? ASN B 170  . ? 1_555 ? 
1208 AK5 19 ARG B  174 ? ARG B 174  . ? 1_555 ? 
1209 AK5 19 HIS B  177 ? HIS B 177  . ? 1_555 ? 
1210 AK5 19 HIS B  178 ? HIS B 178  . ? 1_555 ? 
1211 AK5 19 GLY B  181 ? GLY B 181  . ? 1_555 ? 
1212 AK5 19 PHE B  183 ? PHE B 183  . ? 1_555 ? 
1213 AK5 19 CLA YC .   ? CLA B 1202 . ? 1_555 ? 
1214 AK5 19 CLA DD .   ? CLA B 1208 . ? 1_555 ? 
1215 AK5 19 CLA ED .   ? CLA B 1209 . ? 1_555 ? 
1216 AK5 19 CLA KD .   ? CLA B 1215 . ? 1_555 ? 
1217 AK5 19 CLA QD .   ? CLA B 1221 . ? 1_555 ? 
1218 AK5 19 CLA UD .   ? CLA B 1225 . ? 1_555 ? 
1219 AK5 19 BCR JE .   ? BCR B 4005 . ? 1_555 ? 
1220 AK6 18 ILE B  127 ? ILE B 127  . ? 1_555 ? 
1221 AK6 18 GLY B  128 ? GLY B 128  . ? 1_555 ? 
1222 AK6 18 GLU B  134 ? GLU B 134  . ? 1_555 ? 
1223 AK6 18 GLY B  138 ? GLY B 138  . ? 1_555 ? 
1224 AK6 18 PHE B  141 ? PHE B 141  . ? 1_555 ? 
1225 AK6 18 SER B  186 ? SER B 186  . ? 1_555 ? 
1226 AK6 18 ALA B  189 ? ALA B 189  . ? 1_555 ? 
1227 AK6 18 TRP B  190 ? TRP B 190  . ? 1_555 ? 
1228 AK6 18 HIS B  193 ? HIS B 193  . ? 1_555 ? 
1229 AK6 18 HIS B  196 ? HIS B 196  . ? 1_555 ? 
1230 AK6 18 GLY B  208 ? GLY B 208  . ? 1_555 ? 
1231 AK6 18 TRP B  209 ? TRP B 209  . ? 1_555 ? 
1232 AK6 18 PHE B  212 ? PHE B 212  . ? 1_555 ? 
1233 AK6 18 CLA DD .   ? CLA B 1208 . ? 1_555 ? 
1234 AK6 18 CLA UD .   ? CLA B 1225 . ? 1_555 ? 
1235 AK6 18 BCR JE .   ? BCR B 4005 . ? 1_555 ? 
1236 AK6 18 ECH KE .   ? ECH B 4006 . ? 1_555 ? 
1237 AK6 18 SQD SE .   ? SQD B 5008 . ? 1_555 ? 
1238 AK7 13 LEU B  188 ? LEU B 188  . ? 1_555 ? 
1239 AK7 13 ALA B  189 ? ALA B 189  . ? 1_555 ? 
1240 AK7 13 GLY B  192 ? GLY B 192  . ? 1_555 ? 
1241 AK7 13 VAL B  195 ? VAL B 195  . ? 1_555 ? 
1242 AK7 13 HIS B  196 ? HIS B 196  . ? 1_555 ? 
1243 AK7 13 LEU B  213 ? LEU B 213  . ? 1_555 ? 
1244 AK7 13 PRO B  216 ? PRO B 216  . ? 1_555 ? 
1245 AK7 13 PRO B  217 ? PRO B 217  . ? 1_555 ? 
1246 AK7 13 GLY B  221 ? GLY B 221  . ? 1_555 ? 
1247 AK7 13 LEU B  222 ? LEU B 222  . ? 1_555 ? 
1248 AK7 13 PHE B  226 ? PHE B 226  . ? 1_555 ? 
1249 AK7 13 BCR IE .   ? BCR B 4004 . ? 1_555 ? 
1250 AK7 13 ECH KE .   ? ECH B 4006 . ? 1_555 ? 
1251 AK8 11 PHE B  225 ? PHE B 225  . ? 1_555 ? 
1252 AK8 11 TRP B  230 ? TRP B 230  . ? 1_555 ? 
1253 AK8 11 TYR B  233 ? TYR B 233  . ? 1_555 ? 
1254 AK8 11 THR B  256 ? THR B 256  . ? 1_555 ? 
1255 AK8 11 PHE B  257 ? PHE B 257  . ? 1_555 ? 
1256 AK8 11 HIS B  275 ? HIS B 275  . ? 1_555 ? 
1257 AK8 11 LEU B  278 ? LEU B 278  . ? 1_555 ? 
1258 AK8 11 ALA B  279 ? ALA B 279  . ? 1_555 ? 
1259 AK8 11 CLA JD .   ? CLA B 1214 . ? 1_555 ? 
1260 AK8 11 BCR IE .   ? BCR B 4004 . ? 1_555 ? 
1261 AK8 11 LMG QE .   ? LMG B 5005 . ? 1_555 ? 
1262 AK9 18 THR B  256 ? THR B 256  . ? 1_555 ? 
1263 AK9 18 PHE B  257 ? PHE B 257  . ? 1_555 ? 
1264 AK9 18 GLY B  259 ? GLY B 259  . ? 1_555 ? 
1265 AK9 18 LEU B  268 ? LEU B 268  . ? 1_555 ? 
1266 AK9 18 ASP B  272 ? ASP B 272  . ? 1_555 ? 
1267 AK9 18 HIS B  275 ? HIS B 275  . ? 1_555 ? 
1268 AK9 18 HIS B  276 ? HIS B 276  . ? 1_555 ? 
1269 AK9 18 ILE B  283 ? ILE B 283  . ? 1_555 ? 
1270 AK9 18 HIS B  349 ? HIS B 349  . ? 1_555 ? 
1271 AK9 18 LEU B  353 ? LEU B 353  . ? 1_555 ? 
1272 AK9 18 TRP B  490 ? TRP B 490  . ? 1_555 ? 
1273 AK9 18 TRP B  494 ? TRP B 494  . ? 1_555 ? 
1274 AK9 18 CLA ID .   ? CLA B 1213 . ? 1_555 ? 
1275 AK9 18 CLA KD .   ? CLA B 1215 . ? 1_555 ? 
1276 AK9 18 CLA QD .   ? CLA B 1221 . ? 1_555 ? 
1277 AK9 18 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1278 AK9 18 CLA ZD .   ? CLA B 1231 . ? 1_555 ? 
1279 AK9 18 CLA AE .   ? CLA B 1232 . ? 1_555 ? 
1280 AL1 19 TRP B  123 ? TRP B 123  . ? 1_555 ? 
1281 AL1 19 PHE B  183 ? PHE B 183  . ? 1_555 ? 
1282 AL1 19 SER B  186 ? SER B 186  . ? 1_555 ? 
1283 AL1 19 SER B  187 ? SER B 187  . ? 1_555 ? 
1284 AL1 19 TRP B  190 ? TRP B 190  . ? 1_555 ? 
1285 AL1 19 ILE B  273 ? ILE B 273  . ? 1_555 ? 
1286 AL1 19 HIS B  276 ? HIS B 276  . ? 1_555 ? 
1287 AL1 19 HIS B  277 ? HIS B 277  . ? 1_555 ? 
1288 AL1 19 ILE B  280 ? ILE B 280  . ? 1_555 ? 
1289 AL1 19 VAL B  346 ? VAL B 346  . ? 1_555 ? 
1290 AL1 19 SER B  355 ? SER B 355  . ? 1_555 ? 
1291 AL1 19 TYR B  356 ? TYR B 356  . ? 1_555 ? 
1292 AL1 19 CLA FD .   ? CLA B 1210 . ? 1_555 ? 
1293 AL1 19 CLA JD .   ? CLA B 1214 . ? 1_555 ? 
1294 AL1 19 CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1295 AL1 19 CLA QD .   ? CLA B 1221 . ? 1_555 ? 
1296 AL1 19 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1297 AL1 19 CLA UD .   ? CLA B 1225 . ? 1_555 ? 
1298 AL1 19 MG  UE .   ? MG  B 6002 . ? 1_555 ? 
1299 AL2 16 LEU B  175 ? LEU B 175  . ? 1_555 ? 
1300 AL2 16 LEU B  179 ? LEU B 179  . ? 1_555 ? 
1301 AL2 16 PHE B  183 ? PHE B 183  . ? 1_555 ? 
1302 AL2 16 ALA B  287 ? ALA B 287  . ? 1_555 ? 
1303 AL2 16 MET B  290 ? MET B 290  . ? 1_555 ? 
1304 AL2 16 TYR B  291 ? TYR B 291  . ? 1_555 ? 
1305 AL2 16 ILE B  304 ? ILE B 304  . ? 1_555 ? 
1306 AL2 16 CLA KD .   ? CLA B 1215 . ? 1_555 ? 
1307 AL2 16 CLA ND .   ? CLA B 1218 . ? 1_555 ? 
1308 AL2 16 CLA OD .   ? CLA B 1219 . ? 1_555 ? 
1309 AL2 16 CLA PD .   ? CLA B 1220 . ? 1_555 ? 
1310 AL2 16 CLA QD .   ? CLA B 1221 . ? 1_555 ? 
1311 AL2 16 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1312 AL2 16 BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1313 AL2 16 LHG PE .   ? LHG B 5004 . ? 1_555 ? 
1314 AL2 16 HOH JR .   ? HOH B 8081 . ? 1_555 ? 
1315 AL3 12 ASN B  176 ? ASN B 176  . ? 1_555 ? 
1316 AL3 12 HIS B  177 ? HIS B 177  . ? 1_555 ? 
1317 AL3 12 ALA B  180 ? ALA B 180  . ? 1_555 ? 
1318 AL3 12 VAL B  185 ? VAL B 185  . ? 1_555 ? 
1319 AL3 12 HIS B  289 ? HIS B 289  . ? 1_555 ? 
1320 AL3 12 THR B  293 ? THR B 293  . ? 1_555 ? 
1321 AL3 12 TRP B  295 ? TRP B 295  . ? 1_555 ? 
1322 AL3 12 ILE B  297 ? ILE B 297  . ? 1_555 ? 
1323 AL3 12 CLA ED .   ? CLA B 1209 . ? 1_555 ? 
1324 AL3 12 BCR IE .   ? BCR B 4004 . ? 1_555 ? 
1325 AL3 12 BCR JE .   ? BCR B 4005 . ? 1_555 ? 
1326 AL3 12 ECH KE .   ? ECH B 4006 . ? 1_555 ? 
1327 AL4 10 ILE B  286 ? ILE B 286  . ? 1_555 ? 
1328 AL4 10 HIS B  289 ? HIS B 289  . ? 1_555 ? 
1329 AL4 10 MET B  290 ? MET B 290  . ? 1_555 ? 
1330 AL4 10 ILE B  297 ? ILE B 297  . ? 1_555 ? 
1331 AL4 10 GLY B  298 ? GLY B 298  . ? 1_555 ? 
1332 AL4 10 HIS B  299 ? HIS B 299  . ? 1_555 ? 
1333 AL4 10 CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1334 AL4 10 CLA OD .   ? CLA B 1219 . ? 1_555 ? 
1335 AL4 10 BCR IE .   ? BCR B 4004 . ? 1_555 ? 
1336 AL4 10 BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1337 AL5 9  MET B  290 ? MET B 290  . ? 1_555 ? 
1338 AL5 9  HIS B  299 ? HIS B 299  . ? 1_555 ? 
1339 AL5 9  ALA B  307 ? ALA B 307  . ? 1_555 ? 
1340 AL5 9  HIS B  308 ? HIS B 308  . ? 1_555 ? 
1341 AL5 9  CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1342 AL5 9  CLA ND .   ? CLA B 1218 . ? 1_555 ? 
1343 AL5 9  CLA PD .   ? CLA B 1220 . ? 1_555 ? 
1344 AL5 9  CLA GE .   ? CLA B 1240 . ? 1_555 ? 
1345 AL5 9  BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1346 AL6 13 LEU B  305 ? LEU B 305  . ? 1_555 ? 
1347 AL6 13 HIS B  308 ? HIS B 308  . ? 1_555 ? 
1348 AL6 13 HIS B  317 ? HIS B 317  . ? 1_555 ? 
1349 AL6 13 ILE B  324 ? ILE B 324  . ? 1_555 ? 
1350 AL6 13 LEU B  406 ? LEU B 406  . ? 1_555 ? 
1351 AL6 13 MET B  409 ? MET B 409  . ? 1_555 ? 
1352 AL6 13 CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1353 AL6 13 CLA OD .   ? CLA B 1219 . ? 1_555 ? 
1354 AL6 13 CLA QD .   ? CLA B 1221 . ? 1_555 ? 
1355 AL6 13 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1356 AL6 13 CLA GE .   ? CLA B 1240 . ? 1_555 ? 
1357 AL6 13 BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1358 AL6 13 LHG PE .   ? LHG B 5004 . ? 1_555 ? 
1359 AL7 19 ALA B  171 ? ALA B 171  . ? 1_555 ? 
1360 AL7 19 ARG B  174 ? ARG B 174  . ? 1_555 ? 
1361 AL7 19 LEU B  175 ? LEU B 175  . ? 1_555 ? 
1362 AL7 19 HIS B  178 ? HIS B 178  . ? 1_555 ? 
1363 AL7 19 PHE B  183 ? PHE B 183  . ? 1_555 ? 
1364 AL7 19 PHE B  284 ? PHE B 284  . ? 1_555 ? 
1365 AL7 19 ILE B  301 ? ILE B 301  . ? 1_555 ? 
1366 AL7 19 TYR B  321 ? TYR B 321  . ? 1_555 ? 
1367 AL7 19 ILE B  324 ? ILE B 324  . ? 1_555 ? 
1368 AL7 19 LEU B  334 ? LEU B 334  . ? 1_555 ? 
1369 AL7 19 ALA B  335 ? ALA B 335  . ? 1_555 ? 
1370 AL7 19 SER B  338 ? SER B 338  . ? 1_555 ? 
1371 AL7 19 ILE B  342 ? ILE B 342  . ? 1_555 ? 
1372 AL7 19 CLA YC .   ? CLA B 1202 . ? 1_555 ? 
1373 AL7 19 CLA FD .   ? CLA B 1210 . ? 1_555 ? 
1374 AL7 19 CLA JD .   ? CLA B 1214 . ? 1_555 ? 
1375 AL7 19 CLA KD .   ? CLA B 1215 . ? 1_555 ? 
1376 AL7 19 CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1377 AL7 19 CLA PD .   ? CLA B 1220 . ? 1_555 ? 
1378 AL8 17 SER B  344 ? SER B 344  . ? 1_555 ? 
1379 AL8 17 LEU B  345 ? LEU B 345  . ? 1_555 ? 
1380 AL8 17 GLN B  348 ? GLN B 348  . ? 1_555 ? 
1381 AL8 17 GLN B  374 ? GLN B 374  . ? 1_555 ? 
1382 AL8 17 GLY B  378 ? GLY B 378  . ? 1_555 ? 
1383 AL8 17 MET B  381 ? MET B 381  . ? 1_555 ? 
1384 AL8 17 PHE B  385 ? PHE B 385  . ? 1_555 ? 
1385 AL8 17 LEU B  524 ? LEU B 524  . ? 1_555 ? 
1386 AL8 17 THR B  527 ? THR B 527  . ? 1_555 ? 
1387 AL8 17 MET B  580 ? MET B 580  . ? 1_555 ? 
1388 AL8 17 LEU B  587 ? LEU B 587  . ? 1_555 ? 
1389 AL8 17 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1390 AL8 17 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1391 AL8 17 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1392 AL8 17 BCR LE .   ? BCR B 4010 . ? 1_555 ? 
1393 AL8 17 LHG PE .   ? LHG B 5004 . ? 1_555 ? 
1394 AL8 17 HOH JR .   ? HOH B 8100 . ? 1_555 ? 
1395 AL9 15 VAL B  341 ? VAL B 341  . ? 1_555 ? 
1396 AL9 15 HIS B  349 ? HIS B 349  . ? 1_555 ? 
1397 AL9 15 SER B  352 ? SER B 352  . ? 1_555 ? 
1398 AL9 15 LEU B  505 ? LEU B 505  . ? 1_555 ? 
1399 AL9 15 PHE B  506 ? PHE B 506  . ? 1_555 ? 
1400 AL9 15 CLA JD .   ? CLA B 1214 . ? 1_555 ? 
1401 AL9 15 CLA KD .   ? CLA B 1215 . ? 1_555 ? 
1402 AL9 15 CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1403 AL9 15 CLA RD .   ? CLA B 1222 . ? 1_555 ? 
1404 AL9 15 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1405 AL9 15 CLA ZD .   ? CLA B 1231 . ? 1_555 ? 
1406 AL9 15 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1407 AL9 15 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1408 AL9 15 BCR LE .   ? BCR B 4010 . ? 1_555 ? 
1409 AL9 15 BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1410 AM1 17 TRP B  60  ? TRP B 60   . ? 1_555 ? 
1411 AM1 17 TYR B  117 ? TYR B 117  . ? 1_555 ? 
1412 AM1 17 SER B  118 ? SER B 118  . ? 1_555 ? 
1413 AM1 17 ALA B  368 ? ALA B 368  . ? 1_555 ? 
1414 AM1 17 THR B  371 ? THR B 371  . ? 1_555 ? 
1415 AM1 17 HIS B  372 ? HIS B 372  . ? 1_555 ? 
1416 AM1 17 TYR B  375 ? TYR B 375  . ? 1_555 ? 
1417 AM1 17 ILE B  376 ? ILE B 376  . ? 1_555 ? 
1418 AM1 17 PHE B  379 ? PHE B 379  . ? 1_555 ? 
1419 AM1 17 MET B  646 ? MET B 646  . ? 1_555 ? 
1420 AM1 17 VAL B  715 ? VAL B 715  . ? 1_555 ? 
1421 AM1 17 ALA B  719 ? ALA B 719  . ? 1_555 ? 
1422 AM1 17 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1423 AM1 17 CLA BD .   ? CLA B 1205 . ? 1_555 ? 
1424 AM1 17 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
1425 AM1 17 CLA UD .   ? CLA B 1225 . ? 1_555 ? 
1426 AM1 17 LMG OE .   ? LMG B 5002 . ? 1_555 ? 
1427 AM2 20 TRP B  60  ? TRP B 60   . ? 1_555 ? 
1428 AM2 20 THR B  61  ? THR B 61   . ? 1_555 ? 
1429 AM2 20 GLY B  119 ? GLY B 119  . ? 1_555 ? 
1430 AM2 20 TRP B  123 ? TRP B 123  . ? 1_555 ? 
1431 AM2 20 SER B  186 ? SER B 186  . ? 1_555 ? 
1432 AM2 20 ALA B  189 ? ALA B 189  . ? 1_555 ? 
1433 AM2 20 THR B  343 ? THR B 343  . ? 1_555 ? 
1434 AM2 20 VAL B  346 ? VAL B 346  . ? 1_555 ? 
1435 AM2 20 MET B  350 ? MET B 350  . ? 1_555 ? 
1436 AM2 20 TYR B  356 ? TYR B 356  . ? 1_555 ? 
1437 AM2 20 HIS B  372 ? HIS B 372  . ? 1_555 ? 
1438 AM2 20 HIS B  373 ? HIS B 373  . ? 1_555 ? 
1439 AM2 20 ILE B  376 ? ILE B 376  . ? 1_555 ? 
1440 AM2 20 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1441 AM2 20 CLA FD .   ? CLA B 1210 . ? 1_555 ? 
1442 AM2 20 CLA GD .   ? CLA B 1211 . ? 1_555 ? 
1443 AM2 20 CLA KD .   ? CLA B 1215 . ? 1_555 ? 
1444 AM2 20 CLA TD .   ? CLA B 1224 . ? 1_555 ? 
1445 AM2 20 BCR JE .   ? BCR B 4005 . ? 1_555 ? 
1446 AM2 20 ECH KE .   ? ECH B 4006 . ? 1_555 ? 
1447 AM3 20 ALA B  26  ? ALA B 26   . ? 1_555 ? 
1448 AM3 20 HIS B  29  ? HIS B 29   . ? 1_555 ? 
1449 AM3 20 ASP B  30  ? ASP B 30   . ? 1_555 ? 
1450 AM3 20 LEU B  332 ? LEU B 332  . ? 1_555 ? 
1451 AM3 20 PHE B  379 ? PHE B 379  . ? 1_555 ? 
1452 AM3 20 GLY B  383 ? GLY B 383  . ? 1_555 ? 
1453 AM3 20 HIS B  387 ? HIS B 387  . ? 1_555 ? 
1454 AM3 20 ILE B  390 ? ILE B 390  . ? 1_555 ? 
1455 AM3 20 ARG B  394 ? ARG B 394  . ? 1_555 ? 
1456 AM3 20 TYR B  552 ? TYR B 552  . ? 1_555 ? 
1457 AM3 20 TRP B  570 ? TRP B 570  . ? 1_555 ? 
1458 AM3 20 PHE B  573 ? PHE B 573  . ? 1_555 ? 
1459 AM3 20 VAL B  712 ? VAL B 712  . ? 1_555 ? 
1460 AM3 20 CLA YC .   ? CLA B 1202 . ? 1_555 ? 
1461 AM3 20 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1462 AM3 20 CLA BD .   ? CLA B 1205 . ? 1_555 ? 
1463 AM3 20 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1464 AM3 20 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
1465 AM3 20 LMG OE .   ? LMG B 5002 . ? 1_555 ? 
1466 AM3 20 HOH JR .   ? HOH B 8062 . ? 1_555 ? 
1467 AM4 14 THR B  313 ? THR B 313  . ? 1_555 ? 
1468 AM4 14 ARG B  408 ? ARG B 408  . ? 1_555 ? 
1469 AM4 14 MET B  409 ? MET B 409  . ? 1_555 ? 
1470 AM4 14 HIS B  412 ? HIS B 412  . ? 1_555 ? 
1471 AM4 14 LEU B  416 ? LEU B 416  . ? 1_555 ? 
1472 AM4 14 HIS B  419 ? HIS B 419  . ? 1_555 ? 
1473 AM4 14 CLA PD .   ? CLA B 1220 . ? 1_555 ? 
1474 AM4 14 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1475 AM4 14 CLA XD .   ? CLA B 1228 . ? 1_555 ? 
1476 AM4 14 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1477 AM4 14 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1478 AM4 14 BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1479 AM4 14 LHG PE .   ? LHG B 5004 . ? 1_555 ? 
1480 AM4 14 SQD GF .   ? SQD F 5001 . ? 1_555 ? 
1481 AM5 15 TRP A  702 ? TRP A 702  . ? 1_555 ? 
1482 AM5 15 LYS A  706 ? LYS A 706  . ? 1_555 ? 
1483 AM5 15 HIS B  419 ? HIS B 419  . ? 1_555 ? 
1484 AM5 15 TRP B  422 ? TRP B 422  . ? 1_555 ? 
1485 AM5 15 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1486 AM5 15 CLA YD .   ? CLA B 1229 . ? 1_555 ? 
1487 AM5 15 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1488 AM5 15 ALA F  122 ? ALA F 122  . ? 1_555 ? 
1489 AM5 15 VAL F  123 ? VAL F 123  . ? 1_555 ? 
1490 AM5 15 TYR F  126 ? TYR F 126  . ? 1_555 ? 
1491 AM5 15 LEU F  131 ? LEU F 131  . ? 1_555 ? 
1492 AM5 15 VAL F  132 ? VAL F 132  . ? 1_555 ? 
1493 AM5 15 CLA EF .   ? CLA F 1302 . ? 1_555 ? 
1494 AM5 15 ZEX FF .   ? ZEX F 4016 . ? 1_555 ? 
1495 AM5 15 SQD GF .   ? SQD F 5001 . ? 1_555 ? 
1496 AM6 14 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
1497 AM6 14 TRP B  422 ? TRP B 422  . ? 1_555 ? 
1498 AM6 14 LEU B  425 ? LEU B 425  . ? 1_555 ? 
1499 AM6 14 PHE B  426 ? PHE B 426  . ? 1_555 ? 
1500 AM6 14 HIS B  430 ? HIS B 430  . ? 1_555 ? 
1501 AM6 14 CLA XD .   ? CLA B 1228 . ? 1_555 ? 
1502 AM6 14 CLA YE .   ? CLA B 1230 . ? 1_555 ? 
1503 AM6 14 45D TC .   ? 45D B 4011 . ? 1_555 ? 
1504 AM6 14 BCR WE .   ? BCR B 4014 . ? 1_555 ? 
1505 AM6 14 PHE F  65  ? PHE F 65   . ? 1_555 ? 
1506 AM6 14 SER F  69  ? SER F 69   . ? 1_555 ? 
1507 AM6 14 PHE F  72  ? PHE F 72   . ? 1_555 ? 
1508 AM6 14 ALA F  76  ? ALA F 76   . ? 1_555 ? 
1509 AM6 14 ZEX FF .   ? ZEX F 4016 . ? 1_555 ? 
1510 AM7 14 TRP B  460 ? TRP B 460  . ? 1_555 ? 
1511 AM7 14 SER B  465 ? SER B 465  . ? 1_555 ? 
1512 AM7 14 LEU B  475 ? LEU B 475  . ? 1_555 ? 
1513 AM7 14 LEU B  476 ? LEU B 476  . ? 1_555 ? 
1514 AM7 14 TRP B  494 ? TRP B 494  . ? 1_555 ? 
1515 AM7 14 PHE B  506 ? PHE B 506  . ? 1_555 ? 
1516 AM7 14 CLA JD .   ? CLA B 1214 . ? 1_555 ? 
1517 AM7 14 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1518 AM7 14 CLA AE .   ? CLA B 1232 . ? 1_555 ? 
1519 AM7 14 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1520 AM7 14 BCR LE .   ? BCR B 4010 . ? 1_555 ? 
1521 AM7 14 LHG RE .   ? LHG B 5006 . ? 1_555 ? 
1522 AM7 14 HOH JR .   ? HOH B 8020 . ? 1_555 ? 
1523 AM7 14 HOH JR .   ? HOH B 8044 . ? 1_555 ? 
1524 AM8 7  LEU B  475 ? LEU B 475  . ? 1_555 ? 
1525 AM8 7  ILE B  482 ? ILE B 482  . ? 1_555 ? 
1526 AM8 7  THR B  486 ? THR B 486  . ? 1_555 ? 
1527 AM8 7  CLA JD .   ? CLA B 1214 . ? 1_555 ? 
1528 AM8 7  CLA ZD .   ? CLA B 1231 . ? 1_555 ? 
1529 AM8 7  LHG RE .   ? LHG B 5006 . ? 1_555 ? 
1530 AM8 7  HOH JR .   ? HOH B 8044 . ? 1_555 ? 
1531 AM9 21 GLN B  348 ? GLN B 348  . ? 1_555 ? 
1532 AM9 21 TYR B  351 ? TYR B 351  . ? 1_555 ? 
1533 AM9 21 TYR B  370 ? TYR B 370  . ? 1_555 ? 
1534 AM9 21 ALA B  458 ? ALA B 458  . ? 1_555 ? 
1535 AM9 21 ILE B  461 ? ILE B 461  . ? 1_555 ? 
1536 AM9 21 GLN B  462 ? GLN B 462  . ? 1_555 ? 
1537 AM9 21 PHE B  506 ? PHE B 506  . ? 1_555 ? 
1538 AM9 21 LEU B  507 ? LEU B 507  . ? 1_555 ? 
1539 AM9 21 HIS B  517 ? HIS B 517  . ? 1_555 ? 
1540 AM9 21 ILE B  520 ? ILE B 520  . ? 1_555 ? 
1541 AM9 21 LEU B  587 ? LEU B 587  . ? 1_555 ? 
1542 AM9 21 TYR B  590 ? TYR B 590  . ? 1_555 ? 
1543 AM9 21 TRP B  591 ? TRP B 591  . ? 1_555 ? 
1544 AM9 21 CLA RD .   ? CLA B 1222 . ? 1_555 ? 
1545 AM9 21 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1546 AM9 21 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1547 AM9 21 CLA ZD .   ? CLA B 1231 . ? 1_555 ? 
1548 AM9 21 CLA CE .   ? CLA B 1235 . ? 1_555 ? 
1549 AM9 21 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1550 AM9 21 LHG PE .   ? LHG B 5004 . ? 1_555 ? 
1551 AM9 21 CLA EF .   ? CLA F 1302 . ? 1_555 ? 
1552 AN1 17 PHE B  426 ? PHE B 426  . ? 1_555 ? 
1553 AN1 17 LEU B  427 ? LEU B 427  . ? 1_555 ? 
1554 AN1 17 GLU B  454 ? GLU B 454  . ? 1_555 ? 
1555 AN1 17 PRO B  455 ? PRO B 455  . ? 1_555 ? 
1556 AN1 17 VAL B  456 ? VAL B 456  . ? 1_555 ? 
1557 AN1 17 PHE B  457 ? PHE B 457  . ? 1_555 ? 
1558 AN1 17 ALA B  458 ? ALA B 458  . ? 1_555 ? 
1559 AN1 17 PHE B  514 ? PHE B 514  . ? 1_555 ? 
1560 AN1 17 HIS B  517 ? HIS B 517  . ? 1_555 ? 
1561 AN1 17 HIS B  518 ? HIS B 518  . ? 1_555 ? 
1562 AN1 17 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1563 AN1 17 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1564 AN1 17 VAL F  55  ? VAL F 55   . ? 1_555 ? 
1565 AN1 17 PHE F  65  ? PHE F 65   . ? 1_555 ? 
1566 AN1 17 SER F  69  ? SER F 69   . ? 1_555 ? 
1567 AN1 17 ZEX FF .   ? ZEX F 4016 . ? 1_555 ? 
1568 AN1 17 ZEX KF .   ? ZEX J 4015 . ? 1_555 ? 
1569 AN2 14 LEU B  416 ? LEU B 416  . ? 1_555 ? 
1570 AN2 14 LEU B  420 ? LEU B 420  . ? 1_555 ? 
1571 AN2 14 TRP B  422 ? TRP B 422  . ? 1_555 ? 
1572 AN2 14 ALA B  521 ? ALA B 521  . ? 1_555 ? 
1573 AN2 14 LEU B  524 ? LEU B 524  . ? 1_555 ? 
1574 AN2 14 HIS B  525 ? HIS B 525  . ? 1_555 ? 
1575 AN2 14 CLA RD .   ? CLA B 1222 . ? 1_555 ? 
1576 AN2 14 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1577 AN2 14 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1578 AN2 14 CLA XD .   ? CLA B 1228 . ? 1_555 ? 
1579 AN2 14 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1580 AN2 14 CLA CE .   ? CLA B 1235 . ? 1_555 ? 
1581 AN2 14 BCR LE .   ? BCR B 4010 . ? 1_555 ? 
1582 AN2 14 LHG PE .   ? LHG B 5004 . ? 1_555 ? 
1583 AN3 24 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
1584 AN3 24 THR B  18  ? THR B 18   . ? 1_555 ? 
1585 AN3 24 TRP B  22  ? TRP B 22   . ? 1_555 ? 
1586 AN3 24 HIS B  679 ? HIS B 679  . ? 1_555 ? 
1587 AN3 24 VAL B  688 ? VAL B 688  . ? 1_555 ? 
1588 AN3 24 ARG B  689 ? ARG B 689  . ? 1_555 ? 
1589 AN3 24 TRP B  690 ? TRP B 690  . ? 1_555 ? 
1590 AN3 24 LYS B  691 ? LYS B 691  . ? 1_555 ? 
1591 AN3 24 PRO B  694 ? PRO B 694  . ? 1_555 ? 
1592 AN3 24 VAL B  695 ? VAL B 695  . ? 1_555 ? 
1593 AN3 24 CLA SC .   ? CLA B 1237 . ? 1_555 ? 
1594 AN3 24 PQN HE .   ? PQN B 2002 . ? 1_555 ? 
1595 AN3 24 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
1596 AN3 24 HOH JR .   ? HOH B 8003 . ? 1_555 ? 
1597 AN3 24 HOH JR .   ? HOH B 8015 . ? 1_555 ? 
1598 AN3 24 HOH JR .   ? HOH B 8037 . ? 1_555 ? 
1599 AN3 24 PHE G  31  ? PHE I 31   . ? 1_555 ? 
1600 AN3 24 GLU G  35  ? GLU I 35   . ? 1_555 ? 
1601 AN3 24 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
1602 AN3 24 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
1603 AN3 24 TYR J  99  ? TYR L 99   . ? 1_555 ? 
1604 AN3 24 VAL J  102 ? VAL L 102  . ? 1_555 ? 
1605 AN3 24 THR J  103 ? THR L 103  . ? 1_555 ? 
1606 AN3 24 BCR WF .   ? BCR L 4019 . ? 1_555 ? 
1607 AN4 19 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
1608 AN4 19 PHE B  649 ? PHE B 649  . ? 1_555 ? 
1609 AN4 19 LEU B  652 ? LEU B 652  . ? 1_555 ? 
1610 AN4 19 VAL B  653 ? VAL B 653  . ? 1_555 ? 
1611 AN4 19 THR B  656 ? THR B 656  . ? 1_555 ? 
1612 AN4 19 MET B  659 ? MET B 659  . ? 1_555 ? 
1613 AN4 19 PHE B  660 ? PHE B 660  . ? 1_555 ? 
1614 AN4 19 VAL B  705 ? VAL B 705  . ? 1_555 ? 
1615 AN4 19 HIS B  709 ? HIS B 709  . ? 1_555 ? 
1616 AN4 19 CLA WC .   ? CLA B 1023 . ? 1_555 ? 
1617 AN4 19 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
1618 AN4 19 CLA VD .   ? CLA B 1226 . ? 1_555 ? 
1619 AN4 19 PQN HE .   ? PQN B 2002 . ? 1_555 ? 
1620 AN4 19 BCR ME .   ? BCR B 4017 . ? 1_555 ? 
1621 AN4 19 LMG OE .   ? LMG B 5002 . ? 1_555 ? 
1622 AN4 19 HOH JR .   ? HOH B 8043 . ? 1_555 ? 
1623 AN4 19 ALA G  24  ? ALA I 24   . ? 1_555 ? 
1624 AN4 19 SER J  98  ? SER L 98   . ? 1_555 ? 
1625 AN4 19 BCR WF .   ? BCR L 4019 . ? 1_555 ? 
1626 AN5 10 ALA B  307 ? ALA B 307  . ? 1_555 ? 
1627 AN5 10 HIS B  308 ? HIS B 308  . ? 1_555 ? 
1628 AN5 10 LYS B  309 ? LYS B 309  . ? 1_555 ? 
1629 AN5 10 PRO B  311 ? PRO B 311  . ? 1_555 ? 
1630 AN5 10 LEU B  312 ? LEU B 312  . ? 1_555 ? 
1631 AN5 10 CLA OD .   ? CLA B 1219 . ? 1_555 ? 
1632 AN5 10 CLA PD .   ? CLA B 1220 . ? 1_555 ? 
1633 AN5 10 BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1634 AN5 10 LHG PE .   ? LHG B 5004 . ? 1_555 ? 
1635 AN5 10 SQD GF .   ? SQD F 5001 . ? 1_555 ? 
1636 AN6 11 MET B  659 ? MET B 659  . ? 1_555 ? 
1637 AN6 11 PHE B  660 ? PHE B 660  . ? 1_555 ? 
1638 AN6 11 SER B  663 ? SER B 663  . ? 1_555 ? 
1639 AN6 11 ARG B  665 ? ARG B 665  . ? 1_555 ? 
1640 AN6 11 TRP B  668 ? TRP B 668  . ? 1_555 ? 
1641 AN6 11 ILE B  672 ? ILE B 672  . ? 1_555 ? 
1642 AN6 11 ALA B  696 ? ALA B 696  . ? 1_555 ? 
1643 AN6 11 LEU B  697 ? LEU B 697  . ? 1_555 ? 
1644 AN6 11 ALA B  702 ? ALA B 702  . ? 1_555 ? 
1645 AN6 11 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
1646 AN6 11 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1647 AN7 10 LEU B  222 ? LEU B 222  . ? 1_555 ? 
1648 AN7 10 PHE B  225 ? PHE B 225  . ? 1_555 ? 
1649 AN7 10 LEU B  278 ? LEU B 278  . ? 1_555 ? 
1650 AN7 10 ILE B  285 ? ILE B 285  . ? 1_555 ? 
1651 AN7 10 HIS B  289 ? HIS B 289  . ? 1_555 ? 
1652 AN7 10 ILE B  297 ? ILE B 297  . ? 1_555 ? 
1653 AN7 10 CLA HD .   ? CLA B 1212 . ? 1_555 ? 
1654 AN7 10 CLA ID .   ? CLA B 1213 . ? 1_555 ? 
1655 AN7 10 CLA MD .   ? CLA B 1217 . ? 1_555 ? 
1656 AN7 10 CLA ND .   ? CLA B 1218 . ? 1_555 ? 
1657 AN8 10 PHE B  149 ? PHE B 149  . ? 1_555 ? 
1658 AN8 10 GLY B  181 ? GLY B 181  . ? 1_555 ? 
1659 AN8 10 SER B  186 ? SER B 186  . ? 1_555 ? 
1660 AN8 10 CLA YC .   ? CLA B 1202 . ? 1_555 ? 
1661 AN8 10 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1662 AN8 10 CLA DD .   ? CLA B 1208 . ? 1_555 ? 
1663 AN8 10 CLA FD .   ? CLA B 1210 . ? 1_555 ? 
1664 AN8 10 CLA GD .   ? CLA B 1211 . ? 1_555 ? 
1665 AN8 10 CLA MD .   ? CLA B 1217 . ? 1_555 ? 
1666 AN8 10 CLA UD .   ? CLA B 1225 . ? 1_555 ? 
1667 AN9 10 THR B  61  ? THR B 61   . ? 1_555 ? 
1668 AN9 10 LEU B  65  ? LEU B 65   . ? 1_555 ? 
1669 AN9 10 PHE B  124 ? PHE B 124  . ? 1_555 ? 
1670 AN9 10 MET B  129 ? MET B 129  . ? 1_555 ? 
1671 AN9 10 GLY B  138 ? GLY B 138  . ? 1_555 ? 
1672 AN9 10 LEU B  213 ? LEU B 213  . ? 1_555 ? 
1673 AN9 10 CLA GD .   ? CLA B 1211 . ? 1_555 ? 
1674 AN9 10 CLA HD .   ? CLA B 1212 . ? 1_555 ? 
1675 AN9 10 CLA MD .   ? CLA B 1217 . ? 1_555 ? 
1676 AN9 10 CLA UD .   ? CLA B 1225 . ? 1_555 ? 
1677 AO1 13 PHE B  330 ? PHE B 330  . ? 1_555 ? 
1678 AO1 13 ALA B  337 ? ALA B 337  . ? 1_555 ? 
1679 AO1 13 MET B  381 ? MET B 381  . ? 1_555 ? 
1680 AO1 13 ALA B  384 ? ALA B 384  . ? 1_555 ? 
1681 AO1 13 PHE B  385 ? PHE B 385  . ? 1_555 ? 
1682 AO1 13 GLY B  388 ? GLY B 388  . ? 1_555 ? 
1683 AO1 13 PHE B  391 ? PHE B 391  . ? 1_555 ? 
1684 AO1 13 PHE B  392 ? PHE B 392  . ? 1_555 ? 
1685 AO1 13 CLA RD .   ? CLA B 1222 . ? 1_555 ? 
1686 AO1 13 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1687 AO1 13 CLA ZD .   ? CLA B 1231 . ? 1_555 ? 
1688 AO1 13 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1689 AO1 13 BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1690 AO2 12 CLA RC .   ? CLA B 1022 . ? 1_555 ? 
1691 AO2 12 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
1692 AO2 12 VAL B  642 ? VAL B 642  . ? 1_555 ? 
1693 AO2 12 TRP B  645 ? TRP B 645  . ? 1_555 ? 
1694 AO2 12 TRP B  668 ? TRP B 668  . ? 1_555 ? 
1695 AO2 12 ILE B  672 ? ILE B 672  . ? 1_555 ? 
1696 AO2 12 CLA WC .   ? CLA B 1023 . ? 1_555 ? 
1697 AO2 12 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
1698 AO2 12 CLA VD .   ? CLA B 1226 . ? 1_555 ? 
1699 AO2 12 CLA SC .   ? CLA B 1237 . ? 1_555 ? 
1700 AO2 12 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
1701 AO2 12 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1702 AO3 11 MET B  409 ? MET B 409  . ? 1_555 ? 
1703 AO3 11 ILE B  532 ? ILE B 532  . ? 1_555 ? 
1704 AO3 11 CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1705 AO3 11 CLA ND .   ? CLA B 1218 . ? 1_555 ? 
1706 AO3 11 CLA OD .   ? CLA B 1219 . ? 1_555 ? 
1707 AO3 11 CLA PD .   ? CLA B 1220 . ? 1_555 ? 
1708 AO3 11 CLA SD .   ? CLA B 1223 . ? 1_555 ? 
1709 AO3 11 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1710 AO3 11 CLA GE .   ? CLA B 1240 . ? 1_555 ? 
1711 AO3 11 BCR LE .   ? BCR B 4010 . ? 1_555 ? 
1712 AO3 11 LHG RE .   ? LHG B 5006 . ? 1_555 ? 
1713 AO4 15 TYR B  23  ? TYR B 23   . ? 1_555 ? 
1714 AO4 15 ALA B  26  ? ALA B 26   . ? 1_555 ? 
1715 AO4 15 TRP B  570 ? TRP B 570  . ? 1_555 ? 
1716 AO4 15 PHE B  573 ? PHE B 573  . ? 1_555 ? 
1717 AO4 15 SER B  698 ? SER B 698  . ? 1_555 ? 
1718 AO4 15 GLN B  701 ? GLN B 701  . ? 1_555 ? 
1719 AO4 15 LEU B  704 ? LEU B 704  . ? 1_555 ? 
1720 AO4 15 VAL B  712 ? VAL B 712  . ? 1_555 ? 
1721 AO4 15 CLA XC .   ? CLA B 1201 . ? 1_555 ? 
1722 AO4 15 CLA ZC .   ? CLA B 1203 . ? 1_555 ? 
1723 AO4 15 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
1724 AO4 15 CLA TD .   ? CLA B 1224 . ? 1_555 ? 
1725 AO4 15 CLA VD .   ? CLA B 1226 . ? 1_555 ? 
1726 AO4 15 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
1727 AO4 15 HOH JR .   ? HOH B 8062 . ? 1_555 ? 
1728 AO5 16 HIS B  308 ? HIS B 308  . ? 1_555 ? 
1729 AO5 16 LYS B  309 ? LYS B 309  . ? 1_555 ? 
1730 AO5 16 GLY B  310 ? GLY B 310  . ? 1_555 ? 
1731 AO5 16 PRO B  311 ? PRO B 311  . ? 1_555 ? 
1732 AO5 16 LEU B  312 ? LEU B 312  . ? 1_555 ? 
1733 AO5 16 THR B  313 ? THR B 313  . ? 1_555 ? 
1734 AO5 16 GLY B  316 ? GLY B 316  . ? 1_555 ? 
1735 AO5 16 HIS B  317 ? HIS B 317  . ? 1_555 ? 
1736 AO5 16 VAL B  405 ? VAL B 405  . ? 1_555 ? 
1737 AO5 16 CLA LD .   ? CLA B 1216 . ? 1_555 ? 
1738 AO5 16 CLA PD .   ? CLA B 1220 . ? 1_555 ? 
1739 AO5 16 CLA RD .   ? CLA B 1222 . ? 1_555 ? 
1740 AO5 16 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1741 AO5 16 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1742 AO5 16 CLA DE .   ? CLA B 1236 . ? 1_555 ? 
1743 AO5 16 CLA GE .   ? CLA B 1240 . ? 1_555 ? 
1744 AO6 2  GLY B  487 ? GLY B 487  . ? 1_555 ? 
1745 AO6 2  CLA ID .   ? CLA B 1213 . ? 1_555 ? 
1746 AO7 6  LEU B  475 ? LEU B 475  . ? 1_555 ? 
1747 AO7 6  SER B  481 ? SER B 481  . ? 1_555 ? 
1748 AO7 6  CLA ZD .   ? CLA B 1231 . ? 1_555 ? 
1749 AO7 6  CLA AE .   ? CLA B 1232 . ? 1_555 ? 
1750 AO7 6  BCR NE .   ? BCR B 4018 . ? 1_555 ? 
1751 AO7 6  LHG CF .   ? LHG F 5002 . ? 1_555 ? 
1752 AO8 12 CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
1753 AO8 12 LHG WL .   ? LHG 1 5007 . ? 1_555 ? 
1754 AO8 12 LEU B  148 ? LEU B 148  . ? 1_555 ? 
1755 AO8 12 PHE B  151 ? PHE B 151  . ? 1_555 ? 
1756 AO8 12 TRP B  154 ? TRP B 154  . ? 1_555 ? 
1757 AO8 12 LEU B  155 ? LEU B 155  . ? 1_555 ? 
1758 AO8 12 GLN B  158 ? GLN B 158  . ? 1_555 ? 
1759 AO8 12 PRO B  159 ? PRO B 159  . ? 1_555 ? 
1760 AO8 12 LYS B  160 ? LYS B 160  . ? 1_555 ? 
1761 AO8 12 PHE B  161 ? PHE B 161  . ? 1_555 ? 
1762 AO8 12 CLA DD .   ? CLA B 1208 . ? 1_555 ? 
1763 AO8 12 CLA GD .   ? CLA B 1211 . ? 1_555 ? 
1764 AO9 7  GLU B  134 ? GLU B 134  . ? 1_555 ? 
1765 AO9 7  GLU B  201 ? GLU B 201  . ? 1_555 ? 
1766 AO9 7  HIS B  206 ? HIS B 206  . ? 1_555 ? 
1767 AO9 7  HOH JR .   ? HOH B 8004 . ? 1_555 ? 
1768 AO9 7  HOH JR .   ? HOH B 8026 . ? 1_555 ? 
1769 AO9 7  HOH JR .   ? HOH B 8040 . ? 1_555 ? 
1770 AO9 7  HOH JR .   ? HOH B 8045 . ? 1_555 ? 
1771 AP1 4  LEU B  353 ? LEU B 353  . ? 1_555 ? 
1772 AP1 4  PRO B  354 ? PRO B 354  . ? 1_555 ? 
1773 AP1 4  SER B  355 ? SER B 355  . ? 1_555 ? 
1774 AP1 4  CLA KD .   ? CLA B 1215 . ? 1_555 ? 
1775 AP2 3  ASP B  11  ? ASP B 11   . ? 1_555 ? 
1776 AP2 3  GLY D  135 ? GLY D 135  . ? 1_555 ? 
1777 AP2 3  GLU D  140 ? GLU D 140  . ? 1_555 ? 
1778 AP3 9  CLA IA .   ? CLA A 1013 . ? 1_555 ? 
1779 AP3 9  CLA JC .   ? CLA A 1101 . ? 1_555 ? 
1780 AP3 9  PHE B  429 ? PHE B 429  . ? 1_555 ? 
1781 AP3 9  CLA YD .   ? CLA B 1229 . ? 1_555 ? 
1782 AP3 9  CLA YE .   ? CLA B 1230 . ? 1_555 ? 
1783 AP3 9  45D TC .   ? 45D B 4011 . ? 1_555 ? 
1784 AP3 9  PHE F  72  ? PHE F 72   . ? 1_555 ? 
1785 AP3 9  ILE F  75  ? ILE F 75   . ? 1_555 ? 
1786 AP3 9  CLA DF .   ? CLA F 1301 . ? 1_555 ? 
1787 AP4 18 TYR FA 56  ? TYR 0 59   . ? 1_555 ? 
1788 AP4 18 ILE FA 148 ? ILE 0 151  . ? 1_555 ? 
1789 AP4 18 CLA BR .   ? CLA 0 1503 . ? 1_555 ? 
1790 AP4 18 BCR DR .   ? BCR 0 4022 . ? 1_555 ? 
1791 AP4 18 LMG ER .   ? LMG 0 5001 . ? 1_555 ? 
1792 AP4 18 CLA RC .   ? CLA B 1022 . ? 1_555 ? 
1793 AP4 18 CLA MB .   ? CLA A 1132 . ? 1_555 ? 
1794 AP4 18 HIS B  95  ? HIS B 95   . ? 1_555 ? 
1795 AP4 18 CLA WC .   ? CLA B 1023 . ? 1_555 ? 
1796 AP4 18 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
1797 AP4 18 ILE G  15  ? ILE I 15   . ? 1_555 ? 
1798 AP4 18 GLY G  19  ? GLY I 19   . ? 1_555 ? 
1799 AP4 18 TRP G  20  ? TRP I 20   . ? 1_555 ? 
1800 AP4 18 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
1801 AP4 18 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
1802 AP4 18 HOH OR .   ? HOH I 8001 . ? 1_555 ? 
1803 AP4 18 TRP J  65  ? TRP L 65   . ? 1_555 ? 
1804 AP4 18 PRO J  70  ? PRO L 70   . ? 1_555 ? 
1805 AP5 21 VAL A  121 ? VAL A 121  . ? 1_555 ? 
1806 AP5 21 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
1807 AP5 21 GLY B  433 ? GLY B 433  . ? 1_555 ? 
1808 AP5 21 VAL B  436 ? VAL B 436  . ? 1_555 ? 
1809 AP5 21 HIS B  437 ? HIS B 437  . ? 1_555 ? 
1810 AP5 21 LYS B  449 ? LYS B 449  . ? 1_555 ? 
1811 AP5 21 ILE B  451 ? ILE B 451  . ? 1_555 ? 
1812 AP5 21 CLA QC .   ? CLA A 1012 . ? 1_555 ? 
1813 AP5 21 CLA YD .   ? CLA B 1229 . ? 1_555 ? 
1814 AP5 21 45D TC .   ? 45D B 4011 . ? 1_555 ? 
1815 AP5 21 BCR WE .   ? BCR B 4014 . ? 1_555 ? 
1816 AP5 21 TYR F  40  ? TYR F 40   . ? 1_555 ? 
1817 AP5 21 LEU F  71  ? LEU F 71   . ? 1_555 ? 
1818 AP5 21 ILE F  75  ? ILE F 75   . ? 1_555 ? 
1819 AP5 21 CLA DF .   ? CLA F 1301 . ? 1_555 ? 
1820 AP5 21 ASN H  30  ? ASN J 30   . ? 1_555 ? 
1821 AP5 21 ASP H  35  ? ASP J 35   . ? 1_555 ? 
1822 AP5 21 LEU H  36  ? LEU J 36   . ? 1_555 ? 
1823 AP5 21 LEU H  37  ? LEU J 37   . ? 1_555 ? 
1824 AP5 21 CLA MF .   ? CLA J 1303 . ? 1_555 ? 
1825 AP5 21 ZEX KF .   ? ZEX J 4015 . ? 1_555 ? 
1826 AP6 4  LYS B  45  ? LYS B 45   . ? 1_555 ? 
1827 AP6 4  ARG B  162 ? ARG B 162  . ? 1_555 ? 
1828 AP6 4  GLU K  28  ? GLU M 28   . ? 1_555 ? 
1829 AP6 4  LYS K  31  ? LYS M 31   . ? 1_555 ? 
1830 AP7 10 CYS C  20  ? CYS C 21   . ? 1_555 ? 
1831 AP7 10 VAL C  24  ? VAL C 25   . ? 1_555 ? 
1832 AP7 10 LEU C  25  ? LEU C 26   . ? 1_555 ? 
1833 AP7 10 CYS C  47  ? CYS C 48   . ? 1_555 ? 
1834 AP7 10 VAL C  48  ? VAL C 49   . ? 1_555 ? 
1835 AP7 10 GLY C  49  ? GLY C 50   . ? 1_555 ? 
1836 AP7 10 CYS C  50  ? CYS C 51   . ? 1_555 ? 
1837 AP7 10 LYS C  51  ? LYS C 52   . ? 1_555 ? 
1838 AP7 10 CYS C  53  ? CYS C 54   . ? 1_555 ? 
1839 AP7 10 VAL C  66  ? VAL C 67   . ? 1_555 ? 
1840 AP8 10 CYS C  10  ? CYS C 11   . ? 1_555 ? 
1841 AP8 10 ILE C  11  ? ILE C 12   . ? 1_555 ? 
1842 AP8 10 CYS C  13  ? CYS C 14   . ? 1_555 ? 
1843 AP8 10 THR C  14  ? THR C 15   . ? 1_555 ? 
1844 AP8 10 GLN C  15  ? GLN C 16   . ? 1_555 ? 
1845 AP8 10 CYS C  16  ? CYS C 17   . ? 1_555 ? 
1846 AP8 10 MET C  27  ? MET C 28   . ? 1_555 ? 
1847 AP8 10 CYS C  57  ? CYS C 58   . ? 1_555 ? 
1848 AP8 10 PRO C  58  ? PRO C 59   . ? 1_555 ? 
1849 AP8 10 ILE C  64  ? ILE C 65   . ? 1_555 ? 
1850 AP9 4  TRP B  460 ? TRP B 460  . ? 1_555 ? 
1851 AP9 4  LHG RE .   ? LHG B 5006 . ? 1_555 ? 
1852 AP9 4  ALA F  1   ? ALA F 1    . ? 1_555 ? 
1853 AP9 4  CLA EF .   ? CLA F 1302 . ? 1_555 ? 
1854 AQ1 14 CLA SB .   ? CLA A 1138 . ? 1_555 ? 
1855 AQ1 14 CLA YE .   ? CLA B 1230 . ? 1_555 ? 
1856 AQ1 14 BCR WE .   ? BCR B 4014 . ? 1_555 ? 
1857 AQ1 14 TRP F  78  ? TRP F 78   . ? 1_555 ? 
1858 AQ1 14 ILE F  79  ? ILE F 79   . ? 1_555 ? 
1859 AQ1 14 VAL F  82  ? VAL F 82   . ? 1_555 ? 
1860 AQ1 14 MET F  112 ? MET F 112  . ? 1_555 ? 
1861 AQ1 14 LEU H  18  ? LEU J 18   . ? 1_555 ? 
1862 AQ1 14 THR H  22  ? THR J 22   . ? 1_555 ? 
1863 AQ1 14 GLU H  28  ? GLU J 28   . ? 1_555 ? 
1864 AQ1 14 PHE H  29  ? PHE J 29   . ? 1_555 ? 
1865 AQ1 14 TYR H  33  ? TYR J 33   . ? 1_555 ? 
1866 AQ1 14 CLA LF .   ? CLA J 1302 . ? 1_555 ? 
1867 AQ1 14 HOH PR .   ? HOH J 8001 . ? 1_555 ? 
1868 AQ2 15 VAL B  456 ? VAL B 456  . ? 1_555 ? 
1869 AQ2 15 PHE B  457 ? PHE B 457  . ? 1_555 ? 
1870 AQ2 15 PHE B  472 ? PHE B 472  . ? 1_555 ? 
1871 AQ2 15 CLA XD .   ? CLA B 1228 . ? 1_555 ? 
1872 AQ2 15 CLA BE .   ? CLA B 1234 . ? 1_555 ? 
1873 AQ2 15 ASP F  56  ? ASP F 56   . ? 1_555 ? 
1874 AQ2 15 GLY F  57  ? GLY F 57   . ? 1_555 ? 
1875 AQ2 15 ARG F  58  ? ARG F 58   . ? 1_555 ? 
1876 AQ2 15 PHE F  59  ? PHE F 59   . ? 1_555 ? 
1877 AQ2 15 ILE F  70  ? ILE F 70   . ? 1_555 ? 
1878 AQ2 15 LEU F  73  ? LEU F 73   . ? 1_555 ? 
1879 AQ2 15 TYR F  74  ? TYR F 74   . ? 1_555 ? 
1880 AQ2 15 TRP F  118 ? TRP F 118  . ? 1_555 ? 
1881 AQ2 15 ZEX FF .   ? ZEX F 4016 . ? 1_555 ? 
1882 AQ2 15 LHG CF .   ? LHG F 5002 . ? 1_555 ? 
1883 AQ3 9  CLA XD .   ? CLA B 1228 . ? 1_555 ? 
1884 AQ3 9  CLA YD .   ? CLA B 1229 . ? 1_555 ? 
1885 AQ3 9  CLA CE .   ? CLA B 1235 . ? 1_555 ? 
1886 AQ3 9  VAL F  55  ? VAL F 55   . ? 1_555 ? 
1887 AQ3 9  GLY F  57  ? GLY F 57   . ? 1_555 ? 
1888 AQ3 9  GLY F  77  ? GLY F 77   . ? 1_555 ? 
1889 AQ3 9  GLY F  80  ? GLY F 80   . ? 1_555 ? 
1890 AQ3 9  TRP F  81  ? TRP F 81   . ? 1_555 ? 
1891 AQ3 9  CLA EF .   ? CLA F 1302 . ? 1_555 ? 
1892 AQ4 13 LYS A  706 ? LYS A 706  . ? 1_555 ? 
1893 AQ4 13 TYR B  396 ? TYR B 396  . ? 1_555 ? 
1894 AQ4 13 PRO B  398 ? PRO B 398  . ? 1_555 ? 
1895 AQ4 13 ASP B  403 ? ASP B 403  . ? 1_555 ? 
1896 AQ4 13 ALA B  407 ? ALA B 407  . ? 1_555 ? 
1897 AQ4 13 GLU B  411 ? GLU B 411  . ? 1_555 ? 
1898 AQ4 13 CLA WD .   ? CLA B 1227 . ? 1_555 ? 
1899 AQ4 13 CLA XD .   ? CLA B 1228 . ? 1_555 ? 
1900 AQ4 13 CLA GE .   ? CLA B 1240 . ? 1_555 ? 
1901 AQ4 13 VAL F  132 ? VAL F 132  . ? 1_555 ? 
1902 AQ4 13 LYS F  134 ? LYS F 134  . ? 1_555 ? 
1903 AQ4 13 ASP F  135 ? ASP F 135  . ? 1_555 ? 
1904 AQ4 13 HOH NR .   ? HOH F 8002 . ? 1_555 ? 
1905 AQ5 6  CLA MA .   ? CLA A 1105 . ? 1_555 ? 
1906 AQ5 6  ILE F  103 ? ILE F 103  . ? 1_555 ? 
1907 AQ5 6  VAL F  105 ? VAL F 105  . ? 1_555 ? 
1908 AQ5 6  ASP H  2   ? ASP J 2    . ? 1_555 ? 
1909 AQ5 6  SER H  6   ? SER J 6    . ? 1_555 ? 
1910 AQ5 6  SER H  9   ? SER J 9    . ? 1_555 ? 
1911 AQ6 12 LMG ER .   ? LMG 0 5001 . ? 1_555 ? 
1912 AQ6 12 CLA RC .   ? CLA B 1022 . ? 1_555 ? 
1913 AQ6 12 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
1914 AQ6 12 CLA MB .   ? CLA A 1132 . ? 1_555 ? 
1915 AQ6 12 CLA AD .   ? CLA B 1204 . ? 1_555 ? 
1916 AQ6 12 CLA BD .   ? CLA B 1205 . ? 1_555 ? 
1917 AQ6 12 CLA CD .   ? CLA B 1206 . ? 1_555 ? 
1918 AQ6 12 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
1919 AQ6 12 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
1920 AQ6 12 GLY G  19  ? GLY I 19   . ? 1_555 ? 
1921 AQ6 12 PRO G  23  ? PRO I 23   . ? 1_555 ? 
1922 AQ6 12 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
1923 AQ7 15 CLA BR .   ? CLA 0 1503 . ? 1_555 ? 
1924 AQ7 15 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
1925 AQ7 15 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
1926 AQ7 15 CLA MB .   ? CLA A 1132 . ? 1_555 ? 
1927 AQ7 15 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
1928 AQ7 15 THR B  682 ? THR B 682  . ? 1_555 ? 
1929 AQ7 15 LEU B  684 ? LEU B 684  . ? 1_555 ? 
1930 AQ7 15 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
1931 AQ7 15 CLA SC .   ? CLA B 1237 . ? 1_555 ? 
1932 AQ7 15 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
1933 AQ7 15 TRP G  20  ? TRP I 20   . ? 1_555 ? 
1934 AQ7 15 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
1935 AQ7 15 TRP J  65  ? TRP L 65   . ? 1_555 ? 
1936 AQ7 15 ALA J  87  ? ALA L 87   . ? 1_555 ? 
1937 AQ7 15 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
1938 AQ8 16 PHE B  426 ? PHE B 426  . ? 1_555 ? 
1939 AQ8 16 LEU B  427 ? LEU B 427  . ? 1_555 ? 
1940 AQ8 16 HIS B  430 ? HIS B 430  . ? 1_555 ? 
1941 AQ8 16 ILE B  453 ? ILE B 453  . ? 1_555 ? 
1942 AQ8 16 PHE B  514 ? PHE B 514  . ? 1_555 ? 
1943 AQ8 16 HIS B  518 ? HIS B 518  . ? 1_555 ? 
1944 AQ8 16 CLA YE .   ? CLA B 1230 . ? 1_555 ? 
1945 AQ8 16 CLA CE .   ? CLA B 1235 . ? 1_555 ? 
1946 AQ8 16 LEU F  53  ? LEU F 53   . ? 1_555 ? 
1947 AQ8 16 PRO F  68  ? PRO F 68   . ? 1_555 ? 
1948 AQ8 16 TYR H  33  ? TYR J 33   . ? 1_555 ? 
1949 AQ8 16 LEU H  36  ? LEU J 36   . ? 1_555 ? 
1950 AQ8 16 LEU H  37  ? LEU J 37   . ? 1_555 ? 
1951 AQ8 16 PHE H  38  ? PHE J 38   . ? 1_555 ? 
1952 AQ8 16 HIS H  39  ? HIS J 39   . ? 1_555 ? 
1953 AQ8 16 CLA MF .   ? CLA J 1303 . ? 1_555 ? 
1954 AQ9 12 TRP A  118 ? TRP A 118  . ? 1_555 ? 
1955 AQ9 12 CLA MA .   ? CLA A 1105 . ? 1_555 ? 
1956 AQ9 12 CLA TB .   ? CLA A 1139 . ? 1_555 ? 
1957 AQ9 12 BCR CC .   ? BCR A 4019 . ? 1_555 ? 
1958 AQ9 12 CLA DF .   ? CLA F 1301 . ? 1_555 ? 
1959 AQ9 12 PHE H  21  ? PHE J 21   . ? 1_555 ? 
1960 AQ9 12 GLY H  24  ? GLY J 24   . ? 1_555 ? 
1961 AQ9 12 ILE H  25  ? ILE J 25   . ? 1_555 ? 
1962 AQ9 12 GLU H  28  ? GLU J 28   . ? 1_555 ? 
1963 AQ9 12 ARG H  31  ? ARG J 31   . ? 1_555 ? 
1964 AQ9 12 PHE H  32  ? PHE J 32   . ? 1_555 ? 
1965 AQ9 12 BCR NF .   ? BCR J 4013 . ? 1_555 ? 
1966 AR1 6  CLA YE .   ? CLA B 1230 . ? 1_555 ? 
1967 AR1 6  ILE F  67  ? ILE F 67   . ? 1_555 ? 
1968 AR1 6  PHE H  29  ? PHE J 29   . ? 1_555 ? 
1969 AR1 6  HIS H  39  ? HIS J 39   . ? 1_555 ? 
1970 AR1 6  PRO H  40  ? PRO J 40   . ? 1_555 ? 
1971 AR1 6  ZEX KF .   ? ZEX J 4015 . ? 1_555 ? 
1972 AR2 11 TRP A  118 ? TRP A 118  . ? 1_555 ? 
1973 AR2 11 CLA JC .   ? CLA A 1101 . ? 1_555 ? 
1974 AR2 11 CLA MA .   ? CLA A 1105 . ? 1_555 ? 
1975 AR2 11 CLA OA .   ? CLA A 1107 . ? 1_555 ? 
1976 AR2 11 CLA UB .   ? CLA A 1140 . ? 1_555 ? 
1977 AR2 11 BCR KC .   ? BCR A 4012 . ? 1_555 ? 
1978 AR2 11 PRO H  12  ? PRO J 12   . ? 1_555 ? 
1979 AR2 11 ILE H  27  ? ILE J 27   . ? 1_555 ? 
1980 AR2 11 GLU H  28  ? GLU J 28   . ? 1_555 ? 
1981 AR2 11 ARG H  31  ? ARG J 31   . ? 1_555 ? 
1982 AR2 11 CLA LF .   ? CLA J 1302 . ? 1_555 ? 
1983 AR3 17 ASN A  500 ? ASN A 500  . ? 1_555 ? 
1984 AR3 17 CLA WA .   ? CLA A 1115 . ? 1_555 ? 
1985 AR3 17 CLA CB .   ? CLA A 1121 . ? 1_555 ? 
1986 AR3 17 CLA GB .   ? CLA A 1125 . ? 1_555 ? 
1987 AR3 17 CLA NB .   ? CLA A 1133 . ? 1_555 ? 
1988 AR3 17 CLA OB .   ? CLA A 1134 . ? 1_555 ? 
1989 AR3 17 CLA RB .   ? CLA A 1137 . ? 1_555 ? 
1990 AR3 17 LEU I  69  ? LEU K 76   . ? 1_555 ? 
1991 AR3 17 GLY I  72  ? GLY K 79   . ? 1_555 ? 
1992 AR3 17 MET I  73  ? MET K 80   . ? 1_555 ? 
1993 AR3 17 GLY I  76  ? GLY K 83   . ? 1_555 ? 
1994 AR3 17 SER I  79  ? SER K 86   . ? 1_555 ? 
1995 AR3 17 SER I  80  ? SER K 87   . ? 1_555 ? 
1996 AR3 17 LMG RF .   ? LMG K 5009 . ? 1_555 ? 
1997 AR3 17 HOH QR .   ? HOH K 8001 . ? 1_555 ? 
1998 AR3 17 HOH QR .   ? HOH K 8004 . ? 1_555 ? 
1999 AR3 17 LEU M  211 ? LEU b 213  . ? 1_555 ? 
2000 AR4 14 PHE A  264 ? PHE A 264  . ? 1_555 ? 
2001 AR4 14 CLA UA .   ? CLA A 1113 . ? 1_555 ? 
2002 AR4 14 CLA ZA .   ? CLA A 1118 . ? 1_555 ? 
2003 AR4 14 LMG LC .   ? LMG A 5008 . ? 1_555 ? 
2004 AR4 14 TRP I  11  ? TRP K 18   . ? 1_555 ? 
2005 AR4 14 VAL I  15  ? VAL K 22   . ? 1_555 ? 
2006 AR4 14 GLY I  16  ? GLY K 23   . ? 1_555 ? 
2007 AR4 14 MET I  19  ? MET K 26   . ? 1_555 ? 
2008 AR4 14 CYS I  20  ? CYS K 27   . ? 1_555 ? 
2009 AR4 14 ASN I  23  ? ASN K 30   . ? 1_555 ? 
2010 AR4 14 PHE I  27  ? PHE K 34   . ? 1_555 ? 
2011 AR4 14 MET I  63  ? MET K 70   . ? 1_555 ? 
2012 AR4 14 HIS I  67  ? HIS K 74   . ? 1_555 ? 
2013 AR4 14 BCR QF .   ? BCR K 4001 . ? 1_555 ? 
2014 AR5 9  CLA WA .   ? CLA A 1115 . ? 1_555 ? 
2015 AR5 9  CLA ZA .   ? CLA A 1118 . ? 1_555 ? 
2016 AR5 9  BCR XB .   ? BCR A 4001 . ? 1_555 ? 
2017 AR5 9  PRO I  46  ? PRO K 53   . ? 1_555 ? 
2018 AR5 9  MET I  63  ? MET K 70   . ? 1_555 ? 
2019 AR5 9  SER I  64  ? SER K 71   . ? 1_555 ? 
2020 AR5 9  HIS I  67  ? HIS K 74   . ? 1_555 ? 
2021 AR5 9  ALA I  71  ? ALA K 78   . ? 1_555 ? 
2022 AR5 9  CLA PF .   ? CLA K 1402 . ? 1_555 ? 
2023 AR6 15 CLA BB .   ? CLA A 1120 . ? 1_555 ? 
2024 AR6 15 THR I  7   ? THR K 14   . ? 1_555 ? 
2025 AR6 15 LEU I  13  ? LEU K 20   . ? 1_555 ? 
2026 AR6 15 ILE I  17  ? ILE K 24   . ? 1_555 ? 
2027 AR6 15 ILE I  18  ? ILE K 25   . ? 1_555 ? 
2028 AR6 15 LEU I  21  ? LEU K 28   . ? 1_555 ? 
2029 AR6 15 MET I  73  ? MET K 80   . ? 1_555 ? 
2030 AR6 15 GLY I  76  ? GLY K 83   . ? 1_555 ? 
2031 AR6 15 LEU I  77  ? LEU K 84   . ? 1_555 ? 
2032 AR6 15 SER I  79  ? SER K 86   . ? 1_555 ? 
2033 AR6 15 CLA OF .   ? CLA K 1401 . ? 1_555 ? 
2034 AR6 15 HOH QR .   ? HOH K 8003 . ? 1_555 ? 
2035 AR6 15 LEU M  211 ? LEU b 213  . ? 1_555 ? 
2036 AR6 15 MET M  221 ? MET b 223  . ? 1_555 ? 
2037 AR6 15 CLA DJ .   ? CLA b 1212 . ? 1_555 ? 
2038 AR7 7  PHE FA 153 ? PHE 0 156  . ? 1_555 ? 
2039 AR7 7  HOH MS .   ? HOH 0 8017 . ? 1_555 ? 
2040 AR7 7  HOH MS .   ? HOH 0 8029 . ? 1_555 ? 
2041 AR7 7  HOH IR .   ? HOH A 8043 . ? 1_555 ? 
2042 AR7 7  PRO J  70  ? PRO L 70   . ? 1_555 ? 
2043 AR7 7  ASP J  73  ? ASP L 73   . ? 1_555 ? 
2044 AR7 7  HOH RR .   ? HOH L 8020 . ? 1_555 ? 
2045 AR8 17 ASN J  36  ? ASN L 36   . ? 1_555 ? 
2046 AR8 17 LEU J  37  ? LEU L 37   . ? 1_555 ? 
2047 AR8 17 ARG J  41  ? ARG L 41   . ? 1_555 ? 
2048 AR8 17 GLU J  52  ? GLU L 52   . ? 1_555 ? 
2049 AR8 17 MET J  55  ? MET L 55   . ? 1_555 ? 
2050 AR8 17 ALA J  56  ? ALA L 56   . ? 1_555 ? 
2051 AR8 17 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
2052 AR8 17 CLA VF .   ? CLA L 1503 . ? 1_555 ? 
2053 AR8 17 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
2054 AR8 17 SQD YF .   ? SQD L 5001 . ? 1_555 ? 
2055 AR8 17 HOH RR .   ? HOH L 8019 . ? 1_555 ? 
2056 AR8 17 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
2057 AR8 17 ALA R  24  ? ALA i 24   . ? 1_555 ? 
2058 AR8 17 VAL R  25  ? VAL i 25   . ? 1_555 ? 
2059 AR8 17 THR U  93  ? THR l 93   . ? 1_555 ? 
2060 AR8 17 ALA U  94  ? ALA l 94   . ? 1_555 ? 
2061 AR8 17 SER U  97  ? SER l 97   . ? 1_555 ? 
2062 AR9 19 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
2063 AR9 19 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
2064 AR9 19 CLA MB .   ? CLA A 1132 . ? 1_555 ? 
2065 AR9 19 CLA QB .   ? CLA A 1136 . ? 1_555 ? 
2066 AR9 19 LEU B  684 ? LEU B 684  . ? 1_555 ? 
2067 AR9 19 ALA B  685 ? ALA B 685  . ? 1_555 ? 
2068 AR9 19 LEU B  687 ? LEU B 687  . ? 1_555 ? 
2069 AR9 19 CLA SC .   ? CLA B 1237 . ? 1_555 ? 
2070 AR9 19 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
2071 AR9 19 PHE J  33  ? PHE L 33   . ? 1_555 ? 
2072 AR9 19 LEU J  37  ? LEU L 37   . ? 1_555 ? 
2073 AR9 19 PRO J  38  ? PRO L 38   . ? 1_555 ? 
2074 AR9 19 ALA J  39  ? ALA L 39   . ? 1_555 ? 
2075 AR9 19 VAL J  53  ? VAL L 53   . ? 1_555 ? 
2076 AR9 19 HIS J  57  ? HIS L 57   . ? 1_555 ? 
2077 AR9 19 PHE J  60  ? PHE L 60   . ? 1_555 ? 
2078 AR9 19 CLA TF .   ? CLA L 1501 . ? 1_555 ? 
2079 AR9 19 BCR WF .   ? BCR L 4019 . ? 1_555 ? 
2080 AR9 19 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
2081 AS1 17 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
2082 AS1 17 TYR J  59  ? TYR L 59   . ? 1_555 ? 
2083 AS1 17 GLY J  63  ? GLY L 63   . ? 1_555 ? 
2084 AS1 17 LEU J  67  ? LEU L 67   . ? 1_555 ? 
2085 AS1 17 LEU J  142 ? LEU L 142  . ? 1_555 ? 
2086 AS1 17 LEU J  145 ? LEU L 145  . ? 1_555 ? 
2087 AS1 17 CLA TF .   ? CLA L 1501 . ? 1_555 ? 
2088 AS1 17 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
2089 AS1 17 DGD ZF .   ? DGD L 5004 . ? 1_555 ? 
2090 AS1 17 LMT BG .   ? LMT L 6001 . ? 1_555 ? 
2091 AS1 17 HOH RR .   ? HOH L 8001 . ? 1_555 ? 
2092 AS1 17 HOH RR .   ? HOH L 8008 . ? 1_555 ? 
2093 AS1 17 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
2094 AS1 17 TRP R  12  ? TRP i 12   . ? 1_555 ? 
2095 AS1 17 TRP R  20  ? TRP i 20   . ? 1_555 ? 
2096 AS1 17 LEU R  21  ? LEU i 21   . ? 1_555 ? 
2097 AS1 17 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
2098 AS2 13 LHG WQ .   ? LHG 0 5002 . ? 1_555 ? 
2099 AS2 13 CLA LB .   ? CLA A 1131 . ? 1_555 ? 
2100 AS2 13 CLA XC .   ? CLA B 1201 . ? 1_555 ? 
2101 AS2 13 CLA SC .   ? CLA B 1237 . ? 1_555 ? 
2102 AS2 13 CLA EE .   ? CLA B 1238 . ? 1_555 ? 
2103 AS2 13 CLA FE .   ? CLA B 1239 . ? 1_555 ? 
2104 AS2 13 MET G  27  ? MET I 27   . ? 1_555 ? 
2105 AS2 13 LEU G  30  ? LEU I 30   . ? 1_555 ? 
2106 AS2 13 PHE G  31  ? PHE I 31   . ? 1_555 ? 
2107 AS2 13 ALA J  95  ? ALA L 95   . ? 1_555 ? 
2108 AS2 13 LEU J  96  ? LEU L 96   . ? 1_555 ? 
2109 AS2 13 PHE J  127 ? PHE L 127  . ? 1_555 ? 
2110 AS2 13 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
2111 AS3 17 BCR DR .   ? BCR 0 4022 . ? 1_555 ? 
2112 AS3 17 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
2113 AS3 17 ALA J  56  ? ALA L 56   . ? 1_555 ? 
2114 AS3 17 TYR J  59  ? TYR L 59   . ? 1_555 ? 
2115 AS3 17 GLY J  133 ? GLY L 133  . ? 1_555 ? 
2116 AS3 17 GLY J  134 ? GLY L 134  . ? 1_555 ? 
2117 AS3 17 VAL J  137 ? VAL L 137  . ? 1_555 ? 
2118 AS3 17 CLA TF .   ? CLA L 1501 . ? 1_555 ? 
2119 AS3 17 CLA UF .   ? CLA L 1502 . ? 1_555 ? 
2120 AS3 17 CLA VF .   ? CLA L 1503 . ? 1_555 ? 
2121 AS3 17 SQD YF .   ? SQD L 5001 . ? 1_555 ? 
2122 AS3 17 DGD ZF .   ? DGD L 5004 . ? 1_555 ? 
2123 AS3 17 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
2124 AS3 17 PHE U  128 ? PHE l 128  . ? 1_555 ? 
2125 AS3 17 MET U  132 ? MET l 132  . ? 1_555 ? 
2126 AS3 17 PHE U  136 ? PHE l 136  . ? 1_555 ? 
2127 AS3 17 BCR OL .   ? BCR l 4022 . ? 1_555 ? 
2128 AS4 11 THR J  32  ? THR L 32   . ? 1_555 ? 
2129 AS4 11 ASN J  36  ? ASN L 36   . ? 1_555 ? 
2130 AS4 11 LYS J  42  ? LYS L 42   . ? 1_555 ? 
2131 AS4 11 CLA TF .   ? CLA L 1501 . ? 1_555 ? 
2132 AS4 11 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
2133 AS4 11 SQD CG .   ? SQD L 5002 . ? 1_555 ? 
2134 AS4 11 CLA VI .   ? CLA b 1204 . ? 1_555 ? 
2135 AS4 11 LEU R  29  ? LEU i 29   . ? 1_555 ? 
2136 AS4 11 ILE R  32  ? ILE i 32   . ? 1_555 ? 
2137 AS4 11 HIS R  33  ? HIS i 33   . ? 1_555 ? 
2138 AS4 11 ECH UL .   ? ECH m 4021 . ? 1_555 ? 
2139 AS5 10 CLA IC .   ? CLA A 1130 . ? 1_555 ? 
2140 AS5 10 LMG EC .   ? LMG A 5002 . ? 1_555 ? 
2141 AS5 10 LEU J  67  ? LEU L 67   . ? 1_555 ? 
2142 AS5 10 ARG J  72  ? ARG L 72   . ? 1_555 ? 
2143 AS5 10 SER J  74  ? SER L 74   . ? 1_555 ? 
2144 AS5 10 GLN J  77  ? GLN L 77   . ? 1_555 ? 
2145 AS5 10 CLA VF .   ? CLA L 1503 . ? 1_555 ? 
2146 AS5 10 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
2147 AS5 10 LMT BG .   ? LMT L 6001 . ? 1_555 ? 
2148 AS5 10 HOH RR .   ? HOH L 8009 . ? 1_555 ? 
2149 AS6 15 CLA KB .   ? CLA A 1129 . ? 1_555 ? 
2150 AS6 15 CLA MC .   ? CLA A 1801 . ? 1_555 ? 
2151 AS6 15 BCR AC .   ? BCR A 4007 . ? 1_555 ? 
2152 AS6 15 LHG NC .   ? LHG A 5005 . ? 1_555 ? 
2153 AS6 15 LHG OC .   ? LHG A 5007 . ? 1_555 ? 
2154 AS6 15 VAL J  7   ? VAL L 7    . ? 1_555 ? 
2155 AS6 15 PRO J  23  ? PRO L 23   . ? 1_555 ? 
2156 AS6 15 SER J  27  ? SER L 27   . ? 1_555 ? 
2157 AS6 15 ALA J  28  ? ALA L 28   . ? 1_555 ? 
2158 AS6 15 SQD CG .   ? SQD L 5002 . ? 1_555 ? 
2159 AS6 15 TRP M  152 ? TRP b 154  . ? 1_555 ? 
2160 AS6 15 VAL V  13  ? VAL m 13   . ? 1_555 ? 
2161 AS6 15 LEU V  17  ? LEU m 17   . ? 1_555 ? 
2162 AS6 15 PHE V  20  ? PHE m 20   . ? 1_555 ? 
2163 AS6 15 ARG V  24  ? ARG m 24   . ? 1_555 ? 
2164 AS7 8  LEU J  145 ? LEU L 145  . ? 1_555 ? 
2165 AS7 8  ASP J  149 ? ASP L 149  . ? 1_555 ? 
2166 AS7 8  ARG J  153 ? ARG L 153  . ? 1_555 ? 
2167 AS7 8  CLA VF .   ? CLA L 1503 . ? 1_555 ? 
2168 AS7 8  DGD ZF .   ? DGD L 5004 . ? 1_555 ? 
2169 AS7 8  CLA YI .   ? CLA b 1207 . ? 1_555 ? 
2170 AS7 8  TRP R  12  ? TRP i 12   . ? 1_555 ? 
2171 AS7 8  ILE R  13  ? ILE i 13   . ? 1_555 ? 
2172 AS8 14 SQD YF .   ? SQD L 5001 . ? 1_555 ? 
2173 AS8 14 LHG AG .   ? LHG L 5005 . ? 1_555 ? 
2174 AS8 14 CLA TK .   ? CLA b 1201 . ? 1_555 ? 
2175 AS8 14 CLA VI .   ? CLA b 1204 . ? 1_555 ? 
2176 AS8 14 PHE R  22  ? PHE i 22   . ? 1_555 ? 
2177 AS8 14 THR R  26  ? THR i 26   . ? 1_555 ? 
2178 AS8 14 HIS R  33  ? HIS i 33   . ? 1_555 ? 
2179 AS8 14 BCR NL .   ? BCR l 4019 . ? 1_555 ? 
2180 AS8 14 PHE V  23  ? PHE m 23   . ? 1_555 ? 
2181 AS8 14 THR V  27  ? THR m 27   . ? 1_555 ? 
2182 AS8 14 TYR V  30  ? TYR m 30   . ? 1_555 ? 
2183 AS8 14 LYS V  31  ? LYS m 31   . ? 1_555 ? 
2184 AS8 14 HOH CS .   ? HOH m 8001 . ? 1_555 ? 
2185 AS8 14 HOH CS .   ? HOH m 8003 . ? 1_555 ? 
2186 AS9 9  LMT GR .   ? LMT 0 6001 . ? 1_555 ? 
2187 AS9 9  LEU B  59  ? LEU B 59   . ? 1_555 ? 
2188 AS9 9  CLA XC .   ? CLA B 1201 . ? 1_555 ? 
2189 AS9 9  CLA AD .   ? CLA B 1204 . ? 1_555 ? 
2190 AS9 9  MET G  17  ? MET I 17   . ? 1_555 ? 
2191 AS9 9  LEU K  12  ? LEU M 12   . ? 1_555 ? 
2192 AS9 9  ALA K  19  ? ALA M 19   . ? 1_555 ? 
2193 AS9 9  ALA K  22  ? ALA M 22   . ? 1_555 ? 
2194 AS9 9  SER K  26  ? SER M 26   . ? 1_555 ? 
2195 AT1 8  LHG XQ .   ? LHG 0 5004 . ? 1_555 ? 
2196 AT1 8  LMG WN .   ? LMG 1 5004 . ? 1_555 ? 
2197 AT1 8  LHG VL .   ? LHG 1 5005 . ? 1_555 ? 
2198 AT1 8  LMT XN .   ? LMT 1 6001 . ? 1_555 ? 
2199 AT1 8  SER B  137 ? SER B 137  . ? 1_555 ? 
2200 AT1 8  SER K  4   ? SER M 4    . ? 1_555 ? 
2201 AT1 8  THR K  6   ? THR M 6    . ? 1_555 ? 
2202 AT1 8  GLN K  7   ? GLN M 7    . ? 1_555 ? 
2203 AT2 22 TYR L  455 ? TYR a 455  . ? 1_555 ? 
2204 AT2 22 TYR L  599 ? TYR a 599  . ? 1_555 ? 
2205 AT2 22 ASN L  600 ? ASN a 600  . ? 1_555 ? 
2206 AT2 22 SER L  603 ? SER a 603  . ? 1_555 ? 
2207 AT2 22 ILE L  604 ? ILE a 604  . ? 1_555 ? 
2208 AT2 22 PHE L  607 ? PHE a 607  . ? 1_555 ? 
2209 AT2 22 ILE L  642 ? ILE a 642  . ? 1_555 ? 
2210 AT2 22 TRP L  645 ? TRP a 645  . ? 1_555 ? 
2211 AT2 22 LEU L  650 ? LEU a 650  . ? 1_555 ? 
2212 AT2 22 ILE L  658 ? ILE a 658  . ? 1_555 ? 
2213 AT2 22 PHE L  672 ? PHE a 672  . ? 1_555 ? 
2214 AT2 22 HIS L  676 ? HIS a 676  . ? 1_555 ? 
2215 AT2 22 PHE L  679 ? PHE a 679  . ? 1_555 ? 
2216 AT2 22 TYR L  731 ? TYR a 731  . ? 1_555 ? 
2217 AT2 22 GLY L  735 ? GLY a 735  . ? 1_555 ? 
2218 AT2 22 THR L  739 ? THR a 739  . ? 1_555 ? 
2219 AT2 22 PHE L  742 ? PHE a 742  . ? 1_555 ? 
2220 AT2 22 CLA NI .   ? CLA b 1022 . ? 1_555 ? 
2221 AT2 22 PHE M  615 ? PHE b 617  . ? 1_555 ? 
2222 AT2 22 TRP M  620 ? TRP b 622  . ? 1_555 ? 
2223 AT2 22 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
2224 AT2 22 CLA RI .   ? CLA b 1021 . ? 1_555 ? 
2225 AT3 23 PHE L  677 ? PHE a 677  . ? 1_555 ? 
2226 AT3 23 ALA L  680 ? ALA a 680  . ? 1_555 ? 
2227 AT3 23 PHE L  681 ? PHE a 681  . ? 1_555 ? 
2228 AT3 23 LEU L  683 ? LEU a 683  . ? 1_555 ? 
2229 AT3 23 MET L  684 ? MET a 684  . ? 1_555 ? 
2230 AT3 23 PHE L  687 ? PHE a 687  . ? 1_555 ? 
2231 AT3 23 TYR L  692 ? TYR a 692  . ? 1_555 ? 
2232 AT3 23 TRP L  693 ? TRP a 693  . ? 1_555 ? 
2233 AT3 23 LEU L  696 ? LEU a 696  . ? 1_555 ? 
2234 AT3 23 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2235 AT3 23 SER M  419 ? SER b 421  . ? 1_555 ? 
2236 AT3 23 SER M  422 ? SER b 424  . ? 1_555 ? 
2237 AT3 23 LEU M  423 ? LEU b 425  . ? 1_555 ? 
2238 AT3 23 GLY M  426 ? GLY b 428  . ? 1_555 ? 
2239 AT3 23 PHE M  427 ? PHE b 429  . ? 1_555 ? 
2240 AT3 23 THR M  524 ? THR b 526  . ? 1_555 ? 
2241 AT3 23 LEU M  527 ? LEU b 529  . ? 1_555 ? 
2242 AT3 23 ILE M  528 ? ILE b 530  . ? 1_555 ? 
2243 AT3 23 PHE M  576 ? PHE b 578  . ? 1_555 ? 
2244 AT3 23 TRP M  577 ? TRP b 579  . ? 1_555 ? 
2245 AT3 23 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
2246 AT3 23 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
2247 AT3 23 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
2248 AT4 22 PHE L  452 ? PHE a 452  . ? 1_555 ? 
2249 AT4 22 ILE L  456 ? ILE a 456  . ? 1_555 ? 
2250 AT4 22 PHE L  540 ? PHE a 540  . ? 1_555 ? 
2251 AT4 22 PHE L  596 ? PHE a 596  . ? 1_555 ? 
2252 AT4 22 TRP L  597 ? TRP a 597  . ? 1_555 ? 
2253 AT4 22 ASN L  600 ? ASN a 600  . ? 1_555 ? 
2254 AT4 22 ILE L  642 ? ILE a 642  . ? 1_555 ? 
2255 AT4 22 TYR L  731 ? TYR a 731  . ? 1_555 ? 
2256 AT4 22 CLA FG .   ? CLA a 1011 . ? 1_555 ? 
2257 AT4 22 TRP M  643 ? TRP b 645  . ? 1_555 ? 
2258 AT4 22 LEU M  646 ? LEU b 648  . ? 1_555 ? 
2259 AT4 22 PHE M  647 ? PHE b 649  . ? 1_555 ? 
2260 AT4 22 HIS M  649 ? HIS b 651  . ? 1_555 ? 
2261 AT4 22 LEU M  650 ? LEU b 652  . ? 1_555 ? 
2262 AT4 22 TRP M  652 ? TRP b 654  . ? 1_555 ? 
2263 AT4 22 ALA M  653 ? ALA b 655  . ? 1_555 ? 
2264 AT4 22 CLA RI .   ? CLA b 1021 . ? 1_555 ? 
2265 AT4 22 CLA SI .   ? CLA b 1023 . ? 1_555 ? 
2266 AT4 22 CLA XI .   ? CLA b 1206 . ? 1_555 ? 
2267 AT4 22 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
2268 AT4 22 BCR IK .   ? BCR b 4017 . ? 1_555 ? 
2269 AT4 22 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
2270 AT5 16 TRP L  28  ? TRP a 28   . ? 1_555 ? 
2271 AT5 16 HIS L  33  ? HIS a 33   . ? 1_555 ? 
2272 AT5 16 PHE L  34  ? PHE a 34   . ? 1_555 ? 
2273 AT5 16 ALA L  55  ? ALA a 55   . ? 1_555 ? 
2274 AT5 16 HIS L  56  ? HIS a 56   . ? 1_555 ? 
2275 AT5 16 HIS L  79  ? HIS a 79   . ? 1_555 ? 
2276 AT5 16 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2277 AT5 16 CLA IG .   ? CLA a 1103 . ? 1_555 ? 
2278 AT5 16 CLA JG .   ? CLA a 1104 . ? 1_555 ? 
2279 AT5 16 CLA KG .   ? CLA a 1105 . ? 1_555 ? 
2280 AT5 16 CLA LG .   ? CLA a 1106 . ? 1_555 ? 
2281 AT5 16 CLA OG .   ? CLA a 1109 . ? 1_555 ? 
2282 AT5 16 CLA HH .   ? CLA a 1128 . ? 1_555 ? 
2283 AT5 16 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
2284 AT5 16 LHG AI .   ? LHG a 5001 . ? 1_555 ? 
2285 AT5 16 BCR CL .   ? BCR j 4013 . ? 1_555 ? 
2286 AT6 23 HIS L  56  ? HIS a 56   . ? 1_555 ? 
2287 AT6 23 PHE L  58  ? PHE a 58   . ? 1_555 ? 
2288 AT6 23 ILE L  72  ? ILE a 72   . ? 1_555 ? 
2289 AT6 23 ALA L  75  ? ALA a 75   . ? 1_555 ? 
2290 AT6 23 HIS L  76  ? HIS a 76   . ? 1_555 ? 
2291 AT6 23 HIS L  79  ? HIS a 79   . ? 1_555 ? 
2292 AT6 23 LEU L  80  ? LEU a 80   . ? 1_555 ? 
2293 AT6 23 VAL L  83  ? VAL a 83   . ? 1_555 ? 
2294 AT6 23 PHE L  84  ? PHE a 84   . ? 1_555 ? 
2295 AT6 23 MET L  168 ? MET a 168  . ? 1_555 ? 
2296 AT6 23 TRP L  348 ? TRP a 348  . ? 1_555 ? 
2297 AT6 23 HIS L  349 ? HIS a 349  . ? 1_555 ? 
2298 AT6 23 GLN L  351 ? GLN a 351  . ? 1_555 ? 
2299 AT6 23 LEU L  352 ? LEU a 352  . ? 1_555 ? 
2300 AT6 23 ASN L  355 ? ASN a 355  . ? 1_555 ? 
2301 AT6 23 LEU L  356 ? LEU a 356  . ? 1_555 ? 
2302 AT6 23 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
2303 AT6 23 CLA JG .   ? CLA a 1104 . ? 1_555 ? 
2304 AT6 23 CLA QG .   ? CLA a 1111 . ? 1_555 ? 
2305 AT6 23 CLA CH .   ? CLA a 1123 . ? 1_555 ? 
2306 AT6 23 CLA HH .   ? CLA a 1128 . ? 1_555 ? 
2307 AT6 23 BCR VH .   ? BCR a 4002 . ? 1_555 ? 
2308 AT6 23 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2309 AT7 10 HIS L  56  ? HIS a 56   . ? 1_555 ? 
2310 AT7 10 HIS L  79  ? HIS a 79   . ? 1_555 ? 
2311 AT7 10 VAL L  83  ? VAL a 83   . ? 1_555 ? 
2312 AT7 10 TRP L  86  ? TRP a 86   . ? 1_555 ? 
2313 AT7 10 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
2314 AT7 10 CLA IG .   ? CLA a 1103 . ? 1_555 ? 
2315 AT7 10 CLA LG .   ? CLA a 1106 . ? 1_555 ? 
2316 AT7 10 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
2317 AT7 10 CLA GH .   ? CLA a 1127 . ? 1_555 ? 
2318 AT7 10 CLA HH .   ? CLA a 1128 . ? 1_555 ? 
2319 AT8 16 VAL L  85  ? VAL a 85   . ? 1_555 ? 
2320 AT8 16 TRP L  86  ? TRP a 86   . ? 1_555 ? 
2321 AT8 16 GLY L  89  ? GLY a 89   . ? 1_555 ? 
2322 AT8 16 MET L  90  ? MET a 90   . ? 1_555 ? 
2323 AT8 16 PHE L  92  ? PHE a 92   . ? 1_555 ? 
2324 AT8 16 HIS L  93  ? HIS a 93   . ? 1_555 ? 
2325 AT8 16 PHE L  97  ? PHE a 97   . ? 1_555 ? 
2326 AT8 16 GLN L  115 ? GLN a 115  . ? 1_555 ? 
2327 AT8 16 VAL L  116 ? VAL a 116  . ? 1_555 ? 
2328 AT8 16 TRP L  118 ? TRP a 118  . ? 1_555 ? 
2329 AT8 16 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
2330 AT8 16 CLA LG .   ? CLA a 1106 . ? 1_555 ? 
2331 AT8 16 CLA MG .   ? CLA a 1107 . ? 1_555 ? 
2332 AT8 16 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
2333 AT8 16 BCR ZH .   ? BCR a 4019 . ? 1_555 ? 
2334 AT8 16 CLA EL .   ? CLA j 1302 . ? 1_555 ? 
2335 AT9 17 TRP L  86  ? TRP a 86   . ? 1_555 ? 
2336 AT9 17 MET L  90  ? MET a 90   . ? 1_555 ? 
2337 AT9 17 GLN L  115 ? GLN a 115  . ? 1_555 ? 
2338 AT9 17 GLN L  138 ? GLN a 138  . ? 1_555 ? 
2339 AT9 17 ILE L  139 ? ILE a 139  . ? 1_555 ? 
2340 AT9 17 THR L  140 ? THR a 140  . ? 1_555 ? 
2341 AT9 17 SER L  141 ? SER a 141  . ? 1_555 ? 
2342 AT9 17 LEU L  143 ? LEU a 143  . ? 1_555 ? 
2343 AT9 17 ALA L  667 ? ALA a 667  . ? 1_555 ? 
2344 AT9 17 TYR L  668 ? TYR a 668  . ? 1_555 ? 
2345 AT9 17 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
2346 AT9 17 CLA JG .   ? CLA a 1104 . ? 1_555 ? 
2347 AT9 17 CLA KG .   ? CLA a 1105 . ? 1_555 ? 
2348 AT9 17 CLA MG .   ? CLA a 1107 . ? 1_555 ? 
2349 AT9 17 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
2350 AT9 17 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
2351 AT9 17 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
2352 AU1 15 GLN L  115 ? GLN a 115  . ? 1_555 ? 
2353 AU1 15 VAL L  116 ? VAL a 116  . ? 1_555 ? 
2354 AU1 15 VAL L  117 ? VAL a 117  . ? 1_555 ? 
2355 AU1 15 TRP L  118 ? TRP a 118  . ? 1_555 ? 
2356 AU1 15 GLN L  123 ? GLN a 123  . ? 1_555 ? 
2357 AU1 15 LEU L  126 ? LEU a 126  . ? 1_555 ? 
2358 AU1 15 ILE L  137 ? ILE a 137  . ? 1_555 ? 
2359 AU1 15 CLA KG .   ? CLA a 1105 . ? 1_555 ? 
2360 AU1 15 CLA LG .   ? CLA a 1106 . ? 1_555 ? 
2361 AU1 15 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
2362 AU1 15 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
2363 AU1 15 VAL M  438 ? VAL b 440  . ? 1_555 ? 
2364 AU1 15 PHE M  442 ? PHE b 444  . ? 1_555 ? 
2365 AU1 15 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
2366 AU1 15 ILE S  27  ? ILE j 27   . ? 1_555 ? 
2367 AU2 12 GLU L  7   ? GLU a 7    . ? 1_555 ? 
2368 AU2 12 ARG L  8   ? ARG a 8    . ? 1_555 ? 
2369 AU2 12 VAL L  16  ? VAL a 16   . ? 1_555 ? 
2370 AU2 12 PHE L  77  ? PHE a 77   . ? 1_555 ? 
2371 AU2 12 LEU L  171 ? LEU a 171  . ? 1_555 ? 
2372 AU2 12 ALA L  175 ? ALA a 175  . ? 1_555 ? 
2373 AU2 12 PHE L  178 ? PHE a 178  . ? 1_555 ? 
2374 AU2 12 HIS L  179 ? HIS a 179  . ? 1_555 ? 
2375 AU2 12 LYS L  183 ? LYS a 183  . ? 1_555 ? 
2376 AU2 12 TRP L  189 ? TRP a 189  . ? 1_555 ? 
2377 AU2 12 CLA PG .   ? CLA a 1110 . ? 1_555 ? 
2378 AU2 12 CLA QG .   ? CLA a 1111 . ? 1_555 ? 
2379 AU3 18 THR L  23  ? THR a 23   . ? 1_555 ? 
2380 AU3 18 SER L  24  ? SER a 24   . ? 1_555 ? 
2381 AU3 18 PHE L  25  ? PHE a 25   . ? 1_555 ? 
2382 AU3 18 LYS L  27  ? LYS a 27   . ? 1_555 ? 
2383 AU3 18 TRP L  28  ? TRP a 28   . ? 1_555 ? 
2384 AU3 18 HIS L  33  ? HIS a 33   . ? 1_555 ? 
2385 AU3 18 LYS L  71  ? LYS a 71   . ? 1_555 ? 
2386 AU3 18 SER L  74  ? SER a 74   . ? 1_555 ? 
2387 AU3 18 GLY L  78  ? GLY a 78   . ? 1_555 ? 
2388 AU3 18 VAL L  82  ? VAL a 82   . ? 1_555 ? 
2389 AU3 18 LEU L  173 ? LEU a 173  . ? 1_555 ? 
2390 AU3 18 GLY L  176 ? GLY a 176  . ? 1_555 ? 
2391 AU3 18 TRP L  177 ? TRP a 177  . ? 1_555 ? 
2392 AU3 18 TYR L  180 ? TYR a 180  . ? 1_555 ? 
2393 AU3 18 HIS L  181 ? HIS a 181  . ? 1_555 ? 
2394 AU3 18 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2395 AU3 18 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
2396 AU3 18 PHE S  7   ? PHE j 7    . ? 1_555 ? 
2397 AU4 12 ALA L  12  ? ALA a 12   . ? 1_555 ? 
2398 AU4 12 LYS L  13  ? LYS a 13   . ? 1_555 ? 
2399 AU4 12 VAL L  14  ? VAL a 14   . ? 1_555 ? 
2400 AU4 12 TRP L  189 ? TRP a 189  . ? 1_555 ? 
2401 AU4 12 SER L  195 ? SER a 195  . ? 1_555 ? 
2402 AU4 12 HIS L  199 ? HIS a 199  . ? 1_555 ? 
2403 AU4 12 THR L  313 ? THR a 313  . ? 1_555 ? 
2404 AU4 12 TRP L  315 ? TRP a 315  . ? 1_555 ? 
2405 AU4 12 CLA NG .   ? CLA a 1108 . ? 1_555 ? 
2406 AU4 12 CLA QG .   ? CLA a 1111 . ? 1_555 ? 
2407 AU4 12 CLA XG .   ? CLA a 1118 . ? 1_555 ? 
2408 AU4 12 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2409 AU5 16 PHE L  73  ? PHE a 73   . ? 1_555 ? 
2410 AU5 16 HIS L  76  ? HIS a 76   . ? 1_555 ? 
2411 AU5 16 LEU L  80  ? LEU a 80   . ? 1_555 ? 
2412 AU5 16 MET L  172 ? MET a 172  . ? 1_555 ? 
2413 AU5 16 TRP L  189 ? TRP a 189  . ? 1_555 ? 
2414 AU5 16 ASN L  192 ? ASN a 192  . ? 1_555 ? 
2415 AU5 16 MET L  196 ? MET a 196  . ? 1_555 ? 
2416 AU5 16 HIS L  199 ? HIS a 199  . ? 1_555 ? 
2417 AU5 16 HIS L  200 ? HIS a 200  . ? 1_555 ? 
2418 AU5 16 GLY L  203 ? GLY a 203  . ? 1_555 ? 
2419 AU5 16 CLA IG .   ? CLA a 1103 . ? 1_555 ? 
2420 AU5 16 CLA NG .   ? CLA a 1108 . ? 1_555 ? 
2421 AU5 16 CLA PG .   ? CLA a 1110 . ? 1_555 ? 
2422 AU5 16 CLA CH .   ? CLA a 1123 . ? 1_555 ? 
2423 AU5 16 BCR VH .   ? BCR a 4002 . ? 1_555 ? 
2424 AU5 16 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2425 AU6 20 SER L  150 ? SER a 150  . ? 1_555 ? 
2426 AU6 20 GLY L  151 ? GLY a 151  . ? 1_555 ? 
2427 AU6 20 PHE L  152 ? PHE a 152  . ? 1_555 ? 
2428 AU6 20 GLN L  157 ? GLN a 157  . ? 1_555 ? 
2429 AU6 20 CYS L  160 ? CYS a 160  . ? 1_555 ? 
2430 AU6 20 THR L  161 ? THR a 161  . ? 1_555 ? 
2431 AU6 20 GLY L  164 ? GLY a 164  . ? 1_555 ? 
2432 AU6 20 VAL L  167 ? VAL a 167  . ? 1_555 ? 
2433 AU6 20 MET L  168 ? MET a 168  . ? 1_555 ? 
2434 AU6 20 GLY L  208 ? GLY a 208  . ? 1_555 ? 
2435 AU6 20 GLY L  211 ? GLY a 211  . ? 1_555 ? 
2436 AU6 20 TRP L  212 ? TRP a 212  . ? 1_555 ? 
2437 AU6 20 HIS L  215 ? HIS a 215  . ? 1_555 ? 
2438 AU6 20 VAL L  219 ? VAL a 219  . ? 1_555 ? 
2439 AU6 20 PRO L  239 ? PRO a 239  . ? 1_555 ? 
2440 AU6 20 HIS L  240 ? HIS a 240  . ? 1_555 ? 
2441 AU6 20 CLA SG .   ? CLA a 1113 . ? 1_555 ? 
2442 AU6 20 CLA TG .   ? CLA a 1114 . ? 1_555 ? 
2443 AU6 20 BCR VH .   ? BCR a 4002 . ? 1_555 ? 
2444 AU6 20 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2445 AU7 12 GLY L  214 ? GLY a 214  . ? 1_555 ? 
2446 AU7 12 HIS L  218 ? HIS a 218  . ? 1_555 ? 
2447 AU7 12 PRO L  246 ? PRO a 246  . ? 1_555 ? 
2448 AU7 12 PHE L  256 ? PHE a 256  . ? 1_555 ? 
2449 AU7 12 GLY L  259 ? GLY a 259  . ? 1_555 ? 
2450 AU7 12 LEU L  260 ? LEU a 260  . ? 1_555 ? 
2451 AU7 12 PHE L  263 ? PHE a 263  . ? 1_555 ? 
2452 AU7 12 TYR L  271 ? TYR a 271  . ? 1_555 ? 
2453 AU7 12 PHE L  274 ? PHE a 274  . ? 1_555 ? 
2454 AU7 12 LEU L  298 ? LEU a 298  . ? 1_555 ? 
2455 AU7 12 CLA RG .   ? CLA a 1112 . ? 1_555 ? 
2456 AU7 12 BCR UH .   ? BCR a 4001 . ? 1_555 ? 
2457 AU8 6  TYR L  156 ? TYR a 156  . ? 1_555 ? 
2458 AU8 6  LEU L  238 ? LEU a 238  . ? 1_555 ? 
2459 AU8 6  HIS L  240 ? HIS a 240  . ? 1_555 ? 
2460 AU8 6  LEU L  244 ? LEU a 244  . ? 1_555 ? 
2461 AU8 6  CLA RG .   ? CLA a 1112 . ? 1_555 ? 
2462 AU8 6  BCR VH .   ? BCR a 4002 . ? 1_555 ? 
2463 AU9 15 TRP L  268 ? TRP a 268  . ? 1_555 ? 
2464 AU9 15 LEU L  275 ? LEU a 275  . ? 1_555 ? 
2465 AU9 15 PHE L  277 ? PHE a 277  . ? 1_555 ? 
2466 AU9 15 HIS L  295 ? HIS a 295  . ? 1_555 ? 
2467 AU9 15 LEU L  298 ? LEU a 298  . ? 1_555 ? 
2468 AU9 15 VAL L  302 ? VAL a 302  . ? 1_555 ? 
2469 AU9 15 ILE L  306 ? ILE a 306  . ? 1_555 ? 
2470 AU9 15 ASN L  500 ? ASN a 500  . ? 1_555 ? 
2471 AU9 15 CLA VG .   ? CLA a 1116 . ? 1_555 ? 
2472 AU9 15 CLA ZG .   ? CLA a 1120 . ? 1_555 ? 
2473 AU9 15 CLA LH .   ? CLA a 1134 . ? 1_555 ? 
2474 AU9 15 ALA T  3   ? ALA k 11   . ? 1_555 ? 
2475 AU9 15 ILE T  67  ? ILE k 75   . ? 1_555 ? 
2476 AU9 15 LEU T  74  ? LEU k 82   . ? 1_555 ? 
2477 AU9 15 CLA GL .   ? CLA k 1401 . ? 1_555 ? 
2478 AV1 16 THR L  276 ? THR a 276  . ? 1_555 ? 
2479 AV1 16 PHE L  277 ? PHE a 277  . ? 1_555 ? 
2480 AV1 16 GLY L  279 ? GLY a 279  . ? 1_555 ? 
2481 AV1 16 ASP L  292 ? ASP a 292  . ? 1_555 ? 
2482 AV1 16 THR L  293 ? THR a 293  . ? 1_555 ? 
2483 AV1 16 HIS L  296 ? HIS a 296  . ? 1_555 ? 
2484 AV1 16 ALA L  299 ? ALA a 299  . ? 1_555 ? 
2485 AV1 16 ILE L  300 ? ILE a 300  . ? 1_555 ? 
2486 AV1 16 HIS L  369 ? HIS a 369  . ? 1_555 ? 
2487 AV1 16 MET L  373 ? MET a 373  . ? 1_555 ? 
2488 AV1 16 ALA L  505 ? ALA a 505  . ? 1_555 ? 
2489 AV1 16 CLA UG .   ? CLA a 1115 . ? 1_555 ? 
2490 AV1 16 CLA WG .   ? CLA a 1117 . ? 1_555 ? 
2491 AV1 16 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2492 AV1 16 CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2493 AV1 16 CLA LH .   ? CLA a 1134 . ? 1_555 ? 
2494 AV2 18 ALA L  149 ? ALA a 149  . ? 1_555 ? 
2495 AV2 18 LEU L  205 ? LEU a 205  . ? 1_555 ? 
2496 AV2 18 SER L  209 ? SER a 209  . ? 1_555 ? 
2497 AV2 18 TRP L  212 ? TRP a 212  . ? 1_555 ? 
2498 AV2 18 GLN L  216 ? GLN a 216  . ? 1_555 ? 
2499 AV2 18 HIS L  296 ? HIS a 296  . ? 1_555 ? 
2500 AV2 18 HIS L  297 ? HIS a 297  . ? 1_555 ? 
2501 AV2 18 PHE L  304 ? PHE a 304  . ? 1_555 ? 
2502 AV2 18 LEU L  362 ? LEU a 362  . ? 1_555 ? 
2503 AV2 18 VAL L  366 ? VAL a 366  . ? 1_555 ? 
2504 AV2 18 MET L  370 ? MET a 370  . ? 1_555 ? 
2505 AV2 18 PRO L  375 ? PRO a 375  . ? 1_555 ? 
2506 AV2 18 TYR L  376 ? TYR a 376  . ? 1_555 ? 
2507 AV2 18 CLA VG .   ? CLA a 1116 . ? 1_555 ? 
2508 AV2 18 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2509 AV2 18 CLA GH .   ? CLA a 1127 . ? 1_555 ? 
2510 AV2 18 CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2511 AV2 18 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2512 AV3 17 HIS L  199 ? HIS a 199  . ? 1_555 ? 
2513 AV3 17 ALA L  202 ? ALA a 202  . ? 1_555 ? 
2514 AV3 17 LEU L  207 ? LEU a 207  . ? 1_555 ? 
2515 AV3 17 ILE L  305 ? ILE a 305  . ? 1_555 ? 
2516 AV3 17 HIS L  309 ? HIS a 309  . ? 1_555 ? 
2517 AV3 17 THR L  313 ? THR a 313  . ? 1_555 ? 
2518 AV3 17 TRP L  315 ? TRP a 315  . ? 1_555 ? 
2519 AV3 17 ILE L  317 ? ILE a 317  . ? 1_555 ? 
2520 AV3 17 CLA PG .   ? CLA a 1110 . ? 1_555 ? 
2521 AV3 17 BCR VH .   ? BCR a 4002 . ? 1_555 ? 
2522 AV3 17 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2523 AV3 17 LEU T  55  ? LEU k 63   . ? 1_555 ? 
2524 AV3 17 PRO T  56  ? PRO k 64   . ? 1_555 ? 
2525 AV3 17 LEU T  59  ? LEU k 67   . ? 1_555 ? 
2526 AV3 17 ALA T  60  ? ALA k 68   . ? 1_555 ? 
2527 AV3 17 SER T  63  ? SER k 71   . ? 1_555 ? 
2528 AV3 17 BCR IL .   ? BCR k 4001 . ? 1_555 ? 
2529 AV4 18 MET L  197 ? MET a 197  . ? 1_555 ? 
2530 AV4 18 LEU L  201 ? LEU a 201  . ? 1_555 ? 
2531 AV4 18 LEU L  205 ? LEU a 205  . ? 1_555 ? 
2532 AV4 18 LEU L  303 ? LEU a 303  . ? 1_555 ? 
2533 AV4 18 PHE L  304 ? PHE a 304  . ? 1_555 ? 
2534 AV4 18 ALA L  307 ? ALA a 307  . ? 1_555 ? 
2535 AV4 18 MET L  310 ? MET a 310  . ? 1_555 ? 
2536 AV4 18 TYR L  311 ? TYR a 311  . ? 1_555 ? 
2537 AV4 18 LEU L  358 ? LEU a 358  . ? 1_555 ? 
2538 AV4 18 MET L  429 ? MET a 429  . ? 1_555 ? 
2539 AV4 18 VAL L  553 ? VAL a 553  . ? 1_555 ? 
2540 AV4 18 CLA AH .   ? CLA a 1121 . ? 1_555 ? 
2541 AV4 18 CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2542 AV4 18 CLA CH .   ? CLA a 1123 . ? 1_555 ? 
2543 AV4 18 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2544 AV4 18 CLA IH .   ? CLA a 1129 . ? 1_555 ? 
2545 AV4 18 BCR XH .   ? BCR a 4007 . ? 1_555 ? 
2546 AV4 18 BCR YH .   ? BCR a 4008 . ? 1_555 ? 
2547 AV5 13 ILE L  306 ? ILE a 306  . ? 1_555 ? 
2548 AV5 13 HIS L  309 ? HIS a 309  . ? 1_555 ? 
2549 AV5 13 MET L  310 ? MET a 310  . ? 1_555 ? 
2550 AV5 13 ILE L  317 ? ILE a 317  . ? 1_555 ? 
2551 AV5 13 GLY L  318 ? GLY a 318  . ? 1_555 ? 
2552 AV5 13 HIS L  319 ? HIS a 319  . ? 1_555 ? 
2553 AV5 13 CLA UG .   ? CLA a 1115 . ? 1_555 ? 
2554 AV5 13 CLA AH .   ? CLA a 1121 . ? 1_555 ? 
2555 AV5 13 BCR UH .   ? BCR a 4001 . ? 1_555 ? 
2556 AV5 13 HOH TR .   ? HOH a 8014 . ? 1_555 ? 
2557 AV5 13 ALA T  32  ? ALA k 40   . ? 1_555 ? 
2558 AV5 13 ILE T  33  ? ILE k 41   . ? 1_555 ? 
2559 AV5 13 GLN T  34  ? GLN k 42   . ? 1_555 ? 
2560 AV6 9  HIS L  319 ? HIS a 319  . ? 1_555 ? 
2561 AV6 9  ILE L  324 ? ILE a 324  . ? 1_555 ? 
2562 AV6 9  HIS L  328 ? HIS a 328  . ? 1_555 ? 
2563 AV6 9  CLA YG .   ? CLA a 1119 . ? 1_555 ? 
2564 AV6 9  CLA ZG .   ? CLA a 1120 . ? 1_555 ? 
2565 AV6 9  CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2566 AV6 9  CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2567 AV6 9  CLA RH .   ? CLA a 1801 . ? 1_555 ? 
2568 AV6 9  LHG LI .   ? LHG a 5007 . ? 1_555 ? 
2569 AV7 14 ILE L  324 ? ILE a 324  . ? 1_555 ? 
2570 AV7 14 LEU L  325 ? LEU a 325  . ? 1_555 ? 
2571 AV7 14 HIS L  337 ? HIS a 337  . ? 1_555 ? 
2572 AV7 14 LEU L  340 ? LEU a 340  . ? 1_555 ? 
2573 AV7 14 LEU L  425 ? LEU a 425  . ? 1_555 ? 
2574 AV7 14 MET L  429 ? MET a 429  . ? 1_555 ? 
2575 AV7 14 CLA YG .   ? CLA a 1119 . ? 1_555 ? 
2576 AV7 14 CLA AH .   ? CLA a 1121 . ? 1_555 ? 
2577 AV7 14 CLA DH .   ? CLA a 1124 . ? 1_555 ? 
2578 AV7 14 CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2579 AV7 14 CLA RH .   ? CLA a 1801 . ? 1_555 ? 
2580 AV7 14 BCR XH .   ? BCR a 4007 . ? 1_555 ? 
2581 AV7 14 BCR YH .   ? BCR a 4008 . ? 1_555 ? 
2582 AV7 14 LHG CI .   ? LHG a 5003 . ? 1_555 ? 
2583 AV8 18 HIS L  76  ? HIS a 76   . ? 1_555 ? 
2584 AV8 18 MET L  196 ? MET a 196  . ? 1_555 ? 
2585 AV8 18 MET L  197 ? MET a 197  . ? 1_555 ? 
2586 AV8 18 HIS L  200 ? HIS a 200  . ? 1_555 ? 
2587 AV8 18 MET L  321 ? MET a 321  . ? 1_555 ? 
2588 AV8 18 LEU L  344 ? LEU a 344  . ? 1_555 ? 
2589 AV8 18 THR L  345 ? THR a 345  . ? 1_555 ? 
2590 AV8 18 THR L  346 ? THR a 346  . ? 1_555 ? 
2591 AV8 18 TRP L  348 ? TRP a 348  . ? 1_555 ? 
2592 AV8 18 GLN L  351 ? GLN a 351  . ? 1_555 ? 
2593 AV8 18 ILE L  354 ? ILE a 354  . ? 1_555 ? 
2594 AV8 18 ASN L  355 ? ASN a 355  . ? 1_555 ? 
2595 AV8 18 CLA IG .   ? CLA a 1103 . ? 1_555 ? 
2596 AV8 18 CLA QG .   ? CLA a 1111 . ? 1_555 ? 
2597 AV8 18 CLA YG .   ? CLA a 1119 . ? 1_555 ? 
2598 AV8 18 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2599 AV8 18 CLA GH .   ? CLA a 1127 . ? 1_555 ? 
2600 AV8 18 BCR XH .   ? BCR a 4007 . ? 1_555 ? 
2601 AV9 12 ILE L  364 ? ILE a 364  . ? 1_555 ? 
2602 AV9 12 ILE L  365 ? ILE a 365  . ? 1_555 ? 
2603 AV9 12 GLN L  368 ? GLN a 368  . ? 1_555 ? 
2604 AV9 12 GLY L  398 ? GLY a 398  . ? 1_555 ? 
2605 AV9 12 ILE L  401 ? ILE a 401  . ? 1_555 ? 
2606 AV9 12 MET L  598 ? MET a 598  . ? 1_555 ? 
2607 AV9 12 CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2608 AV9 12 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2609 AV9 12 CLA MH .   ? CLA a 1135 . ? 1_555 ? 
2610 AV9 12 CLA NH .   ? CLA a 1136 . ? 1_555 ? 
2611 AV9 12 CLA OH .   ? CLA a 1137 . ? 1_555 ? 
2612 AV9 12 BCR YH .   ? BCR a 4008 . ? 1_555 ? 
2613 AW1 17 LEU L  358 ? LEU a 358  . ? 1_555 ? 
2614 AW1 17 ILE L  365 ? ILE a 365  . ? 1_555 ? 
2615 AW1 17 GLN L  368 ? GLN a 368  . ? 1_555 ? 
2616 AW1 17 HIS L  369 ? HIS a 369  . ? 1_555 ? 
2617 AW1 17 TYR L  371 ? TYR a 371  . ? 1_555 ? 
2618 AW1 17 ALA L  372 ? ALA a 372  . ? 1_555 ? 
2619 AW1 17 MET L  373 ? MET a 373  . ? 1_555 ? 
2620 AW1 17 SER L  506 ? SER a 506  . ? 1_555 ? 
2621 AW1 17 PHE L  509 ? PHE a 509  . ? 1_555 ? 
2622 AW1 17 CLA VG .   ? CLA a 1116 . ? 1_555 ? 
2623 AW1 17 CLA WG .   ? CLA a 1117 . ? 1_555 ? 
2624 AW1 17 CLA YG .   ? CLA a 1119 . ? 1_555 ? 
2625 AW1 17 CLA CH .   ? CLA a 1123 . ? 1_555 ? 
2626 AW1 17 CLA DH .   ? CLA a 1124 . ? 1_555 ? 
2627 AW1 17 CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2628 AW1 17 CLA MH .   ? CLA a 1135 . ? 1_555 ? 
2629 AW1 17 BCR YH .   ? BCR a 4008 . ? 1_555 ? 
2630 AW2 18 TRP L  86  ? TRP a 86   . ? 1_555 ? 
2631 AW2 18 THR L  140 ? THR a 140  . ? 1_555 ? 
2632 AW2 18 SER L  388 ? SER a 388  . ? 1_555 ? 
2633 AW2 18 THR L  391 ? THR a 391  . ? 1_555 ? 
2634 AW2 18 HIS L  392 ? HIS a 392  . ? 1_555 ? 
2635 AW2 18 TRP L  395 ? TRP a 395  . ? 1_555 ? 
2636 AW2 18 ILE L  396 ? ILE a 396  . ? 1_555 ? 
2637 AW2 18 ILE L  736 ? ILE a 736  . ? 1_555 ? 
2638 AW2 18 TRP L  740 ? TRP a 740  . ? 1_555 ? 
2639 AW2 18 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2640 AW2 18 CLA JG .   ? CLA a 1104 . ? 1_555 ? 
2641 AW2 18 CLA LG .   ? CLA a 1106 . ? 1_555 ? 
2642 AW2 18 CLA MG .   ? CLA a 1107 . ? 1_555 ? 
2643 AW2 18 CLA GH .   ? CLA a 1127 . ? 1_555 ? 
2644 AW2 18 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
2645 AW2 18 LHG AI .   ? LHG a 5001 . ? 1_555 ? 
2646 AW2 18 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
2647 AW2 18 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
2648 AW3 16 LEU L  87  ? LEU a 87   . ? 1_555 ? 
2649 AW3 16 SER L  141 ? SER a 141  . ? 1_555 ? 
2650 AW3 16 GLY L  142 ? GLY a 142  . ? 1_555 ? 
2651 AW3 16 LEU L  146 ? LEU a 146  . ? 1_555 ? 
2652 AW3 16 THR L  363 ? THR a 363  . ? 1_555 ? 
2653 AW3 16 VAL L  366 ? VAL a 366  . ? 1_555 ? 
2654 AW3 16 MET L  370 ? MET a 370  . ? 1_555 ? 
2655 AW3 16 TYR L  376 ? TYR a 376  . ? 1_555 ? 
2656 AW3 16 HIS L  392 ? HIS a 392  . ? 1_555 ? 
2657 AW3 16 HIS L  393 ? HIS a 393  . ? 1_555 ? 
2658 AW3 16 ILE L  396 ? ILE a 396  . ? 1_555 ? 
2659 AW3 16 CLA JG .   ? CLA a 1104 . ? 1_555 ? 
2660 AW3 16 CLA WG .   ? CLA a 1117 . ? 1_555 ? 
2661 AW3 16 CLA CH .   ? CLA a 1123 . ? 1_555 ? 
2662 AW3 16 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
2663 AW3 16 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2664 AW4 19 HIS L  52  ? HIS a 52   . ? 1_555 ? 
2665 AW4 19 ALA L  53  ? ALA a 53   . ? 1_555 ? 
2666 AW4 19 HIS L  56  ? HIS a 56   . ? 1_555 ? 
2667 AW4 19 LEU L  352 ? LEU a 352  . ? 1_555 ? 
2668 AW4 19 LEU L  356 ? LEU a 356  . ? 1_555 ? 
2669 AW4 19 PHE L  399 ? PHE a 399  . ? 1_555 ? 
2670 AW4 19 GLY L  403 ? GLY a 403  . ? 1_555 ? 
2671 AW4 19 HIS L  407 ? HIS a 407  . ? 1_555 ? 
2672 AW4 19 ILE L  410 ? ILE a 410  . ? 1_555 ? 
2673 AW4 19 PHE L  570 ? PHE a 570  . ? 1_555 ? 
2674 AW4 19 ARG L  571 ? ARG a 571  . ? 1_555 ? 
2675 AW4 19 TRP L  588 ? TRP a 588  . ? 1_555 ? 
2676 AW4 19 LEU L  733 ? LEU a 733  . ? 1_555 ? 
2677 AW4 19 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
2678 AW4 19 CLA IG .   ? CLA a 1103 . ? 1_555 ? 
2679 AW4 19 CLA JG .   ? CLA a 1104 . ? 1_555 ? 
2680 AW4 19 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
2681 AW4 19 LHG AI .   ? LHG a 5001 . ? 1_555 ? 
2682 AW4 19 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
2683 AW5 17 PHE L  332 ? PHE a 332  . ? 1_555 ? 
2684 AW5 17 THR L  333 ? THR a 333  . ? 1_555 ? 
2685 AW5 17 LEU L  425 ? LEU a 425  . ? 1_555 ? 
2686 AW5 17 ARG L  428 ? ARG a 428  . ? 1_555 ? 
2687 AW5 17 MET L  429 ? MET a 429  . ? 1_555 ? 
2688 AW5 17 HIS L  432 ? HIS a 432  . ? 1_555 ? 
2689 AW5 17 HIS L  439 ? HIS a 439  . ? 1_555 ? 
2690 AW5 17 CLA YG .   ? CLA a 1119 . ? 1_555 ? 
2691 AW5 17 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
2692 AW5 17 CLA OH .   ? CLA a 1137 . ? 1_555 ? 
2693 AW5 17 LHG CI .   ? LHG a 5003 . ? 1_555 ? 
2694 AW5 17 VAL U  8   ? VAL l 8    . ? 1_555 ? 
2695 AW5 17 THR U  22  ? THR l 22   . ? 1_555 ? 
2696 AW5 17 PRO U  23  ? PRO l 23   . ? 1_555 ? 
2697 AW5 17 ILE U  24  ? ILE l 24   . ? 1_555 ? 
2698 AW5 17 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
2699 AW5 17 LHG QL .   ? LHG l 5003 . ? 1_555 ? 
2700 AW6 14 TRP L  442 ? TRP a 442  . ? 1_555 ? 
2701 AW6 14 ILE L  445 ? ILE a 445  . ? 1_555 ? 
2702 AW6 14 PHE L  446 ? PHE a 446  . ? 1_555 ? 
2703 AW6 14 HIS L  450 ? HIS a 450  . ? 1_555 ? 
2704 AW6 14 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
2705 AW6 14 CLA NH .   ? CLA a 1136 . ? 1_555 ? 
2706 AW6 14 ILE M  19  ? ILE b 21   . ? 1_555 ? 
2707 AW6 14 CLA OI .   ? CLA b 1237 . ? 1_555 ? 
2708 AW6 14 CLA AK .   ? CLA b 1238 . ? 1_555 ? 
2709 AW6 14 PQN DK .   ? PQN b 2002 . ? 1_555 ? 
2710 AW6 14 BCR IK .   ? BCR b 4017 . ? 1_555 ? 
2711 AW6 14 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
2712 AW6 14 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
2713 AW6 14 CLA ML .   ? CLA l 1503 . ? 1_555 ? 
2714 AW7 12 HIS L  490 ? HIS a 490  . ? 1_555 ? 
2715 AW7 12 ALA L  493 ? ALA a 493  . ? 1_555 ? 
2716 AW7 12 THR L  497 ? THR a 497  . ? 1_555 ? 
2717 AW7 12 ALA L  498 ? ALA a 498  . ? 1_555 ? 
2718 AW7 12 CLA VG .   ? CLA a 1116 . ? 1_555 ? 
2719 AW7 12 CLA WG .   ? CLA a 1117 . ? 1_555 ? 
2720 AW7 12 CLA AH .   ? CLA a 1121 . ? 1_555 ? 
2721 AW7 12 CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2722 AW7 12 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2723 AW7 12 CLA LH .   ? CLA a 1134 . ? 1_555 ? 
2724 AW7 12 CLA MH .   ? CLA a 1135 . ? 1_555 ? 
2725 AW7 12 BCR YH .   ? BCR a 4008 . ? 1_555 ? 
2726 AW8 9  PHE L  277 ? PHE a 277  . ? 1_555 ? 
2727 AW8 9  THR L  497 ? THR a 497  . ? 1_555 ? 
2728 AW8 9  PRO L  499 ? PRO a 499  . ? 1_555 ? 
2729 AW8 9  ASN L  500 ? ASN a 500  . ? 1_555 ? 
2730 AW8 9  CLA UG .   ? CLA a 1115 . ? 1_555 ? 
2731 AW8 9  CLA VG .   ? CLA a 1116 . ? 1_555 ? 
2732 AW8 9  CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2733 AW8 9  BCR YH .   ? BCR a 4008 . ? 1_555 ? 
2734 AW8 9  CLA GL .   ? CLA k 1401 . ? 1_555 ? 
2735 AW9 19 GLN L  368 ? GLN a 368  . ? 1_555 ? 
2736 AW9 19 TYR L  371 ? TYR a 371  . ? 1_555 ? 
2737 AW9 19 PHE L  482 ? PHE a 482  . ? 1_555 ? 
2738 AW9 19 ALA L  483 ? ALA a 483  . ? 1_555 ? 
2739 AW9 19 VAL L  486 ? VAL a 486  . ? 1_555 ? 
2740 AW9 19 GLN L  487 ? GLN a 487  . ? 1_555 ? 
2741 AW9 19 HIS L  490 ? HIS a 490  . ? 1_555 ? 
2742 AW9 19 PHE L  509 ? PHE a 509  . ? 1_555 ? 
2743 AW9 19 HIS L  535 ? HIS a 535  . ? 1_555 ? 
2744 AW9 19 HIS L  538 ? HIS a 538  . ? 1_555 ? 
2745 AW9 19 VAL L  605 ? VAL a 605  . ? 1_555 ? 
2746 AW9 19 HIS L  608 ? HIS a 608  . ? 1_555 ? 
2747 AW9 19 LYS L  612 ? LYS a 612  . ? 1_555 ? 
2748 AW9 19 CLA DH .   ? CLA a 1124 . ? 1_555 ? 
2749 AW9 19 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2750 AW9 19 CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2751 AW9 19 CLA NH .   ? CLA a 1136 . ? 1_555 ? 
2752 AW9 19 CLA OH .   ? CLA a 1137 . ? 1_555 ? 
2753 AW9 19 LMG DI .   ? LMG a 5004 . ? 1_555 ? 
2754 AX1 16 TRP L  442 ? TRP a 442  . ? 1_555 ? 
2755 AX1 16 PRO L  480 ? PRO a 480  . ? 1_555 ? 
2756 AX1 16 ILE L  481 ? ILE a 481  . ? 1_555 ? 
2757 AX1 16 PHE L  482 ? PHE a 482  . ? 1_555 ? 
2758 AX1 16 ALA L  483 ? ALA a 483  . ? 1_555 ? 
2759 AX1 16 PHE L  532 ? PHE a 532  . ? 1_555 ? 
2760 AX1 16 HIS L  535 ? HIS a 535  . ? 1_555 ? 
2761 AX1 16 HIS L  536 ? HIS a 536  . ? 1_555 ? 
2762 AX1 16 HIS L  543 ? HIS a 543  . ? 1_555 ? 
2763 AX1 16 CLA DH .   ? CLA a 1124 . ? 1_555 ? 
2764 AX1 16 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
2765 AX1 16 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
2766 AX1 16 CLA MH .   ? CLA a 1135 . ? 1_555 ? 
2767 AX1 16 CLA OH .   ? CLA a 1137 . ? 1_555 ? 
2768 AX1 16 LMG BI .   ? LMG a 5002 . ? 1_555 ? 
2769 AX1 16 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
2770 AX2 10 LEU L  440 ? LEU a 440  . ? 1_555 ? 
2771 AX2 10 TRP L  442 ? TRP a 442  . ? 1_555 ? 
2772 AX2 10 VAL L  443 ? VAL a 443  . ? 1_555 ? 
2773 AX2 10 HIS L  543 ? HIS a 543  . ? 1_555 ? 
2774 AX2 10 CLA DH .   ? CLA a 1124 . ? 1_555 ? 
2775 AX2 10 CLA IH .   ? CLA a 1129 . ? 1_555 ? 
2776 AX2 10 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
2777 AX2 10 CLA MH .   ? CLA a 1135 . ? 1_555 ? 
2778 AX2 10 CLA NH .   ? CLA a 1136 . ? 1_555 ? 
2779 AX2 10 LHG CI .   ? LHG a 5003 . ? 1_555 ? 
2780 AX3 24 THR L  45  ? THR a 45   . ? 1_555 ? 
2781 AX3 24 ILE L  48  ? ILE a 48   . ? 1_555 ? 
2782 AX3 24 ILE L  700 ? ILE a 700  . ? 1_555 ? 
2783 AX3 24 VAL L  701 ? VAL a 701  . ? 1_555 ? 
2784 AX3 24 HIS L  704 ? HIS a 704  . ? 1_555 ? 
2785 AX3 24 VAL L  709 ? VAL a 709  . ? 1_555 ? 
2786 AX3 24 PRO L  711 ? PRO a 711  . ? 1_555 ? 
2787 AX3 24 PRO L  715 ? PRO a 715  . ? 1_555 ? 
2788 AX3 24 ARG L  716 ? ARG a 716  . ? 1_555 ? 
2789 AX3 24 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2790 AX3 24 CLA HI .   ? CLA a 1138 . ? 1_555 ? 
2791 AX3 24 PQN SH .   ? PQN a 2001 . ? 1_555 ? 
2792 AX3 24 HOH TR .   ? HOH a 8024 . ? 1_555 ? 
2793 AX3 24 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
2794 AX3 24 TYR Q  86  ? TYR f 86   . ? 1_555 ? 
2795 AX3 24 LEU Q  87  ? LEU f 87   . ? 1_555 ? 
2796 AX3 24 GLU Q  100 ? GLU f 100  . ? 1_555 ? 
2797 AX3 24 ILE Q  103 ? ILE f 103  . ? 1_555 ? 
2798 AX3 24 MET Q  112 ? MET f 112  . ? 1_555 ? 
2799 AX3 24 CLA WK .   ? CLA f 1301 . ? 1_555 ? 
2800 AX3 24 ALA S  11  ? ALA j 11   . ? 1_555 ? 
2801 AX3 24 MET S  14  ? MET j 14   . ? 1_555 ? 
2802 AX3 24 ILE S  15  ? ILE j 15   . ? 1_555 ? 
2803 AX3 24 LEU S  18  ? LEU j 18   . ? 1_555 ? 
2804 AX4 17 TRP L  49  ? TRP a 49   . ? 1_555 ? 
2805 AX4 17 PHE L  681 ? PHE a 681  . ? 1_555 ? 
2806 AX4 17 LEU L  718 ? LEU a 718  . ? 1_555 ? 
2807 AX4 17 GLN L  722 ? GLN a 722  . ? 1_555 ? 
2808 AX4 17 VAL L  726 ? VAL a 726  . ? 1_555 ? 
2809 AX4 17 HIS L  730 ? HIS a 730  . ? 1_555 ? 
2810 AX4 17 LEU L  733 ? LEU a 733  . ? 1_555 ? 
2811 AX4 17 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2812 AX4 17 CLA LG .   ? CLA a 1106 . ? 1_555 ? 
2813 AX4 17 CLA HH .   ? CLA a 1128 . ? 1_555 ? 
2814 AX4 17 PQN SH .   ? PQN a 2001 . ? 1_555 ? 
2815 AX4 17 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
2816 AX4 17 LHG AI .   ? LHG a 5001 . ? 1_555 ? 
2817 AX4 17 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
2818 AX4 17 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
2819 AX4 17 ALA S  23  ? ALA j 23   . ? 1_555 ? 
2820 AX4 17 BCR CL .   ? BCR j 4013 . ? 1_555 ? 
2821 AX5 12 LEU X  148 ? LEU 2 148  . ? 1_555 ? 
2822 AX5 12 PHE X  151 ? PHE 2 151  . ? 1_555 ? 
2823 AX5 12 LEU GA 17  ? LEU 9 17   . ? 1_555 ? 
2824 AX5 12 LYS L  329 ? LYS a 329  . ? 1_555 ? 
2825 AX5 12 PRO L  331 ? PRO a 331  . ? 1_555 ? 
2826 AX5 12 PHE L  332 ? PHE a 332  . ? 1_555 ? 
2827 AX5 12 CLA AH .   ? CLA a 1121 . ? 1_555 ? 
2828 AX5 12 CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2829 AX5 12 LHG CI .   ? LHG a 5003 . ? 1_555 ? 
2830 AX5 12 LHG LI .   ? LHG a 5007 . ? 1_555 ? 
2831 AX5 12 HOH TR .   ? HOH a 8023 . ? 1_555 ? 
2832 AX5 12 LHG QL .   ? LHG l 5003 . ? 1_555 ? 
2833 AX6 11 MET L  684 ? MET a 684  . ? 1_555 ? 
2834 AX6 11 PHE L  685 ? PHE a 685  . ? 1_555 ? 
2835 AX6 11 SER L  688 ? SER a 688  . ? 1_555 ? 
2836 AX6 11 TRP L  693 ? TRP a 693  . ? 1_555 ? 
2837 AX6 11 ALA L  717 ? ALA a 717  . ? 1_555 ? 
2838 AX6 11 LEU L  718 ? LEU a 718  . ? 1_555 ? 
2839 AX6 11 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2840 AX6 11 CLA PH .   ? CLA a 1139 . ? 1_555 ? 
2841 AX6 11 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
2842 AX6 11 HOH TR .   ? HOH a 8037 . ? 1_555 ? 
2843 AX6 11 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
2844 AX7 7  CYS L  574 ? CYS a 574  . ? 1_555 ? 
2845 AX7 7  GLY L  576 ? GLY a 576  . ? 1_555 ? 
2846 AX7 7  CYS L  583 ? CYS a 583  . ? 1_555 ? 
2847 AX7 7  ARG L  724 ? ARG a 724  . ? 1_555 ? 
2848 AX7 7  CYS M  554 ? CYS b 556  . ? 1_555 ? 
2849 AX7 7  GLY M  556 ? GLY b 558  . ? 1_555 ? 
2850 AX7 7  CYS M  563 ? CYS b 565  . ? 1_555 ? 
2851 AX8 15 LEU L  260 ? LEU a 260  . ? 1_555 ? 
2852 AX8 15 PHE L  263 ? PHE a 263  . ? 1_555 ? 
2853 AX8 15 LEU L  298 ? LEU a 298  . ? 1_555 ? 
2854 AX8 15 ILE L  305 ? ILE a 305  . ? 1_555 ? 
2855 AX8 15 HIS L  309 ? HIS a 309  . ? 1_555 ? 
2856 AX8 15 CLA SG .   ? CLA a 1113 . ? 1_555 ? 
2857 AX8 15 CLA ZG .   ? CLA a 1120 . ? 1_555 ? 
2858 AX8 15 BCR VH .   ? BCR a 4002 . ? 1_555 ? 
2859 AX8 15 ILE T  33  ? ILE k 41   . ? 1_555 ? 
2860 AX8 15 ALA T  60  ? ALA k 68   . ? 1_555 ? 
2861 AX8 15 THR T  61  ? THR k 69   . ? 1_555 ? 
2862 AX8 15 SER T  63  ? SER k 71   . ? 1_555 ? 
2863 AX8 15 PHE T  64  ? PHE k 72   . ? 1_555 ? 
2864 AX8 15 ILE T  67  ? ILE k 75   . ? 1_555 ? 
2865 AX8 15 BCR IL .   ? BCR k 4001 . ? 1_555 ? 
2866 AX9 11 THR L  161 ? THR a 161  . ? 1_555 ? 
2867 AX9 11 GLY L  164 ? GLY a 164  . ? 1_555 ? 
2868 AX9 11 GLY L  165 ? GLY a 165  . ? 1_555 ? 
2869 AX9 11 LEU L  207 ? LEU a 207  . ? 1_555 ? 
2870 AX9 11 CLA IG .   ? CLA a 1103 . ? 1_555 ? 
2871 AX9 11 CLA QG .   ? CLA a 1111 . ? 1_555 ? 
2872 AX9 11 CLA RG .   ? CLA a 1112 . ? 1_555 ? 
2873 AX9 11 CLA TG .   ? CLA a 1114 . ? 1_555 ? 
2874 AX9 11 CLA XG .   ? CLA a 1118 . ? 1_555 ? 
2875 AX9 11 BCR UH .   ? BCR a 4001 . ? 1_555 ? 
2876 AX9 11 BCR WH .   ? BCR a 4003 . ? 1_555 ? 
2877 AY1 11 GLY L  203 ? GLY a 203  . ? 1_555 ? 
2878 AY1 11 LEU L  207 ? LEU a 207  . ? 1_555 ? 
2879 AY1 11 GLY L  208 ? GLY a 208  . ? 1_555 ? 
2880 AY1 11 CLA IG .   ? CLA a 1103 . ? 1_555 ? 
2881 AY1 11 CLA PG .   ? CLA a 1110 . ? 1_555 ? 
2882 AY1 11 CLA QG .   ? CLA a 1111 . ? 1_555 ? 
2883 AY1 11 CLA RG .   ? CLA a 1112 . ? 1_555 ? 
2884 AY1 11 CLA WG .   ? CLA a 1117 . ? 1_555 ? 
2885 AY1 11 CLA XG .   ? CLA a 1118 . ? 1_555 ? 
2886 AY1 11 CLA GH .   ? CLA a 1127 . ? 1_555 ? 
2887 AY1 11 BCR VH .   ? BCR a 4002 . ? 1_555 ? 
2888 AY2 8  ALA L  350 ? ALA a 350  . ? 1_555 ? 
2889 AY2 8  ILE L  354 ? ILE a 354  . ? 1_555 ? 
2890 AY2 8  PHE L  411 ? PHE a 411  . ? 1_555 ? 
2891 AY2 8  CLA YG .   ? CLA a 1119 . ? 1_555 ? 
2892 AY2 8  CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2893 AY2 8  CLA CH .   ? CLA a 1123 . ? 1_555 ? 
2894 AY2 8  BCR YH .   ? BCR a 4008 . ? 1_555 ? 
2895 AY2 8  LHG CI .   ? LHG a 5003 . ? 1_555 ? 
2896 AY3 11 ALA L  357 ? ALA a 357  . ? 1_555 ? 
2897 AY3 11 SER L  361 ? SER a 361  . ? 1_555 ? 
2898 AY3 11 ILE L  401 ? ILE a 401  . ? 1_555 ? 
2899 AY3 11 LEU L  549 ? LEU a 549  . ? 1_555 ? 
2900 AY3 11 CLA YG .   ? CLA a 1119 . ? 1_555 ? 
2901 AY3 11 CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2902 AY3 11 CLA DH .   ? CLA a 1124 . ? 1_555 ? 
2903 AY3 11 CLA EH .   ? CLA a 1125 . ? 1_555 ? 
2904 AY3 11 CLA KH .   ? CLA a 1133 . ? 1_555 ? 
2905 AY3 11 CLA LH .   ? CLA a 1134 . ? 1_555 ? 
2906 AY3 11 BCR XH .   ? BCR a 4007 . ? 1_555 ? 
2907 AY4 5  TRP L  118 ? TRP a 118  . ? 1_555 ? 
2908 AY4 5  CLA KG .   ? CLA a 1105 . ? 1_555 ? 
2909 AY4 5  BCR JI .   ? BCR a 4012 . ? 1_555 ? 
2910 AY4 5  CLA EL .   ? CLA j 1302 . ? 1_555 ? 
2911 AY4 5  BCR CL .   ? BCR j 4013 . ? 1_555 ? 
2912 AY5 20 TRP L  49  ? TRP a 49   . ? 1_555 ? 
2913 AY5 20 ASN L  50  ? ASN a 50   . ? 1_555 ? 
2914 AY5 20 HIS L  52  ? HIS a 52   . ? 1_555 ? 
2915 AY5 20 ALA L  53  ? ALA a 53   . ? 1_555 ? 
2916 AY5 20 ASN L  54  ? ASN a 54   . ? 1_555 ? 
2917 AY5 20 PHE L  399 ? PHE a 399  . ? 1_555 ? 
2918 AY5 20 ARG L  571 ? ARG a 571  . ? 1_555 ? 
2919 AY5 20 SER L  719 ? SER a 719  . ? 1_555 ? 
2920 AY5 20 ILE L  721 ? ILE a 721  . ? 1_555 ? 
2921 AY5 20 GLN L  722 ? GLN a 722  . ? 1_555 ? 
2922 AY5 20 ALA L  725 ? ALA a 725  . ? 1_555 ? 
2923 AY5 20 ALA L  729 ? ALA a 729  . ? 1_555 ? 
2924 AY5 20 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2925 AY5 20 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
2926 AY5 20 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
2927 AY5 20 CLA HH .   ? CLA a 1128 . ? 1_555 ? 
2928 AY5 20 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
2929 AY5 20 HOH TR .   ? HOH a 8008 . ? 1_555 ? 
2930 AY5 20 HOH TR .   ? HOH a 8034 . ? 1_555 ? 
2931 AY5 20 GLY P  50  ? GLY e 51   . ? 1_555 ? 
2932 AY6 12 HIS L  450 ? HIS a 450  . ? 1_555 ? 
2933 AY6 12 PHE L  471 ? PHE a 471  . ? 1_555 ? 
2934 AY6 12 ALA L  475 ? ALA a 475  . ? 1_555 ? 
2935 AY6 12 ILE L  476 ? ILE a 476  . ? 1_555 ? 
2936 AY6 12 GLN L  477 ? GLN a 477  . ? 1_555 ? 
2937 AY6 12 GLN L  479 ? GLN a 479  . ? 1_555 ? 
2938 AY6 12 ILE L  481 ? ILE a 481  . ? 1_555 ? 
2939 AY6 12 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
2940 AY6 12 CLA NH .   ? CLA a 1136 . ? 1_555 ? 
2941 AY6 12 HOH TR .   ? HOH a 8011 . ? 1_555 ? 
2942 AY6 12 ARG U  72  ? ARG l 72   . ? 1_555 ? 
2943 AY6 12 LHG RL .   ? LHG l 5004 . ? 1_555 ? 
2944 AY7 13 HIS L  328 ? HIS a 328  . ? 1_555 ? 
2945 AY7 13 GLY L  330 ? GLY a 330  . ? 1_555 ? 
2946 AY7 13 PRO L  331 ? PRO a 331  . ? 1_555 ? 
2947 AY7 13 PHE L  332 ? PHE a 332  . ? 1_555 ? 
2948 AY7 13 THR L  333 ? THR a 333  . ? 1_555 ? 
2949 AY7 13 HIS L  337 ? HIS a 337  . ? 1_555 ? 
2950 AY7 13 LEU L  425 ? LEU a 425  . ? 1_555 ? 
2951 AY7 13 CLA BH .   ? CLA a 1122 . ? 1_555 ? 
2952 AY7 13 CLA IH .   ? CLA a 1129 . ? 1_555 ? 
2953 AY7 13 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
2954 AY7 13 CLA OH .   ? CLA a 1137 . ? 1_555 ? 
2955 AY7 13 CLA RH .   ? CLA a 1801 . ? 1_555 ? 
2956 AY7 13 BCR XH .   ? BCR a 4007 . ? 1_555 ? 
2957 AY8 8  THR GA 6   ? THR 9 6    . ? 1_555 ? 
2958 AY8 8  LEU GA 9   ? LEU 9 9    . ? 1_555 ? 
2959 AY8 8  ILE L  481 ? ILE a 481  . ? 1_555 ? 
2960 AY8 8  GLN L  484 ? GLN a 484  . ? 1_555 ? 
2961 AY8 8  TRP L  485 ? TRP a 485  . ? 1_555 ? 
2962 AY8 8  CLA MH .   ? CLA a 1135 . ? 1_555 ? 
2963 AY8 8  LHG EI .   ? LHG a 5005 . ? 1_555 ? 
2964 AY8 8  ACT FI .   ? ACT a 7001 . ? 1_555 ? 
2965 AY9 8  SER X  137 ? SER 2 137  . ? 1_555 ? 
2966 AY9 8  VAL X  144 ? VAL 2 144  . ? 1_555 ? 
2967 AY9 8  THR GA 6   ? THR 9 6    . ? 1_555 ? 
2968 AY9 8  GLN GA 7   ? GLN 9 7    . ? 1_555 ? 
2969 AY9 8  TRP L  485 ? TRP a 485  . ? 1_555 ? 
2970 AY9 8  HIS L  488 ? HIS a 488  . ? 1_555 ? 
2971 AY9 8  LEU L  492 ? LEU a 492  . ? 1_555 ? 
2972 AY9 8  LMG DI .   ? LMG a 5004 . ? 1_555 ? 
2973 AZ1 1  LMG DI .   ? LMG a 5004 . ? 1_555 ? 
2974 AZ2 20 HIS L  439 ? HIS a 439  . ? 1_555 ? 
2975 AZ2 20 TRP L  442 ? TRP a 442  . ? 1_555 ? 
2976 AZ2 20 CLA IH .   ? CLA a 1129 . ? 1_555 ? 
2977 AZ2 20 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
2978 AZ2 20 CLA NH .   ? CLA a 1136 . ? 1_555 ? 
2979 AZ2 20 CLA OH .   ? CLA a 1137 . ? 1_555 ? 
2980 AZ2 20 LHG CI .   ? LHG a 5003 . ? 1_555 ? 
2981 AZ2 20 ALA M  676 ? ALA b 678  . ? 1_555 ? 
2982 AZ2 20 ARG M  679 ? ARG b 681  . ? 1_555 ? 
2983 AZ2 20 THR M  680 ? THR b 682  . ? 1_555 ? 
2984 AZ2 20 PRO M  681 ? PRO b 683  . ? 1_555 ? 
2985 AZ2 20 CLA OI .   ? CLA b 1237 . ? 1_555 ? 
2986 AZ2 20 HIS U  19  ? HIS l 19   . ? 1_555 ? 
2987 AZ2 20 THR U  22  ? THR l 22   . ? 1_555 ? 
2988 AZ2 20 ILE U  24  ? ILE l 24   . ? 1_555 ? 
2989 AZ2 20 SER U  25  ? SER l 25   . ? 1_555 ? 
2990 AZ2 20 THR U  30  ? THR l 30   . ? 1_555 ? 
2991 AZ2 20 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
2992 AZ2 20 BCR OL .   ? BCR l 4022 . ? 1_555 ? 
2993 AZ2 20 LHG RL .   ? LHG l 5004 . ? 1_555 ? 
2994 AZ3 16 ILE L  700 ? ILE a 700  . ? 1_555 ? 
2995 AZ3 16 HIS L  704 ? HIS a 704  . ? 1_555 ? 
2996 AZ3 16 CLA II .   ? CLA a 1101 . ? 1_555 ? 
2997 AZ3 16 CLA PH .   ? CLA a 1139 . ? 1_555 ? 
2998 AZ3 16 SER M  416 ? SER b 418  . ? 1_555 ? 
2999 AZ3 16 SER M  419 ? SER b 421  . ? 1_555 ? 
3000 AZ3 16 TRP M  420 ? TRP b 422  . ? 1_555 ? 
3001 AZ3 16 CLA UJ .   ? CLA b 1229 . ? 1_555 ? 
3002 AZ3 16 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
3003 AZ3 16 GLY Q  80  ? GLY f 80   . ? 1_555 ? 
3004 AZ3 16 VAL Q  82  ? VAL f 82   . ? 1_555 ? 
3005 AZ3 16 GLY Q  83  ? GLY f 83   . ? 1_555 ? 
3006 AZ3 16 ARG Q  84  ? ARG f 84   . ? 1_555 ? 
3007 AZ3 16 TYR Q  86  ? TYR f 86   . ? 1_555 ? 
3008 AZ3 16 CLA WK .   ? CLA f 1301 . ? 1_555 ? 
3009 AZ3 16 BCR YK .   ? BCR f 4016 . ? 1_555 ? 
3010 AZ4 19 PRO L  31  ? PRO a 31   . ? 1_555 ? 
3011 AZ4 19 ILE L  48  ? ILE a 48   . ? 1_555 ? 
3012 AZ4 19 TRP L  49  ? TRP a 49   . ? 1_555 ? 
3013 AZ4 19 LEU L  51  ? LEU a 51   . ? 1_555 ? 
3014 AZ4 19 HIS L  52  ? HIS a 52   . ? 1_555 ? 
3015 AZ4 19 CLA GG .   ? CLA a 1013 . ? 1_555 ? 
3016 AZ4 19 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
3017 AZ4 19 CLA OG .   ? CLA a 1109 . ? 1_555 ? 
3018 AZ4 19 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
3019 AZ4 19 CLA HI .   ? CLA a 1138 . ? 1_555 ? 
3020 AZ4 19 CLA PH .   ? CLA a 1139 . ? 1_555 ? 
3021 AZ4 19 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
3022 AZ4 19 PQN SH .   ? PQN a 2001 . ? 1_555 ? 
3023 AZ4 19 LHG AI .   ? LHG a 5001 . ? 1_555 ? 
3024 AZ4 19 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
3025 AZ4 19 PRO S  12  ? PRO j 12   . ? 1_555 ? 
3026 AZ4 19 ILE S  15  ? ILE j 15   . ? 1_555 ? 
3027 AZ4 19 LEU S  19  ? LEU j 19   . ? 1_555 ? 
3028 AZ4 19 BCR CL .   ? BCR j 4013 . ? 1_555 ? 
3029 AZ5 14 TRP L  86  ? TRP a 86   . ? 1_555 ? 
3030 AZ5 14 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
3031 AZ5 14 CLA KG .   ? CLA a 1105 . ? 1_555 ? 
3032 AZ5 14 CLA LG .   ? CLA a 1106 . ? 1_555 ? 
3033 AZ5 14 CLA MG .   ? CLA a 1107 . ? 1_555 ? 
3034 AZ5 14 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
3035 AZ5 14 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
3036 AZ5 14 BCR ZH .   ? BCR a 4019 . ? 1_555 ? 
3037 AZ5 14 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
3038 AZ5 14 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
3039 AZ5 14 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
3040 AZ5 14 ALA S  23  ? ALA j 23   . ? 1_555 ? 
3041 AZ5 14 ASN S  30  ? ASN j 30   . ? 1_555 ? 
3042 AZ5 14 BCR CL .   ? BCR j 4013 . ? 1_555 ? 
3043 AZ6 24 PHE L  449 ? PHE a 449  . ? 1_555 ? 
3044 AZ6 24 GLY L  453 ? GLY a 453  . ? 1_555 ? 
3045 AZ6 24 LEU L  454 ? LEU a 454  . ? 1_555 ? 
3046 AZ6 24 ILE L  456 ? ILE a 456  . ? 1_555 ? 
3047 AZ6 24 HIS L  457 ? HIS a 457  . ? 1_555 ? 
3048 AZ6 24 THR L  460 ? THR a 460  . ? 1_555 ? 
3049 AZ6 24 MET L  461 ? MET a 461  . ? 1_555 ? 
3050 AZ6 24 ARG L  466 ? ARG a 466  . ? 1_555 ? 
3051 AZ6 24 ASP L  469 ? ASP a 469  . ? 1_555 ? 
3052 AZ6 24 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
3053 AZ6 24 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
3054 AZ6 24 LMG BI .   ? LMG a 5002 . ? 1_555 ? 
3055 AZ6 24 HIS M  93  ? HIS b 95   . ? 1_555 ? 
3056 AZ6 24 CLA SI .   ? CLA b 1023 . ? 1_555 ? 
3057 AZ6 24 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
3058 AZ6 24 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
3059 AZ6 24 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
3060 AZ6 24 PRO U  64  ? PRO l 64   . ? 1_555 ? 
3061 AZ6 24 TRP U  65  ? TRP l 65   . ? 1_555 ? 
3062 AZ6 24 LEU U  68  ? LEU l 68   . ? 1_555 ? 
3063 AZ6 24 GLY U  69  ? GLY l 69   . ? 1_555 ? 
3064 AZ6 24 PRO U  70  ? PRO l 70   . ? 1_555 ? 
3065 AZ6 24 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
3066 AZ6 24 CLA ML .   ? CLA l 1503 . ? 1_555 ? 
3067 AZ7 2  CLA AH .   ? CLA a 1121 . ? 1_555 ? 
3068 AZ7 2  CLA RH .   ? CLA a 1801 . ? 1_555 ? 
3069 AZ8 19 ILE L  670 ? ILE a 670  . ? 1_555 ? 
3070 AZ8 19 LEU L  673 ? LEU a 673  . ? 1_555 ? 
3071 AZ8 19 ALA L  674 ? ALA a 674  . ? 1_555 ? 
3072 AZ8 19 PHE L  677 ? PHE a 677  . ? 1_555 ? 
3073 AZ8 19 ALA L  680 ? ALA a 680  . ? 1_555 ? 
3074 AZ8 19 CLA FG .   ? CLA a 1011 . ? 1_555 ? 
3075 AZ8 19 CLA GG .   ? CLA a 1013 . ? 1_555 ? 
3076 AZ8 19 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
3077 AZ8 19 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
3078 AZ8 19 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
3079 AZ8 19 VAL M  434 ? VAL b 436  . ? 1_555 ? 
3080 AZ8 19 TRP M  577 ? TRP b 579  . ? 1_555 ? 
3081 AZ8 19 ASN M  580 ? ASN b 582  . ? 1_555 ? 
3082 AZ8 19 TRP M  584 ? TRP b 586  . ? 1_555 ? 
3083 AZ8 19 LEU M  611 ? LEU b 613  . ? 1_555 ? 
3084 AZ8 19 CLA RI .   ? CLA b 1021 . ? 1_555 ? 
3085 AZ8 19 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
3086 AZ8 19 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
3087 AZ8 19 HOH UR .   ? HOH b 8007 . ? 1_555 ? 
3088 AZ9 16 ASN L  441 ? ASN a 441  . ? 1_555 ? 
3089 AZ9 16 TRP L  442 ? TRP a 442  . ? 1_555 ? 
3090 AZ9 16 ILE L  445 ? ILE a 445  . ? 1_555 ? 
3091 AZ9 16 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
3092 AZ9 16 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
3093 AZ9 16 ILE M  673 ? ILE b 675  . ? 1_555 ? 
3094 AZ9 16 ALA M  676 ? ALA b 678  . ? 1_555 ? 
3095 AZ9 16 ALA M  683 ? ALA b 685  . ? 1_555 ? 
3096 AZ9 16 CLA AK .   ? CLA b 1238 . ? 1_555 ? 
3097 AZ9 16 BCR IK .   ? BCR b 4017 . ? 1_555 ? 
3098 AZ9 16 HOH UR .   ? HOH b 8003 . ? 1_555 ? 
3099 AZ9 16 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
3100 AZ9 16 LEU U  61  ? LEU l 61   . ? 1_555 ? 
3101 AZ9 16 ALA U  92  ? ALA l 92   . ? 1_555 ? 
3102 AZ9 16 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
3103 AZ9 16 BCR NL .   ? BCR l 4019 . ? 1_555 ? 
3104 BC1 17 MET L  671 ? MET a 671  . ? 1_555 ? 
3105 BC1 17 ALA L  674 ? ALA a 674  . ? 1_555 ? 
3106 BC1 17 GLY L  675 ? GLY a 675  . ? 1_555 ? 
3107 BC1 17 PHE L  677 ? PHE a 677  . ? 1_555 ? 
3108 BC1 17 VAL L  678 ? VAL a 678  . ? 1_555 ? 
3109 BC1 17 VAL L  737 ? VAL a 737  . ? 1_555 ? 
3110 BC1 17 TRP L  740 ? TRP a 740  . ? 1_555 ? 
3111 BC1 17 CLA GG .   ? CLA a 1013 . ? 1_555 ? 
3112 BC1 17 CLA FH .   ? CLA a 1126 . ? 1_555 ? 
3113 BC1 17 CLA HH .   ? CLA a 1128 . ? 1_555 ? 
3114 BC1 17 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
3115 BC1 17 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
3116 BC1 17 LEU M  430 ? LEU b 432  . ? 1_555 ? 
3117 BC1 17 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
3118 BC1 17 CLA UJ .   ? CLA b 1229 . ? 1_555 ? 
3119 BC1 17 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
3120 BC1 17 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
3121 BC2 5  THR L  641 ? THR a 641  . ? 1_555 ? 
3122 BC2 5  GLY L  644 ? GLY a 644  . ? 1_555 ? 
3123 BC2 5  ARG L  647 ? ARG a 647  . ? 1_555 ? 
3124 BC2 5  HOH TR .   ? HOH a 8005 . ? 1_555 ? 
3125 BC2 5  TYR M  630 ? TYR b 632  . ? 1_555 ? 
3126 BC3 20 LEU L  646 ? LEU a 646  . ? 1_555 ? 
3127 BC3 20 TRP L  651 ? TRP a 651  . ? 1_555 ? 
3128 BC3 20 CLA FG .   ? CLA a 1011 . ? 1_555 ? 
3129 BC3 20 CLA NI .   ? CLA b 1022 . ? 1_555 ? 
3130 BC3 20 THR M  429 ? THR b 431  . ? 1_555 ? 
3131 BC3 20 VAL M  514 ? VAL b 516  . ? 1_555 ? 
3132 BC3 20 ALA M  517 ? ALA b 519  . ? 1_555 ? 
3133 BC3 20 TRP M  584 ? TRP b 586  . ? 1_555 ? 
3134 BC3 20 PHE M  587 ? PHE b 589  . ? 1_555 ? 
3135 BC3 20 TRP M  614 ? TRP b 616  . ? 1_555 ? 
3136 BC3 20 LEU M  619 ? LEU b 621  . ? 1_555 ? 
3137 BC3 20 SER M  623 ? SER b 625  . ? 1_555 ? 
3138 BC3 20 PHE M  645 ? PHE b 647  . ? 1_555 ? 
3139 BC3 20 HIS M  649 ? HIS b 651  . ? 1_555 ? 
3140 BC3 20 TRP M  652 ? TRP b 654  . ? 1_555 ? 
3141 BC3 20 TYR M  712 ? TYR b 714  . ? 1_555 ? 
3142 BC3 20 THR M  715 ? THR b 717  . ? 1_555 ? 
3143 BC3 20 TYR M  716 ? TYR b 718  . ? 1_555 ? 
3144 BC3 20 PHE M  719 ? PHE b 721  . ? 1_555 ? 
3145 BC3 20 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
3146 BC4 23 ASN L  441 ? ASN a 441  . ? 1_555 ? 
3147 BC4 23 ILE L  445 ? ILE a 445  . ? 1_555 ? 
3148 BC4 23 GLY L  448 ? GLY a 448  . ? 1_555 ? 
3149 BC4 23 PHE L  449 ? PHE a 449  . ? 1_555 ? 
3150 BC4 23 PHE L  540 ? PHE a 540  . ? 1_555 ? 
3151 BC4 23 LEU L  547 ? LEU a 547  . ? 1_555 ? 
3152 BC4 23 ILE L  548 ? ILE a 548  . ? 1_555 ? 
3153 BC4 23 PHE L  596 ? PHE a 596  . ? 1_555 ? 
3154 BC4 23 TRP L  597 ? TRP a 597  . ? 1_555 ? 
3155 BC4 23 CLA NI .   ? CLA b 1022 . ? 1_555 ? 
3156 BC4 23 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
3157 BC4 23 LEU M  650 ? LEU b 652  . ? 1_555 ? 
3158 BC4 23 ALA M  653 ? ALA b 655  . ? 1_555 ? 
3159 BC4 23 THR M  654 ? THR b 656  . ? 1_555 ? 
3160 BC4 23 PHE M  656 ? PHE b 658  . ? 1_555 ? 
3161 BC4 23 MET M  657 ? MET b 659  . ? 1_555 ? 
3162 BC4 23 ILE M  660 ? ILE b 662  . ? 1_555 ? 
3163 BC4 23 TYR M  665 ? TYR b 667  . ? 1_555 ? 
3164 BC4 23 TRP M  666 ? TRP b 668  . ? 1_555 ? 
3165 BC4 23 LEU M  669 ? LEU b 671  . ? 1_555 ? 
3166 BC4 23 CLA BK .   ? CLA b 1239 . ? 1_555 ? 
3167 BC4 23 BCR IK .   ? BCR b 4017 . ? 1_555 ? 
3168 BC4 23 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
3169 BC5 23 HIS M  27  ? HIS b 29   . ? 1_555 ? 
3170 BC5 23 PHE M  29  ? PHE b 31   . ? 1_555 ? 
3171 BC5 23 TYR M  41  ? TYR b 43   . ? 1_555 ? 
3172 BC5 23 ILE M  44  ? ILE b 46   . ? 1_555 ? 
3173 BC5 23 SER M  47  ? SER b 49   . ? 1_555 ? 
3174 BC5 23 HIS M  48  ? HIS b 50   . ? 1_555 ? 
3175 BC5 23 HIS M  51  ? HIS b 53   . ? 1_555 ? 
3176 BC5 23 ILE M  52  ? ILE b 54   . ? 1_555 ? 
3177 BC5 23 ARG M  172 ? ARG b 174  . ? 1_555 ? 
3178 BC5 23 HIS M  176 ? HIS b 178  . ? 1_555 ? 
3179 BC5 23 LEU M  180 ? LEU b 182  . ? 1_555 ? 
3180 BC5 23 LEU M  326 ? LEU b 328  . ? 1_555 ? 
3181 BC5 23 HIS M  327 ? HIS b 329  . ? 1_555 ? 
3182 BC5 23 GLN M  329 ? GLN b 331  . ? 1_555 ? 
3183 BC5 23 LEU M  330 ? LEU b 332  . ? 1_555 ? 
3184 BC5 23 ALA M  333 ? ALA b 335  . ? 1_555 ? 
3185 BC5 23 LEU M  334 ? LEU b 336  . ? 1_555 ? 
3186 BC5 23 CLA TK .   ? CLA b 1201 . ? 1_555 ? 
3187 BC5 23 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3188 BC5 23 CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3189 BC5 23 CLA MJ .   ? CLA b 1221 . ? 1_555 ? 
3190 BC5 23 CLA RJ .   ? CLA b 1226 . ? 1_555 ? 
3191 BC5 23 BCR FK .   ? BCR b 4005 . ? 1_555 ? 
3192 BC6 13 HIS M  27  ? HIS b 29   . ? 1_555 ? 
3193 BC6 13 HIS M  51  ? HIS b 53   . ? 1_555 ? 
3194 BC6 13 TRP M  58  ? TRP b 60   . ? 1_555 ? 
3195 BC6 13 LEU M  337 ? LEU b 339  . ? 1_555 ? 
3196 BC6 13 PHE M  377 ? PHE b 379  . ? 1_555 ? 
3197 BC6 13 CLA TK .   ? CLA b 1201 . ? 1_555 ? 
3198 BC6 13 CLA TI .   ? CLA b 1202 . ? 1_555 ? 
3199 BC6 13 CLA VI .   ? CLA b 1204 . ? 1_555 ? 
3200 BC6 13 CLA WI .   ? CLA b 1205 . ? 1_555 ? 
3201 BC6 13 CLA PJ .   ? CLA b 1224 . ? 1_555 ? 
3202 BC6 13 CLA QJ .   ? CLA b 1225 . ? 1_555 ? 
3203 BC6 13 CLA RJ .   ? CLA b 1226 . ? 1_555 ? 
3204 BC6 13 LMG KK .   ? LMG b 5002 . ? 1_555 ? 
3205 BC7 22 SQD YF .   ? SQD L 5001 . ? 1_555 ? 
3206 BC7 22 SQD CG .   ? SQD L 5002 . ? 1_555 ? 
3207 BC7 22 LEU M  57  ? LEU b 59   . ? 1_555 ? 
3208 BC7 22 GLY M  61  ? GLY b 63   . ? 1_555 ? 
3209 BC7 22 PHE M  64  ? PHE b 66   . ? 1_555 ? 
3210 BC7 22 HIS M  65  ? HIS b 67   . ? 1_555 ? 
3211 BC7 22 TRP M  68  ? TRP b 70   . ? 1_555 ? 
3212 BC7 22 GLN M  69  ? GLN b 71   . ? 1_555 ? 
3213 BC7 22 ALA M  88  ? ALA b 90   . ? 1_555 ? 
3214 BC7 22 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3215 BC7 22 CLA WI .   ? CLA b 1205 . ? 1_555 ? 
3216 BC7 22 CLA XI .   ? CLA b 1206 . ? 1_555 ? 
3217 BC7 22 CLA PJ .   ? CLA b 1224 . ? 1_555 ? 
3218 BC7 22 LEU R  10  ? LEU i 10   . ? 1_555 ? 
3219 BC7 22 PRO R  11  ? PRO i 11   . ? 1_555 ? 
3220 BC7 22 LEU R  14  ? LEU i 14   . ? 1_555 ? 
3221 BC7 22 ILE R  15  ? ILE i 15   . ? 1_555 ? 
3222 BC7 22 VAL R  18  ? VAL i 18   . ? 1_555 ? 
3223 BC7 22 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
3224 BC7 22 ALA V  11  ? ALA m 11   . ? 1_555 ? 
3225 BC7 22 ALA V  15  ? ALA m 15   . ? 1_555 ? 
3226 BC7 22 ECH UL .   ? ECH m 4021 . ? 1_555 ? 
3227 BC8 14 ALA M  86  ? ALA b 88   . ? 1_555 ? 
3228 BC8 14 HIS M  87  ? HIS b 89   . ? 1_555 ? 
3229 BC8 14 ASN M  112 ? ASN b 114  . ? 1_555 ? 
3230 BC8 14 ILE M  113 ? ILE b 115  . ? 1_555 ? 
3231 BC8 14 ALA M  114 ? ALA b 116  . ? 1_555 ? 
3232 BC8 14 TYR M  115 ? TYR b 117  . ? 1_555 ? 
3233 BC8 14 SER M  116 ? SER b 118  . ? 1_555 ? 
3234 BC8 14 VAL M  640 ? VAL b 642  . ? 1_555 ? 
3235 BC8 14 TRP M  641 ? TRP b 643  . ? 1_555 ? 
3236 BC8 14 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3237 BC8 14 CLA VI .   ? CLA b 1204 . ? 1_555 ? 
3238 BC8 14 CLA XI .   ? CLA b 1206 . ? 1_555 ? 
3239 BC8 14 CLA PJ .   ? CLA b 1224 . ? 1_555 ? 
3240 BC8 14 HOH UR .   ? HOH b 8087 . ? 1_555 ? 
3241 BC9 21 ALA L  463 ? ALA a 463  . ? 1_555 ? 
3242 BC9 21 CLA NI .   ? CLA b 1022 . ? 1_555 ? 
3243 BC9 21 HIS M  87  ? HIS b 89   . ? 1_555 ? 
3244 BC9 21 ILE M  89  ? ILE b 91   . ? 1_555 ? 
3245 BC9 21 TRP M  90  ? TRP b 92   . ? 1_555 ? 
3246 BC9 21 ASP M  91  ? ASP b 93   . ? 1_555 ? 
3247 BC9 21 HIS M  93  ? HIS b 95   . ? 1_555 ? 
3248 BC9 21 PHE M  94  ? PHE b 96   . ? 1_555 ? 
3249 BC9 21 ASN M  112 ? ASN b 114  . ? 1_555 ? 
3250 BC9 21 SER M  639 ? SER b 641  . ? 1_555 ? 
3251 BC9 21 VAL M  640 ? VAL b 642  . ? 1_555 ? 
3252 BC9 21 CLA VI .   ? CLA b 1204 . ? 1_555 ? 
3253 BC9 21 CLA WI .   ? CLA b 1205 . ? 1_555 ? 
3254 BC9 21 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
3255 BC9 21 BCR IK .   ? BCR b 4017 . ? 1_555 ? 
3256 BC9 21 LMG KK .   ? LMG b 5002 . ? 1_555 ? 
3257 BC9 21 ILE R  15  ? ILE i 15   . ? 1_555 ? 
3258 BC9 21 VAL R  18  ? VAL i 18   . ? 1_555 ? 
3259 BC9 21 PHE R  22  ? PHE i 22   . ? 1_555 ? 
3260 BC9 21 THR R  26  ? THR i 26   . ? 1_555 ? 
3261 BC9 21 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
3262 BD1 14 LEU J  141 ? LEU L 141  . ? 1_555 ? 
3263 BD1 14 ILE J  151 ? ILE L 151  . ? 1_555 ? 
3264 BD1 14 CLA TF .   ? CLA L 1501 . ? 1_555 ? 
3265 BD1 14 CLA VF .   ? CLA L 1503 . ? 1_555 ? 
3266 BD1 14 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
3267 BD1 14 LMT BG .   ? LMT L 6001 . ? 1_555 ? 
3268 BD1 14 CLA NI .   ? CLA b 1022 . ? 1_555 ? 
3269 BD1 14 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
3270 BD1 14 HIS M  93  ? HIS b 95   . ? 1_555 ? 
3271 BD1 14 CLA XI .   ? CLA b 1206 . ? 1_555 ? 
3272 BD1 14 TRP R  20  ? TRP i 20   . ? 1_555 ? 
3273 BD1 14 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
3274 BD1 14 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
3275 BD1 14 TRP U  65  ? TRP l 65   . ? 1_555 ? 
3276 BD2 14 LHG OC .   ? LHG A 5007 . ? 1_555 ? 
3277 BD2 14 PHE M  49  ? PHE b 51   . ? 1_555 ? 
3278 BD2 14 LEU M  146 ? LEU b 148  . ? 1_555 ? 
3279 BD2 14 PHE M  149 ? PHE b 151  . ? 1_555 ? 
3280 BD2 14 ALA M  150 ? ALA b 152  . ? 1_555 ? 
3281 BD2 14 HIS M  154 ? HIS b 156  . ? 1_555 ? 
3282 BD2 14 LYS M  158 ? LYS b 160  . ? 1_555 ? 
3283 BD2 14 PHE M  159 ? PHE b 161  . ? 1_555 ? 
3284 BD2 14 TRP M  165 ? TRP b 167  . ? 1_555 ? 
3285 BD2 14 CLA AJ .   ? CLA b 1209 . ? 1_555 ? 
3286 BD2 14 CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3287 BD2 14 BCR FK .   ? BCR b 4005 . ? 1_555 ? 
3288 BD2 14 SQD NK .   ? SQD b 5006 . ? 1_555 ? 
3289 BD2 14 HOH UR .   ? HOH b 8111 . ? 1_555 ? 
3290 BD3 12 TRP M  165 ? TRP b 167  . ? 1_555 ? 
3291 BD3 12 SER M  171 ? SER b 173  . ? 1_555 ? 
3292 BD3 12 HIS M  175 ? HIS b 177  . ? 1_555 ? 
3293 BD3 12 ASN M  292 ? ASN b 294  . ? 1_555 ? 
3294 BD3 12 TRP M  293 ? TRP b 295  . ? 1_555 ? 
3295 BD3 12 CLA ZI .   ? CLA b 1208 . ? 1_555 ? 
3296 BD3 12 CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3297 BD3 12 CLA DJ .   ? CLA b 1212 . ? 1_555 ? 
3298 BD3 12 CLA IJ .   ? CLA b 1217 . ? 1_555 ? 
3299 BD3 12 BCR FK .   ? BCR b 4005 . ? 1_555 ? 
3300 BD3 12 HOH UR .   ? HOH b 8071 . ? 1_555 ? 
3301 BD3 12 HOH UR .   ? HOH b 8111 . ? 1_555 ? 
3302 BD4 22 PHE M  45  ? PHE b 47   . ? 1_555 ? 
3303 BD4 22 HIS M  48  ? HIS b 50   . ? 1_555 ? 
3304 BD4 22 PHE M  49  ? PHE b 51   . ? 1_555 ? 
3305 BD4 22 ILE M  52  ? ILE b 54   . ? 1_555 ? 
3306 BD4 22 TRP M  121 ? TRP b 123  . ? 1_555 ? 
3307 BD4 22 TRP M  165 ? TRP b 167  . ? 1_555 ? 
3308 BD4 22 SER M  171 ? SER b 173  . ? 1_555 ? 
3309 BD4 22 ARG M  172 ? ARG b 174  . ? 1_555 ? 
3310 BD4 22 HIS M  175 ? HIS b 177  . ? 1_555 ? 
3311 BD4 22 HIS M  176 ? HIS b 178  . ? 1_555 ? 
3312 BD4 22 GLY M  179 ? GLY b 181  . ? 1_555 ? 
3313 BD4 22 LEU M  180 ? LEU b 182  . ? 1_555 ? 
3314 BD4 22 PHE M  181 ? PHE b 183  . ? 1_555 ? 
3315 BD4 22 TYR M  354 ? TYR b 356  . ? 1_555 ? 
3316 BD4 22 CLA TI .   ? CLA b 1202 . ? 1_555 ? 
3317 BD4 22 CLA ZI .   ? CLA b 1208 . ? 1_555 ? 
3318 BD4 22 CLA AJ .   ? CLA b 1209 . ? 1_555 ? 
3319 BD4 22 CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3320 BD4 22 CLA MJ .   ? CLA b 1221 . ? 1_555 ? 
3321 BD4 22 CLA QJ .   ? CLA b 1225 . ? 1_555 ? 
3322 BD4 22 BCR FK .   ? BCR b 4005 . ? 1_555 ? 
3323 BD4 22 SQD NK .   ? SQD b 5006 . ? 1_555 ? 
3324 BD5 19 CLA OB .   ? CLA A 1134 . ? 1_555 ? 
3325 BD5 19 ILE M  125 ? ILE b 127  . ? 1_555 ? 
3326 BD5 19 GLY M  126 ? GLY b 128  . ? 1_555 ? 
3327 BD5 19 GLY M  136 ? GLY b 138  . ? 1_555 ? 
3328 BD5 19 PHE M  139 ? PHE b 141  . ? 1_555 ? 
3329 BD5 19 SER M  184 ? SER b 186  . ? 1_555 ? 
3330 BD5 19 ALA M  187 ? ALA b 189  . ? 1_555 ? 
3331 BD5 19 TRP M  188 ? TRP b 190  . ? 1_555 ? 
3332 BD5 19 HIS M  191 ? HIS b 193  . ? 1_555 ? 
3333 BD5 19 HIS M  194 ? HIS b 196  . ? 1_555 ? 
3334 BD5 19 VAL M  195 ? VAL b 197  . ? 1_555 ? 
3335 BD5 19 GLY M  206 ? GLY b 208  . ? 1_555 ? 
3336 BD5 19 TRP M  207 ? TRP b 209  . ? 1_555 ? 
3337 BD5 19 PHE M  210 ? PHE b 212  . ? 1_555 ? 
3338 BD5 19 CLA DJ .   ? CLA b 1212 . ? 1_555 ? 
3339 BD5 19 CLA QJ .   ? CLA b 1225 . ? 1_555 ? 
3340 BD5 19 ECH GK .   ? ECH b 4006 . ? 1_555 ? 
3341 BD5 19 SQD NK .   ? SQD b 5006 . ? 1_555 ? 
3342 BD5 19 HOH UR .   ? HOH b 8107 . ? 1_555 ? 
3343 BD6 22 LEU I  77  ? LEU K 84   . ? 1_555 ? 
3344 BD6 22 LMG RF .   ? LMG K 5009 . ? 1_555 ? 
3345 BD6 22 LEU M  186 ? LEU b 188  . ? 1_555 ? 
3346 BD6 22 ALA M  187 ? ALA b 189  . ? 1_555 ? 
3347 BD6 22 GLY M  190 ? GLY b 192  . ? 1_555 ? 
3348 BD6 22 VAL M  193 ? VAL b 195  . ? 1_555 ? 
3349 BD6 22 HIS M  194 ? HIS b 196  . ? 1_555 ? 
3350 BD6 22 PHE M  210 ? PHE b 212  . ? 1_555 ? 
3351 BD6 22 LEU M  211 ? LEU b 213  . ? 1_555 ? 
3352 BD6 22 PRO M  214 ? PRO b 216  . ? 1_555 ? 
3353 BD6 22 PRO M  215 ? PRO b 217  . ? 1_555 ? 
3354 BD6 22 GLY M  219 ? GLY b 221  . ? 1_555 ? 
3355 BD6 22 LEU M  220 ? LEU b 222  . ? 1_555 ? 
3356 BD6 22 PHE M  223 ? PHE b 225  . ? 1_555 ? 
3357 BD6 22 PHE M  224 ? PHE b 226  . ? 1_555 ? 
3358 BD6 22 LEU M  253 ? LEU b 255  . ? 1_555 ? 
3359 BD6 22 CLA AJ .   ? CLA b 1209 . ? 1_555 ? 
3360 BD6 22 CLA CJ .   ? CLA b 1211 . ? 1_555 ? 
3361 BD6 22 CLA EJ .   ? CLA b 1213 . ? 1_555 ? 
3362 BD6 22 BCR EK .   ? BCR b 4004 . ? 1_555 ? 
3363 BD6 22 ECH GK .   ? ECH b 4006 . ? 1_555 ? 
3364 BD6 22 HOH UR .   ? HOH b 8009 . ? 1_555 ? 
3365 BD7 14 TRP M  228 ? TRP b 230  . ? 1_555 ? 
3366 BD7 14 ALA M  232 ? ALA b 234  . ? 1_555 ? 
3367 BD7 14 LEU M  253 ? LEU b 255  . ? 1_555 ? 
3368 BD7 14 THR M  254 ? THR b 256  . ? 1_555 ? 
3369 BD7 14 PHE M  255 ? PHE b 257  . ? 1_555 ? 
3370 BD7 14 HIS M  273 ? HIS b 275  . ? 1_555 ? 
3371 BD7 14 LEU M  276 ? LEU b 278  . ? 1_555 ? 
3372 BD7 14 ALA M  277 ? ALA b 279  . ? 1_555 ? 
3373 BD7 14 VAL M  280 ? VAL b 282  . ? 1_555 ? 
3374 BD7 14 ILE M  284 ? ILE b 286  . ? 1_555 ? 
3375 BD7 14 CLA DJ .   ? CLA b 1212 . ? 1_555 ? 
3376 BD7 14 CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3377 BD7 14 CLA JJ .   ? CLA b 1218 . ? 1_555 ? 
3378 BD7 14 LMG MK .   ? LMG b 5005 . ? 1_555 ? 
3379 BD8 21 THR M  254 ? THR b 256  . ? 1_555 ? 
3380 BD8 21 PHE M  255 ? PHE b 257  . ? 1_555 ? 
3381 BD8 21 LEU M  266 ? LEU b 268  . ? 1_555 ? 
3382 BD8 21 ASP M  270 ? ASP b 272  . ? 1_555 ? 
3383 BD8 21 HIS M  273 ? HIS b 275  . ? 1_555 ? 
3384 BD8 21 HIS M  274 ? HIS b 276  . ? 1_555 ? 
3385 BD8 21 ALA M  277 ? ALA b 279  . ? 1_555 ? 
3386 BD8 21 ILE M  278 ? ILE b 280  . ? 1_555 ? 
3387 BD8 21 HIS M  347 ? HIS b 349  . ? 1_555 ? 
3388 BD8 21 LEU M  351 ? LEU b 353  . ? 1_555 ? 
3389 BD8 21 TRP M  488 ? TRP b 490  . ? 1_555 ? 
3390 BD8 21 TRP M  492 ? TRP b 494  . ? 1_555 ? 
3391 BD8 21 CLA EJ .   ? CLA b 1213 . ? 1_555 ? 
3392 BD8 21 CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3393 BD8 21 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3394 BD8 21 CLA MJ .   ? CLA b 1221 . ? 1_555 ? 
3395 BD8 21 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3396 BD8 21 CLA VJ .   ? CLA b 1231 . ? 1_555 ? 
3397 BD8 21 CLA WJ .   ? CLA b 1232 . ? 1_555 ? 
3398 BD8 21 LMG MK .   ? LMG b 5005 . ? 1_555 ? 
3399 BD8 21 MG  QK .   ? MG  b 6002 . ? 1_555 ? 
3400 BD9 23 TRP M  121 ? TRP b 123  . ? 1_555 ? 
3401 BD9 23 ILE M  125 ? ILE b 127  . ? 1_555 ? 
3402 BD9 23 PHE M  181 ? PHE b 183  . ? 1_555 ? 
3403 BD9 23 SER M  184 ? SER b 186  . ? 1_555 ? 
3404 BD9 23 SER M  185 ? SER b 187  . ? 1_555 ? 
3405 BD9 23 TRP M  188 ? TRP b 190  . ? 1_555 ? 
3406 BD9 23 ILE M  271 ? ILE b 273  . ? 1_555 ? 
3407 BD9 23 HIS M  274 ? HIS b 276  . ? 1_555 ? 
3408 BD9 23 HIS M  275 ? HIS b 277  . ? 1_555 ? 
3409 BD9 23 ILE M  340 ? ILE b 342  . ? 1_555 ? 
3410 BD9 23 LEU M  343 ? LEU b 345  . ? 1_555 ? 
3411 BD9 23 VAL M  344 ? VAL b 346  . ? 1_555 ? 
3412 BD9 23 MET M  348 ? MET b 350  . ? 1_555 ? 
3413 BD9 23 SER M  353 ? SER b 355  . ? 1_555 ? 
3414 BD9 23 TYR M  354 ? TYR b 356  . ? 1_555 ? 
3415 BD9 23 CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3416 BD9 23 CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3417 BD9 23 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3418 BD9 23 CLA MJ .   ? CLA b 1221 . ? 1_555 ? 
3419 BD9 23 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3420 BD9 23 CLA QJ .   ? CLA b 1225 . ? 1_555 ? 
3421 BD9 23 CLA VJ .   ? CLA b 1231 . ? 1_555 ? 
3422 BD9 23 MG  QK .   ? MG  b 6002 . ? 1_555 ? 
3423 BE1 17 LEU M  173 ? LEU b 175  . ? 1_555 ? 
3424 BE1 17 LEU M  177 ? LEU b 179  . ? 1_555 ? 
3425 BE1 17 PHE M  282 ? PHE b 284  . ? 1_555 ? 
3426 BE1 17 ALA M  285 ? ALA b 287  . ? 1_555 ? 
3427 BE1 17 MET M  288 ? MET b 290  . ? 1_555 ? 
3428 BE1 17 TYR M  289 ? TYR b 291  . ? 1_555 ? 
3429 BE1 17 ILE M  302 ? ILE b 304  . ? 1_555 ? 
3430 BE1 17 CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3431 BE1 17 CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3432 BE1 17 CLA JJ .   ? CLA b 1218 . ? 1_555 ? 
3433 BE1 17 CLA KJ .   ? CLA b 1219 . ? 1_555 ? 
3434 BE1 17 CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3435 BE1 17 CLA MJ .   ? CLA b 1221 . ? 1_555 ? 
3436 BE1 17 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3437 BE1 17 BCR HK .   ? BCR b 4010 . ? 1_555 ? 
3438 BE1 17 BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3439 BE1 17 HOH UR .   ? HOH b 8042 . ? 1_555 ? 
3440 BE2 11 ASN M  174 ? ASN b 176  . ? 1_555 ? 
3441 BE2 11 HIS M  175 ? HIS b 177  . ? 1_555 ? 
3442 BE2 11 ALA M  178 ? ALA b 180  . ? 1_555 ? 
3443 BE2 11 VAL M  183 ? VAL b 185  . ? 1_555 ? 
3444 BE2 11 HIS M  287 ? HIS b 289  . ? 1_555 ? 
3445 BE2 11 THR M  291 ? THR b 293  . ? 1_555 ? 
3446 BE2 11 TRP M  293 ? TRP b 295  . ? 1_555 ? 
3447 BE2 11 CLA AJ .   ? CLA b 1209 . ? 1_555 ? 
3448 BE2 11 BCR EK .   ? BCR b 4004 . ? 1_555 ? 
3449 BE2 11 HOH UR .   ? HOH b 8071 . ? 1_555 ? 
3450 BE2 11 HOH UR .   ? HOH b 8073 . ? 1_555 ? 
3451 BE3 10 ILE M  284 ? ILE b 286  . ? 1_555 ? 
3452 BE3 10 HIS M  287 ? HIS b 289  . ? 1_555 ? 
3453 BE3 10 MET M  288 ? MET b 290  . ? 1_555 ? 
3454 BE3 10 ILE M  295 ? ILE b 297  . ? 1_555 ? 
3455 BE3 10 GLY M  296 ? GLY b 298  . ? 1_555 ? 
3456 BE3 10 HIS M  297 ? HIS b 299  . ? 1_555 ? 
3457 BE3 10 CLA EJ .   ? CLA b 1213 . ? 1_555 ? 
3458 BE3 10 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3459 BE3 10 CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3460 BE3 10 BCR EK .   ? BCR b 4004 . ? 1_555 ? 
3461 BE4 9  MET M  288 ? MET b 290  . ? 1_555 ? 
3462 BE4 9  HIS M  297 ? HIS b 299  . ? 1_555 ? 
3463 BE4 9  ILE M  302 ? ILE b 304  . ? 1_555 ? 
3464 BE4 9  ALA M  305 ? ALA b 307  . ? 1_555 ? 
3465 BE4 9  HIS M  306 ? HIS b 308  . ? 1_555 ? 
3466 BE4 9  CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3467 BE4 9  CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3468 BE4 9  CLA CK .   ? CLA b 1240 . ? 1_555 ? 
3469 BE4 9  BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3470 BE5 13 LEU M  303 ? LEU b 305  . ? 1_555 ? 
3471 BE5 13 HIS M  306 ? HIS b 308  . ? 1_555 ? 
3472 BE5 13 HIS M  315 ? HIS b 317  . ? 1_555 ? 
3473 BE5 13 ILE M  322 ? ILE b 324  . ? 1_555 ? 
3474 BE5 13 LEU M  404 ? LEU b 406  . ? 1_555 ? 
3475 BE5 13 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3476 BE5 13 CLA JJ .   ? CLA b 1218 . ? 1_555 ? 
3477 BE5 13 CLA KJ .   ? CLA b 1219 . ? 1_555 ? 
3478 BE5 13 CLA MJ .   ? CLA b 1221 . ? 1_555 ? 
3479 BE5 13 CLA SJ .   ? CLA b 1227 . ? 1_555 ? 
3480 BE5 13 CLA CK .   ? CLA b 1240 . ? 1_555 ? 
3481 BE5 13 BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3482 BE5 13 LHG LK .   ? LHG b 5004 . ? 1_555 ? 
3483 BE6 21 ALA M  169 ? ALA b 171  . ? 1_555 ? 
3484 BE6 21 ARG M  172 ? ARG b 174  . ? 1_555 ? 
3485 BE6 21 LEU M  173 ? LEU b 175  . ? 1_555 ? 
3486 BE6 21 HIS M  176 ? HIS b 178  . ? 1_555 ? 
3487 BE6 21 ILE M  278 ? ILE b 280  . ? 1_555 ? 
3488 BE6 21 PHE M  282 ? PHE b 284  . ? 1_555 ? 
3489 BE6 21 ILE M  299 ? ILE b 301  . ? 1_555 ? 
3490 BE6 21 TYR M  319 ? TYR b 321  . ? 1_555 ? 
3491 BE6 21 ASN M  323 ? ASN b 325  . ? 1_555 ? 
3492 BE6 21 LEU M  332 ? LEU b 334  . ? 1_555 ? 
3493 BE6 21 SER M  336 ? SER b 338  . ? 1_555 ? 
3494 BE6 21 ILE M  340 ? ILE b 342  . ? 1_555 ? 
3495 BE6 21 CLA TI .   ? CLA b 1202 . ? 1_555 ? 
3496 BE6 21 CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3497 BE6 21 CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3498 BE6 21 CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3499 BE6 21 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3500 BE6 21 CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3501 BE6 21 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3502 BE6 21 HOH UR .   ? HOH b 8122 . ? 1_555 ? 
3503 BE6 21 HOH UR .   ? HOH b 8129 . ? 1_555 ? 
3504 BE7 17 SER M  342 ? SER b 344  . ? 1_555 ? 
3505 BE7 17 GLN M  346 ? GLN b 348  . ? 1_555 ? 
3506 BE7 17 GLN M  372 ? GLN b 374  . ? 1_555 ? 
3507 BE7 17 GLY M  376 ? GLY b 378  . ? 1_555 ? 
3508 BE7 17 MET M  379 ? MET b 381  . ? 1_555 ? 
3509 BE7 17 VAL M  380 ? VAL b 382  . ? 1_555 ? 
3510 BE7 17 PHE M  383 ? PHE b 385  . ? 1_555 ? 
3511 BE7 17 LEU M  522 ? LEU b 524  . ? 1_555 ? 
3512 BE7 17 THR M  525 ? THR b 527  . ? 1_555 ? 
3513 BE7 17 MET M  578 ? MET b 580  . ? 1_555 ? 
3514 BE7 17 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3515 BE7 17 CLA WJ .   ? CLA b 1232 . ? 1_555 ? 
3516 BE7 17 CLA XJ .   ? CLA b 1234 . ? 1_555 ? 
3517 BE7 17 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3518 BE7 17 BCR HK .   ? BCR b 4010 . ? 1_555 ? 
3519 BE7 17 LMG OK .   ? LMG b 5007 . ? 1_555 ? 
3520 BE7 17 HOH UR .   ? HOH b 8116 . ? 1_555 ? 
3521 BE8 18 SER M  336 ? SER b 338  . ? 1_555 ? 
3522 BE8 18 VAL M  339 ? VAL b 341  . ? 1_555 ? 
3523 BE8 18 LEU M  343 ? LEU b 345  . ? 1_555 ? 
3524 BE8 18 HIS M  347 ? HIS b 349  . ? 1_555 ? 
3525 BE8 18 SER M  350 ? SER b 352  . ? 1_555 ? 
3526 BE8 18 LEU M  503 ? LEU b 505  . ? 1_555 ? 
3527 BE8 18 PHE M  504 ? PHE b 506  . ? 1_555 ? 
3528 BE8 18 CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3529 BE8 18 CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3530 BE8 18 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3531 BE8 18 CLA MJ .   ? CLA b 1221 . ? 1_555 ? 
3532 BE8 18 CLA NJ .   ? CLA b 1222 . ? 1_555 ? 
3533 BE8 18 CLA VJ .   ? CLA b 1231 . ? 1_555 ? 
3534 BE8 18 CLA XJ .   ? CLA b 1234 . ? 1_555 ? 
3535 BE8 18 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3536 BE8 18 BCR HK .   ? BCR b 4010 . ? 1_555 ? 
3537 BE8 18 BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3538 BE8 18 LHG LK .   ? LHG b 5004 . ? 1_555 ? 
3539 BE9 16 TRP M  58  ? TRP b 60   . ? 1_555 ? 
3540 BE9 16 THR M  62  ? THR b 64   . ? 1_555 ? 
3541 BE9 16 TYR M  115 ? TYR b 117  . ? 1_555 ? 
3542 BE9 16 SER M  116 ? SER b 118  . ? 1_555 ? 
3543 BE9 16 ALA M  366 ? ALA b 368  . ? 1_555 ? 
3544 BE9 16 THR M  369 ? THR b 371  . ? 1_555 ? 
3545 BE9 16 HIS M  370 ? HIS b 372  . ? 1_555 ? 
3546 BE9 16 PHE M  377 ? PHE b 379  . ? 1_555 ? 
3547 BE9 16 MET M  644 ? MET b 646  . ? 1_555 ? 
3548 BE9 16 VAL M  713 ? VAL b 715  . ? 1_555 ? 
3549 BE9 16 ALA M  717 ? ALA b 719  . ? 1_555 ? 
3550 BE9 16 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3551 BE9 16 CLA VI .   ? CLA b 1204 . ? 1_555 ? 
3552 BE9 16 CLA WI .   ? CLA b 1205 . ? 1_555 ? 
3553 BE9 16 CLA QJ .   ? CLA b 1225 . ? 1_555 ? 
3554 BE9 16 LMG KK .   ? LMG b 5002 . ? 1_555 ? 
3555 BF1 18 TRP M  58  ? TRP b 60   . ? 1_555 ? 
3556 BF1 18 THR M  59  ? THR b 61   . ? 1_555 ? 
3557 BF1 18 SER M  116 ? SER b 118  . ? 1_555 ? 
3558 BF1 18 GLY M  117 ? GLY b 119  . ? 1_555 ? 
3559 BF1 18 TRP M  121 ? TRP b 123  . ? 1_555 ? 
3560 BF1 18 ALA M  187 ? ALA b 189  . ? 1_555 ? 
3561 BF1 18 THR M  341 ? THR b 343  . ? 1_555 ? 
3562 BF1 18 MET M  348 ? MET b 350  . ? 1_555 ? 
3563 BF1 18 TYR M  354 ? TYR b 356  . ? 1_555 ? 
3564 BF1 18 HIS M  370 ? HIS b 372  . ? 1_555 ? 
3565 BF1 18 HIS M  371 ? HIS b 373  . ? 1_555 ? 
3566 BF1 18 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3567 BF1 18 CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3568 BF1 18 CLA CJ .   ? CLA b 1211 . ? 1_555 ? 
3569 BF1 18 CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3570 BF1 18 CLA PJ .   ? CLA b 1224 . ? 1_555 ? 
3571 BF1 18 BCR FK .   ? BCR b 4005 . ? 1_555 ? 
3572 BF1 18 ECH GK .   ? ECH b 4006 . ? 1_555 ? 
3573 BF2 22 ILE M  23  ? ILE b 25   . ? 1_555 ? 
3574 BF2 22 ALA M  24  ? ALA b 26   . ? 1_555 ? 
3575 BF2 22 ALA M  26  ? ALA b 28   . ? 1_555 ? 
3576 BF2 22 HIS M  27  ? HIS b 29   . ? 1_555 ? 
3577 BF2 22 ASP M  28  ? ASP b 30   . ? 1_555 ? 
3578 BF2 22 LEU M  330 ? LEU b 332  . ? 1_555 ? 
3579 BF2 22 LEU M  334 ? LEU b 336  . ? 1_555 ? 
3580 BF2 22 PHE M  377 ? PHE b 379  . ? 1_555 ? 
3581 BF2 22 GLY M  381 ? GLY b 383  . ? 1_555 ? 
3582 BF2 22 HIS M  385 ? HIS b 387  . ? 1_555 ? 
3583 BF2 22 ILE M  388 ? ILE b 390  . ? 1_555 ? 
3584 BF2 22 ARG M  392 ? ARG b 394  . ? 1_555 ? 
3585 BF2 22 TYR M  550 ? TYR b 552  . ? 1_555 ? 
3586 BF2 22 TRP M  568 ? TRP b 570  . ? 1_555 ? 
3587 BF2 22 PHE M  571 ? PHE b 573  . ? 1_555 ? 
3588 BF2 22 PHE M  647 ? PHE b 649  . ? 1_555 ? 
3589 BF2 22 CLA TK .   ? CLA b 1201 . ? 1_555 ? 
3590 BF2 22 CLA TI .   ? CLA b 1202 . ? 1_555 ? 
3591 BF2 22 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3592 BF2 22 CLA BK .   ? CLA b 1239 . ? 1_555 ? 
3593 BF2 22 LMG KK .   ? LMG b 5002 . ? 1_555 ? 
3594 BF2 22 HOH UR .   ? HOH b 8095 . ? 1_555 ? 
3595 BF3 14 LEU M  310 ? LEU b 312  . ? 1_555 ? 
3596 BF3 14 THR M  311 ? THR b 313  . ? 1_555 ? 
3597 BF3 14 VAL M  403 ? VAL b 405  . ? 1_555 ? 
3598 BF3 14 ARG M  406 ? ARG b 408  . ? 1_555 ? 
3599 BF3 14 MET M  407 ? MET b 409  . ? 1_555 ? 
3600 BF3 14 HIS M  410 ? HIS b 412  . ? 1_555 ? 
3601 BF3 14 LEU M  414 ? LEU b 416  . ? 1_555 ? 
3602 BF3 14 HIS M  417 ? HIS b 419  . ? 1_555 ? 
3603 BF3 14 CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3604 BF3 14 CLA TJ .   ? CLA b 1228 . ? 1_555 ? 
3605 BF3 14 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3606 BF3 14 BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3607 BF3 14 LHG LK .   ? LHG b 5004 . ? 1_555 ? 
3608 BF3 14 SQD ZK .   ? SQD f 5001 . ? 1_555 ? 
3609 BF4 17 ALA L  703 ? ALA a 703  . ? 1_555 ? 
3610 BF4 17 LYS L  706 ? LYS a 706  . ? 1_555 ? 
3611 BF4 17 LEU L  707 ? LEU a 707  . ? 1_555 ? 
3612 BF4 17 ALA M  413 ? ALA b 415  . ? 1_555 ? 
3613 BF4 17 HIS M  417 ? HIS b 419  . ? 1_555 ? 
3614 BF4 17 TRP M  420 ? TRP b 422  . ? 1_555 ? 
3615 BF4 17 CLA SJ .   ? CLA b 1227 . ? 1_555 ? 
3616 BF4 17 CLA UJ .   ? CLA b 1229 . ? 1_555 ? 
3617 BF4 17 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3618 BF4 17 LHG LK .   ? LHG b 5004 . ? 1_555 ? 
3619 BF4 17 VAL Q  123 ? VAL f 123  . ? 1_555 ? 
3620 BF4 17 LEU Q  131 ? LEU f 131  . ? 1_555 ? 
3621 BF4 17 VAL Q  132 ? VAL f 132  . ? 1_555 ? 
3622 BF4 17 ASP Q  135 ? ASP f 135  . ? 1_555 ? 
3623 BF4 17 CLA XK .   ? CLA f 1302 . ? 1_555 ? 
3624 BF4 17 BCR YK .   ? BCR f 4016 . ? 1_555 ? 
3625 BF4 17 SQD ZK .   ? SQD f 5001 . ? 1_555 ? 
3626 BF5 17 CLA HI .   ? CLA a 1138 . ? 1_555 ? 
3627 BF5 17 TRP M  420 ? TRP b 422  . ? 1_555 ? 
3628 BF5 17 LEU M  423 ? LEU b 425  . ? 1_555 ? 
3629 BF5 17 PHE M  424 ? PHE b 426  . ? 1_555 ? 
3630 BF5 17 HIS M  428 ? HIS b 430  . ? 1_555 ? 
3631 BF5 17 CLA TJ .   ? CLA b 1228 . ? 1_555 ? 
3632 BF5 17 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
3633 BF5 17 CLA YJ .   ? CLA b 1235 . ? 1_555 ? 
3634 BF5 17 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
3635 BF5 17 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
3636 BF5 17 PHE Q  65  ? PHE f 65   . ? 1_555 ? 
3637 BF5 17 SER Q  69  ? SER f 69   . ? 1_555 ? 
3638 BF5 17 PHE Q  72  ? PHE f 72   . ? 1_555 ? 
3639 BF5 17 LEU Q  73  ? LEU f 73   . ? 1_555 ? 
3640 BF5 17 ALA Q  76  ? ALA f 76   . ? 1_555 ? 
3641 BF5 17 BCR YK .   ? BCR f 4016 . ? 1_555 ? 
3642 BF5 17 HOH YR .   ? HOH f 8002 . ? 1_555 ? 
3643 BF6 13 SER M  463 ? SER b 465  . ? 1_555 ? 
3644 BF6 13 LEU M  473 ? LEU b 475  . ? 1_555 ? 
3645 BF6 13 LEU M  474 ? LEU b 476  . ? 1_555 ? 
3646 BF6 13 TRP M  488 ? TRP b 490  . ? 1_555 ? 
3647 BF6 13 TRP M  492 ? TRP b 494  . ? 1_555 ? 
3648 BF6 13 CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3649 BF6 13 CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3650 BF6 13 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3651 BF6 13 CLA WJ .   ? CLA b 1232 . ? 1_555 ? 
3652 BF6 13 CLA XJ .   ? CLA b 1234 . ? 1_555 ? 
3653 BF6 13 BCR HK .   ? BCR b 4010 . ? 1_555 ? 
3654 BF6 13 HOH UR .   ? HOH b 8002 . ? 1_555 ? 
3655 BF6 13 HOH UR .   ? HOH b 8097 . ? 1_555 ? 
3656 BF7 10 LEU M  473 ? LEU b 475  . ? 1_555 ? 
3657 BF7 10 ILE M  480 ? ILE b 482  . ? 1_555 ? 
3658 BF7 10 ALA M  481 ? ALA b 483  . ? 1_555 ? 
3659 BF7 10 THR M  484 ? THR b 486  . ? 1_555 ? 
3660 BF7 10 CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3661 BF7 10 CLA NJ .   ? CLA b 1222 . ? 1_555 ? 
3662 BF7 10 CLA VJ .   ? CLA b 1231 . ? 1_555 ? 
3663 BF7 10 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3664 BF7 10 BCR HK .   ? BCR b 4010 . ? 1_555 ? 
3665 BF7 10 HOH UR .   ? HOH b 8097 . ? 1_555 ? 
3666 BF8 20 GLN M  346 ? GLN b 348  . ? 1_555 ? 
3667 BF8 20 TYR M  349 ? TYR b 351  . ? 1_555 ? 
3668 BF8 20 TYR M  368 ? TYR b 370  . ? 1_555 ? 
3669 BF8 20 ILE M  459 ? ILE b 461  . ? 1_555 ? 
3670 BF8 20 GLN M  460 ? GLN b 462  . ? 1_555 ? 
3671 BF8 20 PHE M  504 ? PHE b 506  . ? 1_555 ? 
3672 BF8 20 LEU M  505 ? LEU b 507  . ? 1_555 ? 
3673 BF8 20 HIS M  515 ? HIS b 517  . ? 1_555 ? 
3674 BF8 20 ILE M  518 ? ILE b 520  . ? 1_555 ? 
3675 BF8 20 LEU M  522 ? LEU b 524  . ? 1_555 ? 
3676 BF8 20 LEU M  585 ? LEU b 587  . ? 1_555 ? 
3677 BF8 20 TYR M  588 ? TYR b 590  . ? 1_555 ? 
3678 BF8 20 TRP M  589 ? TRP b 591  . ? 1_555 ? 
3679 BF8 20 HIS M  593 ? HIS b 595  . ? 1_555 ? 
3680 BF8 20 CLA NJ .   ? CLA b 1222 . ? 1_555 ? 
3681 BF8 20 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3682 BF8 20 CLA VJ .   ? CLA b 1231 . ? 1_555 ? 
3683 BF8 20 CLA YJ .   ? CLA b 1235 . ? 1_555 ? 
3684 BF8 20 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3685 BF8 20 CLA XK .   ? CLA f 1302 . ? 1_555 ? 
3686 BF9 17 LEU M  425 ? LEU b 427  . ? 1_555 ? 
3687 BF9 17 GLU M  452 ? GLU b 454  . ? 1_555 ? 
3688 BF9 17 PRO M  453 ? PRO b 455  . ? 1_555 ? 
3689 BF9 17 VAL M  454 ? VAL b 456  . ? 1_555 ? 
3690 BF9 17 PHE M  455 ? PHE b 457  . ? 1_555 ? 
3691 BF9 17 ALA M  456 ? ALA b 458  . ? 1_555 ? 
3692 BF9 17 PHE M  512 ? PHE b 514  . ? 1_555 ? 
3693 BF9 17 HIS M  515 ? HIS b 517  . ? 1_555 ? 
3694 BF9 17 HIS M  516 ? HIS b 518  . ? 1_555 ? 
3695 BF9 17 HIS M  523 ? HIS b 525  . ? 1_555 ? 
3696 BF9 17 CLA UJ .   ? CLA b 1229 . ? 1_555 ? 
3697 BF9 17 CLA XJ .   ? CLA b 1234 . ? 1_555 ? 
3698 BF9 17 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3699 BF9 17 PHE Q  65  ? PHE f 65   . ? 1_555 ? 
3700 BF9 17 SER Q  69  ? SER f 69   . ? 1_555 ? 
3701 BF9 17 BCR YK .   ? BCR f 4016 . ? 1_555 ? 
3702 BF9 17 ZEX DL .   ? ZEX j 4015 . ? 1_555 ? 
3703 BG1 17 LEU M  414 ? LEU b 416  . ? 1_555 ? 
3704 BG1 17 LEU M  418 ? LEU b 420  . ? 1_555 ? 
3705 BG1 17 TRP M  420 ? TRP b 422  . ? 1_555 ? 
3706 BG1 17 VAL M  421 ? VAL b 423  . ? 1_555 ? 
3707 BG1 17 ALA M  519 ? ALA b 521  . ? 1_555 ? 
3708 BG1 17 LEU M  522 ? LEU b 524  . ? 1_555 ? 
3709 BG1 17 HIS M  523 ? HIS b 525  . ? 1_555 ? 
3710 BG1 17 CLA NJ .   ? CLA b 1222 . ? 1_555 ? 
3711 BG1 17 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3712 BG1 17 CLA SJ .   ? CLA b 1227 . ? 1_555 ? 
3713 BG1 17 CLA TJ .   ? CLA b 1228 . ? 1_555 ? 
3714 BG1 17 CLA WJ .   ? CLA b 1232 . ? 1_555 ? 
3715 BG1 17 CLA XJ .   ? CLA b 1234 . ? 1_555 ? 
3716 BG1 17 CLA YJ .   ? CLA b 1235 . ? 1_555 ? 
3717 BG1 17 BCR HK .   ? BCR b 4010 . ? 1_555 ? 
3718 BG1 17 LHG LK .   ? LHG b 5004 . ? 1_555 ? 
3719 BG1 17 LMG OK .   ? LMG b 5007 . ? 1_555 ? 
3720 BG2 22 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
3721 BG2 22 ILE M  19  ? ILE b 21   . ? 1_555 ? 
3722 BG2 22 TRP M  20  ? TRP b 22   . ? 1_555 ? 
3723 BG2 22 ILE M  673 ? ILE b 675  . ? 1_555 ? 
3724 BG2 22 HIS M  677 ? HIS b 679  . ? 1_555 ? 
3725 BG2 22 VAL M  686 ? VAL b 688  . ? 1_555 ? 
3726 BG2 22 ARG M  687 ? ARG b 689  . ? 1_555 ? 
3727 BG2 22 TRP M  688 ? TRP b 690  . ? 1_555 ? 
3728 BG2 22 LYS M  689 ? LYS b 691  . ? 1_555 ? 
3729 BG2 22 PRO M  692 ? PRO b 694  . ? 1_555 ? 
3730 BG2 22 LEU M  695 ? LEU b 697  . ? 1_555 ? 
3731 BG2 22 CLA OI .   ? CLA b 1237 . ? 1_555 ? 
3732 BG2 22 HOH UR .   ? HOH b 8034 . ? 1_555 ? 
3733 BG2 22 HOH UR .   ? HOH b 8040 . ? 1_555 ? 
3734 BG2 22 PHE R  31  ? PHE i 31   . ? 1_555 ? 
3735 BG2 22 GLU R  35  ? GLU i 35   . ? 1_555 ? 
3736 BG2 22 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
3737 BG2 22 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
3738 BG2 22 TYR U  99  ? TYR l 99   . ? 1_555 ? 
3739 BG2 22 VAL U  102 ? VAL l 102  . ? 1_555 ? 
3740 BG2 22 THR U  103 ? THR l 103  . ? 1_555 ? 
3741 BG2 22 BCR NL .   ? BCR l 4019 . ? 1_555 ? 
3742 BG3 14 PHE M  647 ? PHE b 649  . ? 1_555 ? 
3743 BG3 14 VAL M  651 ? VAL b 653  . ? 1_555 ? 
3744 BG3 14 THR M  654 ? THR b 656  . ? 1_555 ? 
3745 BG3 14 PHE M  658 ? PHE b 660  . ? 1_555 ? 
3746 BG3 14 VAL M  703 ? VAL b 705  . ? 1_555 ? 
3747 BG3 14 HIS M  707 ? HIS b 709  . ? 1_555 ? 
3748 BG3 14 CLA SI .   ? CLA b 1023 . ? 1_555 ? 
3749 BG3 14 CLA RJ .   ? CLA b 1226 . ? 1_555 ? 
3750 BG3 14 PQN DK .   ? PQN b 2002 . ? 1_555 ? 
3751 BG3 14 BCR IK .   ? BCR b 4017 . ? 1_555 ? 
3752 BG3 14 LMG KK .   ? LMG b 5002 . ? 1_555 ? 
3753 BG3 14 HOH UR .   ? HOH b 8057 . ? 1_555 ? 
3754 BG3 14 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
3755 BG3 14 SER U  98  ? SER l 98   . ? 1_555 ? 
3756 BG4 9  LYS M  307 ? LYS b 309  . ? 1_555 ? 
3757 BG4 9  PRO M  309 ? PRO b 311  . ? 1_555 ? 
3758 BG4 9  LEU M  310 ? LEU b 312  . ? 1_555 ? 
3759 BG4 9  ARG M  406 ? ARG b 408  . ? 1_555 ? 
3760 BG4 9  CLA KJ .   ? CLA b 1219 . ? 1_555 ? 
3761 BG4 9  CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3762 BG4 9  BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3763 BG4 9  LHG LK .   ? LHG b 5004 . ? 1_555 ? 
3764 BG4 9  SQD ZK .   ? SQD f 5001 . ? 1_555 ? 
3765 BG5 12 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
3766 BG5 12 MET M  657 ? MET b 659  . ? 1_555 ? 
3767 BG5 12 PHE M  658 ? PHE b 660  . ? 1_555 ? 
3768 BG5 12 SER M  661 ? SER b 663  . ? 1_555 ? 
3769 BG5 12 ARG M  663 ? ARG b 665  . ? 1_555 ? 
3770 BG5 12 TRP M  666 ? TRP b 668  . ? 1_555 ? 
3771 BG5 12 ILE M  670 ? ILE b 672  . ? 1_555 ? 
3772 BG5 12 ALA M  694 ? ALA b 696  . ? 1_555 ? 
3773 BG5 12 LEU M  695 ? LEU b 697  . ? 1_555 ? 
3774 BG5 12 ALA M  700 ? ALA b 702  . ? 1_555 ? 
3775 BG5 12 CLA BK .   ? CLA b 1239 . ? 1_555 ? 
3776 BG5 12 BCR NL .   ? BCR l 4019 . ? 1_555 ? 
3777 BG6 8  PHE M  223 ? PHE b 225  . ? 1_555 ? 
3778 BG6 8  LEU M  276 ? LEU b 278  . ? 1_555 ? 
3779 BG6 8  ILE M  283 ? ILE b 285  . ? 1_555 ? 
3780 BG6 8  HIS M  287 ? HIS b 289  . ? 1_555 ? 
3781 BG6 8  CLA DJ .   ? CLA b 1212 . ? 1_555 ? 
3782 BG6 8  CLA IJ .   ? CLA b 1217 . ? 1_555 ? 
3783 BG6 8  CLA JJ .   ? CLA b 1218 . ? 1_555 ? 
3784 BG6 8  ECH GK .   ? ECH b 4006 . ? 1_555 ? 
3785 BG7 9  ILE M  55  ? ILE b 57   . ? 1_555 ? 
3786 BG7 9  PHE M  147 ? PHE b 149  . ? 1_555 ? 
3787 BG7 9  GLY M  179 ? GLY b 181  . ? 1_555 ? 
3788 BG7 9  SER M  184 ? SER b 186  . ? 1_555 ? 
3789 BG7 9  CLA TI .   ? CLA b 1202 . ? 1_555 ? 
3790 BG7 9  CLA ZI .   ? CLA b 1208 . ? 1_555 ? 
3791 BG7 9  CLA AJ .   ? CLA b 1209 . ? 1_555 ? 
3792 BG7 9  CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3793 BG7 9  CLA QJ .   ? CLA b 1225 . ? 1_555 ? 
3794 BG8 10 THR M  59  ? THR b 61   . ? 1_555 ? 
3795 BG8 10 LEU M  63  ? LEU b 65   . ? 1_555 ? 
3796 BG8 10 PHE M  122 ? PHE b 124  . ? 1_555 ? 
3797 BG8 10 MET M  127 ? MET b 129  . ? 1_555 ? 
3798 BG8 10 GLY M  136 ? GLY b 138  . ? 1_555 ? 
3799 BG8 10 PHE M  139 ? PHE b 141  . ? 1_555 ? 
3800 BG8 10 CLA CJ .   ? CLA b 1211 . ? 1_555 ? 
3801 BG8 10 CLA DJ .   ? CLA b 1212 . ? 1_555 ? 
3802 BG8 10 CLA QJ .   ? CLA b 1225 . ? 1_555 ? 
3803 BG8 10 BCR EK .   ? BCR b 4004 . ? 1_555 ? 
3804 BG9 16 PHE M  328 ? PHE b 330  . ? 1_555 ? 
3805 BG9 16 LEU M  332 ? LEU b 334  . ? 1_555 ? 
3806 BG9 16 ALA M  335 ? ALA b 337  . ? 1_555 ? 
3807 BG9 16 MET M  379 ? MET b 381  . ? 1_555 ? 
3808 BG9 16 ALA M  382 ? ALA b 384  . ? 1_555 ? 
3809 BG9 16 PHE M  383 ? PHE b 385  . ? 1_555 ? 
3810 BG9 16 GLY M  386 ? GLY b 388  . ? 1_555 ? 
3811 BG9 16 PHE M  389 ? PHE b 391  . ? 1_555 ? 
3812 BG9 16 PHE M  390 ? PHE b 392  . ? 1_555 ? 
3813 BG9 16 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3814 BG9 16 CLA NJ .   ? CLA b 1222 . ? 1_555 ? 
3815 BG9 16 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3816 BG9 16 CLA VJ .   ? CLA b 1231 . ? 1_555 ? 
3817 BG9 16 CLA WJ .   ? CLA b 1232 . ? 1_555 ? 
3818 BG9 16 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3819 BG9 16 BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3820 BH1 8  CLA NI .   ? CLA b 1022 . ? 1_555 ? 
3821 BH1 8  CLA JH .   ? CLA a 1131 . ? 1_555 ? 
3822 BH1 8  TRP M  643 ? TRP b 645  . ? 1_555 ? 
3823 BH1 8  PHE M  647 ? PHE b 649  . ? 1_555 ? 
3824 BH1 8  CLA SI .   ? CLA b 1023 . ? 1_555 ? 
3825 BH1 8  CLA XI .   ? CLA b 1206 . ? 1_555 ? 
3826 BH1 8  CLA OI .   ? CLA b 1237 . ? 1_555 ? 
3827 BH1 8  CLA BK .   ? CLA b 1239 . ? 1_555 ? 
3828 BH2 10 MET M  407 ? MET b 409  . ? 1_555 ? 
3829 BH2 10 ILE M  530 ? ILE b 532  . ? 1_555 ? 
3830 BH2 10 CLA HJ .   ? CLA b 1216 . ? 1_555 ? 
3831 BH2 10 CLA KJ .   ? CLA b 1219 . ? 1_555 ? 
3832 BH2 10 CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3833 BH2 10 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3834 BH2 10 CLA SJ .   ? CLA b 1227 . ? 1_555 ? 
3835 BH2 10 CLA CK .   ? CLA b 1240 . ? 1_555 ? 
3836 BH2 10 BCR HK .   ? BCR b 4010 . ? 1_555 ? 
3837 BH2 10 LHG LK .   ? LHG b 5004 . ? 1_555 ? 
3838 BH3 21 TRP M  20  ? TRP b 22   . ? 1_555 ? 
3839 BH3 21 TYR M  21  ? TYR b 23   . ? 1_555 ? 
3840 BH3 21 ALA M  24  ? ALA b 26   . ? 1_555 ? 
3841 BH3 21 THR M  25  ? THR b 27   . ? 1_555 ? 
3842 BH3 21 SER M  551 ? SER b 553  . ? 1_555 ? 
3843 BH3 21 TRP M  568 ? TRP b 570  . ? 1_555 ? 
3844 BH3 21 PHE M  571 ? PHE b 573  . ? 1_555 ? 
3845 BH3 21 SER M  696 ? SER b 698  . ? 1_555 ? 
3846 BH3 21 GLN M  699 ? GLN b 701  . ? 1_555 ? 
3847 BH3 21 LEU M  702 ? LEU b 704  . ? 1_555 ? 
3848 BH3 21 VAL M  710 ? VAL b 712  . ? 1_555 ? 
3849 BH3 21 CLA TK .   ? CLA b 1201 . ? 1_555 ? 
3850 BH3 21 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3851 BH3 21 CLA XI .   ? CLA b 1206 . ? 1_555 ? 
3852 BH3 21 CLA PJ .   ? CLA b 1224 . ? 1_555 ? 
3853 BH3 21 CLA RJ .   ? CLA b 1226 . ? 1_555 ? 
3854 BH3 21 CLA BK .   ? CLA b 1239 . ? 1_555 ? 
3855 BH3 21 HOH UR .   ? HOH b 8047 . ? 1_555 ? 
3856 BH3 21 HOH UR .   ? HOH b 8058 . ? 1_555 ? 
3857 BH3 21 HOH UR .   ? HOH b 8079 . ? 1_555 ? 
3858 BH3 21 HOH UR .   ? HOH b 8100 . ? 1_555 ? 
3859 BH4 14 HIS M  306 ? HIS b 308  . ? 1_555 ? 
3860 BH4 14 LYS M  307 ? LYS b 309  . ? 1_555 ? 
3861 BH4 14 GLY M  308 ? GLY b 310  . ? 1_555 ? 
3862 BH4 14 PRO M  309 ? PRO b 311  . ? 1_555 ? 
3863 BH4 14 LEU M  310 ? LEU b 312  . ? 1_555 ? 
3864 BH4 14 THR M  311 ? THR b 313  . ? 1_555 ? 
3865 BH4 14 HIS M  315 ? HIS b 317  . ? 1_555 ? 
3866 BH4 14 CLA LJ .   ? CLA b 1220 . ? 1_555 ? 
3867 BH4 14 CLA OJ .   ? CLA b 1223 . ? 1_555 ? 
3868 BH4 14 CLA SJ .   ? CLA b 1227 . ? 1_555 ? 
3869 BH4 14 CLA TJ .   ? CLA b 1228 . ? 1_555 ? 
3870 BH4 14 CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3871 BH4 14 CLA CK .   ? CLA b 1240 . ? 1_555 ? 
3872 BH4 14 BCR JK .   ? BCR b 4018 . ? 1_555 ? 
3873 BH5 5  TRP M  228 ? TRP b 230  . ? 1_555 ? 
3874 BH5 5  GLY M  485 ? GLY b 487  . ? 1_555 ? 
3875 BH5 5  ALA M  487 ? ALA b 489  . ? 1_555 ? 
3876 BH5 5  CLA EJ .   ? CLA b 1213 . ? 1_555 ? 
3877 BH5 5  CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3878 BH6 6  CLA MC .   ? CLA A 1801 . ? 1_555 ? 
3879 BH6 6  LHG NC .   ? LHG A 5005 . ? 1_555 ? 
3880 BH6 6  LHG OC .   ? LHG A 5007 . ? 1_555 ? 
3881 BH6 6  CLA ZI .   ? CLA b 1208 . ? 1_555 ? 
3882 BH6 6  CLA BJ .   ? CLA b 1210 . ? 1_555 ? 
3883 BH6 6  CLA CJ .   ? CLA b 1211 . ? 1_555 ? 
3884 BH7 8  TRP M  458 ? TRP b 460  . ? 1_555 ? 
3885 BH7 8  VAL M  472 ? VAL b 474  . ? 1_555 ? 
3886 BH7 8  LEU M  473 ? LEU b 475  . ? 1_555 ? 
3887 BH7 8  ASN M  476 ? ASN b 478  . ? 1_555 ? 
3888 BH7 8  SER M  479 ? SER b 481  . ? 1_555 ? 
3889 BH7 8  ILE M  480 ? ILE b 482  . ? 1_555 ? 
3890 BH7 8  CLA NJ .   ? CLA b 1222 . ? 1_555 ? 
3891 BH7 8  CLA ZJ .   ? CLA b 1236 . ? 1_555 ? 
3892 BH8 7  GLU M  132 ? GLU b 134  . ? 1_555 ? 
3893 BH8 7  GLU M  199 ? GLU b 201  . ? 1_555 ? 
3894 BH8 7  HIS M  204 ? HIS b 206  . ? 1_555 ? 
3895 BH8 7  HOH UR .   ? HOH b 8017 . ? 1_555 ? 
3896 BH8 7  HOH UR .   ? HOH b 8022 . ? 1_555 ? 
3897 BH8 7  HOH UR .   ? HOH b 8088 . ? 1_555 ? 
3898 BH8 7  HOH UR .   ? HOH b 8103 . ? 1_555 ? 
3899 BH9 5  LEU M  351 ? LEU b 353  . ? 1_555 ? 
3900 BH9 5  PRO M  352 ? PRO b 354  . ? 1_555 ? 
3901 BH9 5  SER M  353 ? SER b 355  . ? 1_555 ? 
3902 BH9 5  CLA FJ .   ? CLA b 1214 . ? 1_555 ? 
3903 BH9 5  CLA GJ .   ? CLA b 1215 . ? 1_555 ? 
3904 BI1 14 CLA GG .   ? CLA a 1013 . ? 1_555 ? 
3905 BI1 14 CLA II .   ? CLA a 1101 . ? 1_555 ? 
3906 BI1 14 CLA HI .   ? CLA a 1138 . ? 1_555 ? 
3907 BI1 14 CLA PH .   ? CLA a 1139 . ? 1_555 ? 
3908 BI1 14 PQN SH .   ? PQN a 2001 . ? 1_555 ? 
3909 BI1 14 PHE M  427 ? PHE b 429  . ? 1_555 ? 
3910 BI1 14 CLA UJ .   ? CLA b 1229 . ? 1_555 ? 
3911 BI1 14 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
3912 BI1 14 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
3913 BI1 14 LEU Q  71  ? LEU f 71   . ? 1_555 ? 
3914 BI1 14 PHE Q  72  ? PHE f 72   . ? 1_555 ? 
3915 BI1 14 ILE Q  75  ? ILE f 75   . ? 1_555 ? 
3916 BI1 14 CLA WK .   ? CLA f 1301 . ? 1_555 ? 
3917 BI1 14 ZEX DL .   ? ZEX j 4015 . ? 1_555 ? 
3918 BI2 19 VAL L  121 ? VAL a 121  . ? 1_555 ? 
3919 BI2 19 CLA MG .   ? CLA a 1107 . ? 1_555 ? 
3920 BI2 19 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
3921 BI2 19 GLY M  431 ? GLY b 433  . ? 1_555 ? 
3922 BI2 19 HIS M  435 ? HIS b 437  . ? 1_555 ? 
3923 BI2 19 LYS M  447 ? LYS b 449  . ? 1_555 ? 
3924 BI2 19 ILE M  449 ? ILE b 451  . ? 1_555 ? 
3925 BI2 19 CLA MI .   ? CLA a 1012 . ? 1_555 ? 
3926 BI2 19 CLA UJ .   ? CLA b 1229 . ? 1_555 ? 
3927 BI2 19 ECH PI .   ? ECH b 4011 . ? 1_555 ? 
3928 BI2 19 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
3929 BI2 19 TYR Q  40  ? TYR f 40   . ? 1_555 ? 
3930 BI2 19 LEU Q  71  ? LEU f 71   . ? 1_555 ? 
3931 BI2 19 CLA WK .   ? CLA f 1301 . ? 1_555 ? 
3932 BI2 19 ASN S  30  ? ASN j 30   . ? 1_555 ? 
3933 BI2 19 ASP S  35  ? ASP j 35   . ? 1_555 ? 
3934 BI2 19 LEU S  36  ? LEU j 36   . ? 1_555 ? 
3935 BI2 19 LEU S  37  ? LEU j 37   . ? 1_555 ? 
3936 BI2 19 ZEX DL .   ? ZEX j 4015 . ? 1_555 ? 
3937 BI3 18 SQD CG .   ? SQD L 5002 . ? 1_555 ? 
3938 BI3 18 PHE M  6   ? PHE b 8    . ? 1_555 ? 
3939 BI3 18 GLY M  22  ? GLY b 24   . ? 1_555 ? 
3940 BI3 18 ALA M  26  ? ALA b 28   . ? 1_555 ? 
3941 BI3 18 HIS M  27  ? HIS b 29   . ? 1_555 ? 
3942 BI3 18 SER M  47  ? SER b 49   . ? 1_555 ? 
3943 BI3 18 ILE M  54  ? ILE b 56   . ? 1_555 ? 
3944 BI3 18 CLA TI .   ? CLA b 1202 . ? 1_555 ? 
3945 BI3 18 CLA UI .   ? CLA b 1203 . ? 1_555 ? 
3946 BI3 18 CLA RJ .   ? CLA b 1226 . ? 1_555 ? 
3947 BI3 18 LMG KK .   ? LMG b 5002 . ? 1_555 ? 
3948 BI3 18 MET R  17  ? MET i 17   . ? 1_555 ? 
3949 BI3 18 BCR NL .   ? BCR l 4019 . ? 1_555 ? 
3950 BI3 18 ALA V  22  ? ALA m 22   . ? 1_555 ? 
3951 BI3 18 PHE V  23  ? PHE m 23   . ? 1_555 ? 
3952 BI3 18 SER V  26  ? SER m 26   . ? 1_555 ? 
3953 BI3 18 LEU V  29  ? LEU m 29   . ? 1_555 ? 
3954 BI3 18 TYR V  30  ? TYR m 30   . ? 1_555 ? 
3955 BI4 11 CYS N  21  ? CYS c 21   . ? 1_555 ? 
3956 BI4 11 PRO N  22  ? PRO c 22   . ? 1_555 ? 
3957 BI4 11 VAL N  25  ? VAL c 25   . ? 1_555 ? 
3958 BI4 11 CYS N  48  ? CYS c 48   . ? 1_555 ? 
3959 BI4 11 VAL N  49  ? VAL c 49   . ? 1_555 ? 
3960 BI4 11 GLY N  50  ? GLY c 50   . ? 1_555 ? 
3961 BI4 11 CYS N  51  ? CYS c 51   . ? 1_555 ? 
3962 BI4 11 LYS N  52  ? LYS c 52   . ? 1_555 ? 
3963 BI4 11 ARG N  53  ? ARG c 53   . ? 1_555 ? 
3964 BI4 11 CYS N  54  ? CYS c 54   . ? 1_555 ? 
3965 BI4 11 VAL N  67  ? VAL c 67   . ? 1_555 ? 
3966 BI5 9  CYS N  11  ? CYS c 11   . ? 1_555 ? 
3967 BI5 9  ILE N  12  ? ILE c 12   . ? 1_555 ? 
3968 BI5 9  CYS N  14  ? CYS c 14   . ? 1_555 ? 
3969 BI5 9  THR N  15  ? THR c 15   . ? 1_555 ? 
3970 BI5 9  CYS N  17  ? CYS c 17   . ? 1_555 ? 
3971 BI5 9  CYS N  58  ? CYS c 58   . ? 1_555 ? 
3972 BI5 9  THR N  60  ? THR c 60   . ? 1_555 ? 
3973 BI5 9  SER N  64  ? SER c 64   . ? 1_555 ? 
3974 BI5 9  ILE N  65  ? ILE c 65   . ? 1_555 ? 
3975 BI6 12 CLA HI .   ? CLA a 1138 . ? 1_555 ? 
3976 BI6 12 CLA PH .   ? CLA a 1139 . ? 1_555 ? 
3977 BI6 12 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
3978 BI6 12 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
3979 BI6 12 ILE Q  75  ? ILE f 75   . ? 1_555 ? 
3980 BI6 12 TRP Q  78  ? TRP f 78   . ? 1_555 ? 
3981 BI6 12 ILE Q  79  ? ILE f 79   . ? 1_555 ? 
3982 BI6 12 VAL Q  82  ? VAL f 82   . ? 1_555 ? 
3983 BI6 12 MET Q  112 ? MET f 112  . ? 1_555 ? 
3984 BI6 12 LEU S  18  ? LEU j 18   . ? 1_555 ? 
3985 BI6 12 THR S  22  ? THR j 22   . ? 1_555 ? 
3986 BI6 12 HOH AS .   ? HOH j 8001 . ? 1_555 ? 
3987 BI7 9  PHE M  455 ? PHE b 457  . ? 1_555 ? 
3988 BI7 9  TRP M  458 ? TRP b 460  . ? 1_555 ? 
3989 BI7 9  CLA TJ .   ? CLA b 1228 . ? 1_555 ? 
3990 BI7 9  CLA XJ .   ? CLA b 1234 . ? 1_555 ? 
3991 BI7 9  ASP Q  56  ? ASP f 56   . ? 1_555 ? 
3992 BI7 9  GLY Q  57  ? GLY f 57   . ? 1_555 ? 
3993 BI7 9  ARG Q  58  ? ARG f 58   . ? 1_555 ? 
3994 BI7 9  PHE Q  59  ? PHE f 59   . ? 1_555 ? 
3995 BI7 9  BCR YK .   ? BCR f 4016 . ? 1_555 ? 
3996 BI8 8  CLA HI .   ? CLA a 1138 . ? 1_555 ? 
3997 BI8 8  CLA TJ .   ? CLA b 1228 . ? 1_555 ? 
3998 BI8 8  CLA UJ .   ? CLA b 1229 . ? 1_555 ? 
3999 BI8 8  CLA YJ .   ? CLA b 1235 . ? 1_555 ? 
4000 BI8 8  VAL Q  55  ? VAL f 55   . ? 1_555 ? 
4001 BI8 8  GLY Q  80  ? GLY f 80   . ? 1_555 ? 
4002 BI8 8  TRP Q  81  ? TRP f 81   . ? 1_555 ? 
4003 BI8 8  CLA XK .   ? CLA f 1302 . ? 1_555 ? 
4004 BI9 15 LYS L  706 ? LYS a 706  . ? 1_555 ? 
4005 BI9 15 LEU M  310 ? LEU b 312  . ? 1_555 ? 
4006 BI9 15 PRO M  396 ? PRO b 398  . ? 1_555 ? 
4007 BI9 15 LYS M  400 ? LYS b 402  . ? 1_555 ? 
4008 BI9 15 ASP M  401 ? ASP b 403  . ? 1_555 ? 
4009 BI9 15 ALA M  405 ? ALA b 407  . ? 1_555 ? 
4010 BI9 15 GLU M  409 ? GLU b 411  . ? 1_555 ? 
4011 BI9 15 CLA SJ .   ? CLA b 1227 . ? 1_555 ? 
4012 BI9 15 CLA TJ .   ? CLA b 1228 . ? 1_555 ? 
4013 BI9 15 CLA CK .   ? CLA b 1240 . ? 1_555 ? 
4014 BI9 15 VAL Q  132 ? VAL f 132  . ? 1_555 ? 
4015 BI9 15 ASP Q  135 ? ASP f 135  . ? 1_555 ? 
4016 BI9 15 HOH YR .   ? HOH f 8003 . ? 1_555 ? 
4017 BI9 15 HOH YR .   ? HOH f 8004 . ? 1_555 ? 
4018 BI9 15 HOH YR .   ? HOH f 8007 . ? 1_555 ? 
4019 BJ1 12 CLA NI .   ? CLA b 1022 . ? 1_555 ? 
4020 BJ1 12 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
4021 BJ1 12 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
4022 BJ1 12 CLA SI .   ? CLA b 1023 . ? 1_555 ? 
4023 BJ1 12 CLA VI .   ? CLA b 1204 . ? 1_555 ? 
4024 BJ1 12 CLA XI .   ? CLA b 1206 . ? 1_555 ? 
4025 BJ1 12 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
4026 BJ1 12 CLA AK .   ? CLA b 1238 . ? 1_555 ? 
4027 BJ1 12 CLA BK .   ? CLA b 1239 . ? 1_555 ? 
4028 BJ1 12 GLY R  19  ? GLY i 19   . ? 1_555 ? 
4029 BJ1 12 PRO R  23  ? PRO i 23   . ? 1_555 ? 
4030 BJ1 12 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
4031 BJ2 11 CLA VF .   ? CLA L 1503 . ? 1_555 ? 
4032 BJ2 11 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
4033 BJ2 11 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
4034 BJ2 11 CLA YI .   ? CLA b 1207 . ? 1_555 ? 
4035 BJ2 11 CLA OI .   ? CLA b 1237 . ? 1_555 ? 
4036 BJ2 11 CLA AK .   ? CLA b 1238 . ? 1_555 ? 
4037 BJ2 11 TRP R  20  ? TRP i 20   . ? 1_555 ? 
4038 BJ2 11 BCR AL .   ? BCR i 4018 . ? 1_555 ? 
4039 BJ2 11 TRP U  65  ? TRP l 65   . ? 1_555 ? 
4040 BJ2 11 ALA U  87  ? ALA l 87   . ? 1_555 ? 
4041 BJ2 11 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
4042 BJ3 14 TRP L  118 ? TRP a 118  . ? 1_555 ? 
4043 BJ3 14 CLA II .   ? CLA a 1101 . ? 1_555 ? 
4044 BJ3 14 CLA HG .   ? CLA a 1102 . ? 1_555 ? 
4045 BJ3 14 CLA QH .   ? CLA a 1140 . ? 1_555 ? 
4046 BJ3 14 BCR JI .   ? BCR a 4012 . ? 1_555 ? 
4047 BJ3 14 BCR ZH .   ? BCR a 4019 . ? 1_555 ? 
4048 BJ3 14 PRO S  12  ? PRO j 12   . ? 1_555 ? 
4049 BJ3 14 VAL S  13  ? VAL j 13   . ? 1_555 ? 
4050 BJ3 14 MET S  16  ? MET j 16   . ? 1_555 ? 
4051 BJ3 14 THR S  20  ? THR j 20   . ? 1_555 ? 
4052 BJ3 14 ILE S  27  ? ILE j 27   . ? 1_555 ? 
4053 BJ3 14 GLU S  28  ? GLU j 28   . ? 1_555 ? 
4054 BJ3 14 ARG S  31  ? ARG j 31   . ? 1_555 ? 
4055 BJ3 14 CLA EL .   ? CLA j 1302 . ? 1_555 ? 
4056 BJ4 17 PHE M  424 ? PHE b 426  . ? 1_555 ? 
4057 BJ4 17 LEU M  425 ? LEU b 427  . ? 1_555 ? 
4058 BJ4 17 HIS M  428 ? HIS b 430  . ? 1_555 ? 
4059 BJ4 17 PHE M  512 ? PHE b 514  . ? 1_555 ? 
4060 BJ4 17 HIS M  516 ? HIS b 518  . ? 1_555 ? 
4061 BJ4 17 CLA SK .   ? CLA b 1230 . ? 1_555 ? 
4062 BJ4 17 CLA YJ .   ? CLA b 1235 . ? 1_555 ? 
4063 BJ4 17 BCR RK .   ? BCR b 4014 . ? 1_555 ? 
4064 BJ4 17 ASP Q  64  ? ASP f 64   . ? 1_555 ? 
4065 BJ4 17 PRO Q  68  ? PRO f 68   . ? 1_555 ? 
4066 BJ4 17 TYR S  33  ? TYR j 33   . ? 1_555 ? 
4067 BJ4 17 LEU S  36  ? LEU j 36   . ? 1_555 ? 
4068 BJ4 17 LEU S  37  ? LEU j 37   . ? 1_555 ? 
4069 BJ4 17 PHE S  38  ? PHE j 38   . ? 1_555 ? 
4070 BJ4 17 HIS S  39  ? HIS j 39   . ? 1_555 ? 
4071 BJ4 17 PRO S  40  ? PRO j 40   . ? 1_555 ? 
4072 BJ4 17 CLA FL .   ? CLA j 1303 . ? 1_555 ? 
4073 BJ5 7  TRP L  118 ? TRP a 118  . ? 1_555 ? 
4074 BJ5 7  CLA KG .   ? CLA a 1105 . ? 1_555 ? 
4075 BJ5 7  BCR ZH .   ? BCR a 4019 . ? 1_555 ? 
4076 BJ5 7  PHE S  21  ? PHE j 21   . ? 1_555 ? 
4077 BJ5 7  GLU S  28  ? GLU j 28   . ? 1_555 ? 
4078 BJ5 7  ARG S  31  ? ARG j 31   . ? 1_555 ? 
4079 BJ5 7  BCR CL .   ? BCR j 4013 . ? 1_555 ? 
4080 BJ6 5  ILE Q  67  ? ILE f 67   . ? 1_555 ? 
4081 BJ6 5  ILE Q  70  ? ILE f 70   . ? 1_555 ? 
4082 BJ6 5  HIS S  39  ? HIS j 39   . ? 1_555 ? 
4083 BJ6 5  PRO S  40  ? PRO j 40   . ? 1_555 ? 
4084 BJ6 5  ZEX DL .   ? ZEX j 4015 . ? 1_555 ? 
4085 BJ7 3  CLA UG .   ? CLA a 1115 . ? 1_555 ? 
4086 BJ7 3  CLA LH .   ? CLA a 1134 . ? 1_555 ? 
4087 BJ7 3  LEU T  68  ? LEU k 76   . ? 1_555 ? 
4088 BJ8 11 PHE L  263 ? PHE a 263  . ? 1_555 ? 
4089 BJ8 11 PHE L  264 ? PHE a 264  . ? 1_555 ? 
4090 BJ8 11 VAL T  14  ? VAL k 22   . ? 1_555 ? 
4091 BJ8 11 MET T  18  ? MET k 26   . ? 1_555 ? 
4092 BJ8 11 CYS T  19  ? CYS k 27   . ? 1_555 ? 
4093 BJ8 11 ASN T  22  ? ASN k 30   . ? 1_555 ? 
4094 BJ8 11 VAL T  23  ? VAL k 31   . ? 1_555 ? 
4095 BJ8 11 LYS T  50  ? LYS k 58   . ? 1_555 ? 
4096 BJ8 11 MET T  62  ? MET k 70   . ? 1_555 ? 
4097 BJ8 11 HIS T  66  ? HIS k 74   . ? 1_555 ? 
4098 BJ8 11 BCR IL .   ? BCR k 4001 . ? 1_555 ? 
4099 BJ9 12 TRP L  268 ? TRP a 268  . ? 1_555 ? 
4100 BJ9 12 ILE L  306 ? ILE a 306  . ? 1_555 ? 
4101 BJ9 12 CLA XG .   ? CLA a 1118 . ? 1_555 ? 
4102 BJ9 12 BCR UH .   ? BCR a 4001 . ? 1_555 ? 
4103 BJ9 12 LYS T  50  ? LYS k 58   . ? 1_555 ? 
4104 BJ9 12 LYS T  51  ? LYS k 59   . ? 1_555 ? 
4105 BJ9 12 MET T  62  ? MET k 70   . ? 1_555 ? 
4106 BJ9 12 SER T  63  ? SER k 71   . ? 1_555 ? 
4107 BJ9 12 HIS T  66  ? HIS k 74   . ? 1_555 ? 
4108 BJ9 12 ILE T  67  ? ILE k 75   . ? 1_555 ? 
4109 BJ9 12 ALA T  70  ? ALA k 78   . ? 1_555 ? 
4110 BJ9 12 CLA HL .   ? CLA k 1402 . ? 1_555 ? 
4111 BK1 7  PHE J  156 ? PHE L 156  . ? 1_555 ? 
4112 BK1 7  HOH RR .   ? HOH L 8007 . ? 1_555 ? 
4113 BK1 7  HOH RR .   ? HOH L 8013 . ? 1_555 ? 
4114 BK1 7  HOH TR .   ? HOH a 8012 . ? 1_555 ? 
4115 BK1 7  PRO U  70  ? PRO l 70   . ? 1_555 ? 
4116 BK1 7  ASP U  73  ? ASP l 73   . ? 1_555 ? 
4117 BK1 7  HOH BS .   ? HOH l 8003 . ? 1_555 ? 
4118 BK2 13 LEU FA 87  ? LEU 0 90   . ? 1_555 ? 
4119 BK2 13 VAL FA 88  ? VAL 0 91   . ? 1_555 ? 
4120 BK2 13 ALA FA 91  ? ALA 0 94   . ? 1_555 ? 
4121 BK2 13 LEU CA 21  ? LEU h 21   . ? 1_555 ? 
4122 BK2 13 ALA CA 24  ? ALA h 24   . ? 1_555 ? 
4123 BK2 13 VAL CA 25  ? VAL h 25   . ? 1_555 ? 
4124 BK2 13 ASN U  36  ? ASN l 36   . ? 1_555 ? 
4125 BK2 13 ARG U  41  ? ARG l 41   . ? 1_555 ? 
4126 BK2 13 GLU U  52  ? GLU l 52   . ? 1_555 ? 
4127 BK2 13 MET U  55  ? MET l 55   . ? 1_555 ? 
4128 BK2 13 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
4129 BK2 13 BCR OL .   ? BCR l 4022 . ? 1_555 ? 
4130 BK2 13 HOH BS .   ? HOH l 8019 . ? 1_555 ? 
4131 BK3 19 CLA IH .   ? CLA a 1129 . ? 1_555 ? 
4132 BK3 19 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
4133 BK3 19 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
4134 BK3 19 CLA NH .   ? CLA a 1136 . ? 1_555 ? 
4135 BK3 19 PRO M  681 ? PRO b 683  . ? 1_555 ? 
4136 BK3 19 LEU M  685 ? LEU b 687  . ? 1_555 ? 
4137 BK3 19 CLA OI .   ? CLA b 1237 . ? 1_555 ? 
4138 BK3 19 ECH BL .   ? ECH i 4020 . ? 1_555 ? 
4139 BK3 19 ILE U  24  ? ILE l 24   . ? 1_555 ? 
4140 BK3 19 PHE U  33  ? PHE l 33   . ? 1_555 ? 
4141 BK3 19 LEU U  37  ? LEU l 37   . ? 1_555 ? 
4142 BK3 19 PRO U  38  ? PRO l 38   . ? 1_555 ? 
4143 BK3 19 ALA U  39  ? ALA l 39   . ? 1_555 ? 
4144 BK3 19 VAL U  53  ? VAL l 53   . ? 1_555 ? 
4145 BK3 19 HIS U  57  ? HIS l 57   . ? 1_555 ? 
4146 BK3 19 PHE U  60  ? PHE l 60   . ? 1_555 ? 
4147 BK3 19 CLA KL .   ? CLA l 1501 . ? 1_555 ? 
4148 BK3 19 BCR NL .   ? BCR l 4019 . ? 1_555 ? 
4149 BK3 19 BCR OL .   ? BCR l 4022 . ? 1_555 ? 
4150 BK4 15 CLA PO .   ? CLA 2 1207 . ? 1_555 ? 
4151 BK4 15 CLA JH .   ? CLA a 1131 . ? 1_555 ? 
4152 BK4 15 CLA KI .   ? CLA a 1132 . ? 1_555 ? 
4153 BK4 15 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
4154 BK4 15 TYR U  59  ? TYR l 59   . ? 1_555 ? 
4155 BK4 15 PHE U  60  ? PHE l 60   . ? 1_555 ? 
4156 BK4 15 GLY U  63  ? GLY l 63   . ? 1_555 ? 
4157 BK4 15 PRO U  64  ? PRO l 64   . ? 1_555 ? 
4158 BK4 15 LEU U  67  ? LEU l 67   . ? 1_555 ? 
4159 BK4 15 LEU U  142 ? LEU l 142  . ? 1_555 ? 
4160 BK4 15 LEU U  145 ? LEU l 145  . ? 1_555 ? 
4161 BK4 15 PHE U  152 ? PHE l 152  . ? 1_555 ? 
4162 BK4 15 BCR OL .   ? BCR l 4022 . ? 1_555 ? 
4163 BK4 15 LHG RL .   ? LHG l 5004 . ? 1_555 ? 
4164 BK4 15 HOH BS .   ? HOH l 8015 . ? 1_555 ? 
4165 BK5 15 SQD CG .   ? SQD L 5002 . ? 1_555 ? 
4166 BK5 15 ILE M  23  ? ILE b 25   . ? 1_555 ? 
4167 BK5 15 CLA TK .   ? CLA b 1201 . ? 1_555 ? 
4168 BK5 15 CLA OI .   ? CLA b 1237 . ? 1_555 ? 
4169 BK5 15 CLA AK .   ? CLA b 1238 . ? 1_555 ? 
4170 BK5 15 PQN DK .   ? PQN b 2002 . ? 1_555 ? 
4171 BK5 15 MET R  27  ? MET i 27   . ? 1_555 ? 
4172 BK5 15 LEU R  30  ? LEU i 30   . ? 1_555 ? 
4173 BK5 15 PHE R  31  ? PHE i 31   . ? 1_555 ? 
4174 BK5 15 HIS U  57  ? HIS l 57   . ? 1_555 ? 
4175 BK5 15 ALA U  92  ? ALA l 92   . ? 1_555 ? 
4176 BK5 15 ALA U  95  ? ALA l 95   . ? 1_555 ? 
4177 BK5 15 LEU U  96  ? LEU l 96   . ? 1_555 ? 
4178 BK5 15 PHE U  127 ? PHE l 127  . ? 1_555 ? 
4179 BK5 15 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
4180 BK6 13 MET FA 129 ? MET 0 132  . ? 1_555 ? 
4181 BK6 13 BCR XF .   ? BCR L 4022 . ? 1_555 ? 
4182 BK6 13 CLA GI .   ? CLA a 1130 . ? 1_555 ? 
4183 BK6 13 PHE U  33  ? PHE l 33   . ? 1_555 ? 
4184 BK6 13 MET U  55  ? MET l 55   . ? 1_555 ? 
4185 BK6 13 ALA U  56  ? ALA l 56   . ? 1_555 ? 
4186 BK6 13 TYR U  59  ? TYR l 59   . ? 1_555 ? 
4187 BK6 13 GLY U  133 ? GLY l 133  . ? 1_555 ? 
4188 BK6 13 VAL U  137 ? VAL l 137  . ? 1_555 ? 
4189 BK6 13 CLA KL .   ? CLA l 1501 . ? 1_555 ? 
4190 BK6 13 CLA LL .   ? CLA l 1502 . ? 1_555 ? 
4191 BK6 13 CLA ML .   ? CLA l 1503 . ? 1_555 ? 
4192 BK6 13 LHG RL .   ? LHG l 5004 . ? 1_555 ? 
4193 BK7 14 CLA JO .   ? CLA 2 1201 . ? 1_555 ? 
4194 BK7 14 CLA MO .   ? CLA 2 1204 . ? 1_555 ? 
4195 BK7 14 PHE CA 22  ? PHE h 22   . ? 1_555 ? 
4196 BK7 14 LEU CA 29  ? LEU h 29   . ? 1_555 ? 
4197 BK7 14 LEU CA 30  ? LEU h 30   . ? 1_555 ? 
4198 BK7 14 ILE CA 32  ? ILE h 32   . ? 1_555 ? 
4199 BK7 14 HIS CA 33  ? HIS h 33   . ? 1_555 ? 
4200 BK7 14 PHE U  29  ? PHE l 29   . ? 1_555 ? 
4201 BK7 14 ARG U  31  ? ARG l 31   . ? 1_555 ? 
4202 BK7 14 THR U  32  ? THR l 32   . ? 1_555 ? 
4203 BK7 14 ASN U  36  ? ASN l 36   . ? 1_555 ? 
4204 BK7 14 LYS U  42  ? LYS l 42   . ? 1_555 ? 
4205 BK7 14 LHG TL .   ? LHG l 5002 . ? 1_555 ? 
4206 BK7 14 HOH BS .   ? HOH l 8006 . ? 1_555 ? 
4207 BK8 10 PHE GA 20  ? PHE 9 20   . ? 1_555 ? 
4208 BK8 10 ARG GA 24  ? ARG 9 24   . ? 1_555 ? 
4209 BK8 10 PHE L  332 ? PHE a 332  . ? 1_555 ? 
4210 BK8 10 CLA IH .   ? CLA a 1129 . ? 1_555 ? 
4211 BK8 10 CLA RH .   ? CLA a 1801 . ? 1_555 ? 
4212 BK8 10 VAL U  7   ? VAL l 7    . ? 1_555 ? 
4213 BK8 10 SER U  27  ? SER l 27   . ? 1_555 ? 
4214 BK8 10 ALA U  28  ? ALA l 28   . ? 1_555 ? 
4215 BK8 10 PHE U  29  ? PHE l 29   . ? 1_555 ? 
4216 BK8 10 LHG TL .   ? LHG l 5002 . ? 1_555 ? 
4217 BK9 8  CLA GI .   ? CLA a 1130 . ? 1_555 ? 
4218 BK9 8  LMG BI .   ? LMG a 5002 . ? 1_555 ? 
4219 BK9 8  LEU U  67  ? LEU l 67   . ? 1_555 ? 
4220 BK9 8  LEU U  68  ? LEU l 68   . ? 1_555 ? 
4221 BK9 8  GLN U  77  ? GLN l 77   . ? 1_555 ? 
4222 BK9 8  TYR U  78  ? TYR l 78   . ? 1_555 ? 
4223 BK9 8  CLA ML .   ? CLA l 1503 . ? 1_555 ? 
4224 BK9 8  BCR OL .   ? BCR l 4022 . ? 1_555 ? 
4225 BL1 6  BCR HR .   ? BCR 9 4021 . ? 1_555 ? 
4226 BL1 6  TRP CA 12  ? TRP h 12   . ? 1_555 ? 
4227 BL1 6  LEU U  145 ? LEU l 145  . ? 1_555 ? 
4228 BL1 6  SER U  146 ? SER l 146  . ? 1_555 ? 
4229 BL1 6  ASP U  149 ? ASP l 149  . ? 1_555 ? 
4230 BL1 6  ARG U  153 ? ARG l 153  . ? 1_555 ? 
4231 BL2 11 BCR CR .   ? BCR 0 4019 . ? 1_555 ? 
4232 BL2 11 CLA JO .   ? CLA 2 1201 . ? 1_555 ? 
4233 BL2 11 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
4234 BL2 11 PHE GA 23  ? PHE 9 23   . ? 1_555 ? 
4235 BL2 11 TYR GA 30  ? TYR 9 30   . ? 1_555 ? 
4236 BL2 11 PHE CA 22  ? PHE h 22   . ? 1_555 ? 
4237 BL2 11 HIS CA 33  ? HIS h 33   . ? 1_555 ? 
4238 BL2 11 ALA U  28  ? ALA l 28   . ? 1_555 ? 
4239 BL2 11 THR U  32  ? THR l 32   . ? 1_555 ? 
4240 BL2 11 LHG PL .   ? LHG l 5001 . ? 1_555 ? 
4241 BL2 11 LHG QL .   ? LHG l 5003 . ? 1_555 ? 
4242 BL3 8  SQD YF .   ? SQD L 5001 . ? 1_555 ? 
4243 BL3 8  LEU M  57  ? LEU b 59   . ? 1_555 ? 
4244 BL3 8  CLA VI .   ? CLA b 1204 . ? 1_555 ? 
4245 BL3 8  LEU V  12  ? LEU m 12   . ? 1_555 ? 
4246 BL3 8  LEU V  16  ? LEU m 16   . ? 1_555 ? 
4247 BL3 8  ALA V  19  ? ALA m 19   . ? 1_555 ? 
4248 BL3 8  ALA V  22  ? ALA m 22   . ? 1_555 ? 
4249 BL3 8  SER V  26  ? SER m 26   . ? 1_555 ? 
4250 BL4 5  CLA EN .   ? CLA 1 1134 . ? 1_555 ? 
4251 BL4 5  LMT XN .   ? LMT 1 6001 . ? 1_555 ? 
4252 BL4 5  CLA TQ .   ? CLA 8 1401 . ? 1_555 ? 
4253 BL4 5  GLN B  133 ? GLN B 133  . ? 1_555 ? 
4254 BL4 5  LHG EG .   ? LHG M 5001 . ? 1_555 ? 
4255 BL5 5  ASN FA 2   ? ASN 0 5    . ? 1_555 ? 
4256 BL5 5  CLA SM .   ? CLA 1 1121 . ? 1_555 ? 
4257 BL5 5  CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
4258 BL5 5  LYS B  160 ? LYS B 160  . ? 1_555 ? 
4259 BL5 5  SQD SE .   ? SQD B 5008 . ? 1_555 ? 
4260 BL6 22 TYR W  448 ? TYR 1 455  . ? 1_555 ? 
4261 BL6 22 TYR W  592 ? TYR 1 599  . ? 1_555 ? 
4262 BL6 22 ASN W  593 ? ASN 1 600  . ? 1_555 ? 
4263 BL6 22 SER W  596 ? SER 1 603  . ? 1_555 ? 
4264 BL6 22 ILE W  597 ? ILE 1 604  . ? 1_555 ? 
4265 BL6 22 PHE W  600 ? PHE 1 607  . ? 1_555 ? 
4266 BL6 22 ILE W  635 ? ILE 1 642  . ? 1_555 ? 
4267 BL6 22 LEU W  643 ? LEU 1 650  . ? 1_555 ? 
4268 BL6 22 ILE W  651 ? ILE 1 658  . ? 1_555 ? 
4269 BL6 22 PHE W  665 ? PHE 1 672  . ? 1_555 ? 
4270 BL6 22 HIS W  669 ? HIS 1 676  . ? 1_555 ? 
4271 BL6 22 PHE W  672 ? PHE 1 679  . ? 1_555 ? 
4272 BL6 22 TYR W  724 ? TYR 1 731  . ? 1_555 ? 
4273 BL6 22 GLY W  728 ? GLY 1 735  . ? 1_555 ? 
4274 BL6 22 THR W  731 ? THR 1 738  . ? 1_555 ? 
4275 BL6 22 THR W  732 ? THR 1 739  . ? 1_555 ? 
4276 BL6 22 PHE W  735 ? PHE 1 742  . ? 1_555 ? 
4277 BL6 22 CLA DO .   ? CLA 2 1022 . ? 1_555 ? 
4278 BL6 22 PHE X  617 ? PHE 2 617  . ? 1_555 ? 
4279 BL6 22 TRP X  622 ? TRP 2 622  . ? 1_555 ? 
4280 BL6 22 CLA CO .   ? CLA 1 1012 . ? 1_555 ? 
4281 BL6 22 CLA HO .   ? CLA 2 1021 . ? 1_555 ? 
4282 BL7 25 PHE W  670 ? PHE 1 677  . ? 1_555 ? 
4283 BL7 25 ALA W  673 ? ALA 1 680  . ? 1_555 ? 
4284 BL7 25 PHE W  674 ? PHE 1 681  . ? 1_555 ? 
4285 BL7 25 MET W  677 ? MET 1 684  . ? 1_555 ? 
4286 BL7 25 PHE W  680 ? PHE 1 687  . ? 1_555 ? 
4287 BL7 25 TYR W  685 ? TYR 1 692  . ? 1_555 ? 
4288 BL7 25 TRP W  686 ? TRP 1 693  . ? 1_555 ? 
4289 BL7 25 LEU W  689 ? LEU 1 696  . ? 1_555 ? 
4290 BL7 25 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
4291 BL7 25 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
4292 BL7 25 PQN LN .   ? PQN 1 2001 . ? 1_555 ? 
4293 BL7 25 SER X  421 ? SER 2 421  . ? 1_555 ? 
4294 BL7 25 SER X  424 ? SER 2 424  . ? 1_555 ? 
4295 BL7 25 LEU X  425 ? LEU 2 425  . ? 1_555 ? 
4296 BL7 25 GLY X  428 ? GLY 2 428  . ? 1_555 ? 
4297 BL7 25 PHE X  429 ? PHE 2 429  . ? 1_555 ? 
4298 BL7 25 LEU X  432 ? LEU 2 432  . ? 1_555 ? 
4299 BL7 25 LEU X  522 ? LEU 2 522  . ? 1_555 ? 
4300 BL7 25 THR X  526 ? THR 2 526  . ? 1_555 ? 
4301 BL7 25 LEU X  529 ? LEU 2 529  . ? 1_555 ? 
4302 BL7 25 ILE X  530 ? ILE 2 530  . ? 1_555 ? 
4303 BL7 25 PHE X  578 ? PHE 2 578  . ? 1_555 ? 
4304 BL7 25 TRP X  579 ? TRP 2 579  . ? 1_555 ? 
4305 BL7 25 CLA CO .   ? CLA 1 1012 . ? 1_555 ? 
4306 BL7 25 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
4307 BL8 23 PHE W  445 ? PHE 1 452  . ? 1_555 ? 
4308 BL8 23 ILE W  449 ? ILE 1 456  . ? 1_555 ? 
4309 BL8 23 PHE W  533 ? PHE 1 540  . ? 1_555 ? 
4310 BL8 23 PHE W  589 ? PHE 1 596  . ? 1_555 ? 
4311 BL8 23 TRP W  590 ? TRP 1 597  . ? 1_555 ? 
4312 BL8 23 ASN W  593 ? ASN 1 600  . ? 1_555 ? 
4313 BL8 23 ILE W  635 ? ILE 1 642  . ? 1_555 ? 
4314 BL8 23 TYR W  724 ? TYR 1 731  . ? 1_555 ? 
4315 BL8 23 CLA XL .   ? CLA 1 1011 . ? 1_555 ? 
4316 BL8 23 HOH DS .   ? HOH 1 8002 . ? 1_555 ? 
4317 BL8 23 TRP X  645 ? TRP 2 645  . ? 1_555 ? 
4318 BL8 23 LEU X  648 ? LEU 2 648  . ? 1_555 ? 
4319 BL8 23 PHE X  649 ? PHE 2 649  . ? 1_555 ? 
4320 BL8 23 HIS X  651 ? HIS 2 651  . ? 1_555 ? 
4321 BL8 23 LEU X  652 ? LEU 2 652  . ? 1_555 ? 
4322 BL8 23 TRP X  654 ? TRP 2 654  . ? 1_555 ? 
4323 BL8 23 ALA X  655 ? ALA 2 655  . ? 1_555 ? 
4324 BL8 23 CLA HO .   ? CLA 2 1021 . ? 1_555 ? 
4325 BL8 23 CLA IO .   ? CLA 2 1023 . ? 1_555 ? 
4326 BL8 23 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
4327 BL8 23 CLA PO .   ? CLA 2 1207 . ? 1_555 ? 
4328 BL8 23 BCR ZP .   ? BCR 2 4017 . ? 1_555 ? 
4329 BL8 23 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
4330 BL9 16 HIS W  26  ? HIS 1 33   . ? 1_555 ? 
4331 BL9 16 PHE W  27  ? PHE 1 34   . ? 1_555 ? 
4332 BL9 16 ALA W  48  ? ALA 1 55   . ? 1_555 ? 
4333 BL9 16 HIS W  49  ? HIS 1 56   . ? 1_555 ? 
4334 BL9 16 GLN W  54  ? GLN 1 61   . ? 1_555 ? 
4335 BL9 16 ALA W  68  ? ALA 1 75   . ? 1_555 ? 
4336 BL9 16 HIS W  72  ? HIS 1 79   . ? 1_555 ? 
4337 BL9 16 VAL W  75  ? VAL 1 82   . ? 1_555 ? 
4338 BL9 16 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
4339 BL9 16 CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4340 BL9 16 CLA BM .   ? CLA 1 1104 . ? 1_555 ? 
4341 BL9 16 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
4342 BL9 16 CLA GM .   ? CLA 1 1109 . ? 1_555 ? 
4343 BL9 16 CLA ZM .   ? CLA 1 1128 . ? 1_555 ? 
4344 BL9 16 LHG TN .   ? LHG 1 5001 . ? 1_555 ? 
4345 BL9 16 BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
4346 BM1 23 HIS W  49  ? HIS 1 56   . ? 1_555 ? 
4347 BM1 23 PHE W  51  ? PHE 1 58   . ? 1_555 ? 
4348 BM1 23 ILE W  65  ? ILE 1 72   . ? 1_555 ? 
4349 BM1 23 ALA W  68  ? ALA 1 75   . ? 1_555 ? 
4350 BM1 23 HIS W  69  ? HIS 1 76   . ? 1_555 ? 
4351 BM1 23 HIS W  72  ? HIS 1 79   . ? 1_555 ? 
4352 BM1 23 LEU W  73  ? LEU 1 80   . ? 1_555 ? 
4353 BM1 23 VAL W  76  ? VAL 1 83   . ? 1_555 ? 
4354 BM1 23 PHE W  77  ? PHE 1 84   . ? 1_555 ? 
4355 BM1 23 TRP W  341 ? TRP 1 348  . ? 1_555 ? 
4356 BM1 23 HIS W  342 ? HIS 1 349  . ? 1_555 ? 
4357 BM1 23 GLN W  344 ? GLN 1 351  . ? 1_555 ? 
4358 BM1 23 LEU W  345 ? LEU 1 352  . ? 1_555 ? 
4359 BM1 23 ASN W  348 ? ASN 1 355  . ? 1_555 ? 
4360 BM1 23 LEU W  349 ? LEU 1 356  . ? 1_555 ? 
4361 BM1 23 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
4362 BM1 23 CLA BM .   ? CLA 1 1104 . ? 1_555 ? 
4363 BM1 23 CLA IM .   ? CLA 1 1111 . ? 1_555 ? 
4364 BM1 23 CLA JM .   ? CLA 1 1112 . ? 1_555 ? 
4365 BM1 23 CLA UM .   ? CLA 1 1123 . ? 1_555 ? 
4366 BM1 23 CLA ZM .   ? CLA 1 1128 . ? 1_555 ? 
4367 BM1 23 BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
4368 BM1 23 BCR PN .   ? BCR 1 4003 . ? 1_555 ? 
4369 BM2 11 HIS W  49  ? HIS 1 56   . ? 1_555 ? 
4370 BM2 11 HIS W  72  ? HIS 1 79   . ? 1_555 ? 
4371 BM2 11 VAL W  76  ? VAL 1 83   . ? 1_555 ? 
4372 BM2 11 TRP W  79  ? TRP 1 86   . ? 1_555 ? 
4373 BM2 11 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
4374 BM2 11 CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4375 BM2 11 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
4376 BM2 11 CLA YM .   ? CLA 1 1127 . ? 1_555 ? 
4377 BM2 11 CLA ZM .   ? CLA 1 1128 . ? 1_555 ? 
4378 BM2 11 BCR PN .   ? BCR 1 4003 . ? 1_555 ? 
4379 BM2 11 LHG TN .   ? LHG 1 5001 . ? 1_555 ? 
4380 BM3 12 TRP W  79  ? TRP 1 86   . ? 1_555 ? 
4381 BM3 12 GLY W  82  ? GLY 1 89   . ? 1_555 ? 
4382 BM3 12 MET W  83  ? MET 1 90   . ? 1_555 ? 
4383 BM3 12 PHE W  85  ? PHE 1 92   . ? 1_555 ? 
4384 BM3 12 HIS W  86  ? HIS 1 93   . ? 1_555 ? 
4385 BM3 12 PHE W  90  ? PHE 1 97   . ? 1_555 ? 
4386 BM3 12 TRP W  111 ? TRP 1 118  . ? 1_555 ? 
4387 BM3 12 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
4388 BM3 12 CLA EM .   ? CLA 1 1107 . ? 1_555 ? 
4389 BM3 12 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
4390 BM3 12 BCR SN .   ? BCR 1 4019 . ? 1_555 ? 
4391 BM3 12 BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
4392 BM4 19 TRP W  79  ? TRP 1 86   . ? 1_555 ? 
4393 BM4 19 MET W  83  ? MET 1 90   . ? 1_555 ? 
4394 BM4 19 GLN W  108 ? GLN 1 115  . ? 1_555 ? 
4395 BM4 19 ILE W  130 ? ILE 1 137  . ? 1_555 ? 
4396 BM4 19 GLN W  131 ? GLN 1 138  . ? 1_555 ? 
4397 BM4 19 ILE W  132 ? ILE 1 139  . ? 1_555 ? 
4398 BM4 19 THR W  133 ? THR 1 140  . ? 1_555 ? 
4399 BM4 19 SER W  134 ? SER 1 141  . ? 1_555 ? 
4400 BM4 19 LEU W  136 ? LEU 1 143  . ? 1_555 ? 
4401 BM4 19 ALA W  660 ? ALA 1 667  . ? 1_555 ? 
4402 BM4 19 TYR W  661 ? TYR 1 668  . ? 1_555 ? 
4403 BM4 19 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
4404 BM4 19 CLA CM .   ? CLA 1 1105 . ? 1_555 ? 
4405 BM4 19 CLA EM .   ? CLA 1 1107 . ? 1_555 ? 
4406 BM4 19 CLA GM .   ? CLA 1 1109 . ? 1_555 ? 
4407 BM4 19 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
4408 BM4 19 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
4409 BM4 19 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
4410 BM4 19 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
4411 BM5 16 GLN W  108 ? GLN 1 115  . ? 1_555 ? 
4412 BM5 16 VAL W  109 ? VAL 1 116  . ? 1_555 ? 
4413 BM5 16 VAL W  110 ? VAL 1 117  . ? 1_555 ? 
4414 BM5 16 TRP W  111 ? TRP 1 118  . ? 1_555 ? 
4415 BM5 16 GLN W  116 ? GLN 1 123  . ? 1_555 ? 
4416 BM5 16 LEU W  119 ? LEU 1 126  . ? 1_555 ? 
4417 BM5 16 ILE W  130 ? ILE 1 137  . ? 1_555 ? 
4418 BM5 16 ALA W  660 ? ALA 1 667  . ? 1_555 ? 
4419 BM5 16 CLA CM .   ? CLA 1 1105 . ? 1_555 ? 
4420 BM5 16 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
4421 BM5 16 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
4422 BM5 16 VAL X  440 ? VAL 2 440  . ? 1_555 ? 
4423 BM5 16 PHE X  444 ? PHE 2 444  . ? 1_555 ? 
4424 BM5 16 CLA GQ .   ? CLA 2 1230 . ? 1_555 ? 
4425 BM5 16 ILE DA 27  ? ILE 7 27   . ? 1_555 ? 
4426 BM5 16 BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
4427 BM6 11 ARG W  1   ? ARG 1 8    . ? 1_555 ? 
4428 BM6 11 VAL W  9   ? VAL 1 16   . ? 1_555 ? 
4429 BM6 11 PHE W  66  ? PHE 1 73   . ? 1_555 ? 
4430 BM6 11 LEU W  164 ? LEU 1 171  . ? 1_555 ? 
4431 BM6 11 ALA W  168 ? ALA 1 175  . ? 1_555 ? 
4432 BM6 11 PHE W  171 ? PHE 1 178  . ? 1_555 ? 
4433 BM6 11 HIS W  172 ? HIS 1 179  . ? 1_555 ? 
4434 BM6 11 LYS W  176 ? LYS 1 183  . ? 1_555 ? 
4435 BM6 11 TRP W  182 ? TRP 1 189  . ? 1_555 ? 
4436 BM6 11 CLA HM .   ? CLA 1 1110 . ? 1_555 ? 
4437 BM6 11 CLA IM .   ? CLA 1 1111 . ? 1_555 ? 
4438 BM7 13 ALA W  3   ? ALA 1 10   . ? 1_555 ? 
4439 BM7 13 ALA W  5   ? ALA 1 12   . ? 1_555 ? 
4440 BM7 13 LYS W  6   ? LYS 1 13   . ? 1_555 ? 
4441 BM7 13 VAL W  7   ? VAL 1 14   . ? 1_555 ? 
4442 BM7 13 TRP W  182 ? TRP 1 189  . ? 1_555 ? 
4443 BM7 13 SER W  188 ? SER 1 195  . ? 1_555 ? 
4444 BM7 13 HIS W  192 ? HIS 1 199  . ? 1_555 ? 
4445 BM7 13 THR W  306 ? THR 1 313  . ? 1_555 ? 
4446 BM7 13 ASN W  307 ? ASN 1 314  . ? 1_555 ? 
4447 BM7 13 TRP W  308 ? TRP 1 315  . ? 1_555 ? 
4448 BM7 13 CLA FM .   ? CLA 1 1108 . ? 1_555 ? 
4449 BM7 13 CLA IM .   ? CLA 1 1111 . ? 1_555 ? 
4450 BM7 13 CLA PM .   ? CLA 1 1118 . ? 1_555 ? 
4451 BM8 19 PHE W  66  ? PHE 1 73   . ? 1_555 ? 
4452 BM8 19 HIS W  69  ? HIS 1 76   . ? 1_555 ? 
4453 BM8 19 LEU W  73  ? LEU 1 80   . ? 1_555 ? 
4454 BM8 19 PHE W  77  ? PHE 1 84   . ? 1_555 ? 
4455 BM8 19 MET W  165 ? MET 1 172  . ? 1_555 ? 
4456 BM8 19 TRP W  182 ? TRP 1 189  . ? 1_555 ? 
4457 BM8 19 PHE W  183 ? PHE 1 190  . ? 1_555 ? 
4458 BM8 19 ASN W  185 ? ASN 1 192  . ? 1_555 ? 
4459 BM8 19 MET W  189 ? MET 1 196  . ? 1_555 ? 
4460 BM8 19 HIS W  192 ? HIS 1 199  . ? 1_555 ? 
4461 BM8 19 HIS W  193 ? HIS 1 200  . ? 1_555 ? 
4462 BM8 19 GLY W  196 ? GLY 1 203  . ? 1_555 ? 
4463 BM8 19 LEU W  197 ? LEU 1 204  . ? 1_555 ? 
4464 BM8 19 CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4465 BM8 19 CLA FM .   ? CLA 1 1108 . ? 1_555 ? 
4466 BM8 19 CLA HM .   ? CLA 1 1110 . ? 1_555 ? 
4467 BM8 19 CLA UM .   ? CLA 1 1123 . ? 1_555 ? 
4468 BM8 19 BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
4469 BM8 19 BCR PN .   ? BCR 1 4003 . ? 1_555 ? 
4470 BM9 14 PHE W  145 ? PHE 1 152  . ? 1_555 ? 
4471 BM9 14 GLN W  150 ? GLN 1 157  . ? 1_555 ? 
4472 BM9 14 CYS W  153 ? CYS 1 160  . ? 1_555 ? 
4473 BM9 14 THR W  154 ? THR 1 161  . ? 1_555 ? 
4474 BM9 14 GLY W  201 ? GLY 1 208  . ? 1_555 ? 
4475 BM9 14 GLY W  204 ? GLY 1 211  . ? 1_555 ? 
4476 BM9 14 TRP W  205 ? TRP 1 212  . ? 1_555 ? 
4477 BM9 14 HIS W  208 ? HIS 1 215  . ? 1_555 ? 
4478 BM9 14 VAL W  212 ? VAL 1 219  . ? 1_555 ? 
4479 BM9 14 PRO W  232 ? PRO 1 239  . ? 1_555 ? 
4480 BM9 14 CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4481 BM9 14 CLA LM .   ? CLA 1 1114 . ? 1_555 ? 
4482 BM9 14 BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
4483 BM9 14 BCR PN .   ? BCR 1 4003 . ? 1_555 ? 
4484 BN1 10 LEU W  203 ? LEU 1 210  . ? 1_555 ? 
4485 BN1 10 GLY W  204 ? GLY 1 211  . ? 1_555 ? 
4486 BN1 10 ILE W  210 ? ILE 1 217  . ? 1_555 ? 
4487 BN1 10 HIS W  211 ? HIS 1 218  . ? 1_555 ? 
4488 BN1 10 PHE W  249 ? PHE 1 256  . ? 1_555 ? 
4489 BN1 10 GLY W  252 ? GLY 1 259  . ? 1_555 ? 
4490 BN1 10 LEU W  253 ? LEU 1 260  . ? 1_555 ? 
4491 BN1 10 LEU W  291 ? LEU 1 298  . ? 1_555 ? 
4492 BN1 10 BCR NN .   ? BCR 1 4001 . ? 1_555 ? 
4493 BN1 10 BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
4494 BN2 6  TYR W  149 ? TYR 1 156  . ? 1_555 ? 
4495 BN2 6  LEU W  231 ? LEU 1 238  . ? 1_555 ? 
4496 BN2 6  HIS W  233 ? HIS 1 240  . ? 1_555 ? 
4497 BN2 6  LEU W  237 ? LEU 1 244  . ? 1_555 ? 
4498 BN2 6  CLA JM .   ? CLA 1 1112 . ? 1_555 ? 
4499 BN2 6  BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
4500 BN3 15 TRP W  261 ? TRP 1 268  . ? 1_555 ? 
4501 BN3 15 SER W  265 ? SER 1 272  . ? 1_555 ? 
4502 BN3 15 PHE W  270 ? PHE 1 277  . ? 1_555 ? 
4503 BN3 15 HIS W  288 ? HIS 1 295  . ? 1_555 ? 
4504 BN3 15 LEU W  291 ? LEU 1 298  . ? 1_555 ? 
4505 BN3 15 VAL W  295 ? VAL 1 302  . ? 1_555 ? 
4506 BN3 15 ILE W  299 ? ILE 1 306  . ? 1_555 ? 
4507 BN3 15 ASN W  493 ? ASN 1 500  . ? 1_555 ? 
4508 BN3 15 CLA NM .   ? CLA 1 1116 . ? 1_555 ? 
4509 BN3 15 CLA RM .   ? CLA 1 1120 . ? 1_555 ? 
4510 BN3 15 CLA EN .   ? CLA 1 1134 . ? 1_555 ? 
4511 BN3 15 ALA EA 3   ? ALA 8 11   . ? 1_555 ? 
4512 BN3 15 ILE EA 67  ? ILE 8 75   . ? 1_555 ? 
4513 BN3 15 LEU EA 74  ? LEU 8 82   . ? 1_555 ? 
4514 BN3 15 CLA TQ .   ? CLA 8 1401 . ? 1_555 ? 
4515 BN4 14 PHE W  270 ? PHE 1 277  . ? 1_555 ? 
4516 BN4 14 GLY W  272 ? GLY 1 279  . ? 1_555 ? 
4517 BN4 14 LEU W  281 ? LEU 1 288  . ? 1_555 ? 
4518 BN4 14 ASP W  285 ? ASP 1 292  . ? 1_555 ? 
4519 BN4 14 HIS W  289 ? HIS 1 296  . ? 1_555 ? 
4520 BN4 14 ILE W  293 ? ILE 1 300  . ? 1_555 ? 
4521 BN4 14 HIS W  362 ? HIS 1 369  . ? 1_555 ? 
4522 BN4 14 MET W  366 ? MET 1 373  . ? 1_555 ? 
4523 BN4 14 ALA W  498 ? ALA 1 505  . ? 1_555 ? 
4524 BN4 14 CLA MM .   ? CLA 1 1115 . ? 1_555 ? 
4525 BN4 14 CLA OM .   ? CLA 1 1117 . ? 1_555 ? 
4526 BN4 14 CLA WM .   ? CLA 1 1125 . ? 1_555 ? 
4527 BN4 14 CLA DN .   ? CLA 1 1133 . ? 1_555 ? 
4528 BN4 14 CLA EN .   ? CLA 1 1134 . ? 1_555 ? 
4529 BN5 20 ALA W  142 ? ALA 1 149  . ? 1_555 ? 
4530 BN5 20 LEU W  198 ? LEU 1 205  . ? 1_555 ? 
4531 BN5 20 GLY W  201 ? GLY 1 208  . ? 1_555 ? 
4532 BN5 20 SER W  202 ? SER 1 209  . ? 1_555 ? 
4533 BN5 20 TRP W  205 ? TRP 1 212  . ? 1_555 ? 
4534 BN5 20 GLN W  209 ? GLN 1 216  . ? 1_555 ? 
4535 BN5 20 HIS W  289 ? HIS 1 296  . ? 1_555 ? 
4536 BN5 20 HIS W  290 ? HIS 1 297  . ? 1_555 ? 
4537 BN5 20 ILE W  293 ? ILE 1 300  . ? 1_555 ? 
4538 BN5 20 PHE W  297 ? PHE 1 304  . ? 1_555 ? 
4539 BN5 20 LEU W  355 ? LEU 1 362  . ? 1_555 ? 
4540 BN5 20 VAL W  359 ? VAL 1 366  . ? 1_555 ? 
4541 BN5 20 MET W  363 ? MET 1 370  . ? 1_555 ? 
4542 BN5 20 PRO W  368 ? PRO 1 375  . ? 1_555 ? 
4543 BN5 20 TYR W  369 ? TYR 1 376  . ? 1_555 ? 
4544 BN5 20 CLA NM .   ? CLA 1 1116 . ? 1_555 ? 
4545 BN5 20 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4546 BN5 20 CLA WM .   ? CLA 1 1125 . ? 1_555 ? 
4547 BN5 20 CLA YM .   ? CLA 1 1127 . ? 1_555 ? 
4548 BN5 20 BCR PN .   ? BCR 1 4003 . ? 1_555 ? 
4549 BN6 17 ASN W  191 ? ASN 1 198  . ? 1_555 ? 
4550 BN6 17 HIS W  192 ? HIS 1 199  . ? 1_555 ? 
4551 BN6 17 ALA W  195 ? ALA 1 202  . ? 1_555 ? 
4552 BN6 17 LEU W  200 ? LEU 1 207  . ? 1_555 ? 
4553 BN6 17 HIS W  302 ? HIS 1 309  . ? 1_555 ? 
4554 BN6 17 THR W  306 ? THR 1 313  . ? 1_555 ? 
4555 BN6 17 TRP W  308 ? TRP 1 315  . ? 1_555 ? 
4556 BN6 17 ILE W  310 ? ILE 1 317  . ? 1_555 ? 
4557 BN6 17 CLA HM .   ? CLA 1 1110 . ? 1_555 ? 
4558 BN6 17 BCR NN .   ? BCR 1 4001 . ? 1_555 ? 
4559 BN6 17 BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
4560 BN6 17 BCR PN .   ? BCR 1 4003 . ? 1_555 ? 
4561 BN6 17 PRO EA 56  ? PRO 8 64   . ? 1_555 ? 
4562 BN6 17 LEU EA 59  ? LEU 8 67   . ? 1_555 ? 
4563 BN6 17 ALA EA 60  ? ALA 8 68   . ? 1_555 ? 
4564 BN6 17 SER EA 63  ? SER 8 71   . ? 1_555 ? 
4565 BN6 17 BCR VQ .   ? BCR 8 4001 . ? 1_555 ? 
4566 BN7 20 MET W  190 ? MET 1 197  . ? 1_555 ? 
4567 BN7 20 LEU W  194 ? LEU 1 201  . ? 1_555 ? 
4568 BN7 20 LEU W  198 ? LEU 1 205  . ? 1_555 ? 
4569 BN7 20 LEU W  296 ? LEU 1 303  . ? 1_555 ? 
4570 BN7 20 PHE W  297 ? PHE 1 304  . ? 1_555 ? 
4571 BN7 20 ALA W  300 ? ALA 1 307  . ? 1_555 ? 
4572 BN7 20 MET W  303 ? MET 1 310  . ? 1_555 ? 
4573 BN7 20 TYR W  304 ? TYR 1 311  . ? 1_555 ? 
4574 BN7 20 ILE W  317 ? ILE 1 324  . ? 1_555 ? 
4575 BN7 20 VAL W  546 ? VAL 1 553  . ? 1_555 ? 
4576 BN7 20 CLA OM .   ? CLA 1 1117 . ? 1_555 ? 
4577 BN7 20 CLA RM .   ? CLA 1 1120 . ? 1_555 ? 
4578 BN7 20 CLA SM .   ? CLA 1 1121 . ? 1_555 ? 
4579 BN7 20 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
4580 BN7 20 CLA UM .   ? CLA 1 1123 . ? 1_555 ? 
4581 BN7 20 CLA WM .   ? CLA 1 1125 . ? 1_555 ? 
4582 BN7 20 CLA YM .   ? CLA 1 1127 . ? 1_555 ? 
4583 BN7 20 BCR QN .   ? BCR 1 4007 . ? 1_555 ? 
4584 BN7 20 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4585 BN7 20 HOH DS .   ? HOH 1 8027 . ? 1_555 ? 
4586 BN8 13 ILE W  299 ? ILE 1 306  . ? 1_555 ? 
4587 BN8 13 MET W  303 ? MET 1 310  . ? 1_555 ? 
4588 BN8 13 ILE W  310 ? ILE 1 317  . ? 1_555 ? 
4589 BN8 13 GLY W  311 ? GLY 1 318  . ? 1_555 ? 
4590 BN8 13 HIS W  312 ? HIS 1 319  . ? 1_555 ? 
4591 BN8 13 CLA MM .   ? CLA 1 1115 . ? 1_555 ? 
4592 BN8 13 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4593 BN8 13 CLA SM .   ? CLA 1 1121 . ? 1_555 ? 
4594 BN8 13 CLA EN .   ? CLA 1 1134 . ? 1_555 ? 
4595 BN8 13 BCR NN .   ? BCR 1 4001 . ? 1_555 ? 
4596 BN8 13 ALA EA 32  ? ALA 8 40   . ? 1_555 ? 
4597 BN8 13 GLN EA 34  ? GLN 8 42   . ? 1_555 ? 
4598 BN8 13 LEU EA 68  ? LEU 8 76   . ? 1_555 ? 
4599 BN9 8  HIS W  312 ? HIS 1 319  . ? 1_555 ? 
4600 BN9 8  ILE W  317 ? ILE 1 324  . ? 1_555 ? 
4601 BN9 8  ALA W  320 ? ALA 1 327  . ? 1_555 ? 
4602 BN9 8  HIS W  321 ? HIS 1 328  . ? 1_555 ? 
4603 BN9 8  CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4604 BN9 8  CLA RM .   ? CLA 1 1120 . ? 1_555 ? 
4605 BN9 8  CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
4606 BN9 8  LHG WL .   ? LHG 1 5007 . ? 1_555 ? 
4607 BO1 15 ILE W  317 ? ILE 1 324  . ? 1_555 ? 
4608 BO1 15 LEU W  318 ? LEU 1 325  . ? 1_555 ? 
4609 BO1 15 HIS W  330 ? HIS 1 337  . ? 1_555 ? 
4610 BO1 15 LEU W  333 ? LEU 1 340  . ? 1_555 ? 
4611 BO1 15 LEU W  418 ? LEU 1 425  . ? 1_555 ? 
4612 BO1 15 LEU W  419 ? LEU 1 426  . ? 1_555 ? 
4613 BO1 15 MET W  422 ? MET 1 429  . ? 1_555 ? 
4614 BO1 15 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4615 BO1 15 CLA UM .   ? CLA 1 1123 . ? 1_555 ? 
4616 BO1 15 CLA DN .   ? CLA 1 1133 . ? 1_555 ? 
4617 BO1 15 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
4618 BO1 15 CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
4619 BO1 15 BCR QN .   ? BCR 1 4007 . ? 1_555 ? 
4620 BO1 15 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4621 BO1 15 LHG VN .   ? LHG 1 5003 . ? 1_555 ? 
4622 BO2 21 HIS W  69  ? HIS 1 76   . ? 1_555 ? 
4623 BO2 21 PHE W  183 ? PHE 1 190  . ? 1_555 ? 
4624 BO2 21 MET W  189 ? MET 1 196  . ? 1_555 ? 
4625 BO2 21 MET W  190 ? MET 1 197  . ? 1_555 ? 
4626 BO2 21 HIS W  193 ? HIS 1 200  . ? 1_555 ? 
4627 BO2 21 MET W  314 ? MET 1 321  . ? 1_555 ? 
4628 BO2 21 LEU W  337 ? LEU 1 344  . ? 1_555 ? 
4629 BO2 21 THR W  338 ? THR 1 345  . ? 1_555 ? 
4630 BO2 21 THR W  339 ? THR 1 346  . ? 1_555 ? 
4631 BO2 21 SER W  340 ? SER 1 347  . ? 1_555 ? 
4632 BO2 21 TRP W  341 ? TRP 1 348  . ? 1_555 ? 
4633 BO2 21 GLN W  344 ? GLN 1 351  . ? 1_555 ? 
4634 BO2 21 ILE W  347 ? ILE 1 354  . ? 1_555 ? 
4635 BO2 21 ASN W  348 ? ASN 1 355  . ? 1_555 ? 
4636 BO2 21 LEU W  351 ? LEU 1 358  . ? 1_555 ? 
4637 BO2 21 CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4638 BO2 21 CLA IM .   ? CLA 1 1111 . ? 1_555 ? 
4639 BO2 21 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4640 BO2 21 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
4641 BO2 21 CLA YM .   ? CLA 1 1127 . ? 1_555 ? 
4642 BO2 21 BCR QN .   ? BCR 1 4007 . ? 1_555 ? 
4643 BO3 11 ILE W  358 ? ILE 1 365  . ? 1_555 ? 
4644 BO3 11 GLN W  361 ? GLN 1 368  . ? 1_555 ? 
4645 BO3 11 MET W  387 ? MET 1 394  . ? 1_555 ? 
4646 BO3 11 ILE W  394 ? ILE 1 401  . ? 1_555 ? 
4647 BO3 11 ILE W  535 ? ILE 1 542  . ? 1_555 ? 
4648 BO3 11 MET W  591 ? MET 1 598  . ? 1_555 ? 
4649 BO3 11 CLA WM .   ? CLA 1 1125 . ? 1_555 ? 
4650 BO3 11 CLA FN .   ? CLA 1 1135 . ? 1_555 ? 
4651 BO3 11 CLA GN .   ? CLA 1 1136 . ? 1_555 ? 
4652 BO3 11 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
4653 BO3 11 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4654 BO4 14 LEU W  351 ? LEU 1 358  . ? 1_555 ? 
4655 BO4 14 ILE W  358 ? ILE 1 365  . ? 1_555 ? 
4656 BO4 14 HIS W  362 ? HIS 1 369  . ? 1_555 ? 
4657 BO4 14 ALA W  365 ? ALA 1 372  . ? 1_555 ? 
4658 BO4 14 MET W  366 ? MET 1 373  . ? 1_555 ? 
4659 BO4 14 SER W  499 ? SER 1 506  . ? 1_555 ? 
4660 BO4 14 PHE W  502 ? PHE 1 509  . ? 1_555 ? 
4661 BO4 14 CLA NM .   ? CLA 1 1116 . ? 1_555 ? 
4662 BO4 14 CLA OM .   ? CLA 1 1117 . ? 1_555 ? 
4663 BO4 14 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4664 BO4 14 CLA VM .   ? CLA 1 1124 . ? 1_555 ? 
4665 BO4 14 CLA DN .   ? CLA 1 1133 . ? 1_555 ? 
4666 BO4 14 CLA FN .   ? CLA 1 1135 . ? 1_555 ? 
4667 BO4 14 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4668 BO5 18 TRP W  79  ? TRP 1 86   . ? 1_555 ? 
4669 BO5 18 THR W  133 ? THR 1 140  . ? 1_555 ? 
4670 BO5 18 SER W  381 ? SER 1 388  . ? 1_555 ? 
4671 BO5 18 THR W  384 ? THR 1 391  . ? 1_555 ? 
4672 BO5 18 HIS W  385 ? HIS 1 392  . ? 1_555 ? 
4673 BO5 18 TRP W  388 ? TRP 1 395  . ? 1_555 ? 
4674 BO5 18 ILE W  389 ? ILE 1 396  . ? 1_555 ? 
4675 BO5 18 ILE W  729 ? ILE 1 736  . ? 1_555 ? 
4676 BO5 18 THR W  732 ? THR 1 739  . ? 1_555 ? 
4677 BO5 18 TRP W  733 ? TRP 1 740  . ? 1_555 ? 
4678 BO5 18 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
4679 BO5 18 CLA BM .   ? CLA 1 1104 . ? 1_555 ? 
4680 BO5 18 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
4681 BO5 18 CLA YM .   ? CLA 1 1127 . ? 1_555 ? 
4682 BO5 18 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
4683 BO5 18 LHG TN .   ? LHG 1 5001 . ? 1_555 ? 
4684 BO5 18 CLA CO .   ? CLA 1 1012 . ? 1_555 ? 
4685 BO5 18 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
4686 BO6 19 LEU W  80  ? LEU 1 87   . ? 1_555 ? 
4687 BO6 19 SER W  134 ? SER 1 141  . ? 1_555 ? 
4688 BO6 19 GLY W  135 ? GLY 1 142  . ? 1_555 ? 
4689 BO6 19 LEU W  139 ? LEU 1 146  . ? 1_555 ? 
4690 BO6 19 LEU W  198 ? LEU 1 205  . ? 1_555 ? 
4691 BO6 19 LEU W  355 ? LEU 1 362  . ? 1_555 ? 
4692 BO6 19 THR W  356 ? THR 1 363  . ? 1_555 ? 
4693 BO6 19 MET W  363 ? MET 1 370  . ? 1_555 ? 
4694 BO6 19 TYR W  369 ? TYR 1 376  . ? 1_555 ? 
4695 BO6 19 LEU W  382 ? LEU 1 389  . ? 1_555 ? 
4696 BO6 19 HIS W  385 ? HIS 1 392  . ? 1_555 ? 
4697 BO6 19 HIS W  386 ? HIS 1 393  . ? 1_555 ? 
4698 BO6 19 ILE W  389 ? ILE 1 396  . ? 1_555 ? 
4699 BO6 19 CLA BM .   ? CLA 1 1104 . ? 1_555 ? 
4700 BO6 19 CLA OM .   ? CLA 1 1117 . ? 1_555 ? 
4701 BO6 19 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4702 BO6 19 CLA UM .   ? CLA 1 1123 . ? 1_555 ? 
4703 BO6 19 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
4704 BO6 19 BCR PN .   ? BCR 1 4003 . ? 1_555 ? 
4705 BO7 20 HIS W  45  ? HIS 1 52   . ? 1_555 ? 
4706 BO7 20 ALA W  46  ? ALA 1 53   . ? 1_555 ? 
4707 BO7 20 HIS W  49  ? HIS 1 56   . ? 1_555 ? 
4708 BO7 20 ASP W  50  ? ASP 1 57   . ? 1_555 ? 
4709 BO7 20 LEU W  345 ? LEU 1 352  . ? 1_555 ? 
4710 BO7 20 LEU W  349 ? LEU 1 356  . ? 1_555 ? 
4711 BO7 20 PHE W  392 ? PHE 1 399  . ? 1_555 ? 
4712 BO7 20 GLY W  396 ? GLY 1 403  . ? 1_555 ? 
4713 BO7 20 ALA W  399 ? ALA 1 406  . ? 1_555 ? 
4714 BO7 20 HIS W  400 ? HIS 1 407  . ? 1_555 ? 
4715 BO7 20 ILE W  403 ? ILE 1 410  . ? 1_555 ? 
4716 BO7 20 ARG W  407 ? ARG 1 414  . ? 1_555 ? 
4717 BO7 20 ARG W  564 ? ARG 1 571  . ? 1_555 ? 
4718 BO7 20 TRP W  581 ? TRP 1 588  . ? 1_555 ? 
4719 BO7 20 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
4720 BO7 20 CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4721 BO7 20 CLA BM .   ? CLA 1 1104 . ? 1_555 ? 
4722 BO7 20 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
4723 BO7 20 LHG TN .   ? LHG 1 5001 . ? 1_555 ? 
4724 BO7 20 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
4725 BO8 13 VAL FA 5   ? VAL 0 8    . ? 1_555 ? 
4726 BO8 13 THR FA 19  ? THR 0 22   . ? 1_555 ? 
4727 BO8 13 PRO FA 20  ? PRO 0 23   . ? 1_555 ? 
4728 BO8 13 ILE FA 21  ? ILE 0 24   . ? 1_555 ? 
4729 BO8 13 PHE W  325 ? PHE 1 332  . ? 1_555 ? 
4730 BO8 13 THR W  326 ? THR 1 333  . ? 1_555 ? 
4731 BO8 13 LEU W  418 ? LEU 1 425  . ? 1_555 ? 
4732 BO8 13 ARG W  421 ? ARG 1 428  . ? 1_555 ? 
4733 BO8 13 HIS W  425 ? HIS 1 432  . ? 1_555 ? 
4734 BO8 13 HIS W  432 ? HIS 1 439  . ? 1_555 ? 
4735 BO8 13 CLA YN .   ? CLA 1 1130 . ? 1_555 ? 
4736 BO8 13 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
4737 BO8 13 LHG VN .   ? LHG 1 5003 . ? 1_555 ? 
4738 BO9 16 LEU FA 65  ? LEU 0 68   . ? 1_555 ? 
4739 BO9 16 CLA BR .   ? CLA 0 1503 . ? 1_555 ? 
4740 BO9 16 TRP W  435 ? TRP 1 442  . ? 1_555 ? 
4741 BO9 16 PHE W  439 ? PHE 1 446  . ? 1_555 ? 
4742 BO9 16 PHE W  442 ? PHE 1 449  . ? 1_555 ? 
4743 BO9 16 HIS W  443 ? HIS 1 450  . ? 1_555 ? 
4744 BO9 16 CLA CN .   ? CLA 1 1132 . ? 1_555 ? 
4745 BO9 16 CLA GN .   ? CLA 1 1136 . ? 1_555 ? 
4746 BO9 16 LMG UN .   ? LMG 1 5002 . ? 1_555 ? 
4747 BO9 16 CLA EO .   ? CLA 2 1237 . ? 1_555 ? 
4748 BO9 16 CLA RP .   ? CLA 2 1238 . ? 1_555 ? 
4749 BO9 16 CLA SP .   ? CLA 2 1239 . ? 1_555 ? 
4750 BO9 16 BCR ZP .   ? BCR 2 4017 . ? 1_555 ? 
4751 BO9 16 ILE CA 34  ? ILE h 34   . ? 1_555 ? 
4752 BO9 16 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
4753 BO9 16 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
4754 BP1 22 PRO FA 61  ? PRO 0 64   . ? 1_555 ? 
4755 BP1 22 TRP FA 62  ? TRP 0 65   . ? 1_555 ? 
4756 BP1 22 LEU FA 65  ? LEU 0 68   . ? 1_555 ? 
4757 BP1 22 PRO FA 67  ? PRO 0 70   . ? 1_555 ? 
4758 BP1 22 ARG FA 69  ? ARG 0 72   . ? 1_555 ? 
4759 BP1 22 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
4760 BP1 22 BCR DR .   ? BCR 0 4022 . ? 1_555 ? 
4761 BP1 22 PHE W  442 ? PHE 1 449  . ? 1_555 ? 
4762 BP1 22 GLY W  446 ? GLY 1 453  . ? 1_555 ? 
4763 BP1 22 LEU W  447 ? LEU 1 454  . ? 1_555 ? 
4764 BP1 22 ILE W  449 ? ILE 1 456  . ? 1_555 ? 
4765 BP1 22 HIS W  450 ? HIS 1 457  . ? 1_555 ? 
4766 BP1 22 THR W  453 ? THR 1 460  . ? 1_555 ? 
4767 BP1 22 MET W  454 ? MET 1 461  . ? 1_555 ? 
4768 BP1 22 ARG W  459 ? ARG 1 466  . ? 1_555 ? 
4769 BP1 22 PHE W  464 ? PHE 1 471  . ? 1_555 ? 
4770 BP1 22 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
4771 BP1 22 HOH DS .   ? HOH 1 8001 . ? 1_555 ? 
4772 BP1 22 CLA IO .   ? CLA 2 1023 . ? 1_555 ? 
4773 BP1 22 CLA PO .   ? CLA 2 1207 . ? 1_555 ? 
4774 BP1 22 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
4775 BP1 22 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
4776 BP2 13 TRP W  478 ? TRP 1 485  . ? 1_555 ? 
4777 BP2 13 LEU W  482 ? LEU 1 489  . ? 1_555 ? 
4778 BP2 13 HIS W  483 ? HIS 1 490  . ? 1_555 ? 
4779 BP2 13 ALA W  486 ? ALA 1 493  . ? 1_555 ? 
4780 BP2 13 THR W  490 ? THR 1 497  . ? 1_555 ? 
4781 BP2 13 ALA W  491 ? ALA 1 498  . ? 1_555 ? 
4782 BP2 13 CLA NM .   ? CLA 1 1116 . ? 1_555 ? 
4783 BP2 13 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
4784 BP2 13 CLA WM .   ? CLA 1 1125 . ? 1_555 ? 
4785 BP2 13 CLA EN .   ? CLA 1 1134 . ? 1_555 ? 
4786 BP2 13 CLA FN .   ? CLA 1 1135 . ? 1_555 ? 
4787 BP2 13 CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
4788 BP2 13 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4789 BP3 12 PHE W  270 ? PHE 1 277  . ? 1_555 ? 
4790 BP3 12 THR W  490 ? THR 1 497  . ? 1_555 ? 
4791 BP3 12 PRO W  492 ? PRO 1 499  . ? 1_555 ? 
4792 BP3 12 ASN W  493 ? ASN 1 500  . ? 1_555 ? 
4793 BP3 12 CLA MM .   ? CLA 1 1115 . ? 1_555 ? 
4794 BP3 12 CLA NM .   ? CLA 1 1116 . ? 1_555 ? 
4795 BP3 12 CLA RM .   ? CLA 1 1120 . ? 1_555 ? 
4796 BP3 12 CLA DN .   ? CLA 1 1133 . ? 1_555 ? 
4797 BP3 12 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4798 BP3 12 LHG VL .   ? LHG 1 5005 . ? 1_555 ? 
4799 BP3 12 SER EA 79  ? SER 8 87   . ? 1_555 ? 
4800 BP3 12 CLA TQ .   ? CLA 8 1401 . ? 1_555 ? 
4801 BP4 20 GLN W  361 ? GLN 1 368  . ? 1_555 ? 
4802 BP4 20 TYR W  364 ? TYR 1 371  . ? 1_555 ? 
4803 BP4 20 PHE W  475 ? PHE 1 482  . ? 1_555 ? 
4804 BP4 20 TRP W  478 ? TRP 1 485  . ? 1_555 ? 
4805 BP4 20 VAL W  479 ? VAL 1 486  . ? 1_555 ? 
4806 BP4 20 GLN W  480 ? GLN 1 487  . ? 1_555 ? 
4807 BP4 20 HIS W  483 ? HIS 1 490  . ? 1_555 ? 
4808 BP4 20 PHE W  502 ? PHE 1 509  . ? 1_555 ? 
4809 BP4 20 HIS W  528 ? HIS 1 535  . ? 1_555 ? 
4810 BP4 20 HIS W  531 ? HIS 1 538  . ? 1_555 ? 
4811 BP4 20 ILE W  535 ? ILE 1 542  . ? 1_555 ? 
4812 BP4 20 VAL W  598 ? VAL 1 605  . ? 1_555 ? 
4813 BP4 20 HIS W  601 ? HIS 1 608  . ? 1_555 ? 
4814 BP4 20 PHE W  602 ? PHE 1 609  . ? 1_555 ? 
4815 BP4 20 LYS W  605 ? LYS 1 612  . ? 1_555 ? 
4816 BP4 20 CLA VM .   ? CLA 1 1124 . ? 1_555 ? 
4817 BP4 20 CLA WM .   ? CLA 1 1125 . ? 1_555 ? 
4818 BP4 20 CLA DN .   ? CLA 1 1133 . ? 1_555 ? 
4819 BP4 20 CLA GN .   ? CLA 1 1136 . ? 1_555 ? 
4820 BP4 20 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
4821 BP5 15 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
4822 BP5 15 PHE W  439 ? PHE 1 446  . ? 1_555 ? 
4823 BP5 15 PRO W  473 ? PRO 1 480  . ? 1_555 ? 
4824 BP5 15 ILE W  474 ? ILE 1 481  . ? 1_555 ? 
4825 BP5 15 PHE W  475 ? PHE 1 482  . ? 1_555 ? 
4826 BP5 15 ALA W  476 ? ALA 1 483  . ? 1_555 ? 
4827 BP5 15 PHE W  525 ? PHE 1 532  . ? 1_555 ? 
4828 BP5 15 HIS W  528 ? HIS 1 535  . ? 1_555 ? 
4829 BP5 15 HIS W  529 ? HIS 1 536  . ? 1_555 ? 
4830 BP5 15 HIS W  536 ? HIS 1 543  . ? 1_555 ? 
4831 BP5 15 CLA VM .   ? CLA 1 1124 . ? 1_555 ? 
4832 BP5 15 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
4833 BP5 15 CLA FN .   ? CLA 1 1135 . ? 1_555 ? 
4834 BP5 15 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
4835 BP5 15 LMG UN .   ? LMG 1 5002 . ? 1_555 ? 
4836 BP6 13 ILE W  429 ? ILE 1 436  . ? 1_555 ? 
4837 BP6 13 LEU W  433 ? LEU 1 440  . ? 1_555 ? 
4838 BP6 13 VAL W  436 ? VAL 1 443  . ? 1_555 ? 
4839 BP6 13 ALA W  532 ? ALA 1 539  . ? 1_555 ? 
4840 BP6 13 HIS W  536 ? HIS 1 543  . ? 1_555 ? 
4841 BP6 13 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
4842 BP6 13 CLA VM .   ? CLA 1 1124 . ? 1_555 ? 
4843 BP6 13 CLA AN .   ? CLA 1 1129 . ? 1_555 ? 
4844 BP6 13 CLA YN .   ? CLA 1 1130 . ? 1_555 ? 
4845 BP6 13 CLA FN .   ? CLA 1 1135 . ? 1_555 ? 
4846 BP6 13 CLA GN .   ? CLA 1 1136 . ? 1_555 ? 
4847 BP6 13 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4848 BP6 13 LHG VN .   ? LHG 1 5003 . ? 1_555 ? 
4849 BP7 14 ILE W  693 ? ILE 1 700  . ? 1_555 ? 
4850 BP7 14 HIS W  697 ? HIS 1 704  . ? 1_555 ? 
4851 BP7 14 LEU W  700 ? LEU 1 707  . ? 1_555 ? 
4852 BP7 14 VAL W  702 ? VAL 1 709  . ? 1_555 ? 
4853 BP7 14 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
4854 BP7 14 CLA ZN .   ? CLA 1 1139 . ? 1_555 ? 
4855 BP7 14 PQN LN .   ? PQN 1 2001 . ? 1_555 ? 
4856 BP7 14 SER X  418 ? SER 2 418  . ? 1_555 ? 
4857 BP7 14 SER X  421 ? SER 2 421  . ? 1_555 ? 
4858 BP7 14 TRP X  422 ? TRP 2 422  . ? 1_555 ? 
4859 BP7 14 CLA KP .   ? CLA 2 1228 . ? 1_555 ? 
4860 BP7 14 CLA LP .   ? CLA 2 1229 . ? 1_555 ? 
4861 BP7 14 GLY BA 80  ? GLY 6 80   . ? 1_555 ? 
4862 BP7 14 CLA JQ .   ? CLA 6 1301 . ? 1_555 ? 
4863 BP8 17 TRP W  42  ? TRP 1 49   . ? 1_555 ? 
4864 BP8 17 PHE W  670 ? PHE 1 677  . ? 1_555 ? 
4865 BP8 17 PHE W  674 ? PHE 1 681  . ? 1_555 ? 
4866 BP8 17 LEU W  711 ? LEU 1 718  . ? 1_555 ? 
4867 BP8 17 VAL W  719 ? VAL 1 726  . ? 1_555 ? 
4868 BP8 17 HIS W  723 ? HIS 1 730  . ? 1_555 ? 
4869 BP8 17 LEU W  726 ? LEU 1 733  . ? 1_555 ? 
4870 BP8 17 CLA YL .   ? CLA 1 1013 . ? 1_555 ? 
4871 BP8 17 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
4872 BP8 17 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
4873 BP8 17 CLA ZM .   ? CLA 1 1128 . ? 1_555 ? 
4874 BP8 17 PQN LN .   ? PQN 1 2001 . ? 1_555 ? 
4875 BP8 17 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
4876 BP8 17 LHG TN .   ? LHG 1 5001 . ? 1_555 ? 
4877 BP8 17 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
4878 BP8 17 MET DA 16  ? MET 7 16   . ? 1_555 ? 
4879 BP8 17 BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
4880 BP9 13 SQD FR .   ? SQD 0 5005 . ? 1_555 ? 
4881 BP9 13 LYS W  322 ? LYS 1 329  . ? 1_555 ? 
4882 BP9 13 PRO W  324 ? PRO 1 331  . ? 1_555 ? 
4883 BP9 13 PHE W  325 ? PHE 1 332  . ? 1_555 ? 
4884 BP9 13 CLA SM .   ? CLA 1 1121 . ? 1_555 ? 
4885 BP9 13 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
4886 BP9 13 CLA DN .   ? CLA 1 1133 . ? 1_555 ? 
4887 BP9 13 BCR QN .   ? BCR 1 4007 . ? 1_555 ? 
4888 BP9 13 LHG VN .   ? LHG 1 5003 . ? 1_555 ? 
4889 BP9 13 LHG WL .   ? LHG 1 5007 . ? 1_555 ? 
4890 BP9 13 LEU B  148 ? LEU B 148  . ? 1_555 ? 
4891 BP9 13 SQD SE .   ? SQD B 5008 . ? 1_555 ? 
4892 BP9 13 HOH SR .   ? HOH M 8003 . ? 1_555 ? 
4893 BQ1 14 MET W  677 ? MET 1 684  . ? 1_555 ? 
4894 BQ1 14 PHE W  678 ? PHE 1 685  . ? 1_555 ? 
4895 BQ1 14 SER W  681 ? SER 1 688  . ? 1_555 ? 
4896 BQ1 14 TRP W  686 ? TRP 1 693  . ? 1_555 ? 
4897 BQ1 14 ALA W  710 ? ALA 1 717  . ? 1_555 ? 
4898 BQ1 14 LEU W  711 ? LEU 1 718  . ? 1_555 ? 
4899 BQ1 14 CLA YL .   ? CLA 1 1013 . ? 1_555 ? 
4900 BQ1 14 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
4901 BQ1 14 CLA IN .   ? CLA 1 1138 . ? 1_555 ? 
4902 BQ1 14 CLA ZN .   ? CLA 1 1139 . ? 1_555 ? 
4903 BQ1 14 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
4904 BQ1 14 HOH DS .   ? HOH 1 8031 . ? 1_555 ? 
4905 BQ1 14 BCR FQ .   ? BCR 2 4014 . ? 1_555 ? 
4906 BQ1 14 ILE DA 15  ? ILE 7 15   . ? 1_555 ? 
4907 BQ2 9  CYS W  567 ? CYS 1 574  . ? 1_555 ? 
4908 BQ2 9  GLY W  569 ? GLY 1 576  . ? 1_555 ? 
4909 BQ2 9  PRO W  570 ? PRO 1 577  . ? 1_555 ? 
4910 BQ2 9  CYS W  576 ? CYS 1 583  . ? 1_555 ? 
4911 BQ2 9  ARG W  717 ? ARG 1 724  . ? 1_555 ? 
4912 BQ2 9  CYS X  556 ? CYS 2 556  . ? 1_555 ? 
4913 BQ2 9  GLY X  558 ? GLY 2 558  . ? 1_555 ? 
4914 BQ2 9  PRO X  559 ? PRO 2 559  . ? 1_555 ? 
4915 BQ2 9  CYS X  565 ? CYS 2 565  . ? 1_555 ? 
4916 BQ3 16 LEU W  203 ? LEU 1 210  . ? 1_555 ? 
4917 BQ3 16 LEU W  253 ? LEU 1 260  . ? 1_555 ? 
4918 BQ3 16 PHE W  256 ? PHE 1 263  . ? 1_555 ? 
4919 BQ3 16 PHE W  257 ? PHE 1 264  . ? 1_555 ? 
4920 BQ3 16 LEU W  291 ? LEU 1 298  . ? 1_555 ? 
4921 BQ3 16 ILE W  298 ? ILE 1 305  . ? 1_555 ? 
4922 BQ3 16 HIS W  302 ? HIS 1 309  . ? 1_555 ? 
4923 BQ3 16 CLA KM .   ? CLA 1 1113 . ? 1_555 ? 
4924 BQ3 16 CLA PM .   ? CLA 1 1118 . ? 1_555 ? 
4925 BQ3 16 CLA RM .   ? CLA 1 1120 . ? 1_555 ? 
4926 BQ3 16 BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
4927 BQ3 16 ALA EA 60  ? ALA 8 68   . ? 1_555 ? 
4928 BQ3 16 SER EA 63  ? SER 8 71   . ? 1_555 ? 
4929 BQ3 16 PHE EA 64  ? PHE 8 72   . ? 1_555 ? 
4930 BQ3 16 ILE EA 67  ? ILE 8 75   . ? 1_555 ? 
4931 BQ3 16 BCR VQ .   ? BCR 8 4001 . ? 1_555 ? 
4932 BQ4 13 LEU W  80  ? LEU 1 87   . ? 1_555 ? 
4933 BQ4 13 TYR W  84  ? TYR 1 91   . ? 1_555 ? 
4934 BQ4 13 THR W  154 ? THR 1 161  . ? 1_555 ? 
4935 BQ4 13 GLY W  157 ? GLY 1 164  . ? 1_555 ? 
4936 BQ4 13 GLY W  158 ? GLY 1 165  . ? 1_555 ? 
4937 BQ4 13 CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4938 BQ4 13 CLA IM .   ? CLA 1 1111 . ? 1_555 ? 
4939 BQ4 13 CLA JM .   ? CLA 1 1112 . ? 1_555 ? 
4940 BQ4 13 CLA KM .   ? CLA 1 1113 . ? 1_555 ? 
4941 BQ4 13 CLA LM .   ? CLA 1 1114 . ? 1_555 ? 
4942 BQ4 13 CLA PM .   ? CLA 1 1118 . ? 1_555 ? 
4943 BQ4 13 BCR NN .   ? BCR 1 4001 . ? 1_555 ? 
4944 BQ4 13 CLA UQ .   ? CLA 8 1402 . ? 1_555 ? 
4945 BQ5 9  LEU W  200 ? LEU 1 207  . ? 1_555 ? 
4946 BQ5 9  GLY W  201 ? GLY 1 208  . ? 1_555 ? 
4947 BQ5 9  CLA AM .   ? CLA 1 1103 . ? 1_555 ? 
4948 BQ5 9  CLA BM .   ? CLA 1 1104 . ? 1_555 ? 
4949 BQ5 9  CLA IM .   ? CLA 1 1111 . ? 1_555 ? 
4950 BQ5 9  CLA JM .   ? CLA 1 1112 . ? 1_555 ? 
4951 BQ5 9  CLA OM .   ? CLA 1 1117 . ? 1_555 ? 
4952 BQ5 9  CLA PM .   ? CLA 1 1118 . ? 1_555 ? 
4953 BQ5 9  CLA YM .   ? CLA 1 1127 . ? 1_555 ? 
4954 BQ6 10 ALA W  343 ? ALA 1 350  . ? 1_555 ? 
4955 BQ6 10 ILE W  347 ? ILE 1 354  . ? 1_555 ? 
4956 BQ6 10 GLY W  401 ? GLY 1 408  . ? 1_555 ? 
4957 BQ6 10 PHE W  404 ? PHE 1 411  . ? 1_555 ? 
4958 BQ6 10 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4959 BQ6 10 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
4960 BQ6 10 CLA UM .   ? CLA 1 1123 . ? 1_555 ? 
4961 BQ6 10 CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
4962 BQ6 10 BCR RN .   ? BCR 1 4008 . ? 1_555 ? 
4963 BQ6 10 LHG VN .   ? LHG 1 5003 . ? 1_555 ? 
4964 BQ7 11 SER W  354 ? SER 1 361  . ? 1_555 ? 
4965 BQ7 11 ILE W  394 ? ILE 1 401  . ? 1_555 ? 
4966 BQ7 11 LEU W  542 ? LEU 1 549  . ? 1_555 ? 
4967 BQ7 11 CLA QM .   ? CLA 1 1119 . ? 1_555 ? 
4968 BQ7 11 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
4969 BQ7 11 CLA VM .   ? CLA 1 1124 . ? 1_555 ? 
4970 BQ7 11 CLA WM .   ? CLA 1 1125 . ? 1_555 ? 
4971 BQ7 11 CLA DN .   ? CLA 1 1133 . ? 1_555 ? 
4972 BQ7 11 CLA EN .   ? CLA 1 1134 . ? 1_555 ? 
4973 BQ7 11 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
4974 BQ7 11 BCR QN .   ? BCR 1 4007 . ? 1_555 ? 
4975 BQ8 6  TRP W  111 ? TRP 1 118  . ? 1_555 ? 
4976 BQ8 6  LEU W  159 ? LEU 1 166  . ? 1_555 ? 
4977 BQ8 6  ALA W  163 ? ALA 1 170  . ? 1_555 ? 
4978 BQ8 6  CLA CM .   ? CLA 1 1105 . ? 1_555 ? 
4979 BQ8 6  CLA RQ .   ? CLA 7 1302 . ? 1_555 ? 
4980 BQ8 6  BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
4981 BQ9 19 ASN W  43  ? ASN 1 50   . ? 1_555 ? 
4982 BQ9 19 HIS W  45  ? HIS 1 52   . ? 1_555 ? 
4983 BQ9 19 ALA W  46  ? ALA 1 53   . ? 1_555 ? 
4984 BQ9 19 ASN W  47  ? ASN 1 54   . ? 1_555 ? 
4985 BQ9 19 ARG W  564 ? ARG 1 571  . ? 1_555 ? 
4986 BQ9 19 LEU W  588 ? LEU 1 595  . ? 1_555 ? 
4987 BQ9 19 SER W  712 ? SER 1 719  . ? 1_555 ? 
4988 BQ9 19 ILE W  714 ? ILE 1 721  . ? 1_555 ? 
4989 BQ9 19 GLN W  715 ? GLN 1 722  . ? 1_555 ? 
4990 BQ9 19 VAL W  721 ? VAL 1 728  . ? 1_555 ? 
4991 BQ9 19 ALA W  722 ? ALA 1 729  . ? 1_555 ? 
4992 BQ9 19 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
4993 BQ9 19 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
4994 BQ9 19 CLA BM .   ? CLA 1 1104 . ? 1_555 ? 
4995 BQ9 19 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
4996 BQ9 19 CLA ZM .   ? CLA 1 1128 . ? 1_555 ? 
4997 BQ9 19 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
4998 BQ9 19 HOH DS .   ? HOH 1 8016 . ? 1_555 ? 
4999 BQ9 19 GLY AA 50  ? GLY 5 51   . ? 1_555 ? 
5000 BR1 11 ARG FA 69  ? ARG 0 72   . ? 1_555 ? 
5001 BR1 11 HIS W  443 ? HIS 1 450  . ? 1_555 ? 
5002 BR1 11 PHE W  464 ? PHE 1 471  . ? 1_555 ? 
5003 BR1 11 ALA W  468 ? ALA 1 475  . ? 1_555 ? 
5004 BR1 11 GLN W  470 ? GLN 1 477  . ? 1_555 ? 
5005 BR1 11 GLN W  472 ? GLN 1 479  . ? 1_555 ? 
5006 BR1 11 ILE W  474 ? ILE 1 481  . ? 1_555 ? 
5007 BR1 11 HIS W  529 ? HIS 1 536  . ? 1_555 ? 
5008 BR1 11 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
5009 BR1 11 CLA GN .   ? CLA 1 1136 . ? 1_555 ? 
5010 BR1 11 HOH DS .   ? HOH 1 8018 . ? 1_555 ? 
5011 BR2 15 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
5012 BR2 15 HIS W  321 ? HIS 1 328  . ? 1_555 ? 
5013 BR2 15 LYS W  322 ? LYS 1 329  . ? 1_555 ? 
5014 BR2 15 GLY W  323 ? GLY 1 330  . ? 1_555 ? 
5015 BR2 15 PRO W  324 ? PRO 1 331  . ? 1_555 ? 
5016 BR2 15 PHE W  325 ? PHE 1 332  . ? 1_555 ? 
5017 BR2 15 THR W  326 ? THR 1 333  . ? 1_555 ? 
5018 BR2 15 HIS W  330 ? HIS 1 337  . ? 1_555 ? 
5019 BR2 15 LEU W  418 ? LEU 1 425  . ? 1_555 ? 
5020 BR2 15 CLA TM .   ? CLA 1 1122 . ? 1_555 ? 
5021 BR2 15 CLA AN .   ? CLA 1 1129 . ? 1_555 ? 
5022 BR2 15 CLA YN .   ? CLA 1 1130 . ? 1_555 ? 
5023 BR2 15 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
5024 BR2 15 CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
5025 BR2 15 BCR QN .   ? BCR 1 4007 . ? 1_555 ? 
5026 BR3 7  ILE W  474 ? ILE 1 481  . ? 1_555 ? 
5027 BR3 7  GLN W  477 ? GLN 1 484  . ? 1_555 ? 
5028 BR3 7  TRP W  478 ? TRP 1 485  . ? 1_555 ? 
5029 BR3 7  GLN W  480 ? GLN 1 487  . ? 1_555 ? 
5030 BR3 7  HIS W  481 ? HIS 1 488  . ? 1_555 ? 
5031 BR3 7  VAL K  13  ? VAL M 13   . ? 1_555 ? 
5032 BR3 7  LHG EG .   ? LHG M 5001 . ? 1_555 ? 
5033 BR4 6  LHG XQ .   ? LHG 0 5004 . ? 1_555 ? 
5034 BR4 6  HIS W  481 ? HIS 1 488  . ? 1_555 ? 
5035 BR4 6  LEU W  482 ? LEU 1 489  . ? 1_555 ? 
5036 BR4 6  LEU W  485 ? LEU 1 492  . ? 1_555 ? 
5037 BR4 6  LHG VL .   ? LHG 1 5005 . ? 1_555 ? 
5038 BR4 6  LHG EG .   ? LHG M 5001 . ? 1_555 ? 
5039 BR5 18 HIS FA 16  ? HIS 0 19   . ? 1_555 ? 
5040 BR5 18 LEU FA 17  ? LEU 0 20   . ? 1_555 ? 
5041 BR5 18 THR FA 19  ? THR 0 22   . ? 1_555 ? 
5042 BR5 18 ILE FA 21  ? ILE 0 24   . ? 1_555 ? 
5043 BR5 18 SER FA 22  ? SER 0 25   . ? 1_555 ? 
5044 BR5 18 THR FA 27  ? THR 0 30   . ? 1_555 ? 
5045 BR5 18 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
5046 BR5 18 HIS W  432 ? HIS 1 439  . ? 1_555 ? 
5047 BR5 18 TRP W  435 ? TRP 1 442  . ? 1_555 ? 
5048 BR5 18 CLA AN .   ? CLA 1 1129 . ? 1_555 ? 
5049 BR5 18 CLA HN .   ? CLA 1 1137 . ? 1_555 ? 
5050 BR5 18 LHG VN .   ? LHG 1 5003 . ? 1_555 ? 
5051 BR5 18 ALA X  678 ? ALA 2 678  . ? 1_555 ? 
5052 BR5 18 ARG X  681 ? ARG 2 681  . ? 1_555 ? 
5053 BR5 18 THR X  682 ? THR 2 682  . ? 1_555 ? 
5054 BR5 18 PRO X  683 ? PRO 2 683  . ? 1_555 ? 
5055 BR5 18 CLA EO .   ? CLA 2 1237 . ? 1_555 ? 
5056 BR5 18 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
5057 BR6 22 THR W  38  ? THR 1 45   . ? 1_555 ? 
5058 BR6 22 ILE W  41  ? ILE 1 48   . ? 1_555 ? 
5059 BR6 22 TRP W  42  ? TRP 1 49   . ? 1_555 ? 
5060 BR6 22 ILE W  693 ? ILE 1 700  . ? 1_555 ? 
5061 BR6 22 VAL W  694 ? VAL 1 701  . ? 1_555 ? 
5062 BR6 22 HIS W  697 ? HIS 1 704  . ? 1_555 ? 
5063 BR6 22 VAL W  702 ? VAL 1 709  . ? 1_555 ? 
5064 BR6 22 PRO W  704 ? PRO 1 711  . ? 1_555 ? 
5065 BR6 22 PRO W  708 ? PRO 1 715  . ? 1_555 ? 
5066 BR6 22 ARG W  709 ? ARG 1 716  . ? 1_555 ? 
5067 BR6 22 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
5068 BR6 22 CLA IN .   ? CLA 1 1138 . ? 1_555 ? 
5069 BR6 22 PQN LN .   ? PQN 1 2001 . ? 1_555 ? 
5070 BR6 22 TYR BA 86  ? TYR 6 86   . ? 1_555 ? 
5071 BR6 22 GLU BA 100 ? GLU 6 100  . ? 1_555 ? 
5072 BR6 22 ILE BA 103 ? ILE 6 103  . ? 1_555 ? 
5073 BR6 22 MET BA 112 ? MET 6 112  . ? 1_555 ? 
5074 BR6 22 CLA JQ .   ? CLA 6 1301 . ? 1_555 ? 
5075 BR6 22 ALA DA 11  ? ALA 7 11   . ? 1_555 ? 
5076 BR6 22 MET DA 14  ? MET 7 14   . ? 1_555 ? 
5077 BR6 22 ILE DA 15  ? ILE 7 15   . ? 1_555 ? 
5078 BR6 22 LEU DA 18  ? LEU 7 18   . ? 1_555 ? 
5079 BR7 19 ILE W  41  ? ILE 1 48   . ? 1_555 ? 
5080 BR7 19 TRP W  42  ? TRP 1 49   . ? 1_555 ? 
5081 BR7 19 HIS W  45  ? HIS 1 52   . ? 1_555 ? 
5082 BR7 19 CLA YL .   ? CLA 1 1013 . ? 1_555 ? 
5083 BR7 19 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
5084 BR7 19 CLA GM .   ? CLA 1 1109 . ? 1_555 ? 
5085 BR7 19 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
5086 BR7 19 CLA IN .   ? CLA 1 1138 . ? 1_555 ? 
5087 BR7 19 CLA ZN .   ? CLA 1 1139 . ? 1_555 ? 
5088 BR7 19 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
5089 BR7 19 PQN LN .   ? PQN 1 2001 . ? 1_555 ? 
5090 BR7 19 LHG TN .   ? LHG 1 5001 . ? 1_555 ? 
5091 BR7 19 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
5092 BR7 19 BCR FQ .   ? BCR 2 4014 . ? 1_555 ? 
5093 BR7 19 VAL BA 101 ? VAL 6 101  . ? 1_555 ? 
5094 BR7 19 PHE DA 7   ? PHE 7 7    . ? 1_555 ? 
5095 BR7 19 ALA DA 11  ? ALA 7 11   . ? 1_555 ? 
5096 BR7 19 PRO DA 12  ? PRO 7 12   . ? 1_555 ? 
5097 BR7 19 BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
5098 BR8 13 VAL W  75  ? VAL 1 82   . ? 1_555 ? 
5099 BR8 13 CLA CM .   ? CLA 1 1105 . ? 1_555 ? 
5100 BR8 13 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
5101 BR8 13 CLA EM .   ? CLA 1 1107 . ? 1_555 ? 
5102 BR8 13 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
5103 BR8 13 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
5104 BR8 13 CLA CO .   ? CLA 1 1012 . ? 1_555 ? 
5105 BR8 13 CLA GQ .   ? CLA 2 1230 . ? 1_555 ? 
5106 BR8 13 ALA DA 23  ? ALA 7 23   . ? 1_555 ? 
5107 BR8 13 LEU DA 26  ? LEU 7 26   . ? 1_555 ? 
5108 BR8 13 ILE DA 27  ? ILE 7 27   . ? 1_555 ? 
5109 BR8 13 ASN DA 30  ? ASN 7 30   . ? 1_555 ? 
5110 BR8 13 BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
5111 BR9 20 LEU FA 85  ? LEU 0 88   . ? 1_555 ? 
5112 BR9 20 ALA FA 89  ? ALA 0 92   . ? 1_555 ? 
5113 BR9 20 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
5114 BR9 20 BCR CR .   ? BCR 0 4019 . ? 1_555 ? 
5115 BR9 20 SER W  431 ? SER 1 438  . ? 1_555 ? 
5116 BR9 20 ASN W  434 ? ASN 1 441  . ? 1_555 ? 
5117 BR9 20 TRP W  435 ? TRP 1 442  . ? 1_555 ? 
5118 BR9 20 ILE W  438 ? ILE 1 445  . ? 1_555 ? 
5119 BR9 20 CLA YN .   ? CLA 1 1130 . ? 1_555 ? 
5120 BR9 20 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
5121 BR9 20 HOH DS .   ? HOH 1 8019 . ? 1_555 ? 
5122 BR9 20 ILE X  675 ? ILE 2 675  . ? 1_555 ? 
5123 BR9 20 ALA X  678 ? ALA 2 678  . ? 1_555 ? 
5124 BR9 20 HIS X  679 ? HIS 2 679  . ? 1_555 ? 
5125 BR9 20 THR X  682 ? THR 2 682  . ? 1_555 ? 
5126 BR9 20 ALA X  685 ? ALA 2 685  . ? 1_555 ? 
5127 BR9 20 CLA RP .   ? CLA 2 1238 . ? 1_555 ? 
5128 BR9 20 BCR ZP .   ? BCR 2 4017 . ? 1_555 ? 
5129 BR9 20 HOH ES .   ? HOH 2 8019 . ? 1_555 ? 
5130 BR9 20 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
5131 BS1 16 ALA W  667 ? ALA 1 674  . ? 1_555 ? 
5132 BS1 16 PHE W  670 ? PHE 1 677  . ? 1_555 ? 
5133 BS1 16 VAL W  671 ? VAL 1 678  . ? 1_555 ? 
5134 BS1 16 VAL W  730 ? VAL 1 737  . ? 1_555 ? 
5135 BS1 16 TRP W  733 ? TRP 1 740  . ? 1_555 ? 
5136 BS1 16 CLA YL .   ? CLA 1 1013 . ? 1_555 ? 
5137 BS1 16 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
5138 BS1 16 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
5139 BS1 16 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
5140 BS1 16 CLA ZM .   ? CLA 1 1128 . ? 1_555 ? 
5141 BS1 16 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
5142 BS1 16 LEU X  432 ? LEU 2 432  . ? 1_555 ? 
5143 BS1 16 CLA CO .   ? CLA 1 1012 . ? 1_555 ? 
5144 BS1 16 CLA LP .   ? CLA 2 1229 . ? 1_555 ? 
5145 BS1 16 CLA GQ .   ? CLA 2 1230 . ? 1_555 ? 
5146 BS1 16 BCR FQ .   ? BCR 2 4014 . ? 1_555 ? 
5147 BS2 5  ARG W  455 ? ARG 1 462  . ? 1_555 ? 
5148 BS2 5  THR W  634 ? THR 1 641  . ? 1_555 ? 
5149 BS2 5  ASN W  636 ? ASN 1 643  . ? 1_555 ? 
5150 BS2 5  ARG W  640 ? ARG 1 647  . ? 1_555 ? 
5151 BS2 5  TYR X  632 ? TYR 2 632  . ? 1_555 ? 
5152 BS3 20 ILE W  663 ? ILE 1 670  . ? 1_555 ? 
5153 BS3 20 LEU W  666 ? LEU 1 673  . ? 1_555 ? 
5154 BS3 20 ALA W  667 ? ALA 1 674  . ? 1_555 ? 
5155 BS3 20 HIS W  669 ? HIS 1 676  . ? 1_555 ? 
5156 BS3 20 PHE W  670 ? PHE 1 677  . ? 1_555 ? 
5157 BS3 20 PHE W  672 ? PHE 1 679  . ? 1_555 ? 
5158 BS3 20 ALA W  673 ? ALA 1 680  . ? 1_555 ? 
5159 BS3 20 CLA XL .   ? CLA 1 1011 . ? 1_555 ? 
5160 BS3 20 CLA YL .   ? CLA 1 1013 . ? 1_555 ? 
5161 BS3 20 CLA XM .   ? CLA 1 1126 . ? 1_555 ? 
5162 BS3 20 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
5163 BS3 20 PHE X  578 ? PHE 2 578  . ? 1_555 ? 
5164 BS3 20 TRP X  579 ? TRP 2 579  . ? 1_555 ? 
5165 BS3 20 ASN X  582 ? ASN 2 582  . ? 1_555 ? 
5166 BS3 20 TRP X  586 ? TRP 2 586  . ? 1_555 ? 
5167 BS3 20 LEU X  613 ? LEU 2 613  . ? 1_555 ? 
5168 BS3 20 PHE X  617 ? PHE 2 617  . ? 1_555 ? 
5169 BS3 20 CLA HO .   ? CLA 2 1021 . ? 1_555 ? 
5170 BS3 20 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
5171 BS3 20 HOH ES .   ? HOH 2 8001 . ? 1_555 ? 
5172 BS4 23 LEU W  639 ? LEU 1 646  . ? 1_555 ? 
5173 BS4 23 LEU W  643 ? LEU 1 650  . ? 1_555 ? 
5174 BS4 23 TRP W  644 ? TRP 1 651  . ? 1_555 ? 
5175 BS4 23 CLA XL .   ? CLA 1 1011 . ? 1_555 ? 
5176 BS4 23 CLA DO .   ? CLA 2 1022 . ? 1_555 ? 
5177 BS4 23 THR X  431 ? THR 2 431  . ? 1_555 ? 
5178 BS4 23 TYR X  435 ? TYR 2 435  . ? 1_555 ? 
5179 BS4 23 ALA X  519 ? ALA 2 519  . ? 1_555 ? 
5180 BS4 23 TRP X  586 ? TRP 2 586  . ? 1_555 ? 
5181 BS4 23 PHE X  589 ? PHE 2 589  . ? 1_555 ? 
5182 BS4 23 LEU X  613 ? LEU 2 613  . ? 1_555 ? 
5183 BS4 23 TRP X  616 ? TRP 2 616  . ? 1_555 ? 
5184 BS4 23 LEU X  621 ? LEU 2 621  . ? 1_555 ? 
5185 BS4 23 SER X  625 ? SER 2 625  . ? 1_555 ? 
5186 BS4 23 ILE X  629 ? ILE 2 629  . ? 1_555 ? 
5187 BS4 23 PHE X  647 ? PHE 2 647  . ? 1_555 ? 
5188 BS4 23 HIS X  651 ? HIS 2 651  . ? 1_555 ? 
5189 BS4 23 TRP X  654 ? TRP 2 654  . ? 1_555 ? 
5190 BS4 23 TYR X  714 ? TYR 2 714  . ? 1_555 ? 
5191 BS4 23 THR X  717 ? THR 2 717  . ? 1_555 ? 
5192 BS4 23 TYR X  718 ? TYR 2 718  . ? 1_555 ? 
5193 BS4 23 PHE X  721 ? PHE 2 721  . ? 1_555 ? 
5194 BS4 23 CLA CO .   ? CLA 1 1012 . ? 1_555 ? 
5195 BS5 23 ASN W  434 ? ASN 1 441  . ? 1_555 ? 
5196 BS5 23 ILE W  438 ? ILE 1 445  . ? 1_555 ? 
5197 BS5 23 GLY W  441 ? GLY 1 448  . ? 1_555 ? 
5198 BS5 23 ILE W  449 ? ILE 1 456  . ? 1_555 ? 
5199 BS5 23 PHE W  533 ? PHE 1 540  . ? 1_555 ? 
5200 BS5 23 VAL W  537 ? VAL 1 544  . ? 1_555 ? 
5201 BS5 23 LEU W  540 ? LEU 1 547  . ? 1_555 ? 
5202 BS5 23 ILE W  541 ? ILE 1 548  . ? 1_555 ? 
5203 BS5 23 PHE W  589 ? PHE 1 596  . ? 1_555 ? 
5204 BS5 23 TRP W  590 ? TRP 1 597  . ? 1_555 ? 
5205 BS5 23 CLA DO .   ? CLA 2 1022 . ? 1_555 ? 
5206 BS5 23 CLA CN .   ? CLA 1 1132 . ? 1_555 ? 
5207 BS5 23 ALA X  655 ? ALA 2 655  . ? 1_555 ? 
5208 BS5 23 THR X  656 ? THR 2 656  . ? 1_555 ? 
5209 BS5 23 PHE X  658 ? PHE 2 658  . ? 1_555 ? 
5210 BS5 23 MET X  659 ? MET 2 659  . ? 1_555 ? 
5211 BS5 23 ILE X  662 ? ILE 2 662  . ? 1_555 ? 
5212 BS5 23 TYR X  667 ? TYR 2 667  . ? 1_555 ? 
5213 BS5 23 TRP X  668 ? TRP 2 668  . ? 1_555 ? 
5214 BS5 23 LEU X  671 ? LEU 2 671  . ? 1_555 ? 
5215 BS5 23 CLA SP .   ? CLA 2 1239 . ? 1_555 ? 
5216 BS5 23 BCR ZP .   ? BCR 2 4017 . ? 1_555 ? 
5217 BS5 23 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
5218 BS6 18 PHE X  8   ? PHE 2 8    . ? 1_555 ? 
5219 BS6 18 GLY X  24  ? GLY 2 24   . ? 1_555 ? 
5220 BS6 18 ILE X  25  ? ILE 2 25   . ? 1_555 ? 
5221 BS6 18 ALA X  28  ? ALA 2 28   . ? 1_555 ? 
5222 BS6 18 HIS X  29  ? HIS 2 29   . ? 1_555 ? 
5223 BS6 18 ILE X  56  ? ILE 2 56   . ? 1_555 ? 
5224 BS6 18 CLA KO .   ? CLA 2 1202 . ? 1_555 ? 
5225 BS6 18 CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5226 BS6 18 LMG BQ .   ? LMG 2 5002 . ? 1_555 ? 
5227 BS6 18 ALA GA 19  ? ALA 9 19   . ? 1_555 ? 
5228 BS6 18 SER GA 26  ? SER 9 26   . ? 1_555 ? 
5229 BS6 18 LEU GA 29  ? LEU 9 29   . ? 1_555 ? 
5230 BS6 18 TYR GA 30  ? TYR 9 30   . ? 1_555 ? 
5231 BS6 18 BCR HR .   ? BCR 9 4021 . ? 1_555 ? 
5232 BS6 18 MET CA 17  ? MET h 17   . ? 1_555 ? 
5233 BS6 18 VAL CA 18  ? VAL h 18   . ? 1_555 ? 
5234 BS6 18 LHG PL .   ? LHG l 5001 . ? 1_555 ? 
5235 BS6 18 LHG TL .   ? LHG l 5002 . ? 1_555 ? 
5236 BS7 21 HIS X  29  ? HIS 2 29   . ? 1_555 ? 
5237 BS7 21 PHE X  31  ? PHE 2 31   . ? 1_555 ? 
5238 BS7 21 TYR X  43  ? TYR 2 43   . ? 1_555 ? 
5239 BS7 21 ILE X  46  ? ILE 2 46   . ? 1_555 ? 
5240 BS7 21 SER X  49  ? SER 2 49   . ? 1_555 ? 
5241 BS7 21 HIS X  50  ? HIS 2 50   . ? 1_555 ? 
5242 BS7 21 HIS X  53  ? HIS 2 53   . ? 1_555 ? 
5243 BS7 21 ILE X  54  ? ILE 2 54   . ? 1_555 ? 
5244 BS7 21 ARG X  174 ? ARG 2 174  . ? 1_555 ? 
5245 BS7 21 LEU X  328 ? LEU 2 328  . ? 1_555 ? 
5246 BS7 21 HIS X  329 ? HIS 2 329  . ? 1_555 ? 
5247 BS7 21 GLN X  331 ? GLN 2 331  . ? 1_555 ? 
5248 BS7 21 LEU X  332 ? LEU 2 332  . ? 1_555 ? 
5249 BS7 21 ALA X  335 ? ALA 2 335  . ? 1_555 ? 
5250 BS7 21 LEU X  336 ? LEU 2 336  . ? 1_555 ? 
5251 BS7 21 CLA JO .   ? CLA 2 1201 . ? 1_555 ? 
5252 BS7 21 CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5253 BS7 21 CLA SO .   ? CLA 2 1210 . ? 1_555 ? 
5254 BS7 21 CLA DP .   ? CLA 2 1221 . ? 1_555 ? 
5255 BS7 21 CLA IP .   ? CLA 2 1226 . ? 1_555 ? 
5256 BS7 21 BCR WP .   ? BCR 2 4005 . ? 1_555 ? 
5257 BS8 14 HIS X  29  ? HIS 2 29   . ? 1_555 ? 
5258 BS8 14 HIS X  53  ? HIS 2 53   . ? 1_555 ? 
5259 BS8 14 TRP X  60  ? TRP 2 60   . ? 1_555 ? 
5260 BS8 14 LEU X  339 ? LEU 2 339  . ? 1_555 ? 
5261 BS8 14 PHE X  379 ? PHE 2 379  . ? 1_555 ? 
5262 BS8 14 LEU X  380 ? LEU 2 380  . ? 1_555 ? 
5263 BS8 14 CLA JO .   ? CLA 2 1201 . ? 1_555 ? 
5264 BS8 14 CLA KO .   ? CLA 2 1202 . ? 1_555 ? 
5265 BS8 14 CLA NO .   ? CLA 2 1205 . ? 1_555 ? 
5266 BS8 14 CLA GP .   ? CLA 2 1224 . ? 1_555 ? 
5267 BS8 14 CLA HP .   ? CLA 2 1225 . ? 1_555 ? 
5268 BS8 14 CLA IP .   ? CLA 2 1226 . ? 1_555 ? 
5269 BS8 14 BCR WP .   ? BCR 2 4005 . ? 1_555 ? 
5270 BS8 14 LMG BQ .   ? LMG 2 5002 . ? 1_555 ? 
5271 BS9 18 LEU X  59  ? LEU 2 59   . ? 1_555 ? 
5272 BS9 18 GLY X  63  ? GLY 2 63   . ? 1_555 ? 
5273 BS9 18 PHE X  66  ? PHE 2 66   . ? 1_555 ? 
5274 BS9 18 HIS X  67  ? HIS 2 67   . ? 1_555 ? 
5275 BS9 18 TRP X  70  ? TRP 2 70   . ? 1_555 ? 
5276 BS9 18 GLN X  71  ? GLN 2 71   . ? 1_555 ? 
5277 BS9 18 TRP X  92  ? TRP 2 92   . ? 1_555 ? 
5278 BS9 18 CLA NO .   ? CLA 2 1205 . ? 1_555 ? 
5279 BS9 18 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
5280 BS9 18 ALA GA 11  ? ALA 9 11   . ? 1_555 ? 
5281 BS9 18 BCR HR .   ? BCR 9 4021 . ? 1_555 ? 
5282 BS9 18 LEU CA 10  ? LEU h 10   . ? 1_555 ? 
5283 BS9 18 PRO CA 11  ? PRO h 11   . ? 1_555 ? 
5284 BS9 18 LEU CA 14  ? LEU h 14   . ? 1_555 ? 
5285 BS9 18 ILE CA 15  ? ILE h 15   . ? 1_555 ? 
5286 BS9 18 VAL CA 18  ? VAL h 18   . ? 1_555 ? 
5287 BS9 18 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
5288 BS9 18 LHG PL .   ? LHG l 5001 . ? 1_555 ? 
5289 BT1 14 ALA X  88  ? ALA 2 88   . ? 1_555 ? 
5290 BT1 14 HIS X  89  ? HIS 2 89   . ? 1_555 ? 
5291 BT1 14 ASN X  114 ? ASN 2 114  . ? 1_555 ? 
5292 BT1 14 ILE X  115 ? ILE 2 115  . ? 1_555 ? 
5293 BT1 14 TYR X  117 ? TYR 2 117  . ? 1_555 ? 
5294 BT1 14 SER X  118 ? SER 2 118  . ? 1_555 ? 
5295 BT1 14 VAL X  642 ? VAL 2 642  . ? 1_555 ? 
5296 BT1 14 TRP X  643 ? TRP 2 643  . ? 1_555 ? 
5297 BT1 14 MET X  646 ? MET 2 646  . ? 1_555 ? 
5298 BT1 14 CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5299 BT1 14 CLA MO .   ? CLA 2 1204 . ? 1_555 ? 
5300 BT1 14 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
5301 BT1 14 CLA GP .   ? CLA 2 1224 . ? 1_555 ? 
5302 BT1 14 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
5303 BT2 24 BCR CR .   ? BCR 0 4019 . ? 1_555 ? 
5304 BT2 24 ALA W  456 ? ALA 1 463  . ? 1_555 ? 
5305 BT2 24 LEU W  457 ? LEU 1 464  . ? 1_555 ? 
5306 BT2 24 CLA DO .   ? CLA 2 1022 . ? 1_555 ? 
5307 BT2 24 ILE X  91  ? ILE 2 91   . ? 1_555 ? 
5308 BT2 24 TRP X  92  ? TRP 2 92   . ? 1_555 ? 
5309 BT2 24 ASP X  93  ? ASP 2 93   . ? 1_555 ? 
5310 BT2 24 HIS X  95  ? HIS 2 95   . ? 1_555 ? 
5311 BT2 24 PHE X  96  ? PHE 2 96   . ? 1_555 ? 
5312 BT2 24 ASN X  114 ? ASN 2 114  . ? 1_555 ? 
5313 BT2 24 SER X  641 ? SER 2 641  . ? 1_555 ? 
5314 BT2 24 VAL X  642 ? VAL 2 642  . ? 1_555 ? 
5315 BT2 24 TRP X  645 ? TRP 2 645  . ? 1_555 ? 
5316 BT2 24 CLA MO .   ? CLA 2 1204 . ? 1_555 ? 
5317 BT2 24 CLA NO .   ? CLA 2 1205 . ? 1_555 ? 
5318 BT2 24 CLA PO .   ? CLA 2 1207 . ? 1_555 ? 
5319 BT2 24 CLA SP .   ? CLA 2 1239 . ? 1_555 ? 
5320 BT2 24 BCR ZP .   ? BCR 2 4017 . ? 1_555 ? 
5321 BT2 24 LMG BQ .   ? LMG 2 5002 . ? 1_555 ? 
5322 BT2 24 VAL CA 18  ? VAL h 18   . ? 1_555 ? 
5323 BT2 24 PHE CA 22  ? PHE h 22   . ? 1_555 ? 
5324 BT2 24 MET CA 27  ? MET h 27   . ? 1_555 ? 
5325 BT2 24 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
5326 BT2 24 LHG TL .   ? LHG l 5002 . ? 1_555 ? 
5327 BT3 14 TRP FA 62  ? TRP 0 65   . ? 1_555 ? 
5328 BT3 14 PRO FA 67  ? PRO 0 70   . ? 1_555 ? 
5329 BT3 14 ALA FA 84  ? ALA 0 87   . ? 1_555 ? 
5330 BT3 14 CLA DO .   ? CLA 2 1022 . ? 1_555 ? 
5331 BT3 14 CLA CN .   ? CLA 1 1132 . ? 1_555 ? 
5332 BT3 14 HIS X  95  ? HIS 2 95   . ? 1_555 ? 
5333 BT3 14 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
5334 BT3 14 TRP CA 20  ? TRP h 20   . ? 1_555 ? 
5335 BT3 14 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
5336 BT3 14 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
5337 BT3 14 LEU U  141 ? LEU l 141  . ? 1_555 ? 
5338 BT3 14 ILE U  151 ? ILE l 151  . ? 1_555 ? 
5339 BT3 14 PHE U  152 ? PHE l 152  . ? 1_555 ? 
5340 BT3 14 CLA ML .   ? CLA l 1503 . ? 1_555 ? 
5341 BT4 10 PHE X  47  ? PHE 2 47   . ? 1_555 ? 
5342 BT4 10 PHE X  51  ? PHE 2 51   . ? 1_555 ? 
5343 BT4 10 LEU X  148 ? LEU 2 148  . ? 1_555 ? 
5344 BT4 10 ALA X  152 ? ALA 2 152  . ? 1_555 ? 
5345 BT4 10 HIS X  156 ? HIS 2 156  . ? 1_555 ? 
5346 BT4 10 PHE X  161 ? PHE 2 161  . ? 1_555 ? 
5347 BT4 10 TRP X  167 ? TRP 2 167  . ? 1_555 ? 
5348 BT4 10 CLA RO .   ? CLA 2 1209 . ? 1_555 ? 
5349 BT4 10 CLA SO .   ? CLA 2 1210 . ? 1_555 ? 
5350 BT4 10 BCR WP .   ? BCR 2 4005 . ? 1_555 ? 
5351 BT5 10 TRP X  167 ? TRP 2 167  . ? 1_555 ? 
5352 BT5 10 SER X  173 ? SER 2 173  . ? 1_555 ? 
5353 BT5 10 HIS X  177 ? HIS 2 177  . ? 1_555 ? 
5354 BT5 10 THR X  293 ? THR 2 293  . ? 1_555 ? 
5355 BT5 10 ASN X  294 ? ASN 2 294  . ? 1_555 ? 
5356 BT5 10 TRP X  295 ? TRP 2 295  . ? 1_555 ? 
5357 BT5 10 CLA QO .   ? CLA 2 1208 . ? 1_555 ? 
5358 BT5 10 CLA SO .   ? CLA 2 1210 . ? 1_555 ? 
5359 BT5 10 CLA ZO .   ? CLA 2 1217 . ? 1_555 ? 
5360 BT5 10 BCR WP .   ? BCR 2 4005 . ? 1_555 ? 
5361 BT6 18 PHE X  47  ? PHE 2 47   . ? 1_555 ? 
5362 BT6 18 HIS X  50  ? HIS 2 50   . ? 1_555 ? 
5363 BT6 18 ILE X  54  ? ILE 2 54   . ? 1_555 ? 
5364 BT6 18 TRP X  123 ? TRP 2 123  . ? 1_555 ? 
5365 BT6 18 TRP X  167 ? TRP 2 167  . ? 1_555 ? 
5366 BT6 18 PHE X  168 ? PHE 2 168  . ? 1_555 ? 
5367 BT6 18 SER X  173 ? SER 2 173  . ? 1_555 ? 
5368 BT6 18 ARG X  174 ? ARG 2 174  . ? 1_555 ? 
5369 BT6 18 HIS X  177 ? HIS 2 177  . ? 1_555 ? 
5370 BT6 18 HIS X  178 ? HIS 2 178  . ? 1_555 ? 
5371 BT6 18 LEU X  182 ? LEU 2 182  . ? 1_555 ? 
5372 BT6 18 PHE X  183 ? PHE 2 183  . ? 1_555 ? 
5373 BT6 18 CLA KO .   ? CLA 2 1202 . ? 1_555 ? 
5374 BT6 18 CLA QO .   ? CLA 2 1208 . ? 1_555 ? 
5375 BT6 18 CLA RO .   ? CLA 2 1209 . ? 1_555 ? 
5376 BT6 18 CLA XO .   ? CLA 2 1215 . ? 1_555 ? 
5377 BT6 18 CLA HP .   ? CLA 2 1225 . ? 1_555 ? 
5378 BT6 18 BCR WP .   ? BCR 2 4005 . ? 1_555 ? 
5379 BT7 17 ILE X  127 ? ILE 2 127  . ? 1_555 ? 
5380 BT7 17 GLY X  128 ? GLY 2 128  . ? 1_555 ? 
5381 BT7 17 MET X  129 ? MET 2 129  . ? 1_555 ? 
5382 BT7 17 GLU X  134 ? GLU 2 134  . ? 1_555 ? 
5383 BT7 17 GLY X  138 ? GLY 2 138  . ? 1_555 ? 
5384 BT7 17 PHE X  141 ? PHE 2 141  . ? 1_555 ? 
5385 BT7 17 SER X  186 ? SER 2 186  . ? 1_555 ? 
5386 BT7 17 ALA X  189 ? ALA 2 189  . ? 1_555 ? 
5387 BT7 17 TRP X  190 ? TRP 2 190  . ? 1_555 ? 
5388 BT7 17 HIS X  193 ? HIS 2 193  . ? 1_555 ? 
5389 BT7 17 VAL X  197 ? VAL 2 197  . ? 1_555 ? 
5390 BT7 17 GLY X  208 ? GLY 2 208  . ? 1_555 ? 
5391 BT7 17 TRP X  209 ? TRP 2 209  . ? 1_555 ? 
5392 BT7 17 PHE X  212 ? PHE 2 212  . ? 1_555 ? 
5393 BT7 17 CLA UO .   ? CLA 2 1212 . ? 1_555 ? 
5394 BT7 17 CLA HP .   ? CLA 2 1225 . ? 1_555 ? 
5395 BT7 17 ECH XP .   ? ECH 2 4006 . ? 1_555 ? 
5396 BT8 13 LEU X  188 ? LEU 2 188  . ? 1_555 ? 
5397 BT8 13 VAL X  195 ? VAL 2 195  . ? 1_555 ? 
5398 BT8 13 HIS X  196 ? HIS 2 196  . ? 1_555 ? 
5399 BT8 13 PHE X  212 ? PHE 2 212  . ? 1_555 ? 
5400 BT8 13 THR X  215 ? THR 2 215  . ? 1_555 ? 
5401 BT8 13 PRO X  216 ? PRO 2 216  . ? 1_555 ? 
5402 BT8 13 PRO X  217 ? PRO 2 217  . ? 1_555 ? 
5403 BT8 13 LEU X  222 ? LEU 2 222  . ? 1_555 ? 
5404 BT8 13 LEU X  255 ? LEU 2 255  . ? 1_555 ? 
5405 BT8 13 LEU X  278 ? LEU 2 278  . ? 1_555 ? 
5406 BT8 13 CLA TO .   ? CLA 2 1211 . ? 1_555 ? 
5407 BT8 13 BCR VP .   ? BCR 2 4004 . ? 1_555 ? 
5408 BT8 13 ECH XP .   ? ECH 2 4006 . ? 1_555 ? 
5409 BT9 7  TRP X  230 ? TRP 2 230  . ? 1_555 ? 
5410 BT9 7  LEU X  255 ? LEU 2 255  . ? 1_555 ? 
5411 BT9 7  PHE X  257 ? PHE 2 257  . ? 1_555 ? 
5412 BT9 7  HIS X  275 ? HIS 2 275  . ? 1_555 ? 
5413 BT9 7  LEU X  278 ? LEU 2 278  . ? 1_555 ? 
5414 BT9 7  CLA WO .   ? CLA 2 1214 . ? 1_555 ? 
5415 BT9 7  LMG DQ .   ? LMG 2 5005 . ? 1_555 ? 
5416 BU1 16 PHE X  257 ? PHE 2 257  . ? 1_555 ? 
5417 BU1 16 LEU X  268 ? LEU 2 268  . ? 1_555 ? 
5418 BU1 16 ASP X  272 ? ASP 2 272  . ? 1_555 ? 
5419 BU1 16 HIS X  275 ? HIS 2 275  . ? 1_555 ? 
5420 BU1 16 HIS X  276 ? HIS 2 276  . ? 1_555 ? 
5421 BU1 16 ALA X  279 ? ALA 2 279  . ? 1_555 ? 
5422 BU1 16 ILE X  283 ? ILE 2 283  . ? 1_555 ? 
5423 BU1 16 HIS X  349 ? HIS 2 349  . ? 1_555 ? 
5424 BU1 16 LEU X  353 ? LEU 2 353  . ? 1_555 ? 
5425 BU1 16 TRP X  494 ? TRP 2 494  . ? 1_555 ? 
5426 BU1 16 CLA VO .   ? CLA 2 1213 . ? 1_555 ? 
5427 BU1 16 CLA XO .   ? CLA 2 1215 . ? 1_555 ? 
5428 BU1 16 CLA DP .   ? CLA 2 1221 . ? 1_555 ? 
5429 BU1 16 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5430 BU1 16 CLA MP .   ? CLA 2 1231 . ? 1_555 ? 
5431 BU1 16 CLA NP .   ? CLA 2 1232 . ? 1_555 ? 
5432 BU2 19 TRP X  123 ? TRP 2 123  . ? 1_555 ? 
5433 BU2 19 ILE X  127 ? ILE 2 127  . ? 1_555 ? 
5434 BU2 19 PHE X  183 ? PHE 2 183  . ? 1_555 ? 
5435 BU2 19 SER X  186 ? SER 2 186  . ? 1_555 ? 
5436 BU2 19 SER X  187 ? SER 2 187  . ? 1_555 ? 
5437 BU2 19 TRP X  190 ? TRP 2 190  . ? 1_555 ? 
5438 BU2 19 ILE X  273 ? ILE 2 273  . ? 1_555 ? 
5439 BU2 19 HIS X  276 ? HIS 2 276  . ? 1_555 ? 
5440 BU2 19 HIS X  277 ? HIS 2 277  . ? 1_555 ? 
5441 BU2 19 VAL X  346 ? VAL 2 346  . ? 1_555 ? 
5442 BU2 19 HIS X  349 ? HIS 2 349  . ? 1_555 ? 
5443 BU2 19 MET X  350 ? MET 2 350  . ? 1_555 ? 
5444 BU2 19 SER X  355 ? SER 2 355  . ? 1_555 ? 
5445 BU2 19 TYR X  356 ? TYR 2 356  . ? 1_555 ? 
5446 BU2 19 CLA SO .   ? CLA 2 1210 . ? 1_555 ? 
5447 BU2 19 CLA WO .   ? CLA 2 1214 . ? 1_555 ? 
5448 BU2 19 CLA DP .   ? CLA 2 1221 . ? 1_555 ? 
5449 BU2 19 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5450 BU2 19 CLA HP .   ? CLA 2 1225 . ? 1_555 ? 
5451 BU3 15 LEU X  175 ? LEU 2 175  . ? 1_555 ? 
5452 BU3 15 LEU X  179 ? LEU 2 179  . ? 1_555 ? 
5453 BU3 15 PHE X  183 ? PHE 2 183  . ? 1_555 ? 
5454 BU3 15 PHE X  284 ? PHE 2 284  . ? 1_555 ? 
5455 BU3 15 ALA X  287 ? ALA 2 287  . ? 1_555 ? 
5456 BU3 15 MET X  290 ? MET 2 290  . ? 1_555 ? 
5457 BU3 15 TYR X  291 ? TYR 2 291  . ? 1_555 ? 
5458 BU3 15 ILE X  301 ? ILE 2 301  . ? 1_555 ? 
5459 BU3 15 ILE X  304 ? ILE 2 304  . ? 1_555 ? 
5460 BU3 15 CLA AP .   ? CLA 2 1218 . ? 1_555 ? 
5461 BU3 15 CLA BP .   ? CLA 2 1219 . ? 1_555 ? 
5462 BU3 15 CLA CP .   ? CLA 2 1220 . ? 1_555 ? 
5463 BU3 15 CLA DP .   ? CLA 2 1221 . ? 1_555 ? 
5464 BU3 15 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5465 BU3 15 BCR YP .   ? BCR 2 4010 . ? 1_555 ? 
5466 BU4 9  ASN X  176 ? ASN 2 176  . ? 1_555 ? 
5467 BU4 9  HIS X  177 ? HIS 2 177  . ? 1_555 ? 
5468 BU4 9  ALA X  180 ? ALA 2 180  . ? 1_555 ? 
5469 BU4 9  HIS X  289 ? HIS 2 289  . ? 1_555 ? 
5470 BU4 9  THR X  293 ? THR 2 293  . ? 1_555 ? 
5471 BU4 9  TRP X  295 ? TRP 2 295  . ? 1_555 ? 
5472 BU4 9  ILE X  297 ? ILE 2 297  . ? 1_555 ? 
5473 BU4 9  CLA RO .   ? CLA 2 1209 . ? 1_555 ? 
5474 BU4 9  BCR VP .   ? BCR 2 4004 . ? 1_555 ? 
5475 BU5 9  ILE X  286 ? ILE 2 286  . ? 1_555 ? 
5476 BU5 9  HIS X  289 ? HIS 2 289  . ? 1_555 ? 
5477 BU5 9  MET X  290 ? MET 2 290  . ? 1_555 ? 
5478 BU5 9  ILE X  297 ? ILE 2 297  . ? 1_555 ? 
5479 BU5 9  GLY X  298 ? GLY 2 298  . ? 1_555 ? 
5480 BU5 9  HIS X  299 ? HIS 2 299  . ? 1_555 ? 
5481 BU5 9  CLA YO .   ? CLA 2 1216 . ? 1_555 ? 
5482 BU5 9  CLA BP .   ? CLA 2 1219 . ? 1_555 ? 
5483 BU5 9  BCR VP .   ? BCR 2 4004 . ? 1_555 ? 
5484 BU6 9  MET X  290 ? MET 2 290  . ? 1_555 ? 
5485 BU6 9  HIS X  299 ? HIS 2 299  . ? 1_555 ? 
5486 BU6 9  ILE X  304 ? ILE 2 304  . ? 1_555 ? 
5487 BU6 9  ALA X  307 ? ALA 2 307  . ? 1_555 ? 
5488 BU6 9  HIS X  308 ? HIS 2 308  . ? 1_555 ? 
5489 BU6 9  CLA YO .   ? CLA 2 1216 . ? 1_555 ? 
5490 BU6 9  CLA AP .   ? CLA 2 1218 . ? 1_555 ? 
5491 BU6 9  CLA TP .   ? CLA 2 1240 . ? 1_555 ? 
5492 BU6 9  BCR AQ .   ? BCR 2 4018 . ? 1_555 ? 
5493 BU7 12 LEU X  305 ? LEU 2 305  . ? 1_555 ? 
5494 BU7 12 HIS X  308 ? HIS 2 308  . ? 1_555 ? 
5495 BU7 12 HIS X  317 ? HIS 2 317  . ? 1_555 ? 
5496 BU7 12 VAL X  405 ? VAL 2 405  . ? 1_555 ? 
5497 BU7 12 LEU X  406 ? LEU 2 406  . ? 1_555 ? 
5498 BU7 12 MET X  409 ? MET 2 409  . ? 1_555 ? 
5499 BU7 12 CLA YO .   ? CLA 2 1216 . ? 1_555 ? 
5500 BU7 12 CLA DP .   ? CLA 2 1221 . ? 1_555 ? 
5501 BU7 12 CLA JP .   ? CLA 2 1227 . ? 1_555 ? 
5502 BU7 12 CLA TP .   ? CLA 2 1240 . ? 1_555 ? 
5503 BU7 12 BCR AQ .   ? BCR 2 4018 . ? 1_555 ? 
5504 BU7 12 LHG CQ .   ? LHG 2 5004 . ? 1_555 ? 
5505 BU8 19 ALA X  171 ? ALA 2 171  . ? 1_555 ? 
5506 BU8 19 ARG X  174 ? ARG 2 174  . ? 1_555 ? 
5507 BU8 19 LEU X  175 ? LEU 2 175  . ? 1_555 ? 
5508 BU8 19 HIS X  178 ? HIS 2 178  . ? 1_555 ? 
5509 BU8 19 PHE X  183 ? PHE 2 183  . ? 1_555 ? 
5510 BU8 19 ILE X  280 ? ILE 2 280  . ? 1_555 ? 
5511 BU8 19 ILE X  301 ? ILE 2 301  . ? 1_555 ? 
5512 BU8 19 TYR X  321 ? TYR 2 321  . ? 1_555 ? 
5513 BU8 19 ILE X  324 ? ILE 2 324  . ? 1_555 ? 
5514 BU8 19 ASN X  325 ? ASN 2 325  . ? 1_555 ? 
5515 BU8 19 LEU X  334 ? LEU 2 334  . ? 1_555 ? 
5516 BU8 19 SER X  338 ? SER 2 338  . ? 1_555 ? 
5517 BU8 19 ILE X  342 ? ILE 2 342  . ? 1_555 ? 
5518 BU8 19 CLA KO .   ? CLA 2 1202 . ? 1_555 ? 
5519 BU8 19 CLA WO .   ? CLA 2 1214 . ? 1_555 ? 
5520 BU8 19 CLA XO .   ? CLA 2 1215 . ? 1_555 ? 
5521 BU8 19 CLA YO .   ? CLA 2 1216 . ? 1_555 ? 
5522 BU8 19 CLA CP .   ? CLA 2 1220 . ? 1_555 ? 
5523 BU8 19 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5524 BU9 16 SER X  344 ? SER 2 344  . ? 1_555 ? 
5525 BU9 16 LEU X  345 ? LEU 2 345  . ? 1_555 ? 
5526 BU9 16 GLN X  348 ? GLN 2 348  . ? 1_555 ? 
5527 BU9 16 GLN X  374 ? GLN 2 374  . ? 1_555 ? 
5528 BU9 16 MET X  381 ? MET 2 381  . ? 1_555 ? 
5529 BU9 16 PHE X  385 ? PHE 2 385  . ? 1_555 ? 
5530 BU9 16 LEU X  524 ? LEU 2 524  . ? 1_555 ? 
5531 BU9 16 THR X  527 ? THR 2 527  . ? 1_555 ? 
5532 BU9 16 ALA X  528 ? ALA 2 528  . ? 1_555 ? 
5533 BU9 16 LEU X  587 ? LEU 2 587  . ? 1_555 ? 
5534 BU9 16 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5535 BU9 16 CLA OP .   ? CLA 2 1234 . ? 1_555 ? 
5536 BU9 16 CLA PP .   ? CLA 2 1235 . ? 1_555 ? 
5537 BU9 16 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5538 BU9 16 BCR YP .   ? BCR 2 4010 . ? 1_555 ? 
5539 BU9 16 HOH ES .   ? HOH 2 8003 . ? 1_555 ? 
5540 BV1 18 SER X  338 ? SER 2 338  . ? 1_555 ? 
5541 BV1 18 VAL X  341 ? VAL 2 341  . ? 1_555 ? 
5542 BV1 18 LEU X  345 ? LEU 2 345  . ? 1_555 ? 
5543 BV1 18 GLN X  348 ? GLN 2 348  . ? 1_555 ? 
5544 BV1 18 HIS X  349 ? HIS 2 349  . ? 1_555 ? 
5545 BV1 18 SER X  352 ? SER 2 352  . ? 1_555 ? 
5546 BV1 18 LEU X  353 ? LEU 2 353  . ? 1_555 ? 
5547 BV1 18 LEU X  505 ? LEU 2 505  . ? 1_555 ? 
5548 BV1 18 PHE X  506 ? PHE 2 506  . ? 1_555 ? 
5549 BV1 18 CLA WO .   ? CLA 2 1214 . ? 1_555 ? 
5550 BV1 18 CLA XO .   ? CLA 2 1215 . ? 1_555 ? 
5551 BV1 18 CLA YO .   ? CLA 2 1216 . ? 1_555 ? 
5552 BV1 18 CLA DP .   ? CLA 2 1221 . ? 1_555 ? 
5553 BV1 18 CLA EP .   ? CLA 2 1222 . ? 1_555 ? 
5554 BV1 18 CLA MP .   ? CLA 2 1231 . ? 1_555 ? 
5555 BV1 18 CLA OP .   ? CLA 2 1234 . ? 1_555 ? 
5556 BV1 18 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5557 BV1 18 BCR YP .   ? BCR 2 4010 . ? 1_555 ? 
5558 BV2 14 TRP X  60  ? TRP 2 60   . ? 1_555 ? 
5559 BV2 14 THR X  64  ? THR 2 64   . ? 1_555 ? 
5560 BV2 14 TYR X  117 ? TYR 2 117  . ? 1_555 ? 
5561 BV2 14 SER X  118 ? SER 2 118  . ? 1_555 ? 
5562 BV2 14 ALA X  368 ? ALA 2 368  . ? 1_555 ? 
5563 BV2 14 THR X  371 ? THR 2 371  . ? 1_555 ? 
5564 BV2 14 HIS X  372 ? HIS 2 372  . ? 1_555 ? 
5565 BV2 14 VAL X  715 ? VAL 2 715  . ? 1_555 ? 
5566 BV2 14 ALA X  719 ? ALA 2 719  . ? 1_555 ? 
5567 BV2 14 LEU X  722 ? LEU 2 722  . ? 1_555 ? 
5568 BV2 14 CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5569 BV2 14 CLA NO .   ? CLA 2 1205 . ? 1_555 ? 
5570 BV2 14 CLA HP .   ? CLA 2 1225 . ? 1_555 ? 
5571 BV2 14 LMG BQ .   ? LMG 2 5002 . ? 1_555 ? 
5572 BV3 21 TRP X  60  ? TRP 2 60   . ? 1_555 ? 
5573 BV3 21 THR X  61  ? THR 2 61   . ? 1_555 ? 
5574 BV3 21 SER X  118 ? SER 2 118  . ? 1_555 ? 
5575 BV3 21 GLY X  119 ? GLY 2 119  . ? 1_555 ? 
5576 BV3 21 TRP X  123 ? TRP 2 123  . ? 1_555 ? 
5577 BV3 21 ILE X  342 ? ILE 2 342  . ? 1_555 ? 
5578 BV3 21 THR X  343 ? THR 2 343  . ? 1_555 ? 
5579 BV3 21 VAL X  346 ? VAL 2 346  . ? 1_555 ? 
5580 BV3 21 MET X  350 ? MET 2 350  . ? 1_555 ? 
5581 BV3 21 TYR X  356 ? TYR 2 356  . ? 1_555 ? 
5582 BV3 21 LEU X  369 ? LEU 2 369  . ? 1_555 ? 
5583 BV3 21 HIS X  372 ? HIS 2 372  . ? 1_555 ? 
5584 BV3 21 HIS X  373 ? HIS 2 373  . ? 1_555 ? 
5585 BV3 21 ILE X  376 ? ILE 2 376  . ? 1_555 ? 
5586 BV3 21 CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5587 BV3 21 CLA SO .   ? CLA 2 1210 . ? 1_555 ? 
5588 BV3 21 CLA TO .   ? CLA 2 1211 . ? 1_555 ? 
5589 BV3 21 CLA XO .   ? CLA 2 1215 . ? 1_555 ? 
5590 BV3 21 CLA GP .   ? CLA 2 1224 . ? 1_555 ? 
5591 BV3 21 BCR WP .   ? BCR 2 4005 . ? 1_555 ? 
5592 BV3 21 ECH XP .   ? ECH 2 4006 . ? 1_555 ? 
5593 BV4 16 ALA X  26  ? ALA 2 26   . ? 1_555 ? 
5594 BV4 16 HIS X  29  ? HIS 2 29   . ? 1_555 ? 
5595 BV4 16 ASP X  30  ? ASP 2 30   . ? 1_555 ? 
5596 BV4 16 LEU X  332 ? LEU 2 332  . ? 1_555 ? 
5597 BV4 16 LEU X  336 ? LEU 2 336  . ? 1_555 ? 
5598 BV4 16 PHE X  379 ? PHE 2 379  . ? 1_555 ? 
5599 BV4 16 GLY X  383 ? GLY 2 383  . ? 1_555 ? 
5600 BV4 16 HIS X  387 ? HIS 2 387  . ? 1_555 ? 
5601 BV4 16 ILE X  390 ? ILE 2 390  . ? 1_555 ? 
5602 BV4 16 ARG X  394 ? ARG 2 394  . ? 1_555 ? 
5603 BV4 16 TYR X  552 ? TYR 2 552  . ? 1_555 ? 
5604 BV4 16 TRP X  570 ? TRP 2 570  . ? 1_555 ? 
5605 BV4 16 PHE X  573 ? PHE 2 573  . ? 1_555 ? 
5606 BV4 16 CLA KO .   ? CLA 2 1202 . ? 1_555 ? 
5607 BV4 16 CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5608 BV4 16 LMG BQ .   ? LMG 2 5002 . ? 1_555 ? 
5609 BV5 12 THR X  313 ? THR 2 313  . ? 1_555 ? 
5610 BV5 12 VAL X  405 ? VAL 2 405  . ? 1_555 ? 
5611 BV5 12 ARG X  408 ? ARG 2 408  . ? 1_555 ? 
5612 BV5 12 MET X  409 ? MET 2 409  . ? 1_555 ? 
5613 BV5 12 HIS X  412 ? HIS 2 412  . ? 1_555 ? 
5614 BV5 12 LEU X  416 ? LEU 2 416  . ? 1_555 ? 
5615 BV5 12 HIS X  419 ? HIS 2 419  . ? 1_555 ? 
5616 BV5 12 CLA CP .   ? CLA 2 1220 . ? 1_555 ? 
5617 BV5 12 CLA KP .   ? CLA 2 1228 . ? 1_555 ? 
5618 BV5 12 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5619 BV5 12 BCR AQ .   ? BCR 2 4018 . ? 1_555 ? 
5620 BV5 12 LHG CQ .   ? LHG 2 5004 . ? 1_555 ? 
5621 BV6 13 TRP W  695 ? TRP 1 702  . ? 1_555 ? 
5622 BV6 13 LYS W  699 ? LYS 1 706  . ? 1_555 ? 
5623 BV6 13 LEU W  700 ? LEU 1 707  . ? 1_555 ? 
5624 BV6 13 CLA IN .   ? CLA 1 1138 . ? 1_555 ? 
5625 BV6 13 HIS X  419 ? HIS 2 419  . ? 1_555 ? 
5626 BV6 13 TRP X  422 ? TRP 2 422  . ? 1_555 ? 
5627 BV6 13 CLA JP .   ? CLA 2 1227 . ? 1_555 ? 
5628 BV6 13 CLA LP .   ? CLA 2 1229 . ? 1_555 ? 
5629 BV6 13 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5630 BV6 13 LHG CQ .   ? LHG 2 5004 . ? 1_555 ? 
5631 BV6 13 VAL BA 132 ? VAL 6 132  . ? 1_555 ? 
5632 BV6 13 BCR LQ .   ? BCR 6 4016 . ? 1_555 ? 
5633 BV6 13 LHG MQ .   ? LHG 6 5001 . ? 1_555 ? 
5634 BV7 16 CLA IN .   ? CLA 1 1138 . ? 1_555 ? 
5635 BV7 16 TRP X  422 ? TRP 2 422  . ? 1_555 ? 
5636 BV7 16 LEU X  425 ? LEU 2 425  . ? 1_555 ? 
5637 BV7 16 PHE X  426 ? PHE 2 426  . ? 1_555 ? 
5638 BV7 16 HIS X  430 ? HIS 2 430  . ? 1_555 ? 
5639 BV7 16 CLA KP .   ? CLA 2 1228 . ? 1_555 ? 
5640 BV7 16 CLA GQ .   ? CLA 2 1230 . ? 1_555 ? 
5641 BV7 16 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
5642 BV7 16 BCR FQ .   ? BCR 2 4014 . ? 1_555 ? 
5643 BV7 16 PHE BA 65  ? PHE 6 65   . ? 1_555 ? 
5644 BV7 16 SER BA 69  ? SER 6 69   . ? 1_555 ? 
5645 BV7 16 PHE BA 72  ? PHE 6 72   . ? 1_555 ? 
5646 BV7 16 ALA BA 76  ? ALA 6 76   . ? 1_555 ? 
5647 BV7 16 ILE BA 79  ? ILE 6 79   . ? 1_555 ? 
5648 BV7 16 TRP BA 118 ? TRP 6 118  . ? 1_555 ? 
5649 BV7 16 BCR LQ .   ? BCR 6 4016 . ? 1_555 ? 
5650 BV8 8  SER X  465 ? SER 2 465  . ? 1_555 ? 
5651 BV8 8  TRP X  494 ? TRP 2 494  . ? 1_555 ? 
5652 BV8 8  CLA WO .   ? CLA 2 1214 . ? 1_555 ? 
5653 BV8 8  CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5654 BV8 8  CLA NP .   ? CLA 2 1232 . ? 1_555 ? 
5655 BV8 8  CLA OP .   ? CLA 2 1234 . ? 1_555 ? 
5656 BV8 8  BCR YP .   ? BCR 2 4010 . ? 1_555 ? 
5657 BV8 8  HOH ES .   ? HOH 2 8002 . ? 1_555 ? 
5658 BV9 8  LEU X  475 ? LEU 2 475  . ? 1_555 ? 
5659 BV9 8  ILE X  482 ? ILE 2 482  . ? 1_555 ? 
5660 BV9 8  THR X  486 ? THR 2 486  . ? 1_555 ? 
5661 BV9 8  ALA X  488 ? ALA 2 488  . ? 1_555 ? 
5662 BV9 8  TRP X  490 ? TRP 2 490  . ? 1_555 ? 
5663 BV9 8  CLA WO .   ? CLA 2 1214 . ? 1_555 ? 
5664 BV9 8  CLA MP .   ? CLA 2 1231 . ? 1_555 ? 
5665 BV9 8  LMG DQ .   ? LMG 2 5005 . ? 1_555 ? 
5666 BW1 18 GLN X  348 ? GLN 2 348  . ? 1_555 ? 
5667 BW1 18 TYR X  351 ? TYR 2 351  . ? 1_555 ? 
5668 BW1 18 TYR X  370 ? TYR 2 370  . ? 1_555 ? 
5669 BW1 18 PHE X  457 ? PHE 2 457  . ? 1_555 ? 
5670 BW1 18 ALA X  458 ? ALA 2 458  . ? 1_555 ? 
5671 BW1 18 ILE X  461 ? ILE 2 461  . ? 1_555 ? 
5672 BW1 18 GLN X  462 ? GLN 2 462  . ? 1_555 ? 
5673 BW1 18 LEU X  507 ? LEU 2 507  . ? 1_555 ? 
5674 BW1 18 HIS X  517 ? HIS 2 517  . ? 1_555 ? 
5675 BW1 18 ILE X  520 ? ILE 2 520  . ? 1_555 ? 
5676 BW1 18 LEU X  587 ? LEU 2 587  . ? 1_555 ? 
5677 BW1 18 TYR X  590 ? TYR 2 590  . ? 1_555 ? 
5678 BW1 18 TRP X  591 ? TRP 2 591  . ? 1_555 ? 
5679 BW1 18 CLA EP .   ? CLA 2 1222 . ? 1_555 ? 
5680 BW1 18 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5681 BW1 18 CLA MP .   ? CLA 2 1231 . ? 1_555 ? 
5682 BW1 18 CLA PP .   ? CLA 2 1235 . ? 1_555 ? 
5683 BW1 18 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5684 BW2 16 PHE X  426 ? PHE 2 426  . ? 1_555 ? 
5685 BW2 16 LEU X  427 ? LEU 2 427  . ? 1_555 ? 
5686 BW2 16 GLU X  454 ? GLU 2 454  . ? 1_555 ? 
5687 BW2 16 PRO X  455 ? PRO 2 455  . ? 1_555 ? 
5688 BW2 16 VAL X  456 ? VAL 2 456  . ? 1_555 ? 
5689 BW2 16 PHE X  457 ? PHE 2 457  . ? 1_555 ? 
5690 BW2 16 ALA X  458 ? ALA 2 458  . ? 1_555 ? 
5691 BW2 16 PHE X  514 ? PHE 2 514  . ? 1_555 ? 
5692 BW2 16 HIS X  517 ? HIS 2 517  . ? 1_555 ? 
5693 BW2 16 HIS X  518 ? HIS 2 518  . ? 1_555 ? 
5694 BW2 16 CLA EP .   ? CLA 2 1222 . ? 1_555 ? 
5695 BW2 16 CLA OP .   ? CLA 2 1234 . ? 1_555 ? 
5696 BW2 16 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5697 BW2 16 PHE BA 65  ? PHE 6 65   . ? 1_555 ? 
5698 BW2 16 BCR LQ .   ? BCR 6 4016 . ? 1_555 ? 
5699 BW2 16 ZEX QQ .   ? ZEX 7 4015 . ? 1_555 ? 
5700 BW3 14 LEU X  416 ? LEU 2 416  . ? 1_555 ? 
5701 BW3 14 LEU X  420 ? LEU 2 420  . ? 1_555 ? 
5702 BW3 14 TRP X  422 ? TRP 2 422  . ? 1_555 ? 
5703 BW3 14 VAL X  423 ? VAL 2 423  . ? 1_555 ? 
5704 BW3 14 ALA X  521 ? ALA 2 521  . ? 1_555 ? 
5705 BW3 14 HIS X  525 ? HIS 2 525  . ? 1_555 ? 
5706 BW3 14 CLA EP .   ? CLA 2 1222 . ? 1_555 ? 
5707 BW3 14 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5708 BW3 14 CLA JP .   ? CLA 2 1227 . ? 1_555 ? 
5709 BW3 14 CLA KP .   ? CLA 2 1228 . ? 1_555 ? 
5710 BW3 14 CLA OP .   ? CLA 2 1234 . ? 1_555 ? 
5711 BW3 14 CLA PP .   ? CLA 2 1235 . ? 1_555 ? 
5712 BW3 14 BCR YP .   ? BCR 2 4010 . ? 1_555 ? 
5713 BW3 14 LHG CQ .   ? LHG 2 5004 . ? 1_555 ? 
5714 BW4 24 TYR FA 96  ? TYR 0 99   . ? 1_555 ? 
5715 BW4 24 VAL FA 99  ? VAL 0 102  . ? 1_555 ? 
5716 BW4 24 THR FA 100 ? THR 0 103  . ? 1_555 ? 
5717 BW4 24 BCR CR .   ? BCR 0 4019 . ? 1_555 ? 
5718 BW4 24 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
5719 BW4 24 THR X  18  ? THR 2 18   . ? 1_555 ? 
5720 BW4 24 TRP X  22  ? TRP 2 22   . ? 1_555 ? 
5721 BW4 24 ILE X  675 ? ILE 2 675  . ? 1_555 ? 
5722 BW4 24 VAL X  676 ? VAL 2 676  . ? 1_555 ? 
5723 BW4 24 HIS X  679 ? HIS 2 679  . ? 1_555 ? 
5724 BW4 24 VAL X  688 ? VAL 2 688  . ? 1_555 ? 
5725 BW4 24 TRP X  690 ? TRP 2 690  . ? 1_555 ? 
5726 BW4 24 LYS X  691 ? LYS 2 691  . ? 1_555 ? 
5727 BW4 24 PRO X  694 ? PRO 2 694  . ? 1_555 ? 
5728 BW4 24 VAL X  695 ? VAL 2 695  . ? 1_555 ? 
5729 BW4 24 CLA EO .   ? CLA 2 1237 . ? 1_555 ? 
5730 BW4 24 CLA SP .   ? CLA 2 1239 . ? 1_555 ? 
5731 BW4 24 PQN UP .   ? PQN 2 2002 . ? 1_555 ? 
5732 BW4 24 HOH ES .   ? HOH 2 8011 . ? 1_555 ? 
5733 BW4 24 HOH ES .   ? HOH 2 8018 . ? 1_555 ? 
5734 BW4 24 PHE CA 31  ? PHE h 31   . ? 1_555 ? 
5735 BW4 24 GLU CA 35  ? GLU h 35   . ? 1_555 ? 
5736 BW4 24 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
5737 BW4 24 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
5738 BW5 15 SER FA 95  ? SER 0 98   . ? 1_555 ? 
5739 BW5 15 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
5740 BW5 15 PHE X  649 ? PHE 2 649  . ? 1_555 ? 
5741 BW5 15 LEU X  652 ? LEU 2 652  . ? 1_555 ? 
5742 BW5 15 VAL X  653 ? VAL 2 653  . ? 1_555 ? 
5743 BW5 15 THR X  656 ? THR 2 656  . ? 1_555 ? 
5744 BW5 15 PHE X  660 ? PHE 2 660  . ? 1_555 ? 
5745 BW5 15 HIS X  709 ? HIS 2 709  . ? 1_555 ? 
5746 BW5 15 CLA IO .   ? CLA 2 1023 . ? 1_555 ? 
5747 BW5 15 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
5748 BW5 15 CLA RP .   ? CLA 2 1238 . ? 1_555 ? 
5749 BW5 15 PQN UP .   ? PQN 2 2002 . ? 1_555 ? 
5750 BW5 15 BCR ZP .   ? BCR 2 4017 . ? 1_555 ? 
5751 BW5 15 LMG BQ .   ? LMG 2 5002 . ? 1_555 ? 
5752 BW5 15 ALA CA 24  ? ALA h 24   . ? 1_555 ? 
5753 BW6 7  LYS X  309 ? LYS 2 309  . ? 1_555 ? 
5754 BW6 7  GLY X  310 ? GLY 2 310  . ? 1_555 ? 
5755 BW6 7  PRO X  311 ? PRO 2 311  . ? 1_555 ? 
5756 BW6 7  CLA BP .   ? CLA 2 1219 . ? 1_555 ? 
5757 BW6 7  CLA CP .   ? CLA 2 1220 . ? 1_555 ? 
5758 BW6 7  BCR AQ .   ? BCR 2 4018 . ? 1_555 ? 
5759 BW6 7  LHG CQ .   ? LHG 2 5004 . ? 1_555 ? 
5760 BW7 14 BCR CR .   ? BCR 0 4019 . ? 1_555 ? 
5761 BW7 14 TRP X  22  ? TRP 2 22   . ? 1_555 ? 
5762 BW7 14 MET X  659 ? MET 2 659  . ? 1_555 ? 
5763 BW7 14 PHE X  660 ? PHE 2 660  . ? 1_555 ? 
5764 BW7 14 SER X  663 ? SER 2 663  . ? 1_555 ? 
5765 BW7 14 ARG X  665 ? ARG 2 665  . ? 1_555 ? 
5766 BW7 14 TRP X  668 ? TRP 2 668  . ? 1_555 ? 
5767 BW7 14 ILE X  672 ? ILE 2 672  . ? 1_555 ? 
5768 BW7 14 ALA X  696 ? ALA 2 696  . ? 1_555 ? 
5769 BW7 14 LEU X  697 ? LEU 2 697  . ? 1_555 ? 
5770 BW7 14 ALA X  702 ? ALA 2 702  . ? 1_555 ? 
5771 BW7 14 CLA RP .   ? CLA 2 1238 . ? 1_555 ? 
5772 BW7 14 CLA SP .   ? CLA 2 1239 . ? 1_555 ? 
5773 BW7 14 BCR ZP .   ? BCR 2 4017 . ? 1_555 ? 
5774 BW8 8  LEU X  188 ? LEU 2 188  . ? 1_555 ? 
5775 BW8 8  LEU X  278 ? LEU 2 278  . ? 1_555 ? 
5776 BW8 8  ILE X  285 ? ILE 2 285  . ? 1_555 ? 
5777 BW8 8  HIS X  289 ? HIS 2 289  . ? 1_555 ? 
5778 BW8 8  CLA UO .   ? CLA 2 1212 . ? 1_555 ? 
5779 BW8 8  CLA ZO .   ? CLA 2 1217 . ? 1_555 ? 
5780 BW8 8  CLA AP .   ? CLA 2 1218 . ? 1_555 ? 
5781 BW8 8  ECH XP .   ? ECH 2 4006 . ? 1_555 ? 
5782 BW9 8  PHE X  149 ? PHE 2 149  . ? 1_555 ? 
5783 BW9 8  GLY X  181 ? GLY 2 181  . ? 1_555 ? 
5784 BW9 8  CLA KO .   ? CLA 2 1202 . ? 1_555 ? 
5785 BW9 8  CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5786 BW9 8  CLA QO .   ? CLA 2 1208 . ? 1_555 ? 
5787 BW9 8  CLA RO .   ? CLA 2 1209 . ? 1_555 ? 
5788 BW9 8  CLA SO .   ? CLA 2 1210 . ? 1_555 ? 
5789 BW9 8  CLA HP .   ? CLA 2 1225 . ? 1_555 ? 
5790 BX1 12 THR X  61  ? THR 2 61   . ? 1_555 ? 
5791 BX1 12 LEU X  65  ? LEU 2 65   . ? 1_555 ? 
5792 BX1 12 PHE X  124 ? PHE 2 124  . ? 1_555 ? 
5793 BX1 12 MET X  129 ? MET 2 129  . ? 1_555 ? 
5794 BX1 12 PHE X  141 ? PHE 2 141  . ? 1_555 ? 
5795 BX1 12 LEU X  142 ? LEU 2 142  . ? 1_555 ? 
5796 BX1 12 TRP X  209 ? TRP 2 209  . ? 1_555 ? 
5797 BX1 12 LEU X  213 ? LEU 2 213  . ? 1_555 ? 
5798 BX1 12 CLA TO .   ? CLA 2 1211 . ? 1_555 ? 
5799 BX1 12 CLA UO .   ? CLA 2 1212 . ? 1_555 ? 
5800 BX1 12 CLA HP .   ? CLA 2 1225 . ? 1_555 ? 
5801 BX1 12 BCR VP .   ? BCR 2 4004 . ? 1_555 ? 
5802 BX2 13 PHE X  330 ? PHE 2 330  . ? 1_555 ? 
5803 BX2 13 LEU X  334 ? LEU 2 334  . ? 1_555 ? 
5804 BX2 13 VAL X  341 ? VAL 2 341  . ? 1_555 ? 
5805 BX2 13 PHE X  385 ? PHE 2 385  . ? 1_555 ? 
5806 BX2 13 GLY X  388 ? GLY 2 388  . ? 1_555 ? 
5807 BX2 13 PHE X  391 ? PHE 2 391  . ? 1_555 ? 
5808 BX2 13 PHE X  392 ? PHE 2 392  . ? 1_555 ? 
5809 BX2 13 CLA YO .   ? CLA 2 1216 . ? 1_555 ? 
5810 BX2 13 CLA EP .   ? CLA 2 1222 . ? 1_555 ? 
5811 BX2 13 CLA FP .   ? CLA 2 1223 . ? 1_555 ? 
5812 BX2 13 CLA MP .   ? CLA 2 1231 . ? 1_555 ? 
5813 BX2 13 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5814 BX2 13 BCR AQ .   ? BCR 2 4018 . ? 1_555 ? 
5815 BX3 12 ILE W  438 ? ILE 1 445  . ? 1_555 ? 
5816 BX3 12 CLA DO .   ? CLA 2 1022 . ? 1_555 ? 
5817 BX3 12 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
5818 BX3 12 VAL X  642 ? VAL 2 642  . ? 1_555 ? 
5819 BX3 12 TRP X  645 ? TRP 2 645  . ? 1_555 ? 
5820 BX3 12 TRP X  668 ? TRP 2 668  . ? 1_555 ? 
5821 BX3 12 ILE X  672 ? ILE 2 672  . ? 1_555 ? 
5822 BX3 12 CLA IO .   ? CLA 2 1023 . ? 1_555 ? 
5823 BX3 12 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
5824 BX3 12 CLA EO .   ? CLA 2 1237 . ? 1_555 ? 
5825 BX3 12 CLA SP .   ? CLA 2 1239 . ? 1_555 ? 
5826 BX3 12 PQN UP .   ? PQN 2 2002 . ? 1_555 ? 
5827 BX4 5  CLA BP .   ? CLA 2 1219 . ? 1_555 ? 
5828 BX4 5  CLA CP .   ? CLA 2 1220 . ? 1_555 ? 
5829 BX4 5  CLA JP .   ? CLA 2 1227 . ? 1_555 ? 
5830 BX4 5  CLA TP .   ? CLA 2 1240 . ? 1_555 ? 
5831 BX4 5  BCR YP .   ? BCR 2 4010 . ? 1_555 ? 
5832 BX5 15 TYR X  23  ? TYR 2 23   . ? 1_555 ? 
5833 BX5 15 ALA X  26  ? ALA 2 26   . ? 1_555 ? 
5834 BX5 15 SER X  553 ? SER 2 553  . ? 1_555 ? 
5835 BX5 15 TRP X  570 ? TRP 2 570  . ? 1_555 ? 
5836 BX5 15 SER X  698 ? SER 2 698  . ? 1_555 ? 
5837 BX5 15 GLN X  701 ? GLN 2 701  . ? 1_555 ? 
5838 BX5 15 LEU X  704 ? LEU 2 704  . ? 1_555 ? 
5839 BX5 15 VAL X  712 ? VAL 2 712  . ? 1_555 ? 
5840 BX5 15 CLA JO .   ? CLA 2 1201 . ? 1_555 ? 
5841 BX5 15 CLA LO .   ? CLA 2 1203 . ? 1_555 ? 
5842 BX5 15 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
5843 BX5 15 CLA GP .   ? CLA 2 1224 . ? 1_555 ? 
5844 BX5 15 CLA IP .   ? CLA 2 1226 . ? 1_555 ? 
5845 BX5 15 CLA SP .   ? CLA 2 1239 . ? 1_555 ? 
5846 BX5 15 HOH ES .   ? HOH 2 8022 . ? 1_555 ? 
5847 BX6 11 HIS X  308 ? HIS 2 308  . ? 1_555 ? 
5848 BX6 11 LYS X  309 ? LYS 2 309  . ? 1_555 ? 
5849 BX6 11 GLY X  310 ? GLY 2 310  . ? 1_555 ? 
5850 BX6 11 PRO X  311 ? PRO 2 311  . ? 1_555 ? 
5851 BX6 11 LEU X  312 ? LEU 2 312  . ? 1_555 ? 
5852 BX6 11 THR X  313 ? THR 2 313  . ? 1_555 ? 
5853 BX6 11 CLA CP .   ? CLA 2 1220 . ? 1_555 ? 
5854 BX6 11 CLA JP .   ? CLA 2 1227 . ? 1_555 ? 
5855 BX6 11 CLA KP .   ? CLA 2 1228 . ? 1_555 ? 
5856 BX6 11 CLA QP .   ? CLA 2 1236 . ? 1_555 ? 
5857 BX6 11 CLA TP .   ? CLA 2 1240 . ? 1_555 ? 
5858 BX7 6  GLY X  228 ? GLY 2 228  . ? 1_555 ? 
5859 BX7 6  TRP X  230 ? TRP 2 230  . ? 1_555 ? 
5860 BX7 6  GLY X  231 ? GLY 2 231  . ? 1_555 ? 
5861 BX7 6  ALA X  489 ? ALA 2 489  . ? 1_555 ? 
5862 BX7 6  CLA VO .   ? CLA 2 1213 . ? 1_555 ? 
5863 BX7 6  CLA NP .   ? CLA 2 1232 . ? 1_555 ? 
5864 BX8 4  THR X  130 ? THR 2 130  . ? 1_555 ? 
5865 BX8 4  GLU X  134 ? GLU 2 134  . ? 1_555 ? 
5866 BX8 4  GLU X  201 ? GLU 2 201  . ? 1_555 ? 
5867 BX8 4  HIS X  206 ? HIS 2 206  . ? 1_555 ? 
5868 BX9 9  CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
5869 BX9 9  PQN LN .   ? PQN 1 2001 . ? 1_555 ? 
5870 BX9 9  PHE X  429 ? PHE 2 429  . ? 1_555 ? 
5871 BX9 9  CLA LP .   ? CLA 2 1229 . ? 1_555 ? 
5872 BX9 9  BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
5873 BX9 9  PHE BA 72  ? PHE 6 72   . ? 1_555 ? 
5874 BX9 9  ILE BA 75  ? ILE 6 75   . ? 1_555 ? 
5875 BX9 9  CLA JQ .   ? CLA 6 1301 . ? 1_555 ? 
5876 BX9 9  LEU DA 26  ? LEU 7 26   . ? 1_555 ? 
5877 BY1 14 VAL W  114 ? VAL 1 121  . ? 1_555 ? 
5878 BY1 14 CLA EM .   ? CLA 1 1107 . ? 1_555 ? 
5879 BY1 14 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
5880 BY1 14 HIS X  437 ? HIS 2 437  . ? 1_555 ? 
5881 BY1 14 LYS X  449 ? LYS 2 449  . ? 1_555 ? 
5882 BY1 14 CLA LP .   ? CLA 2 1229 . ? 1_555 ? 
5883 BY1 14 BCR FO .   ? BCR 2 4011 . ? 1_555 ? 
5884 BY1 14 TYR BA 40  ? TYR 6 40   . ? 1_555 ? 
5885 BY1 14 PHE DA 29  ? PHE 7 29   . ? 1_555 ? 
5886 BY1 14 ASN DA 30  ? ASN 7 30   . ? 1_555 ? 
5887 BY1 14 ASP DA 35  ? ASP 7 35   . ? 1_555 ? 
5888 BY1 14 LEU DA 36  ? LEU 7 36   . ? 1_555 ? 
5889 BY1 14 LEU DA 37  ? LEU 7 37   . ? 1_555 ? 
5890 BY1 14 ZEX QQ .   ? ZEX 7 4015 . ? 1_555 ? 
5891 BY2 9  CYS Y  20  ? CYS 3 21   . ? 1_555 ? 
5892 BY2 9  PRO Y  21  ? PRO 3 22   . ? 1_555 ? 
5893 BY2 9  VAL Y  24  ? VAL 3 25   . ? 1_555 ? 
5894 BY2 9  LEU Y  25  ? LEU 3 26   . ? 1_555 ? 
5895 BY2 9  CYS Y  47  ? CYS 3 48   . ? 1_555 ? 
5896 BY2 9  GLY Y  49  ? GLY 3 50   . ? 1_555 ? 
5897 BY2 9  CYS Y  50  ? CYS 3 51   . ? 1_555 ? 
5898 BY2 9  LYS Y  51  ? LYS 3 52   . ? 1_555 ? 
5899 BY2 9  CYS Y  53  ? CYS 3 54   . ? 1_555 ? 
5900 BY3 11 CYS Y  10  ? CYS 3 11   . ? 1_555 ? 
5901 BY3 11 ILE Y  11  ? ILE 3 12   . ? 1_555 ? 
5902 BY3 11 GLY Y  12  ? GLY 3 13   . ? 1_555 ? 
5903 BY3 11 CYS Y  13  ? CYS 3 14   . ? 1_555 ? 
5904 BY3 11 THR Y  14  ? THR 3 15   . ? 1_555 ? 
5905 BY3 11 CYS Y  16  ? CYS 3 17   . ? 1_555 ? 
5906 BY3 11 MET Y  27  ? MET 3 28   . ? 1_555 ? 
5907 BY3 11 CYS Y  57  ? CYS 3 58   . ? 1_555 ? 
5908 BY3 11 THR Y  59  ? THR 3 60   . ? 1_555 ? 
5909 BY3 11 SER Y  63  ? SER 3 64   . ? 1_555 ? 
5910 BY3 11 ILE Y  64  ? ILE 3 65   . ? 1_555 ? 
5911 BY4 12 CLA IN .   ? CLA 1 1138 . ? 1_555 ? 
5912 BY4 12 CLA ZN .   ? CLA 1 1139 . ? 1_555 ? 
5913 BY4 12 BCR FQ .   ? BCR 2 4014 . ? 1_555 ? 
5914 BY4 12 ILE BA 75  ? ILE 6 75   . ? 1_555 ? 
5915 BY4 12 TRP BA 78  ? TRP 6 78   . ? 1_555 ? 
5916 BY4 12 ILE BA 79  ? ILE 6 79   . ? 1_555 ? 
5917 BY4 12 VAL BA 82  ? VAL 6 82   . ? 1_555 ? 
5918 BY4 12 MET BA 112 ? MET 6 112  . ? 1_555 ? 
5919 BY4 12 LEU DA 18  ? LEU 7 18   . ? 1_555 ? 
5920 BY4 12 THR DA 22  ? THR 7 22   . ? 1_555 ? 
5921 BY4 12 LEU DA 26  ? LEU 7 26   . ? 1_555 ? 
5922 BY4 12 HOH KS .   ? HOH 7 8001 . ? 1_555 ? 
5923 BY5 7  PHE X  457 ? PHE 2 457  . ? 1_555 ? 
5924 BY5 7  ASP BA 3   ? ASP 6 3    . ? 1_555 ? 
5925 BY5 7  ASP BA 56  ? ASP 6 56   . ? 1_555 ? 
5926 BY5 7  GLY BA 57  ? GLY 6 57   . ? 1_555 ? 
5927 BY5 7  ARG BA 58  ? ARG 6 58   . ? 1_555 ? 
5928 BY5 7  PHE BA 59  ? PHE 6 59   . ? 1_555 ? 
5929 BY5 7  BCR LQ .   ? BCR 6 4016 . ? 1_555 ? 
5930 BY6 7  CLA KP .   ? CLA 2 1228 . ? 1_555 ? 
5931 BY6 7  CLA LP .   ? CLA 2 1229 . ? 1_555 ? 
5932 BY6 7  CLA PP .   ? CLA 2 1235 . ? 1_555 ? 
5933 BY6 7  GLY BA 77  ? GLY 6 77   . ? 1_555 ? 
5934 BY6 7  GLY BA 80  ? GLY 6 80   . ? 1_555 ? 
5935 BY6 7  TRP BA 81  ? TRP 6 81   . ? 1_555 ? 
5936 BY6 7  CLA KQ .   ? CLA 6 1302 . ? 1_555 ? 
5937 BY7 3  HOH DS .   ? HOH 1 8017 . ? 1_555 ? 
5938 BY7 3  CLA KP .   ? CLA 2 1228 . ? 1_555 ? 
5939 BY7 3  ASP BA 135 ? ASP 6 135  . ? 1_555 ? 
5940 BY8 15 TRP FA 62  ? TRP 0 65   . ? 1_555 ? 
5941 BY8 15 ALA FA 84  ? ALA 0 87   . ? 1_555 ? 
5942 BY8 15 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
5943 BY8 15 CLA YN .   ? CLA 1 1130 . ? 1_555 ? 
5944 BY8 15 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
5945 BY8 15 CLA CN .   ? CLA 1 1132 . ? 1_555 ? 
5946 BY8 15 THR X  682 ? THR 2 682  . ? 1_555 ? 
5947 BY8 15 PRO X  683 ? PRO 2 683  . ? 1_555 ? 
5948 BY8 15 LEU X  684 ? LEU 2 684  . ? 1_555 ? 
5949 BY8 15 CLA PO .   ? CLA 2 1207 . ? 1_555 ? 
5950 BY8 15 CLA EO .   ? CLA 2 1237 . ? 1_555 ? 
5951 BY8 15 CLA RP .   ? CLA 2 1238 . ? 1_555 ? 
5952 BY8 15 TRP CA 20  ? TRP h 20   . ? 1_555 ? 
5953 BY8 15 BCR OQ .   ? BCR h 4018 . ? 1_555 ? 
5954 BY8 15 CLA ML .   ? CLA l 1503 . ? 1_555 ? 
5955 BY9 12 CLA DO .   ? CLA 2 1022 . ? 1_555 ? 
5956 BY9 12 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
5957 BY9 12 CLA CN .   ? CLA 1 1132 . ? 1_555 ? 
5958 BY9 12 CLA IO .   ? CLA 2 1023 . ? 1_555 ? 
5959 BY9 12 CLA MO .   ? CLA 2 1204 . ? 1_555 ? 
5960 BY9 12 CLA NO .   ? CLA 2 1205 . ? 1_555 ? 
5961 BY9 12 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
5962 BY9 12 CLA PO .   ? CLA 2 1207 . ? 1_555 ? 
5963 BY9 12 CLA RP .   ? CLA 2 1238 . ? 1_555 ? 
5964 BY9 12 GLY CA 19  ? GLY h 19   . ? 1_555 ? 
5965 BY9 12 PRO CA 23  ? PRO h 23   . ? 1_555 ? 
5966 BY9 12 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
5967 BZ1 16 TRP W  111 ? TRP 1 118  . ? 1_555 ? 
5968 BZ1 16 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
5969 BZ1 16 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
5970 BZ1 16 CLA CM .   ? CLA 1 1105 . ? 1_555 ? 
5971 BZ1 16 CLA EM .   ? CLA 1 1107 . ? 1_555 ? 
5972 BZ1 16 CLA JN .   ? CLA 1 1140 . ? 1_555 ? 
5973 BZ1 16 BCR BO .   ? BCR 1 4012 . ? 1_555 ? 
5974 BZ1 16 BCR SN .   ? BCR 1 4019 . ? 1_555 ? 
5975 BZ1 16 PRO DA 12  ? PRO 7 12   . ? 1_555 ? 
5976 BZ1 16 VAL DA 13  ? VAL 7 13   . ? 1_555 ? 
5977 BZ1 16 MET DA 16  ? MET 7 16   . ? 1_555 ? 
5978 BZ1 16 THR DA 20  ? THR 7 20   . ? 1_555 ? 
5979 BZ1 16 ILE DA 27  ? ILE 7 27   . ? 1_555 ? 
5980 BZ1 16 GLU DA 28  ? GLU 7 28   . ? 1_555 ? 
5981 BZ1 16 ARG DA 31  ? ARG 7 31   . ? 1_555 ? 
5982 BZ1 16 CLA RQ .   ? CLA 7 1302 . ? 1_555 ? 
5983 BZ2 14 PHE X  426 ? PHE 2 426  . ? 1_555 ? 
5984 BZ2 14 LEU X  427 ? LEU 2 427  . ? 1_555 ? 
5985 BZ2 14 HIS X  430 ? HIS 2 430  . ? 1_555 ? 
5986 BZ2 14 LEU X  434 ? LEU 2 434  . ? 1_555 ? 
5987 BZ2 14 PHE X  514 ? PHE 2 514  . ? 1_555 ? 
5988 BZ2 14 HIS X  518 ? HIS 2 518  . ? 1_555 ? 
5989 BZ2 14 CLA GQ .   ? CLA 2 1230 . ? 1_555 ? 
5990 BZ2 14 CLA PP .   ? CLA 2 1235 . ? 1_555 ? 
5991 BZ2 14 LEU BA 53  ? LEU 6 53   . ? 1_555 ? 
5992 BZ2 14 ASP BA 64  ? ASP 6 64   . ? 1_555 ? 
5993 BZ2 14 TYR DA 33  ? TYR 7 33   . ? 1_555 ? 
5994 BZ2 14 LEU DA 36  ? LEU 7 36   . ? 1_555 ? 
5995 BZ2 14 LEU DA 37  ? LEU 7 37   . ? 1_555 ? 
5996 BZ2 14 CLA SQ .   ? CLA 7 1303 . ? 1_555 ? 
5997 BZ3 5  BCR SN .   ? BCR 1 4019 . ? 1_555 ? 
5998 BZ3 5  GLY DA 24  ? GLY 7 24   . ? 1_555 ? 
5999 BZ3 5  GLU DA 28  ? GLU 7 28   . ? 1_555 ? 
6000 BZ3 5  ARG DA 31  ? ARG 7 31   . ? 1_555 ? 
6001 BZ3 5  BCR PQ .   ? BCR 7 4013 . ? 1_555 ? 
6002 BZ4 5  ILE BA 67  ? ILE 6 67   . ? 1_555 ? 
6003 BZ4 5  LEU BA 71  ? LEU 6 71   . ? 1_555 ? 
6004 BZ4 5  HIS DA 39  ? HIS 7 39   . ? 1_555 ? 
6005 BZ4 5  PRO DA 40  ? PRO 7 40   . ? 1_555 ? 
6006 BZ4 5  ZEX QQ .   ? ZEX 7 4015 . ? 1_555 ? 
6007 BZ5 9  CLA MM .   ? CLA 1 1115 . ? 1_555 ? 
6008 BZ5 9  CLA EN .   ? CLA 1 1134 . ? 1_555 ? 
6009 BZ5 9  LHG VL .   ? LHG 1 5005 . ? 1_555 ? 
6010 BZ5 9  LEU EA 68  ? LEU 8 76   . ? 1_555 ? 
6011 BZ5 9  GLY EA 71  ? GLY 8 79   . ? 1_555 ? 
6012 BZ5 9  MET EA 72  ? MET 8 80   . ? 1_555 ? 
6013 BZ5 9  GLY EA 75  ? GLY 8 83   . ? 1_555 ? 
6014 BZ5 9  LEU EA 76  ? LEU 8 84   . ? 1_555 ? 
6015 BZ5 9  SER EA 79  ? SER 8 87   . ? 1_555 ? 
6016 BZ6 9  PHE W  257 ? PHE 1 264  . ? 1_555 ? 
6017 BZ6 9  BCR ON .   ? BCR 1 4002 . ? 1_555 ? 
6018 BZ6 9  VAL EA 14  ? VAL 8 22   . ? 1_555 ? 
6019 BZ6 9  MET EA 18  ? MET 8 26   . ? 1_555 ? 
6020 BZ6 9  CYS EA 19  ? CYS 8 27   . ? 1_555 ? 
6021 BZ6 9  ASN EA 22  ? ASN 8 30   . ? 1_555 ? 
6022 BZ6 9  MET EA 62  ? MET 8 70   . ? 1_555 ? 
6023 BZ6 9  HIS EA 66  ? HIS 8 74   . ? 1_555 ? 
6024 BZ6 9  BCR VQ .   ? BCR 8 4001 . ? 1_555 ? 
6025 BZ7 10 CLA PM .   ? CLA 1 1118 . ? 1_555 ? 
6026 BZ7 10 BCR NN .   ? BCR 1 4001 . ? 1_555 ? 
6027 BZ7 10 LEU EA 44  ? LEU 8 52   . ? 1_555 ? 
6028 BZ7 10 LEU EA 47  ? LEU 8 55   . ? 1_555 ? 
6029 BZ7 10 LYS EA 51  ? LYS 8 59   . ? 1_555 ? 
6030 BZ7 10 MET EA 62  ? MET 8 70   . ? 1_555 ? 
6031 BZ7 10 SER EA 63  ? SER 8 71   . ? 1_555 ? 
6032 BZ7 10 HIS EA 66  ? HIS 8 74   . ? 1_555 ? 
6033 BZ7 10 ILE EA 67  ? ILE 8 75   . ? 1_555 ? 
6034 BZ7 10 CLA UQ .   ? CLA 8 1402 . ? 1_555 ? 
6035 BZ8 11 ALA FA 25  ? ALA 0 28   . ? 1_555 ? 
6036 BZ8 11 PHE FA 26  ? PHE 0 29   . ? 1_555 ? 
6037 BZ8 11 LMG ER .   ? LMG 0 5001 . ? 1_555 ? 
6038 BZ8 11 SQD FR .   ? SQD 0 5005 . ? 1_555 ? 
6039 BZ8 11 CLA XC .   ? CLA B 1201 . ? 1_555 ? 
6040 BZ8 11 THR G  26  ? THR I 26   . ? 1_555 ? 
6041 BZ8 11 HIS G  33  ? HIS I 33   . ? 1_555 ? 
6042 BZ8 11 BCR WF .   ? BCR L 4019 . ? 1_555 ? 
6043 BZ8 11 PHE K  23  ? PHE M 23   . ? 1_555 ? 
6044 BZ8 11 TYR K  30  ? TYR M 30   . ? 1_555 ? 
6045 BZ8 11 LYS K  31  ? LYS M 31   . ? 1_555 ? 
6046 BZ9 6  CLA BR .   ? CLA 0 1503 . ? 1_555 ? 
6047 BZ9 6  LMT GR .   ? LMT 0 6001 . ? 1_555 ? 
6048 BZ9 6  LMT XN .   ? LMT 1 6001 . ? 1_555 ? 
6049 BZ9 6  TYR G  9   ? TYR I 9    . ? 1_555 ? 
6050 BZ9 6  ASP K  5   ? ASP M 5    . ? 1_555 ? 
6051 BZ9 6  LHG EG .   ? LHG M 5001 . ? 1_555 ? 
6052 CC1 5  PRO FA 67  ? PRO 0 70   . ? 1_555 ? 
6053 CC1 5  ASP FA 70  ? ASP 0 73   . ? 1_555 ? 
6054 CC1 5  HOH DS .   ? HOH 1 8011 . ? 1_555 ? 
6055 CC1 5  PHE U  156 ? PHE l 156  . ? 1_555 ? 
6056 CC1 5  HOH BS .   ? HOH l 8002 . ? 1_555 ? 
6057 CC2 13 ASN FA 33  ? ASN 0 36   . ? 1_555 ? 
6058 CC2 13 ARG FA 38  ? ARG 0 41   . ? 1_555 ? 
6059 CC2 13 LEU FA 45  ? LEU 0 48   . ? 1_555 ? 
6060 CC2 13 GLU FA 49  ? GLU 0 52   . ? 1_555 ? 
6061 CC2 13 MET FA 52  ? MET 0 55   . ? 1_555 ? 
6062 CC2 13 ALA FA 53  ? ALA 0 56   . ? 1_555 ? 
6063 CC2 13 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
6064 CC2 13 BCR DR .   ? BCR 0 4022 . ? 1_555 ? 
6065 CC2 13 LMG ER .   ? LMG 0 5001 . ? 1_555 ? 
6066 CC2 13 HOH MS .   ? HOH 0 8020 . ? 1_555 ? 
6067 CC2 13 THR J  93  ? THR L 93   . ? 1_555 ? 
6068 CC2 13 ALA J  94  ? ALA L 94   . ? 1_555 ? 
6069 CC2 13 SER J  97  ? SER L 97   . ? 1_555 ? 
6070 CC3 17 PHE FA 30  ? PHE 0 33   . ? 1_555 ? 
6071 CC3 17 PRO FA 35  ? PRO 0 38   . ? 1_555 ? 
6072 CC3 17 ALA FA 36  ? ALA 0 39   . ? 1_555 ? 
6073 CC3 17 VAL FA 50  ? VAL 0 53   . ? 1_555 ? 
6074 CC3 17 HIS FA 54  ? HIS 0 57   . ? 1_555 ? 
6075 CC3 17 PHE FA 57  ? PHE 0 60   . ? 1_555 ? 
6076 CC3 17 CLA ZQ .   ? CLA 0 1501 . ? 1_555 ? 
6077 CC3 17 CLA BR .   ? CLA 0 1503 . ? 1_555 ? 
6078 CC3 17 BCR CR .   ? BCR 0 4019 . ? 1_555 ? 
6079 CC3 17 CLA YN .   ? CLA 1 1130 . ? 1_555 ? 
6080 CC3 17 CLA CN .   ? CLA 1 1132 . ? 1_555 ? 
6081 CC3 17 CLA GN .   ? CLA 1 1136 . ? 1_555 ? 
6082 CC3 17 LHG VN .   ? LHG 1 5003 . ? 1_555 ? 
6083 CC3 17 LEU X  684 ? LEU 2 684  . ? 1_555 ? 
6084 CC3 17 LEU X  687 ? LEU 2 687  . ? 1_555 ? 
6085 CC3 17 CLA EO .   ? CLA 2 1237 . ? 1_555 ? 
6086 CC3 17 45D NQ .   ? 45D h 4020 . ? 1_555 ? 
6087 CC4 18 TYR FA 56  ? TYR 0 59   . ? 1_555 ? 
6088 CC4 18 PHE FA 57  ? PHE 0 60   . ? 1_555 ? 
6089 CC4 18 GLY FA 60  ? GLY 0 63   . ? 1_555 ? 
6090 CC4 18 PRO FA 61  ? PRO 0 64   . ? 1_555 ? 
6091 CC4 18 LEU FA 64  ? LEU 0 67   . ? 1_555 ? 
6092 CC4 18 LEU FA 139 ? LEU 0 142  . ? 1_555 ? 
6093 CC4 18 LEU FA 142 ? LEU 0 145  . ? 1_555 ? 
6094 CC4 18 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
6095 CC4 18 LHG XQ .   ? LHG 0 5004 . ? 1_555 ? 
6096 CC4 18 LMT GR .   ? LMT 0 6001 . ? 1_555 ? 
6097 CC4 18 HOH MS .   ? HOH 0 8010 . ? 1_555 ? 
6098 CC4 18 HOH MS .   ? HOH 0 8011 . ? 1_555 ? 
6099 CC4 18 CLA BN .   ? CLA 1 1131 . ? 1_555 ? 
6100 CC4 18 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
6101 CC4 18 PRO G  16  ? PRO I 16   . ? 1_555 ? 
6102 CC4 18 LEU G  21  ? LEU I 21   . ? 1_555 ? 
6103 CC4 18 EQ3 JF .   ? EQ3 I 4020 . ? 1_555 ? 
6104 CC4 18 ALA J  87  ? ALA L 87   . ? 1_555 ? 
6105 CC5 14 ALA FA 89  ? ALA 0 92   . ? 1_555 ? 
6106 CC5 14 ALA FA 92  ? ALA 0 95   . ? 1_555 ? 
6107 CC5 14 LEU FA 93  ? LEU 0 96   . ? 1_555 ? 
6108 CC5 14 PHE FA 124 ? PHE 0 127  . ? 1_555 ? 
6109 CC5 14 CLA AR .   ? CLA 0 1502 . ? 1_555 ? 
6110 CC5 14 CLA OO .   ? CLA 2 1206 . ? 1_555 ? 
6111 CC5 14 CLA EO .   ? CLA 2 1237 . ? 1_555 ? 
6112 CC5 14 CLA RP .   ? CLA 2 1238 . ? 1_555 ? 
6113 CC5 14 PQN UP .   ? PQN 2 2002 . ? 1_555 ? 
6114 CC5 14 MET CA 27  ? MET h 27   . ? 1_555 ? 
6115 CC5 14 LEU CA 30  ? LEU h 30   . ? 1_555 ? 
6116 CC5 14 PHE CA 31  ? PHE h 31   . ? 1_555 ? 
6117 CC5 14 ILE CA 34  ? ILE h 34   . ? 1_555 ? 
6118 CC5 14 LHG TL .   ? LHG l 5002 . ? 1_555 ? 
6119 CC6 8  PHE FA 30  ? PHE 0 33   . ? 1_555 ? 
6120 CC6 8  ALA FA 53  ? ALA 0 56   . ? 1_555 ? 
6121 CC6 8  TYR FA 56  ? TYR 0 59   . ? 1_555 ? 
6122 CC6 8  GLY FA 130 ? GLY 0 133  . ? 1_555 ? 
6123 CC6 8  CLA ZQ .   ? CLA 0 1501 . ? 1_555 ? 
6124 CC6 8  CLA CN .   ? CLA 1 1132 . ? 1_555 ? 
6125 CC6 8  CLA XE .   ? CLA B 1207 . ? 1_555 ? 
6126 CC6 8  BCR XF .   ? BCR L 4022 . ? 1_555 ? 
6127 CC7 11 THR FA 29  ? THR 0 32   . ? 1_555 ? 
6128 CC7 11 ASN FA 33  ? ASN 0 36   . ? 1_555 ? 
6129 CC7 11 CLA ZQ .   ? CLA 0 1501 . ? 1_555 ? 
6130 CC7 11 LHG WQ .   ? LHG 0 5002 . ? 1_555 ? 
6131 CC7 11 CLA XC .   ? CLA B 1201 . ? 1_555 ? 
6132 CC7 11 CLA AD .   ? CLA B 1204 . ? 1_555 ? 
6133 CC7 11 CLA XE .   ? CLA B 1207 . ? 1_555 ? 
6134 CC7 11 PHE G  22  ? PHE I 22   . ? 1_555 ? 
6135 CC7 11 ILE G  32  ? ILE I 32   . ? 1_555 ? 
6136 CC7 11 HIS G  33  ? HIS I 33   . ? 1_555 ? 
6137 CC7 11 BCR IF .   ? BCR I 4018 . ? 1_555 ? 
6138 CC8 10 VAL FA 4   ? VAL 0 7    . ? 1_555 ? 
6139 CC8 10 PRO FA 20  ? PRO 0 23   . ? 1_555 ? 
6140 CC8 10 ALA FA 25  ? ALA 0 28   . ? 1_555 ? 
6141 CC8 10 LHG WQ .   ? LHG 0 5002 . ? 1_555 ? 
6142 CC8 10 HOH MS .   ? HOH 0 8002 . ? 1_555 ? 
6143 CC8 10 HOH MS .   ? HOH 0 8014 . ? 1_555 ? 
6144 CC8 10 CLA KN .   ? CLA 1 1801 . ? 1_555 ? 
6145 CC8 10 VAL K  13  ? VAL M 13   . ? 1_555 ? 
6146 CC8 10 PHE K  20  ? PHE M 20   . ? 1_555 ? 
6147 CC8 10 ARG K  24  ? ARG M 24   . ? 1_555 ? 
6148 CC9 10 LEU FA 142 ? LEU 0 145  . ? 1_555 ? 
6149 CC9 10 SER FA 143 ? SER 0 146  . ? 1_555 ? 
6150 CC9 10 ASP FA 146 ? ASP 0 149  . ? 1_555 ? 
6151 CC9 10 ARG FA 150 ? ARG 0 153  . ? 1_555 ? 
6152 CC9 10 CLA BR .   ? CLA 0 1503 . ? 1_555 ? 
6153 CC9 10 LHG XQ .   ? LHG 0 5004 . ? 1_555 ? 
6154 CC9 10 TYR G  9   ? TYR I 9    . ? 1_555 ? 
6155 CC9 10 TRP G  12  ? TRP I 12   . ? 1_555 ? 
6156 CC9 10 LEU K  9   ? LEU M 9    . ? 1_555 ? 
6157 CC9 10 ECH DG .   ? ECH M 4021 . ? 1_555 ? 
6158 CD1 11 ILE X  56  ? ILE 2 56   . ? 1_555 ? 
6159 CD1 11 LEU X  59  ? LEU 2 59   . ? 1_555 ? 
6160 CD1 11 CLA JO .   ? CLA 2 1201 . ? 1_555 ? 
6161 CD1 11 CLA MO .   ? CLA 2 1204 . ? 1_555 ? 
6162 CD1 11 LEU GA 12  ? LEU 9 12   . ? 1_555 ? 
6163 CD1 11 LEU GA 16  ? LEU 9 16   . ? 1_555 ? 
6164 CD1 11 PRO GA 18  ? PRO 9 18   . ? 1_555 ? 
6165 CD1 11 ALA GA 19  ? ALA 9 19   . ? 1_555 ? 
6166 CD1 11 ALA GA 22  ? ALA 9 22   . ? 1_555 ? 
6167 CD1 11 SER GA 26  ? SER 9 26   . ? 1_555 ? 
6168 CD1 11 LMT SL .   ? LMT l 6001 . ? 1_555 ? 
6169 CD2 20 THR W  16  ? THR 1 23   . ? 1_555 ? 
6170 CD2 20 SER W  17  ? SER 1 24   . ? 1_555 ? 
6171 CD2 20 PHE W  18  ? PHE 1 25   . ? 1_555 ? 
6172 CD2 20 LYS W  20  ? LYS 1 27   . ? 1_555 ? 
6173 CD2 20 TRP W  21  ? TRP 1 28   . ? 1_555 ? 
6174 CD2 20 LYS W  23  ? LYS 1 30   . ? 1_555 ? 
6175 CD2 20 GLY W  25  ? GLY 1 32   . ? 1_555 ? 
6176 CD2 20 PHE W  27  ? PHE 1 34   . ? 1_555 ? 
6177 CD2 20 ASP W  28  ? ASP 1 35   . ? 1_555 ? 
6178 CD2 20 LYS W  64  ? LYS 1 71   . ? 1_555 ? 
6179 CD2 20 SER W  67  ? SER 1 74   . ? 1_555 ? 
6180 CD2 20 VAL W  75  ? VAL 1 82   . ? 1_555 ? 
6181 CD2 20 LEU W  166 ? LEU 1 173  . ? 1_555 ? 
6182 CD2 20 GLY W  169 ? GLY 1 176  . ? 1_555 ? 
6183 CD2 20 TRP W  170 ? TRP 1 177  . ? 1_555 ? 
6184 CD2 20 TYR W  173 ? TYR 1 180  . ? 1_555 ? 
6185 CD2 20 HIS W  174 ? HIS 1 181  . ? 1_555 ? 
6186 CD2 20 CLA AO .   ? CLA 1 1101 . ? 1_555 ? 
6187 CD2 20 CLA ZL .   ? CLA 1 1102 . ? 1_555 ? 
6188 CD2 20 CLA DM .   ? CLA 1 1106 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5OY0 
_atom_sites.fract_transf_matrix[1][1]   0.004713 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002375 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007266 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004975 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
CL 
FE 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A  1  1   ? 103.393 -35.287  -44.070 1.00 92.22  ? 1    MET A N     1 
ATOM   2     C  CA    . MET A  1  1   ? 102.003 -35.644  -44.329 1.00 101.08 ? 1    MET A CA    1 
ATOM   3     C  C     . MET A  1  1   ? 101.907 -36.940  -45.129 1.00 111.46 ? 1    MET A C     1 
ATOM   4     O  O     . MET A  1  1   ? 102.391 -37.022  -46.258 1.00 107.48 ? 1    MET A O     1 
ATOM   5     C  CB    . MET A  1  1   ? 101.287 -34.510  -45.068 1.00 105.93 ? 1    MET A CB    1 
ATOM   6     C  CG    . MET A  1  1   ? 99.892  -34.871  -45.562 1.00 113.00 ? 1    MET A CG    1 
ATOM   7     S  SD    . MET A  1  1   ? 98.815  -35.524  -44.267 1.00 117.66 ? 1    MET A SD    1 
ATOM   8     C  CE    . MET A  1  1   ? 97.352  -35.930  -45.217 1.00 117.12 ? 1    MET A CE    1 
ATOM   9     N  N     . THR A  1  2   ? 101.274 -37.956  -44.531 1.00 100.59 ? 2    THR A N     1 
ATOM   10    C  CA    . THR A  1  2   ? 101.128 -39.261  -45.165 1.00 109.77 ? 2    THR A CA    1 
ATOM   11    C  C     . THR A  1  2   ? 99.637  -39.577  -45.209 1.00 112.73 ? 2    THR A C     1 
ATOM   12    O  O     . THR A  1  2   ? 98.877  -38.814  -45.798 1.00 115.02 ? 2    THR A O     1 
ATOM   13    C  CB    . THR A  1  2   ? 101.975 -40.309  -44.459 1.00 111.71 ? 2    THR A CB    1 
ATOM   14    O  OG1   . THR A  1  2   ? 101.650 -40.324  -43.063 1.00 109.74 ? 2    THR A OG1   1 
ATOM   15    C  CG2   . THR A  1  2   ? 103.460 -40.006  -44.628 1.00 111.28 ? 2    THR A CG2   1 
ATOM   16    N  N     . ILE A  1  3   ? 99.204  -40.686  -44.615 1.00 126.88 ? 3    ILE A N     1 
ATOM   17    C  CA    . ILE A  1  3   ? 97.780  -40.955  -44.464 1.00 118.48 ? 3    ILE A CA    1 
ATOM   18    C  C     . ILE A  1  3   ? 97.285  -40.250  -43.208 1.00 132.97 ? 3    ILE A C     1 
ATOM   19    O  O     . ILE A  1  3   ? 97.987  -40.187  -42.190 1.00 122.61 ? 3    ILE A O     1 
ATOM   20    C  CB    . ILE A  1  3   ? 97.509  -42.473  -44.421 1.00 96.74  ? 3    ILE A CB    1 
ATOM   21    C  CG1   . ILE A  1  3   ? 97.940  -43.086  -43.086 1.00 79.95  ? 3    ILE A CG1   1 
ATOM   22    C  CG2   . ILE A  1  3   ? 98.227  -43.177  -45.568 1.00 92.47  ? 3    ILE A CG2   1 
ATOM   23    C  CD1   . ILE A  1  3   ? 97.553  -44.547  -42.939 1.00 70.52  ? 3    ILE A CD1   1 
ATOM   24    N  N     . SER A  1  4   ? 96.083  -39.676  -43.284 1.00 126.10 ? 4    SER A N     1 
ATOM   25    C  CA    . SER A  1  4   ? 95.498  -38.914  -42.180 1.00 127.85 ? 4    SER A CA    1 
ATOM   26    C  C     . SER A  1  4   ? 94.163  -39.538  -41.795 1.00 128.61 ? 4    SER A C     1 
ATOM   27    O  O     . SER A  1  4   ? 93.115  -39.186  -42.361 1.00 136.68 ? 4    SER A O     1 
ATOM   28    C  CB    . SER A  1  4   ? 95.334  -37.440  -42.551 1.00 126.53 ? 4    SER A CB    1 
ATOM   29    O  OG    . SER A  1  4   ? 94.444  -37.275  -43.641 1.00 124.57 ? 4    SER A OG    1 
ATOM   30    N  N     . PRO A  1  5   ? 94.152  -40.466  -40.842 1.00 128.09 ? 5    PRO A N     1 
ATOM   31    C  CA    . PRO A  1  5   ? 92.886  -41.028  -40.359 1.00 124.69 ? 5    PRO A CA    1 
ATOM   32    C  C     . PRO A  1  5   ? 92.115  -39.995  -39.557 1.00 135.68 ? 5    PRO A C     1 
ATOM   33    O  O     . PRO A  1  5   ? 92.628  -38.894  -39.307 1.00 131.40 ? 5    PRO A O     1 
ATOM   34    C  CB    . PRO A  1  5   ? 93.339  -42.204  -39.479 1.00 111.60 ? 5    PRO A CB    1 
ATOM   35    C  CG    . PRO A  1  5   ? 94.699  -41.820  -39.022 1.00 105.98 ? 5    PRO A CG    1 
ATOM   36    C  CD    . PRO A  1  5   ? 95.317  -41.056  -40.160 1.00 111.99 ? 5    PRO A CD    1 
ATOM   37    N  N     . PRO A  1  6   ? 90.864  -40.298  -39.154 1.00 129.67 ? 6    PRO A N     1 
ATOM   38    C  CA    . PRO A  1  6   ? 90.106  -39.349  -38.321 1.00 134.54 ? 6    PRO A CA    1 
ATOM   39    C  C     . PRO A  1  6   ? 90.831  -38.930  -37.047 1.00 132.14 ? 6    PRO A C     1 
ATOM   40    O  O     . PRO A  1  6   ? 91.510  -37.898  -37.031 1.00 132.93 ? 6    PRO A O     1 
ATOM   41    C  CB    . PRO A  1  6   ? 88.820  -40.121  -38.008 1.00 137.67 ? 6    PRO A CB    1 
ATOM   42    C  CG    . PRO A  1  6   ? 88.628  -40.995  -39.200 1.00 137.24 ? 6    PRO A CG    1 
ATOM   43    C  CD    . PRO A  1  6   ? 90.014  -41.406  -39.631 1.00 133.83 ? 6    PRO A CD    1 
ATOM   44    N  N     . GLU A  1  7   ? 90.689  -39.707  -35.972 1.00 134.39 ? 7    GLU A N     1 
ATOM   45    C  CA    . GLU A  1  7   ? 91.352  -39.370  -34.715 1.00 122.22 ? 7    GLU A CA    1 
ATOM   46    C  C     . GLU A  1  7   ? 91.574  -40.602  -33.842 1.00 107.69 ? 7    GLU A C     1 
ATOM   47    O  O     . GLU A  1  7   ? 92.714  -40.903  -33.476 1.00 106.70 ? 7    GLU A O     1 
ATOM   48    C  CB    . GLU A  1  7   ? 90.552  -38.301  -33.959 1.00 124.63 ? 7    GLU A CB    1 
ATOM   49    C  CG    . GLU A  1  7   ? 89.047  -38.537  -33.891 1.00 127.98 ? 7    GLU A CG    1 
ATOM   50    C  CD    . GLU A  1  7   ? 88.602  -39.095  -32.551 1.00 128.90 ? 7    GLU A CD    1 
ATOM   51    O  OE1   . GLU A  1  7   ? 89.410  -39.066  -31.598 1.00 128.35 ? 7    GLU A OE1   1 
ATOM   52    O  OE2   . GLU A  1  7   ? 87.448  -39.566  -32.452 1.00 129.97 ? 7    GLU A OE2   1 
ATOM   53    N  N     . ARG A  1  8   ? 90.493  -41.311  -33.505 1.00 124.05 ? 8    ARG A N     1 
ATOM   54    C  CA    . ARG A  1  8   ? 90.526  -42.531  -32.702 1.00 120.87 ? 8    ARG A CA    1 
ATOM   55    C  C     . ARG A  1  8   ? 90.950  -42.287  -31.256 1.00 139.70 ? 8    ARG A C     1 
ATOM   56    O  O     . ARG A  1  8   ? 91.949  -42.847  -30.793 1.00 120.77 ? 8    ARG A O     1 
ATOM   57    C  CB    . ARG A  1  8   ? 91.439  -43.578  -33.347 1.00 104.87 ? 8    ARG A CB    1 
ATOM   58    C  CG    . ARG A  1  8   ? 90.690  -44.736  -33.973 1.00 97.30  ? 8    ARG A CG    1 
ATOM   59    C  CD    . ARG A  1  8   ? 90.296  -45.766  -32.928 1.00 85.49  ? 8    ARG A CD    1 
ATOM   60    N  NE    . ARG A  1  8   ? 91.451  -46.501  -32.417 1.00 72.58  ? 8    ARG A NE    1 
ATOM   61    C  CZ    . ARG A  1  8   ? 92.061  -47.483  -33.077 1.00 68.86  ? 8    ARG A CZ    1 
ATOM   62    N  NH1   . ARG A  1  8   ? 93.102  -48.108  -32.540 1.00 64.78  ? 8    ARG A NH1   1 
ATOM   63    N  NH2   . ARG A  1  8   ? 91.631  -47.838  -34.280 1.00 72.14  ? 8    ARG A NH2   1 
ATOM   64    N  N     . GLU A  1  9   ? 90.191  -41.459  -30.539 1.00 123.35 ? 9    GLU A N     1 
ATOM   65    C  CA    . GLU A  1  9   ? 90.260  -41.386  -29.085 1.00 132.48 ? 9    GLU A CA    1 
ATOM   66    C  C     . GLU A  1  9   ? 88.844  -41.210  -28.552 1.00 138.30 ? 9    GLU A C     1 
ATOM   67    O  O     . GLU A  1  9   ? 88.025  -40.512  -29.159 1.00 144.72 ? 9    GLU A O     1 
ATOM   68    C  CB    . GLU A  1  9   ? 91.179  -40.248  -28.599 1.00 135.12 ? 9    GLU A CB    1 
ATOM   69    C  CG    . GLU A  1  9   ? 90.505  -38.897  -28.404 1.00 135.38 ? 9    GLU A CG    1 
ATOM   70    C  CD    . GLU A  1  9   ? 91.441  -37.854  -27.820 1.00 133.29 ? 9    GLU A CD    1 
ATOM   71    O  OE1   . GLU A  1  9   ? 92.292  -38.215  -26.980 1.00 131.75 ? 9    GLU A OE1   1 
ATOM   72    O  OE2   . GLU A  1  9   ? 91.327  -36.673  -28.209 1.00 133.55 ? 9    GLU A OE2   1 
ATOM   73    N  N     . ALA A  1  10  ? 88.549  -41.872  -27.427 1.00 156.91 ? 10   ALA A N     1 
ATOM   74    C  CA    . ALA A  1  10  ? 87.194  -41.933  -26.865 1.00 133.84 ? 10   ALA A CA    1 
ATOM   75    C  C     . ALA A  1  10  ? 87.275  -41.582  -25.382 1.00 118.57 ? 10   ALA A C     1 
ATOM   76    O  O     . ALA A  1  10  ? 87.231  -42.467  -24.524 1.00 108.85 ? 10   ALA A O     1 
ATOM   77    C  CB    . ALA A  1  10  ? 86.573  -43.312  -27.094 1.00 129.38 ? 10   ALA A CB    1 
ATOM   78    N  N     . LYS A  1  11  ? 87.363  -40.281  -25.091 1.00 122.39 ? 11   LYS A N     1 
ATOM   79    C  CA    . LYS A  1  11  ? 87.665  -39.786  -23.747 1.00 124.67 ? 11   LYS A CA    1 
ATOM   80    C  C     . LYS A  1  11  ? 88.840  -40.554  -23.152 1.00 133.50 ? 11   LYS A C     1 
ATOM   81    O  O     . LYS A  1  11  ? 88.822  -40.978  -21.994 1.00 132.37 ? 11   LYS A O     1 
ATOM   82    C  CB    . LYS A  1  11  ? 86.442  -39.853  -22.830 1.00 117.30 ? 11   LYS A CB    1 
ATOM   83    C  CG    . LYS A  1  11  ? 86.245  -38.615  -21.949 1.00 111.44 ? 11   LYS A CG    1 
ATOM   84    C  CD    . LYS A  1  11  ? 87.524  -38.193  -21.224 1.00 107.41 ? 11   LYS A CD    1 
ATOM   85    C  CE    . LYS A  1  11  ? 88.076  -36.881  -21.777 1.00 103.10 ? 11   LYS A CE    1 
ATOM   86    N  NZ    . LYS A  1  11  ? 89.357  -36.474  -21.129 1.00 94.00  ? 11   LYS A NZ    1 
ATOM   87    N  N     . ALA A  1  12  ? 89.866  -40.744  -23.967 1.00 117.92 ? 12   ALA A N     1 
ATOM   88    C  CA    . ALA A  1  12  ? 91.037  -41.510  -23.588 1.00 109.00 ? 12   ALA A CA    1 
ATOM   89    C  C     . ALA A  1  12  ? 92.188  -40.582  -23.235 1.00 104.02 ? 12   ALA A C     1 
ATOM   90    O  O     . ALA A  1  12  ? 92.246  -39.426  -23.664 1.00 109.64 ? 12   ALA A O     1 
ATOM   91    C  CB    . ALA A  1  12  ? 91.452  -42.457  -24.717 1.00 109.55 ? 12   ALA A CB    1 
ATOM   92    N  N     . LYS A  1  13  ? 93.113  -41.108  -22.442 1.00 121.37 ? 13   LYS A N     1 
ATOM   93    C  CA    . LYS A  1  13  ? 94.362  -40.423  -22.153 1.00 86.91  ? 13   LYS A CA    1 
ATOM   94    C  C     . LYS A  1  13  ? 95.322  -40.459  -23.332 1.00 76.07  ? 13   LYS A C     1 
ATOM   95    O  O     . LYS A  1  13  ? 96.489  -40.067  -23.197 1.00 78.26  ? 13   LYS A O     1 
ATOM   96    C  CB    . LYS A  1  13  ? 95.005  -41.044  -20.914 1.00 68.06  ? 13   LYS A CB    1 
ATOM   97    C  CG    . LYS A  1  13  ? 93.994  -41.504  -19.874 1.00 55.37  ? 13   LYS A CG    1 
ATOM   98    C  CD    . LYS A  1  13  ? 94.675  -41.875  -18.566 1.00 56.45  ? 13   LYS A CD    1 
ATOM   99    C  CE    . LYS A  1  13  ? 94.600  -40.742  -17.546 1.00 58.66  ? 13   LYS A CE    1 
ATOM   100   N  NZ    . LYS A  1  13  ? 95.232  -39.477  -18.008 1.00 60.06  ? 13   LYS A NZ    1 
ATOM   101   N  N     . VAL A  1  14  ? 94.803  -40.942  -24.465 1.00 79.60  ? 14   VAL A N     1 
ATOM   102   C  CA    . VAL A  1  14  ? 95.562  -40.958  -25.707 1.00 67.52  ? 14   VAL A CA    1 
ATOM   103   C  C     . VAL A  1  14  ? 95.946  -39.538  -26.089 1.00 62.95  ? 14   VAL A C     1 
ATOM   104   O  O     . VAL A  1  14  ? 95.103  -38.633  -26.123 1.00 65.01  ? 14   VAL A O     1 
ATOM   105   C  CB    . VAL A  1  14  ? 94.748  -41.627  -26.825 1.00 63.99  ? 14   VAL A CB    1 
ATOM   106   C  CG1   . VAL A  1  14  ? 95.472  -41.495  -28.158 1.00 56.85  ? 14   VAL A CG1   1 
ATOM   107   C  CG2   . VAL A  1  14  ? 94.486  -43.089  -26.499 1.00 63.19  ? 14   VAL A CG2   1 
ATOM   108   N  N     . SER A  1  15  ? 97.228  -39.340  -26.377 1.00 50.73  ? 15   SER A N     1 
ATOM   109   C  CA    . SER A  1  15  ? 97.733  -38.067  -26.863 1.00 49.69  ? 15   SER A CA    1 
ATOM   110   C  C     . SER A  1  15  ? 98.897  -38.362  -27.795 1.00 53.84  ? 15   SER A C     1 
ATOM   111   O  O     . SER A  1  15  ? 99.801  -39.121  -27.433 1.00 61.48  ? 15   SER A O     1 
ATOM   112   C  CB    . SER A  1  15  ? 98.170  -37.162  -25.707 1.00 51.68  ? 15   SER A CB    1 
ATOM   113   O  OG    . SER A  1  15  ? 99.097  -37.822  -24.863 1.00 68.92  ? 15   SER A OG    1 
ATOM   114   N  N     . VAL A  1  16  ? 98.857  -37.786  -28.997 1.00 49.84  ? 16   VAL A N     1 
ATOM   115   C  CA    . VAL A  1  16  ? 99.841  -38.055  -30.038 1.00 50.05  ? 16   VAL A CA    1 
ATOM   116   C  C     . VAL A  1  16  ? 100.211 -36.742  -30.721 1.00 50.56  ? 16   VAL A C     1 
ATOM   117   O  O     . VAL A  1  16  ? 99.549  -35.717  -30.553 1.00 51.23  ? 16   VAL A O     1 
ATOM   118   C  CB    . VAL A  1  16  ? 99.325  -39.068  -31.087 1.00 51.90  ? 16   VAL A CB    1 
ATOM   119   C  CG1   . VAL A  1  16  ? 98.769  -40.314  -30.416 1.00 49.87  ? 16   VAL A CG1   1 
ATOM   120   C  CG2   . VAL A  1  16  ? 98.275  -38.427  -31.977 1.00 51.83  ? 16   VAL A CG2   1 
ATOM   121   N  N     . ASP A  1  17  ? 101.295 -36.789  -31.490 1.00 50.08  ? 17   ASP A N     1 
ATOM   122   C  CA    . ASP A  1  17  ? 101.662 -35.739  -32.430 1.00 50.95  ? 17   ASP A CA    1 
ATOM   123   C  C     . ASP A  1  17  ? 101.496 -36.285  -33.842 1.00 56.08  ? 17   ASP A C     1 
ATOM   124   O  O     . ASP A  1  17  ? 101.959 -37.390  -34.140 1.00 65.32  ? 17   ASP A O     1 
ATOM   125   C  CB    . ASP A  1  17  ? 103.103 -35.270  -32.212 1.00 50.27  ? 17   ASP A CB    1 
ATOM   126   C  CG    . ASP A  1  17  ? 103.285 -34.496  -30.917 1.00 57.49  ? 17   ASP A CG    1 
ATOM   127   O  OD1   . ASP A  1  17  ? 102.544 -33.517  -30.687 1.00 60.98  ? 17   ASP A OD1   1 
ATOM   128   O  OD2   . ASP A  1  17  ? 104.180 -34.867  -30.129 1.00 60.76  ? 17   ASP A OD2   1 
ATOM   129   N  N     . ASN A  1  18  ? 100.837 -35.520  -34.706 1.00 59.51  ? 18   ASN A N     1 
ATOM   130   C  CA    . ASN A  1  18  ? 100.555 -35.966  -36.065 1.00 57.40  ? 18   ASN A CA    1 
ATOM   131   C  C     . ASN A  1  18  ? 101.746 -35.655  -36.967 1.00 61.84  ? 18   ASN A C     1 
ATOM   132   O  O     . ASN A  1  18  ? 102.181 -34.504  -37.056 1.00 65.55  ? 18   ASN A O     1 
ATOM   133   C  CB    . ASN A  1  18  ? 99.285  -35.303  -36.601 1.00 56.26  ? 18   ASN A CB    1 
ATOM   134   C  CG    . ASN A  1  18  ? 98.035  -35.751  -35.865 1.00 59.41  ? 18   ASN A CG    1 
ATOM   135   O  OD1   . ASN A  1  18  ? 97.963  -36.871  -35.358 1.00 62.58  ? 18   ASN A OD1   1 
ATOM   136   N  ND2   . ASN A  1  18  ? 97.041  -34.874  -35.806 1.00 63.46  ? 18   ASN A ND2   1 
ATOM   137   N  N     . ASN A  1  19  ? 102.271 -36.682  -37.627 1.00 63.20  ? 19   ASN A N     1 
ATOM   138   C  CA    . ASN A  1  19  ? 103.321 -36.567  -38.633 1.00 68.06  ? 19   ASN A CA    1 
ATOM   139   C  C     . ASN A  1  19  ? 104.560 -35.818  -38.135 1.00 62.75  ? 19   ASN A C     1 
ATOM   140   O  O     . ASN A  1  19  ? 104.925 -34.783  -38.704 1.00 71.52  ? 19   ASN A O     1 
ATOM   141   C  CB    . ASN A  1  19  ? 102.762 -35.887  -39.880 1.00 67.78  ? 19   ASN A CB    1 
ATOM   142   C  CG    . ASN A  1  19  ? 101.896 -36.820  -40.698 1.00 70.61  ? 19   ASN A CG    1 
ATOM   143   O  OD1   . ASN A  1  19  ? 100.752 -36.513  -41.012 1.00 70.41  ? 19   ASN A OD1   1 
ATOM   144   N  ND2   . ASN A  1  19  ? 102.444 -37.985  -41.037 1.00 76.01  ? 19   ASN A ND2   1 
ATOM   145   N  N     . PRO A  1  20  ? 105.248 -36.332  -37.120 1.00 54.39  ? 20   PRO A N     1 
ATOM   146   C  CA    . PRO A  1  20  ? 106.451 -35.641  -36.643 1.00 54.98  ? 20   PRO A CA    1 
ATOM   147   C  C     . PRO A  1  20  ? 107.665 -35.947  -37.505 1.00 54.67  ? 20   PRO A C     1 
ATOM   148   O  O     . PRO A  1  20  ? 108.543 -35.099  -37.688 1.00 54.00  ? 20   PRO A O     1 
ATOM   149   C  CB    . PRO A  1  20  ? 106.614 -36.183  -35.217 1.00 52.40  ? 20   PRO A CB    1 
ATOM   150   C  CG    . PRO A  1  20  ? 106.057 -37.561  -35.284 1.00 52.13  ? 20   PRO A CG    1 
ATOM   151   C  CD    . PRO A  1  20  ? 104.958 -37.543  -36.329 1.00 53.42  ? 20   PRO A CD    1 
ATOM   152   N  N     . VAL A  1  21  ? 107.721 -37.163  -38.036 1.00 51.78  ? 21   VAL A N     1 
ATOM   153   C  CA    . VAL A  1  21  ? 108.851 -37.616  -38.838 1.00 54.25  ? 21   VAL A CA    1 
ATOM   154   C  C     . VAL A  1  21  ? 108.319 -38.082  -40.185 1.00 56.72  ? 21   VAL A C     1 
ATOM   155   O  O     . VAL A  1  21  ? 107.676 -39.139  -40.263 1.00 61.27  ? 21   VAL A O     1 
ATOM   156   C  CB    . VAL A  1  21  ? 109.627 -38.739  -38.133 1.00 50.51  ? 21   VAL A CB    1 
ATOM   157   C  CG1   . VAL A  1  21  ? 110.751 -39.237  -39.024 1.00 50.66  ? 21   VAL A CG1   1 
ATOM   158   C  CG2   . VAL A  1  21  ? 110.166 -38.252  -36.803 1.00 49.44  ? 21   VAL A CG2   1 
ATOM   159   N  N     . PRO A  1  22  ? 108.547 -37.335  -41.258 1.00 59.80  ? 22   PRO A N     1 
ATOM   160   C  CA    . PRO A  1  22  ? 108.013 -37.749  -42.557 1.00 59.45  ? 22   PRO A CA    1 
ATOM   161   C  C     . PRO A  1  22  ? 108.727 -38.984  -43.082 1.00 57.72  ? 22   PRO A C     1 
ATOM   162   O  O     . PRO A  1  22  ? 109.907 -39.216  -42.809 1.00 56.68  ? 22   PRO A O     1 
ATOM   163   C  CB    . PRO A  1  22  ? 108.264 -36.531  -43.453 1.00 56.56  ? 22   PRO A CB    1 
ATOM   164   C  CG    . PRO A  1  22  ? 109.391 -35.810  -42.813 1.00 55.85  ? 22   PRO A CG    1 
ATOM   165   C  CD    . PRO A  1  22  ? 109.264 -36.051  -41.331 1.00 59.51  ? 22   PRO A CD    1 
ATOM   166   N  N     . THR A  1  23  ? 107.978 -39.792  -43.826 1.00 61.93  ? 23   THR A N     1 
ATOM   167   C  CA    . THR A  1  23  ? 108.543 -40.973  -44.461 1.00 59.97  ? 23   THR A CA    1 
ATOM   168   C  C     . THR A  1  23  ? 109.469 -40.551  -45.594 1.00 62.44  ? 23   THR A C     1 
ATOM   169   O  O     . THR A  1  23  ? 109.094 -39.735  -46.441 1.00 68.44  ? 23   THR A O     1 
ATOM   170   C  CB    . THR A  1  23  ? 107.423 -41.868  -44.990 1.00 58.45  ? 23   THR A CB    1 
ATOM   171   O  OG1   . THR A  1  23  ? 106.505 -42.162  -43.928 1.00 55.63  ? 23   THR A OG1   1 
ATOM   172   C  CG2   . THR A  1  23  ? 107.983 -43.165  -45.554 1.00 56.27  ? 23   THR A CG2   1 
ATOM   173   N  N     . SER A  1  24  ? 110.682 -41.098  -45.607 1.00 62.66  ? 24   SER A N     1 
ATOM   174   C  CA    . SER A  1  24  ? 111.663 -40.713  -46.611 1.00 65.27  ? 24   SER A CA    1 
ATOM   175   C  C     . SER A  1  24  ? 112.778 -41.748  -46.655 1.00 72.20  ? 24   SER A C     1 
ATOM   176   O  O     . SER A  1  24  ? 113.048 -42.431  -45.665 1.00 68.37  ? 24   SER A O     1 
ATOM   177   C  CB    . SER A  1  24  ? 112.233 -39.322  -46.322 1.00 62.18  ? 24   SER A CB    1 
ATOM   178   O  OG    . SER A  1  24  ? 113.006 -38.867  -47.414 1.00 70.43  ? 24   SER A OG    1 
ATOM   179   N  N     . PHE A  1  25  ? 113.427 -41.847  -47.816 1.00 74.81  ? 25   PHE A N     1 
ATOM   180   C  CA    . PHE A  1  25  ? 114.472 -42.838  -48.040 1.00 68.50  ? 25   PHE A CA    1 
ATOM   181   C  C     . PHE A  1  25  ? 115.881 -42.265  -47.996 1.00 66.25  ? 25   PHE A C     1 
ATOM   182   O  O     . PHE A  1  25  ? 116.840 -43.044  -47.993 1.00 65.20  ? 25   PHE A O     1 
ATOM   183   C  CB    . PHE A  1  25  ? 114.279 -43.531  -49.396 1.00 70.04  ? 25   PHE A CB    1 
ATOM   184   C  CG    . PHE A  1  25  ? 113.218 -44.594  -49.404 1.00 71.57  ? 25   PHE A CG    1 
ATOM   185   C  CD1   . PHE A  1  25  ? 113.369 -45.750  -48.656 1.00 67.86  ? 25   PHE A CD1   1 
ATOM   186   C  CD2   . PHE A  1  25  ? 112.085 -44.453  -50.188 1.00 67.73  ? 25   PHE A CD2   1 
ATOM   187   C  CE1   . PHE A  1  25  ? 112.398 -46.732  -48.674 1.00 64.25  ? 25   PHE A CE1   1 
ATOM   188   C  CE2   . PHE A  1  25  ? 111.113 -45.432  -50.210 1.00 59.26  ? 25   PHE A CE2   1 
ATOM   189   C  CZ    . PHE A  1  25  ? 111.269 -46.572  -49.453 1.00 58.42  ? 25   PHE A CZ    1 
ATOM   190   N  N     . GLU A  1  26  ? 116.036 -40.938  -47.972 1.00 61.90  ? 26   GLU A N     1 
ATOM   191   C  CA    . GLU A  1  26  ? 117.362 -40.342  -48.122 1.00 66.41  ? 26   GLU A CA    1 
ATOM   192   C  C     . GLU A  1  26  ? 118.330 -40.845  -47.054 1.00 66.99  ? 26   GLU A C     1 
ATOM   193   O  O     . GLU A  1  26  ? 119.450 -41.267  -47.369 1.00 76.58  ? 26   GLU A O     1 
ATOM   194   C  CB    . GLU A  1  26  ? 117.262 -38.817  -48.094 1.00 68.49  ? 26   GLU A CB    1 
ATOM   195   C  CG    . GLU A  1  26  ? 116.158 -38.286  -47.212 1.00 75.38  ? 26   GLU A CG    1 
ATOM   196   C  CD    . GLU A  1  26  ? 116.129 -36.775  -47.159 1.00 97.05  ? 26   GLU A CD    1 
ATOM   197   O  OE1   . GLU A  1  26  ? 116.986 -36.137  -47.808 1.00 104.42 ? 26   GLU A OE1   1 
ATOM   198   O  OE2   . GLU A  1  26  ? 115.248 -36.226  -46.466 1.00 105.57 ? 26   GLU A OE2   1 
ATOM   199   N  N     . LYS A  1  27  ? 117.909 -40.833  -45.785 1.00 57.91  ? 27   LYS A N     1 
ATOM   200   C  CA    . LYS A  1  27  ? 118.799 -41.269  -44.711 1.00 56.52  ? 27   LYS A CA    1 
ATOM   201   C  C     . LYS A  1  27  ? 119.152 -42.747  -44.796 1.00 56.03  ? 27   LYS A C     1 
ATOM   202   O  O     . LYS A  1  27  ? 120.118 -43.169  -44.154 1.00 58.13  ? 27   LYS A O     1 
ATOM   203   C  CB    . LYS A  1  27  ? 118.186 -40.965  -43.343 1.00 55.45  ? 27   LYS A CB    1 
ATOM   204   C  CG    . LYS A  1  27  ? 118.252 -39.496  -42.966 1.00 58.48  ? 27   LYS A CG    1 
ATOM   205   C  CD    . LYS A  1  27  ? 117.611 -39.231  -41.619 1.00 57.72  ? 27   LYS A CD    1 
ATOM   206   C  CE    . LYS A  1  27  ? 117.635 -37.744  -41.296 1.00 65.00  ? 27   LYS A CE    1 
ATOM   207   N  NZ    . LYS A  1  27  ? 117.184 -37.457  -39.905 1.00 71.18  ? 27   LYS A NZ    1 
ATOM   208   N  N     . TRP A  1  28  ? 118.399 -43.546  -45.562 1.00 59.24  ? 28   TRP A N     1 
ATOM   209   C  CA    . TRP A  1  28  ? 118.815 -44.926  -45.791 1.00 63.17  ? 28   TRP A CA    1 
ATOM   210   C  C     . TRP A  1  28  ? 120.169 -44.984  -46.482 1.00 67.96  ? 28   TRP A C     1 
ATOM   211   O  O     . TRP A  1  28  ? 120.958 -45.901  -46.227 1.00 75.92  ? 28   TRP A O     1 
ATOM   212   C  CB    . TRP A  1  28  ? 117.788 -45.681  -46.633 1.00 60.35  ? 28   TRP A CB    1 
ATOM   213   C  CG    . TRP A  1  28  ? 116.448 -45.885  -46.004 1.00 59.36  ? 28   TRP A CG    1 
ATOM   214   C  CD1   . TRP A  1  28  ? 115.743 -44.997  -45.244 1.00 57.70  ? 28   TRP A CD1   1 
ATOM   215   C  CD2   . TRP A  1  28  ? 115.642 -47.063  -46.098 1.00 60.88  ? 28   TRP A CD2   1 
ATOM   216   N  NE1   . TRP A  1  28  ? 114.545 -45.551  -44.859 1.00 60.14  ? 28   TRP A NE1   1 
ATOM   217   C  CE2   . TRP A  1  28  ? 114.459 -46.819  -45.371 1.00 60.77  ? 28   TRP A CE2   1 
ATOM   218   C  CE3   . TRP A  1  28  ? 115.806 -48.300  -46.726 1.00 63.98  ? 28   TRP A CE3   1 
ATOM   219   C  CZ2   . TRP A  1  28  ? 113.447 -47.769  -45.254 1.00 62.35  ? 28   TRP A CZ2   1 
ATOM   220   C  CZ3   . TRP A  1  28  ? 114.800 -49.241  -46.610 1.00 71.35  ? 28   TRP A CZ3   1 
ATOM   221   C  CH2   . TRP A  1  28  ? 113.636 -48.971  -45.879 1.00 68.43  ? 28   TRP A CH2   1 
ATOM   222   N  N     . GLY A  1  29  ? 120.451 -44.027  -47.360 1.00 64.62  ? 29   GLY A N     1 
ATOM   223   C  CA    . GLY A  1  29  ? 121.733 -43.945  -48.021 1.00 66.09  ? 29   GLY A CA    1 
ATOM   224   C  C     . GLY A  1  29  ? 122.755 -43.103  -47.296 1.00 60.13  ? 29   GLY A C     1 
ATOM   225   O  O     . GLY A  1  29  ? 123.818 -42.811  -47.855 1.00 61.97  ? 29   GLY A O     1 
ATOM   226   N  N     . LYS A  1  30  ? 122.462 -42.696  -46.061 1.00 56.46  ? 30   LYS A N     1 
ATOM   227   C  CA    . LYS A  1  30  ? 123.355 -41.884  -45.240 1.00 60.19  ? 30   LYS A CA    1 
ATOM   228   C  C     . LYS A  1  30  ? 123.654 -42.673  -43.971 1.00 63.73  ? 30   LYS A C     1 
ATOM   229   O  O     . LYS A  1  30  ? 123.097 -42.382  -42.901 1.00 62.09  ? 30   LYS A O     1 
ATOM   230   C  CB    . LYS A  1  30  ? 122.729 -40.529  -44.921 1.00 60.70  ? 30   LYS A CB    1 
ATOM   231   C  CG    . LYS A  1  30  ? 122.256 -39.770  -46.146 1.00 56.10  ? 30   LYS A CG    1 
ATOM   232   C  CD    . LYS A  1  30  ? 121.260 -38.685  -45.771 1.00 63.19  ? 30   LYS A CD    1 
ATOM   233   C  CE    . LYS A  1  30  ? 120.914 -37.817  -46.969 1.00 77.00  ? 30   LYS A CE    1 
ATOM   234   N  NZ    . LYS A  1  30  ? 122.105 -37.067  -47.460 1.00 76.25  ? 30   LYS A NZ    1 
ATOM   235   N  N     . PRO A  1  31  ? 124.525 -43.679  -44.051 1.00 67.44  ? 31   PRO A N     1 
ATOM   236   C  CA    . PRO A  1  31  ? 124.755 -44.547  -42.890 1.00 61.08  ? 31   PRO A CA    1 
ATOM   237   C  C     . PRO A  1  31  ? 125.453 -43.799  -41.765 1.00 58.89  ? 31   PRO A C     1 
ATOM   238   O  O     . PRO A  1  31  ? 126.338 -42.972  -41.995 1.00 62.34  ? 31   PRO A O     1 
ATOM   239   C  CB    . PRO A  1  31  ? 125.634 -45.668  -43.455 1.00 60.40  ? 31   PRO A CB    1 
ATOM   240   C  CG    . PRO A  1  31  ? 126.321 -45.048  -44.629 1.00 57.42  ? 31   PRO A CG    1 
ATOM   241   C  CD    . PRO A  1  31  ? 125.355 -44.058  -45.208 1.00 64.39  ? 31   PRO A CD    1 
ATOM   242   N  N     . GLY A  1  32  ? 125.041 -44.099  -40.535 1.00 61.20  ? 32   GLY A N     1 
ATOM   243   C  CA    . GLY A  1  32  ? 125.503 -43.347  -39.387 1.00 62.33  ? 32   GLY A CA    1 
ATOM   244   C  C     . GLY A  1  32  ? 124.780 -42.041  -39.164 1.00 58.78  ? 32   GLY A C     1 
ATOM   245   O  O     . GLY A  1  32  ? 125.226 -41.237  -38.337 1.00 57.32  ? 32   GLY A O     1 
ATOM   246   N  N     . HIS A  1  33  ? 123.669 -41.815  -39.872 1.00 61.62  ? 33   HIS A N     1 
ATOM   247   C  CA    . HIS A  1  33  ? 122.940 -40.553  -39.789 1.00 51.23  ? 33   HIS A CA    1 
ATOM   248   C  C     . HIS A  1  33  ? 122.511 -40.227  -38.366 1.00 56.14  ? 33   HIS A C     1 
ATOM   249   O  O     . HIS A  1  33  ? 122.425 -39.049  -38.000 1.00 58.49  ? 33   HIS A O     1 
ATOM   250   C  CB    . HIS A  1  33  ? 121.708 -40.612  -40.688 1.00 49.64  ? 33   HIS A CB    1 
ATOM   251   C  CG    . HIS A  1  33  ? 120.591 -41.431  -40.119 1.00 53.26  ? 33   HIS A CG    1 
ATOM   252   N  ND1   . HIS A  1  33  ? 119.621 -40.896  -39.299 1.00 56.85  ? 33   HIS A ND1   1 
ATOM   253   C  CD2   . HIS A  1  33  ? 120.301 -42.748  -40.235 1.00 49.52  ? 33   HIS A CD2   1 
ATOM   254   C  CE1   . HIS A  1  33  ? 118.775 -41.847  -38.943 1.00 49.95  ? 33   HIS A CE1   1 
ATOM   255   N  NE2   . HIS A  1  33  ? 119.168 -42.981  -39.494 1.00 48.22  ? 33   HIS A NE2   1 
ATOM   256   N  N     . PHE A  1  34  ? 122.230 -41.250  -37.556 1.00 59.15  ? 34   PHE A N     1 
ATOM   257   C  CA    . PHE A  1  34  ? 121.680 -41.063  -36.219 1.00 57.69  ? 34   PHE A CA    1 
ATOM   258   C  C     . PHE A  1  34  ? 122.710 -40.597  -35.201 1.00 57.19  ? 34   PHE A C     1 
ATOM   259   O  O     . PHE A  1  34  ? 122.323 -40.192  -34.101 1.00 62.70  ? 34   PHE A O     1 
ATOM   260   C  CB    . PHE A  1  34  ? 121.036 -42.364  -35.730 1.00 55.48  ? 34   PHE A CB    1 
ATOM   261   C  CG    . PHE A  1  34  ? 121.954 -43.551  -35.787 1.00 52.75  ? 34   PHE A CG    1 
ATOM   262   C  CD1   . PHE A  1  34  ? 122.791 -43.850  -34.724 1.00 43.72  ? 34   PHE A CD1   1 
ATOM   263   C  CD2   . PHE A  1  34  ? 121.980 -44.368  -36.906 1.00 57.70  ? 34   PHE A CD2   1 
ATOM   264   C  CE1   . PHE A  1  34  ? 123.638 -44.939  -34.777 1.00 42.43  ? 34   PHE A CE1   1 
ATOM   265   C  CE2   . PHE A  1  34  ? 122.826 -45.460  -36.965 1.00 51.16  ? 34   PHE A CE2   1 
ATOM   266   C  CZ    . PHE A  1  34  ? 123.658 -45.744  -35.900 1.00 44.74  ? 34   PHE A CZ    1 
ATOM   267   N  N     . ASP A  1  35  ? 123.998 -40.649  -35.530 1.00 54.17  ? 35   ASP A N     1 
ATOM   268   C  CA    . ASP A  1  35  ? 125.062 -40.258  -34.615 1.00 58.32  ? 35   ASP A CA    1 
ATOM   269   C  C     . ASP A  1  35  ? 125.802 -39.067  -35.204 1.00 55.93  ? 35   ASP A C     1 
ATOM   270   O  O     . ASP A  1  35  ? 126.273 -39.127  -36.345 1.00 57.77  ? 35   ASP A O     1 
ATOM   271   C  CB    . ASP A  1  35  ? 126.026 -41.427  -34.363 1.00 61.94  ? 35   ASP A CB    1 
ATOM   272   C  CG    . ASP A  1  35  ? 126.928 -41.204  -33.157 1.00 69.80  ? 35   ASP A CG    1 
ATOM   273   O  OD1   . ASP A  1  35  ? 127.456 -40.085  -32.994 1.00 74.68  ? 35   ASP A OD1   1 
ATOM   274   O  OD2   . ASP A  1  35  ? 127.109 -42.156  -32.368 1.00 73.93  ? 35   ASP A OD2   1 
ATOM   275   N  N     . ARG A  1  36  ? 125.890 -37.981  -34.429 1.00 58.38  ? 36   ARG A N     1 
ATOM   276   C  CA    . ARG A  1  36  ? 126.579 -36.788  -34.910 1.00 65.74  ? 36   ARG A CA    1 
ATOM   277   C  C     . ARG A  1  36  ? 128.062 -37.058  -35.128 1.00 64.01  ? 36   ARG A C     1 
ATOM   278   O  O     . ARG A  1  36  ? 128.667 -36.517  -36.061 1.00 58.95  ? 36   ARG A O     1 
ATOM   279   C  CB    . ARG A  1  36  ? 126.388 -35.633  -33.929 1.00 77.90  ? 36   ARG A CB    1 
ATOM   280   C  CG    . ARG A  1  36  ? 124.945 -35.307  -33.589 1.00 88.08  ? 36   ARG A CG    1 
ATOM   281   C  CD    . ARG A  1  36  ? 124.874 -33.982  -32.847 1.00 100.09 ? 36   ARG A CD    1 
ATOM   282   N  NE    . ARG A  1  36  ? 123.583 -33.757  -32.205 1.00 109.59 ? 36   ARG A NE    1 
ATOM   283   C  CZ    . ARG A  1  36  ? 123.249 -32.630  -31.584 1.00 116.25 ? 36   ARG A CZ    1 
ATOM   284   N  NH1   . ARG A  1  36  ? 124.110 -31.623  -31.525 1.00 116.81 ? 36   ARG A NH1   1 
ATOM   285   N  NH2   . ARG A  1  36  ? 122.053 -32.507  -31.023 1.00 118.29 ? 36   ARG A NH2   1 
ATOM   286   N  N     . THR A  1  37  ? 128.664 -37.895  -34.281 1.00 61.91  ? 37   THR A N     1 
ATOM   287   C  CA    . THR A  1  37  ? 130.062 -38.270  -34.453 1.00 68.22  ? 37   THR A CA    1 
ATOM   288   C  C     . THR A  1  37  ? 130.283 -39.197  -35.642 1.00 69.93  ? 37   THR A C     1 
ATOM   289   O  O     . THR A  1  37  ? 131.427 -39.594  -35.889 1.00 70.33  ? 37   THR A O     1 
ATOM   290   C  CB    . THR A  1  37  ? 130.593 -38.936  -33.180 1.00 67.76  ? 37   THR A CB    1 
ATOM   291   O  OG1   . THR A  1  37  ? 129.902 -40.173  -32.960 1.00 66.33  ? 37   THR A OG1   1 
ATOM   292   C  CG2   . THR A  1  37  ? 130.390 -38.028  -31.976 1.00 69.73  ? 37   THR A CG2   1 
ATOM   293   N  N     . LEU A  1  38  ? 129.222 -39.551  -36.374 1.00 72.74  ? 38   LEU A N     1 
ATOM   294   C  CA    . LEU A  1  38  ? 129.309 -40.442  -37.521 1.00 62.71  ? 38   LEU A CA    1 
ATOM   295   C  C     . LEU A  1  38  ? 128.802 -39.840  -38.821 1.00 64.55  ? 38   LEU A C     1 
ATOM   296   O  O     . LEU A  1  38  ? 129.167 -40.343  -39.889 1.00 64.08  ? 38   LEU A O     1 
ATOM   297   C  CB    . LEU A  1  38  ? 128.510 -41.729  -37.267 1.00 52.76  ? 38   LEU A CB    1 
ATOM   298   C  CG    . LEU A  1  38  ? 128.968 -42.688  -36.176 1.00 49.62  ? 38   LEU A CG    1 
ATOM   299   C  CD1   . LEU A  1  38  ? 128.097 -43.930  -36.205 1.00 56.76  ? 38   LEU A CD1   1 
ATOM   300   C  CD2   . LEU A  1  38  ? 130.420 -43.050  -36.372 1.00 45.33  ? 38   LEU A CD2   1 
ATOM   301   N  N     . ALA A  1  39  ? 127.982 -38.787  -38.764 1.00 60.17  ? 39   ALA A N     1 
ATOM   302   C  CA    . ALA A  1  39  ? 127.228 -38.359  -39.940 1.00 71.54  ? 39   ALA A CA    1 
ATOM   303   C  C     . ALA A  1  39  ? 128.142 -37.872  -41.060 1.00 71.89  ? 39   ALA A C     1 
ATOM   304   O  O     . ALA A  1  39  ? 127.847 -38.085  -42.242 1.00 69.56  ? 39   ALA A O     1 
ATOM   305   C  CB    . ALA A  1  39  ? 126.228 -37.270  -39.550 1.00 75.98  ? 39   ALA A CB    1 
ATOM   306   N  N     . ARG A  1  40  ? 129.256 -37.219  -40.713 1.00 67.33  ? 40   ARG A N     1 
ATOM   307   C  CA    . ARG A  1  40  ? 130.143 -36.679  -41.741 1.00 67.09  ? 40   ARG A CA    1 
ATOM   308   C  C     . ARG A  1  40  ? 130.708 -37.778  -42.636 1.00 68.22  ? 40   ARG A C     1 
ATOM   309   O  O     . ARG A  1  40  ? 131.038 -37.522  -43.800 1.00 71.22  ? 40   ARG A O     1 
ATOM   310   C  CB    . ARG A  1  40  ? 131.275 -35.879  -41.091 1.00 70.56  ? 40   ARG A CB    1 
ATOM   311   C  CG    . ARG A  1  40  ? 132.603 -36.621  -41.005 1.00 82.43  ? 40   ARG A CG    1 
ATOM   312   C  CD    . ARG A  1  40  ? 133.451 -36.138  -39.839 1.00 90.96  ? 40   ARG A CD    1 
ATOM   313   N  NE    . ARG A  1  40  ? 134.792 -36.719  -39.865 1.00 99.71  ? 40   ARG A NE    1 
ATOM   314   C  CZ    . ARG A  1  40  ? 135.698 -36.562  -38.904 1.00 103.32 ? 40   ARG A CZ    1 
ATOM   315   N  NH1   . ARG A  1  40  ? 135.411 -35.845  -37.826 1.00 108.73 ? 40   ARG A NH1   1 
ATOM   316   N  NH2   . ARG A  1  40  ? 136.893 -37.125  -39.018 1.00 96.26  ? 40   ARG A NH2   1 
ATOM   317   N  N     . GLY A  1  41  ? 130.808 -39.003  -42.125 1.00 69.45  ? 41   GLY A N     1 
ATOM   318   C  CA    . GLY A  1  41  ? 131.370 -40.099  -42.875 1.00 62.52  ? 41   GLY A CA    1 
ATOM   319   C  C     . GLY A  1  41  ? 132.572 -40.698  -42.176 1.00 60.09  ? 41   GLY A C     1 
ATOM   320   O  O     . GLY A  1  41  ? 133.009 -40.219  -41.126 1.00 62.14  ? 41   GLY A O     1 
ATOM   321   N  N     . PRO A  1  42  ? 133.127 -41.766  -42.741 1.00 63.41  ? 42   PRO A N     1 
ATOM   322   C  CA    . PRO A  1  42  ? 134.296 -42.410  -42.139 1.00 59.17  ? 42   PRO A CA    1 
ATOM   323   C  C     . PRO A  1  42  ? 135.612 -41.760  -42.549 1.00 61.45  ? 42   PRO A C     1 
ATOM   324   O  O     . PRO A  1  42  ? 135.721 -41.087  -43.575 1.00 65.09  ? 42   PRO A O     1 
ATOM   325   C  CB    . PRO A  1  42  ? 134.213 -43.844  -42.681 1.00 56.81  ? 42   PRO A CB    1 
ATOM   326   C  CG    . PRO A  1  42  ? 133.555 -43.684  -44.014 1.00 59.06  ? 42   PRO A CG    1 
ATOM   327   C  CD    . PRO A  1  42  ? 132.584 -42.539  -43.872 1.00 56.96  ? 42   PRO A CD    1 
ATOM   328   N  N     . LYS A  1  43  ? 136.618 -41.976  -41.704 1.00 64.24  ? 43   LYS A N     1 
ATOM   329   C  CA    . LYS A  1  43  ? 137.992 -41.582  -41.993 1.00 64.09  ? 43   LYS A CA    1 
ATOM   330   C  C     . LYS A  1  43  ? 138.909 -42.741  -41.636 1.00 59.11  ? 43   LYS A C     1 
ATOM   331   O  O     . LYS A  1  43  ? 139.998 -42.887  -42.202 1.00 61.86  ? 43   LYS A O     1 
ATOM   332   C  CB    . LYS A  1  43  ? 138.388 -40.322  -41.216 1.00 61.58  ? 43   LYS A CB    1 
ATOM   333   C  CG    . LYS A  1  43  ? 137.591 -39.071  -41.567 1.00 54.24  ? 43   LYS A CG    1 
ATOM   334   C  CD    . LYS A  1  43  ? 138.019 -38.471  -42.895 1.00 65.76  ? 43   LYS A CD    1 
ATOM   335   C  CE    . LYS A  1  43  ? 137.168 -37.249  -43.239 1.00 75.18  ? 43   LYS A CE    1 
ATOM   336   N  NZ    . LYS A  1  43  ? 137.522 -36.649  -44.557 1.00 75.48  ? 43   LYS A NZ    1 
ATOM   337   N  N     . THR A  1  44  ? 138.471 -43.561  -40.684 1.00 58.66  ? 44   THR A N     1 
ATOM   338   C  CA    . THR A  1  44  ? 139.153 -44.782  -40.282 1.00 55.68  ? 44   THR A CA    1 
ATOM   339   C  C     . THR A  1  44  ? 138.130 -45.908  -40.190 1.00 50.40  ? 44   THR A C     1 
ATOM   340   O  O     . THR A  1  44  ? 136.918 -45.677  -40.189 1.00 49.84  ? 44   THR A O     1 
ATOM   341   C  CB    . THR A  1  44  ? 139.878 -44.609  -38.941 1.00 52.24  ? 44   THR A CB    1 
ATOM   342   O  OG1   . THR A  1  44  ? 138.920 -44.306  -37.919 1.00 51.41  ? 44   THR A OG1   1 
ATOM   343   C  CG2   . THR A  1  44  ? 140.900 -43.477  -39.024 1.00 47.16  ? 44   THR A CG2   1 
ATOM   344   N  N     . THR A  1  45  ? 138.624 -47.146  -40.114 1.00 46.52  ? 45   THR A N     1 
ATOM   345   C  CA    . THR A  1  45  ? 137.721 -48.291  -40.086 1.00 46.04  ? 45   THR A CA    1 
ATOM   346   C  C     . THR A  1  45  ? 136.914 -48.370  -38.794 1.00 44.79  ? 45   THR A C     1 
ATOM   347   O  O     . THR A  1  45  ? 135.842 -48.990  -38.782 1.00 48.12  ? 45   THR A O     1 
ATOM   348   C  CB    . THR A  1  45  ? 138.506 -49.585  -40.305 1.00 48.62  ? 45   THR A CB    1 
ATOM   349   O  OG1   . THR A  1  45  ? 139.606 -49.649  -39.387 1.00 45.40  ? 45   THR A OG1   1 
ATOM   350   C  CG2   . THR A  1  45  ? 139.032 -49.637  -41.731 1.00 47.39  ? 45   THR A CG2   1 
ATOM   351   N  N     . THR A  1  46  ? 137.397 -47.747  -37.716 1.00 44.12  ? 46   THR A N     1 
ATOM   352   C  CA    . THR A  1  46  ? 136.633 -47.687  -36.474 1.00 45.37  ? 46   THR A CA    1 
ATOM   353   C  C     . THR A  1  46  ? 135.221 -47.172  -36.722 1.00 44.15  ? 46   THR A C     1 
ATOM   354   O  O     . THR A  1  46  ? 134.251 -47.679  -36.143 1.00 48.04  ? 46   THR A O     1 
ATOM   355   C  CB    . THR A  1  46  ? 137.362 -46.795  -35.467 1.00 45.06  ? 46   THR A CB    1 
ATOM   356   O  OG1   . THR A  1  46  ? 138.685 -47.300  -35.254 1.00 53.14  ? 46   THR A OG1   1 
ATOM   357   C  CG2   . THR A  1  46  ? 136.622 -46.752  -34.140 1.00 43.52  ? 46   THR A CG2   1 
ATOM   358   N  N     . TRP A  1  47  ? 135.092 -46.186  -37.616 1.00 47.74  ? 47   TRP A N     1 
ATOM   359   C  CA    . TRP A  1  47  ? 133.796 -45.599  -37.941 1.00 46.87  ? 47   TRP A CA    1 
ATOM   360   C  C     . TRP A  1  47  ? 132.764 -46.663  -38.284 1.00 44.44  ? 47   TRP A C     1 
ATOM   361   O  O     . TRP A  1  47  ? 131.594 -46.552  -37.902 1.00 46.80  ? 47   TRP A O     1 
ATOM   362   C  CB    . TRP A  1  47  ? 133.962 -44.621  -39.103 1.00 47.63  ? 47   TRP A CB    1 
ATOM   363   C  CG    . TRP A  1  47  ? 132.723 -43.871  -39.477 1.00 53.30  ? 47   TRP A CG    1 
ATOM   364   C  CD1   . TRP A  1  47  ? 132.348 -42.637  -39.034 1.00 49.18  ? 47   TRP A CD1   1 
ATOM   365   C  CD2   . TRP A  1  47  ? 131.708 -44.293  -40.396 1.00 56.06  ? 47   TRP A CD2   1 
ATOM   366   N  NE1   . TRP A  1  47  ? 131.156 -42.269  -39.608 1.00 55.35  ? 47   TRP A NE1   1 
ATOM   367   C  CE2   . TRP A  1  47  ? 130.743 -43.268  -40.450 1.00 58.33  ? 47   TRP A CE2   1 
ATOM   368   C  CE3   . TRP A  1  47  ? 131.519 -45.440  -41.175 1.00 49.53  ? 47   TRP A CE3   1 
ATOM   369   C  CZ2   . TRP A  1  47  ? 129.607 -43.355  -41.251 1.00 61.03  ? 47   TRP A CZ2   1 
ATOM   370   C  CZ3   . TRP A  1  47  ? 130.394 -45.525  -41.967 1.00 56.96  ? 47   TRP A CZ3   1 
ATOM   371   C  CH2   . TRP A  1  47  ? 129.452 -44.488  -42.002 1.00 61.90  ? 47   TRP A CH2   1 
ATOM   372   N  N     . ILE A  1  48  ? 133.182 -47.711  -38.996 1.00 44.77  ? 48   ILE A N     1 
ATOM   373   C  CA    . ILE A  1  48  ? 132.248 -48.772  -39.357 1.00 44.76  ? 48   ILE A CA    1 
ATOM   374   C  C     . ILE A  1  48  ? 131.711 -49.450  -38.105 1.00 54.86  ? 48   ILE A C     1 
ATOM   375   O  O     . ILE A  1  48  ? 130.492 -49.541  -37.899 1.00 52.52  ? 48   ILE A O     1 
ATOM   376   C  CB    . ILE A  1  48  ? 132.927 -49.780  -40.298 1.00 45.37  ? 48   ILE A CB    1 
ATOM   377   C  CG1   . ILE A  1  48  ? 133.375 -49.072  -41.573 1.00 46.70  ? 48   ILE A CG1   1 
ATOM   378   C  CG2   . ILE A  1  48  ? 131.996 -50.945  -40.602 1.00 45.33  ? 48   ILE A CG2   1 
ATOM   379   C  CD1   . ILE A  1  48  ? 134.216 -49.925  -42.464 1.00 47.38  ? 48   ILE A CD1   1 
ATOM   380   N  N     . TRP A  1  49  ? 132.615 -49.907  -37.233 1.00 43.63  ? 49   TRP A N     1 
ATOM   381   C  CA    . TRP A  1  49  ? 132.196 -50.711  -36.090 1.00 41.63  ? 49   TRP A CA    1 
ATOM   382   C  C     . TRP A  1  49  ? 131.223 -49.940  -35.210 1.00 41.10  ? 49   TRP A C     1 
ATOM   383   O  O     . TRP A  1  49  ? 130.153 -50.449  -34.851 1.00 40.70  ? 49   TRP A O     1 
ATOM   384   C  CB    . TRP A  1  49  ? 133.417 -51.163  -35.288 1.00 40.98  ? 49   TRP A CB    1 
ATOM   385   C  CG    . TRP A  1  49  ? 134.409 -51.955  -36.095 1.00 41.51  ? 49   TRP A CG    1 
ATOM   386   C  CD1   . TRP A  1  49  ? 135.702 -51.613  -36.371 1.00 41.91  ? 49   TRP A CD1   1 
ATOM   387   C  CD2   . TRP A  1  49  ? 134.180 -53.213  -36.745 1.00 41.77  ? 49   TRP A CD2   1 
ATOM   388   N  NE1   . TRP A  1  49  ? 136.295 -52.584  -37.141 1.00 42.40  ? 49   TRP A NE1   1 
ATOM   389   C  CE2   . TRP A  1  49  ? 135.382 -53.576  -37.386 1.00 42.33  ? 49   TRP A CE2   1 
ATOM   390   C  CE3   . TRP A  1  49  ? 133.079 -54.070  -36.840 1.00 41.64  ? 49   TRP A CE3   1 
ATOM   391   C  CZ2   . TRP A  1  49  ? 135.514 -54.759  -38.114 1.00 42.74  ? 49   TRP A CZ2   1 
ATOM   392   C  CZ3   . TRP A  1  49  ? 133.212 -55.245  -37.560 1.00 42.05  ? 49   TRP A CZ3   1 
ATOM   393   C  CH2   . TRP A  1  49  ? 134.421 -55.578  -38.187 1.00 42.59  ? 49   TRP A CH2   1 
ATOM   394   N  N     . ASN A  1  50  ? 131.564 -48.688  -34.890 1.00 41.16  ? 50   ASN A N     1 
ATOM   395   C  CA    . ASN A  1  50  ? 130.706 -47.880  -34.032 1.00 40.93  ? 50   ASN A CA    1 
ATOM   396   C  C     . ASN A  1  50  ? 129.324 -47.702  -34.636 1.00 42.52  ? 50   ASN A C     1 
ATOM   397   O  O     . ASN A  1  50  ? 128.335 -47.616  -33.897 1.00 45.57  ? 50   ASN A O     1 
ATOM   398   C  CB    . ASN A  1  50  ? 131.355 -46.523  -33.768 1.00 40.88  ? 50   ASN A CB    1 
ATOM   399   C  CG    . ASN A  1  50  ? 132.711 -46.652  -33.115 1.00 42.88  ? 50   ASN A CG    1 
ATOM   400   O  OD1   . ASN A  1  50  ? 133.035 -47.688  -32.536 1.00 52.77  ? 50   ASN A OD1   1 
ATOM   401   N  ND2   . ASN A  1  50  ? 133.515 -45.601  -33.203 1.00 47.35  ? 50   ASN A ND2   1 
ATOM   402   N  N     . LEU A  1  51  ? 129.235 -47.671  -35.972 1.00 44.44  ? 51   LEU A N     1 
ATOM   403   C  CA    . LEU A  1  51  ? 127.938 -47.561  -36.632 1.00 42.92  ? 51   LEU A CA    1 
ATOM   404   C  C     . LEU A  1  51  ? 127.013 -48.693  -36.206 1.00 46.30  ? 51   LEU A C     1 
ATOM   405   O  O     . LEU A  1  51  ? 125.818 -48.477  -35.968 1.00 42.30  ? 51   LEU A O     1 
ATOM   406   C  CB    . LEU A  1  51  ? 128.132 -47.551  -38.150 1.00 44.15  ? 51   LEU A CB    1 
ATOM   407   C  CG    . LEU A  1  51  ? 126.938 -47.359  -39.090 1.00 45.04  ? 51   LEU A CG    1 
ATOM   408   C  CD1   . LEU A  1  51  ? 127.433 -46.773  -40.381 1.00 46.28  ? 51   LEU A CD1   1 
ATOM   409   C  CD2   . LEU A  1  51  ? 126.223 -48.659  -39.378 1.00 45.00  ? 51   LEU A CD2   1 
ATOM   410   N  N     . HIS A  1  52  ? 127.548 -49.907  -36.095 1.00 50.59  ? 52   HIS A N     1 
ATOM   411   C  CA    . HIS A  1  52  ? 126.747 -51.004  -35.575 1.00 49.65  ? 52   HIS A CA    1 
ATOM   412   C  C     . HIS A  1  52  ? 126.668 -50.967  -34.057 1.00 47.64  ? 52   HIS A C     1 
ATOM   413   O  O     . HIS A  1  52  ? 125.660 -51.393  -33.482 1.00 50.67  ? 52   HIS A O     1 
ATOM   414   C  CB    . HIS A  1  52  ? 127.323 -52.339  -36.041 1.00 51.04  ? 52   HIS A CB    1 
ATOM   415   C  CG    . HIS A  1  52  ? 127.542 -52.411  -37.518 1.00 48.33  ? 52   HIS A CG    1 
ATOM   416   N  ND1   . HIS A  1  52  ? 128.626 -51.827  -38.139 1.00 45.19  ? 52   HIS A ND1   1 
ATOM   417   C  CD2   . HIS A  1  52  ? 126.811 -52.989  -38.499 1.00 45.90  ? 52   HIS A CD2   1 
ATOM   418   C  CE1   . HIS A  1  52  ? 128.558 -52.050  -39.439 1.00 47.05  ? 52   HIS A CE1   1 
ATOM   419   N  NE2   . HIS A  1  52  ? 127.465 -52.750  -39.683 1.00 52.52  ? 52   HIS A NE2   1 
ATOM   420   N  N     . ALA A  1  53  ? 127.704 -50.444  -33.400 1.00 44.21  ? 53   ALA A N     1 
ATOM   421   C  CA    . ALA A  1  53  ? 127.749 -50.487  -31.943 1.00 43.00  ? 53   ALA A CA    1 
ATOM   422   C  C     . ALA A  1  53  ? 126.677 -49.604  -31.315 1.00 47.33  ? 53   ALA A C     1 
ATOM   423   O  O     . ALA A  1  53  ? 126.139 -49.944  -30.255 1.00 42.66  ? 53   ALA A O     1 
ATOM   424   C  CB    . ALA A  1  53  ? 129.138 -50.071  -31.459 1.00 38.98  ? 53   ALA A CB    1 
ATOM   425   N  N     . ASN A  1  54  ? 126.339 -48.485  -31.958 1.00 39.21  ? 54   ASN A N     1 
ATOM   426   C  CA    . ASN A  1  54  ? 125.440 -47.492  -31.388 1.00 39.14  ? 54   ASN A CA    1 
ATOM   427   C  C     . ASN A  1  54  ? 124.088 -47.431  -32.085 1.00 51.79  ? 54   ASN A C     1 
ATOM   428   O  O     . ASN A  1  54  ? 123.328 -46.487  -31.846 1.00 57.17  ? 54   ASN A O     1 
ATOM   429   C  CB    . ASN A  1  54  ? 126.103 -46.113  -31.425 1.00 47.64  ? 54   ASN A CB    1 
ATOM   430   C  CG    . ASN A  1  54  ? 127.379 -46.061  -30.613 1.00 48.10  ? 54   ASN A CG    1 
ATOM   431   O  OD1   . ASN A  1  54  ? 127.498 -46.724  -29.582 1.00 57.71  ? 54   ASN A OD1   1 
ATOM   432   N  ND2   . ASN A  1  54  ? 128.343 -45.273  -31.073 1.00 43.21  ? 54   ASN A ND2   1 
ATOM   433   N  N     . ALA A  1  55  ? 123.759 -48.418  -32.926 1.00 48.51  ? 55   ALA A N     1 
ATOM   434   C  CA    . ALA A  1  55  ? 122.553 -48.321  -33.746 1.00 42.28  ? 55   ALA A CA    1 
ATOM   435   C  C     . ALA A  1  55  ? 121.289 -48.233  -32.895 1.00 45.74  ? 55   ALA A C     1 
ATOM   436   O  O     . ALA A  1  55  ? 120.357 -47.498  -33.239 1.00 47.53  ? 55   ALA A O     1 
ATOM   437   C  CB    . ALA A  1  55  ? 122.467 -49.505  -34.710 1.00 41.36  ? 55   ALA A CB    1 
ATOM   438   N  N     . HIS A  1  56  ? 121.232 -48.966  -31.781 1.00 40.17  ? 56   HIS A N     1 
ATOM   439   C  CA    . HIS A  1  56  ? 120.043 -48.970  -30.936 1.00 39.82  ? 56   HIS A CA    1 
ATOM   440   C  C     . HIS A  1  56  ? 120.210 -48.153  -29.660 1.00 46.68  ? 56   HIS A C     1 
ATOM   441   O  O     . HIS A  1  56  ? 119.317 -48.166  -28.807 1.00 40.01  ? 56   HIS A O     1 
ATOM   442   C  CB    . HIS A  1  56  ? 119.644 -50.401  -30.581 1.00 39.36  ? 56   HIS A CB    1 
ATOM   443   C  CG    . HIS A  1  56  ? 119.304 -51.250  -31.765 1.00 40.70  ? 56   HIS A CG    1 
ATOM   444   N  ND1   . HIS A  1  56  ? 119.166 -50.737  -33.037 1.00 48.48  ? 56   HIS A ND1   1 
ATOM   445   C  CD2   . HIS A  1  56  ? 119.073 -52.579  -31.870 1.00 45.69  ? 56   HIS A CD2   1 
ATOM   446   C  CE1   . HIS A  1  56  ? 118.866 -51.714  -33.872 1.00 47.50  ? 56   HIS A CE1   1 
ATOM   447   N  NE2   . HIS A  1  56  ? 118.802 -52.842  -33.189 1.00 43.16  ? 56   HIS A NE2   1 
ATOM   448   N  N     . ASP A  1  57  ? 121.323 -47.436  -29.510 1.00 43.74  ? 57   ASP A N     1 
ATOM   449   C  CA    . ASP A  1  57  ? 121.565 -46.629  -28.313 1.00 48.65  ? 57   ASP A CA    1 
ATOM   450   C  C     . ASP A  1  57  ? 120.806 -45.306  -28.444 1.00 51.60  ? 57   ASP A C     1 
ATOM   451   O  O     . ASP A  1  57  ? 121.376 -44.233  -28.661 1.00 53.02  ? 57   ASP A O     1 
ATOM   452   C  CB    . ASP A  1  57  ? 123.060 -46.415  -28.118 1.00 47.45  ? 57   ASP A CB    1 
ATOM   453   C  CG    . ASP A  1  57  ? 123.415 -45.969  -26.710 1.00 51.38  ? 57   ASP A CG    1 
ATOM   454   O  OD1   . ASP A  1  57  ? 122.505 -45.843  -25.862 1.00 53.23  ? 57   ASP A OD1   1 
ATOM   455   O  OD2   . ASP A  1  57  ? 124.616 -45.747  -26.452 1.00 52.30  ? 57   ASP A OD2   1 
ATOM   456   N  N     . PHE A  1  58  ? 119.479 -45.400  -28.294 1.00 44.89  ? 58   PHE A N     1 
ATOM   457   C  CA    . PHE A  1  58  ? 118.618 -44.251  -28.574 1.00 48.64  ? 58   PHE A CA    1 
ATOM   458   C  C     . PHE A  1  58  ? 118.905 -43.079  -27.640 1.00 44.17  ? 58   PHE A C     1 
ATOM   459   O  O     . PHE A  1  58  ? 118.734 -41.921  -28.039 1.00 49.16  ? 58   PHE A O     1 
ATOM   460   C  CB    . PHE A  1  58  ? 117.142 -44.659  -28.494 1.00 48.01  ? 58   PHE A CB    1 
ATOM   461   C  CG    . PHE A  1  58  ? 116.741 -45.698  -29.518 1.00 50.60  ? 58   PHE A CG    1 
ATOM   462   C  CD1   . PHE A  1  58  ? 117.486 -45.878  -30.675 1.00 50.09  ? 58   PHE A CD1   1 
ATOM   463   C  CD2   . PHE A  1  58  ? 115.623 -46.494  -29.322 1.00 43.31  ? 58   PHE A CD2   1 
ATOM   464   C  CE1   . PHE A  1  58  ? 117.129 -46.834  -31.612 1.00 47.55  ? 58   PHE A CE1   1 
ATOM   465   C  CE2   . PHE A  1  58  ? 115.261 -47.457  -30.257 1.00 40.27  ? 58   PHE A CE2   1 
ATOM   466   C  CZ    . PHE A  1  58  ? 116.016 -47.625  -31.403 1.00 40.78  ? 58   PHE A CZ    1 
ATOM   467   N  N     . ASP A  1  59  ? 119.346 -43.349  -26.407 1.00 38.13  ? 59   ASP A N     1 
ATOM   468   C  CA    . ASP A  1  59  ? 119.747 -42.267  -25.510 1.00 38.68  ? 59   ASP A CA    1 
ATOM   469   C  C     . ASP A  1  59  ? 120.861 -41.434  -26.126 1.00 49.15  ? 59   ASP A C     1 
ATOM   470   O  O     . ASP A  1  59  ? 120.799 -40.200  -26.136 1.00 64.82  ? 59   ASP A O     1 
ATOM   471   C  CB    . ASP A  1  59  ? 120.214 -42.822  -24.165 1.00 54.31  ? 59   ASP A CB    1 
ATOM   472   C  CG    . ASP A  1  59  ? 119.213 -43.747  -23.531 1.00 61.82  ? 59   ASP A CG    1 
ATOM   473   O  OD1   . ASP A  1  59  ? 117.998 -43.481  -23.639 1.00 65.51  ? 59   ASP A OD1   1 
ATOM   474   O  OD2   . ASP A  1  59  ? 119.654 -44.741  -22.917 1.00 61.18  ? 59   ASP A OD2   1 
ATOM   475   N  N     . SER A  1  60  ? 121.898 -42.097  -26.639 1.00 46.15  ? 60   SER A N     1 
ATOM   476   C  CA    . SER A  1  60  ? 123.060 -41.396  -27.166 1.00 47.06  ? 60   SER A CA    1 
ATOM   477   C  C     . SER A  1  60  ? 122.766 -40.663  -28.465 1.00 58.48  ? 60   SER A C     1 
ATOM   478   O  O     . SER A  1  60  ? 123.609 -39.884  -28.923 1.00 70.54  ? 60   SER A O     1 
ATOM   479   C  CB    . SER A  1  60  ? 124.207 -42.381  -27.379 1.00 58.53  ? 60   SER A CB    1 
ATOM   480   O  OG    . SER A  1  60  ? 123.855 -43.357  -28.341 1.00 66.57  ? 60   SER A OG    1 
ATOM   481   N  N     . GLN A  1  61  ? 121.604 -40.895  -29.068 1.00 58.92  ? 61   GLN A N     1 
ATOM   482   C  CA    . GLN A  1  61  ? 121.234 -40.209  -30.295 1.00 46.90  ? 61   GLN A CA    1 
ATOM   483   C  C     . GLN A  1  61  ? 120.469 -38.921  -30.019 1.00 49.81  ? 61   GLN A C     1 
ATOM   484   O  O     . GLN A  1  61  ? 120.725 -37.901  -30.666 1.00 52.86  ? 61   GLN A O     1 
ATOM   485   C  CB    . GLN A  1  61  ? 120.402 -41.142  -31.178 1.00 44.44  ? 61   GLN A CB    1 
ATOM   486   C  CG    . GLN A  1  61  ? 121.035 -42.506  -31.389 1.00 51.58  ? 61   GLN A CG    1 
ATOM   487   C  CD    . GLN A  1  61  ? 120.121 -43.473  -32.117 1.00 57.54  ? 61   GLN A CD    1 
ATOM   488   O  OE1   . GLN A  1  61  ? 119.049 -43.097  -32.591 1.00 72.62  ? 61   GLN A OE1   1 
ATOM   489   N  NE2   . GLN A  1  61  ? 120.544 -44.727  -32.211 1.00 46.10  ? 61   GLN A NE2   1 
ATOM   490   N  N     . THR A  1  62  ? 119.541 -38.949  -29.064 1.00 51.81  ? 62   THR A N     1 
ATOM   491   C  CA    . THR A  1  62  ? 118.747 -37.783  -28.707 1.00 51.73  ? 62   THR A CA    1 
ATOM   492   C  C     . THR A  1  62  ? 118.595 -37.703  -27.196 1.00 58.66  ? 62   THR A C     1 
ATOM   493   O  O     . THR A  1  62  ? 118.490 -38.724  -26.510 1.00 60.07  ? 62   THR A O     1 
ATOM   494   C  CB    . THR A  1  62  ? 117.354 -37.817  -29.347 1.00 53.93  ? 62   THR A CB    1 
ATOM   495   O  OG1   . THR A  1  62  ? 116.508 -36.869  -28.685 1.00 50.69  ? 62   THR A OG1   1 
ATOM   496   C  CG2   . THR A  1  62  ? 116.741 -39.212  -29.233 1.00 54.46  ? 62   THR A CG2   1 
ATOM   497   N  N     . SER A  1  63  ? 118.572 -36.476  -26.687 1.00 54.97  ? 63   SER A N     1 
ATOM   498   C  CA    . SER A  1  63  ? 118.341 -36.220  -25.272 1.00 57.25  ? 63   SER A CA    1 
ATOM   499   C  C     . SER A  1  63  ? 116.863 -36.068  -24.932 1.00 54.75  ? 63   SER A C     1 
ATOM   500   O  O     . SER A  1  63  ? 116.527 -35.865  -23.760 1.00 53.28  ? 63   SER A O     1 
ATOM   501   C  CB    . SER A  1  63  ? 119.102 -34.966  -24.838 1.00 58.46  ? 63   SER A CB    1 
ATOM   502   O  OG    . SER A  1  63  ? 118.817 -33.882  -25.703 1.00 66.76  ? 63   SER A OG    1 
ATOM   503   N  N     . ASP A  1  64  ? 115.978 -36.163  -25.919 1.00 46.37  ? 64   ASP A N     1 
ATOM   504   C  CA    . ASP A  1  64  ? 114.547 -35.994  -25.703 1.00 53.88  ? 64   ASP A CA    1 
ATOM   505   C  C     . ASP A  1  64  ? 113.940 -37.333  -25.297 1.00 49.50  ? 64   ASP A C     1 
ATOM   506   O  O     . ASP A  1  64  ? 113.984 -38.296  -26.069 1.00 58.49  ? 64   ASP A O     1 
ATOM   507   C  CB    . ASP A  1  64  ? 113.880 -35.455  -26.969 1.00 56.75  ? 64   ASP A CB    1 
ATOM   508   C  CG    . ASP A  1  64  ? 112.446 -35.025  -26.738 1.00 62.96  ? 64   ASP A CG    1 
ATOM   509   O  OD1   . ASP A  1  64  ? 111.991 -35.051  -25.576 1.00 66.76  ? 64   ASP A OD1   1 
ATOM   510   O  OD2   . ASP A  1  64  ? 111.772 -34.659  -27.723 1.00 67.90  ? 64   ASP A OD2   1 
ATOM   511   N  N     . LEU A  1  65  ? 113.372 -37.390  -24.088 1.00 40.85  ? 65   LEU A N     1 
ATOM   512   C  CA    . LEU A  1  65  ? 112.800 -38.641  -23.596 1.00 42.60  ? 65   LEU A CA    1 
ATOM   513   C  C     . LEU A  1  65  ? 111.625 -39.100  -24.452 1.00 51.18  ? 65   LEU A C     1 
ATOM   514   O  O     . LEU A  1  65  ? 111.429 -40.309  -24.648 1.00 44.13  ? 65   LEU A O     1 
ATOM   515   C  CB    . LEU A  1  65  ? 112.369 -38.476  -22.137 1.00 42.38  ? 65   LEU A CB    1 
ATOM   516   C  CG    . LEU A  1  65  ? 111.818 -39.695  -21.394 1.00 53.03  ? 65   LEU A CG    1 
ATOM   517   C  CD1   . LEU A  1  65  ? 112.661 -40.936  -21.651 1.00 38.62  ? 65   LEU A CD1   1 
ATOM   518   C  CD2   . LEU A  1  65  ? 111.741 -39.406  -19.898 1.00 48.49  ? 65   LEU A CD2   1 
ATOM   519   N  N     . GLU A  1  66  ? 110.850 -38.151  -24.986 1.00 55.62  ? 66   GLU A N     1 
ATOM   520   C  CA    . GLU A  1  66  ? 109.690 -38.498  -25.800 1.00 51.90  ? 66   GLU A CA    1 
ATOM   521   C  C     . GLU A  1  66  ? 110.108 -39.175  -27.101 1.00 46.28  ? 66   GLU A C     1 
ATOM   522   O  O     . GLU A  1  66  ? 109.521 -40.191  -27.499 1.00 50.49  ? 66   GLU A O     1 
ATOM   523   C  CB    . GLU A  1  66  ? 108.868 -37.240  -26.079 1.00 43.20  ? 66   GLU A CB    1 
ATOM   524   C  CG    . GLU A  1  66  ? 107.457 -37.502  -26.558 1.00 46.91  ? 66   GLU A CG    1 
ATOM   525   C  CD    . GLU A  1  66  ? 106.644 -36.231  -26.661 1.00 49.38  ? 66   GLU A CD    1 
ATOM   526   O  OE1   . GLU A  1  66  ? 107.061 -35.317  -27.405 1.00 48.32  ? 66   GLU A OE1   1 
ATOM   527   O  OE2   . GLU A  1  66  ? 105.600 -36.140  -25.982 1.00 49.30  ? 66   GLU A OE2   1 
ATOM   528   N  N     . ASP A  1  67  ? 111.128 -38.635  -27.772 1.00 43.36  ? 67   ASP A N     1 
ATOM   529   C  CA    . ASP A  1  67  ? 111.573 -39.226  -29.030 1.00 49.93  ? 67   ASP A CA    1 
ATOM   530   C  C     . ASP A  1  67  ? 112.181 -40.603  -28.800 1.00 47.68  ? 67   ASP A C     1 
ATOM   531   O  O     . ASP A  1  67  ? 111.983 -41.518  -29.610 1.00 57.15  ? 67   ASP A O     1 
ATOM   532   C  CB    . ASP A  1  67  ? 112.572 -38.300  -29.725 1.00 60.66  ? 67   ASP A CB    1 
ATOM   533   C  CG    . ASP A  1  67  ? 112.910 -38.758  -31.134 1.00 70.40  ? 67   ASP A CG    1 
ATOM   534   O  OD1   . ASP A  1  67  ? 112.146 -39.570  -31.702 1.00 66.14  ? 67   ASP A OD1   1 
ATOM   535   O  OD2   . ASP A  1  67  ? 113.947 -38.308  -31.669 1.00 72.71  ? 67   ASP A OD2   1 
ATOM   536   N  N     . VAL A  1  68  ? 112.918 -40.769  -27.699 1.00 52.25  ? 68   VAL A N     1 
ATOM   537   C  CA    . VAL A  1  68  ? 113.450 -42.081  -27.340 1.00 41.00  ? 68   VAL A CA    1 
ATOM   538   C  C     . VAL A  1  68  ? 112.311 -43.073  -27.136 1.00 45.08  ? 68   VAL A C     1 
ATOM   539   O  O     . VAL A  1  68  ? 112.357 -44.209  -27.624 1.00 47.29  ? 68   VAL A O     1 
ATOM   540   C  CB    . VAL A  1  68  ? 114.337 -41.975  -26.086 1.00 43.02  ? 68   VAL A CB    1 
ATOM   541   C  CG1   . VAL A  1  68  ? 114.737 -43.359  -25.591 1.00 42.52  ? 68   VAL A CG1   1 
ATOM   542   C  CG2   . VAL A  1  68  ? 115.569 -41.133  -26.372 1.00 42.81  ? 68   VAL A CG2   1 
ATOM   543   N  N     . SER A  1  69  ? 111.270 -42.650  -26.411 1.00 44.37  ? 69   SER A N     1 
ATOM   544   C  CA    . SER A  1  69  ? 110.124 -43.524  -26.180 1.00 43.57  ? 69   SER A CA    1 
ATOM   545   C  C     . SER A  1  69  ? 109.471 -43.935  -27.491 1.00 42.24  ? 69   SER A C     1 
ATOM   546   O  O     . SER A  1  69  ? 109.089 -45.099  -27.669 1.00 50.94  ? 69   SER A O     1 
ATOM   547   C  CB    . SER A  1  69  ? 109.110 -42.820  -25.281 1.00 47.91  ? 69   SER A CB    1 
ATOM   548   O  OG    . SER A  1  69  ? 109.717 -42.381  -24.080 1.00 48.00  ? 69   SER A OG    1 
ATOM   549   N  N     . ARG A  1  70  ? 109.332 -42.988  -28.419 1.00 42.33  ? 70   ARG A N     1 
ATOM   550   C  CA    . ARG A  1  70  ? 108.708 -43.290  -29.705 1.00 43.27  ? 70   ARG A CA    1 
ATOM   551   C  C     . ARG A  1  70  ? 109.548 -44.279  -30.508 1.00 43.16  ? 70   ARG A C     1 
ATOM   552   O  O     . ARG A  1  70  ? 109.019 -45.245  -31.088 1.00 43.47  ? 70   ARG A O     1 
ATOM   553   C  CB    . ARG A  1  70  ? 108.487 -41.990  -30.476 1.00 44.24  ? 70   ARG A CB    1 
ATOM   554   C  CG    . ARG A  1  70  ? 107.456 -41.097  -29.816 1.00 44.54  ? 70   ARG A CG    1 
ATOM   555   C  CD    . ARG A  1  70  ? 107.492 -39.697  -30.363 1.00 45.35  ? 70   ARG A CD    1 
ATOM   556   N  NE    . ARG A  1  70  ? 106.285 -38.965  -30.002 1.00 45.90  ? 70   ARG A NE    1 
ATOM   557   C  CZ    . ARG A  1  70  ? 106.078 -37.682  -30.272 1.00 47.43  ? 70   ARG A CZ    1 
ATOM   558   N  NH1   . ARG A  1  70  ? 107.007 -36.976  -30.904 1.00 46.93  ? 70   ARG A NH1   1 
ATOM   559   N  NH2   . ARG A  1  70  ? 104.942 -37.106  -29.906 1.00 47.15  ? 70   ARG A NH2   1 
ATOM   560   N  N     . LYS A  1  71  ? 110.863 -44.050  -30.555 1.00 42.77  ? 71   LYS A N     1 
ATOM   561   C  CA    . LYS A  1  71  ? 111.752 -44.996  -31.220 1.00 42.62  ? 71   LYS A CA    1 
ATOM   562   C  C     . LYS A  1  71  ? 111.613 -46.390  -30.624 1.00 52.22  ? 71   LYS A C     1 
ATOM   563   O  O     . LYS A  1  71  ? 111.546 -47.383  -31.358 1.00 53.12  ? 71   LYS A O     1 
ATOM   564   C  CB    . LYS A  1  71  ? 113.200 -44.517  -31.126 1.00 42.22  ? 71   LYS A CB    1 
ATOM   565   C  CG    . LYS A  1  71  ? 113.453 -43.182  -31.781 1.00 43.59  ? 71   LYS A CG    1 
ATOM   566   C  CD    . LYS A  1  71  ? 114.940 -42.899  -31.925 1.00 47.84  ? 71   LYS A CD    1 
ATOM   567   C  CE    . LYS A  1  71  ? 115.172 -41.649  -32.769 1.00 56.32  ? 71   LYS A CE    1 
ATOM   568   N  NZ    . LYS A  1  71  ? 116.557 -41.569  -33.318 1.00 56.25  ? 71   LYS A NZ    1 
ATOM   569   N  N     . ILE A  1  72  ? 111.546 -46.477  -29.293 1.00 41.08  ? 72   ILE A N     1 
ATOM   570   C  CA    . ILE A  1  72  ? 111.449 -47.775  -28.626 1.00 45.53  ? 72   ILE A CA    1 
ATOM   571   C  C     . ILE A  1  72  ? 110.140 -48.468  -28.988 1.00 40.94  ? 72   ILE A C     1 
ATOM   572   O  O     . ILE A  1  72  ? 110.118 -49.667  -29.286 1.00 40.88  ? 72   ILE A O     1 
ATOM   573   C  CB    . ILE A  1  72  ? 111.609 -47.594  -27.103 1.00 39.50  ? 72   ILE A CB    1 
ATOM   574   C  CG1   . ILE A  1  72  ? 113.069 -47.309  -26.747 1.00 38.87  ? 72   ILE A CG1   1 
ATOM   575   C  CG2   . ILE A  1  72  ? 111.111 -48.806  -26.339 1.00 38.98  ? 72   ILE A CG2   1 
ATOM   576   C  CD1   . ILE A  1  72  ? 113.238 -46.632  -25.418 1.00 38.27  ? 72   ILE A CD1   1 
ATOM   577   N  N     . PHE A  1  73  ? 109.034 -47.722  -28.985 1.00 41.53  ? 73   PHE A N     1 
ATOM   578   C  CA    . PHE A  1  73  ? 107.731 -48.309  -29.290 1.00 42.12  ? 73   PHE A CA    1 
ATOM   579   C  C     . PHE A  1  73  ? 107.700 -48.885  -30.708 1.00 51.51  ? 73   PHE A C     1 
ATOM   580   O  O     . PHE A  1  73  ? 107.283 -50.037  -30.929 1.00 54.31  ? 73   PHE A O     1 
ATOM   581   C  CB    . PHE A  1  73  ? 106.653 -47.242  -29.094 1.00 42.70  ? 73   PHE A CB    1 
ATOM   582   C  CG    . PHE A  1  73  ? 105.253 -47.782  -29.016 1.00 45.35  ? 73   PHE A CG    1 
ATOM   583   C  CD1   . PHE A  1  73  ? 104.969 -48.917  -28.270 1.00 47.14  ? 73   PHE A CD1   1 
ATOM   584   C  CD2   . PHE A  1  73  ? 104.213 -47.129  -29.664 1.00 47.75  ? 73   PHE A CD2   1 
ATOM   585   C  CE1   . PHE A  1  73  ? 103.677 -49.406  -28.191 1.00 43.42  ? 73   PHE A CE1   1 
ATOM   586   C  CE2   . PHE A  1  73  ? 102.920 -47.609  -29.588 1.00 54.65  ? 73   PHE A CE2   1 
ATOM   587   C  CZ    . PHE A  1  73  ? 102.649 -48.751  -28.850 1.00 52.78  ? 73   PHE A CZ    1 
ATOM   588   N  N     . SER A  1  74  ? 108.165 -48.101  -31.687 1.00 47.10  ? 74   SER A N     1 
ATOM   589   C  CA    . SER A  1  74  ? 108.176 -48.609  -33.057 1.00 44.32  ? 74   SER A CA    1 
ATOM   590   C  C     . SER A  1  74  ? 109.158 -49.761  -33.231 1.00 43.81  ? 74   SER A C     1 
ATOM   591   O  O     . SER A  1  74  ? 108.890 -50.692  -34.004 1.00 44.29  ? 74   SER A O     1 
ATOM   592   C  CB    . SER A  1  74  ? 108.493 -47.485  -34.034 1.00 45.13  ? 74   SER A CB    1 
ATOM   593   O  OG    . SER A  1  74  ? 107.437 -46.549  -34.031 1.00 56.99  ? 74   SER A OG    1 
ATOM   594   N  N     . ALA A  1  75  ? 110.291 -49.727  -32.522 1.00 42.89  ? 75   ALA A N     1 
ATOM   595   C  CA    . ALA A  1  75  ? 111.218 -50.852  -32.571 1.00 42.38  ? 75   ALA A CA    1 
ATOM   596   C  C     . ALA A  1  75  ? 110.574 -52.117  -32.020 1.00 42.02  ? 75   ALA A C     1 
ATOM   597   O  O     . ALA A  1  75  ? 110.808 -53.215  -32.533 1.00 42.12  ? 75   ALA A O     1 
ATOM   598   C  CB    . ALA A  1  75  ? 112.493 -50.514  -31.799 1.00 41.47  ? 75   ALA A CB    1 
ATOM   599   N  N     . HIS A  1  76  ? 109.764 -51.981  -30.968 1.00 41.66  ? 76   HIS A N     1 
ATOM   600   C  CA    . HIS A  1  76  ? 109.053 -53.136  -30.428 1.00 41.42  ? 76   HIS A CA    1 
ATOM   601   C  C     . HIS A  1  76  ? 108.103 -53.722  -31.461 1.00 42.40  ? 76   HIS A C     1 
ATOM   602   O  O     . HIS A  1  76  ? 108.014 -54.947  -31.610 1.00 42.39  ? 76   HIS A O     1 
ATOM   603   C  CB    . HIS A  1  76  ? 108.285 -52.745  -29.167 1.00 47.94  ? 76   HIS A CB    1 
ATOM   604   C  CG    . HIS A  1  76  ? 109.159 -52.417  -27.998 1.00 42.20  ? 76   HIS A CG    1 
ATOM   605   N  ND1   . HIS A  1  76  ? 108.649 -52.132  -26.749 1.00 39.56  ? 76   HIS A ND1   1 
ATOM   606   C  CD2   . HIS A  1  76  ? 110.505 -52.332  -27.883 1.00 39.43  ? 76   HIS A CD2   1 
ATOM   607   C  CE1   . HIS A  1  76  ? 109.643 -51.886  -25.916 1.00 38.74  ? 76   HIS A CE1   1 
ATOM   608   N  NE2   . HIS A  1  76  ? 110.779 -51.996  -26.580 1.00 41.59  ? 76   HIS A NE2   1 
ATOM   609   N  N     . PHE A  1  77  ? 107.375 -52.855  -32.178 1.00 43.30  ? 77   PHE A N     1 
ATOM   610   C  CA    . PHE A  1  77  ? 106.512 -53.348  -33.254 1.00 44.66  ? 77   PHE A CA    1 
ATOM   611   C  C     . PHE A  1  77  ? 107.314 -54.084  -34.327 1.00 44.66  ? 77   PHE A C     1 
ATOM   612   O  O     . PHE A  1  77  ? 106.911 -55.160  -34.791 1.00 45.04  ? 77   PHE A O     1 
ATOM   613   C  CB    . PHE A  1  77  ? 105.724 -52.199  -33.874 1.00 45.30  ? 77   PHE A CB    1 
ATOM   614   C  CG    . PHE A  1  77  ? 104.487 -51.838  -33.114 1.00 45.41  ? 77   PHE A CG    1 
ATOM   615   C  CD1   . PHE A  1  77  ? 103.476 -52.767  -32.940 1.00 45.66  ? 77   PHE A CD1   1 
ATOM   616   C  CD2   . PHE A  1  77  ? 104.325 -50.569  -32.587 1.00 45.34  ? 77   PHE A CD2   1 
ATOM   617   C  CE1   . PHE A  1  77  ? 102.328 -52.442  -32.243 1.00 45.82  ? 77   PHE A CE1   1 
ATOM   618   C  CE2   . PHE A  1  77  ? 103.179 -50.235  -31.889 1.00 45.50  ? 77   PHE A CE2   1 
ATOM   619   C  CZ    . PHE A  1  77  ? 102.180 -51.173  -31.716 1.00 45.74  ? 77   PHE A CZ    1 
ATOM   620   N  N     . GLY A  1  78  ? 108.454 -53.520  -34.734 1.00 44.54  ? 78   GLY A N     1 
ATOM   621   C  CA    . GLY A  1  78  ? 109.303 -54.207  -35.698 1.00 44.83  ? 78   GLY A CA    1 
ATOM   622   C  C     . GLY A  1  78  ? 109.795 -55.556  -35.199 1.00 45.04  ? 78   GLY A C     1 
ATOM   623   O  O     . GLY A  1  78  ? 109.820 -56.539  -35.948 1.00 48.74  ? 78   GLY A O     1 
ATOM   624   N  N     . HIS A  1  79  ? 110.186 -55.624  -33.924 1.00 43.02  ? 79   HIS A N     1 
ATOM   625   C  CA    . HIS A  1  79  ? 110.650 -56.888  -33.358 1.00 44.32  ? 79   HIS A CA    1 
ATOM   626   C  C     . HIS A  1  79  ? 109.533 -57.924  -33.321 1.00 44.70  ? 79   HIS A C     1 
ATOM   627   O  O     . HIS A  1  79  ? 109.766 -59.114  -33.580 1.00 42.69  ? 79   HIS A O     1 
ATOM   628   C  CB    . HIS A  1  79  ? 111.207 -56.673  -31.952 1.00 41.18  ? 79   HIS A CB    1 
ATOM   629   C  CG    . HIS A  1  79  ? 111.638 -57.941  -31.290 1.00 42.67  ? 79   HIS A CG    1 
ATOM   630   N  ND1   . HIS A  1  79  ? 110.763 -58.755  -30.603 1.00 40.33  ? 79   HIS A ND1   1 
ATOM   631   C  CD2   . HIS A  1  79  ? 112.844 -58.554  -31.236 1.00 40.00  ? 79   HIS A CD2   1 
ATOM   632   C  CE1   . HIS A  1  79  ? 111.412 -59.813  -30.152 1.00 42.42  ? 79   HIS A CE1   1 
ATOM   633   N  NE2   . HIS A  1  79  ? 112.677 -59.710  -30.515 1.00 39.54  ? 79   HIS A NE2   1 
ATOM   634   N  N     . LEU A  1  80  ? 108.316 -57.496  -32.973 1.00 45.76  ? 80   LEU A N     1 
ATOM   635   C  CA    . LEU A  1  80  ? 107.181 -58.413  -33.004 1.00 43.40  ? 80   LEU A CA    1 
ATOM   636   C  C     . LEU A  1  80  ? 106.933 -58.919  -34.416 1.00 44.48  ? 80   LEU A C     1 
ATOM   637   O  O     . LEU A  1  80  ? 106.606 -60.094  -34.612 1.00 53.78  ? 80   LEU A O     1 
ATOM   638   C  CB    . LEU A  1  80  ? 105.926 -57.737  -32.450 1.00 43.63  ? 80   LEU A CB    1 
ATOM   639   C  CG    . LEU A  1  80  ? 105.854 -57.528  -30.936 1.00 42.69  ? 80   LEU A CG    1 
ATOM   640   C  CD1   . LEU A  1  80  ? 104.484 -56.998  -30.537 1.00 43.13  ? 80   LEU A CD1   1 
ATOM   641   C  CD2   . LEU A  1  80  ? 106.173 -58.818  -30.189 1.00 42.00  ? 80   LEU A CD2   1 
ATOM   642   N  N     . ALA A  1  81  ? 107.096 -58.049  -35.415 1.00 46.79  ? 81   ALA A N     1 
ATOM   643   C  CA    . ALA A  1  81  ? 106.927 -58.489  -36.798 1.00 47.43  ? 81   ALA A CA    1 
ATOM   644   C  C     . ALA A  1  81  ? 107.987 -59.514  -37.185 1.00 53.98  ? 81   ALA A C     1 
ATOM   645   O  O     . ALA A  1  81  ? 107.698 -60.475  -37.913 1.00 60.50  ? 81   ALA A O     1 
ATOM   646   C  CB    . ALA A  1  81  ? 106.961 -57.288  -37.742 1.00 47.24  ? 81   ALA A CB    1 
ATOM   647   N  N     . VAL A  1  82  ? 109.219 -59.331  -36.704 1.00 51.64  ? 82   VAL A N     1 
ATOM   648   C  CA    . VAL A  1  82  ? 110.266 -60.325  -36.949 1.00 57.06  ? 82   VAL A CA    1 
ATOM   649   C  C     . VAL A  1  82  ? 109.881 -61.666  -36.332 1.00 51.00  ? 82   VAL A C     1 
ATOM   650   O  O     . VAL A  1  82  ? 110.003 -62.727  -36.964 1.00 55.58  ? 82   VAL A O     1 
ATOM   651   C  CB    . VAL A  1  82  ? 111.621 -59.834  -36.407 1.00 53.45  ? 82   VAL A CB    1 
ATOM   652   C  CG1   . VAL A  1  82  ? 112.683 -60.891  -36.647 1.00 54.25  ? 82   VAL A CG1   1 
ATOM   653   C  CG2   . VAL A  1  82  ? 112.024 -58.521  -37.055 1.00 50.25  ? 82   VAL A CG2   1 
ATOM   654   N  N     . VAL A  1  83  ? 109.423 -61.638  -35.078 1.00 46.51  ? 83   VAL A N     1 
ATOM   655   C  CA    . VAL A  1  83  ? 109.036 -62.877  -34.407 1.00 50.10  ? 83   VAL A CA    1 
ATOM   656   C  C     . VAL A  1  83  ? 107.878 -63.543  -35.143 1.00 55.67  ? 83   VAL A C     1 
ATOM   657   O  O     . VAL A  1  83  ? 107.813 -64.775  -35.243 1.00 64.16  ? 83   VAL A O     1 
ATOM   658   C  CB    . VAL A  1  83  ? 108.693 -62.603  -32.929 1.00 55.93  ? 83   VAL A CB    1 
ATOM   659   C  CG1   . VAL A  1  83  ? 108.179 -63.865  -32.252 1.00 42.41  ? 83   VAL A CG1   1 
ATOM   660   C  CG2   . VAL A  1  83  ? 109.911 -62.060  -32.192 1.00 41.62  ? 83   VAL A CG2   1 
ATOM   661   N  N     . PHE A  1  84  ? 106.955 -62.742  -35.682 1.00 58.56  ? 84   PHE A N     1 
ATOM   662   C  CA    . PHE A  1  84  ? 105.841 -63.303  -36.444 1.00 55.26  ? 84   PHE A CA    1 
ATOM   663   C  C     . PHE A  1  84  ? 106.325 -63.975  -37.721 1.00 52.21  ? 84   PHE A C     1 
ATOM   664   O  O     . PHE A  1  84  ? 105.856 -65.067  -38.066 1.00 51.30  ? 84   PHE A O     1 
ATOM   665   C  CB    . PHE A  1  84  ? 104.814 -62.221  -36.774 1.00 54.21  ? 84   PHE A CB    1 
ATOM   666   C  CG    . PHE A  1  84  ? 103.718 -62.094  -35.757 1.00 55.94  ? 84   PHE A CG    1 
ATOM   667   C  CD1   . PHE A  1  84  ? 102.900 -63.175  -35.461 1.00 53.89  ? 84   PHE A CD1   1 
ATOM   668   C  CD2   . PHE A  1  84  ? 103.494 -60.890  -35.107 1.00 51.81  ? 84   PHE A CD2   1 
ATOM   669   C  CE1   . PHE A  1  84  ? 101.885 -63.059  -34.525 1.00 56.22  ? 84   PHE A CE1   1 
ATOM   670   C  CE2   . PHE A  1  84  ? 102.482 -60.764  -34.171 1.00 48.78  ? 84   PHE A CE2   1 
ATOM   671   C  CZ    . PHE A  1  84  ? 101.675 -61.848  -33.880 1.00 52.52  ? 84   PHE A CZ    1 
ATOM   672   N  N     . VAL A  1  85  ? 107.245 -63.330  -38.445 1.00 52.59  ? 85   VAL A N     1 
ATOM   673   C  CA    . VAL A  1  85  ? 107.828 -63.957  -39.631 1.00 56.65  ? 85   VAL A CA    1 
ATOM   674   C  C     . VAL A  1  85  ? 108.443 -65.302  -39.265 1.00 60.61  ? 85   VAL A C     1 
ATOM   675   O  O     . VAL A  1  85  ? 108.229 -66.312  -39.946 1.00 65.16  ? 85   VAL A O     1 
ATOM   676   C  CB    . VAL A  1  85  ? 108.864 -63.027  -40.288 1.00 59.92  ? 85   VAL A CB    1 
ATOM   677   C  CG1   . VAL A  1  85  ? 109.697 -63.797  -41.301 1.00 48.75  ? 85   VAL A CG1   1 
ATOM   678   C  CG2   . VAL A  1  85  ? 108.175 -61.853  -40.960 1.00 52.51  ? 85   VAL A CG2   1 
ATOM   679   N  N     . TRP A  1  86  ? 109.189 -65.338  -38.159 1.00 59.54  ? 86   TRP A N     1 
ATOM   680   C  CA    . TRP A  1  86  ? 109.857 -66.574  -37.752 1.00 56.33  ? 86   TRP A CA    1 
ATOM   681   C  C     . TRP A  1  86  ? 108.850 -67.672  -37.405 1.00 54.50  ? 86   TRP A C     1 
ATOM   682   O  O     . TRP A  1  86  ? 109.001 -68.832  -37.818 1.00 51.88  ? 86   TRP A O     1 
ATOM   683   C  CB    . TRP A  1  86  ? 110.781 -66.284  -36.571 1.00 49.75  ? 86   TRP A CB    1 
ATOM   684   C  CG    . TRP A  1  86  ? 111.381 -67.496  -35.957 1.00 46.70  ? 86   TRP A CG    1 
ATOM   685   C  CD1   . TRP A  1  86  ? 112.456 -68.201  -36.412 1.00 49.96  ? 86   TRP A CD1   1 
ATOM   686   C  CD2   . TRP A  1  86  ? 110.950 -68.147  -34.757 1.00 44.90  ? 86   TRP A CD2   1 
ATOM   687   N  NE1   . TRP A  1  86  ? 112.717 -69.257  -35.572 1.00 45.35  ? 86   TRP A NE1   1 
ATOM   688   C  CE2   . TRP A  1  86  ? 111.805 -69.245  -34.550 1.00 42.96  ? 86   TRP A CE2   1 
ATOM   689   C  CE3   . TRP A  1  86  ? 109.919 -67.911  -33.842 1.00 44.86  ? 86   TRP A CE3   1 
ATOM   690   C  CZ2   . TRP A  1  86  ? 111.666 -70.100  -33.464 1.00 42.35  ? 86   TRP A CZ2   1 
ATOM   691   C  CZ3   . TRP A  1  86  ? 109.782 -68.767  -32.763 1.00 42.44  ? 86   TRP A CZ3   1 
ATOM   692   C  CH2   . TRP A  1  86  ? 110.650 -69.846  -32.583 1.00 42.10  ? 86   TRP A CH2   1 
ATOM   693   N  N     . LEU A  1  87  ? 107.812 -67.327  -36.643 1.00 50.35  ? 87   LEU A N     1 
ATOM   694   C  CA    . LEU A  1  87  ? 106.850 -68.339  -36.219 1.00 49.19  ? 87   LEU A CA    1 
ATOM   695   C  C     . LEU A  1  87  ? 106.045 -68.862  -37.402 1.00 58.81  ? 87   LEU A C     1 
ATOM   696   O  O     . LEU A  1  87  ? 105.796 -70.074  -37.513 1.00 61.54  ? 87   LEU A O     1 
ATOM   697   C  CB    . LEU A  1  87  ? 105.926 -67.764  -35.148 1.00 49.30  ? 87   LEU A CB    1 
ATOM   698   C  CG    . LEU A  1  87  ? 105.058 -68.779  -34.409 1.00 58.61  ? 87   LEU A CG    1 
ATOM   699   C  CD1   . LEU A  1  87  ? 105.916 -69.905  -33.862 1.00 59.57  ? 87   LEU A CD1   1 
ATOM   700   C  CD2   . LEU A  1  87  ? 104.292 -68.103  -33.289 1.00 68.80  ? 87   LEU A CD2   1 
ATOM   701   N  N     . SER A  1  88  ? 105.628 -67.965  -38.298 1.00 55.96  ? 88   SER A N     1 
ATOM   702   C  CA    . SER A  1  88  ? 104.944 -68.414  -39.500 1.00 57.40  ? 88   SER A CA    1 
ATOM   703   C  C     . SER A  1  88  ? 105.864 -69.259  -40.370 1.00 54.55  ? 88   SER A C     1 
ATOM   704   O  O     . SER A  1  88  ? 105.398 -70.180  -41.041 1.00 61.43  ? 88   SER A O     1 
ATOM   705   C  CB    . SER A  1  88  ? 104.398 -67.217  -40.280 1.00 67.45  ? 88   SER A CB    1 
ATOM   706   O  OG    . SER A  1  88  ? 105.438 -66.359  -40.708 1.00 75.25  ? 88   SER A OG    1 
ATOM   707   N  N     . GLY A  1  89  ? 107.171 -68.987  -40.354 1.00 53.63  ? 89   GLY A N     1 
ATOM   708   C  CA    . GLY A  1  89  ? 108.095 -69.866  -41.054 1.00 59.03  ? 89   GLY A CA    1 
ATOM   709   C  C     . GLY A  1  89  ? 108.129 -71.262  -40.462 1.00 59.63  ? 89   GLY A C     1 
ATOM   710   O  O     . GLY A  1  89  ? 108.179 -72.259  -41.192 1.00 58.02  ? 89   GLY A O     1 
ATOM   711   N  N     . MET A  1  90  ? 108.113 -71.352  -39.131 1.00 61.56  ? 90   MET A N     1 
ATOM   712   C  CA    . MET A  1  90  ? 108.032 -72.661  -38.484 1.00 58.35  ? 90   MET A CA    1 
ATOM   713   C  C     . MET A  1  90  ? 106.776 -73.405  -38.920 1.00 59.37  ? 90   MET A C     1 
ATOM   714   O  O     . MET A  1  90  ? 106.829 -74.585  -39.295 1.00 49.55  ? 90   MET A O     1 
ATOM   715   C  CB    . MET A  1  90  ? 108.060 -72.506  -36.962 1.00 51.49  ? 90   MET A CB    1 
ATOM   716   C  CG    . MET A  1  90  ? 109.328 -71.877  -36.404 1.00 45.67  ? 90   MET A CG    1 
ATOM   717   S  SD    . MET A  1  90  ? 110.830 -72.659  -37.017 1.00 48.63  ? 90   MET A SD    1 
ATOM   718   C  CE    . MET A  1  90  ? 111.292 -71.541  -38.341 1.00 46.35  ? 90   MET A CE    1 
ATOM   719   N  N     . TYR A  1  91  ? 105.631 -72.718  -38.884 1.00 64.05  ? 91   TYR A N     1 
ATOM   720   C  CA    . TYR A  1  91  ? 104.377 -73.367  -39.258 1.00 50.48  ? 91   TYR A CA    1 
ATOM   721   C  C     . TYR A  1  91  ? 104.350 -73.735  -40.737 1.00 54.24  ? 91   TYR A C     1 
ATOM   722   O  O     . TYR A  1  91  ? 103.790 -74.773  -41.108 1.00 59.07  ? 91   TYR A O     1 
ATOM   723   C  CB    . TYR A  1  91  ? 103.193 -72.470  -38.903 1.00 50.84  ? 91   TYR A CB    1 
ATOM   724   C  CG    . TYR A  1  91  ? 102.739 -72.597  -37.463 1.00 50.45  ? 91   TYR A CG    1 
ATOM   725   C  CD1   . TYR A  1  91  ? 101.738 -73.493  -37.111 1.00 52.73  ? 91   TYR A CD1   1 
ATOM   726   C  CD2   . TYR A  1  91  ? 103.309 -71.821  -36.460 1.00 48.56  ? 91   TYR A CD2   1 
ATOM   727   C  CE1   . TYR A  1  91  ? 101.312 -73.613  -35.800 1.00 57.80  ? 91   TYR A CE1   1 
ATOM   728   C  CE2   . TYR A  1  91  ? 102.890 -71.933  -35.145 1.00 51.59  ? 91   TYR A CE2   1 
ATOM   729   C  CZ    . TYR A  1  91  ? 101.892 -72.833  -34.820 1.00 57.54  ? 91   TYR A CZ    1 
ATOM   730   O  OH    . TYR A  1  91  ? 101.472 -72.954  -33.514 1.00 56.97  ? 91   TYR A OH    1 
ATOM   731   N  N     . PHE A  1  92  ? 104.973 -72.923  -41.592 1.00 57.58  ? 92   PHE A N     1 
ATOM   732   C  CA    . PHE A  1  92  ? 105.017 -73.249  -43.011 1.00 59.32  ? 92   PHE A CA    1 
ATOM   733   C  C     . PHE A  1  92  ? 105.867 -74.484  -43.264 1.00 61.58  ? 92   PHE A C     1 
ATOM   734   O  O     . PHE A  1  92  ? 105.490 -75.345  -44.066 1.00 64.84  ? 92   PHE A O     1 
ATOM   735   C  CB    . PHE A  1  92  ? 105.552 -72.069  -43.821 1.00 60.69  ? 92   PHE A CB    1 
ATOM   736   C  CG    . PHE A  1  92  ? 105.455 -72.271  -45.308 1.00 61.82  ? 92   PHE A CG    1 
ATOM   737   C  CD1   . PHE A  1  92  ? 104.352 -71.815  -46.008 1.00 64.65  ? 92   PHE A CD1   1 
ATOM   738   C  CD2   . PHE A  1  92  ? 106.455 -72.933  -46.003 1.00 62.04  ? 92   PHE A CD2   1 
ATOM   739   C  CE1   . PHE A  1  92  ? 104.253 -72.007  -47.373 1.00 63.53  ? 92   PHE A CE1   1 
ATOM   740   C  CE2   . PHE A  1  92  ? 106.358 -73.131  -47.369 1.00 60.96  ? 92   PHE A CE2   1 
ATOM   741   C  CZ    . PHE A  1  92  ? 105.260 -72.664  -48.054 1.00 57.97  ? 92   PHE A CZ    1 
ATOM   742   N  N     . HIS A  1  93  ? 107.030 -74.575  -42.616 1.00 59.01  ? 93   HIS A N     1 
ATOM   743   C  CA    . HIS A  1  93  ? 107.847 -75.773  -42.774 1.00 58.40  ? 93   HIS A CA    1 
ATOM   744   C  C     . HIS A  1  93  ? 107.144 -77.000  -42.212 1.00 56.44  ? 93   HIS A C     1 
ATOM   745   O  O     . HIS A  1  93  ? 107.315 -78.107  -42.735 1.00 57.73  ? 93   HIS A O     1 
ATOM   746   C  CB    . HIS A  1  93  ? 109.210 -75.575  -42.117 1.00 55.26  ? 93   HIS A CB    1 
ATOM   747   C  CG    . HIS A  1  93  ? 110.265 -75.100  -43.066 1.00 56.71  ? 93   HIS A CG    1 
ATOM   748   N  ND1   . HIS A  1  93  ? 111.285 -75.914  -43.509 1.00 59.32  ? 93   HIS A ND1   1 
ATOM   749   C  CD2   . HIS A  1  93  ? 110.447 -73.903  -43.673 1.00 51.89  ? 93   HIS A CD2   1 
ATOM   750   C  CE1   . HIS A  1  93  ? 112.057 -75.237  -44.340 1.00 60.03  ? 93   HIS A CE1   1 
ATOM   751   N  NE2   . HIS A  1  93  ? 111.570 -74.015  -44.456 1.00 52.21  ? 93   HIS A NE2   1 
ATOM   752   N  N     . GLY A  1  94  ? 106.341 -76.826  -41.160 1.00 51.85  ? 94   GLY A N     1 
ATOM   753   C  CA    . GLY A  1  94  ? 105.506 -77.922  -40.701 1.00 52.15  ? 94   GLY A CA    1 
ATOM   754   C  C     . GLY A  1  94  ? 104.449 -78.321  -41.710 1.00 60.49  ? 94   GLY A C     1 
ATOM   755   O  O     . GLY A  1  94  ? 104.095 -79.500  -41.812 1.00 54.25  ? 94   GLY A O     1 
ATOM   756   N  N     . ALA A  1  95  ? 103.930 -77.353  -42.466 1.00 60.96  ? 95   ALA A N     1 
ATOM   757   C  CA    . ALA A  1  95  ? 102.898 -77.649  -43.455 1.00 59.85  ? 95   ALA A CA    1 
ATOM   758   C  C     . ALA A  1  95  ? 103.470 -78.312  -44.706 1.00 62.25  ? 95   ALA A C     1 
ATOM   759   O  O     . ALA A  1  95  ? 102.870 -79.251  -45.239 1.00 61.41  ? 95   ALA A O     1 
ATOM   760   C  CB    . ALA A  1  95  ? 102.154 -76.366  -43.834 1.00 56.66  ? 95   ALA A CB    1 
ATOM   761   N  N     . LYS A  1  96  ? 104.632 -77.852  -45.179 1.00 62.10  ? 96   LYS A N     1 
ATOM   762   C  CA    . LYS A  1  96  ? 105.124 -78.213  -46.502 1.00 57.71  ? 96   LYS A CA    1 
ATOM   763   C  C     . LYS A  1  96  ? 106.392 -79.055  -46.516 1.00 57.34  ? 96   LYS A C     1 
ATOM   764   O  O     . LYS A  1  96  ? 106.669 -79.692  -47.536 1.00 67.51  ? 96   LYS A O     1 
ATOM   765   C  CB    . LYS A  1  96  ? 105.376 -76.949  -47.336 1.00 64.99  ? 96   LYS A CB    1 
ATOM   766   C  CG    . LYS A  1  96  ? 104.117 -76.358  -47.942 1.00 84.75  ? 96   LYS A CG    1 
ATOM   767   C  CD    . LYS A  1  96  ? 104.312 -76.066  -49.423 1.00 98.27  ? 96   LYS A CD    1 
ATOM   768   C  CE    . LYS A  1  96  ? 104.904 -77.270  -50.145 1.00 103.76 ? 96   LYS A CE    1 
ATOM   769   N  NZ    . LYS A  1  96  ? 105.062 -77.032  -51.606 1.00 108.22 ? 96   LYS A NZ    1 
ATOM   770   N  N     . PHE A  1  97  ? 107.173 -79.077  -45.437 1.00 58.92  ? 97   PHE A N     1 
ATOM   771   C  CA    . PHE A  1  97  ? 108.426 -79.823  -45.451 1.00 55.60  ? 97   PHE A CA    1 
ATOM   772   C  C     . PHE A  1  97  ? 108.547 -80.749  -44.246 1.00 54.68  ? 97   PHE A C     1 
ATOM   773   O  O     . PHE A  1  97  ? 109.656 -81.099  -43.836 1.00 63.05  ? 97   PHE A O     1 
ATOM   774   C  CB    . PHE A  1  97  ? 109.623 -78.876  -45.527 1.00 54.89  ? 97   PHE A CB    1 
ATOM   775   C  CG    . PHE A  1  97  ? 109.556 -77.918  -46.680 1.00 57.37  ? 97   PHE A CG    1 
ATOM   776   C  CD1   . PHE A  1  97  ? 109.751 -78.360  -47.979 1.00 57.78  ? 97   PHE A CD1   1 
ATOM   777   C  CD2   . PHE A  1  97  ? 109.291 -76.577  -46.466 1.00 62.36  ? 97   PHE A CD2   1 
ATOM   778   C  CE1   . PHE A  1  97  ? 109.681 -77.479  -49.045 1.00 63.94  ? 97   PHE A CE1   1 
ATOM   779   C  CE2   . PHE A  1  97  ? 109.220 -75.690  -47.525 1.00 65.37  ? 97   PHE A CE2   1 
ATOM   780   C  CZ    . PHE A  1  97  ? 109.415 -76.142  -48.817 1.00 66.14  ? 97   PHE A CZ    1 
ATOM   781   N  N     . SER A  1  98  ? 107.418 -81.174  -43.685 1.00 54.80  ? 98   SER A N     1 
ATOM   782   C  CA    . SER A  1  98  ? 107.405 -82.059  -42.532 1.00 54.05  ? 98   SER A CA    1 
ATOM   783   C  C     . SER A  1  98  ? 106.615 -83.327  -42.829 1.00 57.95  ? 98   SER A C     1 
ATOM   784   O  O     . SER A  1  98  ? 105.834 -83.401  -43.784 1.00 61.09  ? 98   SER A O     1 
ATOM   785   C  CB    . SER A  1  98  ? 106.797 -81.374  -41.303 1.00 60.50  ? 98   SER A CB    1 
ATOM   786   O  OG    . SER A  1  98  ? 105.405 -81.629  -41.221 1.00 53.73  ? 98   SER A OG    1 
ATOM   787   N  N     . ASN A  1  99  ? 106.831 -84.325  -41.977 1.00 55.41  ? 99   ASN A N     1 
ATOM   788   C  CA    . ASN A  1  99  ? 106.058 -85.562  -41.963 1.00 56.24  ? 99   ASN A CA    1 
ATOM   789   C  C     . ASN A  1  99  ? 105.014 -85.545  -40.858 1.00 56.04  ? 99   ASN A C     1 
ATOM   790   O  O     . ASN A  1  99  ? 104.799 -86.556  -40.184 1.00 55.75  ? 99   ASN A O     1 
ATOM   791   C  CB    . ASN A  1  99  ? 106.987 -86.758  -41.795 1.00 56.12  ? 99   ASN A CB    1 
ATOM   792   C  CG    . ASN A  1  99  ? 107.913 -86.614  -40.599 1.00 58.56  ? 99   ASN A CG    1 
ATOM   793   O  OD1   . ASN A  1  99  ? 107.778 -85.693  -39.795 1.00 53.63  ? 99   ASN A OD1   1 
ATOM   794   N  ND2   . ASN A  1  99  ? 108.860 -87.530  -40.477 1.00 59.55  ? 99   ASN A ND2   1 
ATOM   795   N  N     . TYR A  1  100 ? 104.355 -84.401  -40.654 1.00 59.86  ? 100  TYR A N     1 
ATOM   796   C  CA    . TYR A  1  100 ? 103.557 -84.210  -39.446 1.00 59.66  ? 100  TYR A CA    1 
ATOM   797   C  C     . TYR A  1  100 ? 102.366 -85.160  -39.397 1.00 64.31  ? 100  TYR A C     1 
ATOM   798   O  O     . TYR A  1  100 ? 102.109 -85.784  -38.365 1.00 59.63  ? 100  TYR A O     1 
ATOM   799   C  CB    . TYR A  1  100 ? 103.091 -82.760  -39.335 1.00 55.15  ? 100  TYR A CB    1 
ATOM   800   C  CG    . TYR A  1  100 ? 102.131 -82.555  -38.188 1.00 56.03  ? 100  TYR A CG    1 
ATOM   801   C  CD1   . TYR A  1  100 ? 102.571 -82.633  -36.872 1.00 52.05  ? 100  TYR A CD1   1 
ATOM   802   C  CD2   . TYR A  1  100 ? 100.781 -82.305  -38.417 1.00 54.16  ? 100  TYR A CD2   1 
ATOM   803   C  CE1   . TYR A  1  100 ? 101.701 -82.460  -35.813 1.00 53.48  ? 100  TYR A CE1   1 
ATOM   804   C  CE2   . TYR A  1  100 ? 99.898  -82.129  -37.363 1.00 55.90  ? 100  TYR A CE2   1 
ATOM   805   C  CZ    . TYR A  1  100 ? 100.367 -82.207  -36.060 1.00 61.00  ? 100  TYR A CZ    1 
ATOM   806   O  OH    . TYR A  1  100 ? 99.508  -82.035  -34.996 1.00 56.06  ? 100  TYR A OH    1 
ATOM   807   N  N     . GLU A  1  101 ? 101.615 -85.274  -40.495 1.00 67.50  ? 101  GLU A N     1 
ATOM   808   C  CA    . GLU A  1  101 ? 100.461 -86.170  -40.498 1.00 66.66  ? 101  GLU A CA    1 
ATOM   809   C  C     . GLU A  1  101 ? 100.889 -87.622  -40.308 1.00 64.85  ? 101  GLU A C     1 
ATOM   810   O  O     . GLU A  1  101 ? 100.272 -88.369  -39.535 1.00 69.26  ? 101  GLU A O     1 
ATOM   811   C  CB    . GLU A  1  101 ? 99.673  -86.002  -41.796 1.00 71.62  ? 101  GLU A CB    1 
ATOM   812   C  CG    . GLU A  1  101 ? 99.049  -84.623  -41.981 1.00 75.17  ? 101  GLU A CG    1 
ATOM   813   C  CD    . GLU A  1  101 ? 98.554  -84.392  -43.402 1.00 76.30  ? 101  GLU A CD    1 
ATOM   814   O  OE1   . GLU A  1  101 ? 99.187  -84.912  -44.344 1.00 77.96  ? 101  GLU A OE1   1 
ATOM   815   O  OE2   . GLU A  1  101 ? 97.533  -83.694  -43.578 1.00 75.65  ? 101  GLU A OE2   1 
ATOM   816   N  N     . GLY A  1  102 ? 101.952 -88.036  -41.001 1.00 62.99  ? 102  GLY A N     1 
ATOM   817   C  CA    . GLY A  1  102 ? 102.466 -89.383  -40.814 1.00 60.45  ? 102  GLY A CA    1 
ATOM   818   C  C     . GLY A  1  102 ? 102.900 -89.647  -39.386 1.00 64.13  ? 102  GLY A C     1 
ATOM   819   O  O     . GLY A  1  102 ? 102.602 -90.703  -38.821 1.00 65.23  ? 102  GLY A O     1 
ATOM   820   N  N     . TRP A  1  103 ? 103.611 -88.689  -38.779 1.00 62.62  ? 103  TRP A N     1 
ATOM   821   C  CA    . TRP A  1  103 ? 103.980 -88.827  -37.375 1.00 55.84  ? 103  TRP A CA    1 
ATOM   822   C  C     . TRP A  1  103 ? 102.747 -88.912  -36.487 1.00 60.39  ? 103  TRP A C     1 
ATOM   823   O  O     . TRP A  1  103 ? 102.718 -89.683  -35.520 1.00 55.82  ? 103  TRP A O     1 
ATOM   824   C  CB    . TRP A  1  103 ? 104.860 -87.659  -36.928 1.00 56.67  ? 103  TRP A CB    1 
ATOM   825   C  CG    . TRP A  1  103 ? 105.018 -87.634  -35.441 1.00 52.85  ? 103  TRP A CG    1 
ATOM   826   C  CD1   . TRP A  1  103 ? 105.915 -88.347  -34.701 1.00 52.24  ? 103  TRP A CD1   1 
ATOM   827   C  CD2   . TRP A  1  103 ? 104.229 -86.888  -34.505 1.00 56.28  ? 103  TRP A CD2   1 
ATOM   828   N  NE1   . TRP A  1  103 ? 105.744 -88.082  -33.365 1.00 58.99  ? 103  TRP A NE1   1 
ATOM   829   C  CE2   . TRP A  1  103 ? 104.715 -87.188  -33.218 1.00 62.40  ? 103  TRP A CE2   1 
ATOM   830   C  CE3   . TRP A  1  103 ? 103.166 -85.988  -34.632 1.00 52.89  ? 103  TRP A CE3   1 
ATOM   831   C  CZ2   . TRP A  1  103 ? 104.175 -86.622  -32.066 1.00 62.76  ? 103  TRP A CZ2   1 
ATOM   832   C  CZ3   . TRP A  1  103 ? 102.631 -85.426  -33.487 1.00 52.61  ? 103  TRP A CZ3   1 
ATOM   833   C  CH2   . TRP A  1  103 ? 103.135 -85.746  -32.222 1.00 57.55  ? 103  TRP A CH2   1 
ATOM   834   N  N     . LEU A  1  104 ? 101.724 -88.113  -36.800 1.00 58.24  ? 104  LEU A N     1 
ATOM   835   C  CA    . LEU A  1  104 ? 100.506 -88.080  -36.000 1.00 55.28  ? 104  LEU A CA    1 
ATOM   836   C  C     . LEU A  1  104 ? 99.793  -89.424  -36.031 1.00 58.48  ? 104  LEU A C     1 
ATOM   837   O  O     . LEU A  1  104 ? 99.207  -89.847  -35.028 1.00 59.53  ? 104  LEU A O     1 
ATOM   838   C  CB    . LEU A  1  104 ? 99.589  -86.966  -36.512 1.00 55.74  ? 104  LEU A CB    1 
ATOM   839   C  CG    . LEU A  1  104 ? 98.276  -86.673  -35.782 1.00 55.91  ? 104  LEU A CG    1 
ATOM   840   C  CD1   . LEU A  1  104 ? 98.529  -86.051  -34.414 1.00 54.52  ? 104  LEU A CD1   1 
ATOM   841   C  CD2   . LEU A  1  104 ? 97.399  -85.770  -36.624 1.00 56.73  ? 104  LEU A CD2   1 
ATOM   842   N  N     . ALA A  1  105 ? 99.839  -90.114  -37.174 1.00 57.45  ? 105  ALA A N     1 
ATOM   843   C  CA    . ALA A  1  105 ? 99.150  -91.396  -37.281 1.00 61.40  ? 105  ALA A CA    1 
ATOM   844   C  C     . ALA A  1  105 ? 99.814  -92.495  -36.459 1.00 63.77  ? 105  ALA A C     1 
ATOM   845   O  O     . ALA A  1  105 ? 99.166  -93.507  -36.171 1.00 66.80  ? 105  ALA A O     1 
ATOM   846   C  CB    . ALA A  1  105 ? 99.062  -91.829  -38.745 1.00 59.48  ? 105  ALA A CB    1 
ATOM   847   N  N     . ASP A  1  106 ? 101.079 -92.318  -36.063 1.00 60.99  ? 106  ASP A N     1 
ATOM   848   C  CA    . ASP A  1  106 ? 101.835 -93.358  -35.371 1.00 60.98  ? 106  ASP A CA    1 
ATOM   849   C  C     . ASP A  1  106 ? 103.058 -92.756  -34.682 1.00 63.75  ? 106  ASP A C     1 
ATOM   850   O  O     . ASP A  1  106 ? 104.188 -92.977  -35.130 1.00 62.88  ? 106  ASP A O     1 
ATOM   851   C  CB    . ASP A  1  106 ? 102.254 -94.440  -36.369 1.00 57.08  ? 106  ASP A CB    1 
ATOM   852   C  CG    . ASP A  1  106 ? 102.994 -95.593  -35.719 1.00 60.28  ? 106  ASP A CG    1 
ATOM   853   O  OD1   . ASP A  1  106 ? 102.883 -95.761  -34.487 1.00 65.76  ? 106  ASP A OD1   1 
ATOM   854   O  OD2   . ASP A  1  106 ? 103.695 -96.327  -36.448 1.00 61.42  ? 106  ASP A OD2   1 
ATOM   855   N  N     . PRO A  1  107 ? 102.884 -92.010  -33.587 1.00 64.10  ? 107  PRO A N     1 
ATOM   856   C  CA    . PRO A  1  107 ? 104.004 -91.245  -33.020 1.00 66.30  ? 107  PRO A CA    1 
ATOM   857   C  C     . PRO A  1  107 ? 105.023 -92.062  -32.237 1.00 62.77  ? 107  PRO A C     1 
ATOM   858   O  O     . PRO A  1  107 ? 105.970 -91.475  -31.701 1.00 59.64  ? 107  PRO A O     1 
ATOM   859   C  CB    . PRO A  1  107 ? 103.293 -90.240  -32.101 1.00 59.61  ? 107  PRO A CB    1 
ATOM   860   C  CG    . PRO A  1  107 ? 102.064 -90.950  -31.671 1.00 54.88  ? 107  PRO A CG    1 
ATOM   861   C  CD    . PRO A  1  107 ? 101.626 -91.773  -32.857 1.00 61.10  ? 107  PRO A CD    1 
ATOM   862   N  N     . THR A  1  108 ? 104.881 -93.383  -32.148 1.00 63.27  ? 108  THR A N     1 
ATOM   863   C  CA    . THR A  1  108 ? 105.847 -94.187  -31.412 1.00 59.42  ? 108  THR A CA    1 
ATOM   864   C  C     . THR A  1  108 ? 106.857 -94.893  -32.309 1.00 61.70  ? 108  THR A C     1 
ATOM   865   O  O     . THR A  1  108 ? 107.840 -95.433  -31.794 1.00 61.91  ? 108  THR A O     1 
ATOM   866   C  CB    . THR A  1  108 ? 105.128 -95.226  -30.538 1.00 57.60  ? 108  THR A CB    1 
ATOM   867   O  OG1   . THR A  1  108 ? 104.373 -96.116  -31.367 1.00 61.76  ? 108  THR A OG1   1 
ATOM   868   C  CG2   . THR A  1  108 ? 104.192 -94.539  -29.557 1.00 51.53  ? 108  THR A CG2   1 
ATOM   869   N  N     . HIS A  1  109 ? 106.650 -94.903  -33.627 1.00 63.80  ? 109  HIS A N     1 
ATOM   870   C  CA    . HIS A  1  109 ? 107.556 -95.576  -34.550 1.00 67.02  ? 109  HIS A CA    1 
ATOM   871   C  C     . HIS A  1  109 ? 108.121 -94.638  -35.607 1.00 66.86  ? 109  HIS A C     1 
ATOM   872   O  O     . HIS A  1  109 ? 108.680 -95.110  -36.604 1.00 73.51  ? 109  HIS A O     1 
ATOM   873   C  CB    . HIS A  1  109 ? 106.854 -96.761  -35.226 1.00 57.63  ? 109  HIS A CB    1 
ATOM   874   C  CG    . HIS A  1  109 ? 106.151 -97.673  -34.268 1.00 62.51  ? 109  HIS A CG    1 
ATOM   875   N  ND1   . HIS A  1  109 ? 104.778 -97.740  -34.178 1.00 66.21  ? 109  HIS A ND1   1 
ATOM   876   C  CD2   . HIS A  1  109 ? 106.631 -98.542  -33.346 1.00 67.46  ? 109  HIS A CD2   1 
ATOM   877   C  CE1   . HIS A  1  109 ? 104.441 -98.617  -33.250 1.00 67.90  ? 109  HIS A CE1   1 
ATOM   878   N  NE2   . HIS A  1  109 ? 105.546 -99.117  -32.728 1.00 65.30  ? 109  HIS A NE2   1 
ATOM   879   N  N     . ILE A  1  110 ? 108.002 -93.327  -35.415 1.00 60.54  ? 110  ILE A N     1 
ATOM   880   C  CA    . ILE A  1  110 ? 108.484 -92.357  -36.389 1.00 68.64  ? 110  ILE A CA    1 
ATOM   881   C  C     . ILE A  1  110 ? 109.070 -91.168  -35.642 1.00 59.37  ? 110  ILE A C     1 
ATOM   882   O  O     . ILE A  1  110 ? 108.531 -90.732  -34.618 1.00 59.10  ? 110  ILE A O     1 
ATOM   883   C  CB    . ILE A  1  110 ? 107.356 -91.929  -37.352 1.00 80.84  ? 110  ILE A CB    1 
ATOM   884   C  CG1   . ILE A  1  110 ? 107.886 -91.005  -38.454 1.00 81.54  ? 110  ILE A CG1   1 
ATOM   885   C  CG2   . ILE A  1  110 ? 106.236 -91.282  -36.584 1.00 82.10  ? 110  ILE A CG2   1 
ATOM   886   C  CD1   . ILE A  1  110 ? 107.642 -89.533  -38.213 1.00 77.81  ? 110  ILE A CD1   1 
ATOM   887   N  N     . LYS A  1  111 ? 110.195 -90.649  -36.156 1.00 62.58  ? 111  LYS A N     1 
ATOM   888   C  CA    . LYS A  1  111 ? 110.896 -89.517  -35.562 1.00 59.84  ? 111  LYS A CA    1 
ATOM   889   C  C     . LYS A  1  111 ? 110.466 -88.227  -36.240 1.00 62.42  ? 111  LYS A C     1 
ATOM   890   O  O     . LYS A  1  111 ? 110.455 -88.164  -37.478 1.00 72.41  ? 111  LYS A O     1 
ATOM   891   C  CB    . LYS A  1  111 ? 112.407 -89.691  -35.694 1.00 55.11  ? 111  LYS A CB    1 
ATOM   892   C  CG    . LYS A  1  111 ? 112.940 -90.968  -35.068 1.00 56.35  ? 111  LYS A CG    1 
ATOM   893   C  CD    . LYS A  1  111 ? 112.578 -91.045  -33.597 1.00 66.39  ? 111  LYS A CD    1 
ATOM   894   C  CE    . LYS A  1  111 ? 112.996 -92.375  -32.988 1.00 75.64  ? 111  LYS A CE    1 
ATOM   895   N  NZ    . LYS A  1  111 ? 112.677 -92.433  -31.532 1.00 76.33  ? 111  LYS A NZ    1 
ATOM   896   N  N     . PRO A  1  112 ? 110.102 -87.194  -35.481 1.00 59.00  ? 112  PRO A N     1 
ATOM   897   C  CA    . PRO A  1  112 ? 109.639 -85.945  -36.104 1.00 61.49  ? 112  PRO A CA    1 
ATOM   898   C  C     . PRO A  1  112 ? 110.731 -85.285  -36.936 1.00 59.82  ? 112  PRO A C     1 
ATOM   899   O  O     . PRO A  1  112 ? 111.876 -85.148  -36.499 1.00 60.49  ? 112  PRO A O     1 
ATOM   900   C  CB    . PRO A  1  112 ? 109.245 -85.076  -34.902 1.00 62.23  ? 112  PRO A CB    1 
ATOM   901   C  CG    . PRO A  1  112 ? 109.000 -86.038  -33.794 1.00 65.45  ? 112  PRO A CG    1 
ATOM   902   C  CD    . PRO A  1  112 ? 109.966 -87.165  -34.016 1.00 65.14  ? 112  PRO A CD    1 
ATOM   903   N  N     . SER A  1  113 ? 110.359 -84.872  -38.147 1.00 56.78  ? 113  SER A N     1 
ATOM   904   C  CA    . SER A  1  113 ? 111.249 -84.142  -39.038 1.00 56.48  ? 113  SER A CA    1 
ATOM   905   C  C     . SER A  1  113 ? 110.466 -83.047  -39.746 1.00 61.43  ? 113  SER A C     1 
ATOM   906   O  O     . SER A  1  113 ? 109.314 -83.252  -40.140 1.00 60.31  ? 113  SER A O     1 
ATOM   907   C  CB    . SER A  1  113 ? 111.902 -85.067  -40.072 1.00 58.62  ? 113  SER A CB    1 
ATOM   908   O  OG    . SER A  1  113 ? 112.751 -84.332  -40.937 1.00 51.22  ? 113  SER A OG    1 
ATOM   909   N  N     . ALA A  1  114 ? 111.100 -81.876  -39.902 1.00 64.29  ? 114  ALA A N     1 
ATOM   910   C  CA    . ALA A  1  114 ? 110.456 -80.747  -40.566 1.00 61.00  ? 114  ALA A CA    1 
ATOM   911   C  C     . ALA A  1  114 ? 111.465 -79.868  -41.296 1.00 50.70  ? 114  ALA A C     1 
ATOM   912   O  O     . ALA A  1  114 ? 111.264 -78.653  -41.405 1.00 50.41  ? 114  ALA A O     1 
ATOM   913   C  CB    . ALA A  1  114 ? 109.659 -79.898  -39.570 1.00 62.79  ? 114  ALA A CB    1 
ATOM   914   N  N     . GLN A  1  115 ? 112.546 -80.460  -41.798 1.00 50.78  ? 115  GLN A N     1 
ATOM   915   C  CA    . GLN A  1  115 ? 113.491 -79.744  -42.650 1.00 50.99  ? 115  GLN A CA    1 
ATOM   916   C  C     . GLN A  1  115 ? 114.111 -80.742  -43.616 1.00 58.53  ? 115  GLN A C     1 
ATOM   917   O  O     . GLN A  1  115 ? 114.826 -81.655  -43.194 1.00 53.78  ? 115  GLN A O     1 
ATOM   918   C  CB    . GLN A  1  115 ? 114.561 -79.048  -41.824 1.00 50.51  ? 115  GLN A CB    1 
ATOM   919   C  CG    . GLN A  1  115 ? 115.778 -78.631  -42.628 1.00 54.10  ? 115  GLN A CG    1 
ATOM   920   C  CD    . GLN A  1  115 ? 116.614 -77.623  -41.884 1.00 51.63  ? 115  GLN A CD    1 
ATOM   921   O  OE1   . GLN A  1  115 ? 116.126 -76.984  -40.963 1.00 61.12  ? 115  GLN A OE1   1 
ATOM   922   N  NE2   . GLN A  1  115 ? 117.875 -77.473  -42.274 1.00 48.74  ? 115  GLN A NE2   1 
ATOM   923   N  N     . VAL A  1  116 ? 113.835 -80.567  -44.904 1.00 66.92  ? 116  VAL A N     1 
ATOM   924   C  CA    . VAL A  1  116 ? 114.394 -81.408  -45.954 1.00 63.50  ? 116  VAL A CA    1 
ATOM   925   C  C     . VAL A  1  116 ? 115.545 -80.654  -46.601 1.00 57.33  ? 116  VAL A C     1 
ATOM   926   O  O     . VAL A  1  116 ? 115.422 -79.463  -46.913 1.00 58.10  ? 116  VAL A O     1 
ATOM   927   C  CB    . VAL A  1  116 ? 113.327 -81.786  -46.993 1.00 64.05  ? 116  VAL A CB    1 
ATOM   928   C  CG1   . VAL A  1  116 ? 113.660 -83.129  -47.625 1.00 71.75  ? 116  VAL A CG1   1 
ATOM   929   C  CG2   . VAL A  1  116 ? 111.942 -81.800  -46.353 1.00 57.69  ? 116  VAL A CG2   1 
ATOM   930   N  N     . VAL A  1  117 ? 116.661 -81.339  -46.797 1.00 62.09  ? 117  VAL A N     1 
ATOM   931   C  CA    . VAL A  1  117 ? 117.868 -80.732  -47.346 1.00 57.88  ? 117  VAL A CA    1 
ATOM   932   C  C     . VAL A  1  117 ? 117.985 -81.098  -48.818 1.00 58.20  ? 117  VAL A C     1 
ATOM   933   O  O     . VAL A  1  117 ? 117.739 -82.247  -49.211 1.00 59.55  ? 117  VAL A O     1 
ATOM   934   C  CB    . VAL A  1  117 ? 119.111 -81.177  -46.551 1.00 58.44  ? 117  VAL A CB    1 
ATOM   935   C  CG1   . VAL A  1  117 ? 120.387 -80.803  -47.283 1.00 60.26  ? 117  VAL A CG1   1 
ATOM   936   C  CG2   . VAL A  1  117 ? 119.093 -80.551  -45.166 1.00 52.65  ? 117  VAL A CG2   1 
ATOM   937   N  N     . TRP A  1  118 ? 118.346 -80.115  -49.634 1.00 57.39  ? 118  TRP A N     1 
ATOM   938   C  CA    . TRP A  1  118 ? 118.563 -80.360  -51.050 1.00 63.33  ? 118  TRP A CA    1 
ATOM   939   C  C     . TRP A  1  118 ? 119.818 -81.205  -51.253 1.00 60.26  ? 118  TRP A C     1 
ATOM   940   O  O     . TRP A  1  118 ? 120.801 -81.042  -50.524 1.00 58.05  ? 118  TRP A O     1 
ATOM   941   C  CB    . TRP A  1  118 ? 118.712 -79.043  -51.802 1.00 61.91  ? 118  TRP A CB    1 
ATOM   942   C  CG    . TRP A  1  118 ? 117.449 -78.264  -51.962 1.00 65.01  ? 118  TRP A CG    1 
ATOM   943   C  CD1   . TRP A  1  118 ? 116.194 -78.763  -52.143 1.00 70.45  ? 118  TRP A CD1   1 
ATOM   944   C  CD2   . TRP A  1  118 ? 117.317 -76.837  -51.948 1.00 64.60  ? 118  TRP A CD2   1 
ATOM   945   N  NE1   . TRP A  1  118 ? 115.288 -77.735  -52.246 1.00 75.86  ? 118  TRP A NE1   1 
ATOM   946   C  CE2   . TRP A  1  118 ? 115.952 -76.543  -52.127 1.00 73.75  ? 118  TRP A CE2   1 
ATOM   947   C  CE3   . TRP A  1  118 ? 118.221 -75.781  -51.800 1.00 61.40  ? 118  TRP A CE3   1 
ATOM   948   C  CZ2   . TRP A  1  118 ? 115.469 -75.237  -52.165 1.00 75.87  ? 118  TRP A CZ2   1 
ATOM   949   C  CZ3   . TRP A  1  118 ? 117.742 -74.488  -51.841 1.00 60.78  ? 118  TRP A CZ3   1 
ATOM   950   C  CH2   . TRP A  1  118 ? 116.378 -74.226  -52.017 1.00 70.50  ? 118  TRP A CH2   1 
ATOM   951   N  N     . PRO A  1  119 ? 119.820 -82.107  -52.235 1.00 60.01  ? 119  PRO A N     1 
ATOM   952   C  CA    . PRO A  1  119 ? 121.013 -82.917  -52.522 1.00 62.31  ? 119  PRO A CA    1 
ATOM   953   C  C     . PRO A  1  119 ? 122.043 -82.129  -53.317 1.00 64.41  ? 119  PRO A C     1 
ATOM   954   O  O     . PRO A  1  119 ? 121.875 -81.888  -54.516 1.00 68.45  ? 119  PRO A O     1 
ATOM   955   C  CB    . PRO A  1  119 ? 120.445 -84.095  -53.331 1.00 65.23  ? 119  PRO A CB    1 
ATOM   956   C  CG    . PRO A  1  119 ? 118.955 -84.042  -53.133 1.00 68.41  ? 119  PRO A CG    1 
ATOM   957   C  CD    . PRO A  1  119 ? 118.640 -82.596  -52.960 1.00 64.22  ? 119  PRO A CD    1 
ATOM   958   N  N     . ILE A  1  120 ? 123.123 -81.730  -52.647 1.00 64.66  ? 120  ILE A N     1 
ATOM   959   C  CA    . ILE A  1  120 ? 124.236 -81.051  -53.298 1.00 65.03  ? 120  ILE A CA    1 
ATOM   960   C  C     . ILE A  1  120 ? 125.501 -81.347  -52.503 1.00 59.29  ? 120  ILE A C     1 
ATOM   961   O  O     . ILE A  1  120 ? 125.464 -81.493  -51.278 1.00 57.97  ? 120  ILE A O     1 
ATOM   962   C  CB    . ILE A  1  120 ? 123.977 -79.529  -53.434 1.00 60.05  ? 120  ILE A CB    1 
ATOM   963   C  CG1   . ILE A  1  120 ? 125.087 -78.850  -54.244 1.00 60.68  ? 120  ILE A CG1   1 
ATOM   964   C  CG2   . ILE A  1  120 ? 123.809 -78.881  -52.075 1.00 58.37  ? 120  ILE A CG2   1 
ATOM   965   C  CD1   . ILE A  1  120 ? 125.057 -79.179  -55.733 1.00 62.53  ? 120  ILE A CD1   1 
ATOM   966   N  N     . VAL A  1  121 ? 126.621 -81.467  -53.227 1.00 59.42  ? 121  VAL A N     1 
ATOM   967   C  CA    . VAL A  1  121 ? 127.970 -81.747  -52.721 1.00 58.81  ? 121  VAL A CA    1 
ATOM   968   C  C     . VAL A  1  121 ? 127.988 -82.809  -51.625 1.00 57.89  ? 121  VAL A C     1 
ATOM   969   O  O     . VAL A  1  121 ? 128.863 -82.802  -50.752 1.00 56.88  ? 121  VAL A O     1 
ATOM   970   C  CB    . VAL A  1  121 ? 128.674 -80.457  -52.248 1.00 57.88  ? 121  VAL A CB    1 
ATOM   971   C  CG1   . VAL A  1  121 ? 128.749 -79.447  -53.382 1.00 58.90  ? 121  VAL A CG1   1 
ATOM   972   C  CG2   . VAL A  1  121 ? 128.007 -79.843  -51.015 1.00 60.08  ? 121  VAL A CG2   1 
ATOM   973   N  N     . GLY A  1  122 ? 127.053 -83.752  -51.681 1.00 58.33  ? 122  GLY A N     1 
ATOM   974   C  CA    . GLY A  1  122 ? 127.029 -84.851  -50.745 1.00 57.67  ? 122  GLY A CA    1 
ATOM   975   C  C     . GLY A  1  122 ? 126.226 -84.611  -49.490 1.00 56.32  ? 122  GLY A C     1 
ATOM   976   O  O     . GLY A  1  122 ? 125.931 -85.575  -48.772 1.00 55.93  ? 122  GLY A O     1 
ATOM   977   N  N     . GLN A  1  123 ? 125.847 -83.364  -49.206 1.00 55.65  ? 123  GLN A N     1 
ATOM   978   C  CA    . GLN A  1  123 ? 125.133 -83.048  -47.974 1.00 57.81  ? 123  GLN A CA    1 
ATOM   979   C  C     . GLN A  1  123 ? 123.750 -83.682  -47.902 1.00 57.08  ? 123  GLN A C     1 
ATOM   980   O  O     . GLN A  1  123 ? 123.129 -83.650  -46.832 1.00 53.68  ? 123  GLN A O     1 
ATOM   981   C  CB    . GLN A  1  123 ? 125.000 -81.537  -47.825 1.00 63.54  ? 123  GLN A CB    1 
ATOM   982   C  CG    . GLN A  1  123 ? 123.813 -80.960  -48.567 1.00 65.47  ? 123  GLN A CG    1 
ATOM   983   C  CD    . GLN A  1  123 ? 123.922 -79.465  -48.743 1.00 69.44  ? 123  GLN A CD    1 
ATOM   984   O  OE1   . GLN A  1  123 ? 125.011 -78.939  -48.971 1.00 79.89  ? 123  GLN A OE1   1 
ATOM   985   N  NE2   . GLN A  1  123 ? 122.794 -78.769  -48.641 1.00 58.81  ? 123  GLN A NE2   1 
ATOM   986   N  N     . GLY A  1  124 ? 123.252 -84.249  -49.003 1.00 59.34  ? 124  GLY A N     1 
ATOM   987   C  CA    . GLY A  1  124 ? 121.972 -84.931  -48.969 1.00 58.46  ? 124  GLY A CA    1 
ATOM   988   C  C     . GLY A  1  124 ? 121.894 -86.026  -47.926 1.00 55.84  ? 124  GLY A C     1 
ATOM   989   O  O     . GLY A  1  124 ? 120.791 -86.438  -47.552 1.00 55.84  ? 124  GLY A O     1 
ATOM   990   N  N     . ILE A  1  125 ? 123.043 -86.501  -47.442 1.00 55.31  ? 125  ILE A N     1 
ATOM   991   C  CA    . ILE A  1  125 ? 123.066 -87.520  -46.403 1.00 54.66  ? 125  ILE A CA    1 
ATOM   992   C  C     . ILE A  1  125 ? 122.393 -87.037  -45.125 1.00 56.10  ? 125  ILE A C     1 
ATOM   993   O  O     . ILE A  1  125 ? 121.943 -87.857  -44.317 1.00 53.00  ? 125  ILE A O     1 
ATOM   994   C  CB    . ILE A  1  125 ? 124.522 -87.959  -46.138 1.00 54.34  ? 125  ILE A CB    1 
ATOM   995   C  CG1   . ILE A  1  125 ? 124.554 -89.243  -45.306 1.00 55.81  ? 125  ILE A CG1   1 
ATOM   996   C  CG2   . ILE A  1  125 ? 125.299 -86.846  -45.445 1.00 53.13  ? 125  ILE A CG2   1 
ATOM   997   C  CD1   . ILE A  1  125 ? 125.953 -89.696  -44.923 1.00 53.69  ? 125  ILE A CD1   1 
ATOM   998   N  N     . LEU A  1  126 ? 122.295 -85.717  -44.926 1.00 61.50  ? 126  LEU A N     1 
ATOM   999   C  CA    . LEU A  1  126 ? 121.624 -85.183  -43.745 1.00 51.51  ? 126  LEU A CA    1 
ATOM   1000  C  C     . LEU A  1  126 ? 120.138 -85.523  -43.714 1.00 52.31  ? 126  LEU A C     1 
ATOM   1001  O  O     . LEU A  1  126 ? 119.520 -85.454  -42.647 1.00 57.95  ? 126  LEU A O     1 
ATOM   1002  C  CB    . LEU A  1  126 ? 121.808 -83.669  -43.677 1.00 50.89  ? 126  LEU A CB    1 
ATOM   1003  C  CG    . LEU A  1  126 ? 123.256 -83.214  -43.517 1.00 50.33  ? 126  LEU A CG    1 
ATOM   1004  C  CD1   . LEU A  1  126 ? 123.337 -81.709  -43.464 1.00 49.80  ? 126  LEU A CD1   1 
ATOM   1005  C  CD2   . LEU A  1  126 ? 123.853 -83.823  -42.267 1.00 51.85  ? 126  LEU A CD2   1 
ATOM   1006  N  N     . ASN A  1  127 ? 119.549 -85.886  -44.854 1.00 56.25  ? 127  ASN A N     1 
ATOM   1007  C  CA    . ASN A  1  127 ? 118.158 -86.333  -44.907 1.00 57.77  ? 127  ASN A CA    1 
ATOM   1008  C  C     . ASN A  1  127 ? 118.062 -87.766  -44.385 1.00 57.11  ? 127  ASN A C     1 
ATOM   1009  O  O     . ASN A  1  127 ? 117.865 -88.731  -45.136 1.00 61.84  ? 127  ASN A O     1 
ATOM   1010  C  CB    . ASN A  1  127 ? 117.617 -86.247  -46.328 1.00 55.32  ? 127  ASN A CB    1 
ATOM   1011  C  CG    . ASN A  1  127 ? 117.544 -84.832  -46.843 1.00 55.33  ? 127  ASN A CG    1 
ATOM   1012  O  OD1   . ASN A  1  127 ? 117.264 -83.904  -46.089 1.00 54.34  ? 127  ASN A OD1   1 
ATOM   1013  N  ND2   . ASN A  1  127 ? 117.801 -84.655  -48.136 1.00 56.50  ? 127  ASN A ND2   1 
ATOM   1014  N  N     . GLY A  1  128 ? 118.193 -87.911  -43.073 1.00 56.61  ? 128  GLY A N     1 
ATOM   1015  C  CA    . GLY A  1  128 ? 118.123 -89.231  -42.471 1.00 55.22  ? 128  GLY A CA    1 
ATOM   1016  C  C     . GLY A  1  128 ? 116.722 -89.809  -42.543 1.00 56.26  ? 128  GLY A C     1 
ATOM   1017  O  O     . GLY A  1  128 ? 115.728 -89.085  -42.586 1.00 63.50  ? 128  GLY A O     1 
ATOM   1018  N  N     . ASP A  1  129 ? 116.648 -91.138  -42.574 1.00 60.56  ? 129  ASP A N     1 
ATOM   1019  C  CA    . ASP A  1  129 ? 115.365 -91.833  -42.652 1.00 71.06  ? 129  ASP A CA    1 
ATOM   1020  C  C     . ASP A  1  129 ? 114.693 -91.774  -41.287 1.00 64.50  ? 129  ASP A C     1 
ATOM   1021  O  O     . ASP A  1  129 ? 115.104 -92.468  -40.353 1.00 55.72  ? 129  ASP A O     1 
ATOM   1022  C  CB    . ASP A  1  129 ? 115.566 -93.276  -43.109 1.00 80.72  ? 129  ASP A CB    1 
ATOM   1023  C  CG    . ASP A  1  129 ? 114.295 -94.101  -43.014 1.00 90.49  ? 129  ASP A CG    1 
ATOM   1024  O  OD1   . ASP A  1  129 ? 113.988 -94.612  -41.916 1.00 91.62  ? 129  ASP A OD1   1 
ATOM   1025  O  OD2   . ASP A  1  129 ? 113.594 -94.230  -44.039 1.00 97.56  ? 129  ASP A OD2   1 
ATOM   1026  N  N     . VAL A  1  130 ? 113.641 -90.958  -41.172 1.00 66.33  ? 130  VAL A N     1 
ATOM   1027  C  CA    . VAL A  1  130 ? 112.981 -90.739  -39.890 1.00 64.36  ? 130  VAL A CA    1 
ATOM   1028  C  C     . VAL A  1  130 ? 111.721 -91.589  -39.740 1.00 70.53  ? 130  VAL A C     1 
ATOM   1029  O  O     . VAL A  1  130 ? 111.006 -91.456  -38.746 1.00 64.22  ? 130  VAL A O     1 
ATOM   1030  C  CB    . VAL A  1  130 ? 112.664 -89.247  -39.678 1.00 60.53  ? 130  VAL A CB    1 
ATOM   1031  C  CG1   . VAL A  1  130 ? 113.941 -88.447  -39.605 1.00 52.30  ? 130  VAL A CG1   1 
ATOM   1032  C  CG2   . VAL A  1  130 ? 111.784 -88.740  -40.803 1.00 61.52  ? 130  VAL A CG2   1 
ATOM   1033  N  N     . GLY A  1  131 ? 111.426 -92.446  -40.702 1.00 74.46  ? 131  GLY A N     1 
ATOM   1034  C  CA    . GLY A  1  131 ? 110.284 -93.333  -40.609 1.00 74.68  ? 131  GLY A CA    1 
ATOM   1035  C  C     . GLY A  1  131 ? 109.211 -92.997  -41.634 1.00 68.55  ? 131  GLY A C     1 
ATOM   1036  O  O     . GLY A  1  131 ? 109.052 -91.845  -42.059 1.00 63.20  ? 131  GLY A O     1 
ATOM   1037  N  N     . GLY A  1  132 ? 108.461 -94.021  -42.034 1.00 67.28  ? 132  GLY A N     1 
ATOM   1038  C  CA    . GLY A  1  132 ? 107.365 -93.828  -42.967 1.00 66.89  ? 132  GLY A CA    1 
ATOM   1039  C  C     . GLY A  1  132 ? 107.800 -93.364  -44.335 1.00 65.49  ? 132  GLY A C     1 
ATOM   1040  O  O     . GLY A  1  132 ? 107.031 -92.689  -45.028 1.00 61.69  ? 132  GLY A O     1 
ATOM   1041  N  N     . GLY A  1  133 ? 109.017 -93.711  -44.748 1.00 63.84  ? 133  GLY A N     1 
ATOM   1042  C  CA    . GLY A  1  133 ? 109.533 -93.248  -46.018 1.00 66.32  ? 133  GLY A CA    1 
ATOM   1043  C  C     . GLY A  1  133 ? 109.930 -91.793  -46.045 1.00 69.11  ? 133  GLY A C     1 
ATOM   1044  O  O     . GLY A  1  133 ? 110.285 -91.282  -47.111 1.00 81.08  ? 133  GLY A O     1 
ATOM   1045  N  N     . PHE A  1  134 ? 109.880 -91.104  -44.912 1.00 59.35  ? 134  PHE A N     1 
ATOM   1046  C  CA    . PHE A  1  134 ? 110.264 -89.705  -44.868 1.00 58.50  ? 134  PHE A CA    1 
ATOM   1047  C  C     . PHE A  1  134 ? 111.746 -89.586  -44.553 1.00 60.67  ? 134  PHE A C     1 
ATOM   1048  O  O     . PHE A  1  134 ? 112.281 -90.314  -43.709 1.00 62.10  ? 134  PHE A O     1 
ATOM   1049  C  CB    . PHE A  1  134 ? 109.447 -88.933  -43.833 1.00 57.55  ? 134  PHE A CB    1 
ATOM   1050  C  CG    . PHE A  1  134 ? 109.453 -87.451  -44.057 1.00 57.13  ? 134  PHE A CG    1 
ATOM   1051  C  CD1   . PHE A  1  134 ? 108.663 -86.891  -45.047 1.00 58.17  ? 134  PHE A CD1   1 
ATOM   1052  C  CD2   . PHE A  1  134 ? 110.255 -86.616  -43.290 1.00 55.75  ? 134  PHE A CD2   1 
ATOM   1053  C  CE1   . PHE A  1  134 ? 108.662 -85.530  -45.267 1.00 57.84  ? 134  PHE A CE1   1 
ATOM   1054  C  CE2   . PHE A  1  134 ? 110.259 -85.249  -43.505 1.00 55.42  ? 134  PHE A CE2   1 
ATOM   1055  C  CZ    . PHE A  1  134 ? 109.462 -84.706  -44.497 1.00 56.46  ? 134  PHE A CZ    1 
ATOM   1056  N  N     . HIS A  1  135 ? 112.405 -88.663  -45.245 1.00 56.94  ? 135  HIS A N     1 
ATOM   1057  C  CA    . HIS A  1  135 ? 113.834 -88.436  -45.089 1.00 63.62  ? 135  HIS A CA    1 
ATOM   1058  C  C     . HIS A  1  135 ? 114.065 -86.951  -44.874 1.00 61.94  ? 135  HIS A C     1 
ATOM   1059  O  O     . HIS A  1  135 ? 113.655 -86.129  -45.701 1.00 58.80  ? 135  HIS A O     1 
ATOM   1060  C  CB    . HIS A  1  135 ? 114.609 -88.943  -46.306 1.00 60.07  ? 135  HIS A CB    1 
ATOM   1061  C  CG    . HIS A  1  135 ? 114.456 -90.413  -46.539 1.00 66.05  ? 135  HIS A CG    1 
ATOM   1062  N  ND1   . HIS A  1  135 ? 115.362 -91.339  -46.070 1.00 67.52  ? 135  HIS A ND1   1 
ATOM   1063  C  CD2   . HIS A  1  135 ? 113.489 -91.118  -47.173 1.00 66.57  ? 135  HIS A CD2   1 
ATOM   1064  C  CE1   . HIS A  1  135 ? 114.967 -92.551  -46.416 1.00 68.38  ? 135  HIS A CE1   1 
ATOM   1065  N  NE2   . HIS A  1  135 ? 113.832 -92.445  -47.084 1.00 68.92  ? 135  HIS A NE2   1 
ATOM   1066  N  N     . GLY A  1  136 ? 114.708 -86.615  -43.765 1.00 57.02  ? 136  GLY A N     1 
ATOM   1067  C  CA    . GLY A  1  136 ? 114.992 -85.227  -43.470 1.00 55.04  ? 136  GLY A CA    1 
ATOM   1068  C  C     . GLY A  1  136 ? 115.790 -85.106  -42.194 1.00 57.07  ? 136  GLY A C     1 
ATOM   1069  O  O     . GLY A  1  136 ? 116.355 -86.084  -41.692 1.00 56.57  ? 136  GLY A O     1 
ATOM   1070  N  N     . ILE A  1  137 ? 115.834 -83.886  -41.677 1.00 50.66  ? 137  ILE A N     1 
ATOM   1071  C  CA    . ILE A  1  137 ? 116.538 -83.593  -40.436 1.00 49.28  ? 137  ILE A CA    1 
ATOM   1072  C  C     . ILE A  1  137 ? 115.568 -83.747  -39.275 1.00 51.04  ? 137  ILE A C     1 
ATOM   1073  O  O     . ILE A  1  137 ? 114.454 -83.210  -39.305 1.00 48.86  ? 137  ILE A O     1 
ATOM   1074  C  CB    . ILE A  1  137 ? 117.148 -82.182  -40.466 1.00 48.67  ? 137  ILE A CB    1 
ATOM   1075  C  CG1   . ILE A  1  137 ? 118.368 -82.157  -41.387 1.00 51.38  ? 137  ILE A CG1   1 
ATOM   1076  C  CG2   . ILE A  1  137 ? 117.510 -81.706  -39.053 1.00 47.24  ? 137  ILE A CG2   1 
ATOM   1077  C  CD1   . ILE A  1  137 ? 118.976 -80.792  -41.522 1.00 51.27  ? 137  ILE A CD1   1 
ATOM   1078  N  N     . GLN A  1  138 ? 115.989 -84.490  -38.257 1.00 49.70  ? 138  GLN A N     1 
ATOM   1079  C  CA    . GLN A  1  138 ? 115.167 -84.665  -37.070 1.00 50.76  ? 138  GLN A CA    1 
ATOM   1080  C  C     . GLN A  1  138 ? 115.165 -83.383  -36.242 1.00 49.39  ? 138  GLN A C     1 
ATOM   1081  O  O     . GLN A  1  138 ? 116.224 -82.839  -35.913 1.00 48.11  ? 138  GLN A O     1 
ATOM   1082  C  CB    . GLN A  1  138 ? 115.682 -85.844  -36.249 1.00 47.00  ? 138  GLN A CB    1 
ATOM   1083  C  CG    . GLN A  1  138 ? 114.758 -86.254  -35.128 1.00 46.64  ? 138  GLN A CG    1 
ATOM   1084  C  CD    . GLN A  1  138 ? 115.083 -87.623  -34.584 1.00 46.68  ? 138  GLN A CD    1 
ATOM   1085  O  OE1   . GLN A  1  138 ? 115.844 -88.381  -35.186 1.00 47.19  ? 138  GLN A OE1   1 
ATOM   1086  N  NE2   . GLN A  1  138 ? 114.509 -87.951  -33.435 1.00 50.40  ? 138  GLN A NE2   1 
ATOM   1087  N  N     . ILE A  1  139 ? 113.975 -82.892  -35.924 1.00 46.27  ? 139  ILE A N     1 
ATOM   1088  C  CA    . ILE A  1  139 ? 113.822 -81.644  -35.191 1.00 45.38  ? 139  ILE A CA    1 
ATOM   1089  C  C     . ILE A  1  139 ? 113.657 -81.957  -33.711 1.00 48.08  ? 139  ILE A C     1 
ATOM   1090  O  O     . ILE A  1  139 ? 113.071 -82.975  -33.326 1.00 44.76  ? 139  ILE A O     1 
ATOM   1091  C  CB    . ILE A  1  139 ? 112.636 -80.813  -35.728 1.00 45.94  ? 139  ILE A CB    1 
ATOM   1092  C  CG1   . ILE A  1  139 ? 111.320 -81.577  -35.579 1.00 46.57  ? 139  ILE A CG1   1 
ATOM   1093  C  CG2   . ILE A  1  139 ? 112.874 -80.423  -37.176 1.00 46.83  ? 139  ILE A CG2   1 
ATOM   1094  C  CD1   . ILE A  1  139 ? 110.100 -80.708  -35.736 1.00 46.91  ? 139  ILE A CD1   1 
ATOM   1095  N  N     . THR A  1  140 ? 114.198 -81.079  -32.869 1.00 50.50  ? 140  THR A N     1 
ATOM   1096  C  CA    . THR A  1  140 ? 114.132 -81.242  -31.422 1.00 49.09  ? 140  THR A CA    1 
ATOM   1097  C  C     . THR A  1  140 ? 113.402 -80.092  -30.740 1.00 48.04  ? 140  THR A C     1 
ATOM   1098  O  O     . THR A  1  140 ? 113.438 -79.992  -29.508 1.00 46.06  ? 140  THR A O     1 
ATOM   1099  C  CB    . THR A  1  140 ? 115.538 -81.377  -30.839 1.00 41.76  ? 140  THR A CB    1 
ATOM   1100  O  OG1   . THR A  1  140 ? 116.290 -80.206  -31.165 1.00 47.27  ? 140  THR A OG1   1 
ATOM   1101  C  CG2   . THR A  1  140 ? 116.239 -82.593  -31.416 1.00 42.30  ? 140  THR A CG2   1 
ATOM   1102  N  N     . SER A  1  141 ? 112.739 -79.226  -31.508 1.00 46.86  ? 141  SER A N     1 
ATOM   1103  C  CA    . SER A  1  141 ? 112.044 -78.065  -30.968 1.00 44.81  ? 141  SER A CA    1 
ATOM   1104  C  C     . SER A  1  141 ? 110.693 -78.404  -30.350 1.00 45.69  ? 141  SER A C     1 
ATOM   1105  O  O     . SER A  1  141 ? 110.087 -77.531  -29.718 1.00 46.73  ? 141  SER A O     1 
ATOM   1106  C  CB    . SER A  1  141 ? 111.855 -77.019  -32.071 1.00 50.76  ? 141  SER A CB    1 
ATOM   1107  O  OG    . SER A  1  141 ? 111.287 -77.599  -33.235 1.00 57.18  ? 141  SER A OG    1 
ATOM   1108  N  N     . GLY A  1  142 ? 110.207 -79.632  -30.519 1.00 44.17  ? 142  GLY A N     1 
ATOM   1109  C  CA    . GLY A  1  142 ? 108.916 -80.008  -29.977 1.00 46.94  ? 142  GLY A CA    1 
ATOM   1110  C  C     . GLY A  1  142 ? 107.723 -79.444  -30.714 1.00 51.02  ? 142  GLY A C     1 
ATOM   1111  O  O     . GLY A  1  142 ? 106.619 -79.426  -30.163 1.00 56.35  ? 142  GLY A O     1 
ATOM   1112  N  N     . LEU A  1  143 ? 107.912 -78.980  -31.953 1.00 44.73  ? 143  LEU A N     1 
ATOM   1113  C  CA    . LEU A  1  143 ? 106.811 -78.372  -32.694 1.00 45.56  ? 143  LEU A CA    1 
ATOM   1114  C  C     . LEU A  1  143 ? 105.678 -79.364  -32.926 1.00 54.68  ? 143  LEU A C     1 
ATOM   1115  O  O     . LEU A  1  143 ? 104.499 -79.006  -32.810 1.00 53.12  ? 143  LEU A O     1 
ATOM   1116  C  CB    . LEU A  1  143 ? 107.317 -77.820  -34.026 1.00 47.05  ? 143  LEU A CB    1 
ATOM   1117  C  CG    . LEU A  1  143 ? 108.133 -76.526  -33.998 1.00 51.65  ? 143  LEU A CG    1 
ATOM   1118  C  CD1   . LEU A  1  143 ? 108.567 -76.144  -35.411 1.00 48.52  ? 143  LEU A CD1   1 
ATOM   1119  C  CD2   . LEU A  1  143 ? 107.340 -75.396  -33.339 1.00 45.01  ? 143  LEU A CD2   1 
ATOM   1120  N  N     . PHE A  1  144 ? 106.012 -80.615  -33.261 1.00 51.19  ? 144  PHE A N     1 
ATOM   1121  C  CA    . PHE A  1  144 ? 104.974 -81.614  -33.502 1.00 52.91  ? 144  PHE A CA    1 
ATOM   1122  C  C     . PHE A  1  144 ? 104.128 -81.841  -32.256 1.00 51.40  ? 144  PHE A C     1 
ATOM   1123  O  O     . PHE A  1  144 ? 102.905 -81.998  -32.347 1.00 52.32  ? 144  PHE A O     1 
ATOM   1124  C  CB    . PHE A  1  144 ? 105.589 -82.940  -33.957 1.00 56.95  ? 144  PHE A CB    1 
ATOM   1125  C  CG    . PHE A  1  144 ? 106.007 -82.969  -35.402 1.00 56.56  ? 144  PHE A CG    1 
ATOM   1126  C  CD1   . PHE A  1  144 ? 106.359 -81.810  -36.073 1.00 51.78  ? 144  PHE A CD1   1 
ATOM   1127  C  CD2   . PHE A  1  144 ? 106.046 -84.169  -36.090 1.00 60.96  ? 144  PHE A CD2   1 
ATOM   1128  C  CE1   . PHE A  1  144 ? 106.747 -81.852  -37.401 1.00 53.63  ? 144  PHE A CE1   1 
ATOM   1129  C  CE2   . PHE A  1  144 ? 106.430 -84.216  -37.416 1.00 60.57  ? 144  PHE A CE2   1 
ATOM   1130  C  CZ    . PHE A  1  144 ? 106.781 -83.056  -38.073 1.00 55.33  ? 144  PHE A CZ    1 
ATOM   1131  N  N     . TYR A  1  145 ? 104.762 -81.857  -31.079 1.00 48.52  ? 145  TYR A N     1 
ATOM   1132  C  CA    . TYR A  1  145 ? 104.031 -82.151  -29.849 1.00 52.65  ? 145  TYR A CA    1 
ATOM   1133  C  C     . TYR A  1  145 ? 103.096 -81.004  -29.480 1.00 58.37  ? 145  TYR A C     1 
ATOM   1134  O  O     . TYR A  1  145 ? 101.945 -81.233  -29.077 1.00 59.09  ? 145  TYR A O     1 
ATOM   1135  C  CB    . TYR A  1  145 ? 105.020 -82.449  -28.720 1.00 48.76  ? 145  TYR A CB    1 
ATOM   1136  C  CG    . TYR A  1  145 ? 106.148 -83.364  -29.148 1.00 45.24  ? 145  TYR A CG    1 
ATOM   1137  C  CD1   . TYR A  1  145 ? 105.894 -84.507  -29.898 1.00 53.97  ? 145  TYR A CD1   1 
ATOM   1138  C  CD2   . TYR A  1  145 ? 107.466 -83.069  -28.833 1.00 44.31  ? 145  TYR A CD2   1 
ATOM   1139  C  CE1   . TYR A  1  145 ? 106.921 -85.337  -30.307 1.00 55.43  ? 145  TYR A CE1   1 
ATOM   1140  C  CE2   . TYR A  1  145 ? 108.499 -83.893  -29.238 1.00 46.79  ? 145  TYR A CE2   1 
ATOM   1141  C  CZ    . TYR A  1  145 ? 108.220 -85.026  -29.975 1.00 53.07  ? 145  TYR A CZ    1 
ATOM   1142  O  OH    . TYR A  1  145 ? 109.241 -85.854  -30.385 1.00 49.66  ? 145  TYR A OH    1 
ATOM   1143  N  N     . LEU A  1  146 ? 103.570 -79.765  -29.630 1.00 52.86  ? 146  LEU A N     1 
ATOM   1144  C  CA    . LEU A  1  146 ? 102.698 -78.602  -29.493 1.00 49.28  ? 146  LEU A CA    1 
ATOM   1145  C  C     . LEU A  1  146 ? 101.523 -78.673  -30.465 1.00 52.68  ? 146  LEU A C     1 
ATOM   1146  O  O     . LEU A  1  146 ? 100.369 -78.453  -30.080 1.00 58.45  ? 146  LEU A O     1 
ATOM   1147  C  CB    . LEU A  1  146 ? 103.506 -77.322  -29.716 1.00 45.08  ? 146  LEU A CB    1 
ATOM   1148  C  CG    . LEU A  1  146 ? 102.716 -76.035  -29.973 1.00 45.34  ? 146  LEU A CG    1 
ATOM   1149  C  CD1   . LEU A  1  146 ? 101.937 -75.607  -28.738 1.00 44.94  ? 146  LEU A CD1   1 
ATOM   1150  C  CD2   . LEU A  1  146 ? 103.636 -74.922  -30.447 1.00 44.87  ? 146  LEU A CD2   1 
ATOM   1151  N  N     . TRP A  1  147 ? 101.799 -78.978  -31.736 1.00 47.74  ? 147  TRP A N     1 
ATOM   1152  C  CA    . TRP A  1  147 ? 100.733 -78.993  -32.731 1.00 49.01  ? 147  TRP A CA    1 
ATOM   1153  C  C     . TRP A  1  147 ? 99.719  -80.096  -32.452 1.00 54.42  ? 147  TRP A C     1 
ATOM   1154  O  O     . TRP A  1  147 ? 98.526  -79.919  -32.727 1.00 52.29  ? 147  TRP A O     1 
ATOM   1155  C  CB    . TRP A  1  147 ? 101.329 -79.135  -34.133 1.00 49.65  ? 147  TRP A CB    1 
ATOM   1156  C  CG    . TRP A  1  147 ? 102.215 -77.976  -34.511 1.00 49.09  ? 147  TRP A CG    1 
ATOM   1157  C  CD1   . TRP A  1  147 ? 102.208 -76.726  -33.959 1.00 48.38  ? 147  TRP A CD1   1 
ATOM   1158  C  CD2   . TRP A  1  147 ? 103.249 -77.968  -35.505 1.00 49.23  ? 147  TRP A CD2   1 
ATOM   1159  N  NE1   . TRP A  1  147 ? 103.163 -75.940  -34.555 1.00 48.08  ? 147  TRP A NE1   1 
ATOM   1160  C  CE2   . TRP A  1  147 ? 103.816 -76.677  -35.507 1.00 52.78  ? 147  TRP A CE2   1 
ATOM   1161  C  CE3   . TRP A  1  147 ? 103.746 -78.924  -36.396 1.00 49.89  ? 147  TRP A CE3   1 
ATOM   1162  C  CZ2   . TRP A  1  147 ? 104.854 -76.318  -36.365 1.00 48.60  ? 147  TRP A CZ2   1 
ATOM   1163  C  CZ3   . TRP A  1  147 ? 104.778 -78.565  -37.246 1.00 49.89  ? 147  TRP A CZ3   1 
ATOM   1164  C  CH2   . TRP A  1  147 ? 105.321 -77.272  -37.223 1.00 49.26  ? 147  TRP A CH2   1 
ATOM   1165  N  N     . ARG A  1  148 ? 100.162 -81.226  -31.894 1.00 49.50  ? 148  ARG A N     1 
ATOM   1166  C  CA    . ARG A  1  148 ? 99.216  -82.280  -31.538 1.00 50.21  ? 148  ARG A CA    1 
ATOM   1167  C  C     . ARG A  1  148 ? 98.372  -81.876  -30.338 1.00 49.91  ? 148  ARG A C     1 
ATOM   1168  O  O     . ARG A  1  148 ? 97.158  -82.112  -30.321 1.00 50.72  ? 148  ARG A O     1 
ATOM   1169  C  CB    . ARG A  1  148 ? 99.949  -83.593  -31.257 1.00 50.05  ? 148  ARG A CB    1 
ATOM   1170  C  CG    . ARG A  1  148 ? 99.041  -84.726  -30.773 1.00 50.74  ? 148  ARG A CG    1 
ATOM   1171  C  CD    . ARG A  1  148 ? 99.675  -86.093  -31.024 1.00 51.61  ? 148  ARG A CD    1 
ATOM   1172  N  NE    . ARG A  1  148 ? 98.884  -87.193  -30.472 1.00 57.42  ? 148  ARG A NE    1 
ATOM   1173  C  CZ    . ARG A  1  148 ? 98.845  -88.422  -30.984 1.00 68.73  ? 148  ARG A CZ    1 
ATOM   1174  N  NH1   . ARG A  1  148 ? 99.541  -88.713  -32.075 1.00 70.25  ? 148  ARG A NH1   1 
ATOM   1175  N  NH2   . ARG A  1  148 ? 98.101  -89.360  -30.411 1.00 69.59  ? 148  ARG A NH2   1 
ATOM   1176  N  N     . ALA A  1  149 ? 98.994  -81.263  -29.325 1.00 52.82  ? 149  ALA A N     1 
ATOM   1177  C  CA    . ALA A  1  149 ? 98.233  -80.817  -28.162 1.00 49.10  ? 149  ALA A CA    1 
ATOM   1178  C  C     . ALA A  1  149 ? 97.207  -79.759  -28.547 1.00 51.05  ? 149  ALA A C     1 
ATOM   1179  O  O     . ALA A  1  149 ? 96.096  -79.736  -28.007 1.00 49.32  ? 149  ALA A O     1 
ATOM   1180  C  CB    . ALA A  1  149 ? 99.178  -80.283  -27.086 1.00 57.46  ? 149  ALA A CB    1 
ATOM   1181  N  N     . SER A  1  150 ? 97.561  -78.876  -29.484 1.00 48.92  ? 150  SER A N     1 
ATOM   1182  C  CA    . SER A  1  150 ? 96.621  -77.870  -29.965 1.00 49.54  ? 150  SER A CA    1 
ATOM   1183  C  C     . SER A  1  150 ? 95.500  -78.473  -30.803 1.00 50.98  ? 150  SER A C     1 
ATOM   1184  O  O     . SER A  1  150 ? 94.466  -77.825  -30.990 1.00 51.63  ? 150  SER A O     1 
ATOM   1185  C  CB    . SER A  1  150 ? 97.355  -76.812  -30.790 1.00 49.26  ? 150  SER A CB    1 
ATOM   1186  O  OG    . SER A  1  150 ? 98.343  -76.151  -30.023 1.00 48.89  ? 150  SER A OG    1 
ATOM   1187  N  N     . GLY A  1  151 ? 95.681  -79.682  -31.318 1.00 51.54  ? 151  GLY A N     1 
ATOM   1188  C  CA    . GLY A  1  151 ? 94.671  -80.321  -32.129 1.00 52.96  ? 151  GLY A CA    1 
ATOM   1189  C  C     . GLY A  1  151 ? 94.834  -80.173  -33.626 1.00 58.07  ? 151  GLY A C     1 
ATOM   1190  O  O     . GLY A  1  151 ? 93.836  -80.281  -34.346 1.00 67.81  ? 151  GLY A O     1 
ATOM   1191  N  N     . PHE A  1  152 ? 96.046  -79.917  -34.114 1.00 61.69  ? 152  PHE A N     1 
ATOM   1192  C  CA    . PHE A  1  152 ? 96.289  -79.917  -35.550 1.00 59.46  ? 152  PHE A CA    1 
ATOM   1193  C  C     . PHE A  1  152 ? 96.295  -81.341  -36.082 1.00 62.25  ? 152  PHE A C     1 
ATOM   1194  O  O     . PHE A  1  152 ? 96.896  -82.241  -35.488 1.00 66.06  ? 152  PHE A O     1 
ATOM   1195  C  CB    . PHE A  1  152 ? 97.623  -79.248  -35.880 1.00 56.83  ? 152  PHE A CB    1 
ATOM   1196  C  CG    . PHE A  1  152 ? 97.570  -77.752  -35.883 1.00 57.94  ? 152  PHE A CG    1 
ATOM   1197  C  CD1   . PHE A  1  152 ? 96.899  -77.077  -36.886 1.00 63.01  ? 152  PHE A CD1   1 
ATOM   1198  C  CD2   . PHE A  1  152 ? 98.202  -77.018  -34.891 1.00 51.50  ? 152  PHE A CD2   1 
ATOM   1199  C  CE1   . PHE A  1  152 ? 96.849  -75.697  -36.897 1.00 63.09  ? 152  PHE A CE1   1 
ATOM   1200  C  CE2   . PHE A  1  152 ? 98.157  -75.640  -34.897 1.00 51.19  ? 152  PHE A CE2   1 
ATOM   1201  C  CZ    . PHE A  1  152 ? 97.478  -74.978  -35.901 1.00 55.85  ? 152  PHE A CZ    1 
ATOM   1202  N  N     . THR A  1  153 ? 95.627  -81.541  -37.217 1.00 62.01  ? 153  THR A N     1 
ATOM   1203  C  CA    . THR A  1  153 ? 95.563  -82.846  -37.852 1.00 59.72  ? 153  THR A CA    1 
ATOM   1204  C  C     . THR A  1  153 ? 95.875  -82.810  -39.340 1.00 61.74  ? 153  THR A C     1 
ATOM   1205  O  O     . THR A  1  153 ? 95.885  -83.869  -39.976 1.00 70.40  ? 153  THR A O     1 
ATOM   1206  C  CB    . THR A  1  153 ? 94.175  -83.475  -37.648 1.00 66.95  ? 153  THR A CB    1 
ATOM   1207  O  OG1   . THR A  1  153 ? 93.159  -82.525  -38.002 1.00 65.88  ? 153  THR A OG1   1 
ATOM   1208  C  CG2   . THR A  1  153 ? 93.989  -83.906  -36.198 1.00 59.86  ? 153  THR A CG2   1 
ATOM   1209  N  N     . ASP A  1  154 ? 96.140  -81.639  -39.912 1.00 58.07  ? 154  ASP A N     1 
ATOM   1210  C  CA    . ASP A  1  154 ? 96.229  -81.499  -41.356 1.00 70.86  ? 154  ASP A CA    1 
ATOM   1211  C  C     . ASP A  1  154 ? 97.304  -80.483  -41.713 1.00 61.79  ? 154  ASP A C     1 
ATOM   1212  O  O     . ASP A  1  154 ? 97.572  -79.545  -40.960 1.00 61.32  ? 154  ASP A O     1 
ATOM   1213  C  CB    . ASP A  1  154 ? 94.873  -81.071  -41.948 1.00 73.22  ? 154  ASP A CB    1 
ATOM   1214  C  CG    . ASP A  1  154 ? 94.822  -81.188  -43.463 1.00 83.50  ? 154  ASP A CG    1 
ATOM   1215  O  OD1   . ASP A  1  154 ? 95.767  -80.735  -44.142 1.00 87.48  ? 154  ASP A OD1   1 
ATOM   1216  O  OD2   . ASP A  1  154 ? 93.825  -81.736  -43.981 1.00 89.54  ? 154  ASP A OD2   1 
ATOM   1217  N  N     . SER A  1  155 ? 97.904  -80.676  -42.888 1.00 68.07  ? 155  SER A N     1 
ATOM   1218  C  CA    . SER A  1  155 ? 98.864  -79.708  -43.405 1.00 65.61  ? 155  SER A CA    1 
ATOM   1219  C  C     . SER A  1  155 ? 98.207  -78.362  -43.696 1.00 64.89  ? 155  SER A C     1 
ATOM   1220  O  O     . SER A  1  155 ? 98.838  -77.309  -43.526 1.00 67.43  ? 155  SER A O     1 
ATOM   1221  C  CB    . SER A  1  155 ? 99.523  -80.271  -44.665 1.00 69.07  ? 155  SER A CB    1 
ATOM   1222  O  OG    . SER A  1  155 ? 100.461 -79.367  -45.214 1.00 84.43  ? 155  SER A OG    1 
ATOM   1223  N  N     . TYR A  1  156 ? 96.940  -78.374  -44.119 1.00 60.48  ? 156  TYR A N     1 
ATOM   1224  C  CA    . TYR A  1  156 ? 96.278  -77.139  -44.526 1.00 61.93  ? 156  TYR A CA    1 
ATOM   1225  C  C     . TYR A  1  156 ? 96.052  -76.198  -43.350 1.00 59.50  ? 156  TYR A C     1 
ATOM   1226  O  O     . TYR A  1  156 ? 96.090  -74.976  -43.523 1.00 59.35  ? 156  TYR A O     1 
ATOM   1227  C  CB    . TYR A  1  156 ? 94.952  -77.462  -45.222 1.00 62.30  ? 156  TYR A CB    1 
ATOM   1228  C  CG    . TYR A  1  156 ? 94.161  -76.244  -45.649 1.00 62.93  ? 156  TYR A CG    1 
ATOM   1229  C  CD1   . TYR A  1  156 ? 94.565  -75.473  -46.732 1.00 63.76  ? 156  TYR A CD1   1 
ATOM   1230  C  CD2   . TYR A  1  156 ? 93.007  -75.870  -44.972 1.00 63.81  ? 156  TYR A CD2   1 
ATOM   1231  C  CE1   . TYR A  1  156 ? 93.844  -74.358  -47.125 1.00 65.40  ? 156  TYR A CE1   1 
ATOM   1232  C  CE2   . TYR A  1  156 ? 92.279  -74.760  -45.359 1.00 66.58  ? 156  TYR A CE2   1 
ATOM   1233  C  CZ    . TYR A  1  156 ? 92.702  -74.007  -46.437 1.00 72.31  ? 156  TYR A CZ    1 
ATOM   1234  O  OH    . TYR A  1  156 ? 91.983  -72.900  -46.827 1.00 86.65  ? 156  TYR A OH    1 
ATOM   1235  N  N     . GLN A  1  157 ? 95.828  -76.736  -42.151 1.00 58.94  ? 157  GLN A N     1 
ATOM   1236  C  CA    . GLN A  1  157 ? 95.675  -75.874  -40.983 1.00 60.16  ? 157  GLN A CA    1 
ATOM   1237  C  C     . GLN A  1  157 ? 96.993  -75.193  -40.624 1.00 57.32  ? 157  GLN A C     1 
ATOM   1238  O  O     . GLN A  1  157 ? 97.014  -74.000  -40.297 1.00 61.74  ? 157  GLN A O     1 
ATOM   1239  C  CB    . GLN A  1  157 ? 95.142  -76.687  -39.806 1.00 59.25  ? 157  GLN A CB    1 
ATOM   1240  C  CG    . GLN A  1  157 ? 93.935  -77.533  -40.151 1.00 65.18  ? 157  GLN A CG    1 
ATOM   1241  C  CD    . GLN A  1  157 ? 93.616  -78.556  -39.080 1.00 65.79  ? 157  GLN A CD    1 
ATOM   1242  O  OE1   . GLN A  1  157 ? 94.394  -79.482  -38.834 1.00 62.42  ? 157  GLN A OE1   1 
ATOM   1243  N  NE2   . GLN A  1  157 ? 92.466  -78.395  -38.433 1.00 61.17  ? 157  GLN A NE2   1 
ATOM   1244  N  N     . LEU A  1  158 ? 98.104  -75.930  -40.693 1.00 55.79  ? 158  LEU A N     1 
ATOM   1245  C  CA    . LEU A  1  158 ? 99.412  -75.315  -40.486 1.00 55.74  ? 158  LEU A CA    1 
ATOM   1246  C  C     . LEU A  1  158 ? 99.689  -74.247  -41.537 1.00 59.86  ? 158  LEU A C     1 
ATOM   1247  O  O     . LEU A  1  158 ? 100.258 -73.192  -41.229 1.00 62.82  ? 158  LEU A O     1 
ATOM   1248  C  CB    . LEU A  1  158 ? 100.505 -76.384  -40.512 1.00 58.74  ? 158  LEU A CB    1 
ATOM   1249  C  CG    . LEU A  1  158 ? 100.373 -77.557  -39.538 1.00 59.96  ? 158  LEU A CG    1 
ATOM   1250  C  CD1   . LEU A  1  158 ? 101.518 -78.542  -39.736 1.00 53.69  ? 158  LEU A CD1   1 
ATOM   1251  C  CD2   . LEU A  1  158 ? 100.329 -77.064  -38.098 1.00 60.31  ? 158  LEU A CD2   1 
ATOM   1252  N  N     . TYR A  1  159 ? 99.293  -74.502  -42.786 1.00 56.55  ? 159  TYR A N     1 
ATOM   1253  C  CA    . TYR A  1  159 ? 99.502  -73.521  -43.848 1.00 60.12  ? 159  TYR A CA    1 
ATOM   1254  C  C     . TYR A  1  159 ? 98.684  -72.257  -43.606 1.00 58.52  ? 159  TYR A C     1 
ATOM   1255  O  O     . TYR A  1  159 ? 99.189  -71.136  -43.773 1.00 57.65  ? 159  TYR A O     1 
ATOM   1256  C  CB    . TYR A  1  159 ? 99.152  -74.155  -45.192 1.00 58.77  ? 159  TYR A CB    1 
ATOM   1257  C  CG    . TYR A  1  159 ? 99.230  -73.231  -46.379 1.00 65.73  ? 159  TYR A CG    1 
ATOM   1258  C  CD1   . TYR A  1  159 ? 100.453 -72.897  -46.946 1.00 71.39  ? 159  TYR A CD1   1 
ATOM   1259  C  CD2   . TYR A  1  159 ? 98.074  -72.715  -46.956 1.00 73.88  ? 159  TYR A CD2   1 
ATOM   1260  C  CE1   . TYR A  1  159 ? 100.524 -72.058  -48.046 1.00 84.19  ? 159  TYR A CE1   1 
ATOM   1261  C  CE2   . TYR A  1  159 ? 98.133  -71.878  -48.055 1.00 75.13  ? 159  TYR A CE2   1 
ATOM   1262  C  CZ    . TYR A  1  159 ? 99.358  -71.552  -48.597 1.00 82.80  ? 159  TYR A CZ    1 
ATOM   1263  O  OH    . TYR A  1  159 ? 99.417  -70.717  -49.692 1.00 82.32  ? 159  TYR A OH    1 
ATOM   1264  N  N     . CYS A  1  160 ? 97.418  -72.418  -43.210 1.00 57.68  ? 160  CYS A N     1 
ATOM   1265  C  CA    . CYS A  1  160 ? 96.593  -71.264  -42.867 1.00 61.41  ? 160  CYS A CA    1 
ATOM   1266  C  C     . CYS A  1  160 ? 97.195  -70.492  -41.703 1.00 56.16  ? 160  CYS A C     1 
ATOM   1267  O  O     . CYS A  1  160 ? 97.157  -69.254  -41.680 1.00 55.99  ? 160  CYS A O     1 
ATOM   1268  C  CB    . CYS A  1  160 ? 95.169  -71.714  -42.532 1.00 58.42  ? 160  CYS A CB    1 
ATOM   1269  S  SG    . CYS A  1  160 ? 94.243  -72.401  -43.927 1.00 63.34  ? 160  CYS A SG    1 
ATOM   1270  N  N     . THR A  1  161 ? 97.767  -71.209  -40.731 1.00 55.08  ? 161  THR A N     1 
ATOM   1271  C  CA    . THR A  1  161 ? 98.417  -70.552  -39.602 1.00 53.63  ? 161  THR A CA    1 
ATOM   1272  C  C     . THR A  1  161 ? 99.635  -69.754  -40.051 1.00 53.15  ? 161  THR A C     1 
ATOM   1273  O  O     . THR A  1  161 ? 99.852  -68.631  -39.586 1.00 52.49  ? 161  THR A O     1 
ATOM   1274  C  CB    . THR A  1  161 ? 98.812  -71.589  -38.552 1.00 52.71  ? 161  THR A CB    1 
ATOM   1275  O  OG1   . THR A  1  161 ? 97.661  -72.365  -38.194 1.00 53.28  ? 161  THR A OG1   1 
ATOM   1276  C  CG2   . THR A  1  161 ? 99.372  -70.903  -37.306 1.00 51.28  ? 161  THR A CG2   1 
ATOM   1277  N  N     . ALA A  1  162 ? 100.439 -70.316  -40.954 1.00 54.20  ? 162  ALA A N     1 
ATOM   1278  C  CA    . ALA A  1  162 ? 101.590 -69.582  -41.474 1.00 53.90  ? 162  ALA A CA    1 
ATOM   1279  C  C     . ALA A  1  162 ? 101.154 -68.319  -42.210 1.00 55.73  ? 162  ALA A C     1 
ATOM   1280  O  O     . ALA A  1  162 ? 101.791 -67.263  -42.087 1.00 55.37  ? 162  ALA A O     1 
ATOM   1281  C  CB    . ALA A  1  162 ? 102.414 -70.484  -42.392 1.00 54.38  ? 162  ALA A CB    1 
ATOM   1282  N  N     . ILE A  1  163 ? 100.065 -68.404  -42.977 1.00 60.28  ? 163  ILE A N     1 
ATOM   1283  C  CA    . ILE A  1  163 ? 99.575  -67.218  -43.676 1.00 59.45  ? 163  ILE A CA    1 
ATOM   1284  C  C     . ILE A  1  163 ? 99.090  -66.169  -42.680 1.00 64.73  ? 163  ILE A C     1 
ATOM   1285  O  O     . ILE A  1  163 ? 99.349  -64.966  -42.842 1.00 70.89  ? 163  ILE A O     1 
ATOM   1286  C  CB    . ILE A  1  163 ? 98.478  -67.606  -44.681 1.00 61.95  ? 163  ILE A CB    1 
ATOM   1287  C  CG1   . ILE A  1  163 ? 99.027  -68.616  -45.690 1.00 70.36  ? 163  ILE A CG1   1 
ATOM   1288  C  CG2   . ILE A  1  163 ? 97.948  -66.373  -45.390 1.00 58.56  ? 163  ILE A CG2   1 
ATOM   1289  C  CD1   . ILE A  1  163 ? 100.345 -68.198  -46.319 1.00 71.55  ? 163  ILE A CD1   1 
ATOM   1290  N  N     . GLY A  1  164 ? 98.380  -66.600  -41.635 1.00 60.40  ? 164  GLY A N     1 
ATOM   1291  C  CA    . GLY A  1  164 ? 97.985  -65.667  -40.593 1.00 66.32  ? 164  GLY A CA    1 
ATOM   1292  C  C     . GLY A  1  164 ? 99.176  -65.019  -39.911 1.00 66.80  ? 164  GLY A C     1 
ATOM   1293  O  O     . GLY A  1  164 ? 99.138  -63.838  -39.561 1.00 66.01  ? 164  GLY A O     1 
ATOM   1294  N  N     . GLY A  1  165 ? 100.252 -65.784  -39.717 1.00 54.17  ? 165  GLY A N     1 
ATOM   1295  C  CA    . GLY A  1  165 ? 101.451 -65.223  -39.116 1.00 52.96  ? 165  GLY A CA    1 
ATOM   1296  C  C     . GLY A  1  165 ? 102.109 -64.180  -39.998 1.00 56.39  ? 165  GLY A C     1 
ATOM   1297  O  O     . GLY A  1  165 ? 102.603 -63.159  -39.509 1.00 52.57  ? 165  GLY A O     1 
ATOM   1298  N  N     . LEU A  1  166 ? 102.118 -64.416  -41.311 1.00 64.00  ? 166  LEU A N     1 
ATOM   1299  C  CA    . LEU A  1  166 ? 102.649 -63.411  -42.230 1.00 64.08  ? 166  LEU A CA    1 
ATOM   1300  C  C     . LEU A  1  166 ? 101.797 -62.144  -42.221 1.00 64.38  ? 166  LEU A C     1 
ATOM   1301  O  O     . LEU A  1  166 ? 102.333 -61.024  -42.216 1.00 63.08  ? 166  LEU A O     1 
ATOM   1302  C  CB    . LEU A  1  166 ? 102.745 -63.991  -43.640 1.00 67.44  ? 166  LEU A CB    1 
ATOM   1303  C  CG    . LEU A  1  166 ? 103.807 -65.080  -43.797 1.00 71.51  ? 166  LEU A CG    1 
ATOM   1304  C  CD1   . LEU A  1  166 ? 103.838 -65.617  -45.220 1.00 71.46  ? 166  LEU A CD1   1 
ATOM   1305  C  CD2   . LEU A  1  166 ? 105.171 -64.547  -43.386 1.00 67.12  ? 166  LEU A CD2   1 
ATOM   1306  N  N     . VAL A  1  167 ? 100.470 -62.298  -42.215 1.00 59.94  ? 167  VAL A N     1 
ATOM   1307  C  CA    . VAL A  1  167 ? 99.598  -61.126  -42.148 1.00 61.77  ? 167  VAL A CA    1 
ATOM   1308  C  C     . VAL A  1  167 ? 99.826  -60.369  -40.842 1.00 65.55  ? 167  VAL A C     1 
ATOM   1309  O  O     . VAL A  1  167 ? 99.836  -59.131  -40.815 1.00 68.23  ? 167  VAL A O     1 
ATOM   1310  C  CB    . VAL A  1  167 ? 98.122  -61.535  -42.324 1.00 62.68  ? 167  VAL A CB    1 
ATOM   1311  C  CG1   . VAL A  1  167 ? 97.213  -60.329  -42.146 1.00 60.10  ? 167  VAL A CG1   1 
ATOM   1312  C  CG2   . VAL A  1  167 ? 97.894  -62.160  -43.699 1.00 56.81  ? 167  VAL A CG2   1 
ATOM   1313  N  N     . MET A  1  168 ? 100.032 -61.100  -39.743 1.00 55.35  ? 168  MET A N     1 
ATOM   1314  C  CA    . MET A  1  168 ? 100.294 -60.458  -38.460 1.00 51.85  ? 168  MET A CA    1 
ATOM   1315  C  C     . MET A  1  168 ? 101.613 -59.699  -38.479 1.00 51.75  ? 168  MET A C     1 
ATOM   1316  O  O     . MET A  1  168 ? 101.711 -58.602  -37.917 1.00 51.03  ? 168  MET A O     1 
ATOM   1317  C  CB    . MET A  1  168 ? 100.297 -61.502  -37.347 1.00 61.87  ? 168  MET A CB    1 
ATOM   1318  C  CG    . MET A  1  168 ? 98.919  -61.907  -36.879 1.00 67.72  ? 168  MET A CG    1 
ATOM   1319  S  SD    . MET A  1  168 ? 98.000  -60.483  -36.282 1.00 73.53  ? 168  MET A SD    1 
ATOM   1320  C  CE    . MET A  1  168 ? 96.698  -61.294  -35.365 1.00 80.96  ? 168  MET A CE    1 
ATOM   1321  N  N     . ALA A  1  169 ? 102.643 -60.275  -39.101 1.00 50.90  ? 169  ALA A N     1 
ATOM   1322  C  CA    . ALA A  1  169 ? 103.909 -59.563  -39.240 1.00 50.38  ? 169  ALA A CA    1 
ATOM   1323  C  C     . ALA A  1  169 ? 103.724 -58.269  -40.021 1.00 51.90  ? 169  ALA A C     1 
ATOM   1324  O  O     . ALA A  1  169 ? 104.261 -57.220  -39.640 1.00 54.33  ? 169  ALA A O     1 
ATOM   1325  C  CB    . ALA A  1  169 ? 104.945 -60.455  -39.920 1.00 50.41  ? 169  ALA A CB    1 
ATOM   1326  N  N     . ALA A  1  170 ? 102.967 -58.324  -41.121 1.00 57.46  ? 170  ALA A N     1 
ATOM   1327  C  CA    . ALA A  1  170 ? 102.698 -57.109  -41.887 1.00 59.90  ? 170  ALA A CA    1 
ATOM   1328  C  C     . ALA A  1  170 ? 101.963 -56.074  -41.040 1.00 56.07  ? 170  ALA A C     1 
ATOM   1329  O  O     . ALA A  1  170 ? 102.274 -54.877  -41.095 1.00 56.08  ? 170  ALA A O     1 
ATOM   1330  C  CB    . ALA A  1  170 ? 101.898 -57.446  -43.145 1.00 54.13  ? 170  ALA A CB    1 
ATOM   1331  N  N     . LEU A  1  171 ? 100.987 -56.522  -40.245 1.00 54.30  ? 171  LEU A N     1 
ATOM   1332  C  CA    . LEU A  1  171 ? 100.245 -55.612  -39.376 1.00 53.67  ? 171  LEU A CA    1 
ATOM   1333  C  C     . LEU A  1  171 ? 101.162 -54.950  -38.350 1.00 58.57  ? 171  LEU A C     1 
ATOM   1334  O  O     . LEU A  1  171 ? 101.079 -53.737  -38.120 1.00 57.71  ? 171  LEU A O     1 
ATOM   1335  C  CB    . LEU A  1  171 ? 99.110  -56.365  -38.681 1.00 53.14  ? 171  LEU A CB    1 
ATOM   1336  C  CG    . LEU A  1  171 ? 97.749  -56.367  -39.375 1.00 68.80  ? 171  LEU A CG    1 
ATOM   1337  C  CD1   . LEU A  1  171 ? 97.177  -57.771  -39.429 1.00 78.16  ? 171  LEU A CD1   1 
ATOM   1338  C  CD2   . LEU A  1  171 ? 96.800  -55.435  -38.650 1.00 76.82  ? 171  LEU A CD2   1 
ATOM   1339  N  N     . MET A  1  172 ? 102.041 -55.737  -37.717 1.00 49.58  ? 172  MET A N     1 
ATOM   1340  C  CA    . MET A  1  172 ? 102.973 -55.173  -36.739 1.00 48.38  ? 172  MET A CA    1 
ATOM   1341  C  C     . MET A  1  172 ? 103.912 -54.165  -37.390 1.00 51.60  ? 172  MET A C     1 
ATOM   1342  O  O     . MET A  1  172 ? 104.187 -53.099  -36.821 1.00 60.43  ? 172  MET A O     1 
ATOM   1343  C  CB    . MET A  1  172 ? 103.793 -56.277  -36.060 1.00 47.35  ? 172  MET A CB    1 
ATOM   1344  C  CG    . MET A  1  172 ? 103.000 -57.386  -35.386 1.00 54.18  ? 172  MET A CG    1 
ATOM   1345  S  SD    . MET A  1  172 ? 101.534 -56.855  -34.481 1.00 64.75  ? 172  MET A SD    1 
ATOM   1346  C  CE    . MET A  1  172 ? 102.268 -56.009  -33.096 1.00 51.19  ? 172  MET A CE    1 
ATOM   1347  N  N     . LEU A  1  173 ? 104.430 -54.492  -38.576 1.00 51.96  ? 173  LEU A N     1 
ATOM   1348  C  CA    . LEU A  1  173 ? 105.316 -53.571  -39.280 1.00 55.13  ? 173  LEU A CA    1 
ATOM   1349  C  C     . LEU A  1  173 ? 104.608 -52.253  -39.580 1.00 55.34  ? 173  LEU A C     1 
ATOM   1350  O  O     . LEU A  1  173 ? 105.162 -51.164  -39.358 1.00 49.96  ? 173  LEU A O     1 
ATOM   1351  C  CB    . LEU A  1  173 ? 105.817 -54.228  -40.566 1.00 55.43  ? 173  LEU A CB    1 
ATOM   1352  C  CG    . LEU A  1  173 ? 107.178 -53.783  -41.094 1.00 57.93  ? 173  LEU A CG    1 
ATOM   1353  C  CD1   . LEU A  1  173 ? 108.253 -54.054  -40.057 1.00 49.81  ? 173  LEU A CD1   1 
ATOM   1354  C  CD2   . LEU A  1  173 ? 107.495 -54.501  -42.394 1.00 66.54  ? 173  LEU A CD2   1 
ATOM   1355  N  N     . PHE A  1  174 ? 103.372 -52.335  -40.086 1.00 52.06  ? 174  PHE A N     1 
ATOM   1356  C  CA    . PHE A  1  174 ? 102.625 -51.117  -40.379 1.00 58.30  ? 174  PHE A CA    1 
ATOM   1357  C  C     . PHE A  1  174 ? 102.345 -50.323  -39.112 1.00 57.80  ? 174  PHE A C     1 
ATOM   1358  O  O     . PHE A  1  174 ? 102.364 -49.090  -39.135 1.00 57.17  ? 174  PHE A O     1 
ATOM   1359  C  CB    . PHE A  1  174 ? 101.315 -51.436  -41.098 1.00 58.15  ? 174  PHE A CB    1 
ATOM   1360  C  CG    . PHE A  1  174 ? 100.465 -50.222  -41.361 1.00 63.05  ? 174  PHE A CG    1 
ATOM   1361  C  CD1   . PHE A  1  174 ? 100.697 -49.423  -42.471 1.00 71.17  ? 174  PHE A CD1   1 
ATOM   1362  C  CD2   . PHE A  1  174 ? 99.446  -49.870  -40.491 1.00 64.12  ? 174  PHE A CD2   1 
ATOM   1363  C  CE1   . PHE A  1  174 ? 99.921  -48.301  -42.710 1.00 75.01  ? 174  PHE A CE1   1 
ATOM   1364  C  CE2   . PHE A  1  174 ? 98.669  -48.749  -40.722 1.00 69.86  ? 174  PHE A CE2   1 
ATOM   1365  C  CZ    . PHE A  1  174 ? 98.906  -47.964  -41.834 1.00 74.11  ? 174  PHE A CZ    1 
ATOM   1366  N  N     . ALA A  1  175 ? 102.074 -51.006  -37.999 1.00 55.91  ? 175  ALA A N     1 
ATOM   1367  C  CA    . ALA A  1  175 ? 101.817 -50.290  -36.753 1.00 49.68  ? 175  ALA A CA    1 
ATOM   1368  C  C     . ALA A  1  175 ? 103.066 -49.565  -36.272 1.00 54.59  ? 175  ALA A C     1 
ATOM   1369  O  O     . ALA A  1  175 ? 102.982 -48.438  -35.768 1.00 55.01  ? 175  ALA A O     1 
ATOM   1370  C  CB    . ALA A  1  175 ? 101.309 -51.255  -35.684 1.00 52.32  ? 175  ALA A CB    1 
ATOM   1371  N  N     . GLY A  1  176 ? 104.232 -50.193  -36.424 1.00 56.55  ? 176  GLY A N     1 
ATOM   1372  C  CA    . GLY A  1  176 ? 105.471 -49.519  -36.065 1.00 47.50  ? 176  GLY A CA    1 
ATOM   1373  C  C     . GLY A  1  176 ? 105.709 -48.276  -36.897 1.00 48.29  ? 176  GLY A C     1 
ATOM   1374  O  O     . GLY A  1  176 ? 105.997 -47.196  -36.366 1.00 50.96  ? 176  GLY A O     1 
ATOM   1375  N  N     . TRP A  1  177 ? 105.584 -48.411  -38.221 1.00 49.58  ? 177  TRP A N     1 
ATOM   1376  C  CA    . TRP A  1  177 ? 105.710 -47.239  -39.084 1.00 50.28  ? 177  TRP A CA    1 
ATOM   1377  C  C     . TRP A  1  177 ? 104.689 -46.168  -38.715 1.00 50.70  ? 177  TRP A C     1 
ATOM   1378  O  O     . TRP A  1  177 ? 105.020 -44.979  -38.651 1.00 50.81  ? 177  TRP A O     1 
ATOM   1379  C  CB    . TRP A  1  177 ? 105.551 -47.635  -40.549 1.00 51.49  ? 177  TRP A CB    1 
ATOM   1380  C  CG    . TRP A  1  177 ? 105.403 -46.445  -41.443 1.00 52.63  ? 177  TRP A CG    1 
ATOM   1381  C  CD1   . TRP A  1  177 ? 106.403 -45.649  -41.915 1.00 52.81  ? 177  TRP A CD1   1 
ATOM   1382  C  CD2   . TRP A  1  177 ? 104.180 -45.903  -41.960 1.00 53.79  ? 177  TRP A CD2   1 
ATOM   1383  N  NE1   . TRP A  1  177 ? 105.882 -44.648  -42.697 1.00 67.81  ? 177  TRP A NE1   1 
ATOM   1384  C  CE2   . TRP A  1  177 ? 104.519 -44.782  -42.742 1.00 57.60  ? 177  TRP A CE2   1 
ATOM   1385  C  CE3   . TRP A  1  177 ? 102.832 -46.258  -41.838 1.00 54.25  ? 177  TRP A CE3   1 
ATOM   1386  C  CZ2   . TRP A  1  177 ? 103.560 -44.014  -43.400 1.00 55.91  ? 177  TRP A CZ2   1 
ATOM   1387  C  CZ3   . TRP A  1  177 ? 101.882 -45.493  -42.491 1.00 55.51  ? 177  TRP A CZ3   1 
ATOM   1388  C  CH2   . TRP A  1  177 ? 102.250 -44.387  -43.265 1.00 56.33  ? 177  TRP A CH2   1 
ATOM   1389  N  N     . PHE A  1  178 ? 103.447 -46.578  -38.452 1.00 51.03  ? 178  PHE A N     1 
ATOM   1390  C  CA    . PHE A  1  178 ? 102.369 -45.636  -38.180 1.00 51.58  ? 178  PHE A CA    1 
ATOM   1391  C  C     . PHE A  1  178 ? 102.618 -44.863  -36.894 1.00 54.14  ? 178  PHE A C     1 
ATOM   1392  O  O     . PHE A  1  178 ? 102.400 -43.647  -36.842 1.00 51.05  ? 178  PHE A O     1 
ATOM   1393  C  CB    . PHE A  1  178 ? 101.043 -46.396  -38.112 1.00 52.03  ? 178  PHE A CB    1 
ATOM   1394  C  CG    . PHE A  1  178 ? 99.851  -45.530  -37.821 1.00 56.77  ? 178  PHE A CG    1 
ATOM   1395  C  CD1   . PHE A  1  178 ? 99.192  -44.870  -38.847 1.00 54.34  ? 178  PHE A CD1   1 
ATOM   1396  C  CD2   . PHE A  1  178 ? 99.374  -45.394  -36.527 1.00 54.40  ? 178  PHE A CD2   1 
ATOM   1397  C  CE1   . PHE A  1  178 ? 98.090  -44.080  -38.587 1.00 54.68  ? 178  PHE A CE1   1 
ATOM   1398  C  CE2   . PHE A  1  178 ? 98.273  -44.605  -36.260 1.00 52.60  ? 178  PHE A CE2   1 
ATOM   1399  C  CZ    . PHE A  1  178 ? 97.628  -43.948  -37.294 1.00 59.29  ? 178  PHE A CZ    1 
ATOM   1400  N  N     . HIS A  1  179 ? 103.082 -45.543  -35.849 1.00 51.51  ? 179  HIS A N     1 
ATOM   1401  C  CA    . HIS A  1  179 ? 103.284 -44.880  -34.571 1.00 52.92  ? 179  HIS A CA    1 
ATOM   1402  C  C     . HIS A  1  179 ? 104.638 -44.201  -34.451 1.00 49.76  ? 179  HIS A C     1 
ATOM   1403  O  O     . HIS A  1  179 ? 104.847 -43.455  -33.490 1.00 54.86  ? 179  HIS A O     1 
ATOM   1404  C  CB    . HIS A  1  179 ? 103.080 -45.866  -33.423 1.00 48.03  ? 179  HIS A CB    1 
ATOM   1405  C  CG    . HIS A  1  179 ? 101.640 -46.150  -33.150 1.00 51.28  ? 179  HIS A CG    1 
ATOM   1406  N  ND1   . HIS A  1  179 ? 100.717 -45.148  -32.940 1.00 51.67  ? 179  HIS A ND1   1 
ATOM   1407  C  CD2   . HIS A  1  179 ? 100.955 -47.314  -33.087 1.00 49.05  ? 179  HIS A CD2   1 
ATOM   1408  C  CE1   . HIS A  1  179 ? 99.526  -45.684  -32.745 1.00 49.91  ? 179  HIS A CE1   1 
ATOM   1409  N  NE2   . HIS A  1  179 ? 99.644  -46.996  -32.829 1.00 49.19  ? 179  HIS A NE2   1 
ATOM   1410  N  N     . TYR A  1  180 ? 105.556 -44.414  -35.392 1.00 48.26  ? 180  TYR A N     1 
ATOM   1411  C  CA    . TYR A  1  180 ? 106.687 -43.494  -35.403 1.00 47.94  ? 180  TYR A CA    1 
ATOM   1412  C  C     . TYR A  1  180 ? 106.448 -42.280  -36.298 1.00 49.10  ? 180  TYR A C     1 
ATOM   1413  O  O     . TYR A  1  180 ? 106.796 -41.156  -35.917 1.00 49.02  ? 180  TYR A O     1 
ATOM   1414  C  CB    . TYR A  1  180 ? 107.973 -44.195  -35.839 1.00 47.53  ? 180  TYR A CB    1 
ATOM   1415  C  CG    . TYR A  1  180 ? 109.180 -43.348  -35.529 1.00 47.07  ? 180  TYR A CG    1 
ATOM   1416  C  CD1   . TYR A  1  180 ? 109.601 -43.159  -34.215 1.00 49.84  ? 180  TYR A CD1   1 
ATOM   1417  C  CD2   . TYR A  1  180 ? 109.879 -42.708  -36.538 1.00 47.78  ? 180  TYR A CD2   1 
ATOM   1418  C  CE1   . TYR A  1  180 ? 110.698 -42.368  -33.921 1.00 45.63  ? 180  TYR A CE1   1 
ATOM   1419  C  CE2   . TYR A  1  180 ? 110.971 -41.917  -36.255 1.00 47.42  ? 180  TYR A CE2   1 
ATOM   1420  C  CZ    . TYR A  1  180 ? 111.378 -41.749  -34.947 1.00 49.27  ? 180  TYR A CZ    1 
ATOM   1421  O  OH    . TYR A  1  180 ? 112.469 -40.961  -34.666 1.00 48.10  ? 180  TYR A OH    1 
ATOM   1422  N  N     . HIS A  1  181 ? 105.851 -42.476  -37.474 1.00 50.22  ? 181  HIS A N     1 
ATOM   1423  C  CA    . HIS A  1  181 ? 105.796 -41.438  -38.498 1.00 51.40  ? 181  HIS A CA    1 
ATOM   1424  C  C     . HIS A  1  181 ? 104.459 -40.718  -38.587 1.00 57.08  ? 181  HIS A C     1 
ATOM   1425  O  O     . HIS A  1  181 ? 104.436 -39.533  -38.931 1.00 63.14  ? 181  HIS A O     1 
ATOM   1426  C  CB    . HIS A  1  181 ? 106.111 -42.036  -39.874 1.00 52.21  ? 181  HIS A CB    1 
ATOM   1427  C  CG    . HIS A  1  181 ? 107.569 -42.261  -40.120 1.00 53.58  ? 181  HIS A CG    1 
ATOM   1428  N  ND1   . HIS A  1  181 ? 108.340 -41.392  -40.861 1.00 56.26  ? 181  HIS A ND1   1 
ATOM   1429  C  CD2   . HIS A  1  181 ? 108.396 -43.261  -39.733 1.00 51.84  ? 181  HIS A CD2   1 
ATOM   1430  C  CE1   . HIS A  1  181 ? 109.579 -41.843  -40.917 1.00 52.75  ? 181  HIS A CE1   1 
ATOM   1431  N  NE2   . HIS A  1  181 ? 109.640 -42.975  -40.240 1.00 50.81  ? 181  HIS A NE2   1 
ATOM   1432  N  N     . VAL A  1  182 ? 103.347 -41.393  -38.307 1.00 54.39  ? 182  VAL A N     1 
ATOM   1433  C  CA    . VAL A  1  182 ? 102.038 -40.819  -38.600 1.00 55.94  ? 182  VAL A CA    1 
ATOM   1434  C  C     . VAL A  1  182 ? 101.385 -40.301  -37.328 1.00 54.96  ? 182  VAL A C     1 
ATOM   1435  O  O     . VAL A  1  182 ? 100.997 -39.131  -37.251 1.00 55.52  ? 182  VAL A O     1 
ATOM   1436  C  CB    . VAL A  1  182 ? 101.131 -41.842  -39.303 1.00 56.19  ? 182  VAL A CB    1 
ATOM   1437  C  CG1   . VAL A  1  182 ? 99.832  -41.186  -39.719 1.00 57.45  ? 182  VAL A CG1   1 
ATOM   1438  C  CG2   . VAL A  1  182 ? 101.844 -42.426  -40.500 1.00 56.65  ? 182  VAL A CG2   1 
ATOM   1439  N  N     . LYS A  1  183 ? 101.247 -41.169  -36.327 1.00 56.44  ? 183  LYS A N     1 
ATOM   1440  C  CA    . LYS A  1  183 ? 100.653 -40.803  -35.041 1.00 58.69  ? 183  LYS A CA    1 
ATOM   1441  C  C     . LYS A  1  183 ? 101.575 -41.312  -33.936 1.00 60.26  ? 183  LYS A C     1 
ATOM   1442  O  O     . LYS A  1  183 ? 101.443 -42.450  -33.477 1.00 53.15  ? 183  LYS A O     1 
ATOM   1443  C  CB    . LYS A  1  183 ? 99.240  -41.357  -34.916 1.00 59.43  ? 183  LYS A CB    1 
ATOM   1444  C  CG    . LYS A  1  183 ? 98.287  -40.779  -35.951 1.00 57.98  ? 183  LYS A CG    1 
ATOM   1445  C  CD    . LYS A  1  183 ? 96.901  -40.545  -35.382 1.00 55.25  ? 183  LYS A CD    1 
ATOM   1446  C  CE    . LYS A  1  183 ? 96.026  -39.791  -36.369 1.00 64.77  ? 183  LYS A CE    1 
ATOM   1447  N  NZ    . LYS A  1  183 ? 94.645  -39.582  -35.849 1.00 67.82  ? 183  LYS A NZ    1 
ATOM   1448  N  N     . ALA A  1  184 ? 102.509 -40.459  -33.517 1.00 60.11  ? 184  ALA A N     1 
ATOM   1449  C  CA    . ALA A  1  184 ? 103.486 -40.821  -32.499 1.00 52.07  ? 184  ALA A CA    1 
ATOM   1450  C  C     . ALA A  1  184 ? 102.950 -40.453  -31.125 1.00 52.88  ? 184  ALA A C     1 
ATOM   1451  O  O     . ALA A  1  184 ? 102.655 -39.274  -30.885 1.00 56.21  ? 184  ALA A O     1 
ATOM   1452  C  CB    . ALA A  1  184 ? 104.808 -40.117  -32.749 1.00 47.96  ? 184  ALA A CB    1 
ATOM   1453  N  N     . PRO A  1  185 ? 102.801 -41.405  -30.208 1.00 51.58  ? 185  PRO A N     1 
ATOM   1454  C  CA    . PRO A  1  185 ? 102.224 -41.080  -28.899 1.00 53.56  ? 185  PRO A CA    1 
ATOM   1455  C  C     . PRO A  1  185 ? 103.198 -40.294  -28.034 1.00 48.47  ? 185  PRO A C     1 
ATOM   1456  O  O     . PRO A  1  185 ? 104.417 -40.474  -28.104 1.00 47.34  ? 185  PRO A O     1 
ATOM   1457  C  CB    . PRO A  1  185 ? 101.913 -42.453  -28.294 1.00 48.04  ? 185  PRO A CB    1 
ATOM   1458  C  CG    . PRO A  1  185 ? 102.859 -43.387  -28.974 1.00 56.18  ? 185  PRO A CG    1 
ATOM   1459  C  CD    . PRO A  1  185 ? 103.074 -42.844  -30.361 1.00 54.57  ? 185  PRO A CD    1 
ATOM   1460  N  N     . LYS A  1  186 ? 102.636 -39.408  -27.214 1.00 45.80  ? 186  LYS A N     1 
ATOM   1461  C  CA    . LYS A  1  186 ? 103.417 -38.491  -26.398 1.00 50.28  ? 186  LYS A CA    1 
ATOM   1462  C  C     . LYS A  1  186 ? 104.040 -39.209  -25.198 1.00 51.61  ? 186  LYS A C     1 
ATOM   1463  O  O     . LYS A  1  186 ? 103.680 -40.338  -24.848 1.00 56.86  ? 186  LYS A O     1 
ATOM   1464  C  CB    . LYS A  1  186 ? 102.542 -37.335  -25.916 1.00 45.90  ? 186  LYS A CB    1 
ATOM   1465  C  CG    . LYS A  1  186 ? 102.344 -36.221  -26.933 1.00 47.00  ? 186  LYS A CG    1 
ATOM   1466  C  CD    . LYS A  1  186 ? 101.340 -35.206  -26.416 1.00 57.69  ? 186  LYS A CD    1 
ATOM   1467  C  CE    . LYS A  1  186 ? 101.488 -33.862  -27.105 1.00 69.82  ? 186  LYS A CE    1 
ATOM   1468  N  NZ    . LYS A  1  186 ? 102.706 -33.133  -26.643 1.00 77.66  ? 186  LYS A NZ    1 
ATOM   1469  N  N     . LEU A  1  187 ? 104.993 -38.528  -24.556 1.00 45.52  ? 187  LEU A N     1 
ATOM   1470  C  CA    . LEU A  1  187 ? 105.624 -39.093  -23.369 1.00 48.48  ? 187  LEU A CA    1 
ATOM   1471  C  C     . LEU A  1  187 ? 104.618 -39.279  -22.245 1.00 51.73  ? 187  LEU A C     1 
ATOM   1472  O  O     . LEU A  1  187 ? 104.727 -40.231  -21.463 1.00 52.25  ? 187  LEU A O     1 
ATOM   1473  C  CB    . LEU A  1  187 ? 106.778 -38.204  -22.904 1.00 42.07  ? 187  LEU A CB    1 
ATOM   1474  C  CG    . LEU A  1  187 ? 107.513 -38.659  -21.638 1.00 41.01  ? 187  LEU A CG    1 
ATOM   1475  C  CD1   . LEU A  1  187 ? 108.162 -40.013  -21.842 1.00 40.35  ? 187  LEU A CD1   1 
ATOM   1476  C  CD2   . LEU A  1  187 ? 108.548 -37.640  -21.215 1.00 40.79  ? 187  LEU A CD2   1 
ATOM   1477  N  N     . GLU A  1  188 ? 103.635 -38.379  -22.150 1.00 47.93  ? 188  GLU A N     1 
ATOM   1478  C  CA    . GLU A  1  188 ? 102.563 -38.533  -21.173 1.00 52.54  ? 188  GLU A CA    1 
ATOM   1479  C  C     . GLU A  1  188 ? 101.846 -39.868  -21.333 1.00 47.79  ? 188  GLU A C     1 
ATOM   1480  O  O     . GLU A  1  188 ? 101.397 -40.453  -20.342 1.00 48.12  ? 188  GLU A O     1 
ATOM   1481  C  CB    . GLU A  1  188 ? 101.574 -37.374  -21.311 1.00 68.67  ? 188  GLU A CB    1 
ATOM   1482  C  CG    . GLU A  1  188 ? 100.283 -37.537  -20.533 1.00 86.48  ? 188  GLU A CG    1 
ATOM   1483  C  CD    . GLU A  1  188 ? 99.178  -36.642  -21.057 1.00 99.89  ? 188  GLU A CD    1 
ATOM   1484  O  OE1   . GLU A  1  188 ? 99.467  -35.784  -21.920 1.00 104.04 ? 188  GLU A OE1   1 
ATOM   1485  O  OE2   . GLU A  1  188 ? 98.022  -36.803  -20.611 1.00 103.73 ? 188  GLU A OE2   1 
ATOM   1486  N  N     . TRP A  1  189 ? 101.745 -40.373  -22.565 1.00 46.89  ? 189  TRP A N     1 
ATOM   1487  C  CA    . TRP A  1  189 ? 101.021 -41.618  -22.803 1.00 48.70  ? 189  TRP A CA    1 
ATOM   1488  C  C     . TRP A  1  189 ? 101.807 -42.824  -22.301 1.00 44.75  ? 189  TRP A C     1 
ATOM   1489  O  O     . TRP A  1  189 ? 101.230 -43.739  -21.701 1.00 43.23  ? 189  TRP A O     1 
ATOM   1490  C  CB    . TRP A  1  189 ? 100.704 -41.756  -24.294 1.00 44.50  ? 189  TRP A CB    1 
ATOM   1491  C  CG    . TRP A  1  189 ? 99.994  -43.029  -24.672 1.00 44.70  ? 189  TRP A CG    1 
ATOM   1492  C  CD1   . TRP A  1  189 ? 98.654  -43.279  -24.589 1.00 45.36  ? 189  TRP A CD1   1 
ATOM   1493  C  CD2   . TRP A  1  189 ? 100.589 -44.213  -25.217 1.00 44.31  ? 189  TRP A CD2   1 
ATOM   1494  N  NE1   . TRP A  1  189 ? 98.380  -44.549  -25.039 1.00 45.40  ? 189  TRP A NE1   1 
ATOM   1495  C  CE2   . TRP A  1  189 ? 99.552  -45.144  -25.427 1.00 44.76  ? 189  TRP A CE2   1 
ATOM   1496  C  CE3   . TRP A  1  189 ? 101.897 -44.578  -25.540 1.00 46.39  ? 189  TRP A CE3   1 
ATOM   1497  C  CZ2   . TRP A  1  189 ? 99.786  -46.416  -25.945 1.00 44.59  ? 189  TRP A CZ2   1 
ATOM   1498  C  CZ3   . TRP A  1  189 ? 102.124 -45.838  -26.057 1.00 47.57  ? 189  TRP A CZ3   1 
ATOM   1499  C  CH2   . TRP A  1  189 ? 101.075 -46.741  -26.257 1.00 45.58  ? 189  TRP A CH2   1 
ATOM   1500  N  N     . PHE A  1  190 ? 103.120 -42.849  -22.539 1.00 42.06  ? 190  PHE A N     1 
ATOM   1501  C  CA    . PHE A  1  190 ? 103.914 -43.993  -22.107 1.00 43.47  ? 190  PHE A CA    1 
ATOM   1502  C  C     . PHE A  1  190 ? 103.955 -44.104  -20.590 1.00 43.16  ? 190  PHE A C     1 
ATOM   1503  O  O     . PHE A  1  190 ? 103.968 -45.216  -20.052 1.00 46.01  ? 190  PHE A O     1 
ATOM   1504  C  CB    . PHE A  1  190 ? 105.332 -43.900  -22.676 1.00 45.52  ? 190  PHE A CB    1 
ATOM   1505  C  CG    . PHE A  1  190 ? 105.394 -44.052  -24.170 1.00 50.97  ? 190  PHE A CG    1 
ATOM   1506  C  CD1   . PHE A  1  190 ? 105.469 -45.310  -24.747 1.00 54.65  ? 190  PHE A CD1   1 
ATOM   1507  C  CD2   . PHE A  1  190 ? 105.372 -42.941  -24.997 1.00 45.02  ? 190  PHE A CD2   1 
ATOM   1508  C  CE1   . PHE A  1  190 ? 105.521 -45.462  -26.120 1.00 49.50  ? 190  PHE A CE1   1 
ATOM   1509  C  CE2   . PHE A  1  190 ? 105.423 -43.085  -26.373 1.00 51.86  ? 190  PHE A CE2   1 
ATOM   1510  C  CZ    . PHE A  1  190 ? 105.499 -44.350  -26.934 1.00 54.51  ? 190  PHE A CZ    1 
ATOM   1511  N  N     . GLN A  1  191 ? 103.948 -42.973  -19.889 1.00 43.73  ? 191  GLN A N     1 
ATOM   1512  C  CA    . GLN A  1  191 ? 104.088 -42.951  -18.440 1.00 39.87  ? 191  GLN A CA    1 
ATOM   1513  C  C     . GLN A  1  191 ? 102.825 -43.379  -17.701 1.00 40.12  ? 191  GLN A C     1 
ATOM   1514  O  O     . GLN A  1  191 ? 102.820 -43.357  -16.465 1.00 42.67  ? 191  GLN A O     1 
ATOM   1515  C  CB    . GLN A  1  191 ? 104.502 -41.553  -17.977 1.00 39.93  ? 191  GLN A CB    1 
ATOM   1516  C  CG    . GLN A  1  191 ? 105.855 -41.100  -18.489 1.00 39.62  ? 191  GLN A CG    1 
ATOM   1517  C  CD    . GLN A  1  191 ? 106.149 -39.654  -18.138 1.00 47.33  ? 191  GLN A CD    1 
ATOM   1518  O  OE1   . GLN A  1  191 ? 105.443 -38.740  -18.567 1.00 43.13  ? 191  GLN A OE1   1 
ATOM   1519  N  NE2   . GLN A  1  191 ? 107.192 -39.440  -17.347 1.00 39.18  ? 191  GLN A NE2   1 
ATOM   1520  N  N     . ASN A  1  192 ? 101.762 -43.768  -18.410 1.00 40.82  ? 192  ASN A N     1 
ATOM   1521  C  CA    . ASN A  1  192 ? 100.538 -44.269  -17.776 1.00 41.14  ? 192  ASN A CA    1 
ATOM   1522  C  C     . ASN A  1  192 ? 100.751 -45.714  -17.321 1.00 40.49  ? 192  ASN A C     1 
ATOM   1523  O  O     . ASN A  1  192 ? 100.177 -46.665  -17.857 1.00 43.94  ? 192  ASN A O     1 
ATOM   1524  C  CB    . ASN A  1  192 ? 99.357  -44.172  -18.729 1.00 42.17  ? 192  ASN A CB    1 
ATOM   1525  C  CG    . ASN A  1  192 ? 98.843  -42.761  -18.884 1.00 55.22  ? 192  ASN A CG    1 
ATOM   1526  O  OD1   . ASN A  1  192 ? 99.242  -42.038  -19.797 1.00 57.25  ? 192  ASN A OD1   1 
ATOM   1527  N  ND2   . ASN A  1  192 ? 97.938  -42.363  -17.997 1.00 59.98  ? 192  ASN A ND2   1 
ATOM   1528  N  N     . VAL A  1  193 ? 101.587 -45.865  -16.290 1.00 39.66  ? 193  VAL A N     1 
ATOM   1529  C  CA    . VAL A  1  193 ? 101.999 -47.199  -15.865 1.00 41.65  ? 193  VAL A CA    1 
ATOM   1530  C  C     . VAL A  1  193 ? 100.855 -47.941  -15.187 1.00 40.03  ? 193  VAL A C     1 
ATOM   1531  O  O     . VAL A  1  193 ? 100.732 -49.162  -15.334 1.00 39.26  ? 193  VAL A O     1 
ATOM   1532  C  CB    . VAL A  1  193 ? 103.240 -47.119  -14.954 1.00 43.98  ? 193  VAL A CB    1 
ATOM   1533  C  CG1   . VAL A  1  193 ? 104.500 -46.926  -15.793 1.00 37.75  ? 193  VAL A CG1   1 
ATOM   1534  C  CG2   . VAL A  1  193 ? 103.098 -45.988  -13.952 1.00 47.52  ? 193  VAL A CG2   1 
ATOM   1535  N  N     . GLU A  1  194 ? 99.997  -47.234  -14.450 1.00 39.71  ? 194  GLU A N     1 
ATOM   1536  C  CA    . GLU A  1  194 ? 98.870  -47.895  -13.799 1.00 40.07  ? 194  GLU A CA    1 
ATOM   1537  C  C     . GLU A  1  194 ? 97.927  -48.515  -14.828 1.00 43.34  ? 194  GLU A C     1 
ATOM   1538  O  O     . GLU A  1  194 ? 97.557  -49.694  -14.727 1.00 42.84  ? 194  GLU A O     1 
ATOM   1539  C  CB    . GLU A  1  194 ? 98.130  -46.901  -12.902 1.00 40.51  ? 194  GLU A CB    1 
ATOM   1540  C  CG    . GLU A  1  194 ? 98.785  -46.654  -11.538 1.00 39.87  ? 194  GLU A CG    1 
ATOM   1541  C  CD    . GLU A  1  194 ? 99.936  -45.653  -11.577 1.00 48.12  ? 194  GLU A CD    1 
ATOM   1542  O  OE1   . GLU A  1  194 ? 100.352 -45.245  -12.681 1.00 39.53  ? 194  GLU A OE1   1 
ATOM   1543  O  OE2   . GLU A  1  194 ? 100.420 -45.268  -10.494 1.00 40.40  ? 194  GLU A OE2   1 
ATOM   1544  N  N     . SER A  1  195 ? 97.537  -47.731  -15.838 1.00 41.48  ? 195  SER A N     1 
ATOM   1545  C  CA    . SER A  1  195 ? 96.675  -48.246  -16.898 1.00 42.25  ? 195  SER A CA    1 
ATOM   1546  C  C     . SER A  1  195 ? 97.364  -49.355  -17.687 1.00 41.86  ? 195  SER A C     1 
ATOM   1547  O  O     . SER A  1  195 ? 96.744  -50.377  -18.009 1.00 42.19  ? 195  SER A O     1 
ATOM   1548  C  CB    . SER A  1  195 ? 96.258  -47.102  -17.821 1.00 43.05  ? 195  SER A CB    1 
ATOM   1549  O  OG    . SER A  1  195 ? 95.579  -47.581  -18.965 1.00 43.80  ? 195  SER A OG    1 
ATOM   1550  N  N     . MET A  1  196 ? 98.646  -49.168  -18.012 1.00 41.22  ? 196  MET A N     1 
ATOM   1551  C  CA    . MET A  1  196 ? 99.373  -50.198  -18.747 1.00 40.86  ? 196  MET A CA    1 
ATOM   1552  C  C     . MET A  1  196 ? 99.405  -51.510  -17.974 1.00 43.87  ? 196  MET A C     1 
ATOM   1553  O  O     . MET A  1  196 ? 99.264  -52.588  -18.561 1.00 51.11  ? 196  MET A O     1 
ATOM   1554  C  CB    . MET A  1  196 ? 100.793 -49.725  -19.056 1.00 40.24  ? 196  MET A CB    1 
ATOM   1555  C  CG    . MET A  1  196 ? 101.568 -50.676  -19.949 1.00 45.01  ? 196  MET A CG    1 
ATOM   1556  S  SD    . MET A  1  196 ? 103.205 -50.054  -20.363 1.00 50.23  ? 196  MET A SD    1 
ATOM   1557  C  CE    . MET A  1  196 ? 102.808 -48.369  -20.826 1.00 40.10  ? 196  MET A CE    1 
ATOM   1558  N  N     . MET A  1  197 ? 99.566  -51.438  -16.650 1.00 45.74  ? 197  MET A N     1 
ATOM   1559  C  CA    . MET A  1  197 ? 99.577  -52.651  -15.840 1.00 39.42  ? 197  MET A CA    1 
ATOM   1560  C  C     . MET A  1  197 ? 98.195  -53.289  -15.772 1.00 42.10  ? 197  MET A C     1 
ATOM   1561  O  O     . MET A  1  197 ? 98.071  -54.513  -15.890 1.00 41.06  ? 197  MET A O     1 
ATOM   1562  C  CB    . MET A  1  197 ? 100.096 -52.343  -14.436 1.00 48.87  ? 197  MET A CB    1 
ATOM   1563  C  CG    . MET A  1  197 ? 100.322 -53.580  -13.580 1.00 65.52  ? 197  MET A CG    1 
ATOM   1564  S  SD    . MET A  1  197 ? 101.693 -54.613  -14.119 1.00 56.37  ? 197  MET A SD    1 
ATOM   1565  C  CE    . MET A  1  197 ? 102.829 -53.326  -14.515 1.00 37.14  ? 197  MET A CE    1 
ATOM   1566  N  N     . ASN A  1  198 ? 97.145  -52.482  -15.568 1.00 40.86  ? 198  ASN A N     1 
ATOM   1567  C  CA    . ASN A  1  198 ? 95.786  -53.017  -15.614 1.00 44.69  ? 198  ASN A CA    1 
ATOM   1568  C  C     . ASN A  1  198 ? 95.539  -53.780  -16.910 1.00 51.75  ? 198  ASN A C     1 
ATOM   1569  O  O     . ASN A  1  198 ? 94.978  -54.885  -16.900 1.00 47.02  ? 198  ASN A O     1 
ATOM   1570  C  CB    . ASN A  1  198 ? 94.761  -51.890  -15.468 1.00 42.48  ? 198  ASN A CB    1 
ATOM   1571  C  CG    . ASN A  1  198 ? 94.622  -51.408  -14.043 1.00 42.26  ? 198  ASN A CG    1 
ATOM   1572  O  OD1   . ASN A  1  198 ? 95.186  -51.993  -13.122 1.00 45.11  ? 198  ASN A OD1   1 
ATOM   1573  N  ND2   . ASN A  1  198 ? 93.854  -50.343  -13.851 1.00 42.90  ? 198  ASN A ND2   1 
ATOM   1574  N  N     . HIS A  1  199 ? 95.982  -53.214  -18.036 1.00 48.23  ? 199  HIS A N     1 
ATOM   1575  C  CA    . HIS A  1  199 ? 95.706  -53.834  -19.328 1.00 44.84  ? 199  HIS A CA    1 
ATOM   1576  C  C     . HIS A  1  199 ? 96.574  -55.061  -19.561 1.00 42.28  ? 199  HIS A C     1 
ATOM   1577  O  O     . HIS A  1  199 ? 96.109  -56.051  -20.137 1.00 42.73  ? 199  HIS A O     1 
ATOM   1578  C  CB    . HIS A  1  199 ? 95.904  -52.824  -20.456 1.00 43.29  ? 199  HIS A CB    1 
ATOM   1579  C  CG    . HIS A  1  199 ? 94.876  -51.741  -20.474 1.00 44.13  ? 199  HIS A CG    1 
ATOM   1580  N  ND1   . HIS A  1  199 ? 95.024  -50.565  -19.772 1.00 44.03  ? 199  HIS A ND1   1 
ATOM   1581  C  CD2   . HIS A  1  199 ? 93.675  -51.662  -21.092 1.00 45.21  ? 199  HIS A CD2   1 
ATOM   1582  C  CE1   . HIS A  1  199 ? 93.963  -49.803  -19.964 1.00 44.85  ? 199  HIS A CE1   1 
ATOM   1583  N  NE2   . HIS A  1  199 ? 93.129  -50.448  -20.757 1.00 46.41  ? 199  HIS A NE2   1 
ATOM   1584  N  N     . HIS A  1  200 ? 97.838  -55.021  -19.139 1.00 41.32  ? 200  HIS A N     1 
ATOM   1585  C  CA    . HIS A  1  200 ? 98.696  -56.178  -19.368 1.00 47.09  ? 200  HIS A CA    1 
ATOM   1586  C  C     . HIS A  1  200 ? 98.329  -57.332  -18.449 1.00 44.55  ? 200  HIS A C     1 
ATOM   1587  O  O     . HIS A  1  200 ? 98.527  -58.495  -18.811 1.00 40.57  ? 200  HIS A O     1 
ATOM   1588  C  CB    . HIS A  1  200 ? 100.164 -55.794  -19.203 1.00 39.88  ? 200  HIS A CB    1 
ATOM   1589  C  CG    . HIS A  1  200 ? 100.701 -54.985  -20.342 1.00 53.28  ? 200  HIS A CG    1 
ATOM   1590  N  ND1   . HIS A  1  200 ? 101.988 -54.492  -20.367 1.00 53.43  ? 200  HIS A ND1   1 
ATOM   1591  C  CD2   . HIS A  1  200 ? 100.122 -54.586  -21.499 1.00 49.35  ? 200  HIS A CD2   1 
ATOM   1592  C  CE1   . HIS A  1  200 ? 102.178 -53.822  -21.490 1.00 49.71  ? 200  HIS A CE1   1 
ATOM   1593  N  NE2   . HIS A  1  200 ? 101.061 -53.863  -22.193 1.00 48.32  ? 200  HIS A NE2   1 
ATOM   1594  N  N     . LEU A  1  201 ? 97.771  -57.039  -17.275 1.00 40.58  ? 201  LEU A N     1 
ATOM   1595  C  CA    . LEU A  1  201 ? 97.315  -58.103  -16.390 1.00 45.97  ? 201  LEU A CA    1 
ATOM   1596  C  C     . LEU A  1  201 ? 95.982  -58.672  -16.860 1.00 46.10  ? 201  LEU A C     1 
ATOM   1597  O  O     . LEU A  1  201 ? 95.884  -59.861  -17.186 1.00 41.69  ? 201  LEU A O     1 
ATOM   1598  C  CB    . LEU A  1  201 ? 97.204  -57.578  -14.957 1.00 42.15  ? 201  LEU A CB    1 
ATOM   1599  C  CG    . LEU A  1  201 ? 98.534  -57.267  -14.276 1.00 39.22  ? 201  LEU A CG    1 
ATOM   1600  C  CD1   . LEU A  1  201 ? 98.290  -56.504  -12.993 1.00 40.77  ? 201  LEU A CD1   1 
ATOM   1601  C  CD2   . LEU A  1  201 ? 99.303  -58.552  -14.008 1.00 38.63  ? 201  LEU A CD2   1 
ATOM   1602  N  N     . ALA A  1  202 ? 94.945  -57.829  -16.916 1.00 48.52  ? 202  ALA A N     1 
ATOM   1603  C  CA    . ALA A  1  202 ? 93.613  -58.327  -17.251 1.00 51.03  ? 202  ALA A CA    1 
ATOM   1604  C  C     . ALA A  1  202 ? 93.488  -58.648  -18.737 1.00 47.20  ? 202  ALA A C     1 
ATOM   1605  O  O     . ALA A  1  202 ? 92.813  -59.615  -19.111 1.00 48.56  ? 202  ALA A O     1 
ATOM   1606  C  CB    . ALA A  1  202 ? 92.552  -57.310  -16.830 1.00 45.52  ? 202  ALA A CB    1 
ATOM   1607  N  N     . GLY A  1  203 ? 94.137  -57.864  -19.596 1.00 43.76  ? 203  GLY A N     1 
ATOM   1608  C  CA    . GLY A  1  203 ? 93.922  -57.977  -21.028 1.00 44.46  ? 203  GLY A CA    1 
ATOM   1609  C  C     . GLY A  1  203 ? 94.909  -58.834  -21.795 1.00 44.07  ? 203  GLY A C     1 
ATOM   1610  O  O     . GLY A  1  203 ? 94.503  -59.636  -22.640 1.00 50.30  ? 203  GLY A O     1 
ATOM   1611  N  N     . LEU A  1  204 ? 96.207  -58.674  -21.536 1.00 49.80  ? 204  LEU A N     1 
ATOM   1612  C  CA    . LEU A  1  204 ? 97.192  -59.442  -22.291 1.00 48.26  ? 204  LEU A CA    1 
ATOM   1613  C  C     . LEU A  1  204 ? 97.357  -60.849  -21.725 1.00 53.21  ? 204  LEU A C     1 
ATOM   1614  O  O     . LEU A  1  204 ? 97.320  -61.834  -22.472 1.00 51.60  ? 204  LEU A O     1 
ATOM   1615  C  CB    . LEU A  1  204 ? 98.529  -58.701  -22.314 1.00 49.84  ? 204  LEU A CB    1 
ATOM   1616  C  CG    . LEU A  1  204 ? 99.764  -59.460  -22.814 1.00 53.47  ? 204  LEU A CG    1 
ATOM   1617  C  CD1   . LEU A  1  204 ? 99.575  -60.033  -24.221 1.00 42.17  ? 204  LEU A CD1   1 
ATOM   1618  C  CD2   . LEU A  1  204 ? 100.975 -58.547  -22.767 1.00 54.06  ? 204  LEU A CD2   1 
ATOM   1619  N  N     . LEU A  1  205 ? 97.533  -60.963  -20.407 1.00 51.09  ? 205  LEU A N     1 
ATOM   1620  C  CA    . LEU A  1  205 ? 97.733  -62.261  -19.772 1.00 41.41  ? 205  LEU A CA    1 
ATOM   1621  C  C     . LEU A  1  205 ? 96.419  -62.928  -19.386 1.00 53.77  ? 205  LEU A C     1 
ATOM   1622  O  O     . LEU A  1  205 ? 96.286  -64.150  -19.517 1.00 64.95  ? 205  LEU A O     1 
ATOM   1623  C  CB    . LEU A  1  205 ? 98.620  -62.112  -18.533 1.00 40.40  ? 205  LEU A CB    1 
ATOM   1624  C  CG    . LEU A  1  205 ? 100.002 -61.497  -18.766 1.00 39.63  ? 205  LEU A CG    1 
ATOM   1625  C  CD1   . LEU A  1  205 ? 100.564 -60.959  -17.461 1.00 39.24  ? 205  LEU A CD1   1 
ATOM   1626  C  CD2   . LEU A  1  205 ? 100.956 -62.507  -19.400 1.00 39.33  ? 205  LEU A CD2   1 
ATOM   1627  N  N     . GLY A  1  206 ? 95.443  -62.154  -18.914 1.00 52.99  ? 206  GLY A N     1 
ATOM   1628  C  CA    . GLY A  1  206 ? 94.167  -62.712  -18.511 1.00 46.69  ? 206  GLY A CA    1 
ATOM   1629  C  C     . GLY A  1  206 ? 93.311  -63.177  -19.672 1.00 48.45  ? 206  GLY A C     1 
ATOM   1630  O  O     . GLY A  1  206 ? 92.888  -64.338  -19.725 1.00 47.34  ? 206  GLY A O     1 
ATOM   1631  N  N     . LEU A  1  207 ? 93.040  -62.271  -20.613 1.00 46.78  ? 207  LEU A N     1 
ATOM   1632  C  CA    . LEU A  1  207 ? 92.269  -62.658  -21.787 1.00 50.86  ? 207  LEU A CA    1 
ATOM   1633  C  C     . LEU A  1  207 ? 93.039  -63.637  -22.664 1.00 60.94  ? 207  LEU A C     1 
ATOM   1634  O  O     . LEU A  1  207 ? 92.425  -64.461  -23.349 1.00 69.12  ? 207  LEU A O     1 
ATOM   1635  C  CB    . LEU A  1  207 ? 91.864  -61.422  -22.586 1.00 46.58  ? 207  LEU A CB    1 
ATOM   1636  C  CG    . LEU A  1  207 ? 90.855  -60.485  -21.919 1.00 47.04  ? 207  LEU A CG    1 
ATOM   1637  C  CD1   . LEU A  1  207 ? 90.324  -59.480  -22.919 1.00 47.88  ? 207  LEU A CD1   1 
ATOM   1638  C  CD2   . LEU A  1  207 ? 89.717  -61.277  -21.298 1.00 47.67  ? 207  LEU A CD2   1 
ATOM   1639  N  N     . GLY A  1  208 ? 94.372  -63.578  -22.648 1.00 54.67  ? 208  GLY A N     1 
ATOM   1640  C  CA    . GLY A  1  208 ? 95.147  -64.567  -23.380 1.00 48.85  ? 208  GLY A CA    1 
ATOM   1641  C  C     . GLY A  1  208 ? 94.866  -65.978  -22.904 1.00 49.06  ? 208  GLY A C     1 
ATOM   1642  O  O     . GLY A  1  208 ? 94.505  -66.859  -23.692 1.00 51.24  ? 208  GLY A O     1 
ATOM   1643  N  N     . SER A  1  209 ? 94.998  -66.204  -21.596 1.00 44.20  ? 209  SER A N     1 
ATOM   1644  C  CA    . SER A  1  209 ? 94.724  -67.531  -21.061 1.00 53.77  ? 209  SER A CA    1 
ATOM   1645  C  C     . SER A  1  209 ? 93.237  -67.862  -21.106 1.00 52.89  ? 209  SER A C     1 
ATOM   1646  O  O     . SER A  1  209 ? 92.882  -69.040  -21.182 1.00 62.14  ? 209  SER A O     1 
ATOM   1647  C  CB    . SER A  1  209 ? 95.268  -67.658  -19.636 1.00 45.74  ? 209  SER A CB    1 
ATOM   1648  O  OG    . SER A  1  209 ? 94.901  -66.546  -18.844 1.00 57.20  ? 209  SER A OG    1 
ATOM   1649  N  N     . LEU A  1  210 ? 92.355  -66.857  -21.101 1.00 45.96  ? 210  LEU A N     1 
ATOM   1650  C  CA    . LEU A  1  210 ? 90.927  -67.144  -21.242 1.00 51.46  ? 210  LEU A CA    1 
ATOM   1651  C  C     . LEU A  1  210 ? 90.616  -67.683  -22.635 1.00 52.72  ? 210  LEU A C     1 
ATOM   1652  O  O     . LEU A  1  210 ? 89.958  -68.723  -22.782 1.00 56.87  ? 210  LEU A O     1 
ATOM   1653  C  CB    . LEU A  1  210 ? 90.097  -65.889  -20.956 1.00 56.61  ? 210  LEU A CB    1 
ATOM   1654  C  CG    . LEU A  1  210 ? 88.732  -66.020  -20.259 1.00 59.04  ? 210  LEU A CG    1 
ATOM   1655  C  CD1   . LEU A  1  210 ? 87.828  -64.833  -20.597 1.00 56.67  ? 210  LEU A CD1   1 
ATOM   1656  C  CD2   . LEU A  1  210 ? 88.026  -67.334  -20.570 1.00 61.63  ? 210  LEU A CD2   1 
ATOM   1657  N  N     . GLY A  1  211 ? 91.080  -66.984  -23.672 1.00 48.51  ? 211  GLY A N     1 
ATOM   1658  C  CA    . GLY A  1  211 ? 90.905  -67.476  -25.026 1.00 56.72  ? 211  GLY A CA    1 
ATOM   1659  C  C     . GLY A  1  211 ? 91.576  -68.814  -25.252 1.00 58.19  ? 211  GLY A C     1 
ATOM   1660  O  O     . GLY A  1  211 ? 91.058  -69.659  -25.991 1.00 66.05  ? 211  GLY A O     1 
ATOM   1661  N  N     . TRP A  1  212 ? 92.724  -69.042  -24.610 1.00 50.63  ? 212  TRP A N     1 
ATOM   1662  C  CA    . TRP A  1  212 ? 93.361  -70.338  -24.790 1.00 53.48  ? 212  TRP A CA    1 
ATOM   1663  C  C     . TRP A  1  212 ? 92.612  -71.441  -24.058 1.00 55.21  ? 212  TRP A C     1 
ATOM   1664  O  O     . TRP A  1  212 ? 92.571  -72.575  -24.541 1.00 59.64  ? 212  TRP A O     1 
ATOM   1665  C  CB    . TRP A  1  212 ? 94.817  -70.314  -24.342 1.00 54.49  ? 212  TRP A CB    1 
ATOM   1666  C  CG    . TRP A  1  212 ? 95.506  -71.553  -24.795 1.00 50.16  ? 212  TRP A CG    1 
ATOM   1667  C  CD1   . TRP A  1  212 ? 96.072  -72.517  -24.014 1.00 45.46  ? 212  TRP A CD1   1 
ATOM   1668  C  CD2   . TRP A  1  212 ? 95.646  -71.997  -26.150 1.00 51.13  ? 212  TRP A CD2   1 
ATOM   1669  N  NE1   . TRP A  1  212 ? 96.582  -73.522  -24.803 1.00 55.69  ? 212  TRP A NE1   1 
ATOM   1670  C  CE2   . TRP A  1  212 ? 96.333  -73.224  -26.118 1.00 53.62  ? 212  TRP A CE2   1 
ATOM   1671  C  CE3   . TRP A  1  212 ? 95.276  -71.463  -27.390 1.00 49.72  ? 212  TRP A CE3   1 
ATOM   1672  C  CZ2   . TRP A  1  212 ? 96.652  -73.928  -27.277 1.00 51.30  ? 212  TRP A CZ2   1 
ATOM   1673  C  CZ3   . TRP A  1  212 ? 95.593  -72.162  -28.535 1.00 51.62  ? 212  TRP A CZ3   1 
ATOM   1674  C  CH2   . TRP A  1  212 ? 96.276  -73.379  -28.472 1.00 51.34  ? 212  TRP A CH2   1 
ATOM   1675  N  N     . ALA A  1  213 ? 92.032  -71.146  -22.894 1.00 50.02  ? 213  ALA A N     1 
ATOM   1676  C  CA    . ALA A  1  213 ? 91.157  -72.120  -22.257 1.00 48.55  ? 213  ALA A CA    1 
ATOM   1677  C  C     . ALA A  1  213 ? 89.981  -72.442  -23.164 1.00 52.06  ? 213  ALA A C     1 
ATOM   1678  O  O     . ALA A  1  213 ? 89.567  -73.602  -23.270 1.00 56.98  ? 213  ALA A O     1 
ATOM   1679  C  CB    . ALA A  1  213 ? 90.677  -71.598  -20.902 1.00 47.88  ? 213  ALA A CB    1 
ATOM   1680  N  N     . GLY A  1  214 ? 89.455  -71.425  -23.851 1.00 50.35  ? 214  GLY A N     1 
ATOM   1681  C  CA    . GLY A  1  214 ? 88.396  -71.665  -24.822 1.00 51.71  ? 214  GLY A CA    1 
ATOM   1682  C  C     . GLY A  1  214 ? 88.821  -72.610  -25.932 1.00 52.10  ? 214  GLY A C     1 
ATOM   1683  O  O     . GLY A  1  214 ? 88.117  -73.576  -26.247 1.00 53.04  ? 214  GLY A O     1 
ATOM   1684  N  N     . HIS A  1  215 ? 89.986  -72.348  -26.538 1.00 51.13  ? 215  HIS A N     1 
ATOM   1685  C  CA    . HIS A  1  215 ? 90.466  -73.231  -27.603 1.00 55.43  ? 215  HIS A CA    1 
ATOM   1686  C  C     . HIS A  1  215 ? 90.743  -74.636  -27.083 1.00 53.01  ? 215  HIS A C     1 
ATOM   1687  O  O     . HIS A  1  215 ? 90.463  -75.625  -27.770 1.00 56.77  ? 215  HIS A O     1 
ATOM   1688  C  CB    . HIS A  1  215 ? 91.727  -72.680  -28.268 1.00 51.79  ? 215  HIS A CB    1 
ATOM   1689  C  CG    . HIS A  1  215 ? 92.416  -73.678  -29.153 1.00 54.78  ? 215  HIS A CG    1 
ATOM   1690  N  ND1   . HIS A  1  215 ? 92.166  -73.778  -30.505 1.00 54.87  ? 215  HIS A ND1   1 
ATOM   1691  C  CD2   . HIS A  1  215 ? 93.323  -74.645  -28.871 1.00 56.72  ? 215  HIS A CD2   1 
ATOM   1692  C  CE1   . HIS A  1  215 ? 92.903  -74.746  -31.021 1.00 52.00  ? 215  HIS A CE1   1 
ATOM   1693  N  NE2   . HIS A  1  215 ? 93.612  -75.290  -30.050 1.00 54.47  ? 215  HIS A NE2   1 
ATOM   1694  N  N     . GLN A  1  216 ? 91.319  -74.746  -25.884 1.00 50.29  ? 216  GLN A N     1 
ATOM   1695  C  CA    . GLN A  1  216 ? 91.628  -76.059  -25.332 1.00 50.10  ? 216  GLN A CA    1 
ATOM   1696  C  C     . GLN A  1  216 ? 90.359  -76.858  -25.079 1.00 52.44  ? 216  GLN A C     1 
ATOM   1697  O  O     . GLN A  1  216 ? 90.297  -78.053  -25.388 1.00 52.88  ? 216  GLN A O     1 
ATOM   1698  C  CB    . GLN A  1  216 ? 92.433  -75.915  -24.041 1.00 52.34  ? 216  GLN A CB    1 
ATOM   1699  C  CG    . GLN A  1  216 ? 93.899  -75.580  -24.251 1.00 55.42  ? 216  GLN A CG    1 
ATOM   1700  C  CD    . GLN A  1  216 ? 94.710  -75.723  -22.977 1.00 53.71  ? 216  GLN A CD    1 
ATOM   1701  O  OE1   . GLN A  1  216 ? 94.322  -75.218  -21.926 1.00 49.78  ? 216  GLN A OE1   1 
ATOM   1702  N  NE2   . GLN A  1  216 ? 95.836  -76.424  -23.062 1.00 55.18  ? 216  GLN A NE2   1 
ATOM   1703  N  N     . ILE A  1  217 ? 89.331  -76.207  -24.532 1.00 51.56  ? 217  ILE A N     1 
ATOM   1704  C  CA    . ILE A  1  217 ? 88.083  -76.899  -24.235 1.00 52.64  ? 217  ILE A CA    1 
ATOM   1705  C  C     . ILE A  1  217 ? 87.370  -77.298  -25.521 1.00 58.88  ? 217  ILE A C     1 
ATOM   1706  O  O     . ILE A  1  217 ? 86.844  -78.412  -25.633 1.00 54.79  ? 217  ILE A O     1 
ATOM   1707  C  CB    . ILE A  1  217 ? 87.193  -76.017  -23.339 1.00 52.74  ? 217  ILE A CB    1 
ATOM   1708  C  CG1   . ILE A  1  217 ? 87.830  -75.834  -21.959 1.00 51.57  ? 217  ILE A CG1   1 
ATOM   1709  C  CG2   . ILE A  1  217 ? 85.801  -76.614  -23.211 1.00 54.05  ? 217  ILE A CG2   1 
ATOM   1710  C  CD1   . ILE A  1  217 ? 87.055  -74.910  -21.047 1.00 51.62  ? 217  ILE A CD1   1 
ATOM   1711  N  N     . HIS A  1  218 ? 87.351  -76.411  -26.518 1.00 54.32  ? 218  HIS A N     1 
ATOM   1712  C  CA    . HIS A  1  218 ? 86.534  -76.659  -27.700 1.00 55.61  ? 218  HIS A CA    1 
ATOM   1713  C  C     . HIS A  1  218 ? 87.270  -77.380  -28.820 1.00 55.81  ? 218  HIS A C     1 
ATOM   1714  O  O     . HIS A  1  218 ? 86.622  -78.044  -29.638 1.00 61.87  ? 218  HIS A O     1 
ATOM   1715  C  CB    . HIS A  1  218 ? 85.970  -75.343  -28.236 1.00 56.04  ? 218  HIS A CB    1 
ATOM   1716  C  CG    . HIS A  1  218 ? 84.818  -74.824  -27.440 1.00 56.49  ? 218  HIS A CG    1 
ATOM   1717  N  ND1   . HIS A  1  218 ? 83.517  -75.204  -27.685 1.00 61.01  ? 218  HIS A ND1   1 
ATOM   1718  C  CD2   . HIS A  1  218 ? 84.771  -73.969  -26.392 1.00 55.78  ? 218  HIS A CD2   1 
ATOM   1719  C  CE1   . HIS A  1  218 ? 82.716  -74.600  -26.825 1.00 64.23  ? 218  HIS A CE1   1 
ATOM   1720  N  NE2   . HIS A  1  218 ? 83.454  -73.848  -26.029 1.00 56.76  ? 218  HIS A NE2   1 
ATOM   1721  N  N     . VAL A  1  219 ? 88.595  -77.272  -28.888 1.00 54.71  ? 219  VAL A N     1 
ATOM   1722  C  CA    . VAL A  1  219 ? 89.337  -77.867  -29.995 1.00 54.92  ? 219  VAL A CA    1 
ATOM   1723  C  C     . VAL A  1  219 ? 90.331  -78.905  -29.484 1.00 54.14  ? 219  VAL A C     1 
ATOM   1724  O  O     . VAL A  1  219 ? 90.304  -80.064  -29.910 1.00 54.78  ? 219  VAL A O     1 
ATOM   1725  C  CB    . VAL A  1  219 ? 90.052  -76.784  -30.825 1.00 54.55  ? 219  VAL A CB    1 
ATOM   1726  C  CG1   . VAL A  1  219 ? 90.817  -77.414  -31.981 1.00 54.85  ? 219  VAL A CG1   1 
ATOM   1727  C  CG2   . VAL A  1  219 ? 89.054  -75.756  -31.335 1.00 55.39  ? 219  VAL A CG2   1 
ATOM   1728  N  N     . SER A  1  220 ? 91.215  -78.500  -28.568 1.00 52.80  ? 220  SER A N     1 
ATOM   1729  C  CA    . SER A  1  220 ? 92.277  -79.395  -28.112 1.00 52.01  ? 220  SER A CA    1 
ATOM   1730  C  C     . SER A  1  220 ? 91.713  -80.627  -27.413 1.00 54.83  ? 220  SER A C     1 
ATOM   1731  O  O     . SER A  1  220 ? 92.108  -81.762  -27.711 1.00 57.13  ? 220  SER A O     1 
ATOM   1732  C  CB    . SER A  1  220 ? 93.229  -78.652  -27.172 1.00 50.57  ? 220  SER A CB    1 
ATOM   1733  O  OG    . SER A  1  220 ? 93.865  -77.565  -27.821 1.00 51.70  ? 220  SER A OG    1 
ATOM   1734  N  N     . MET A  1  221 ? 90.784  -80.422  -26.474 1.00 52.62  ? 221  MET A N     1 
ATOM   1735  C  CA    . MET A  1  221 ? 90.405  -81.518  -25.583 1.00 54.01  ? 221  MET A CA    1 
ATOM   1736  C  C     . MET A  1  221 ? 89.614  -82.617  -26.283 1.00 59.06  ? 221  MET A C     1 
ATOM   1737  O  O     . MET A  1  221 ? 89.990  -83.791  -26.141 1.00 64.81  ? 221  MET A O     1 
ATOM   1738  C  CB    . MET A  1  221 ? 89.667  -80.965  -24.363 1.00 52.66  ? 221  MET A CB    1 
ATOM   1739  C  CG    . MET A  1  221 ? 90.603  -80.369  -23.324 1.00 52.22  ? 221  MET A CG    1 
ATOM   1740  S  SD    . MET A  1  221 ? 89.694  -79.864  -21.864 1.00 55.99  ? 221  MET A SD    1 
ATOM   1741  C  CE    . MET A  1  221 ? 88.801  -81.382  -21.533 1.00 53.32  ? 221  MET A CE    1 
ATOM   1742  N  N     . PRO A  1  222 ? 88.530  -82.341  -27.024 1.00 55.39  ? 222  PRO A N     1 
ATOM   1743  C  CA    . PRO A  1  222 ? 87.825  -83.457  -27.681 1.00 56.75  ? 222  PRO A CA    1 
ATOM   1744  C  C     . PRO A  1  222 ? 88.674  -84.163  -28.726 1.00 58.67  ? 222  PRO A C     1 
ATOM   1745  O  O     . PRO A  1  222 ? 88.646  -85.400  -28.832 1.00 57.47  ? 222  PRO A O     1 
ATOM   1746  C  CB    . PRO A  1  222 ? 86.600  -82.773  -28.302 1.00 57.87  ? 222  PRO A CB    1 
ATOM   1747  C  CG    . PRO A  1  222 ? 87.013  -81.361  -28.491 1.00 57.11  ? 222  PRO A CG    1 
ATOM   1748  C  CD    . PRO A  1  222 ? 87.883  -81.048  -27.318 1.00 55.63  ? 222  PRO A CD    1 
ATOM   1749  N  N     . ILE A  1  223 ? 89.453  -83.397  -29.490 1.00 56.39  ? 223  ILE A N     1 
ATOM   1750  C  CA    . ILE A  1  223 ? 90.273  -83.979  -30.545 1.00 56.57  ? 223  ILE A CA    1 
ATOM   1751  C  C     . ILE A  1  223 ? 91.357  -84.872  -29.951 1.00 60.92  ? 223  ILE A C     1 
ATOM   1752  O  O     . ILE A  1  223 ? 91.607  -85.975  -30.448 1.00 56.27  ? 223  ILE A O     1 
ATOM   1753  C  CB    . ILE A  1  223 ? 90.855  -82.864  -31.433 1.00 56.24  ? 223  ILE A CB    1 
ATOM   1754  C  CG1   . ILE A  1  223 ? 89.728  -82.192  -32.232 1.00 57.39  ? 223  ILE A CG1   1 
ATOM   1755  C  CG2   . ILE A  1  223 ? 91.936  -83.409  -32.353 1.00 56.19  ? 223  ILE A CG2   1 
ATOM   1756  C  CD1   . ILE A  1  223 ? 90.182  -81.054  -33.125 1.00 57.21  ? 223  ILE A CD1   1 
ATOM   1757  N  N     . ASN A  1  224 ? 91.995  -84.435  -28.860 1.00 60.02  ? 224  ASN A N     1 
ATOM   1758  C  CA    . ASN A  1  224 ? 92.990  -85.288  -28.215 1.00 53.65  ? 224  ASN A CA    1 
ATOM   1759  C  C     . ASN A  1  224 ? 92.347  -86.459  -27.485 1.00 54.23  ? 224  ASN A C     1 
ATOM   1760  O  O     . ASN A  1  224 ? 92.935  -87.545  -27.421 1.00 54.22  ? 224  ASN A O     1 
ATOM   1761  C  CB    . ASN A  1  224 ? 93.846  -84.464  -27.259 1.00 52.17  ? 224  ASN A CB    1 
ATOM   1762  C  CG    . ASN A  1  224 ? 94.920  -83.686  -27.980 1.00 51.49  ? 224  ASN A CG    1 
ATOM   1763  O  OD1   . ASN A  1  224 ? 96.053  -84.146  -28.105 1.00 50.94  ? 224  ASN A OD1   1 
ATOM   1764  N  ND2   . ASN A  1  224 ? 94.564  -82.510  -28.484 1.00 51.58  ? 224  ASN A ND2   1 
ATOM   1765  N  N     . LYS A  1  225 ? 91.152  -86.259  -26.927 1.00 54.78  ? 225  LYS A N     1 
ATOM   1766  C  CA    . LYS A  1  225 ? 90.400  -87.358  -26.337 1.00 55.55  ? 225  LYS A CA    1 
ATOM   1767  C  C     . LYS A  1  225 ? 90.188  -88.471  -27.352 1.00 60.03  ? 225  LYS A C     1 
ATOM   1768  O  O     . LYS A  1  225 ? 90.326  -89.656  -27.028 1.00 57.03  ? 225  LYS A O     1 
ATOM   1769  C  CB    . LYS A  1  225 ? 89.061  -86.831  -25.817 1.00 56.15  ? 225  LYS A CB    1 
ATOM   1770  C  CG    . LYS A  1  225 ? 88.120  -87.878  -25.260 1.00 63.02  ? 225  LYS A CG    1 
ATOM   1771  C  CD    . LYS A  1  225 ? 88.461  -88.223  -23.824 1.00 65.57  ? 225  LYS A CD    1 
ATOM   1772  C  CE    . LYS A  1  225 ? 87.401  -89.127  -23.227 1.00 71.78  ? 225  LYS A CE    1 
ATOM   1773  N  NZ    . LYS A  1  225 ? 86.050  -88.515  -23.358 1.00 72.87  ? 225  LYS A NZ    1 
ATOM   1774  N  N     . LEU A  1  226 ? 89.865  -88.100  -28.592 1.00 62.57  ? 226  LEU A N     1 
ATOM   1775  C  CA    . LEU A  1  226 ? 89.682  -89.102  -29.638 1.00 60.86  ? 226  LEU A CA    1 
ATOM   1776  C  C     . LEU A  1  226 ? 91.017  -89.644  -30.144 1.00 62.26  ? 226  LEU A C     1 
ATOM   1777  O  O     . LEU A  1  226 ? 91.120  -90.832  -30.466 1.00 65.97  ? 226  LEU A O     1 
ATOM   1778  C  CB    . LEU A  1  226 ? 88.857  -88.511  -30.783 1.00 59.80  ? 226  LEU A CB    1 
ATOM   1779  C  CG    . LEU A  1  226 ? 87.431  -88.133  -30.370 1.00 60.57  ? 226  LEU A CG    1 
ATOM   1780  C  CD1   . LEU A  1  226 ? 86.755  -87.269  -31.418 1.00 61.40  ? 226  LEU A CD1   1 
ATOM   1781  C  CD2   . LEU A  1  226 ? 86.608  -89.380  -30.094 1.00 61.71  ? 226  LEU A CD2   1 
ATOM   1782  N  N     . LEU A  1  227 ? 92.050  -88.798  -30.213 1.00 62.59  ? 227  LEU A N     1 
ATOM   1783  C  CA    . LEU A  1  227 ? 93.357  -89.257  -30.678 1.00 57.34  ? 227  LEU A CA    1 
ATOM   1784  C  C     . LEU A  1  227 ? 93.924  -90.327  -29.755 1.00 62.99  ? 227  LEU A C     1 
ATOM   1785  O  O     . LEU A  1  227 ? 94.419  -91.363  -30.214 1.00 67.93  ? 227  LEU A O     1 
ATOM   1786  C  CB    . LEU A  1  227 ? 94.327  -88.079  -30.782 1.00 55.35  ? 227  LEU A CB    1 
ATOM   1787  C  CG    . LEU A  1  227 ? 94.322  -87.256  -32.071 1.00 58.34  ? 227  LEU A CG    1 
ATOM   1788  C  CD1   . LEU A  1  227 ? 95.292  -86.084  -31.948 1.00 54.53  ? 227  LEU A CD1   1 
ATOM   1789  C  CD2   . LEU A  1  227 ? 94.666  -88.129  -33.273 1.00 56.72  ? 227  LEU A CD2   1 
ATOM   1790  N  N     . ASP A  1  228 ? 93.862  -90.090  -28.444 1.00 63.11  ? 228  ASP A N     1 
ATOM   1791  C  CA    . ASP A  1  228 ? 94.401  -91.047  -27.485 1.00 62.54  ? 228  ASP A CA    1 
ATOM   1792  C  C     . ASP A  1  228 ? 93.542  -92.298  -27.381 1.00 66.26  ? 228  ASP A C     1 
ATOM   1793  O  O     . ASP A  1  228 ? 94.043  -93.346  -26.960 1.00 67.35  ? 228  ASP A O     1 
ATOM   1794  C  CB    . ASP A  1  228 ? 94.548  -90.381  -26.116 1.00 58.19  ? 228  ASP A CB    1 
ATOM   1795  C  CG    . ASP A  1  228 ? 95.381  -89.115  -26.178 1.00 59.29  ? 228  ASP A CG    1 
ATOM   1796  O  OD1   . ASP A  1  228 ? 95.893  -88.807  -27.275 1.00 60.30  ? 228  ASP A OD1   1 
ATOM   1797  O  OD2   . ASP A  1  228 ? 95.524  -88.428  -25.142 1.00 55.69  ? 228  ASP A OD2   1 
ATOM   1798  N  N     . ALA A  1  229 ? 92.269  -92.214  -27.762 1.00 61.00  ? 229  ALA A N     1 
ATOM   1799  C  CA    . ALA A  1  229 ? 91.406  -93.386  -27.796 1.00 58.48  ? 229  ALA A CA    1 
ATOM   1800  C  C     . ALA A  1  229 ? 91.725  -94.318  -28.956 1.00 59.38  ? 229  ALA A C     1 
ATOM   1801  O  O     . ALA A  1  229 ? 91.095  -95.376  -29.067 1.00 60.54  ? 229  ALA A O     1 
ATOM   1802  C  CB    . ALA A  1  229 ? 89.940  -92.953  -27.863 1.00 59.46  ? 229  ALA A CB    1 
ATOM   1803  N  N     . GLY A  1  230 ? 92.683  -93.960  -29.809 1.00 58.93  ? 230  GLY A N     1 
ATOM   1804  C  CA    . GLY A  1  230 ? 93.052  -94.770  -30.949 1.00 59.77  ? 230  GLY A CA    1 
ATOM   1805  C  C     . GLY A  1  230 ? 92.378  -94.389  -32.247 1.00 63.20  ? 230  GLY A C     1 
ATOM   1806  O  O     . GLY A  1  230 ? 92.633  -95.040  -33.267 1.00 61.71  ? 230  GLY A O     1 
ATOM   1807  N  N     . VAL A  1  231 ? 91.532  -93.357  -32.241 1.00 68.13  ? 231  VAL A N     1 
ATOM   1808  C  CA    . VAL A  1  231 ? 90.834  -92.938  -33.451 1.00 64.48  ? 231  VAL A CA    1 
ATOM   1809  C  C     . VAL A  1  231 ? 91.834  -92.352  -34.437 1.00 63.63  ? 231  VAL A C     1 
ATOM   1810  O  O     . VAL A  1  231 ? 92.659  -91.500  -34.080 1.00 64.95  ? 231  VAL A O     1 
ATOM   1811  C  CB    . VAL A  1  231 ? 89.730  -91.923  -33.113 1.00 68.34  ? 231  VAL A CB    1 
ATOM   1812  C  CG1   . VAL A  1  231 ? 88.934  -91.557  -34.361 1.00 68.06  ? 231  VAL A CG1   1 
ATOM   1813  C  CG2   . VAL A  1  231 ? 88.811  -92.466  -32.024 1.00 68.81  ? 231  VAL A CG2   1 
ATOM   1814  N  N     . ALA A  1  232 ? 91.763  -92.808  -35.684 1.00 67.28  ? 232  ALA A N     1 
ATOM   1815  C  CA    . ALA A  1  232 ? 92.648  -92.288  -36.715 1.00 72.59  ? 232  ALA A CA    1 
ATOM   1816  C  C     . ALA A  1  232 ? 92.374  -90.802  -36.935 1.00 69.57  ? 232  ALA A C     1 
ATOM   1817  O  O     . ALA A  1  232 ? 91.218  -90.366  -36.855 1.00 70.96  ? 232  ALA A O     1 
ATOM   1818  C  CB    . ALA A  1  232 ? 92.461  -93.058  -38.023 1.00 64.16  ? 232  ALA A CB    1 
ATOM   1819  N  N     . PRO A  1  233 ? 93.407  -90.000  -37.205 1.00 67.30  ? 233  PRO A N     1 
ATOM   1820  C  CA    . PRO A  1  233 ? 93.194  -88.548  -37.343 1.00 68.31  ? 233  PRO A CA    1 
ATOM   1821  C  C     . PRO A  1  233 ? 92.219  -88.168  -38.441 1.00 69.21  ? 233  PRO A C     1 
ATOM   1822  O  O     . PRO A  1  233 ? 91.599  -87.101  -38.361 1.00 71.35  ? 233  PRO A O     1 
ATOM   1823  C  CB    . PRO A  1  233 ? 94.605  -88.019  -37.636 1.00 66.21  ? 233  PRO A CB    1 
ATOM   1824  C  CG    . PRO A  1  233 ? 95.519  -89.034  -37.019 1.00 64.17  ? 233  PRO A CG    1 
ATOM   1825  C  CD    . PRO A  1  233 ? 94.835  -90.358  -37.219 1.00 64.45  ? 233  PRO A CD    1 
ATOM   1826  N  N     . LYS A  1  234 ? 92.062  -89.006  -39.466 1.00 71.05  ? 234  LYS A N     1 
ATOM   1827  C  CA    . LYS A  1  234 ? 91.123  -88.693  -40.537 1.00 77.53  ? 234  LYS A CA    1 
ATOM   1828  C  C     . LYS A  1  234 ? 89.676  -88.925  -40.120 1.00 74.49  ? 234  LYS A C     1 
ATOM   1829  O  O     . LYS A  1  234 ? 88.777  -88.247  -40.627 1.00 77.33  ? 234  LYS A O     1 
ATOM   1830  C  CB    . LYS A  1  234 ? 91.455  -89.513  -41.787 1.00 84.91  ? 234  LYS A CB    1 
ATOM   1831  C  CG    . LYS A  1  234 ? 92.290  -88.767  -42.829 1.00 90.83  ? 234  LYS A CG    1 
ATOM   1832  C  CD    . LYS A  1  234 ? 93.453  -88.006  -42.195 1.00 94.94  ? 234  LYS A CD    1 
ATOM   1833  C  CE    . LYS A  1  234 ? 93.280  -86.495  -42.340 1.00 95.65  ? 234  LYS A CE    1 
ATOM   1834  N  NZ    . LYS A  1  234 ? 94.240  -85.725  -41.498 1.00 87.25  ? 234  LYS A NZ    1 
ATOM   1835  N  N     . ASP A  1  235 ? 89.432  -89.864  -39.203 1.00 77.14  ? 235  ASP A N     1 
ATOM   1836  C  CA    . ASP A  1  235 ? 88.085  -90.125  -38.708 1.00 75.40  ? 235  ASP A CA    1 
ATOM   1837  C  C     . ASP A  1  235 ? 87.615  -89.100  -37.685 1.00 70.81  ? 235  ASP A C     1 
ATOM   1838  O  O     . ASP A  1  235 ? 86.435  -89.116  -37.317 1.00 69.27  ? 235  ASP A O     1 
ATOM   1839  C  CB    . ASP A  1  235 ? 88.009  -91.521  -38.082 1.00 77.33  ? 235  ASP A CB    1 
ATOM   1840  C  CG    . ASP A  1  235 ? 88.353  -92.623  -39.063 1.00 83.43  ? 235  ASP A CG    1 
ATOM   1841  O  OD1   . ASP A  1  235 ? 88.006  -92.493  -40.257 1.00 86.43  ? 235  ASP A OD1   1 
ATOM   1842  O  OD2   . ASP A  1  235 ? 88.969  -93.622  -38.635 1.00 85.92  ? 235  ASP A OD2   1 
ATOM   1843  N  N     . ILE A  1  236 ? 88.496  -88.224  -37.211 1.00 64.31  ? 236  ILE A N     1 
ATOM   1844  C  CA    . ILE A  1  236 ? 88.136  -87.248  -36.186 1.00 63.56  ? 236  ILE A CA    1 
ATOM   1845  C  C     . ILE A  1  236 ? 87.514  -86.027  -36.853 1.00 67.77  ? 236  ILE A C     1 
ATOM   1846  O  O     . ILE A  1  236 ? 88.034  -85.549  -37.873 1.00 64.04  ? 236  ILE A O     1 
ATOM   1847  C  CB    . ILE A  1  236 ? 89.356  -86.855  -35.338 1.00 67.29  ? 236  ILE A CB    1 
ATOM   1848  C  CG1   . ILE A  1  236 ? 90.089  -88.106  -34.858 1.00 73.33  ? 236  ILE A CG1   1 
ATOM   1849  C  CG2   . ILE A  1  236 ? 88.932  -86.016  -34.143 1.00 71.40  ? 236  ILE A CG2   1 
ATOM   1850  C  CD1   . ILE A  1  236 ? 91.180  -87.819  -33.862 1.00 70.71  ? 236  ILE A CD1   1 
ATOM   1851  N  N     . PRO A  1  237 ? 86.407  -85.501  -36.326 1.00 64.24  ? 237  PRO A N     1 
ATOM   1852  C  CA    . PRO A  1  237 ? 85.813  -84.289  -36.902 1.00 64.69  ? 237  PRO A CA    1 
ATOM   1853  C  C     . PRO A  1  237 ? 86.763  -83.101  -36.848 1.00 64.62  ? 237  PRO A C     1 
ATOM   1854  O  O     . PRO A  1  237 ? 87.701  -83.044  -36.048 1.00 61.97  ? 237  PRO A O     1 
ATOM   1855  C  CB    . PRO A  1  237 ? 84.578  -84.047  -36.024 1.00 65.05  ? 237  PRO A CB    1 
ATOM   1856  C  CG    . PRO A  1  237 ? 84.251  -85.378  -35.447 1.00 65.47  ? 237  PRO A CG    1 
ATOM   1857  C  CD    . PRO A  1  237 ? 85.559  -86.086  -35.272 1.00 64.47  ? 237  PRO A CD    1 
ATOM   1858  N  N     . LEU A  1  238 ? 86.504  -82.138  -37.730 1.00 72.44  ? 238  LEU A N     1 
ATOM   1859  C  CA    . LEU A  1  238 ? 87.261  -80.901  -37.735 1.00 67.69  ? 238  LEU A CA    1 
ATOM   1860  C  C     . LEU A  1  238 ? 86.909  -80.076  -36.499 1.00 65.94  ? 238  LEU A C     1 
ATOM   1861  O  O     . LEU A  1  238 ? 85.841  -80.258  -35.908 1.00 62.48  ? 238  LEU A O     1 
ATOM   1862  C  CB    . LEU A  1  238 ? 86.980  -80.114  -39.014 1.00 66.35  ? 238  LEU A CB    1 
ATOM   1863  C  CG    . LEU A  1  238 ? 87.462  -80.757  -40.318 1.00 64.66  ? 238  LEU A CG    1 
ATOM   1864  C  CD1   . LEU A  1  238 ? 87.255  -79.816  -41.490 1.00 72.01  ? 238  LEU A CD1   1 
ATOM   1865  C  CD2   . LEU A  1  238 ? 88.920  -81.171  -40.220 1.00 63.52  ? 238  LEU A CD2   1 
ATOM   1866  N  N     . PRO A  1  239 ? 87.805  -79.172  -36.078 1.00 64.17  ? 239  PRO A N     1 
ATOM   1867  C  CA    . PRO A  1  239 ? 87.557  -78.403  -34.843 1.00 65.68  ? 239  PRO A CA    1 
ATOM   1868  C  C     . PRO A  1  239 ? 86.203  -77.713  -34.787 1.00 70.55  ? 239  PRO A C     1 
ATOM   1869  O  O     . PRO A  1  239 ? 85.560  -77.709  -33.730 1.00 73.37  ? 239  PRO A O     1 
ATOM   1870  C  CB    . PRO A  1  239 ? 88.703  -77.384  -34.849 1.00 58.44  ? 239  PRO A CB    1 
ATOM   1871  C  CG    . PRO A  1  239 ? 89.795  -78.073  -35.571 1.00 58.27  ? 239  PRO A CG    1 
ATOM   1872  C  CD    . PRO A  1  239 ? 89.136  -78.884  -36.642 1.00 61.65  ? 239  PRO A CD    1 
ATOM   1873  N  N     . HIS A  1  240 ? 85.747  -77.136  -35.900 1.00 68.82  ? 240  HIS A N     1 
ATOM   1874  C  CA    . HIS A  1  240 ? 84.490  -76.398  -35.899 1.00 71.41  ? 240  HIS A CA    1 
ATOM   1875  C  C     . HIS A  1  240 ? 83.266  -77.306  -35.838 1.00 65.07  ? 240  HIS A C     1 
ATOM   1876  O  O     . HIS A  1  240 ? 82.165  -76.819  -35.555 1.00 65.72  ? 240  HIS A O     1 
ATOM   1877  C  CB    . HIS A  1  240 ? 84.412  -75.509  -37.138 1.00 77.09  ? 240  HIS A CB    1 
ATOM   1878  C  CG    . HIS A  1  240 ? 84.577  -76.253  -38.426 1.00 75.93  ? 240  HIS A CG    1 
ATOM   1879  N  ND1   . HIS A  1  240 ? 83.542  -76.929  -39.032 1.00 83.06  ? 240  HIS A ND1   1 
ATOM   1880  C  CD2   . HIS A  1  240 ? 85.658  -76.428  -39.222 1.00 75.28  ? 240  HIS A CD2   1 
ATOM   1881  C  CE1   . HIS A  1  240 ? 83.977  -77.487  -40.148 1.00 83.00  ? 240  HIS A CE1   1 
ATOM   1882  N  NE2   . HIS A  1  240 ? 85.258  -77.198  -40.286 1.00 78.54  ? 240  HIS A NE2   1 
ATOM   1883  N  N     . GLU A  1  241 ? 83.425  -78.605  -36.099 1.00 64.24  ? 241  GLU A N     1 
ATOM   1884  C  CA    . GLU A  1  241 ? 82.274  -79.500  -36.042 1.00 70.98  ? 241  GLU A CA    1 
ATOM   1885  C  C     . GLU A  1  241 ? 81.782  -79.693  -34.612 1.00 72.33  ? 241  GLU A C     1 
ATOM   1886  O  O     . GLU A  1  241 ? 80.576  -79.861  -34.393 1.00 66.12  ? 241  GLU A O     1 
ATOM   1887  C  CB    . GLU A  1  241 ? 82.617  -80.844  -36.688 1.00 73.44  ? 241  GLU A CB    1 
ATOM   1888  C  CG    . GLU A  1  241 ? 82.979  -80.728  -38.164 1.00 79.23  ? 241  GLU A CG    1 
ATOM   1889  C  CD    . GLU A  1  241 ? 83.193  -82.072  -38.833 1.00 83.45  ? 241  GLU A CD    1 
ATOM   1890  O  OE1   . GLU A  1  241 ? 82.623  -83.076  -38.359 1.00 85.61  ? 241  GLU A OE1   1 
ATOM   1891  O  OE2   . GLU A  1  241 ? 83.932  -82.125  -39.839 1.00 87.59  ? 241  GLU A OE2   1 
ATOM   1892  N  N     . PHE A  1  242 ? 82.686  -79.657  -33.628 1.00 71.92  ? 242  PHE A N     1 
ATOM   1893  C  CA    . PHE A  1  242 ? 82.269  -79.757  -32.232 1.00 65.43  ? 242  PHE A CA    1 
ATOM   1894  C  C     . PHE A  1  242 ? 81.486  -78.536  -31.778 1.00 69.60  ? 242  PHE A C     1 
ATOM   1895  O  O     . PHE A  1  242 ? 80.713  -78.630  -30.818 1.00 66.22  ? 242  PHE A O     1 
ATOM   1896  C  CB    . PHE A  1  242 ? 83.482  -79.956  -31.329 1.00 61.42  ? 242  PHE A CB    1 
ATOM   1897  C  CG    . PHE A  1  242 ? 84.262  -81.194  -31.633 1.00 62.39  ? 242  PHE A CG    1 
ATOM   1898  C  CD1   . PHE A  1  242 ? 83.941  -82.397  -31.025 1.00 63.35  ? 242  PHE A CD1   1 
ATOM   1899  C  CD2   . PHE A  1  242 ? 85.315  -81.160  -32.531 1.00 70.08  ? 242  PHE A CD2   1 
ATOM   1900  C  CE1   . PHE A  1  242 ? 84.661  -83.549  -31.305 1.00 66.93  ? 242  PHE A CE1   1 
ATOM   1901  C  CE2   . PHE A  1  242 ? 86.038  -82.306  -32.819 1.00 78.54  ? 242  PHE A CE2   1 
ATOM   1902  C  CZ    . PHE A  1  242 ? 85.710  -83.504  -32.205 1.00 72.90  ? 242  PHE A CZ    1 
ATOM   1903  N  N     . ILE A  1  243 ? 81.668  -77.400  -32.446 1.00 69.56  ? 243  ILE A N     1 
ATOM   1904  C  CA    . ILE A  1  243 ? 80.906  -76.201  -32.130 1.00 64.10  ? 243  ILE A CA    1 
ATOM   1905  C  C     . ILE A  1  243 ? 79.608  -76.135  -32.931 1.00 72.13  ? 243  ILE A C     1 
ATOM   1906  O  O     . ILE A  1  243 ? 78.601  -75.619  -32.437 1.00 75.84  ? 243  ILE A O     1 
ATOM   1907  C  CB    . ILE A  1  243 ? 81.782  -74.960  -32.370 1.00 73.68  ? 243  ILE A CB    1 
ATOM   1908  C  CG1   . ILE A  1  243 ? 83.098  -75.104  -31.599 1.00 72.45  ? 243  ILE A CG1   1 
ATOM   1909  C  CG2   . ILE A  1  243 ? 81.051  -73.690  -31.959 1.00 77.18  ? 243  ILE A CG2   1 
ATOM   1910  C  CD1   . ILE A  1  243 ? 84.146  -74.075  -31.958 1.00 69.00  ? 243  ILE A CD1   1 
ATOM   1911  N  N     . LEU A  1  244 ? 79.603  -76.662  -34.157 1.00 73.71  ? 244  LEU A N     1 
ATOM   1912  C  CA    . LEU A  1  244 ? 78.356  -76.747  -34.912 1.00 72.37  ? 244  LEU A CA    1 
ATOM   1913  C  C     . LEU A  1  244 ? 77.461  -77.864  -34.390 1.00 76.50  ? 244  LEU A C     1 
ATOM   1914  O  O     . LEU A  1  244 ? 76.240  -77.694  -34.308 1.00 85.61  ? 244  LEU A O     1 
ATOM   1915  C  CB    . LEU A  1  244 ? 78.649  -76.956  -36.397 1.00 71.65  ? 244  LEU A CB    1 
ATOM   1916  C  CG    . LEU A  1  244 ? 79.321  -75.805  -37.147 1.00 71.25  ? 244  LEU A CG    1 
ATOM   1917  C  CD1   . LEU A  1  244 ? 79.682  -76.242  -38.558 1.00 74.62  ? 244  LEU A CD1   1 
ATOM   1918  C  CD2   . LEU A  1  244 ? 78.418  -74.581  -37.174 1.00 68.70  ? 244  LEU A CD2   1 
ATOM   1919  N  N     . GLU A  1  245 ? 78.046  -79.005  -34.036 1.00 75.39  ? 245  GLU A N     1 
ATOM   1920  C  CA    . GLU A  1  245 ? 77.292  -80.135  -33.509 1.00 80.36  ? 245  GLU A CA    1 
ATOM   1921  C  C     . GLU A  1  245 ? 77.606  -80.317  -32.029 1.00 80.00  ? 245  GLU A C     1 
ATOM   1922  O  O     . GLU A  1  245 ? 78.470  -81.131  -31.677 1.00 74.43  ? 245  GLU A O     1 
ATOM   1923  C  CB    . GLU A  1  245 ? 77.617  -81.413  -34.284 1.00 84.40  ? 245  GLU A CB    1 
ATOM   1924  C  CG    . GLU A  1  245 ? 77.106  -81.420  -35.710 1.00 98.42  ? 245  GLU A CG    1 
ATOM   1925  C  CD    . GLU A  1  245 ? 75.593  -81.496  -35.777 1.00 114.31 ? 245  GLU A CD    1 
ATOM   1926  O  OE1   . GLU A  1  245 ? 75.014  -82.377  -35.106 1.00 119.37 ? 245  GLU A OE1   1 
ATOM   1927  O  OE2   . GLU A  1  245 ? 74.984  -80.670  -36.490 1.00 117.72 ? 245  GLU A OE2   1 
ATOM   1928  N  N     . PRO A  1  246 ? 76.921  -79.595  -31.136 1.00 82.49  ? 246  PRO A N     1 
ATOM   1929  C  CA    . PRO A  1  246 ? 77.264  -79.673  -29.705 1.00 78.63  ? 246  PRO A CA    1 
ATOM   1930  C  C     . PRO A  1  246 ? 77.035  -81.048  -29.100 1.00 75.41  ? 246  PRO A C     1 
ATOM   1931  O  O     . PRO A  1  246 ? 77.538  -81.313  -27.998 1.00 84.33  ? 246  PRO A O     1 
ATOM   1932  C  CB    . PRO A  1  246 ? 76.345  -78.623  -29.060 1.00 72.41  ? 246  PRO A CB    1 
ATOM   1933  C  CG    . PRO A  1  246 ? 75.805  -77.804  -30.203 1.00 73.09  ? 246  PRO A CG    1 
ATOM   1934  C  CD    . PRO A  1  246 ? 75.759  -78.727  -31.373 1.00 79.25  ? 246  PRO A CD    1 
ATOM   1935  N  N     . SER A  1  247 ? 76.297  -81.925  -29.784 1.00 69.69  ? 247  SER A N     1 
ATOM   1936  C  CA    . SER A  1  247 ? 76.102  -83.282  -29.292 1.00 70.14  ? 247  SER A CA    1 
ATOM   1937  C  C     . SER A  1  247 ? 77.408  -84.063  -29.269 1.00 72.97  ? 247  SER A C     1 
ATOM   1938  O  O     . SER A  1  247 ? 77.576  -84.958  -28.434 1.00 69.20  ? 247  SER A O     1 
ATOM   1939  C  CB    . SER A  1  247 ? 75.054  -83.994  -30.146 1.00 78.55  ? 247  SER A CB    1 
ATOM   1940  O  OG    . SER A  1  247 ? 75.199  -83.647  -31.514 1.00 81.10  ? 247  SER A OG    1 
ATOM   1941  N  N     . LYS A  1  248 ? 78.347  -83.732  -30.159 1.00 72.69  ? 248  LYS A N     1 
ATOM   1942  C  CA    . LYS A  1  248 ? 79.666  -84.356  -30.112 1.00 72.38  ? 248  LYS A CA    1 
ATOM   1943  C  C     . LYS A  1  248 ? 80.369  -84.040  -28.797 1.00 74.39  ? 248  LYS A C     1 
ATOM   1944  O  O     . LYS A  1  248 ? 80.892  -84.938  -28.123 1.00 81.94  ? 248  LYS A O     1 
ATOM   1945  C  CB    . LYS A  1  248 ? 80.508  -83.889  -31.299 1.00 71.72  ? 248  LYS A CB    1 
ATOM   1946  C  CG    . LYS A  1  248 ? 79.868  -84.131  -32.654 1.00 74.45  ? 248  LYS A CG    1 
ATOM   1947  C  CD    . LYS A  1  248 ? 80.792  -83.703  -33.781 1.00 79.22  ? 248  LYS A CD    1 
ATOM   1948  C  CE    . LYS A  1  248 ? 80.159  -83.938  -35.139 1.00 85.18  ? 248  LYS A CE    1 
ATOM   1949  N  NZ    . LYS A  1  248 ? 79.837  -85.372  -35.359 1.00 94.34  ? 248  LYS A NZ    1 
ATOM   1950  N  N     . MET A  1  249 ? 80.395  -82.760  -28.418 1.00 65.16  ? 249  MET A N     1 
ATOM   1951  C  CA    . MET A  1  249 ? 80.937  -82.391  -27.115 1.00 71.73  ? 249  MET A CA    1 
ATOM   1952  C  C     . MET A  1  249 ? 80.183  -83.101  -25.999 1.00 70.46  ? 249  MET A C     1 
ATOM   1953  O  O     . MET A  1  249 ? 80.792  -83.723  -25.121 1.00 61.96  ? 249  MET A O     1 
ATOM   1954  C  CB    . MET A  1  249 ? 80.875  -80.875  -26.922 1.00 72.42  ? 249  MET A CB    1 
ATOM   1955  C  CG    . MET A  1  249 ? 81.723  -80.074  -27.894 1.00 73.65  ? 249  MET A CG    1 
ATOM   1956  S  SD    . MET A  1  249 ? 83.486  -80.429  -27.766 1.00 73.97  ? 249  MET A SD    1 
ATOM   1957  C  CE    . MET A  1  249 ? 83.811  -80.008  -26.061 1.00 71.82  ? 249  MET A CE    1 
ATOM   1958  N  N     . ALA A  1  250 ? 78.847  -83.042  -26.039 1.00 72.60  ? 250  ALA A N     1 
ATOM   1959  C  CA    . ALA A  1  250 ? 78.042  -83.615  -24.964 1.00 68.35  ? 250  ALA A CA    1 
ATOM   1960  C  C     . ALA A  1  250 ? 78.298  -85.107  -24.783 1.00 73.60  ? 250  ALA A C     1 
ATOM   1961  O  O     . ALA A  1  250 ? 78.260  -85.608  -23.654 1.00 79.46  ? 250  ALA A O     1 
ATOM   1962  C  CB    . ALA A  1  250 ? 76.559  -83.358  -25.225 1.00 66.17  ? 250  ALA A CB    1 
ATOM   1963  N  N     . GLU A  1  251 ? 78.558  -85.838  -25.866 1.00 72.40  ? 251  GLU A N     1 
ATOM   1964  C  CA    . GLU A  1  251 ? 78.861  -87.253  -25.693 1.00 73.85  ? 251  GLU A CA    1 
ATOM   1965  C  C     . GLU A  1  251 ? 80.314  -87.473  -25.301 1.00 68.48  ? 251  GLU A C     1 
ATOM   1966  O  O     . GLU A  1  251 ? 80.629  -88.475  -24.649 1.00 69.82  ? 251  GLU A O     1 
ATOM   1967  C  CB    . GLU A  1  251 ? 78.509  -88.042  -26.956 1.00 84.40  ? 251  GLU A CB    1 
ATOM   1968  C  CG    . GLU A  1  251 ? 79.241  -87.635  -28.218 1.00 92.31  ? 251  GLU A CG    1 
ATOM   1969  C  CD    . GLU A  1  251 ? 78.754  -88.413  -29.428 1.00 101.34 ? 251  GLU A CD    1 
ATOM   1970  O  OE1   . GLU A  1  251 ? 78.466  -89.621  -29.283 1.00 104.38 ? 251  GLU A OE1   1 
ATOM   1971  O  OE2   . GLU A  1  251 ? 78.643  -87.816  -30.521 1.00 102.61 ? 251  GLU A OE2   1 
ATOM   1972  N  N     . LEU A  1  252 ? 81.212  -86.557  -25.666 1.00 70.91  ? 252  LEU A N     1 
ATOM   1973  C  CA    . LEU A  1  252 ? 82.553  -86.625  -25.100 1.00 63.96  ? 252  LEU A CA    1 
ATOM   1974  C  C     . LEU A  1  252 ? 82.598  -86.066  -23.681 1.00 63.28  ? 252  LEU A C     1 
ATOM   1975  O  O     . LEU A  1  252 ? 83.443  -86.488  -22.882 1.00 63.28  ? 252  LEU A O     1 
ATOM   1976  C  CB    . LEU A  1  252 ? 83.551  -85.891  -25.997 1.00 64.51  ? 252  LEU A CB    1 
ATOM   1977  C  CG    . LEU A  1  252 ? 84.019  -86.678  -27.224 1.00 65.31  ? 252  LEU A CG    1 
ATOM   1978  C  CD1   . LEU A  1  252 ? 85.104  -85.931  -27.971 1.00 60.28  ? 252  LEU A CD1   1 
ATOM   1979  C  CD2   . LEU A  1  252 ? 84.510  -88.056  -26.820 1.00 61.16  ? 252  LEU A CD2   1 
ATOM   1980  N  N     . TYR A  1  253 ? 81.701  -85.140  -23.347 1.00 61.54  ? 253  TYR A N     1 
ATOM   1981  C  CA    . TYR A  1  253 ? 81.639  -84.541  -22.013 1.00 60.60  ? 253  TYR A CA    1 
ATOM   1982  C  C     . TYR A  1  253 ? 80.179  -84.317  -21.636 1.00 64.76  ? 253  TYR A C     1 
ATOM   1983  O  O     . TYR A  1  253 ? 79.558  -83.338  -22.083 1.00 68.07  ? 253  TYR A O     1 
ATOM   1984  C  CB    . TYR A  1  253 ? 82.430  -83.238  -21.957 1.00 59.29  ? 253  TYR A CB    1 
ATOM   1985  C  CG    . TYR A  1  253 ? 83.854  -83.404  -22.425 1.00 58.22  ? 253  TYR A CG    1 
ATOM   1986  C  CD1   . TYR A  1  253 ? 84.801  -84.016  -21.614 1.00 57.27  ? 253  TYR A CD1   1 
ATOM   1987  C  CD2   . TYR A  1  253 ? 84.247  -82.970  -23.683 1.00 58.23  ? 253  TYR A CD2   1 
ATOM   1988  C  CE1   . TYR A  1  253 ? 86.102  -84.180  -22.037 1.00 56.34  ? 253  TYR A CE1   1 
ATOM   1989  C  CE2   . TYR A  1  253 ? 85.550  -83.131  -24.117 1.00 58.88  ? 253  TYR A CE2   1 
ATOM   1990  C  CZ    . TYR A  1  253 ? 86.473  -83.737  -23.288 1.00 56.49  ? 253  TYR A CZ    1 
ATOM   1991  O  OH    . TYR A  1  253 ? 87.771  -83.899  -23.713 1.00 57.99  ? 253  TYR A OH    1 
ATOM   1992  N  N     . PRO A  1  254 ? 79.599  -85.198  -20.815 1.00 63.96  ? 254  PRO A N     1 
ATOM   1993  C  CA    . PRO A  1  254 ? 78.163  -85.085  -20.506 1.00 63.31  ? 254  PRO A CA    1 
ATOM   1994  C  C     . PRO A  1  254 ? 77.757  -83.760  -19.884 1.00 65.46  ? 254  PRO A C     1 
ATOM   1995  O  O     . PRO A  1  254 ? 76.593  -83.360  -20.022 1.00 69.24  ? 254  PRO A O     1 
ATOM   1996  C  CB    . PRO A  1  254 ? 77.930  -86.256  -19.542 1.00 63.72  ? 254  PRO A CB    1 
ATOM   1997  C  CG    . PRO A  1  254 ? 78.974  -87.247  -19.912 1.00 63.23  ? 254  PRO A CG    1 
ATOM   1998  C  CD    . PRO A  1  254 ? 80.185  -86.430  -20.262 1.00 63.57  ? 254  PRO A CD    1 
ATOM   1999  N  N     . SER A  1  255 ? 78.676  -83.065  -19.207 1.00 61.42  ? 255  SER A N     1 
ATOM   2000  C  CA    . SER A  1  255 ? 78.340  -81.775  -18.613 1.00 62.85  ? 255  SER A CA    1 
ATOM   2001  C  C     . SER A  1  255 ? 77.870  -80.779  -19.663 1.00 73.53  ? 255  SER A C     1 
ATOM   2002  O  O     . SER A  1  255 ? 77.057  -79.897  -19.361 1.00 77.59  ? 255  SER A O     1 
ATOM   2003  C  CB    . SER A  1  255 ? 79.542  -81.210  -17.857 1.00 65.81  ? 255  SER A CB    1 
ATOM   2004  O  OG    . SER A  1  255 ? 80.675  -81.117  -18.701 1.00 68.62  ? 255  SER A OG    1 
ATOM   2005  N  N     . PHE A  1  256 ? 78.361  -80.905  -20.898 1.00 73.75  ? 256  PHE A N     1 
ATOM   2006  C  CA    . PHE A  1  256 ? 77.922  -80.012  -21.963 1.00 66.90  ? 256  PHE A CA    1 
ATOM   2007  C  C     . PHE A  1  256 ? 76.423  -80.096  -22.199 1.00 68.69  ? 256  PHE A C     1 
ATOM   2008  O  O     . PHE A  1  256 ? 75.837  -79.144  -22.726 1.00 67.63  ? 256  PHE A O     1 
ATOM   2009  C  CB    . PHE A  1  256 ? 78.686  -80.315  -23.252 1.00 61.94  ? 256  PHE A CB    1 
ATOM   2010  C  CG    . PHE A  1  256 ? 79.983  -79.577  -23.360 1.00 60.44  ? 256  PHE A CG    1 
ATOM   2011  C  CD1   . PHE A  1  256 ? 81.134  -80.086  -22.789 1.00 67.93  ? 256  PHE A CD1   1 
ATOM   2012  C  CD2   . PHE A  1  256 ? 80.046  -78.356  -24.008 1.00 60.27  ? 256  PHE A CD2   1 
ATOM   2013  C  CE1   . PHE A  1  256 ? 82.332  -79.394  -22.872 1.00 64.42  ? 256  PHE A CE1   1 
ATOM   2014  C  CE2   . PHE A  1  256 ? 81.238  -77.661  -24.094 1.00 61.89  ? 256  PHE A CE2   1 
ATOM   2015  C  CZ    . PHE A  1  256 ? 82.382  -78.180  -23.524 1.00 57.75  ? 256  PHE A CZ    1 
ATOM   2016  N  N     . ALA A  1  257 ? 75.789  -81.206  -21.808 1.00 69.22  ? 257  ALA A N     1 
ATOM   2017  C  CA    . ALA A  1  257 ? 74.338  -81.303  -21.917 1.00 71.32  ? 257  ALA A CA    1 
ATOM   2018  C  C     . ALA A  1  257 ? 73.644  -80.235  -21.083 1.00 75.86  ? 257  ALA A C     1 
ATOM   2019  O  O     . ALA A  1  257 ? 72.537  -79.805  -21.424 1.00 87.50  ? 257  ALA A O     1 
ATOM   2020  C  CB    . ALA A  1  257 ? 73.869  -82.695  -21.495 1.00 67.22  ? 257  ALA A CB    1 
ATOM   2021  N  N     . GLN A  1  258 ? 74.273  -79.794  -19.995 1.00 74.64  ? 258  GLN A N     1 
ATOM   2022  C  CA    . GLN A  1  258 ? 73.683  -78.768  -19.148 1.00 68.01  ? 258  GLN A CA    1 
ATOM   2023  C  C     . GLN A  1  258 ? 74.017  -77.358  -19.612 1.00 65.86  ? 258  GLN A C     1 
ATOM   2024  O  O     . GLN A  1  258 ? 73.318  -76.413  -19.228 1.00 64.85  ? 258  GLN A O     1 
ATOM   2025  C  CB    . GLN A  1  258 ? 74.130  -78.960  -17.694 1.00 69.32  ? 258  GLN A CB    1 
ATOM   2026  C  CG    . GLN A  1  258 ? 73.715  -80.304  -17.108 1.00 67.30  ? 258  GLN A CG    1 
ATOM   2027  C  CD    . GLN A  1  258 ? 73.762  -80.336  -15.593 1.00 68.74  ? 258  GLN A CD    1 
ATOM   2028  O  OE1   . GLN A  1  258 ? 73.147  -79.509  -14.922 1.00 78.23  ? 258  GLN A OE1   1 
ATOM   2029  N  NE2   . GLN A  1  258 ? 74.487  -81.302  -15.047 1.00 68.95  ? 258  GLN A NE2   1 
ATOM   2030  N  N     . GLY A  1  259 ? 75.060  -77.196  -20.423 1.00 68.08  ? 259  GLY A N     1 
ATOM   2031  C  CA    . GLY A  1  259 ? 75.346  -75.906  -21.021 1.00 65.34  ? 259  GLY A CA    1 
ATOM   2032  C  C     . GLY A  1  259 ? 76.035  -74.941  -20.069 1.00 68.98  ? 259  GLY A C     1 
ATOM   2033  O  O     . GLY A  1  259 ? 76.801  -75.329  -19.185 1.00 70.07  ? 259  GLY A O     1 
ATOM   2034  N  N     . LEU A  1  260 ? 75.743  -73.655  -20.264 1.00 68.59  ? 260  LEU A N     1 
ATOM   2035  C  CA    . LEU A  1  260 ? 76.384  -72.572  -19.531 1.00 68.91  ? 260  LEU A CA    1 
ATOM   2036  C  C     . LEU A  1  260 ? 75.697  -72.238  -18.216 1.00 67.27  ? 260  LEU A C     1 
ATOM   2037  O  O     . LEU A  1  260 ? 76.271  -71.500  -17.408 1.00 70.87  ? 260  LEU A O     1 
ATOM   2038  C  CB    . LEU A  1  260 ? 76.428  -71.307  -20.392 1.00 71.69  ? 260  LEU A CB    1 
ATOM   2039  C  CG    . LEU A  1  260 ? 77.123  -71.393  -21.748 1.00 70.23  ? 260  LEU A CG    1 
ATOM   2040  C  CD1   . LEU A  1  260 ? 76.985  -70.062  -22.468 1.00 70.62  ? 260  LEU A CD1   1 
ATOM   2041  C  CD2   . LEU A  1  260 ? 78.584  -71.777  -21.579 1.00 60.86  ? 260  LEU A CD2   1 
ATOM   2042  N  N     . THR A  1  261 ? 74.485  -72.736  -17.991 1.00 68.48  ? 261  THR A N     1 
ATOM   2043  C  CA    . THR A  1  261 ? 73.773  -72.439  -16.749 1.00 68.65  ? 261  THR A CA    1 
ATOM   2044  C  C     . THR A  1  261 ? 74.574  -72.780  -15.499 1.00 72.31  ? 261  THR A C     1 
ATOM   2045  O  O     . THR A  1  261 ? 74.640  -71.934  -14.592 1.00 60.92  ? 261  THR A O     1 
ATOM   2046  C  CB    . THR A  1  261 ? 72.419  -73.159  -16.759 1.00 68.20  ? 261  THR A CB    1 
ATOM   2047  O  OG1   . THR A  1  261 ? 71.561  -72.545  -17.730 1.00 76.77  ? 261  THR A OG1   1 
ATOM   2048  C  CG2   . THR A  1  261 ? 71.771  -73.097  -15.387 1.00 64.58  ? 261  THR A CG2   1 
ATOM   2049  N  N     . PRO A  1  262 ? 75.207  -73.956  -15.379 1.00 78.25  ? 262  PRO A N     1 
ATOM   2050  C  CA    . PRO A  1  262 ? 76.017  -74.216  -14.175 1.00 70.04  ? 262  PRO A CA    1 
ATOM   2051  C  C     . PRO A  1  262 ? 77.126  -73.203  -13.963 1.00 59.67  ? 262  PRO A C     1 
ATOM   2052  O  O     . PRO A  1  262 ? 77.537  -72.979  -12.818 1.00 57.70  ? 262  PRO A O     1 
ATOM   2053  C  CB    . PRO A  1  262 ? 76.577  -75.623  -14.429 1.00 67.95  ? 262  PRO A CB    1 
ATOM   2054  C  CG    . PRO A  1  262 ? 75.602  -76.249  -15.363 1.00 73.19  ? 262  PRO A CG    1 
ATOM   2055  C  CD    . PRO A  1  262 ? 75.160  -75.140  -16.260 1.00 72.42  ? 262  PRO A CD    1 
ATOM   2056  N  N     . PHE A  1  263 ? 77.616  -72.575  -15.033 1.00 62.40  ? 263  PHE A N     1 
ATOM   2057  C  CA    . PHE A  1  263 ? 78.681  -71.589  -14.889 1.00 57.09  ? 263  PHE A CA    1 
ATOM   2058  C  C     . PHE A  1  263 ? 78.183  -70.337  -14.179 1.00 62.47  ? 263  PHE A C     1 
ATOM   2059  O  O     . PHE A  1  263 ? 78.813  -69.859  -13.228 1.00 66.21  ? 263  PHE A O     1 
ATOM   2060  C  CB    . PHE A  1  263 ? 79.260  -71.236  -16.259 1.00 56.77  ? 263  PHE A CB    1 
ATOM   2061  C  CG    . PHE A  1  263 ? 80.154  -70.028  -16.244 1.00 61.47  ? 263  PHE A CG    1 
ATOM   2062  C  CD1   . PHE A  1  263 ? 81.451  -70.117  -15.774 1.00 67.28  ? 263  PHE A CD1   1 
ATOM   2063  C  CD2   . PHE A  1  263 ? 79.695  -68.801  -16.700 1.00 60.29  ? 263  PHE A CD2   1 
ATOM   2064  C  CE1   . PHE A  1  263 ? 82.276  -69.004  -15.759 1.00 72.09  ? 263  PHE A CE1   1 
ATOM   2065  C  CE2   . PHE A  1  263 ? 80.515  -67.685  -16.685 1.00 61.99  ? 263  PHE A CE2   1 
ATOM   2066  C  CZ    . PHE A  1  263 ? 81.807  -67.787  -16.216 1.00 66.39  ? 263  PHE A CZ    1 
ATOM   2067  N  N     . PHE A  1  264 ? 77.051  -69.790  -14.625 1.00 61.27  ? 264  PHE A N     1 
ATOM   2068  C  CA    . PHE A  1  264 ? 76.543  -68.540  -14.074 1.00 61.58  ? 264  PHE A CA    1 
ATOM   2069  C  C     . PHE A  1  264 ? 75.880  -68.702  -12.711 1.00 66.45  ? 264  PHE A C     1 
ATOM   2070  O  O     . PHE A  1  264 ? 75.667  -67.695  -12.027 1.00 73.35  ? 264  PHE A O     1 
ATOM   2071  C  CB    . PHE A  1  264 ? 75.558  -67.896  -15.054 1.00 59.29  ? 264  PHE A CB    1 
ATOM   2072  C  CG    . PHE A  1  264 ? 76.201  -67.392  -16.315 1.00 60.20  ? 264  PHE A CG    1 
ATOM   2073  C  CD1   . PHE A  1  264 ? 76.937  -66.217  -16.312 1.00 63.62  ? 264  PHE A CD1   1 
ATOM   2074  C  CD2   . PHE A  1  264 ? 76.073  -68.093  -17.503 1.00 67.29  ? 264  PHE A CD2   1 
ATOM   2075  C  CE1   . PHE A  1  264 ? 77.534  -65.751  -17.471 1.00 66.06  ? 264  PHE A CE1   1 
ATOM   2076  C  CE2   . PHE A  1  264 ? 76.666  -67.632  -18.667 1.00 69.06  ? 264  PHE A CE2   1 
ATOM   2077  C  CZ    . PHE A  1  264 ? 77.397  -66.460  -18.650 1.00 70.55  ? 264  PHE A CZ    1 
ATOM   2078  N  N     . THR A  1  265 ? 75.557  -69.924  -12.294 1.00 60.37  ? 265  THR A N     1 
ATOM   2079  C  CA    . THR A  1  265 ? 74.930  -70.159  -11.000 1.00 60.51  ? 265  THR A CA    1 
ATOM   2080  C  C     . THR A  1  265 ? 75.905  -70.694  -9.960  1.00 62.59  ? 265  THR A C     1 
ATOM   2081  O  O     . THR A  1  265 ? 75.469  -71.156  -8.901  1.00 66.54  ? 265  THR A O     1 
ATOM   2082  C  CB    . THR A  1  265 ? 73.748  -71.122  -11.146 1.00 61.60  ? 265  THR A CB    1 
ATOM   2083  O  OG1   . THR A  1  265 ? 74.181  -72.330  -11.785 1.00 64.32  ? 265  THR A OG1   1 
ATOM   2084  C  CG2   . THR A  1  265 ? 72.646  -70.488  -11.972 1.00 62.60  ? 265  THR A CG2   1 
ATOM   2085  N  N     . LEU A  1  266 ? 77.210  -70.639  -10.237 1.00 57.40  ? 266  LEU A N     1 
ATOM   2086  C  CA    . LEU A  1  266 ? 78.244  -71.135  -9.325  1.00 70.49  ? 266  LEU A CA    1 
ATOM   2087  C  C     . LEU A  1  266 ? 78.066  -72.624  -9.041  1.00 72.70  ? 266  LEU A C     1 
ATOM   2088  O  O     . LEU A  1  266 ? 78.404  -73.113  -7.959  1.00 75.47  ? 266  LEU A O     1 
ATOM   2089  C  CB    . LEU A  1  266 ? 78.273  -70.335  -8.017  1.00 71.71  ? 266  LEU A CB    1 
ATOM   2090  C  CG    . LEU A  1  266 ? 78.253  -68.811  -8.156  1.00 71.07  ? 266  LEU A CG    1 
ATOM   2091  C  CD1   . LEU A  1  266 ? 78.192  -68.143  -6.788  1.00 74.84  ? 266  LEU A CD1   1 
ATOM   2092  C  CD2   . LEU A  1  266 ? 79.458  -68.325  -8.948  1.00 64.52  ? 266  LEU A CD2   1 
ATOM   2093  N  N     . ASN A  1  267 ? 77.524  -73.348  -10.009 1.00 70.15  ? 267  ASN A N     1 
ATOM   2094  C  CA    . ASN A  1  267 ? 77.388  -74.801  -9.924  1.00 62.15  ? 267  ASN A CA    1 
ATOM   2095  C  C     . ASN A  1  267 ? 78.487  -75.485  -10.729 1.00 62.26  ? 267  ASN A C     1 
ATOM   2096  O  O     . ASN A  1  267 ? 78.236  -76.370  -11.546 1.00 62.23  ? 267  ASN A O     1 
ATOM   2097  C  CB    . ASN A  1  267 ? 76.006  -75.222  -10.403 1.00 59.48  ? 267  ASN A CB    1 
ATOM   2098  C  CG    . ASN A  1  267 ? 75.595  -76.572  -9.866  1.00 60.24  ? 267  ASN A CG    1 
ATOM   2099  O  OD1   . ASN A  1  267 ? 76.114  -77.028  -8.850  1.00 65.93  ? 267  ASN A OD1   1 
ATOM   2100  N  ND2   . ASN A  1  267 ? 74.656  -77.220  -10.543 1.00 61.54  ? 267  ASN A ND2   1 
ATOM   2101  N  N     . TRP A  1  268 ? 79.732  -75.065  -10.487 1.00 62.67  ? 268  TRP A N     1 
ATOM   2102  C  CA    . TRP A  1  268 ? 80.846  -75.444  -11.348 1.00 63.07  ? 268  TRP A CA    1 
ATOM   2103  C  C     . TRP A  1  268 ? 81.146  -76.935  -11.316 1.00 56.82  ? 268  TRP A C     1 
ATOM   2104  O  O     . TRP A  1  268 ? 81.698  -77.454  -12.290 1.00 57.74  ? 268  TRP A O     1 
ATOM   2105  C  CB    . TRP A  1  268 ? 82.099  -74.661  -10.958 1.00 64.07  ? 268  TRP A CB    1 
ATOM   2106  C  CG    . TRP A  1  268 ? 81.949  -73.185  -11.136 1.00 62.96  ? 268  TRP A CG    1 
ATOM   2107  C  CD1   . TRP A  1  268 ? 80.942  -72.535  -11.790 1.00 64.49  ? 268  TRP A CD1   1 
ATOM   2108  C  CD2   . TRP A  1  268 ? 82.831  -72.169  -10.647 1.00 58.22  ? 268  TRP A CD2   1 
ATOM   2109  N  NE1   . TRP A  1  268 ? 81.144  -71.178  -11.740 1.00 62.67  ? 268  TRP A NE1   1 
ATOM   2110  C  CE2   . TRP A  1  268 ? 82.297  -70.927  -11.044 1.00 59.23  ? 268  TRP A CE2   1 
ATOM   2111  C  CE3   . TRP A  1  268 ? 84.020  -72.188  -9.913  1.00 55.39  ? 268  TRP A CE3   1 
ATOM   2112  C  CZ2   . TRP A  1  268 ? 82.912  -69.718  -10.733 1.00 57.42  ? 268  TRP A CZ2   1 
ATOM   2113  C  CZ3   . TRP A  1  268 ? 84.629  -70.986  -9.604  1.00 52.53  ? 268  TRP A CZ3   1 
ATOM   2114  C  CH2   . TRP A  1  268 ? 84.075  -69.769  -10.013 1.00 56.02  ? 268  TRP A CH2   1 
ATOM   2115  N  N     . GLY A  1  269 ? 80.784  -77.633  -10.237 1.00 57.38  ? 269  GLY A N     1 
ATOM   2116  C  CA    . GLY A  1  269 ? 81.135  -79.041  -10.118 1.00 58.52  ? 269  GLY A CA    1 
ATOM   2117  C  C     . GLY A  1  269 ? 80.571  -79.909  -11.226 1.00 58.33  ? 269  GLY A C     1 
ATOM   2118  O  O     . GLY A  1  269 ? 81.141  -80.956  -11.550 1.00 58.19  ? 269  GLY A O     1 
ATOM   2119  N  N     . VAL A  1  270 ? 79.452  -79.490  -11.820 1.00 57.44  ? 270  VAL A N     1 
ATOM   2120  C  CA    . VAL A  1  270 ? 78.878  -80.219  -12.951 1.00 58.48  ? 270  VAL A CA    1 
ATOM   2121  C  C     . VAL A  1  270 ? 79.911  -80.387  -14.057 1.00 57.73  ? 270  VAL A C     1 
ATOM   2122  O  O     . VAL A  1  270 ? 79.972  -81.429  -14.721 1.00 61.80  ? 270  VAL A O     1 
ATOM   2123  C  CB    . VAL A  1  270 ? 77.614  -79.498  -13.453 1.00 64.63  ? 270  VAL A CB    1 
ATOM   2124  C  CG1   . VAL A  1  270 ? 77.404  -79.742  -14.938 1.00 71.26  ? 270  VAL A CG1   1 
ATOM   2125  C  CG2   . VAL A  1  270 ? 76.403  -79.953  -12.655 1.00 69.26  ? 270  VAL A CG2   1 
ATOM   2126  N  N     . TYR A  1  271 ? 80.755  -79.375  -14.252 1.00 56.59  ? 271  TYR A N     1 
ATOM   2127  C  CA    . TYR A  1  271 ? 81.841  -79.374  -15.228 1.00 55.77  ? 271  TYR A CA    1 
ATOM   2128  C  C     . TYR A  1  271 ? 83.008  -80.265  -14.836 1.00 54.87  ? 271  TYR A C     1 
ATOM   2129  O  O     . TYR A  1  271 ? 84.070  -80.107  -15.450 1.00 63.92  ? 271  TYR A O     1 
ATOM   2130  C  CB    . TYR A  1  271 ? 82.357  -77.949  -15.429 1.00 54.87  ? 271  TYR A CB    1 
ATOM   2131  C  CG    . TYR A  1  271 ? 81.342  -76.976  -15.974 1.00 55.70  ? 271  TYR A CG    1 
ATOM   2132  C  CD1   . TYR A  1  271 ? 80.305  -77.405  -16.790 1.00 57.06  ? 271  TYR A CD1   1 
ATOM   2133  C  CD2   . TYR A  1  271 ? 81.429  -75.619  -15.679 1.00 55.15  ? 271  TYR A CD2   1 
ATOM   2134  C  CE1   . TYR A  1  271 ? 79.375  -76.512  -17.296 1.00 57.87  ? 271  TYR A CE1   1 
ATOM   2135  C  CE2   . TYR A  1  271 ? 80.508  -74.718  -16.179 1.00 55.94  ? 271  TYR A CE2   1 
ATOM   2136  C  CZ    . TYR A  1  271 ? 79.480  -75.170  -16.989 1.00 61.57  ? 271  TYR A CZ    1 
ATOM   2137  O  OH    . TYR A  1  271 ? 78.551  -74.285  -17.495 1.00 58.16  ? 271  TYR A OH    1 
ATOM   2138  N  N     . SER A  1  272 ? 82.899  -81.179  -13.871 1.00 56.71  ? 272  SER A N     1 
ATOM   2139  C  CA    . SER A  1  272 ? 84.080  -81.882  -13.382 1.00 54.12  ? 272  SER A CA    1 
ATOM   2140  C  C     . SER A  1  272 ? 84.643  -82.894  -14.372 1.00 54.21  ? 272  SER A C     1 
ATOM   2141  O  O     . SER A  1  272 ? 85.718  -83.444  -14.110 1.00 59.99  ? 272  SER A O     1 
ATOM   2142  C  CB    . SER A  1  272 ? 83.762  -82.589  -12.067 1.00 54.42  ? 272  SER A CB    1 
ATOM   2143  O  OG    . SER A  1  272 ? 82.751  -83.562  -12.251 1.00 72.55  ? 272  SER A OG    1 
ATOM   2144  N  N     . ASP A  1  273 ? 83.962  -83.159  -15.488 1.00 55.21  ? 273  ASP A N     1 
ATOM   2145  C  CA    . ASP A  1  273 ? 84.472  -84.127  -16.451 1.00 55.38  ? 273  ASP A CA    1 
ATOM   2146  C  C     . ASP A  1  273 ? 85.429  -83.521  -17.469 1.00 54.57  ? 273  ASP A C     1 
ATOM   2147  O  O     . ASP A  1  273 ? 86.182  -84.268  -18.104 1.00 54.54  ? 273  ASP A O     1 
ATOM   2148  C  CB    . ASP A  1  273 ? 83.323  -84.828  -17.187 1.00 59.82  ? 273  ASP A CB    1 
ATOM   2149  C  CG    . ASP A  1  273 ? 82.181  -83.893  -17.527 1.00 74.01  ? 273  ASP A CG    1 
ATOM   2150  O  OD1   . ASP A  1  273 ? 82.442  -82.801  -18.073 1.00 76.52  ? 273  ASP A OD1   1 
ATOM   2151  O  OD2   . ASP A  1  273 ? 81.017  -84.261  -17.258 1.00 74.28  ? 273  ASP A OD2   1 
ATOM   2152  N  N     . PHE A  1  274 ? 85.434  -82.198  -17.637 1.00 54.11  ? 274  PHE A N     1 
ATOM   2153  C  CA    . PHE A  1  274 ? 86.406  -81.564  -18.516 1.00 55.19  ? 274  PHE A CA    1 
ATOM   2154  C  C     . PHE A  1  274 ? 87.222  -80.459  -17.854 1.00 57.39  ? 274  PHE A C     1 
ATOM   2155  O  O     . PHE A  1  274 ? 88.204  -80.008  -18.453 1.00 63.49  ? 274  PHE A O     1 
ATOM   2156  C  CB    . PHE A  1  274 ? 85.721  -81.013  -19.779 1.00 54.54  ? 274  PHE A CB    1 
ATOM   2157  C  CG    . PHE A  1  274 ? 84.840  -79.820  -19.540 1.00 54.95  ? 274  PHE A CG    1 
ATOM   2158  C  CD1   . PHE A  1  274 ? 85.318  -78.537  -19.755 1.00 54.22  ? 274  PHE A CD1   1 
ATOM   2159  C  CD2   . PHE A  1  274 ? 83.525  -79.980  -19.138 1.00 57.69  ? 274  PHE A CD2   1 
ATOM   2160  C  CE1   . PHE A  1  274 ? 84.506  -77.437  -19.552 1.00 60.04  ? 274  PHE A CE1   1 
ATOM   2161  C  CE2   . PHE A  1  274 ? 82.708  -78.884  -18.935 1.00 56.90  ? 274  PHE A CE2   1 
ATOM   2162  C  CZ    . PHE A  1  274 ? 83.198  -77.612  -19.141 1.00 60.49  ? 274  PHE A CZ    1 
ATOM   2163  N  N     . LEU A  1  275 ? 86.862  -80.016  -16.652 1.00 53.24  ? 275  LEU A N     1 
ATOM   2164  C  CA    . LEU A  1  275 ? 87.702  -79.132  -15.845 1.00 54.53  ? 275  LEU A CA    1 
ATOM   2165  C  C     . LEU A  1  275 ? 88.192  -79.971  -14.670 1.00 56.74  ? 275  LEU A C     1 
ATOM   2166  O  O     . LEU A  1  275 ? 87.471  -80.168  -13.687 1.00 60.99  ? 275  LEU A O     1 
ATOM   2167  C  CB    . LEU A  1  275 ? 86.934  -77.891  -15.396 1.00 54.12  ? 275  LEU A CB    1 
ATOM   2168  C  CG    . LEU A  1  275 ? 86.398  -77.024  -16.537 1.00 51.22  ? 275  LEU A CG    1 
ATOM   2169  C  CD1   . LEU A  1  275 ? 85.597  -75.850  -15.999 1.00 52.38  ? 275  LEU A CD1   1 
ATOM   2170  C  CD2   . LEU A  1  275 ? 87.540  -76.544  -17.420 1.00 50.37  ? 275  LEU A CD2   1 
ATOM   2171  N  N     . THR A  1  276 ? 89.416  -80.476  -14.781 1.00 53.96  ? 276  THR A N     1 
ATOM   2172  C  CA    . THR A  1  276 ? 89.887  -81.547  -13.921 1.00 58.20  ? 276  THR A CA    1 
ATOM   2173  C  C     . THR A  1  276 ? 91.041  -81.091  -13.038 1.00 59.55  ? 276  THR A C     1 
ATOM   2174  O  O     . THR A  1  276 ? 91.677  -80.060  -13.278 1.00 58.70  ? 276  THR A O     1 
ATOM   2175  C  CB    . THR A  1  276 ? 90.330  -82.753  -14.756 1.00 55.86  ? 276  THR A CB    1 
ATOM   2176  O  OG1   . THR A  1  276 ? 91.393  -82.360  -15.633 1.00 50.87  ? 276  THR A OG1   1 
ATOM   2177  C  CG2   . THR A  1  276 ? 89.167  -83.272  -15.586 1.00 50.71  ? 276  THR A CG2   1 
ATOM   2178  N  N     . PHE A  1  277 ? 91.292  -81.887  -11.999 1.00 56.99  ? 277  PHE A N     1 
ATOM   2179  C  CA    . PHE A  1  277 ? 92.468  -81.753  -11.147 1.00 48.29  ? 277  PHE A CA    1 
ATOM   2180  C  C     . PHE A  1  277 ? 93.082  -83.138  -10.949 1.00 51.54  ? 277  PHE A C     1 
ATOM   2181  O  O     . PHE A  1  277 ? 93.229  -83.636  -9.834  1.00 52.07  ? 277  PHE A O     1 
ATOM   2182  C  CB    . PHE A  1  277 ? 92.134  -81.108  -9.803  1.00 53.63  ? 277  PHE A CB    1 
ATOM   2183  C  CG    . PHE A  1  277 ? 93.191  -80.155  -9.311  1.00 49.46  ? 277  PHE A CG    1 
ATOM   2184  C  CD1   . PHE A  1  277 ? 92.926  -78.802  -9.211  1.00 44.93  ? 277  PHE A CD1   1 
ATOM   2185  C  CD2   . PHE A  1  277 ? 94.454  -80.612  -8.969  1.00 50.23  ? 277  PHE A CD2   1 
ATOM   2186  C  CE1   . PHE A  1  277 ? 93.896  -77.920  -8.766  1.00 56.56  ? 277  PHE A CE1   1 
ATOM   2187  C  CE2   . PHE A  1  277 ? 95.431  -79.733  -8.525  1.00 59.88  ? 277  PHE A CE2   1 
ATOM   2188  C  CZ    . PHE A  1  277 ? 95.149  -78.386  -8.423  1.00 61.18  ? 277  PHE A CZ    1 
ATOM   2189  N  N     . LYS A  1  278 ? 93.435  -83.774  -12.068 1.00 51.16  ? 278  LYS A N     1 
ATOM   2190  C  CA    . LYS A  1  278 ? 93.965  -85.131  -12.008 1.00 57.32  ? 278  LYS A CA    1 
ATOM   2191  C  C     . LYS A  1  278 ? 95.387  -85.151  -11.464 1.00 57.37  ? 278  LYS A C     1 
ATOM   2192  O  O     . LYS A  1  278 ? 95.726  -86.005  -10.639 1.00 54.97  ? 278  LYS A O     1 
ATOM   2193  C  CB    . LYS A  1  278 ? 93.924  -85.778  -13.393 1.00 58.70  ? 278  LYS A CB    1 
ATOM   2194  C  CG    . LYS A  1  278 ? 92.535  -86.025  -13.949 1.00 59.59  ? 278  LYS A CG    1 
ATOM   2195  C  CD    . LYS A  1  278 ? 92.625  -86.651  -15.333 1.00 61.16  ? 278  LYS A CD    1 
ATOM   2196  C  CE    . LYS A  1  278 ? 91.281  -87.178  -15.809 1.00 60.08  ? 278  LYS A CE    1 
ATOM   2197  N  NZ    . LYS A  1  278 ? 91.443  -88.017  -17.028 1.00 62.59  ? 278  LYS A NZ    1 
ATOM   2198  N  N     . GLY A  1  279 ? 96.226  -84.221  -11.905 1.00 62.33  ? 279  GLY A N     1 
ATOM   2199  C  CA    . GLY A  1  279 ? 97.640  -84.315  -11.638 1.00 48.93  ? 279  GLY A CA    1 
ATOM   2200  C  C     . GLY A  1  279 ? 98.278  -85.371  -12.518 1.00 50.37  ? 279  GLY A C     1 
ATOM   2201  O  O     . GLY A  1  279 ? 97.675  -85.877  -13.469 1.00 55.71  ? 279  GLY A O     1 
ATOM   2202  N  N     . GLY A  1  280 ? 99.522  -85.704  -12.185 1.00 47.65  ? 280  GLY A N     1 
ATOM   2203  C  CA    . GLY A  1  280 ? 100.198 -86.759  -12.912 1.00 48.13  ? 280  GLY A CA    1 
ATOM   2204  C  C     . GLY A  1  280 ? 100.314 -86.467  -14.398 1.00 47.95  ? 280  GLY A C     1 
ATOM   2205  O  O     . GLY A  1  280 ? 100.462 -85.320  -14.832 1.00 52.29  ? 280  GLY A O     1 
ATOM   2206  N  N     . LEU A  1  281 ? 100.237 -87.530  -15.197 1.00 47.00  ? 281  LEU A N     1 
ATOM   2207  C  CA    . LEU A  1  281 ? 100.409 -87.430  -16.637 1.00 50.32  ? 281  LEU A CA    1 
ATOM   2208  C  C     . LEU A  1  281 ? 99.360  -88.278  -17.341 1.00 55.36  ? 281  LEU A C     1 
ATOM   2209  O  O     . LEU A  1  281 ? 98.685  -89.110  -16.730 1.00 46.46  ? 281  LEU A O     1 
ATOM   2210  C  CB    . LEU A  1  281 ? 101.813 -87.869  -17.068 1.00 56.64  ? 281  LEU A CB    1 
ATOM   2211  C  CG    . LEU A  1  281 ? 102.978 -87.044  -16.526 1.00 56.04  ? 281  LEU A CG    1 
ATOM   2212  C  CD1   . LEU A  1  281 ? 104.302 -87.718  -16.849 1.00 52.59  ? 281  LEU A CD1   1 
ATOM   2213  C  CD2   . LEU A  1  281 ? 102.925 -85.640  -17.102 1.00 55.53  ? 281  LEU A CD2   1 
ATOM   2214  N  N     . ASN A  1  282 ? 99.237  -88.054  -18.643 1.00 52.85  ? 282  ASN A N     1 
ATOM   2215  C  CA    . ASN A  1  282 ? 98.366  -88.864  -19.485 1.00 47.99  ? 282  ASN A CA    1 
ATOM   2216  C  C     . ASN A  1  282 ? 99.030  -90.212  -19.745 1.00 51.35  ? 282  ASN A C     1 
ATOM   2217  O  O     . ASN A  1  282 ? 100.162 -90.245  -20.240 1.00 57.45  ? 282  ASN A O     1 
ATOM   2218  C  CB    . ASN A  1  282 ? 98.091  -88.135  -20.798 1.00 48.33  ? 282  ASN A CB    1 
ATOM   2219  C  CG    . ASN A  1  282 ? 96.958  -88.751  -21.592 1.00 49.69  ? 282  ASN A CG    1 
ATOM   2220  O  OD1   . ASN A  1  282 ? 96.935  -89.955  -21.844 1.00 50.37  ? 282  ASN A OD1   1 
ATOM   2221  N  ND2   . ASN A  1  282 ? 96.008  -87.920  -21.999 1.00 50.13  ? 282  ASN A ND2   1 
ATOM   2222  N  N     . PRO A  1  283 ? 98.372  -91.334  -19.440 1.00 58.50  ? 283  PRO A N     1 
ATOM   2223  C  CA    . PRO A  1  283 ? 99.036  -92.635  -19.618 1.00 55.67  ? 283  PRO A CA    1 
ATOM   2224  C  C     . PRO A  1  283 ? 99.336  -92.969  -21.067 1.00 52.97  ? 283  PRO A C     1 
ATOM   2225  O  O     . PRO A  1  283 ? 100.273 -93.732  -21.328 1.00 53.21  ? 283  PRO A O     1 
ATOM   2226  C  CB    . PRO A  1  283 ? 98.033  -93.632  -19.016 1.00 61.71  ? 283  PRO A CB    1 
ATOM   2227  C  CG    . PRO A  1  283 ? 97.019  -92.805  -18.285 1.00 64.40  ? 283  PRO A CG    1 
ATOM   2228  C  CD    . PRO A  1  283 ? 96.985  -91.489  -18.981 1.00 64.88  ? 283  PRO A CD    1 
ATOM   2229  N  N     . VAL A  1  284 ? 98.569  -92.432  -22.018 1.00 50.04  ? 284  VAL A N     1 
ATOM   2230  C  CA    . VAL A  1  284 ? 98.788  -92.773  -23.419 1.00 51.15  ? 284  VAL A CA    1 
ATOM   2231  C  C     . VAL A  1  284 ? 99.943  -91.969  -24.007 1.00 59.46  ? 284  VAL A C     1 
ATOM   2232  O  O     . VAL A  1  284 ? 100.718 -92.482  -24.821 1.00 56.43  ? 284  VAL A O     1 
ATOM   2233  C  CB    . VAL A  1  284 ? 97.493  -92.569  -24.225 1.00 51.80  ? 284  VAL A CB    1 
ATOM   2234  C  CG1   . VAL A  1  284 ? 97.712  -92.950  -25.677 1.00 52.55  ? 284  VAL A CG1   1 
ATOM   2235  C  CG2   . VAL A  1  284 ? 96.357  -93.382  -23.625 1.00 52.74  ? 284  VAL A CG2   1 
ATOM   2236  N  N     . THR A  1  285 ? 100.083 -90.702  -23.608 1.00 60.82  ? 285  THR A N     1 
ATOM   2237  C  CA    . THR A  1  285 ? 101.016 -89.797  -24.265 1.00 60.04  ? 285  THR A CA    1 
ATOM   2238  C  C     . THR A  1  285 ? 102.203 -89.387  -23.408 1.00 58.50  ? 285  THR A C     1 
ATOM   2239  O  O     . THR A  1  285 ? 103.188 -88.883  -23.957 1.00 47.85  ? 285  THR A O     1 
ATOM   2240  C  CB    . THR A  1  285 ? 100.290 -88.525  -24.724 1.00 55.87  ? 285  THR A CB    1 
ATOM   2241  O  OG1   . THR A  1  285 ? 99.879  -87.765  -23.578 1.00 47.64  ? 285  THR A OG1   1 
ATOM   2242  C  CG2   . THR A  1  285 ? 99.070  -88.884  -25.569 1.00 52.18  ? 285  THR A CG2   1 
ATOM   2243  N  N     . GLY A  1  286 ? 102.138 -89.582  -22.093 1.00 61.79  ? 286  GLY A N     1 
ATOM   2244  C  CA    . GLY A  1  286 ? 103.195 -89.148  -21.205 1.00 59.00  ? 286  GLY A CA    1 
ATOM   2245  C  C     . GLY A  1  286 ? 103.184 -87.675  -20.867 1.00 56.11  ? 286  GLY A C     1 
ATOM   2246  O  O     . GLY A  1  286 ? 104.089 -87.211  -20.159 1.00 47.38  ? 286  GLY A O     1 
ATOM   2247  N  N     . GLY A  1  287 ? 102.197 -86.921  -21.349 1.00 54.42  ? 287  GLY A N     1 
ATOM   2248  C  CA    . GLY A  1  287 ? 102.115 -85.503  -21.088 1.00 51.81  ? 287  GLY A CA    1 
ATOM   2249  C  C     . GLY A  1  287 ? 101.043 -85.168  -20.063 1.00 52.20  ? 287  GLY A C     1 
ATOM   2250  O  O     . GLY A  1  287 ? 100.278 -86.018  -19.617 1.00 45.03  ? 287  GLY A O     1 
ATOM   2251  N  N     . LEU A  1  288 ? 101.012 -83.891  -19.688 1.00 55.40  ? 288  LEU A N     1 
ATOM   2252  C  CA    . LEU A  1  288 ? 99.998  -83.410  -18.760 1.00 52.51  ? 288  LEU A CA    1 
ATOM   2253  C  C     . LEU A  1  288 ? 98.612  -83.558  -19.372 1.00 48.51  ? 288  LEU A C     1 
ATOM   2254  O  O     . LEU A  1  288 ? 98.432  -83.403  -20.584 1.00 48.12  ? 288  LEU A O     1 
ATOM   2255  C  CB    . LEU A  1  288 ? 100.262 -81.947  -18.398 1.00 53.55  ? 288  LEU A CB    1 
ATOM   2256  C  CG    . LEU A  1  288 ? 101.535 -81.660  -17.602 1.00 49.35  ? 288  LEU A CG    1 
ATOM   2257  C  CD1   . LEU A  1  288 ? 101.804 -80.164  -17.527 1.00 49.30  ? 288  LEU A CD1   1 
ATOM   2258  C  CD2   . LEU A  1  288 ? 101.418 -82.252  -16.214 1.00 45.47  ? 288  LEU A CD2   1 
ATOM   2259  N  N     . TRP A  1  289 ? 97.632  -83.885  -18.528 1.00 52.07  ? 289  TRP A N     1 
ATOM   2260  C  CA    . TRP A  1  289 ? 96.246  -83.961  -18.974 1.00 51.38  ? 289  TRP A CA    1 
ATOM   2261  C  C     . TRP A  1  289 ? 95.806  -82.612  -19.522 1.00 51.86  ? 289  TRP A C     1 
ATOM   2262  O  O     . TRP A  1  289 ? 95.861  -81.601  -18.814 1.00 53.06  ? 289  TRP A O     1 
ATOM   2263  C  CB    . TRP A  1  289 ? 95.335  -84.374  -17.819 1.00 54.55  ? 289  TRP A CB    1 
ATOM   2264  C  CG    . TRP A  1  289 ? 95.441  -85.811  -17.392 1.00 52.28  ? 289  TRP A CG    1 
ATOM   2265  C  CD1   . TRP A  1  289 ? 96.091  -86.292  -16.294 1.00 47.99  ? 289  TRP A CD1   1 
ATOM   2266  C  CD2   . TRP A  1  289 ? 94.856  -86.947  -18.042 1.00 48.53  ? 289  TRP A CD2   1 
ATOM   2267  N  NE1   . TRP A  1  289 ? 95.956  -87.658  -16.225 1.00 49.63  ? 289  TRP A NE1   1 
ATOM   2268  C  CE2   . TRP A  1  289 ? 95.202  -88.084  -17.287 1.00 53.75  ? 289  TRP A CE2   1 
ATOM   2269  C  CE3   . TRP A  1  289 ? 94.077  -87.113  -19.192 1.00 55.02  ? 289  TRP A CE3   1 
ATOM   2270  C  CZ2   . TRP A  1  289 ? 94.792  -89.370  -17.641 1.00 55.31  ? 289  TRP A CZ2   1 
ATOM   2271  C  CZ3   . TRP A  1  289 ? 93.675  -88.395  -19.545 1.00 50.56  ? 289  TRP A CZ3   1 
ATOM   2272  C  CH2   . TRP A  1  289 ? 94.034  -89.504  -18.772 1.00 50.55  ? 289  TRP A CH2   1 
ATOM   2273  N  N     . LEU A  1  290 ? 95.373  -82.596  -20.787 1.00 47.39  ? 290  LEU A N     1 
ATOM   2274  C  CA    . LEU A  1  290 ? 94.931  -81.346  -21.399 1.00 47.51  ? 290  LEU A CA    1 
ATOM   2275  C  C     . LEU A  1  290 ? 93.764  -80.732  -20.643 1.00 47.84  ? 290  LEU A C     1 
ATOM   2276  O  O     . LEU A  1  290 ? 93.628  -79.505  -20.607 1.00 47.53  ? 290  LEU A O     1 
ATOM   2277  C  CB    . LEU A  1  290 ? 94.550  -81.572  -22.861 1.00 48.47  ? 290  LEU A CB    1 
ATOM   2278  C  CG    . LEU A  1  290 ? 95.723  -81.758  -23.821 1.00 52.33  ? 290  LEU A CG    1 
ATOM   2279  C  CD1   . LEU A  1  290 ? 95.249  -81.636  -25.253 1.00 49.10  ? 290  LEU A CD1   1 
ATOM   2280  C  CD2   . LEU A  1  290 ? 96.823  -80.750  -23.531 1.00 46.90  ? 290  LEU A CD2   1 
ATOM   2281  N  N     . SER A  1  291 ? 92.912  -81.561  -20.037 1.00 52.84  ? 291  SER A N     1 
ATOM   2282  C  CA    . SER A  1  291 ? 91.828  -81.032  -19.216 1.00 55.01  ? 291  SER A CA    1 
ATOM   2283  C  C     . SER A  1  291 ? 92.378  -80.294  -18.003 1.00 56.83  ? 291  SER A C     1 
ATOM   2284  O  O     . SER A  1  291 ? 91.856  -79.241  -17.611 1.00 58.65  ? 291  SER A O     1 
ATOM   2285  C  CB    . SER A  1  291 ? 90.906  -82.169  -18.782 1.00 49.92  ? 291  SER A CB    1 
ATOM   2286  O  OG    . SER A  1  291 ? 91.643  -83.167  -18.100 1.00 49.42  ? 291  SER A OG    1 
ATOM   2287  N  N     . ASP A  1  292 ? 93.436  -80.838  -17.396 1.00 52.09  ? 292  ASP A N     1 
ATOM   2288  C  CA    . ASP A  1  292 ? 94.112  -80.133  -16.316 1.00 51.91  ? 292  ASP A CA    1 
ATOM   2289  C  C     . ASP A  1  292 ? 94.637  -78.785  -16.789 1.00 56.54  ? 292  ASP A C     1 
ATOM   2290  O  O     . ASP A  1  292 ? 94.498  -77.780  -16.085 1.00 57.75  ? 292  ASP A O     1 
ATOM   2291  C  CB    . ASP A  1  292 ? 95.255  -80.985  -15.761 1.00 51.59  ? 292  ASP A CB    1 
ATOM   2292  C  CG    . ASP A  1  292 ? 94.781  -82.064  -14.811 1.00 47.11  ? 292  ASP A CG    1 
ATOM   2293  O  OD1   . ASP A  1  292 ? 93.580  -82.091  -14.474 1.00 52.29  ? 292  ASP A OD1   1 
ATOM   2294  O  OD2   . ASP A  1  292 ? 95.619  -82.888  -14.395 1.00 46.86  ? 292  ASP A OD2   1 
ATOM   2295  N  N     . THR A  1  293 ? 95.229  -78.737  -17.986 1.00 47.24  ? 293  THR A N     1 
ATOM   2296  C  CA    . THR A  1  293 ? 95.796  -77.481  -18.465 1.00 45.43  ? 293  THR A CA    1 
ATOM   2297  C  C     . THR A  1  293 ? 94.708  -76.483  -18.837 1.00 46.05  ? 293  THR A C     1 
ATOM   2298  O  O     . THR A  1  293 ? 94.910  -75.272  -18.706 1.00 54.83  ? 293  THR A O     1 
ATOM   2299  C  CB    . THR A  1  293 ? 96.722  -77.734  -19.654 1.00 45.29  ? 293  THR A CB    1 
ATOM   2300  O  OG1   . THR A  1  293 ? 95.966  -78.265  -20.747 1.00 51.16  ? 293  THR A OG1   1 
ATOM   2301  C  CG2   . THR A  1  293 ? 97.812  -78.722  -19.271 1.00 44.71  ? 293  THR A CG2   1 
ATOM   2302  N  N     . ALA A  1  294 ? 93.541  -76.966  -19.260 1.00 46.35  ? 294  ALA A N     1 
ATOM   2303  C  CA    . ALA A  1  294 ? 92.433  -76.061  -19.547 1.00 53.78  ? 294  ALA A CA    1 
ATOM   2304  C  C     . ALA A  1  294 ? 91.859  -75.475  -18.264 1.00 46.87  ? 294  ALA A C     1 
ATOM   2305  O  O     . ALA A  1  294 ? 91.595  -74.269  -18.190 1.00 48.55  ? 294  ALA A O     1 
ATOM   2306  C  CB    . ALA A  1  294 ? 91.348  -76.789  -20.343 1.00 48.35  ? 294  ALA A CB    1 
ATOM   2307  N  N     . HIS A  1  295 ? 91.657  -76.314  -17.246 1.00 46.92  ? 295  HIS A N     1 
ATOM   2308  C  CA    . HIS A  1  295 ? 91.241  -75.807  -15.942 1.00 46.73  ? 295  HIS A CA    1 
ATOM   2309  C  C     . HIS A  1  295 ? 92.272  -74.827  -15.386 1.00 50.82  ? 295  HIS A C     1 
ATOM   2310  O  O     . HIS A  1  295 ? 91.921  -73.791  -14.801 1.00 51.31  ? 295  HIS A O     1 
ATOM   2311  C  CB    . HIS A  1  295 ? 91.034  -76.982  -14.988 1.00 46.95  ? 295  HIS A CB    1 
ATOM   2312  C  CG    . HIS A  1  295 ? 90.356  -76.613  -13.710 1.00 47.08  ? 295  HIS A CG    1 
ATOM   2313  N  ND1   . HIS A  1  295 ? 90.288  -77.468  -12.630 1.00 54.68  ? 295  HIS A ND1   1 
ATOM   2314  C  CD2   . HIS A  1  295 ? 89.704  -75.487  -13.342 1.00 47.22  ? 295  HIS A CD2   1 
ATOM   2315  C  CE1   . HIS A  1  295 ? 89.631  -76.878  -11.648 1.00 54.24  ? 295  HIS A CE1   1 
ATOM   2316  N  NE2   . HIS A  1  295 ? 89.265  -75.676  -12.056 1.00 47.36  ? 295  HIS A NE2   1 
ATOM   2317  N  N     . HIS A  1  296 ? 93.552  -75.136  -15.589 1.00 45.75  ? 296  HIS A N     1 
ATOM   2318  C  CA    . HIS A  1  296 ? 94.639  -74.273  -15.154 1.00 44.65  ? 296  HIS A CA    1 
ATOM   2319  C  C     . HIS A  1  296 ? 94.574  -72.913  -15.839 1.00 44.57  ? 296  HIS A C     1 
ATOM   2320  O  O     . HIS A  1  296 ? 94.718  -71.871  -15.191 1.00 45.03  ? 296  HIS A O     1 
ATOM   2321  C  CB    . HIS A  1  296 ? 95.966  -74.983  -15.440 1.00 43.95  ? 296  HIS A CB    1 
ATOM   2322  C  CG    . HIS A  1  296 ? 97.118  -74.061  -15.670 1.00 51.17  ? 296  HIS A CG    1 
ATOM   2323  N  ND1   . HIS A  1  296 ? 97.881  -73.553  -14.642 1.00 52.41  ? 296  HIS A ND1   1 
ATOM   2324  C  CD2   . HIS A  1  296 ? 97.646  -73.563  -16.812 1.00 55.64  ? 296  HIS A CD2   1 
ATOM   2325  C  CE1   . HIS A  1  296 ? 98.827  -72.777  -15.139 1.00 54.37  ? 296  HIS A CE1   1 
ATOM   2326  N  NE2   . HIS A  1  296 ? 98.703  -72.763  -16.453 1.00 52.12  ? 296  HIS A NE2   1 
ATOM   2327  N  N     . HIS A  1  297 ? 94.364  -72.903  -17.156 1.00 44.07  ? 297  HIS A N     1 
ATOM   2328  C  CA    . HIS A  1  297 ? 94.304  -71.638  -17.877 1.00 44.09  ? 297  HIS A CA    1 
ATOM   2329  C  C     . HIS A  1  297 ? 93.059  -70.845  -17.510 1.00 44.73  ? 297  HIS A C     1 
ATOM   2330  O  O     . HIS A  1  297 ? 93.112  -69.614  -17.443 1.00 51.46  ? 297  HIS A O     1 
ATOM   2331  C  CB    . HIS A  1  297 ? 94.361  -71.888  -19.382 1.00 46.29  ? 297  HIS A CB    1 
ATOM   2332  C  CG    . HIS A  1  297 ? 95.690  -72.387  -19.850 1.00 48.00  ? 297  HIS A CG    1 
ATOM   2333  N  ND1   . HIS A  1  297 ? 95.829  -73.517  -20.627 1.00 53.72  ? 297  HIS A ND1   1 
ATOM   2334  C  CD2   . HIS A  1  297 ? 96.942  -71.917  -19.642 1.00 48.52  ? 297  HIS A CD2   1 
ATOM   2335  C  CE1   . HIS A  1  297 ? 97.109  -73.720  -20.879 1.00 58.21  ? 297  HIS A CE1   1 
ATOM   2336  N  NE2   . HIS A  1  297 ? 97.805  -72.764  -20.292 1.00 52.21  ? 297  HIS A NE2   1 
ATOM   2337  N  N     . LEU A  1  298 ? 91.946  -71.526  -17.247 1.00 45.60  ? 298  LEU A N     1 
ATOM   2338  C  CA    . LEU A  1  298 ? 90.751  -70.832  -16.779 1.00 52.77  ? 298  LEU A CA    1 
ATOM   2339  C  C     . LEU A  1  298 ? 91.015  -70.123  -15.454 1.00 49.61  ? 298  LEU A C     1 
ATOM   2340  O  O     . LEU A  1  298 ? 90.681  -68.940  -15.285 1.00 53.11  ? 298  LEU A O     1 
ATOM   2341  C  CB    . LEU A  1  298 ? 89.597  -71.825  -16.647 1.00 47.31  ? 298  LEU A CB    1 
ATOM   2342  C  CG    . LEU A  1  298 ? 88.315  -71.327  -15.981 1.00 53.87  ? 298  LEU A CG    1 
ATOM   2343  C  CD1   . LEU A  1  298 ? 87.832  -70.026  -16.614 1.00 48.42  ? 298  LEU A CD1   1 
ATOM   2344  C  CD2   . LEU A  1  298 ? 87.235  -72.398  -16.062 1.00 49.22  ? 298  LEU A CD2   1 
ATOM   2345  N  N     . ALA A  1  299 ? 91.623  -70.835  -14.499 1.00 45.55  ? 299  ALA A N     1 
ATOM   2346  C  CA    . ALA A  1  299 ? 91.890  -70.230  -13.197 1.00 46.80  ? 299  ALA A CA    1 
ATOM   2347  C  C     . ALA A  1  299 ? 92.922  -69.108  -13.301 1.00 49.71  ? 299  ALA A C     1 
ATOM   2348  O  O     . ALA A  1  299 ? 92.784  -68.068  -12.647 1.00 47.82  ? 299  ALA A O     1 
ATOM   2349  C  CB    . ALA A  1  299 ? 92.348  -71.301  -12.209 1.00 44.16  ? 299  ALA A CB    1 
ATOM   2350  N  N     . ILE A  1  300 ? 93.957  -69.300  -14.123 1.00 50.25  ? 300  ILE A N     1 
ATOM   2351  C  CA    . ILE A  1  300 ? 94.958  -68.258  -14.342 1.00 46.23  ? 300  ILE A CA    1 
ATOM   2352  C  C     . ILE A  1  300 ? 94.317  -67.023  -14.958 1.00 53.07  ? 300  ILE A C     1 
ATOM   2353  O  O     . ILE A  1  300 ? 94.664  -65.886  -14.615 1.00 52.81  ? 300  ILE A O     1 
ATOM   2354  C  CB    . ILE A  1  300 ? 96.098  -68.806  -15.222 1.00 41.58  ? 300  ILE A CB    1 
ATOM   2355  C  CG1   . ILE A  1  300 ? 96.947  -69.794  -14.429 1.00 48.69  ? 300  ILE A CG1   1 
ATOM   2356  C  CG2   . ILE A  1  300 ? 96.958  -67.687  -15.762 1.00 41.00  ? 300  ILE A CG2   1 
ATOM   2357  C  CD1   . ILE A  1  300 ? 97.553  -69.193  -13.196 1.00 55.55  ? 300  ILE A CD1   1 
ATOM   2358  N  N     . ALA A  1  301 ? 93.371  -67.225  -15.878 1.00 55.78  ? 301  ALA A N     1 
ATOM   2359  C  CA    . ALA A  1  301 ? 92.684  -66.101  -16.497 1.00 51.22  ? 301  ALA A CA    1 
ATOM   2360  C  C     . ALA A  1  301 ? 91.866  -65.334  -15.470 1.00 49.09  ? 301  ALA A C     1 
ATOM   2361  O  O     . ALA A  1  301 ? 91.908  -64.100  -15.425 1.00 48.61  ? 301  ALA A O     1 
ATOM   2362  C  CB    . ALA A  1  301 ? 91.793  -66.595  -17.637 1.00 45.10  ? 301  ALA A CB    1 
ATOM   2363  N  N     . VAL A  1  302 ? 91.097  -66.052  -14.646 1.00 45.67  ? 302  VAL A N     1 
ATOM   2364  C  CA    . VAL A  1  302 ? 90.327  -65.374  -13.602 1.00 44.99  ? 302  VAL A CA    1 
ATOM   2365  C  C     . VAL A  1  302 ? 91.259  -64.579  -12.699 1.00 44.00  ? 302  VAL A C     1 
ATOM   2366  O  O     . VAL A  1  302 ? 91.002  -63.405  -12.385 1.00 44.05  ? 302  VAL A O     1 
ATOM   2367  C  CB    . VAL A  1  302 ? 89.484  -66.385  -12.801 1.00 45.59  ? 302  VAL A CB    1 
ATOM   2368  C  CG1   . VAL A  1  302 ? 89.017  -65.760  -11.488 1.00 45.64  ? 302  VAL A CG1   1 
ATOM   2369  C  CG2   . VAL A  1  302 ? 88.286  -66.857  -13.627 1.00 46.80  ? 302  VAL A CG2   1 
ATOM   2370  N  N     . LEU A  1  303 ? 92.376  -65.192  -12.299 1.00 43.12  ? 303  LEU A N     1 
ATOM   2371  C  CA    . LEU A  1  303 ? 93.341  -64.525  -11.433 1.00 47.67  ? 303  LEU A CA    1 
ATOM   2372  C  C     . LEU A  1  303 ? 93.861  -63.240  -12.070 1.00 49.38  ? 303  LEU A C     1 
ATOM   2373  O  O     . LEU A  1  303 ? 93.856  -62.175  -11.442 1.00 51.97  ? 303  LEU A O     1 
ATOM   2374  C  CB    . LEU A  1  303 ? 94.499  -65.475  -11.122 1.00 55.08  ? 303  LEU A CB    1 
ATOM   2375  C  CG    . LEU A  1  303 ? 94.933  -65.634  -9.663  1.00 54.98  ? 303  LEU A CG    1 
ATOM   2376  C  CD1   . LEU A  1  303 ? 96.151  -66.540  -9.565  1.00 60.94  ? 303  LEU A CD1   1 
ATOM   2377  C  CD2   . LEU A  1  303 ? 95.216  -64.290  -9.024  1.00 44.14  ? 303  LEU A CD2   1 
ATOM   2378  N  N     . PHE A  1  304 ? 94.310  -63.321  -13.325 1.00 43.70  ? 304  PHE A N     1 
ATOM   2379  C  CA    . PHE A  1  304 ? 94.931  -62.165  -13.963 1.00 44.71  ? 304  PHE A CA    1 
ATOM   2380  C  C     . PHE A  1  304 ? 93.915  -61.065  -14.239 1.00 48.66  ? 304  PHE A C     1 
ATOM   2381  O  O     . PHE A  1  304 ? 94.229  -59.874  -14.112 1.00 57.65  ? 304  PHE A O     1 
ATOM   2382  C  CB    . PHE A  1  304 ? 95.635  -62.594  -15.249 1.00 44.46  ? 304  PHE A CB    1 
ATOM   2383  C  CG    . PHE A  1  304 ? 97.037  -63.086  -15.031 1.00 48.11  ? 304  PHE A CG    1 
ATOM   2384  C  CD1   . PHE A  1  304 ? 97.896  -62.403  -14.188 1.00 47.26  ? 304  PHE A CD1   1 
ATOM   2385  C  CD2   . PHE A  1  304 ? 97.491  -64.235  -15.656 1.00 47.11  ? 304  PHE A CD2   1 
ATOM   2386  C  CE1   . PHE A  1  304 ? 99.184  -62.854  -13.980 1.00 60.28  ? 304  PHE A CE1   1 
ATOM   2387  C  CE2   . PHE A  1  304 ? 98.775  -64.690  -15.451 1.00 46.62  ? 304  PHE A CE2   1 
ATOM   2388  C  CZ    . PHE A  1  304 ? 99.622  -64.000  -14.613 1.00 56.54  ? 304  PHE A CZ    1 
ATOM   2389  N  N     . ILE A  1  305 ? 92.687  -61.434  -14.601 1.00 45.94  ? 305  ILE A N     1 
ATOM   2390  C  CA    . ILE A  1  305 ? 91.671  -60.417  -14.829 1.00 44.00  ? 305  ILE A CA    1 
ATOM   2391  C  C     . ILE A  1  305 ? 91.334  -59.707  -13.525 1.00 48.15  ? 305  ILE A C     1 
ATOM   2392  O  O     . ILE A  1  305 ? 91.156  -58.485  -13.500 1.00 44.07  ? 305  ILE A O     1 
ATOM   2393  C  CB    . ILE A  1  305 ? 90.427  -61.039  -15.486 1.00 47.51  ? 305  ILE A CB    1 
ATOM   2394  C  CG1   . ILE A  1  305 ? 90.772  -61.565  -16.878 1.00 45.29  ? 305  ILE A CG1   1 
ATOM   2395  C  CG2   . ILE A  1  305 ? 89.310  -60.020  -15.584 1.00 46.02  ? 305  ILE A CG2   1 
ATOM   2396  C  CD1   . ILE A  1  305 ? 89.579  -62.118  -17.619 1.00 58.52  ? 305  ILE A CD1   1 
ATOM   2397  N  N     . ILE A  1  306 ? 91.258  -60.451  -12.417 1.00 49.69  ? 306  ILE A N     1 
ATOM   2398  C  CA    . ILE A  1  306 ? 91.038  -59.811  -11.122 1.00 45.06  ? 306  ILE A CA    1 
ATOM   2399  C  C     . ILE A  1  306 ? 92.194  -58.876  -10.799 1.00 54.87  ? 306  ILE A C     1 
ATOM   2400  O  O     . ILE A  1  306 ? 91.997  -57.729  -10.374 1.00 54.05  ? 306  ILE A O     1 
ATOM   2401  C  CB    . ILE A  1  306 ? 90.847  -60.871  -10.023 1.00 45.07  ? 306  ILE A CB    1 
ATOM   2402  C  CG1   . ILE A  1  306 ? 89.516  -61.601  -10.212 1.00 46.60  ? 306  ILE A CG1   1 
ATOM   2403  C  CG2   . ILE A  1  306 ? 90.919  -60.233  -8.642  1.00 43.38  ? 306  ILE A CG2   1 
ATOM   2404  C  CD1   . ILE A  1  306 ? 89.279  -62.688  -9.205  1.00 48.37  ? 306  ILE A CD1   1 
ATOM   2405  N  N     . ALA A  1  307 ? 93.422  -59.352  -11.016 1.00 53.73  ? 307  ALA A N     1 
ATOM   2406  C  CA    . ALA A  1  307 ? 94.606  -58.542  -10.759 1.00 42.77  ? 307  ALA A CA    1 
ATOM   2407  C  C     . ALA A  1  307 ? 94.589  -57.245  -11.556 1.00 47.61  ? 307  ALA A C     1 
ATOM   2408  O  O     . ALA A  1  307 ? 95.063  -56.212  -11.069 1.00 46.17  ? 307  ALA A O     1 
ATOM   2409  C  CB    . ALA A  1  307 ? 95.863  -59.350  -11.085 1.00 49.91  ? 307  ALA A CB    1 
ATOM   2410  N  N     . GLY A  1  308 ? 94.043  -57.274  -12.771 1.00 50.57  ? 308  GLY A N     1 
ATOM   2411  C  CA    . GLY A  1  308 ? 94.031  -56.099  -13.624 1.00 42.09  ? 308  GLY A CA    1 
ATOM   2412  C  C     . GLY A  1  308 ? 93.137  -54.964  -13.161 1.00 43.36  ? 308  GLY A C     1 
ATOM   2413  O  O     . GLY A  1  308 ? 92.829  -54.059  -13.941 1.00 47.71  ? 308  GLY A O     1 
ATOM   2414  N  N     . HIS A  1  309 ? 92.721  -54.986  -11.895 1.00 51.46  ? 309  HIS A N     1 
ATOM   2415  C  CA    . HIS A  1  309 ? 91.842  -53.960  -11.348 1.00 43.35  ? 309  HIS A CA    1 
ATOM   2416  C  C     . HIS A  1  309 ? 92.422  -53.259  -10.128 1.00 44.65  ? 309  HIS A C     1 
ATOM   2417  O  O     . HIS A  1  309 ? 91.693  -52.523  -9.452  1.00 46.73  ? 309  HIS A O     1 
ATOM   2418  C  CB    . HIS A  1  309 ? 90.484  -54.565  -10.988 1.00 45.57  ? 309  HIS A CB    1 
ATOM   2419  C  CG    . HIS A  1  309 ? 89.705  -55.025  -12.175 1.00 50.73  ? 309  HIS A CG    1 
ATOM   2420  N  ND1   . HIS A  1  309 ? 89.850  -56.283  -12.719 1.00 47.55  ? 309  HIS A ND1   1 
ATOM   2421  C  CD2   . HIS A  1  309 ? 88.789  -54.387  -12.939 1.00 47.66  ? 309  HIS A CD2   1 
ATOM   2422  C  CE1   . HIS A  1  309 ? 89.050  -56.403  -13.762 1.00 47.50  ? 309  HIS A CE1   1 
ATOM   2423  N  NE2   . HIS A  1  309 ? 88.398  -55.265  -13.918 1.00 51.40  ? 309  HIS A NE2   1 
ATOM   2424  N  N     . MET A  1  310 ? 93.705  -53.465  -9.822  1.00 43.63  ? 310  MET A N     1 
ATOM   2425  C  CA    . MET A  1  310 ? 94.265  -52.898  -8.598  1.00 49.40  ? 310  MET A CA    1 
ATOM   2426  C  C     . MET A  1  310 ? 94.558  -51.409  -8.725  1.00 44.94  ? 310  MET A C     1 
ATOM   2427  O  O     . MET A  1  310 ? 94.461  -50.678  -7.733  1.00 46.50  ? 310  MET A O     1 
ATOM   2428  C  CB    . MET A  1  310 ? 95.540  -53.647  -8.196  1.00 45.28  ? 310  MET A CB    1 
ATOM   2429  C  CG    . MET A  1  310 ? 96.269  -53.034  -7.000  1.00 45.11  ? 310  MET A CG    1 
ATOM   2430  S  SD    . MET A  1  310 ? 97.532  -54.084  -6.256  1.00 47.97  ? 310  MET A SD    1 
ATOM   2431  C  CE    . MET A  1  310 ? 98.087  -54.951  -7.703  1.00 49.55  ? 310  MET A CE    1 
ATOM   2432  N  N     . TYR A  1  311 ? 94.888  -50.938  -9.923  1.00 42.33  ? 311  TYR A N     1 
ATOM   2433  C  CA    . TYR A  1  311 ? 95.480  -49.622  -10.101 1.00 44.24  ? 311  TYR A CA    1 
ATOM   2434  C  C     . TYR A  1  311 ? 94.464  -48.601  -10.604 1.00 47.52  ? 311  TYR A C     1 
ATOM   2435  O  O     . TYR A  1  311 ? 93.589  -48.913  -11.417 1.00 47.94  ? 311  TYR A O     1 
ATOM   2436  C  CB    . TYR A  1  311 ? 96.674  -49.717  -11.049 1.00 41.53  ? 311  TYR A CB    1 
ATOM   2437  C  CG    . TYR A  1  311 ? 97.715  -50.688  -10.533 1.00 42.46  ? 311  TYR A CG    1 
ATOM   2438  C  CD1   . TYR A  1  311 ? 98.371  -50.457  -9.330  1.00 41.32  ? 311  TYR A CD1   1 
ATOM   2439  C  CD2   . TYR A  1  311 ? 98.025  -51.843  -11.232 1.00 40.39  ? 311  TYR A CD2   1 
ATOM   2440  C  CE1   . TYR A  1  311 ? 99.310  -51.347  -8.846  1.00 40.48  ? 311  TYR A CE1   1 
ATOM   2441  C  CE2   . TYR A  1  311 ? 98.956  -52.734  -10.757 1.00 39.61  ? 311  TYR A CE2   1 
ATOM   2442  C  CZ    . TYR A  1  311 ? 99.604  -52.485  -9.569  1.00 41.72  ? 311  TYR A CZ    1 
ATOM   2443  O  OH    . TYR A  1  311 ? 100.544 -53.388  -9.103  1.00 39.65  ? 311  TYR A OH    1 
ATOM   2444  N  N     . ARG A  1  312 ? 94.593  -47.378  -10.103 1.00 42.15  ? 312  ARG A N     1 
ATOM   2445  C  CA    . ARG A  1  312 ? 93.671  -46.306  -10.430 1.00 45.23  ? 312  ARG A CA    1 
ATOM   2446  C  C     . ARG A  1  312 ? 93.998  -45.709  -11.791 1.00 55.04  ? 312  ARG A C     1 
ATOM   2447  O  O     . ARG A  1  312 ? 95.167  -45.491  -12.126 1.00 52.70  ? 312  ARG A O     1 
ATOM   2448  C  CB    . ARG A  1  312 ? 93.733  -45.219  -9.358  1.00 43.97  ? 312  ARG A CB    1 
ATOM   2449  C  CG    . ARG A  1  312 ? 92.820  -44.033  -9.603  1.00 47.06  ? 312  ARG A CG    1 
ATOM   2450  C  CD    . ARG A  1  312 ? 93.130  -42.930  -8.614  1.00 53.60  ? 312  ARG A CD    1 
ATOM   2451  N  NE    . ARG A  1  312 ? 93.114  -43.428  -7.243  1.00 68.08  ? 312  ARG A NE    1 
ATOM   2452  C  CZ    . ARG A  1  312 ? 93.867  -42.938  -6.264  1.00 75.45  ? 312  ARG A CZ    1 
ATOM   2453  N  NH1   . ARG A  1  312 ? 94.707  -41.942  -6.508  1.00 78.79  ? 312  ARG A NH1   1 
ATOM   2454  N  NH2   . ARG A  1  312 ? 93.790  -43.451  -5.044  1.00 76.04  ? 312  ARG A NH2   1 
ATOM   2455  N  N     . THR A  1  313 ? 92.954  -45.445  -12.578 1.00 59.11  ? 313  THR A N     1 
ATOM   2456  C  CA    . THR A  1  313 ? 93.119  -44.770  -13.859 1.00 50.48  ? 313  THR A CA    1 
ATOM   2457  C  C     . THR A  1  313 ? 92.180  -43.573  -13.956 1.00 53.18  ? 313  THR A C     1 
ATOM   2458  O  O     . THR A  1  313 ? 92.508  -42.486  -13.470 1.00 56.45  ? 313  THR A O     1 
ATOM   2459  C  CB    . THR A  1  313 ? 92.879  -45.735  -15.022 1.00 46.18  ? 313  THR A CB    1 
ATOM   2460  O  OG1   . THR A  1  313 ? 91.535  -46.224  -14.972 1.00 51.76  ? 313  THR A OG1   1 
ATOM   2461  C  CG2   . THR A  1  313 ? 93.846  -46.911  -14.953 1.00 43.82  ? 313  THR A CG2   1 
ATOM   2462  N  N     . ASN A  1  314 ? 91.007  -43.757  -14.564 1.00 52.68  ? 314  ASN A N     1 
ATOM   2463  C  CA    . ASN A  1  314 ? 90.093  -42.655  -14.839 1.00 58.26  ? 314  ASN A CA    1 
ATOM   2464  C  C     . ASN A  1  314 ? 88.869  -42.647  -13.935 1.00 60.97  ? 314  ASN A C     1 
ATOM   2465  O  O     . ASN A  1  314 ? 87.908  -41.921  -14.221 1.00 57.11  ? 314  ASN A O     1 
ATOM   2466  C  CB    . ASN A  1  314 ? 89.638  -42.694  -16.299 1.00 55.53  ? 314  ASN A CB    1 
ATOM   2467  C  CG    . ASN A  1  314 ? 90.777  -42.495  -17.268 1.00 56.87  ? 314  ASN A CG    1 
ATOM   2468  O  OD1   . ASN A  1  314 ? 91.832  -41.978  -16.903 1.00 54.81  ? 314  ASN A OD1   1 
ATOM   2469  N  ND2   . ASN A  1  314 ? 90.568  -42.894  -18.517 1.00 54.92  ? 314  ASN A ND2   1 
ATOM   2470  N  N     . TRP A  1  315 ? 88.868  -43.424  -12.851 1.00 61.13  ? 315  TRP A N     1 
ATOM   2471  C  CA    . TRP A  1  315 ? 87.611  -43.605  -12.134 1.00 60.07  ? 315  TRP A CA    1 
ATOM   2472  C  C     . TRP A  1  315 ? 87.758  -43.616  -10.614 1.00 58.41  ? 315  TRP A C     1 
ATOM   2473  O  O     . TRP A  1  315 ? 86.836  -44.056  -9.918  1.00 53.90  ? 315  TRP A O     1 
ATOM   2474  C  CB    . TRP A  1  315 ? 86.932  -44.879  -12.641 1.00 54.13  ? 315  TRP A CB    1 
ATOM   2475  C  CG    . TRP A  1  315 ? 86.414  -44.689  -14.039 1.00 56.76  ? 315  TRP A CG    1 
ATOM   2476  C  CD1   . TRP A  1  315 ? 85.288  -44.009  -14.409 1.00 56.13  ? 315  TRP A CD1   1 
ATOM   2477  C  CD2   . TRP A  1  315 ? 87.026  -45.138  -15.254 1.00 54.64  ? 315  TRP A CD2   1 
ATOM   2478  N  NE1   . TRP A  1  315 ? 85.151  -44.025  -15.773 1.00 56.61  ? 315  TRP A NE1   1 
ATOM   2479  C  CE2   . TRP A  1  315 ? 86.207  -44.707  -16.317 1.00 55.72  ? 315  TRP A CE2   1 
ATOM   2480  C  CE3   . TRP A  1  315 ? 88.182  -45.864  -15.547 1.00 57.53  ? 315  TRP A CE3   1 
ATOM   2481  C  CZ2   . TRP A  1  315 ? 86.506  -44.985  -17.648 1.00 57.65  ? 315  TRP A CZ2   1 
ATOM   2482  C  CZ3   . TRP A  1  315 ? 88.476  -46.138  -16.869 1.00 55.14  ? 315  TRP A CZ3   1 
ATOM   2483  C  CH2   . TRP A  1  315 ? 87.644  -45.698  -17.902 1.00 57.17  ? 315  TRP A CH2   1 
ATOM   2484  N  N     . GLY A  1  316 ? 88.875  -43.123  -10.078 1.00 53.27  ? 316  GLY A N     1 
ATOM   2485  C  CA    . GLY A  1  316 ? 89.022  -42.959  -8.645  1.00 48.71  ? 316  GLY A CA    1 
ATOM   2486  C  C     . GLY A  1  316 ? 89.271  -44.236  -7.868  1.00 58.41  ? 316  GLY A C     1 
ATOM   2487  O  O     . GLY A  1  316 ? 90.078  -44.252  -6.933  1.00 65.40  ? 316  GLY A O     1 
ATOM   2488  N  N     . ILE A  1  317 ? 88.561  -45.309  -8.223  1.00 48.58  ? 317  ILE A N     1 
ATOM   2489  C  CA    . ILE A  1  317 ? 88.868  -46.613  -7.659  1.00 50.16  ? 317  ILE A CA    1 
ATOM   2490  C  C     . ILE A  1  317 ? 90.263  -47.027  -8.103  1.00 53.74  ? 317  ILE A C     1 
ATOM   2491  O  O     . ILE A  1  317 ? 90.748  -46.625  -9.168  1.00 55.49  ? 317  ILE A O     1 
ATOM   2492  C  CB    . ILE A  1  317 ? 87.831  -47.661  -8.093  1.00 57.31  ? 317  ILE A CB    1 
ATOM   2493  C  CG1   . ILE A  1  317 ? 87.858  -47.808  -9.617  1.00 58.58  ? 317  ILE A CG1   1 
ATOM   2494  C  CG2   . ILE A  1  317 ? 86.450  -47.272  -7.599  1.00 56.24  ? 317  ILE A CG2   1 
ATOM   2495  C  CD1   . ILE A  1  317 ? 87.007  -48.920  -10.163 1.00 54.83  ? 317  ILE A CD1   1 
ATOM   2496  N  N     . GLY A  1  318 ? 90.914  -47.839  -7.285  1.00 47.84  ? 318  GLY A N     1 
ATOM   2497  C  CA    . GLY A  1  318 ? 92.230  -48.354  -7.604  1.00 45.00  ? 318  GLY A CA    1 
ATOM   2498  C  C     . GLY A  1  318 ? 93.320  -47.676  -6.790  1.00 50.83  ? 318  GLY A C     1 
ATOM   2499  O  O     . GLY A  1  318 ? 93.077  -46.797  -5.961  1.00 52.31  ? 318  GLY A O     1 
ATOM   2500  N  N     . HIS A  1  319 ? 94.544  -48.108  -7.069  1.00 41.64  ? 319  HIS A N     1 
ATOM   2501  C  CA    . HIS A  1  319 ? 95.724  -47.709  -6.323  1.00 44.09  ? 319  HIS A CA    1 
ATOM   2502  C  C     . HIS A  1  319 ? 96.611  -46.795  -7.152  1.00 47.17  ? 319  HIS A C     1 
ATOM   2503  O  O     . HIS A  1  319 ? 96.743  -46.971  -8.367  1.00 49.01  ? 319  HIS A O     1 
ATOM   2504  C  CB    . HIS A  1  319 ? 96.544  -48.930  -5.903  1.00 52.19  ? 319  HIS A CB    1 
ATOM   2505  C  CG    . HIS A  1  319 ? 96.156  -49.489  -4.574  1.00 50.43  ? 319  HIS A CG    1 
ATOM   2506  N  ND1   . HIS A  1  319 ? 95.367  -50.611  -4.439  1.00 45.36  ? 319  HIS A ND1   1 
ATOM   2507  C  CD2   . HIS A  1  319 ? 96.450  -49.080  -3.318  1.00 50.93  ? 319  HIS A CD2   1 
ATOM   2508  C  CE1   . HIS A  1  319 ? 95.196  -50.867  -3.155  1.00 43.63  ? 319  HIS A CE1   1 
ATOM   2509  N  NE2   . HIS A  1  319 ? 95.841  -49.954  -2.454  1.00 46.56  ? 319  HIS A NE2   1 
ATOM   2510  N  N     . SER A  1  320 ? 97.229  -45.834  -6.483  1.00 40.29  ? 320  SER A N     1 
ATOM   2511  C  CA    . SER A  1  320 ? 98.396  -45.160  -7.022  1.00 39.77  ? 320  SER A CA    1 
ATOM   2512  C  C     . SER A  1  320 ? 99.629  -45.936  -6.577  1.00 43.30  ? 320  SER A C     1 
ATOM   2513  O  O     . SER A  1  320 ? 99.849  -46.118  -5.376  1.00 46.02  ? 320  SER A O     1 
ATOM   2514  C  CB    . SER A  1  320 ? 98.465  -43.714  -6.543  1.00 40.05  ? 320  SER A CB    1 
ATOM   2515  O  OG    . SER A  1  320 ? 99.738  -43.171  -6.840  1.00 39.47  ? 320  SER A OG    1 
ATOM   2516  N  N     . MET A  1  321 ? 100.418 -46.416  -7.540  1.00 38.33  ? 321  MET A N     1 
ATOM   2517  C  CA    . MET A  1  321 ? 101.637 -47.134  -7.182  1.00 37.45  ? 321  MET A CA    1 
ATOM   2518  C  C     . MET A  1  321 ? 102.622 -46.229  -6.452  1.00 39.46  ? 321  MET A C     1 
ATOM   2519  O  O     . MET A  1  321 ? 103.370 -46.697  -5.586  1.00 46.30  ? 321  MET A O     1 
ATOM   2520  C  CB    . MET A  1  321 ? 102.277 -47.740  -8.430  1.00 37.12  ? 321  MET A CB    1 
ATOM   2521  C  CG    . MET A  1  321 ? 101.305 -48.569  -9.250  1.00 48.45  ? 321  MET A CG    1 
ATOM   2522  S  SD    . MET A  1  321 ? 102.019 -49.373  -10.695 1.00 44.34  ? 321  MET A SD    1 
ATOM   2523  C  CE    . MET A  1  321 ? 103.092 -50.573  -9.912  1.00 49.69  ? 321  MET A CE    1 
ATOM   2524  N  N     . LYS A  1  322 ? 102.628 -44.934  -6.775  1.00 37.38  ? 322  LYS A N     1 
ATOM   2525  C  CA    . LYS A  1  322 ? 103.468 -43.987  -6.048  1.00 37.12  ? 322  LYS A CA    1 
ATOM   2526  C  C     . LYS A  1  322 ? 103.126 -43.981  -4.562  1.00 40.61  ? 322  LYS A C     1 
ATOM   2527  O  O     . LYS A  1  322 ? 104.020 -44.028  -3.709  1.00 48.05  ? 322  LYS A O     1 
ATOM   2528  C  CB    . LYS A  1  322 ? 103.313 -42.589  -6.649  1.00 40.13  ? 322  LYS A CB    1 
ATOM   2529  C  CG    . LYS A  1  322 ? 104.230 -41.523  -6.063  1.00 37.45  ? 322  LYS A CG    1 
ATOM   2530  C  CD    . LYS A  1  322 ? 104.028 -40.196  -6.790  1.00 38.04  ? 322  LYS A CD    1 
ATOM   2531  C  CE    . LYS A  1  322 ? 105.018 -39.126  -6.352  1.00 37.88  ? 322  LYS A CE    1 
ATOM   2532  N  NZ    . LYS A  1  322 ? 104.812 -38.681  -4.945  1.00 46.53  ? 322  LYS A NZ    1 
ATOM   2533  N  N     . GLU A  1  323 ? 101.829 -43.933  -4.233  1.00 45.83  ? 323  GLU A N     1 
ATOM   2534  C  CA    . GLU A  1  323 ? 101.407 -43.966  -2.833  1.00 46.50  ? 323  GLU A CA    1 
ATOM   2535  C  C     . GLU A  1  323 ? 101.858 -45.251  -2.146  1.00 44.34  ? 323  GLU A C     1 
ATOM   2536  O  O     . GLU A  1  323 ? 102.444 -45.213  -1.056  1.00 48.98  ? 323  GLU A O     1 
ATOM   2537  C  CB    . GLU A  1  323 ? 99.888  -43.832  -2.729  1.00 42.10  ? 323  GLU A CB    1 
ATOM   2538  C  CG    . GLU A  1  323 ? 99.327  -42.448  -2.955  1.00 51.75  ? 323  GLU A CG    1 
ATOM   2539  C  CD    . GLU A  1  323 ? 97.829  -42.398  -2.696  1.00 71.93  ? 323  GLU A CD    1 
ATOM   2540  O  OE1   . GLU A  1  323 ? 97.374  -43.038  -1.722  1.00 77.45  ? 323  GLU A OE1   1 
ATOM   2541  O  OE2   . GLU A  1  323 ? 97.106  -41.734  -3.471  1.00 74.83  ? 323  GLU A OE2   1 
ATOM   2542  N  N     . ILE A  1  324 ? 101.566 -46.402  -2.758  1.00 39.79  ? 324  ILE A N     1 
ATOM   2543  C  CA    . ILE A  1  324 ? 101.958 -47.680  -2.167  1.00 43.02  ? 324  ILE A CA    1 
ATOM   2544  C  C     . ILE A  1  324 ? 103.451 -47.685  -1.883  1.00 43.19  ? 324  ILE A C     1 
ATOM   2545  O  O     . ILE A  1  324 ? 103.888 -47.961  -0.759  1.00 40.71  ? 324  ILE A O     1 
ATOM   2546  C  CB    . ILE A  1  324 ? 101.569 -48.850  -3.089  1.00 44.14  ? 324  ILE A CB    1 
ATOM   2547  C  CG1   . ILE A  1  324 ? 100.090 -48.791  -3.456  1.00 37.77  ? 324  ILE A CG1   1 
ATOM   2548  C  CG2   . ILE A  1  324 ? 101.897 -50.180  -2.422  1.00 44.79  ? 324  ILE A CG2   1 
ATOM   2549  C  CD1   . ILE A  1  324 ? 99.657  -49.931  -4.336  1.00 37.85  ? 324  ILE A CD1   1 
ATOM   2550  N  N     . LEU A  1  325 ? 104.253 -47.363  -2.902  1.00 39.38  ? 325  LEU A N     1 
ATOM   2551  C  CA    . LEU A  1  325 ? 105.701 -47.360  -2.738  1.00 42.15  ? 325  LEU A CA    1 
ATOM   2552  C  C     . LEU A  1  325 ? 106.116 -46.450  -1.591  1.00 44.72  ? 325  LEU A C     1 
ATOM   2553  O  O     . LEU A  1  325 ? 106.888 -46.855  -0.712  1.00 41.49  ? 325  LEU A O     1 
ATOM   2554  C  CB    . LEU A  1  325 ? 106.378 -46.941  -4.045  1.00 35.67  ? 325  LEU A CB    1 
ATOM   2555  C  CG    . LEU A  1  325 ? 106.376 -47.980  -5.175  1.00 34.68  ? 325  LEU A CG    1 
ATOM   2556  C  CD1   . LEU A  1  325 ? 106.472 -47.309  -6.541  1.00 34.89  ? 325  LEU A CD1   1 
ATOM   2557  C  CD2   . LEU A  1  325 ? 107.506 -48.981  -5.001  1.00 33.95  ? 325  LEU A CD2   1 
ATOM   2558  N  N     . GLU A  1  326 ? 105.574 -45.228  -1.555  1.00 35.73  ? 326  GLU A N     1 
ATOM   2559  C  CA    . GLU A  1  326 ? 105.968 -44.274  -0.524  1.00 35.82  ? 326  GLU A CA    1 
ATOM   2560  C  C     . GLU A  1  326 ? 105.565 -44.731  0.871   1.00 42.00  ? 326  GLU A C     1 
ATOM   2561  O  O     . GLU A  1  326 ? 106.199 -44.335  1.855   1.00 43.57  ? 326  GLU A O     1 
ATOM   2562  C  CB    . GLU A  1  326 ? 105.369 -42.905  -0.827  1.00 36.47  ? 326  GLU A CB    1 
ATOM   2563  C  CG    . GLU A  1  326 ? 106.148 -42.135  -1.870  1.00 36.31  ? 326  GLU A CG    1 
ATOM   2564  C  CD    . GLU A  1  326 ? 105.460 -40.861  -2.303  1.00 39.66  ? 326  GLU A CD    1 
ATOM   2565  O  OE1   . GLU A  1  326 ? 104.320 -40.607  -1.857  1.00 47.97  ? 326  GLU A OE1   1 
ATOM   2566  O  OE2   . GLU A  1  326 ? 106.067 -40.118  -3.098  1.00 38.27  ? 326  GLU A OE2   1 
ATOM   2567  N  N     . ALA A  1  327 ? 104.528 -45.559  0.982   1.00 49.90  ? 327  ALA A N     1 
ATOM   2568  C  CA    . ALA A  1  327 ? 104.102 -46.028  2.293   1.00 36.38  ? 327  ALA A CA    1 
ATOM   2569  C  C     . ALA A  1  327 ? 105.018 -47.103  2.873   1.00 41.76  ? 327  ALA A C     1 
ATOM   2570  O  O     . ALA A  1  327 ? 104.946 -47.369  4.078   1.00 43.04  ? 327  ALA A O     1 
ATOM   2571  C  CB    . ALA A  1  327 ? 102.670 -46.557  2.218   1.00 42.91  ? 327  ALA A CB    1 
ATOM   2572  N  N     . HIS A  1  328 ? 105.882 -47.715  2.063   1.00 35.30  ? 328  HIS A N     1 
ATOM   2573  C  CA    . HIS A  1  328 ? 106.698 -48.848  2.503   1.00 34.74  ? 328  HIS A CA    1 
ATOM   2574  C  C     . HIS A  1  328 ? 108.100 -48.350  2.844   1.00 46.81  ? 328  HIS A C     1 
ATOM   2575  O  O     . HIS A  1  328 ? 108.997 -48.298  1.999   1.00 33.77  ? 328  HIS A O     1 
ATOM   2576  C  CB    . HIS A  1  328 ? 106.707 -49.944  1.446   1.00 34.43  ? 328  HIS A CB    1 
ATOM   2577  C  CG    . HIS A  1  328 ? 105.367 -50.583  1.243   1.00 36.61  ? 328  HIS A CG    1 
ATOM   2578  N  ND1   . HIS A  1  328 ? 104.248 -49.863  0.889   1.00 35.61  ? 328  HIS A ND1   1 
ATOM   2579  C  CD2   . HIS A  1  328 ? 104.962 -51.868  1.372   1.00 37.66  ? 328  HIS A CD2   1 
ATOM   2580  C  CE1   . HIS A  1  328 ? 103.213 -50.678  0.794   1.00 41.89  ? 328  HIS A CE1   1 
ATOM   2581  N  NE2   . HIS A  1  328 ? 103.621 -51.900  1.080   1.00 40.54  ? 328  HIS A NE2   1 
ATOM   2582  N  N     . LYS A  1  329 ? 108.275 -47.991  4.114   1.00 41.82  ? 329  LYS A N     1 
ATOM   2583  C  CA    . LYS A  1  329 ? 109.529 -47.509  4.666   1.00 36.73  ? 329  LYS A CA    1 
ATOM   2584  C  C     . LYS A  1  329 ? 109.590 -47.945  6.123   1.00 37.40  ? 329  LYS A C     1 
ATOM   2585  O  O     . LYS A  1  329 ? 108.566 -47.995  6.808   1.00 42.55  ? 329  LYS A O     1 
ATOM   2586  C  CB    . LYS A  1  329 ? 109.634 -45.985  4.555   1.00 40.69  ? 329  LYS A CB    1 
ATOM   2587  C  CG    . LYS A  1  329 ? 108.427 -45.267  5.129   1.00 40.99  ? 329  LYS A CG    1 
ATOM   2588  C  CD    . LYS A  1  329 ? 108.684 -43.791  5.328   1.00 43.98  ? 329  LYS A CD    1 
ATOM   2589  C  CE    . LYS A  1  329 ? 107.460 -43.111  5.916   1.00 48.86  ? 329  LYS A CE    1 
ATOM   2590  N  NZ    . LYS A  1  329 ? 107.762 -41.716  6.333   1.00 56.65  ? 329  LYS A NZ    1 
ATOM   2591  N  N     . GLY A  1  330 ? 110.793 -48.260  6.594   1.00 33.51  ? 330  GLY A N     1 
ATOM   2592  C  CA    . GLY A  1  330 ? 110.946 -48.814  7.918   1.00 37.24  ? 330  GLY A CA    1 
ATOM   2593  C  C     . GLY A  1  330 ? 112.140 -48.286  8.688   1.00 49.30  ? 330  GLY A C     1 
ATOM   2594  O  O     . GLY A  1  330 ? 112.955 -47.508  8.179   1.00 46.05  ? 330  GLY A O     1 
ATOM   2595  N  N     . PRO A  1  331 ? 112.264 -48.716  9.946   1.00 49.91  ? 331  PRO A N     1 
ATOM   2596  C  CA    . PRO A  1  331 ? 113.370 -48.227  10.786  1.00 46.65  ? 331  PRO A CA    1 
ATOM   2597  C  C     . PRO A  1  331 ? 114.741 -48.614  10.265  1.00 47.52  ? 331  PRO A C     1 
ATOM   2598  O  O     . PRO A  1  331 ? 115.740 -48.021  10.694  1.00 41.98  ? 331  PRO A O     1 
ATOM   2599  C  CB    . PRO A  1  331 ? 113.090 -48.872  12.152  1.00 45.44  ? 331  PRO A CB    1 
ATOM   2600  C  CG    . PRO A  1  331 ? 111.657 -49.310  12.100  1.00 48.54  ? 331  PRO A CG    1 
ATOM   2601  C  CD    . PRO A  1  331 ? 111.385 -49.648  10.671  1.00 41.05  ? 331  PRO A CD    1 
ATOM   2602  N  N     . PHE A  1  332 ? 114.823 -49.582  9.353   1.00 36.07  ? 332  PHE A N     1 
ATOM   2603  C  CA    . PHE A  1  332 ? 116.098 -50.051  8.835   1.00 36.59  ? 332  PHE A CA    1 
ATOM   2604  C  C     . PHE A  1  332 ? 116.482 -49.431  7.500   1.00 34.81  ? 332  PHE A C     1 
ATOM   2605  O  O     . PHE A  1  332 ? 117.619 -49.629  7.063   1.00 35.05  ? 332  PHE A O     1 
ATOM   2606  C  CB    . PHE A  1  332 ? 116.085 -51.576  8.654   1.00 34.82  ? 332  PHE A CB    1 
ATOM   2607  C  CG    . PHE A  1  332 ? 115.865 -52.352  9.917   1.00 36.28  ? 332  PHE A CG    1 
ATOM   2608  C  CD1   . PHE A  1  332 ? 116.928 -52.940  10.574  1.00 34.88  ? 332  PHE A CD1   1 
ATOM   2609  C  CD2   . PHE A  1  332 ? 114.591 -52.524  10.429  1.00 42.17  ? 332  PHE A CD2   1 
ATOM   2610  C  CE1   . PHE A  1  332 ? 116.732 -53.664  11.729  1.00 40.46  ? 332  PHE A CE1   1 
ATOM   2611  C  CE2   . PHE A  1  332 ? 114.389 -53.246  11.585  1.00 42.51  ? 332  PHE A CE2   1 
ATOM   2612  C  CZ    . PHE A  1  332 ? 115.463 -53.817  12.235  1.00 43.65  ? 332  PHE A CZ    1 
ATOM   2613  N  N     . THR A  1  333 ? 115.565 -48.709  6.831   1.00 32.60  ? 333  THR A N     1 
ATOM   2614  C  CA    . THR A  1  333 ? 115.728 -48.400  5.410   1.00 34.99  ? 333  THR A CA    1 
ATOM   2615  C  C     . THR A  1  333 ? 115.312 -46.972  5.060   1.00 40.72  ? 333  THR A C     1 
ATOM   2616  O  O     . THR A  1  333 ? 114.918 -46.703  3.919   1.00 32.75  ? 333  THR A O     1 
ATOM   2617  C  CB    . THR A  1  333 ? 114.935 -49.379  4.535   1.00 40.29  ? 333  THR A CB    1 
ATOM   2618  O  OG1   . THR A  1  333 ? 113.555 -49.379  4.933   1.00 39.30  ? 333  THR A OG1   1 
ATOM   2619  C  CG2   . THR A  1  333 ? 115.501 -50.791  4.645   1.00 31.85  ? 333  THR A CG2   1 
ATOM   2620  N  N     . GLY A  1  334 ? 115.389 -46.052  6.015   1.00 35.79  ? 334  GLY A N     1 
ATOM   2621  C  CA    . GLY A  1  334 ? 115.231 -44.641  5.694   1.00 36.27  ? 334  GLY A CA    1 
ATOM   2622  C  C     . GLY A  1  334 ? 113.882 -44.326  5.076   1.00 43.80  ? 334  GLY A C     1 
ATOM   2623  O  O     . GLY A  1  334 ? 112.824 -44.649  5.628   1.00 37.80  ? 334  GLY A O     1 
ATOM   2624  N  N     . GLU A  1  335 ? 113.918 -43.684  3.907   1.00 36.69  ? 335  GLU A N     1 
ATOM   2625  C  CA    . GLU A  1  335 ? 112.712 -43.287  3.190   1.00 38.07  ? 335  GLU A CA    1 
ATOM   2626  C  C     . GLU A  1  335 ? 112.095 -44.414  2.373   1.00 40.45  ? 335  GLU A C     1 
ATOM   2627  O  O     . GLU A  1  335 ? 111.024 -44.216  1.789   1.00 46.72  ? 335  GLU A O     1 
ATOM   2628  C  CB    . GLU A  1  335 ? 113.012 -42.103  2.271   1.00 40.54  ? 335  GLU A CB    1 
ATOM   2629  C  CG    . GLU A  1  335 ? 113.553 -40.893  2.996   1.00 51.43  ? 335  GLU A CG    1 
ATOM   2630  C  CD    . GLU A  1  335 ? 112.540 -40.293  3.943   1.00 60.57  ? 335  GLU A CD    1 
ATOM   2631  O  OE1   . GLU A  1  335 ? 111.330 -40.534  3.752   1.00 66.26  ? 335  GLU A OE1   1 
ATOM   2632  O  OE2   . GLU A  1  335 ? 112.951 -39.584  4.882   1.00 68.00  ? 335  GLU A OE2   1 
ATOM   2633  N  N     . GLY A  1  336 ? 112.738 -45.575  2.303   1.00 39.77  ? 336  GLY A N     1 
ATOM   2634  C  CA    . GLY A  1  336 ? 112.113 -46.703  1.632   1.00 42.93  ? 336  GLY A CA    1 
ATOM   2635  C  C     . GLY A  1  336 ? 112.038 -46.513  0.129   1.00 37.51  ? 336  GLY A C     1 
ATOM   2636  O  O     . GLY A  1  336 ? 112.991 -46.076  -0.525  1.00 37.09  ? 336  GLY A O     1 
ATOM   2637  N  N     . HIS A  1  337 ? 110.879 -46.845  -0.426  1.00 33.33  ? 337  HIS A N     1 
ATOM   2638  C  CA    . HIS A  1  337 ? 110.676 -46.877  -1.867  1.00 36.99  ? 337  HIS A CA    1 
ATOM   2639  C  C     . HIS A  1  337 ? 110.341 -45.514  -2.457  1.00 43.77  ? 337  HIS A C     1 
ATOM   2640  O  O     . HIS A  1  337 ? 109.938 -45.448  -3.623  1.00 46.12  ? 337  HIS A O     1 
ATOM   2641  C  CB    . HIS A  1  337 ? 109.574 -47.880  -2.206  1.00 33.20  ? 337  HIS A CB    1 
ATOM   2642  C  CG    . HIS A  1  337 ? 109.756 -49.210  -1.547  1.00 40.57  ? 337  HIS A CG    1 
ATOM   2643  N  ND1   . HIS A  1  337 ? 109.511 -49.413  -0.205  1.00 41.28  ? 337  HIS A ND1   1 
ATOM   2644  C  CD2   . HIS A  1  337 ? 110.172 -50.401  -2.038  1.00 41.03  ? 337  HIS A CD2   1 
ATOM   2645  C  CE1   . HIS A  1  337 ? 109.762 -50.673  0.100   1.00 41.43  ? 337  HIS A CE1   1 
ATOM   2646  N  NE2   . HIS A  1  337 ? 110.166 -51.293  -0.993  1.00 38.70  ? 337  HIS A NE2   1 
ATOM   2647  N  N     . LYS A  1  338 ? 110.488 -44.438  -1.687  1.00 39.26  ? 338  LYS A N     1 
ATOM   2648  C  CA    . LYS A  1  338 ? 110.323 -43.102  -2.239  1.00 38.53  ? 338  LYS A CA    1 
ATOM   2649  C  C     . LYS A  1  338 ? 111.324 -42.883  -3.369  1.00 39.13  ? 338  LYS A C     1 
ATOM   2650  O  O     . LYS A  1  338 ? 112.500 -43.236  -3.249  1.00 36.96  ? 338  LYS A O     1 
ATOM   2651  C  CB    . LYS A  1  338 ? 110.506 -42.055  -1.139  1.00 38.55  ? 338  LYS A CB    1 
ATOM   2652  C  CG    . LYS A  1  338 ? 110.712 -40.641  -1.647  1.00 44.40  ? 338  LYS A CG    1 
ATOM   2653  C  CD    . LYS A  1  338 ? 109.818 -39.656  -0.921  1.00 50.17  ? 338  LYS A CD    1 
ATOM   2654  C  CE    . LYS A  1  338 ? 110.228 -38.225  -1.225  1.00 61.78  ? 338  LYS A CE    1 
ATOM   2655  N  NZ    . LYS A  1  338 ? 111.580 -37.895  -0.671  1.00 67.38  ? 338  LYS A NZ    1 
ATOM   2656  N  N     . GLY A  1  339 ? 110.846 -42.323  -4.482  1.00 35.40  ? 339  GLY A N     1 
ATOM   2657  C  CA    . GLY A  1  339 ? 111.667 -42.116  -5.653  1.00 38.59  ? 339  GLY A CA    1 
ATOM   2658  C  C     . GLY A  1  339 ? 111.661 -43.255  -6.655  1.00 33.79  ? 339  GLY A C     1 
ATOM   2659  O  O     . GLY A  1  339 ? 112.069 -43.053  -7.804  1.00 33.84  ? 339  GLY A O     1 
ATOM   2660  N  N     . LEU A  1  340 ? 111.217 -44.446  -6.259  1.00 33.58  ? 340  LEU A N     1 
ATOM   2661  C  CA    . LEU A  1  340 ? 111.192 -45.563  -7.197  1.00 33.39  ? 340  LEU A CA    1 
ATOM   2662  C  C     . LEU A  1  340 ? 110.174 -45.333  -8.308  1.00 33.98  ? 340  LEU A C     1 
ATOM   2663  O  O     . LEU A  1  340 ? 110.433 -45.659  -9.471  1.00 36.76  ? 340  LEU A O     1 
ATOM   2664  C  CB    . LEU A  1  340 ? 110.896 -46.861  -6.451  1.00 33.11  ? 340  LEU A CB    1 
ATOM   2665  C  CG    . LEU A  1  340 ? 112.087 -47.752  -6.101  1.00 41.79  ? 340  LEU A CG    1 
ATOM   2666  C  CD1   . LEU A  1  340 ? 113.316 -46.954  -5.693  1.00 32.15  ? 340  LEU A CD1   1 
ATOM   2667  C  CD2   . LEU A  1  340 ? 111.672 -48.669  -4.979  1.00 53.27  ? 340  LEU A CD2   1 
ATOM   2668  N  N     . TYR A  1  341 ? 109.013 -44.768  -7.970  1.00 34.55  ? 341  TYR A N     1 
ATOM   2669  C  CA    . TYR A  1  341 ? 108.008 -44.478  -8.985  1.00 35.19  ? 341  TYR A CA    1 
ATOM   2670  C  C     . TYR A  1  341 ? 108.532 -43.490  -10.024 1.00 44.41  ? 341  TYR A C     1 
ATOM   2671  O  O     . TYR A  1  341 ? 108.237 -43.622  -11.216 1.00 45.15  ? 341  TYR A O     1 
ATOM   2672  C  CB    . TYR A  1  341 ? 106.735 -43.944  -8.327  1.00 35.80  ? 341  TYR A CB    1 
ATOM   2673  C  CG    . TYR A  1  341 ? 105.579 -43.795  -9.288  1.00 40.71  ? 341  TYR A CG    1 
ATOM   2674  C  CD1   . TYR A  1  341 ? 104.813 -44.897  -9.658  1.00 36.66  ? 341  TYR A CD1   1 
ATOM   2675  C  CD2   . TYR A  1  341 ? 105.254 -42.560  -9.830  1.00 37.12  ? 341  TYR A CD2   1 
ATOM   2676  C  CE1   . TYR A  1  341 ? 103.757 -44.772  -10.540 1.00 37.82  ? 341  TYR A CE1   1 
ATOM   2677  C  CE2   . TYR A  1  341 ? 104.199 -42.426  -10.715 1.00 37.83  ? 341  TYR A CE2   1 
ATOM   2678  C  CZ    . TYR A  1  341 ? 103.453 -43.537  -11.067 1.00 43.21  ? 341  TYR A CZ    1 
ATOM   2679  O  OH    . TYR A  1  341 ? 102.396 -43.418  -11.946 1.00 38.72  ? 341  TYR A OH    1 
ATOM   2680  N  N     . GLU A  1  342 ? 109.316 -42.495  -9.594  1.00 43.14  ? 342  GLU A N     1 
ATOM   2681  C  CA    . GLU A  1  342 ? 109.868 -41.537  -10.549 1.00 35.56  ? 342  GLU A CA    1 
ATOM   2682  C  C     . GLU A  1  342 ? 110.969 -42.166  -11.395 1.00 35.12  ? 342  GLU A C     1 
ATOM   2683  O  O     . GLU A  1  342 ? 111.088 -41.866  -12.589 1.00 40.06  ? 342  GLU A O     1 
ATOM   2684  C  CB    . GLU A  1  342 ? 110.397 -40.301  -9.823  1.00 35.63  ? 342  GLU A CB    1 
ATOM   2685  C  CG    . GLU A  1  342 ? 109.319 -39.404  -9.245  1.00 36.26  ? 342  GLU A CG    1 
ATOM   2686  C  CD    . GLU A  1  342 ? 108.847 -39.862  -7.880  1.00 42.18  ? 342  GLU A CD    1 
ATOM   2687  O  OE1   . GLU A  1  342 ? 109.291 -40.936  -7.415  1.00 36.96  ? 342  GLU A OE1   1 
ATOM   2688  O  OE2   . GLU A  1  342 ? 108.034 -39.139  -7.270  1.00 42.25  ? 342  GLU A OE2   1 
ATOM   2689  N  N     . ILE A  1  343 ? 111.788 -43.031  -10.791 1.00 34.44  ? 343  ILE A N     1 
ATOM   2690  C  CA    . ILE A  1  343 ? 112.819 -43.744  -11.542 1.00 34.03  ? 343  ILE A CA    1 
ATOM   2691  C  C     . ILE A  1  343 ? 112.186 -44.611  -12.625 1.00 41.46  ? 343  ILE A C     1 
ATOM   2692  O  O     . ILE A  1  343 ? 112.524 -44.505  -13.809 1.00 41.16  ? 343  ILE A O     1 
ATOM   2693  C  CB    . ILE A  1  343 ? 113.688 -44.587  -10.591 1.00 35.25  ? 343  ILE A CB    1 
ATOM   2694  C  CG1   . ILE A  1  343 ? 114.643 -43.695  -9.796  1.00 35.44  ? 343  ILE A CG1   1 
ATOM   2695  C  CG2   . ILE A  1  343 ? 114.445 -45.663  -11.361 1.00 34.12  ? 343  ILE A CG2   1 
ATOM   2696  C  CD1   . ILE A  1  343 ? 115.536 -44.463  -8.850  1.00 32.47  ? 343  ILE A CD1   1 
ATOM   2697  N  N     . LEU A  1  344 ? 111.253 -45.478  -12.234 1.00 34.82  ? 344  LEU A N     1 
ATOM   2698  C  CA    . LEU A  1  344 ? 110.662 -46.447  -13.148 1.00 39.70  ? 344  LEU A CA    1 
ATOM   2699  C  C     . LEU A  1  344 ? 109.618 -45.838  -14.074 1.00 40.59  ? 344  LEU A C     1 
ATOM   2700  O  O     . LEU A  1  344 ? 108.988 -46.572  -14.842 1.00 42.14  ? 344  LEU A O     1 
ATOM   2701  C  CB    . LEU A  1  344 ? 110.044 -47.598  -12.354 1.00 34.24  ? 344  LEU A CB    1 
ATOM   2702  C  CG    . LEU A  1  344 ? 111.057 -48.421  -11.564 1.00 33.50  ? 344  LEU A CG    1 
ATOM   2703  C  CD1   . LEU A  1  344 ? 110.365 -49.392  -10.636 1.00 33.38  ? 344  LEU A CD1   1 
ATOM   2704  C  CD2   . LEU A  1  344 ? 111.965 -49.151  -12.538 1.00 33.23  ? 344  LEU A CD2   1 
ATOM   2705  N  N     . THR A  1  345 ? 109.410 -44.527  -14.016 1.00 40.49  ? 345  THR A N     1 
ATOM   2706  C  CA    . THR A  1  345 ? 108.526 -43.855  -14.950 1.00 36.46  ? 345  THR A CA    1 
ATOM   2707  C  C     . THR A  1  345 ? 109.254 -42.782  -15.751 1.00 38.38  ? 345  THR A C     1 
ATOM   2708  O  O     . THR A  1  345 ? 108.626 -42.098  -16.568 1.00 37.44  ? 345  THR A O     1 
ATOM   2709  C  CB    . THR A  1  345 ? 107.312 -43.273  -14.201 1.00 36.93  ? 345  THR A CB    1 
ATOM   2710  O  OG1   . THR A  1  345 ? 106.156 -43.338  -15.041 1.00 50.12  ? 345  THR A OG1   1 
ATOM   2711  C  CG2   . THR A  1  345 ? 107.548 -41.830  -13.751 1.00 37.15  ? 345  THR A CG2   1 
ATOM   2712  N  N     . THR A  1  346 ? 110.568 -42.636  -15.560 1.00 36.20  ? 346  THR A N     1 
ATOM   2713  C  CA    . THR A  1  346 ? 111.384 -41.790  -16.417 1.00 36.43  ? 346  THR A CA    1 
ATOM   2714  C  C     . THR A  1  346 ? 112.606 -42.489  -17.000 1.00 35.99  ? 346  THR A C     1 
ATOM   2715  O  O     . THR A  1  346 ? 113.234 -41.926  -17.903 1.00 42.07  ? 346  THR A O     1 
ATOM   2716  C  CB    . THR A  1  346 ? 111.851 -40.535  -15.662 1.00 36.45  ? 346  THR A CB    1 
ATOM   2717  O  OG1   . THR A  1  346 ? 112.540 -40.912  -14.461 1.00 35.73  ? 346  THR A OG1   1 
ATOM   2718  C  CG2   . THR A  1  346 ? 110.665 -39.645  -15.321 1.00 37.07  ? 346  THR A CG2   1 
ATOM   2719  N  N     . SER A  1  347 ? 112.961 -43.686  -16.533 1.00 35.35  ? 347  SER A N     1 
ATOM   2720  C  CA    . SER A  1  347 ? 114.168 -44.375  -16.979 1.00 34.92  ? 347  SER A CA    1 
ATOM   2721  C  C     . SER A  1  347 ? 113.788 -45.667  -17.688 1.00 49.04  ? 347  SER A C     1 
ATOM   2722  O  O     . SER A  1  347 ? 113.296 -46.606  -17.055 1.00 36.80  ? 347  SER A O     1 
ATOM   2723  C  CB    . SER A  1  347 ? 115.102 -44.672  -15.810 1.00 35.32  ? 347  SER A CB    1 
ATOM   2724  O  OG    . SER A  1  347 ? 116.138 -45.544  -16.226 1.00 35.72  ? 347  SER A OG    1 
ATOM   2725  N  N     . TRP A  1  348 ? 114.036 -45.717  -18.998 1.00 45.06  ? 348  TRP A N     1 
ATOM   2726  C  CA    . TRP A  1  348 ? 113.817 -46.948  -19.751 1.00 35.79  ? 348  TRP A CA    1 
ATOM   2727  C  C     . TRP A  1  348 ? 114.773 -48.053  -19.307 1.00 41.56  ? 348  TRP A C     1 
ATOM   2728  O  O     . TRP A  1  348 ? 114.394 -49.231  -19.264 1.00 42.93  ? 348  TRP A O     1 
ATOM   2729  C  CB    . TRP A  1  348 ? 113.974 -46.676  -21.245 1.00 36.02  ? 348  TRP A CB    1 
ATOM   2730  C  CG    . TRP A  1  348 ? 112.813 -45.974  -21.883 1.00 39.93  ? 348  TRP A CG    1 
ATOM   2731  C  CD1   . TRP A  1  348 ? 112.702 -44.638  -22.147 1.00 40.49  ? 348  TRP A CD1   1 
ATOM   2732  C  CD2   . TRP A  1  348 ? 111.602 -46.579  -22.357 1.00 41.27  ? 348  TRP A CD2   1 
ATOM   2733  N  NE1   . TRP A  1  348 ? 111.494 -44.374  -22.748 1.00 42.17  ? 348  TRP A NE1   1 
ATOM   2734  C  CE2   . TRP A  1  348 ? 110.801 -45.548  -22.889 1.00 43.77  ? 348  TRP A CE2   1 
ATOM   2735  C  CE3   . TRP A  1  348 ? 111.115 -47.890  -22.377 1.00 39.06  ? 348  TRP A CE3   1 
ATOM   2736  C  CZ2   . TRP A  1  348 ? 109.541 -45.789  -23.434 1.00 45.34  ? 348  TRP A CZ2   1 
ATOM   2737  C  CZ3   . TRP A  1  348 ? 109.863 -48.128  -22.921 1.00 43.93  ? 348  TRP A CZ3   1 
ATOM   2738  C  CH2   . TRP A  1  348 ? 109.091 -47.082  -23.442 1.00 46.99  ? 348  TRP A CH2   1 
ATOM   2739  N  N     . HIS A  1  349 ? 116.018 -47.698  -18.976 1.00 34.25  ? 349  HIS A N     1 
ATOM   2740  C  CA    . HIS A  1  349 ? 116.992 -48.720  -18.610 1.00 33.62  ? 349  HIS A CA    1 
ATOM   2741  C  C     . HIS A  1  349 ? 116.644 -49.387  -17.285 1.00 33.10  ? 349  HIS A C     1 
ATOM   2742  O  O     . HIS A  1  349 ? 116.890 -50.583  -17.121 1.00 40.43  ? 349  HIS A O     1 
ATOM   2743  C  CB    . HIS A  1  349 ? 118.397 -48.123  -18.554 1.00 33.39  ? 349  HIS A CB    1 
ATOM   2744  C  CG    . HIS A  1  349 ? 118.966 -47.791  -19.900 1.00 40.68  ? 349  HIS A CG    1 
ATOM   2745  N  ND1   . HIS A  1  349 ? 119.510 -48.745  -20.734 1.00 41.97  ? 349  HIS A ND1   1 
ATOM   2746  C  CD2   . HIS A  1  349 ? 119.072 -46.611  -20.557 1.00 35.37  ? 349  HIS A CD2   1 
ATOM   2747  C  CE1   . HIS A  1  349 ? 119.933 -48.166  -21.844 1.00 38.80  ? 349  HIS A CE1   1 
ATOM   2748  N  NE2   . HIS A  1  349 ? 119.679 -46.872  -21.761 1.00 37.14  ? 349  HIS A NE2   1 
ATOM   2749  N  N     . ALA A  1  350 ? 116.070 -48.644  -16.337 1.00 33.09  ? 350  ALA A N     1 
ATOM   2750  C  CA    . ALA A  1  350 ? 115.671 -49.242  -15.065 1.00 37.45  ? 350  ALA A CA    1 
ATOM   2751  C  C     . ALA A  1  350 ? 114.580 -50.291  -15.272 1.00 38.22  ? 350  ALA A C     1 
ATOM   2752  O  O     . ALA A  1  350 ? 114.658 -51.416  -14.745 1.00 38.10  ? 350  ALA A O     1 
ATOM   2753  C  CB    . ALA A  1  350 ? 115.197 -48.146  -14.112 1.00 33.56  ? 350  ALA A CB    1 
ATOM   2754  N  N     . GLN A  1  351 ? 113.546 -49.924  -16.034 1.00 33.50  ? 351  GLN A N     1 
ATOM   2755  C  CA    . GLN A  1  351 ? 112.498 -50.872  -16.394 1.00 33.79  ? 351  GLN A CA    1 
ATOM   2756  C  C     . GLN A  1  351 ? 113.079 -52.080  -17.114 1.00 33.89  ? 351  GLN A C     1 
ATOM   2757  O  O     . GLN A  1  351 ? 112.705 -53.221  -16.822 1.00 43.60  ? 351  GLN A O     1 
ATOM   2758  C  CB    . GLN A  1  351 ? 111.442 -50.177  -17.259 1.00 36.98  ? 351  GLN A CB    1 
ATOM   2759  C  CG    . GLN A  1  351 ? 110.475 -49.264  -16.496 1.00 34.86  ? 351  GLN A CG    1 
ATOM   2760  C  CD    . GLN A  1  351 ? 109.292 -50.022  -15.908 1.00 35.00  ? 351  GLN A CD    1 
ATOM   2761  O  OE1   . GLN A  1  351 ? 109.121 -51.212  -16.161 1.00 34.94  ? 351  GLN A OE1   1 
ATOM   2762  N  NE2   . GLN A  1  351 ? 108.470 -49.333  -15.124 1.00 35.24  ? 351  GLN A NE2   1 
ATOM   2763  N  N     . LEU A  1  352 ? 114.016 -51.852  -18.042 1.00 33.68  ? 352  LEU A N     1 
ATOM   2764  C  CA    . LEU A  1  352 ? 114.601 -52.960  -18.792 1.00 33.60  ? 352  LEU A CA    1 
ATOM   2765  C  C     . LEU A  1  352 ? 115.451 -53.861  -17.904 1.00 32.90  ? 352  LEU A C     1 
ATOM   2766  O  O     . LEU A  1  352 ? 115.480 -55.073  -18.115 1.00 32.82  ? 352  LEU A O     1 
ATOM   2767  C  CB    . LEU A  1  352 ? 115.429 -52.434  -19.968 1.00 33.89  ? 352  LEU A CB    1 
ATOM   2768  C  CG    . LEU A  1  352 ? 115.995 -53.510  -20.904 1.00 33.96  ? 352  LEU A CG    1 
ATOM   2769  C  CD1   . LEU A  1  352 ? 114.883 -54.389  -21.448 1.00 34.40  ? 352  LEU A CD1   1 
ATOM   2770  C  CD2   . LEU A  1  352 ? 116.808 -52.917  -22.044 1.00 34.32  ? 352  LEU A CD2   1 
ATOM   2771  N  N     . ALA A  1  353 ? 116.135 -53.305  -16.907 1.00 35.63  ? 353  ALA A N     1 
ATOM   2772  C  CA    . ALA A  1  353 ? 116.902 -54.142  -15.992 1.00 37.41  ? 353  ALA A CA    1 
ATOM   2773  C  C     . ALA A  1  353 ? 115.977 -55.042  -15.190 1.00 40.72  ? 353  ALA A C     1 
ATOM   2774  O  O     . ALA A  1  353 ? 116.187 -56.264  -15.115 1.00 41.21  ? 353  ALA A O     1 
ATOM   2775  C  CB    . ALA A  1  353 ? 117.751 -53.277  -15.062 1.00 36.96  ? 353  ALA A CB    1 
ATOM   2776  N  N     . ILE A  1  354 ? 114.936 -54.454  -14.589 1.00 34.44  ? 354  ILE A N     1 
ATOM   2777  C  CA    . ILE A  1  354 ? 113.955 -55.264  -13.866 1.00 35.55  ? 354  ILE A CA    1 
ATOM   2778  C  C     . ILE A  1  354 ? 113.418 -56.369  -14.767 1.00 34.48  ? 354  ILE A C     1 
ATOM   2779  O  O     . ILE A  1  354 ? 113.386 -57.553  -14.395 1.00 35.69  ? 354  ILE A O     1 
ATOM   2780  C  CB    . ILE A  1  354 ? 112.804 -54.388  -13.342 1.00 37.50  ? 354  ILE A CB    1 
ATOM   2781  C  CG1   . ILE A  1  354 ? 113.261 -53.484  -12.203 1.00 31.99  ? 354  ILE A CG1   1 
ATOM   2782  C  CG2   . ILE A  1  354 ? 111.647 -55.269  -12.897 1.00 34.09  ? 354  ILE A CG2   1 
ATOM   2783  C  CD1   . ILE A  1  354 ? 112.154 -52.597  -11.695 1.00 32.39  ? 354  ILE A CD1   1 
ATOM   2784  N  N     . ASN A  1  355 ? 112.998 -55.988  -15.976 1.00 34.64  ? 355  ASN A N     1 
ATOM   2785  C  CA    . ASN A  1  355 ? 112.254 -56.900  -16.836 1.00 33.27  ? 355  ASN A CA    1 
ATOM   2786  C  C     . ASN A  1  355 ? 113.153 -57.980  -17.413 1.00 33.07  ? 355  ASN A C     1 
ATOM   2787  O  O     . ASN A  1  355 ? 112.731 -59.130  -17.533 1.00 36.08  ? 355  ASN A O     1 
ATOM   2788  C  CB    . ASN A  1  355 ? 111.555 -56.112  -17.941 1.00 33.97  ? 355  ASN A CB    1 
ATOM   2789  C  CG    . ASN A  1  355 ? 110.514 -55.150  -17.397 1.00 41.38  ? 355  ASN A CG    1 
ATOM   2790  O  OD1   . ASN A  1  355 ? 110.031 -55.309  -16.273 1.00 36.75  ? 355  ASN A OD1   1 
ATOM   2791  N  ND2   . ASN A  1  355 ? 110.158 -54.147  -18.195 1.00 45.25  ? 355  ASN A ND2   1 
ATOM   2792  N  N     . LEU A  1  356 ? 114.398 -57.644  -17.755 1.00 32.80  ? 356  LEU A N     1 
ATOM   2793  C  CA    . LEU A  1  356 ? 115.361 -58.661  -18.161 1.00 43.87  ? 356  LEU A CA    1 
ATOM   2794  C  C     . LEU A  1  356 ? 115.619 -59.654  -17.033 1.00 32.07  ? 356  LEU A C     1 
ATOM   2795  O  O     . LEU A  1  356 ? 115.612 -60.870  -17.259 1.00 32.12  ? 356  LEU A O     1 
ATOM   2796  C  CB    . LEU A  1  356 ? 116.665 -58.005  -18.613 1.00 32.41  ? 356  LEU A CB    1 
ATOM   2797  C  CG    . LEU A  1  356 ? 116.663 -57.377  -20.006 1.00 32.99  ? 356  LEU A CG    1 
ATOM   2798  C  CD1   . LEU A  1  356 ? 117.958 -56.626  -20.251 1.00 32.81  ? 356  LEU A CD1   1 
ATOM   2799  C  CD2   . LEU A  1  356 ? 116.446 -58.439  -21.070 1.00 33.42  ? 356  LEU A CD2   1 
ATOM   2800  N  N     . ALA A  1  357 ? 115.839 -59.161  -15.808 1.00 31.63  ? 357  ALA A N     1 
ATOM   2801  C  CA    . ALA A  1  357 ? 116.085 -60.075  -14.691 1.00 52.04  ? 357  ALA A CA    1 
ATOM   2802  C  C     . ALA A  1  357 ? 114.923 -61.044  -14.513 1.00 34.08  ? 357  ALA A C     1 
ATOM   2803  O  O     . ALA A  1  357 ? 115.115 -62.268  -14.437 1.00 31.72  ? 357  ALA A O     1 
ATOM   2804  C  CB    . ALA A  1  357 ? 116.326 -59.289  -13.401 1.00 30.82  ? 357  ALA A CB    1 
ATOM   2805  N  N     . LEU A  1  358 ? 113.701 -60.509  -14.481 1.00 40.96  ? 358  LEU A N     1 
ATOM   2806  C  CA    . LEU A  1  358 ? 112.541 -61.356  -14.224 1.00 32.40  ? 358  LEU A CA    1 
ATOM   2807  C  C     . LEU A  1  358 ? 112.244 -62.274  -15.401 1.00 45.84  ? 358  LEU A C     1 
ATOM   2808  O  O     . LEU A  1  358 ? 111.866 -63.431  -15.201 1.00 56.73  ? 358  LEU A O     1 
ATOM   2809  C  CB    . LEU A  1  358 ? 111.323 -60.499  -13.888 1.00 33.27  ? 358  LEU A CB    1 
ATOM   2810  C  CG    . LEU A  1  358 ? 111.108 -60.268  -12.391 1.00 39.32  ? 358  LEU A CG    1 
ATOM   2811  C  CD1   . LEU A  1  358 ? 110.989 -61.598  -11.652 1.00 32.20  ? 358  LEU A CD1   1 
ATOM   2812  C  CD2   . LEU A  1  358 ? 112.225 -59.413  -11.799 1.00 35.38  ? 358  LEU A CD2   1 
ATOM   2813  N  N     . LEU A  1  359 ? 112.425 -61.793  -16.634 1.00 43.47  ? 359  LEU A N     1 
ATOM   2814  C  CA    . LEU A  1  359 ? 112.109 -62.614  -17.797 1.00 40.26  ? 359  LEU A CA    1 
ATOM   2815  C  C     . LEU A  1  359 ? 113.122 -63.740  -17.964 1.00 40.01  ? 359  LEU A C     1 
ATOM   2816  O  O     . LEU A  1  359 ? 112.755 -64.856  -18.351 1.00 41.58  ? 359  LEU A O     1 
ATOM   2817  C  CB    . LEU A  1  359 ? 112.043 -61.747  -19.057 1.00 33.95  ? 359  LEU A CB    1 
ATOM   2818  C  CG    . LEU A  1  359 ? 111.567 -62.472  -20.323 1.00 36.69  ? 359  LEU A CG    1 
ATOM   2819  C  CD1   . LEU A  1  359 ? 110.137 -62.977  -20.169 1.00 35.13  ? 359  LEU A CD1   1 
ATOM   2820  C  CD2   . LEU A  1  359 ? 111.695 -61.597  -21.560 1.00 35.09  ? 359  LEU A CD2   1 
ATOM   2821  N  N     . GLY A  1  360 ? 114.395 -63.478  -17.661 1.00 33.25  ? 360  GLY A N     1 
ATOM   2822  C  CA    . GLY A  1  360 ? 115.373 -64.554  -17.664 1.00 34.01  ? 360  GLY A CA    1 
ATOM   2823  C  C     . GLY A  1  360 ? 115.087 -65.583  -16.588 1.00 37.93  ? 360  GLY A C     1 
ATOM   2824  O  O     . GLY A  1  360 ? 115.120 -66.797  -16.843 1.00 51.91  ? 360  GLY A O     1 
ATOM   2825  N  N     . SER A  1  361 ? 114.798 -65.114  -15.367 1.00 35.57  ? 361  SER A N     1 
ATOM   2826  C  CA    . SER A  1  361 ? 114.438 -66.041  -14.298 1.00 37.89  ? 361  SER A CA    1 
ATOM   2827  C  C     . SER A  1  361 ? 113.219 -66.869  -14.684 1.00 36.89  ? 361  SER A C     1 
ATOM   2828  O  O     . SER A  1  361 ? 113.154 -68.070  -14.394 1.00 48.42  ? 361  SER A O     1 
ATOM   2829  C  CB    . SER A  1  361 ? 114.183 -65.274  -13.000 1.00 33.02  ? 361  SER A CB    1 
ATOM   2830  O  OG    . SER A  1  361 ? 115.318 -64.519  -12.619 1.00 36.31  ? 361  SER A OG    1 
ATOM   2831  N  N     . LEU A  1  362 ? 112.257 -66.247  -15.369 1.00 33.64  ? 362  LEU A N     1 
ATOM   2832  C  CA    . LEU A  1  362 ? 111.061 -66.958  -15.801 1.00 39.53  ? 362  LEU A CA    1 
ATOM   2833  C  C     . LEU A  1  362 ? 111.385 -67.995  -16.866 1.00 36.37  ? 362  LEU A C     1 
ATOM   2834  O  O     . LEU A  1  362 ? 110.835 -69.096  -16.847 1.00 43.87  ? 362  LEU A O     1 
ATOM   2835  C  CB    . LEU A  1  362 ? 110.018 -65.967  -16.319 1.00 45.62  ? 362  LEU A CB    1 
ATOM   2836  C  CG    . LEU A  1  362 ? 108.631 -66.555  -16.585 1.00 55.69  ? 362  LEU A CG    1 
ATOM   2837  C  CD1   . LEU A  1  362 ? 107.563 -65.666  -15.977 1.00 66.38  ? 362  LEU A CD1   1 
ATOM   2838  C  CD2   . LEU A  1  362 ? 108.393 -66.721  -18.068 1.00 60.37  ? 362  LEU A CD2   1 
ATOM   2839  N  N     . THR A  1  363 ? 112.258 -67.659  -17.815 1.00 35.12  ? 363  THR A N     1 
ATOM   2840  C  CA    . THR A  1  363 ? 112.625 -68.626  -18.844 1.00 43.37  ? 363  THR A CA    1 
ATOM   2841  C  C     . THR A  1  363 ? 113.296 -69.847  -18.225 1.00 50.93  ? 363  THR A C     1 
ATOM   2842  O  O     . THR A  1  363 ? 113.054 -70.994  -18.641 1.00 48.00  ? 363  THR A O     1 
ATOM   2843  C  CB    . THR A  1  363 ? 113.537 -67.955  -19.870 1.00 34.05  ? 363  THR A CB    1 
ATOM   2844  O  OG1   . THR A  1  363 ? 112.971 -66.694  -20.239 1.00 34.28  ? 363  THR A OG1   1 
ATOM   2845  C  CG2   . THR A  1  363 ? 113.673 -68.809  -21.109 1.00 34.59  ? 363  THR A CG2   1 
ATOM   2846  N  N     . ILE A  1  364 ? 114.122 -69.616  -17.203 1.00 42.25  ? 364  ILE A N     1 
ATOM   2847  C  CA    . ILE A  1  364 ? 114.739 -70.727  -16.481 1.00 35.07  ? 364  ILE A CA    1 
ATOM   2848  C  C     . ILE A  1  364 ? 113.674 -71.556  -15.766 1.00 35.54  ? 364  ILE A C     1 
ATOM   2849  O  O     . ILE A  1  364 ? 113.687 -72.797  -15.810 1.00 35.68  ? 364  ILE A O     1 
ATOM   2850  C  CB    . ILE A  1  364 ? 115.805 -70.192  -15.510 1.00 42.53  ? 364  ILE A CB    1 
ATOM   2851  C  CG1   . ILE A  1  364 ? 116.972 -69.599  -16.310 1.00 42.50  ? 364  ILE A CG1   1 
ATOM   2852  C  CG2   . ILE A  1  364 ? 116.258 -71.284  -14.556 1.00 37.93  ? 364  ILE A CG2   1 
ATOM   2853  C  CD1   . ILE A  1  364 ? 117.951 -68.799  -15.494 1.00 40.84  ? 364  ILE A CD1   1 
ATOM   2854  N  N     . ILE A  1  365 ? 112.737 -70.880  -15.094 1.00 33.54  ? 365  ILE A N     1 
ATOM   2855  C  CA    . ILE A  1  365 ? 111.631 -71.577  -14.440 1.00 34.63  ? 365  ILE A CA    1 
ATOM   2856  C  C     . ILE A  1  365 ? 110.850 -72.406  -15.455 1.00 37.47  ? 365  ILE A C     1 
ATOM   2857  O  O     . ILE A  1  365 ? 110.376 -73.506  -15.151 1.00 40.57  ? 365  ILE A O     1 
ATOM   2858  C  CB    . ILE A  1  365 ? 110.733 -70.559  -13.707 1.00 43.26  ? 365  ILE A CB    1 
ATOM   2859  C  CG1   . ILE A  1  365 ? 111.477 -69.984  -12.495 1.00 45.42  ? 365  ILE A CG1   1 
ATOM   2860  C  CG2   . ILE A  1  365 ? 109.383 -71.176  -13.321 1.00 34.48  ? 365  ILE A CG2   1 
ATOM   2861  C  CD1   . ILE A  1  365 ? 110.782 -68.817  -11.821 1.00 33.22  ? 365  ILE A CD1   1 
ATOM   2862  N  N     . VAL A  1  366 ? 110.726 -71.899  -16.681 1.00 41.38  ? 366  VAL A N     1 
ATOM   2863  C  CA    . VAL A  1  366 ? 110.009 -72.614  -17.733 1.00 42.35  ? 366  VAL A CA    1 
ATOM   2864  C  C     . VAL A  1  366 ? 110.731 -73.911  -18.077 1.00 40.43  ? 366  VAL A C     1 
ATOM   2865  O  O     . VAL A  1  366 ? 110.118 -74.981  -18.148 1.00 35.87  ? 366  VAL A O     1 
ATOM   2866  C  CB    . VAL A  1  366 ? 109.840 -71.708  -18.968 1.00 35.64  ? 366  VAL A CB    1 
ATOM   2867  C  CG1   . VAL A  1  366 ? 109.605 -72.536  -20.220 1.00 36.36  ? 366  VAL A CG1   1 
ATOM   2868  C  CG2   . VAL A  1  366 ? 108.696 -70.717  -18.752 1.00 35.90  ? 366  VAL A CG2   1 
ATOM   2869  N  N     . ALA A  1  367 ? 112.043 -73.831  -18.306 1.00 34.90  ? 367  ALA A N     1 
ATOM   2870  C  CA    . ALA A  1  367 ? 112.821 -75.047  -18.552 1.00 42.20  ? 367  ALA A CA    1 
ATOM   2871  C  C     . ALA A  1  367 ? 112.617 -76.067  -17.433 1.00 47.69  ? 367  ALA A C     1 
ATOM   2872  O  O     . ALA A  1  367 ? 112.298 -77.246  -17.678 1.00 60.62  ? 367  ALA A O     1 
ATOM   2873  C  CB    . ALA A  1  367 ? 114.303 -74.699  -18.694 1.00 34.39  ? 367  ALA A CB    1 
ATOM   2874  N  N     . GLN A  1  368 ? 112.771 -75.608  -16.188 1.00 42.67  ? 368  GLN A N     1 
ATOM   2875  C  CA    . GLN A  1  368 ? 112.719 -76.510  -15.042 1.00 41.01  ? 368  GLN A CA    1 
ATOM   2876  C  C     . GLN A  1  368 ? 111.336 -77.128  -14.864 1.00 41.96  ? 368  GLN A C     1 
ATOM   2877  O  O     . GLN A  1  368 ? 111.220 -78.293  -14.471 1.00 40.49  ? 368  GLN A O     1 
ATOM   2878  C  CB    . GLN A  1  368 ? 113.140 -75.759  -13.780 1.00 37.34  ? 368  GLN A CB    1 
ATOM   2879  C  CG    . GLN A  1  368 ? 114.620 -75.420  -13.739 1.00 36.55  ? 368  GLN A CG    1 
ATOM   2880  C  CD    . GLN A  1  368 ? 115.460 -76.540  -13.147 1.00 42.58  ? 368  GLN A CD    1 
ATOM   2881  O  OE1   . GLN A  1  368 ? 115.112 -77.719  -13.250 1.00 38.75  ? 368  GLN A OE1   1 
ATOM   2882  N  NE2   . GLN A  1  368 ? 116.566 -76.173  -12.511 1.00 32.18  ? 368  GLN A NE2   1 
ATOM   2883  N  N     . HIS A  1  369 ? 110.275 -76.367  -15.137 1.00 48.22  ? 369  HIS A N     1 
ATOM   2884  C  CA    . HIS A  1  369 ? 108.925 -76.887  -14.963 1.00 36.17  ? 369  HIS A CA    1 
ATOM   2885  C  C     . HIS A  1  369 ? 108.497 -77.776  -16.120 1.00 43.57  ? 369  HIS A C     1 
ATOM   2886  O  O     . HIS A  1  369 ? 107.741 -78.733  -15.916 1.00 40.99  ? 369  HIS A O     1 
ATOM   2887  C  CB    . HIS A  1  369 ? 107.938 -75.734  -14.801 1.00 39.49  ? 369  HIS A CB    1 
ATOM   2888  C  CG    . HIS A  1  369 ? 107.955 -75.116  -13.440 1.00 40.97  ? 369  HIS A CG    1 
ATOM   2889  N  ND1   . HIS A  1  369 ? 107.069 -74.132  -13.058 1.00 40.25  ? 369  HIS A ND1   1 
ATOM   2890  C  CD2   . HIS A  1  369 ? 108.750 -75.345  -12.369 1.00 35.90  ? 369  HIS A CD2   1 
ATOM   2891  C  CE1   . HIS A  1  369 ? 107.316 -73.782  -11.810 1.00 40.25  ? 369  HIS A CE1   1 
ATOM   2892  N  NE2   . HIS A  1  369 ? 108.332 -74.501  -11.370 1.00 34.88  ? 369  HIS A NE2   1 
ATOM   2893  N  N     . MET A  1  370 ? 108.969 -77.487  -17.332 1.00 39.98  ? 370  MET A N     1 
ATOM   2894  C  CA    . MET A  1  370 ? 108.556 -78.273  -18.483 1.00 43.08  ? 370  MET A CA    1 
ATOM   2895  C  C     . MET A  1  370 ? 109.262 -79.618  -18.550 1.00 47.61  ? 370  MET A C     1 
ATOM   2896  O  O     . MET A  1  370 ? 108.691 -80.572  -19.090 1.00 49.02  ? 370  MET A O     1 
ATOM   2897  C  CB    . MET A  1  370 ? 108.797 -77.492  -19.774 1.00 44.05  ? 370  MET A CB    1 
ATOM   2898  C  CG    . MET A  1  370 ? 107.894 -76.288  -19.938 1.00 43.52  ? 370  MET A CG    1 
ATOM   2899  S  SD    . MET A  1  370 ? 108.112 -75.487  -21.533 1.00 51.24  ? 370  MET A SD    1 
ATOM   2900  C  CE    . MET A  1  370 ? 107.542 -76.788  -22.624 1.00 42.35  ? 370  MET A CE    1 
ATOM   2901  N  N     . TYR A  1  371 ? 110.488 -79.736  -18.022 1.00 49.22  ? 371  TYR A N     1 
ATOM   2902  C  CA    . TYR A  1  371 ? 111.121 -81.054  -18.083 1.00 37.64  ? 371  TYR A CA    1 
ATOM   2903  C  C     . TYR A  1  371 ? 110.413 -82.057  -17.172 1.00 42.91  ? 371  TYR A C     1 
ATOM   2904  O  O     . TYR A  1  371 ? 110.163 -83.200  -17.575 1.00 39.17  ? 371  TYR A O     1 
ATOM   2905  C  CB    . TYR A  1  371 ? 112.616 -80.963  -17.756 1.00 42.41  ? 371  TYR A CB    1 
ATOM   2906  C  CG    . TYR A  1  371 ? 113.014 -81.247  -16.318 1.00 48.31  ? 371  TYR A CG    1 
ATOM   2907  C  CD1   . TYR A  1  371 ? 113.154 -82.552  -15.850 1.00 41.61  ? 371  TYR A CD1   1 
ATOM   2908  C  CD2   . TYR A  1  371 ? 113.293 -80.207  -15.442 1.00 50.85  ? 371  TYR A CD2   1 
ATOM   2909  C  CE1   . TYR A  1  371 ? 113.523 -82.804  -14.540 1.00 40.35  ? 371  TYR A CE1   1 
ATOM   2910  C  CE2   . TYR A  1  371 ? 113.666 -80.449  -14.135 1.00 45.44  ? 371  TYR A CE2   1 
ATOM   2911  C  CZ    . TYR A  1  371 ? 113.782 -81.744  -13.689 1.00 40.04  ? 371  TYR A CZ    1 
ATOM   2912  O  OH    . TYR A  1  371 ? 114.157 -81.970  -12.385 1.00 40.64  ? 371  TYR A OH    1 
ATOM   2913  N  N     . ALA A  1  372 ? 110.063 -81.649  -15.951 1.00 44.58  ? 372  ALA A N     1 
ATOM   2914  C  CA    . ALA A  1  372 ? 109.526 -82.583  -14.968 1.00 40.55  ? 372  ALA A CA    1 
ATOM   2915  C  C     . ALA A  1  372 ? 108.012 -82.728  -15.030 1.00 48.66  ? 372  ALA A C     1 
ATOM   2916  O  O     . ALA A  1  372 ? 107.479 -83.738  -14.553 1.00 38.57  ? 372  ALA A O     1 
ATOM   2917  C  CB    . ALA A  1  372 ? 109.931 -82.152  -13.555 1.00 45.70  ? 372  ALA A CB    1 
ATOM   2918  N  N     . MET A  1  373 ? 107.308 -81.740  -15.581 1.00 43.09  ? 373  MET A N     1 
ATOM   2919  C  CA    . MET A  1  373 ? 105.864 -81.800  -15.789 1.00 41.35  ? 373  MET A CA    1 
ATOM   2920  C  C     . MET A  1  373 ? 105.602 -81.659  -17.285 1.00 41.36  ? 373  MET A C     1 
ATOM   2921  O  O     . MET A  1  373 ? 105.077 -80.635  -17.743 1.00 46.33  ? 373  MET A O     1 
ATOM   2922  C  CB    . MET A  1  373 ? 105.146 -80.720  -14.982 1.00 38.82  ? 373  MET A CB    1 
ATOM   2923  C  CG    . MET A  1  373 ? 105.310 -80.905  -13.473 1.00 48.10  ? 373  MET A CG    1 
ATOM   2924  S  SD    . MET A  1  373 ? 104.918 -79.459  -12.469 1.00 41.28  ? 373  MET A SD    1 
ATOM   2925  C  CE    . MET A  1  373 ? 106.131 -78.290  -13.081 1.00 37.44  ? 373  MET A CE    1 
ATOM   2926  N  N     . PRO A  1  374 ? 105.943 -82.678  -18.070 1.00 44.27  ? 374  PRO A N     1 
ATOM   2927  C  CA    . PRO A  1  374 ? 105.956 -82.529  -19.532 1.00 42.67  ? 374  PRO A CA    1 
ATOM   2928  C  C     . PRO A  1  374 ? 104.570 -82.209  -20.061 1.00 49.12  ? 374  PRO A C     1 
ATOM   2929  O  O     . PRO A  1  374 ? 103.631 -83.005  -19.914 1.00 47.56  ? 374  PRO A O     1 
ATOM   2930  C  CB    . PRO A  1  374 ? 106.447 -83.899  -20.023 1.00 42.43  ? 374  PRO A CB    1 
ATOM   2931  C  CG    . PRO A  1  374 ? 106.100 -84.844  -18.918 1.00 47.80  ? 374  PRO A CG    1 
ATOM   2932  C  CD    . PRO A  1  374 ? 106.210 -84.063  -17.644 1.00 49.03  ? 374  PRO A CD    1 
ATOM   2933  N  N     . PRO A  1  375 ? 104.396 -81.036  -20.664 1.00 51.56  ? 375  PRO A N     1 
ATOM   2934  C  CA    . PRO A  1  375 ? 103.050 -80.574  -21.026 1.00 52.33  ? 375  PRO A CA    1 
ATOM   2935  C  C     . PRO A  1  375 ? 102.545 -81.077  -22.368 1.00 48.97  ? 375  PRO A C     1 
ATOM   2936  O  O     . PRO A  1  375 ? 101.340 -80.982  -22.626 1.00 43.72  ? 375  PRO A O     1 
ATOM   2937  C  CB    . PRO A  1  375 ? 103.207 -79.038  -21.046 1.00 50.62  ? 375  PRO A CB    1 
ATOM   2938  C  CG    . PRO A  1  375 ? 104.628 -78.750  -20.573 1.00 43.34  ? 375  PRO A CG    1 
ATOM   2939  C  CD    . PRO A  1  375 ? 105.406 -79.985  -20.855 1.00 45.79  ? 375  PRO A CD    1 
ATOM   2940  N  N     . TYR A  1  376 ? 103.415 -81.613  -23.210 1.00 47.21  ? 376  TYR A N     1 
ATOM   2941  C  CA    . TYR A  1  376 ? 102.977 -81.959  -24.548 1.00 49.01  ? 376  TYR A CA    1 
ATOM   2942  C  C     . TYR A  1  376 ? 102.955 -83.473  -24.748 1.00 52.59  ? 376  TYR A C     1 
ATOM   2943  O  O     . TYR A  1  376 ? 103.725 -84.205  -24.116 1.00 50.41  ? 376  TYR A O     1 
ATOM   2944  C  CB    . TYR A  1  376 ? 103.882 -81.305  -25.599 1.00 43.78  ? 376  TYR A CB    1 
ATOM   2945  C  CG    . TYR A  1  376 ? 103.819 -79.793  -25.565 1.00 50.71  ? 376  TYR A CG    1 
ATOM   2946  C  CD1   . TYR A  1  376 ? 102.696 -79.117  -26.025 1.00 56.39  ? 376  TYR A CD1   1 
ATOM   2947  C  CD2   . TYR A  1  376 ? 104.873 -79.041  -25.057 1.00 43.84  ? 376  TYR A CD2   1 
ATOM   2948  C  CE1   . TYR A  1  376 ? 102.627 -77.738  -25.987 1.00 53.30  ? 376  TYR A CE1   1 
ATOM   2949  C  CE2   . TYR A  1  376 ? 104.810 -77.663  -25.014 1.00 42.47  ? 376  TYR A CE2   1 
ATOM   2950  C  CZ    . TYR A  1  376 ? 103.688 -77.017  -25.482 1.00 48.27  ? 376  TYR A CZ    1 
ATOM   2951  O  OH    . TYR A  1  376 ? 103.623 -75.644  -25.439 1.00 49.03  ? 376  TYR A OH    1 
ATOM   2952  N  N     . PRO A  1  377 ? 102.066 -83.974  -25.610 1.00 47.18  ? 377  PRO A N     1 
ATOM   2953  C  CA    . PRO A  1  377 ? 102.002 -85.422  -25.861 1.00 46.46  ? 377  PRO A CA    1 
ATOM   2954  C  C     . PRO A  1  377 ? 103.273 -85.913  -26.538 1.00 46.28  ? 377  PRO A C     1 
ATOM   2955  O  O     . PRO A  1  377 ? 103.671 -85.398  -27.585 1.00 46.42  ? 377  PRO A O     1 
ATOM   2956  C  CB    . PRO A  1  377 ? 100.777 -85.572  -26.774 1.00 47.72  ? 377  PRO A CB    1 
ATOM   2957  C  CG    . PRO A  1  377 ? 100.601 -84.237  -27.404 1.00 47.64  ? 377  PRO A CG    1 
ATOM   2958  C  CD    . PRO A  1  377 ? 101.027 -83.246  -26.357 1.00 53.31  ? 377  PRO A CD    1 
ATOM   2959  N  N     . TYR A  1  378 ? 103.915 -86.904  -25.912 1.00 53.78  ? 378  TYR A N     1 
ATOM   2960  C  CA    . TYR A  1  378 ? 105.073 -87.632  -26.428 1.00 51.34  ? 378  TYR A CA    1 
ATOM   2961  C  C     . TYR A  1  378 ? 106.370 -86.835  -26.363 1.00 57.66  ? 378  TYR A C     1 
ATOM   2962  O  O     . TYR A  1  378 ? 107.342 -87.196  -27.041 1.00 61.02  ? 378  TYR A O     1 
ATOM   2963  C  CB    . TYR A  1  378 ? 104.836 -88.119  -27.864 1.00 47.07  ? 378  TYR A CB    1 
ATOM   2964  C  CG    . TYR A  1  378 ? 103.611 -88.995  -28.000 1.00 54.68  ? 378  TYR A CG    1 
ATOM   2965  C  CD1   . TYR A  1  378 ? 103.638 -90.321  -27.593 1.00 48.58  ? 378  TYR A CD1   1 
ATOM   2966  C  CD2   . TYR A  1  378 ? 102.427 -88.494  -28.529 1.00 51.46  ? 378  TYR A CD2   1 
ATOM   2967  C  CE1   . TYR A  1  378 ? 102.524 -91.126  -27.707 1.00 51.19  ? 378  TYR A CE1   1 
ATOM   2968  C  CE2   . TYR A  1  378 ? 101.303 -89.292  -28.647 1.00 50.03  ? 378  TYR A CE2   1 
ATOM   2969  C  CZ    . TYR A  1  378 ? 101.359 -90.610  -28.236 1.00 51.79  ? 378  TYR A CZ    1 
ATOM   2970  O  OH    . TYR A  1  378 ? 100.253 -91.424  -28.350 1.00 53.30  ? 378  TYR A OH    1 
ATOM   2971  N  N     . GLN A  1  379 ? 106.434 -85.768  -25.556 1.00 57.30  ? 379  GLN A N     1 
ATOM   2972  C  CA    . GLN A  1  379 ? 107.685 -85.021  -25.450 1.00 54.27  ? 379  GLN A CA    1 
ATOM   2973  C  C     . GLN A  1  379 ? 108.665 -85.676  -24.484 1.00 45.88  ? 379  GLN A C     1 
ATOM   2974  O  O     . GLN A  1  379 ? 109.876 -85.640  -24.727 1.00 50.44  ? 379  GLN A O     1 
ATOM   2975  C  CB    . GLN A  1  379 ? 107.423 -83.568  -25.028 1.00 53.90  ? 379  GLN A CB    1 
ATOM   2976  C  CG    . GLN A  1  379 ? 107.344 -83.328  -23.524 1.00 51.96  ? 379  GLN A CG    1 
ATOM   2977  C  CD    . GLN A  1  379 ? 107.503 -81.869  -23.140 1.00 44.28  ? 379  GLN A CD    1 
ATOM   2978  O  OE1   . GLN A  1  379 ? 106.734 -81.013  -23.572 1.00 50.20  ? 379  GLN A OE1   1 
ATOM   2979  N  NE2   . GLN A  1  379 ? 108.506 -81.581  -22.320 1.00 40.02  ? 379  GLN A NE2   1 
ATOM   2980  N  N     . ALA A  1  380 ? 108.173 -86.287  -23.402 1.00 42.45  ? 380  ALA A N     1 
ATOM   2981  C  CA    . ALA A  1  380 ? 109.073 -86.859  -22.406 1.00 45.73  ? 380  ALA A CA    1 
ATOM   2982  C  C     . ALA A  1  380 ? 109.800 -88.082  -22.944 1.00 47.80  ? 380  ALA A C     1 
ATOM   2983  O  O     . ALA A  1  380 ? 110.966 -88.308  -22.604 1.00 41.69  ? 380  ALA A O     1 
ATOM   2984  C  CB    . ALA A  1  380 ? 108.296 -87.205  -21.137 1.00 44.80  ? 380  ALA A CB    1 
ATOM   2985  N  N     . ILE A  1  381 ? 109.134 -88.871  -23.792 1.00 55.54  ? 381  ILE A N     1 
ATOM   2986  C  CA    . ILE A  1  381 ? 109.769 -90.028  -24.409 1.00 53.92  ? 381  ILE A CA    1 
ATOM   2987  C  C     . ILE A  1  381 ? 110.811 -89.617  -25.444 1.00 44.15  ? 381  ILE A C     1 
ATOM   2988  O  O     . ILE A  1  381 ? 111.733 -90.391  -25.730 1.00 43.73  ? 381  ILE A O     1 
ATOM   2989  C  CB    . ILE A  1  381 ? 108.687 -90.943  -25.017 1.00 62.95  ? 381  ILE A CB    1 
ATOM   2990  C  CG1   . ILE A  1  381 ? 108.659 -92.279  -24.278 1.00 68.08  ? 381  ILE A CG1   1 
ATOM   2991  C  CG2   . ILE A  1  381 ? 108.882 -91.139  -26.522 1.00 72.86  ? 381  ILE A CG2   1 
ATOM   2992  C  CD1   . ILE A  1  381 ? 108.284 -92.144  -22.831 1.00 59.78  ? 381  ILE A CD1   1 
ATOM   2993  N  N     . ASP A  1  382 ? 110.699 -88.411  -26.003 1.00 44.35  ? 382  ASP A N     1 
ATOM   2994  C  CA    . ASP A  1  382 ? 111.676 -87.889  -26.960 1.00 44.23  ? 382  ASP A CA    1 
ATOM   2995  C  C     . ASP A  1  382 ? 112.761 -87.167  -26.172 1.00 43.08  ? 382  ASP A C     1 
ATOM   2996  O  O     . ASP A  1  382 ? 112.718 -85.950  -25.981 1.00 45.83  ? 382  ASP A O     1 
ATOM   2997  C  CB    . ASP A  1  382 ? 111.006 -86.969  -27.973 1.00 44.67  ? 382  ASP A CB    1 
ATOM   2998  C  CG    . ASP A  1  382 ? 111.971 -86.458  -29.026 1.00 45.68  ? 382  ASP A CG    1 
ATOM   2999  O  OD1   . ASP A  1  382 ? 113.136 -86.904  -29.046 1.00 49.26  ? 382  ASP A OD1   1 
ATOM   3000  O  OD2   . ASP A  1  382 ? 111.562 -85.606  -29.840 1.00 49.55  ? 382  ASP A OD2   1 
ATOM   3001  N  N     . TYR A  1  383 ? 113.758 -87.935  -25.723 1.00 46.22  ? 383  TYR A N     1 
ATOM   3002  C  CA    . TYR A  1  383 ? 114.787 -87.398  -24.837 1.00 55.70  ? 383  TYR A CA    1 
ATOM   3003  C  C     . TYR A  1  383 ? 115.568 -86.259  -25.487 1.00 58.50  ? 383  TYR A C     1 
ATOM   3004  O  O     . TYR A  1  383 ? 116.054 -85.361  -24.785 1.00 65.19  ? 383  TYR A O     1 
ATOM   3005  C  CB    . TYR A  1  383 ? 115.732 -88.522  -24.403 1.00 54.38  ? 383  TYR A CB    1 
ATOM   3006  C  CG    . TYR A  1  383 ? 115.050 -89.661  -23.664 1.00 45.33  ? 383  TYR A CG    1 
ATOM   3007  C  CD1   . TYR A  1  383 ? 113.884 -89.447  -22.940 1.00 42.28  ? 383  TYR A CD1   1 
ATOM   3008  C  CD2   . TYR A  1  383 ? 115.575 -90.948  -23.690 1.00 41.56  ? 383  TYR A CD2   1 
ATOM   3009  C  CE1   . TYR A  1  383 ? 113.258 -90.477  -22.265 1.00 41.54  ? 383  TYR A CE1   1 
ATOM   3010  C  CE2   . TYR A  1  383 ? 114.956 -91.986  -23.012 1.00 41.97  ? 383  TYR A CE2   1 
ATOM   3011  C  CZ    . TYR A  1  383 ? 113.796 -91.743  -22.299 1.00 43.71  ? 383  TYR A CZ    1 
ATOM   3012  O  OH    . TYR A  1  383 ? 113.163 -92.766  -21.623 1.00 42.41  ? 383  TYR A OH    1 
ATOM   3013  N  N     . ALA A  1  384 ? 115.693 -86.270  -26.818 1.00 43.18  ? 384  ALA A N     1 
ATOM   3014  C  CA    . ALA A  1  384 ? 116.388 -85.185  -27.504 1.00 41.02  ? 384  ALA A CA    1 
ATOM   3015  C  C     . ALA A  1  384 ? 115.625 -83.874  -27.372 1.00 52.21  ? 384  ALA A C     1 
ATOM   3016  O  O     . ALA A  1  384 ? 116.215 -82.832  -27.069 1.00 50.78  ? 384  ALA A O     1 
ATOM   3017  C  CB    . ALA A  1  384 ? 116.601 -85.540  -28.974 1.00 41.95  ? 384  ALA A CB    1 
ATOM   3018  N  N     . THR A  1  385 ? 114.310 -83.905  -27.607 1.00 50.57  ? 385  THR A N     1 
ATOM   3019  C  CA    . THR A  1  385 ? 113.487 -82.716  -27.403 1.00 47.06  ? 385  THR A CA    1 
ATOM   3020  C  C     . THR A  1  385 ? 113.563 -82.237  -25.959 1.00 50.30  ? 385  THR A C     1 
ATOM   3021  O  O     . THR A  1  385 ? 113.669 -81.033  -25.696 1.00 47.17  ? 385  THR A O     1 
ATOM   3022  C  CB    . THR A  1  385 ? 112.035 -83.012  -27.787 1.00 45.75  ? 385  THR A CB    1 
ATOM   3023  O  OG1   . THR A  1  385 ? 111.938 -83.199  -29.205 1.00 52.24  ? 385  THR A OG1   1 
ATOM   3024  C  CG2   . THR A  1  385 ? 111.118 -81.871  -27.365 1.00 41.47  ? 385  THR A CG2   1 
ATOM   3025  N  N     . GLN A  1  386 ? 113.512 -83.170  -25.010 1.00 45.68  ? 386  GLN A N     1 
ATOM   3026  C  CA    . GLN A  1  386 ? 113.544 -82.819  -23.596 1.00 42.62  ? 386  GLN A CA    1 
ATOM   3027  C  C     . GLN A  1  386 ? 114.835 -82.080  -23.243 1.00 45.85  ? 386  GLN A C     1 
ATOM   3028  O  O     . GLN A  1  386 ? 114.810 -80.965  -22.688 1.00 44.49  ? 386  GLN A O     1 
ATOM   3029  C  CB    . GLN A  1  386 ? 113.388 -84.103  -22.779 1.00 40.95  ? 386  GLN A CB    1 
ATOM   3030  C  CG    . GLN A  1  386 ? 112.899 -83.929  -21.367 1.00 49.85  ? 386  GLN A CG    1 
ATOM   3031  C  CD    . GLN A  1  386 ? 111.405 -83.772  -21.282 1.00 43.83  ? 386  GLN A CD    1 
ATOM   3032  O  OE1   . GLN A  1  386 ? 110.819 -82.920  -21.945 1.00 47.86  ? 386  GLN A OE1   1 
ATOM   3033  N  NE2   . GLN A  1  386 ? 110.776 -84.594  -20.453 1.00 41.03  ? 386  GLN A NE2   1 
ATOM   3034  N  N     . LEU A  1  387 ? 115.976 -82.683  -23.593 1.00 39.04  ? 387  LEU A N     1 
ATOM   3035  C  CA    . LEU A  1  387 ? 117.277 -82.072  -23.335 1.00 44.06  ? 387  LEU A CA    1 
ATOM   3036  C  C     . LEU A  1  387 ? 117.415 -80.733  -24.053 1.00 47.94  ? 387  LEU A C     1 
ATOM   3037  O  O     . LEU A  1  387 ? 117.869 -79.741  -23.464 1.00 56.50  ? 387  LEU A O     1 
ATOM   3038  C  CB    . LEU A  1  387 ? 118.383 -83.037  -23.769 1.00 43.45  ? 387  LEU A CB    1 
ATOM   3039  C  CG    . LEU A  1  387 ? 119.840 -82.603  -23.610 1.00 45.31  ? 387  LEU A CG    1 
ATOM   3040  C  CD1   . LEU A  1  387 ? 120.157 -82.300  -22.154 1.00 36.10  ? 387  LEU A CD1   1 
ATOM   3041  C  CD2   . LEU A  1  387 ? 120.770 -83.680  -24.158 1.00 37.34  ? 387  LEU A CD2   1 
ATOM   3042  N  N     . SER A  1  388 ? 117.013 -80.683  -25.327 1.00 47.59  ? 388  SER A N     1 
ATOM   3043  C  CA    . SER A  1  388 ? 117.196 -79.477  -26.127 1.00 44.58  ? 388  SER A CA    1 
ATOM   3044  C  C     . SER A  1  388 ? 116.364 -78.321  -25.583 1.00 41.78  ? 388  SER A C     1 
ATOM   3045  O  O     . SER A  1  388 ? 116.859 -77.194  -25.469 1.00 42.82  ? 388  SER A O     1 
ATOM   3046  C  CB    . SER A  1  388 ? 116.835 -79.762  -27.587 1.00 43.02  ? 388  SER A CB    1 
ATOM   3047  O  OG    . SER A  1  388 ? 117.674 -80.752  -28.154 1.00 52.16  ? 388  SER A OG    1 
ATOM   3048  N  N     . LEU A  1  389 ? 115.096 -78.574  -25.249 1.00 38.41  ? 389  LEU A N     1 
ATOM   3049  C  CA    . LEU A  1  389 ? 114.241 -77.511  -24.727 1.00 38.06  ? 389  LEU A CA    1 
ATOM   3050  C  C     . LEU A  1  389 ? 114.748 -77.007  -23.384 1.00 43.42  ? 389  LEU A C     1 
ATOM   3051  O  O     . LEU A  1  389 ? 114.823 -75.786  -23.156 1.00 46.85  ? 389  LEU A O     1 
ATOM   3052  C  CB    . LEU A  1  389 ? 112.797 -78.003  -24.606 1.00 41.17  ? 389  LEU A CB    1 
ATOM   3053  C  CG    . LEU A  1  389 ? 111.995 -78.227  -25.893 1.00 39.26  ? 389  LEU A CG    1 
ATOM   3054  C  CD1   . LEU A  1  389 ? 110.604 -78.744  -25.568 1.00 39.79  ? 389  LEU A CD1   1 
ATOM   3055  C  CD2   . LEU A  1  389 ? 111.907 -76.951  -26.700 1.00 39.40  ? 389  LEU A CD2   1 
ATOM   3056  N  N     . PHE A  1  390 ? 115.116 -77.931  -22.486 1.00 36.41  ? 390  PHE A N     1 
ATOM   3057  C  CA    . PHE A  1  390 ? 115.669 -77.523  -21.199 1.00 35.57  ? 390  PHE A CA    1 
ATOM   3058  C  C     . PHE A  1  390 ? 116.873 -76.606  -21.389 1.00 38.33  ? 390  PHE A C     1 
ATOM   3059  O  O     . PHE A  1  390 ? 116.919 -75.493  -20.841 1.00 34.88  ? 390  PHE A O     1 
ATOM   3060  C  CB    . PHE A  1  390 ? 116.043 -78.764  -20.387 1.00 35.45  ? 390  PHE A CB    1 
ATOM   3061  C  CG    . PHE A  1  390 ? 116.694 -78.457  -19.073 1.00 46.40  ? 390  PHE A CG    1 
ATOM   3062  C  CD1   . PHE A  1  390 ? 115.931 -78.296  -17.927 1.00 45.89  ? 390  PHE A CD1   1 
ATOM   3063  C  CD2   . PHE A  1  390 ? 118.070 -78.341  -18.979 1.00 43.71  ? 390  PHE A CD2   1 
ATOM   3064  C  CE1   . PHE A  1  390 ? 116.528 -78.011  -16.713 1.00 40.88  ? 390  PHE A CE1   1 
ATOM   3065  C  CE2   . PHE A  1  390 ? 118.671 -78.053  -17.772 1.00 45.92  ? 390  PHE A CE2   1 
ATOM   3066  C  CZ    . PHE A  1  390 ? 117.899 -77.893  -16.635 1.00 41.45  ? 390  PHE A CZ    1 
ATOM   3067  N  N     . THR A  1  391 ? 117.851 -77.047  -22.190 1.00 35.23  ? 391  THR A N     1 
ATOM   3068  C  CA    . THR A  1  391 ? 119.084 -76.278  -22.335 1.00 46.24  ? 391  THR A CA    1 
ATOM   3069  C  C     . THR A  1  391 ? 118.842 -74.956  -23.058 1.00 37.52  ? 391  THR A C     1 
ATOM   3070  O  O     . THR A  1  391 ? 119.435 -73.929  -22.699 1.00 40.26  ? 391  THR A O     1 
ATOM   3071  C  CB    . THR A  1  391 ? 120.134 -77.108  -23.071 1.00 48.52  ? 391  THR A CB    1 
ATOM   3072  O  OG1   . THR A  1  391 ? 119.635 -77.459  -24.362 1.00 80.10  ? 391  THR A OG1   1 
ATOM   3073  C  CG2   . THR A  1  391 ? 120.418 -78.381  -22.316 1.00 34.96  ? 391  THR A CG2   1 
ATOM   3074  N  N     . HIS A  1  392 ? 117.981 -74.962  -24.080 1.00 37.03  ? 392  HIS A N     1 
ATOM   3075  C  CA    . HIS A  1  392 ? 117.689 -73.742  -24.824 1.00 41.26  ? 392  HIS A CA    1 
ATOM   3076  C  C     . HIS A  1  392 ? 117.100 -72.674  -23.912 1.00 39.53  ? 392  HIS A C     1 
ATOM   3077  O  O     . HIS A  1  392 ? 117.554 -71.518  -23.906 1.00 41.84  ? 392  HIS A O     1 
ATOM   3078  C  CB    . HIS A  1  392 ? 116.737 -74.067  -25.979 1.00 38.52  ? 392  HIS A CB    1 
ATOM   3079  C  CG    . HIS A  1  392 ? 115.892 -72.912  -26.415 1.00 43.98  ? 392  HIS A CG    1 
ATOM   3080  N  ND1   . HIS A  1  392 ? 116.323 -71.971  -27.325 1.00 40.78  ? 392  HIS A ND1   1 
ATOM   3081  C  CD2   . HIS A  1  392 ? 114.639 -72.546  -26.061 1.00 43.72  ? 392  HIS A CD2   1 
ATOM   3082  C  CE1   . HIS A  1  392 ? 115.374 -71.073  -27.511 1.00 39.94  ? 392  HIS A CE1   1 
ATOM   3083  N  NE2   . HIS A  1  392 ? 114.342 -71.398  -26.754 1.00 48.41  ? 392  HIS A NE2   1 
ATOM   3084  N  N     . HIS A  1  393 ? 116.086 -73.047  -23.122 1.00 35.32  ? 393  HIS A N     1 
ATOM   3085  C  CA    . HIS A  1  393 ? 115.483 -72.064  -22.229 1.00 42.24  ? 393  HIS A CA    1 
ATOM   3086  C  C     . HIS A  1  393 ? 116.465 -71.625  -21.149 1.00 42.21  ? 393  HIS A C     1 
ATOM   3087  O  O     . HIS A  1  393 ? 116.468 -70.451  -20.748 1.00 39.59  ? 393  HIS A O     1 
ATOM   3088  C  CB    . HIS A  1  393 ? 114.202 -72.623  -21.620 1.00 46.07  ? 393  HIS A CB    1 
ATOM   3089  C  CG    . HIS A  1  393 ? 113.110 -72.828  -22.620 1.00 49.69  ? 393  HIS A CG    1 
ATOM   3090  N  ND1   . HIS A  1  393 ? 112.663 -71.821  -23.447 1.00 48.13  ? 393  HIS A ND1   1 
ATOM   3091  C  CD2   . HIS A  1  393 ? 112.385 -73.927  -22.936 1.00 50.51  ? 393  HIS A CD2   1 
ATOM   3092  C  CE1   . HIS A  1  393 ? 111.704 -72.290  -24.225 1.00 43.77  ? 393  HIS A CE1   1 
ATOM   3093  N  NE2   . HIS A  1  393 ? 111.517 -73.564  -23.936 1.00 51.68  ? 393  HIS A NE2   1 
ATOM   3094  N  N     . MET A  1  394 ? 117.318 -72.547  -20.679 1.00 33.80  ? 394  MET A N     1 
ATOM   3095  C  CA    . MET A  1  394 ? 118.384 -72.166  -19.754 1.00 33.12  ? 394  MET A CA    1 
ATOM   3096  C  C     . MET A  1  394 ? 119.239 -71.038  -20.329 1.00 34.98  ? 394  MET A C     1 
ATOM   3097  O  O     . MET A  1  394 ? 119.422 -69.994  -19.690 1.00 36.29  ? 394  MET A O     1 
ATOM   3098  C  CB    . MET A  1  394 ? 119.258 -73.384  -19.427 1.00 36.16  ? 394  MET A CB    1 
ATOM   3099  C  CG    . MET A  1  394 ? 118.731 -74.268  -18.308 1.00 32.83  ? 394  MET A CG    1 
ATOM   3100  S  SD    . MET A  1  394 ? 118.747 -73.405  -16.730 1.00 47.12  ? 394  MET A SD    1 
ATOM   3101  C  CE    . MET A  1  394 ? 117.680 -74.449  -15.739 1.00 32.31  ? 394  MET A CE    1 
ATOM   3102  N  N     . TRP A  1  395 ? 119.769 -71.240  -21.541 1.00 37.00  ? 395  TRP A N     1 
ATOM   3103  C  CA    . TRP A  1  395 ? 120.665 -70.250  -22.136 1.00 42.05  ? 395  TRP A CA    1 
ATOM   3104  C  C     . TRP A  1  395 ? 119.963 -68.914  -22.349 1.00 38.70  ? 395  TRP A C     1 
ATOM   3105  O  O     . TRP A  1  395 ? 120.544 -67.847  -22.088 1.00 42.85  ? 395  TRP A O     1 
ATOM   3106  C  CB    . TRP A  1  395 ? 121.236 -70.766  -23.458 1.00 44.49  ? 395  TRP A CB    1 
ATOM   3107  C  CG    . TRP A  1  395 ? 122.245 -71.860  -23.290 1.00 46.29  ? 395  TRP A CG    1 
ATOM   3108  C  CD1   . TRP A  1  395 ? 122.149 -73.140  -23.750 1.00 51.71  ? 395  TRP A CD1   1 
ATOM   3109  C  CD2   . TRP A  1  395 ? 123.500 -71.775  -22.600 1.00 42.97  ? 395  TRP A CD2   1 
ATOM   3110  N  NE1   . TRP A  1  395 ? 123.266 -73.858  -23.396 1.00 54.03  ? 395  TRP A NE1   1 
ATOM   3111  C  CE2   . TRP A  1  395 ? 124.111 -73.044  -22.689 1.00 49.38  ? 395  TRP A CE2   1 
ATOM   3112  C  CE3   . TRP A  1  395 ? 124.167 -70.751  -21.920 1.00 33.33  ? 395  TRP A CE3   1 
ATOM   3113  C  CZ2   . TRP A  1  395 ? 125.355 -73.316  -22.124 1.00 37.73  ? 395  TRP A CZ2   1 
ATOM   3114  C  CZ3   . TRP A  1  395 ? 125.403 -71.023  -21.359 1.00 32.19  ? 395  TRP A CZ3   1 
ATOM   3115  C  CH2   . TRP A  1  395 ? 125.983 -72.296  -21.464 1.00 32.39  ? 395  TRP A CH2   1 
ATOM   3116  N  N     . ILE A  1  396 ? 118.719 -68.946  -22.836 1.00 39.15  ? 396  ILE A N     1 
ATOM   3117  C  CA    . ILE A  1  396 ? 117.993 -67.692  -23.028 1.00 34.02  ? 396  ILE A CA    1 
ATOM   3118  C  C     . ILE A  1  396 ? 117.861 -66.950  -21.700 1.00 33.55  ? 396  ILE A C     1 
ATOM   3119  O  O     . ILE A  1  396 ? 118.096 -65.733  -21.621 1.00 39.54  ? 396  ILE A O     1 
ATOM   3120  C  CB    . ILE A  1  396 ? 116.624 -67.955  -23.681 1.00 37.32  ? 396  ILE A CB    1 
ATOM   3121  C  CG1   . ILE A  1  396 ? 116.800 -68.648  -25.038 1.00 49.27  ? 396  ILE A CG1   1 
ATOM   3122  C  CG2   . ILE A  1  396 ? 115.860 -66.658  -23.869 1.00 37.21  ? 396  ILE A CG2   1 
ATOM   3123  C  CD1   . ILE A  1  396 ? 117.593 -67.843  -26.059 1.00 35.65  ? 396  ILE A CD1   1 
ATOM   3124  N  N     . GLY A  1  397 ? 117.514 -67.677  -20.631 1.00 33.09  ? 397  GLY A N     1 
ATOM   3125  C  CA    . GLY A  1  397 ? 117.372 -67.036  -19.334 1.00 32.56  ? 397  GLY A CA    1 
ATOM   3126  C  C     . GLY A  1  397 ? 118.667 -66.421  -18.844 1.00 35.44  ? 397  GLY A C     1 
ATOM   3127  O  O     . GLY A  1  397 ? 118.679 -65.302  -18.321 1.00 41.67  ? 397  GLY A O     1 
ATOM   3128  N  N     . GLY A  1  398 ? 119.775 -67.146  -19.008 1.00 31.96  ? 398  GLY A N     1 
ATOM   3129  C  CA    . GLY A  1  398 ? 121.057 -66.628  -18.558 1.00 31.35  ? 398  GLY A CA    1 
ATOM   3130  C  C     . GLY A  1  398 ? 121.444 -65.353  -19.278 1.00 34.58  ? 398  GLY A C     1 
ATOM   3131  O  O     . GLY A  1  398 ? 121.893 -64.380  -18.655 1.00 40.64  ? 398  GLY A O     1 
ATOM   3132  N  N     . PHE A  1  399 ? 121.260 -65.331  -20.601 1.00 34.39  ? 399  PHE A N     1 
ATOM   3133  C  CA    . PHE A  1  399 ? 121.560 -64.117  -21.353 1.00 40.05  ? 399  PHE A CA    1 
ATOM   3134  C  C     . PHE A  1  399 ? 120.694 -62.947  -20.895 1.00 39.10  ? 399  PHE A C     1 
ATOM   3135  O  O     . PHE A  1  399 ? 121.200 -61.832  -20.703 1.00 38.27  ? 399  PHE A O     1 
ATOM   3136  C  CB    . PHE A  1  399 ? 121.403 -64.370  -22.852 1.00 32.96  ? 399  PHE A CB    1 
ATOM   3137  C  CG    . PHE A  1  399 ? 122.613 -65.005  -23.478 1.00 33.06  ? 399  PHE A CG    1 
ATOM   3138  C  CD1   . PHE A  1  399 ? 123.721 -64.240  -23.798 1.00 33.01  ? 399  PHE A CD1   1 
ATOM   3139  C  CD2   . PHE A  1  399 ? 122.652 -66.365  -23.728 1.00 33.24  ? 399  PHE A CD2   1 
ATOM   3140  C  CE1   . PHE A  1  399 ? 124.845 -64.820  -24.365 1.00 37.29  ? 399  PHE A CE1   1 
ATOM   3141  C  CE2   . PHE A  1  399 ? 123.774 -66.951  -24.293 1.00 37.79  ? 399  PHE A CE2   1 
ATOM   3142  C  CZ    . PHE A  1  399 ? 124.871 -66.177  -24.613 1.00 35.55  ? 399  PHE A CZ    1 
ATOM   3143  N  N     . LEU A  1  400 ? 119.391 -63.179  -20.694 1.00 38.70  ? 400  LEU A N     1 
ATOM   3144  C  CA    . LEU A  1  400 ? 118.528 -62.091  -20.233 1.00 32.42  ? 400  LEU A CA    1 
ATOM   3145  C  C     . LEU A  1  400 ? 118.964 -61.565  -18.863 1.00 34.50  ? 400  LEU A C     1 
ATOM   3146  O  O     . LEU A  1  400 ? 118.925 -60.352  -18.615 1.00 35.71  ? 400  LEU A O     1 
ATOM   3147  C  CB    . LEU A  1  400 ? 117.070 -62.551  -20.206 1.00 32.79  ? 400  LEU A CB    1 
ATOM   3148  C  CG    . LEU A  1  400 ? 116.523 -62.899  -21.597 1.00 37.73  ? 400  LEU A CG    1 
ATOM   3149  C  CD1   . LEU A  1  400 ? 115.033 -63.220  -21.568 1.00 35.59  ? 400  LEU A CD1   1 
ATOM   3150  C  CD2   . LEU A  1  400 ? 116.813 -61.774  -22.578 1.00 33.88  ? 400  LEU A CD2   1 
ATOM   3151  N  N     . ILE A  1  401 ? 119.404 -62.459  -17.968 1.00 31.34  ? 401  ILE A N     1 
ATOM   3152  C  CA    . ILE A  1  401 ? 119.840 -62.027  -16.639 1.00 30.79  ? 401  ILE A CA    1 
ATOM   3153  C  C     . ILE A  1  401 ? 121.091 -61.156  -16.732 1.00 30.56  ? 401  ILE A C     1 
ATOM   3154  O  O     . ILE A  1  401 ? 121.196 -60.103  -16.076 1.00 38.69  ? 401  ILE A O     1 
ATOM   3155  C  CB    . ILE A  1  401 ? 120.069 -63.254  -15.737 1.00 31.64  ? 401  ILE A CB    1 
ATOM   3156  C  CG1   . ILE A  1  401 ? 118.729 -63.860  -15.309 1.00 34.87  ? 401  ILE A CG1   1 
ATOM   3157  C  CG2   . ILE A  1  401 ? 120.931 -62.886  -14.535 1.00 29.92  ? 401  ILE A CG2   1 
ATOM   3158  C  CD1   . ILE A  1  401 ? 118.845 -65.204  -14.622 1.00 35.95  ? 401  ILE A CD1   1 
ATOM   3159  N  N     . VAL A  1  402 ? 122.062 -61.580  -17.545 1.00 30.65  ? 402  VAL A N     1 
ATOM   3160  C  CA    . VAL A  1  402 ? 123.269 -60.775  -17.710 1.00 33.74  ? 402  VAL A CA    1 
ATOM   3161  C  C     . VAL A  1  402 ? 122.922 -59.412  -18.300 1.00 33.81  ? 402  VAL A C     1 
ATOM   3162  O  O     . VAL A  1  402 ? 123.474 -58.377  -17.893 1.00 35.98  ? 402  VAL A O     1 
ATOM   3163  C  CB    . VAL A  1  402 ? 124.303 -61.528  -18.564 1.00 34.48  ? 402  VAL A CB    1 
ATOM   3164  C  CG1   . VAL A  1  402 ? 125.490 -60.636  -18.859 1.00 31.60  ? 402  VAL A CG1   1 
ATOM   3165  C  CG2   . VAL A  1  402 ? 124.759 -62.778  -17.831 1.00 30.32  ? 402  VAL A CG2   1 
ATOM   3166  N  N     . GLY A  1  403 ? 121.989 -59.383  -19.254 1.00 33.99  ? 403  GLY A N     1 
ATOM   3167  C  CA    . GLY A  1  403 ? 121.530 -58.105  -19.772 1.00 31.72  ? 403  GLY A CA    1 
ATOM   3168  C  C     . GLY A  1  403 ? 120.918 -57.227  -18.696 1.00 39.12  ? 403  GLY A C     1 
ATOM   3169  O  O     . GLY A  1  403 ? 121.054 -55.998  -18.729 1.00 41.71  ? 403  GLY A O     1 
ATOM   3170  N  N     . ALA A  1  404 ? 120.209 -57.845  -17.744 1.00 31.95  ? 404  ALA A N     1 
ATOM   3171  C  CA    . ALA A  1  404 ? 119.654 -57.081  -16.627 1.00 33.76  ? 404  ALA A CA    1 
ATOM   3172  C  C     . ALA A  1  404 ? 120.755 -56.394  -15.840 1.00 33.07  ? 404  ALA A C     1 
ATOM   3173  O  O     . ALA A  1  404 ? 120.616 -55.233  -15.432 1.00 39.90  ? 404  ALA A O     1 
ATOM   3174  C  CB    . ALA A  1  404 ? 118.847 -57.990  -15.705 1.00 40.39  ? 404  ALA A CB    1 
ATOM   3175  N  N     . GLY A  1  405 ? 121.852 -57.108  -15.601 1.00 41.85  ? 405  GLY A N     1 
ATOM   3176  C  CA    . GLY A  1  405 ? 123.009 -56.457  -15.000 1.00 35.94  ? 405  GLY A CA    1 
ATOM   3177  C  C     . GLY A  1  405 ? 123.498 -55.278  -15.826 1.00 33.92  ? 405  GLY A C     1 
ATOM   3178  O  O     . GLY A  1  405 ? 123.749 -54.181  -15.301 1.00 43.89  ? 405  GLY A O     1 
ATOM   3179  N  N     . ALA A  1  406 ? 123.633 -55.490  -17.139 1.00 35.98  ? 406  ALA A N     1 
ATOM   3180  C  CA    . ALA A  1  406 ? 124.081 -54.422  -18.033 1.00 32.96  ? 406  ALA A CA    1 
ATOM   3181  C  C     . ALA A  1  406 ? 123.232 -53.169  -17.881 1.00 34.93  ? 406  ALA A C     1 
ATOM   3182  O  O     . ALA A  1  406 ? 123.752 -52.048  -17.800 1.00 44.37  ? 406  ALA A O     1 
ATOM   3183  C  CB    . ALA A  1  406 ? 124.049 -54.902  -19.487 1.00 31.52  ? 406  ALA A CB    1 
ATOM   3184  N  N     . HIS A  1  407 ? 121.922 -53.338  -17.821 1.00 31.43  ? 407  HIS A N     1 
ATOM   3185  C  CA    . HIS A  1  407 ? 121.054 -52.171  -17.846 1.00 36.81  ? 407  HIS A CA    1 
ATOM   3186  C  C     . HIS A  1  407 ? 120.841 -51.553  -16.478 1.00 38.62  ? 407  HIS A C     1 
ATOM   3187  O  O     . HIS A  1  407 ? 120.570 -50.349  -16.401 1.00 40.81  ? 407  HIS A O     1 
ATOM   3188  C  CB    . HIS A  1  407 ? 119.732 -52.525  -18.517 1.00 37.79  ? 407  HIS A CB    1 
ATOM   3189  C  CG    . HIS A  1  407 ? 119.879 -52.727  -19.989 1.00 42.25  ? 407  HIS A CG    1 
ATOM   3190  N  ND1   . HIS A  1  407 ? 120.010 -51.676  -20.871 1.00 38.01  ? 407  HIS A ND1   1 
ATOM   3191  C  CD2   . HIS A  1  407 ? 119.998 -53.856  -20.725 1.00 32.86  ? 407  HIS A CD2   1 
ATOM   3192  C  CE1   . HIS A  1  407 ? 120.161 -52.149  -22.095 1.00 35.77  ? 407  HIS A CE1   1 
ATOM   3193  N  NE2   . HIS A  1  407 ? 120.153 -53.468  -22.032 1.00 40.91  ? 407  HIS A NE2   1 
ATOM   3194  N  N     . GLY A  1  408 ? 121.017 -52.316  -15.398 1.00 39.98  ? 408  GLY A N     1 
ATOM   3195  C  CA    . GLY A  1  408 ? 121.191 -51.680  -14.104 1.00 30.64  ? 408  GLY A CA    1 
ATOM   3196  C  C     . GLY A  1  408 ? 122.391 -50.755  -14.102 1.00 30.96  ? 408  GLY A C     1 
ATOM   3197  O  O     . GLY A  1  408 ? 122.324 -49.622  -13.604 1.00 39.57  ? 408  GLY A O     1 
ATOM   3198  N  N     . ALA A  1  409 ? 123.497 -51.207  -14.701 1.00 39.20  ? 409  ALA A N     1 
ATOM   3199  C  CA    . ALA A  1  409 ? 124.682 -50.355  -14.771 1.00 35.22  ? 409  ALA A CA    1 
ATOM   3200  C  C     . ALA A  1  409 ? 124.434 -49.117  -15.628 1.00 36.71  ? 409  ALA A C     1 
ATOM   3201  O  O     . ALA A  1  409 ? 124.856 -48.005  -15.270 1.00 46.34  ? 409  ALA A O     1 
ATOM   3202  C  CB    . ALA A  1  409 ? 125.869 -51.153  -15.309 1.00 36.36  ? 409  ALA A CB    1 
ATOM   3203  N  N     . ILE A  1  410 ? 123.763 -49.290  -16.769 1.00 40.37  ? 410  ILE A N     1 
ATOM   3204  C  CA    . ILE A  1  410 ? 123.487 -48.140  -17.626 1.00 32.10  ? 410  ILE A CA    1 
ATOM   3205  C  C     . ILE A  1  410 ? 122.579 -47.147  -16.912 1.00 32.23  ? 410  ILE A C     1 
ATOM   3206  O  O     . ILE A  1  410 ? 122.759 -45.928  -17.032 1.00 44.57  ? 410  ILE A O     1 
ATOM   3207  C  CB    . ILE A  1  410 ? 122.889 -48.585  -18.971 1.00 32.59  ? 410  ILE A CB    1 
ATOM   3208  C  CG1   . ILE A  1  410 ? 123.891 -49.442  -19.745 1.00 36.49  ? 410  ILE A CG1   1 
ATOM   3209  C  CG2   . ILE A  1  410 ? 122.519 -47.373  -19.796 1.00 33.31  ? 410  ILE A CG2   1 
ATOM   3210  C  CD1   . ILE A  1  410 ? 123.262 -50.278  -20.834 1.00 33.04  ? 410  ILE A CD1   1 
ATOM   3211  N  N     . PHE A  1  411 ? 121.588 -47.640  -16.161 1.00 32.02  ? 411  PHE A N     1 
ATOM   3212  C  CA    . PHE A  1  411 ? 120.777 -46.731  -15.358 1.00 34.55  ? 411  PHE A CA    1 
ATOM   3213  C  C     . PHE A  1  411 ? 121.649 -45.932  -14.404 1.00 42.43  ? 411  PHE A C     1 
ATOM   3214  O  O     . PHE A  1  411 ? 121.511 -44.707  -14.299 1.00 39.85  ? 411  PHE A O     1 
ATOM   3215  C  CB    . PHE A  1  411 ? 119.709 -47.481  -14.560 1.00 37.79  ? 411  PHE A CB    1 
ATOM   3216  C  CG    . PHE A  1  411 ? 119.100 -46.644  -13.461 1.00 38.82  ? 411  PHE A CG    1 
ATOM   3217  C  CD1   . PHE A  1  411 ? 118.094 -45.733  -13.744 1.00 32.50  ? 411  PHE A CD1   1 
ATOM   3218  C  CD2   . PHE A  1  411 ? 119.563 -46.738  -12.154 1.00 31.51  ? 411  PHE A CD2   1 
ATOM   3219  C  CE1   . PHE A  1  411 ? 117.548 -44.942  -12.745 1.00 32.59  ? 411  PHE A CE1   1 
ATOM   3220  C  CE2   . PHE A  1  411 ? 119.024 -45.952  -11.148 1.00 31.60  ? 411  PHE A CE2   1 
ATOM   3221  C  CZ    . PHE A  1  411 ? 118.014 -45.052  -11.444 1.00 32.14  ? 411  PHE A CZ    1 
ATOM   3222  N  N     . MET A  1  412 ? 122.540 -46.620  -13.679 1.00 31.37  ? 412  MET A N     1 
ATOM   3223  C  CA    . MET A  1  412 ? 123.389 -45.924  -12.716 1.00 33.11  ? 412  MET A CA    1 
ATOM   3224  C  C     . MET A  1  412 ? 124.203 -44.824  -13.386 1.00 37.33  ? 412  MET A C     1 
ATOM   3225  O  O     . MET A  1  412 ? 124.329 -43.721  -12.843 1.00 39.10  ? 412  MET A O     1 
ATOM   3226  C  CB    . MET A  1  412 ? 124.312 -46.910  -11.997 1.00 38.38  ? 412  MET A CB    1 
ATOM   3227  C  CG    . MET A  1  412 ? 123.633 -47.748  -10.928 1.00 30.27  ? 412  MET A CG    1 
ATOM   3228  S  SD    . MET A  1  412 ? 122.673 -46.771  -9.751  1.00 34.10  ? 412  MET A SD    1 
ATOM   3229  C  CE    . MET A  1  412 ? 123.878 -45.565  -9.222  1.00 34.21  ? 412  MET A CE    1 
ATOM   3230  N  N     . VAL A  1  413 ? 124.734 -45.086  -14.578 1.00 41.84  ? 413  VAL A N     1 
ATOM   3231  C  CA    . VAL A  1  413 ? 125.591 -44.077  -15.200 1.00 33.26  ? 413  VAL A CA    1 
ATOM   3232  C  C     . VAL A  1  413 ? 124.771 -42.937  -15.817 1.00 37.04  ? 413  VAL A C     1 
ATOM   3233  O  O     . VAL A  1  413 ? 125.141 -41.764  -15.690 1.00 46.33  ? 413  VAL A O     1 
ATOM   3234  C  CB    . VAL A  1  413 ? 126.536 -44.731  -16.228 1.00 33.14  ? 413  VAL A CB    1 
ATOM   3235  C  CG1   . VAL A  1  413 ? 127.314 -43.675  -16.989 1.00 32.72  ? 413  VAL A CG1   1 
ATOM   3236  C  CG2   . VAL A  1  413 ? 127.505 -45.673  -15.521 1.00 31.63  ? 413  VAL A CG2   1 
ATOM   3237  N  N     . ARG A  1  414 ? 123.643 -43.236  -16.468 1.00 37.57  ? 414  ARG A N     1 
ATOM   3238  C  CA    . ARG A  1  414 ? 122.979 -42.242  -17.315 1.00 40.00  ? 414  ARG A CA    1 
ATOM   3239  C  C     . ARG A  1  414 ? 121.742 -41.595  -16.706 1.00 33.91  ? 414  ARG A C     1 
ATOM   3240  O  O     . ARG A  1  414 ? 121.462 -40.434  -17.014 1.00 38.71  ? 414  ARG A O     1 
ATOM   3241  C  CB    . ARG A  1  414 ? 122.566 -42.860  -18.658 1.00 44.67  ? 414  ARG A CB    1 
ATOM   3242  C  CG    . ARG A  1  414 ? 123.695 -43.076  -19.644 1.00 34.25  ? 414  ARG A CG    1 
ATOM   3243  C  CD    . ARG A  1  414 ? 123.172 -43.672  -20.941 1.00 42.47  ? 414  ARG A CD    1 
ATOM   3244  N  NE    . ARG A  1  414 ? 124.264 -44.046  -21.832 1.00 48.33  ? 414  ARG A NE    1 
ATOM   3245  C  CZ    . ARG A  1  414 ? 124.111 -44.483  -23.076 1.00 45.04  ? 414  ARG A CZ    1 
ATOM   3246  N  NH1   . ARG A  1  414 ? 122.899 -44.602  -23.602 1.00 44.82  ? 414  ARG A NH1   1 
ATOM   3247  N  NH2   . ARG A  1  414 ? 125.178 -44.799  -23.798 1.00 44.02  ? 414  ARG A NH2   1 
ATOM   3248  N  N     . ASP A  1  415 ? 120.966 -42.307  -15.885 1.00 35.74  ? 415  ASP A N     1 
ATOM   3249  C  CA    . ASP A  1  415 ? 119.681 -41.790  -15.431 1.00 33.81  ? 415  ASP A CA    1 
ATOM   3250  C  C     . ASP A  1  415 ? 119.600 -41.528  -13.935 1.00 37.26  ? 415  ASP A C     1 
ATOM   3251  O  O     . ASP A  1  415 ? 118.727 -40.766  -13.510 1.00 44.29  ? 415  ASP A O     1 
ATOM   3252  C  CB    . ASP A  1  415 ? 118.551 -42.756  -15.819 1.00 37.34  ? 415  ASP A CB    1 
ATOM   3253  C  CG    . ASP A  1  415 ? 118.435 -42.942  -17.320 1.00 48.31  ? 415  ASP A CG    1 
ATOM   3254  O  OD1   . ASP A  1  415 ? 118.835 -42.023  -18.069 1.00 49.90  ? 415  ASP A OD1   1 
ATOM   3255  O  OD2   . ASP A  1  415 ? 117.942 -44.007  -17.751 1.00 46.80  ? 415  ASP A OD2   1 
ATOM   3256  N  N     . TYR A  1  416 ? 120.459 -42.150  -13.134 1.00 32.88  ? 416  TYR A N     1 
ATOM   3257  C  CA    . TYR A  1  416 ? 120.491 -41.887  -11.703 1.00 32.62  ? 416  TYR A CA    1 
ATOM   3258  C  C     . TYR A  1  416 ? 120.724 -40.405  -11.436 1.00 43.19  ? 416  TYR A C     1 
ATOM   3259  O  O     . TYR A  1  416 ? 121.699 -39.819  -11.915 1.00 33.17  ? 416  TYR A O     1 
ATOM   3260  C  CB    . TYR A  1  416 ? 121.584 -42.736  -11.053 1.00 32.00  ? 416  TYR A CB    1 
ATOM   3261  C  CG    . TYR A  1  416 ? 122.024 -42.284  -9.680  1.00 31.80  ? 416  TYR A CG    1 
ATOM   3262  C  CD1   . TYR A  1  416 ? 121.323 -42.665  -8.544  1.00 39.65  ? 416  TYR A CD1   1 
ATOM   3263  C  CD2   . TYR A  1  416 ? 123.156 -41.497  -9.516  1.00 31.86  ? 416  TYR A CD2   1 
ATOM   3264  C  CE1   . TYR A  1  416 ? 121.730 -42.265  -7.279  1.00 31.80  ? 416  TYR A CE1   1 
ATOM   3265  C  CE2   . TYR A  1  416 ? 123.569 -41.088  -8.255  1.00 41.43  ? 416  TYR A CE2   1 
ATOM   3266  C  CZ    . TYR A  1  416 ? 122.851 -41.477  -7.141  1.00 31.55  ? 416  TYR A CZ    1 
ATOM   3267  O  OH    . TYR A  1  416 ? 123.252 -41.085  -5.885  1.00 33.87  ? 416  TYR A OH    1 
ATOM   3268  N  N     . ASP A  1  417 ? 119.809 -39.800  -10.691 1.00 37.07  ? 417  ASP A N     1 
ATOM   3269  C  CA    . ASP A  1  417 ? 119.921 -38.410  -10.274 1.00 33.89  ? 417  ASP A CA    1 
ATOM   3270  C  C     . ASP A  1  417 ? 120.057 -38.392  -8.761  1.00 33.60  ? 417  ASP A C     1 
ATOM   3271  O  O     . ASP A  1  417 ? 119.096 -38.737  -8.057  1.00 39.16  ? 417  ASP A O     1 
ATOM   3272  C  CB    . ASP A  1  417 ? 118.692 -37.611  -10.718 1.00 43.33  ? 417  ASP A CB    1 
ATOM   3273  C  CG    . ASP A  1  417 ? 118.844 -36.108  -10.509 1.00 46.96  ? 417  ASP A CG    1 
ATOM   3274  O  OD1   . ASP A  1  417 ? 119.402 -35.676  -9.479  1.00 45.94  ? 417  ASP A OD1   1 
ATOM   3275  O  OD2   . ASP A  1  417 ? 118.385 -35.350  -11.388 1.00 54.37  ? 417  ASP A OD2   1 
ATOM   3276  N  N     . PRO A  1  418 ? 121.213 -38.019  -8.216  1.00 42.68  ? 418  PRO A N     1 
ATOM   3277  C  CA    . PRO A  1  418 ? 121.373 -38.070  -6.753  1.00 40.47  ? 418  PRO A CA    1 
ATOM   3278  C  C     . PRO A  1  418 ? 120.417 -37.154  -6.007  1.00 41.58  ? 418  PRO A C     1 
ATOM   3279  O  O     . PRO A  1  418 ? 120.061 -37.451  -4.859  1.00 44.75  ? 418  PRO A O     1 
ATOM   3280  C  CB    . PRO A  1  418 ? 122.840 -37.665  -6.548  1.00 43.29  ? 418  PRO A CB    1 
ATOM   3281  C  CG    . PRO A  1  418 ? 123.226 -36.944  -7.812  1.00 49.97  ? 418  PRO A CG    1 
ATOM   3282  C  CD    . PRO A  1  418 ? 122.440 -37.590  -8.907  1.00 46.02  ? 418  PRO A CD    1 
ATOM   3283  N  N     . ALA A  1  419 ? 119.969 -36.062  -6.628  1.00 43.82  ? 419  ALA A N     1 
ATOM   3284  C  CA    . ALA A  1  419 ? 119.009 -35.176  -5.978  1.00 37.24  ? 419  ALA A CA    1 
ATOM   3285  C  C     . ALA A  1  419 ? 117.626 -35.798  -5.860  1.00 35.10  ? 419  ALA A C     1 
ATOM   3286  O  O     . ALA A  1  419 ? 116.782 -35.260  -5.136  1.00 41.82  ? 419  ALA A O     1 
ATOM   3287  C  CB    . ALA A  1  419 ? 118.916 -33.850  -6.735  1.00 35.69  ? 419  ALA A CB    1 
ATOM   3288  N  N     . LYS A  1  420 ? 117.377 -36.909  -6.548  1.00 37.16  ? 420  LYS A N     1 
ATOM   3289  C  CA    . LYS A  1  420 ? 116.092 -37.590  -6.511  1.00 36.64  ? 420  LYS A CA    1 
ATOM   3290  C  C     . LYS A  1  420 ? 116.169 -38.910  -5.763  1.00 46.10  ? 420  LYS A C     1 
ATOM   3291  O  O     . LYS A  1  420 ? 115.218 -39.697  -5.808  1.00 53.18  ? 420  LYS A O     1 
ATOM   3292  C  CB    . LYS A  1  420 ? 115.580 -37.818  -7.934  1.00 37.65  ? 420  LYS A CB    1 
ATOM   3293  C  CG    . LYS A  1  420 ? 115.457 -36.545  -8.746  1.00 47.96  ? 420  LYS A CG    1 
ATOM   3294  C  CD    . LYS A  1  420 ? 115.126 -36.842  -10.195 1.00 57.70  ? 420  LYS A CD    1 
ATOM   3295  C  CE    . LYS A  1  420 ? 115.168 -35.576  -11.036 1.00 58.55  ? 420  LYS A CE    1 
ATOM   3296  N  NZ    . LYS A  1  420 ? 115.187 -35.911  -12.483 1.00 63.62  ? 420  LYS A NZ    1 
ATOM   3297  N  N     . ASN A  1  421 ? 117.284 -39.171  -5.081  1.00 47.86  ? 421  ASN A N     1 
ATOM   3298  C  CA    . ASN A  1  421 ? 117.501 -40.415  -4.360  1.00 40.37  ? 421  ASN A CA    1 
ATOM   3299  C  C     . ASN A  1  421 ? 118.265 -40.120  -3.068  1.00 38.62  ? 421  ASN A C     1 
ATOM   3300  O  O     . ASN A  1  421 ? 119.396 -40.552  -2.860  1.00 36.85  ? 421  ASN A O     1 
ATOM   3301  C  CB    . ASN A  1  421 ? 118.245 -41.419  -5.236  1.00 35.63  ? 421  ASN A CB    1 
ATOM   3302  C  CG    . ASN A  1  421 ? 117.438 -41.843  -6.435  1.00 40.13  ? 421  ASN A CG    1 
ATOM   3303  O  OD1   . ASN A  1  421 ? 116.512 -42.645  -6.312  1.00 32.41  ? 421  ASN A OD1   1 
ATOM   3304  N  ND2   . ASN A  1  421 ? 117.777 -41.306  -7.605  1.00 36.29  ? 421  ASN A ND2   1 
ATOM   3305  N  N     . VAL A  1  422 ? 117.635 -39.365  -2.176  1.00 32.98  ? 422  VAL A N     1 
ATOM   3306  C  CA    . VAL A  1  422 ? 118.245 -38.972  -0.912  1.00 35.45  ? 422  VAL A CA    1 
ATOM   3307  C  C     . VAL A  1  422 ? 117.654 -39.848  0.187   1.00 41.01  ? 422  VAL A C     1 
ATOM   3308  O  O     . VAL A  1  422 ? 116.497 -39.675  0.580   1.00 42.45  ? 422  VAL A O     1 
ATOM   3309  C  CB    . VAL A  1  422 ? 118.033 -37.482  -0.621  1.00 36.88  ? 422  VAL A CB    1 
ATOM   3310  C  CG1   . VAL A  1  422 ? 118.760 -37.087  0.655   1.00 34.41  ? 422  VAL A CG1   1 
ATOM   3311  C  CG2   . VAL A  1  422 ? 118.515 -36.639  -1.798  1.00 40.99  ? 422  VAL A CG2   1 
ATOM   3312  N  N     . ASN A  1  423 ? 118.459 -40.797  0.673   1.00 32.52  ? 423  ASN A N     1 
ATOM   3313  C  CA    . ASN A  1  423 ? 118.109 -41.682  1.782   1.00 33.10  ? 423  ASN A CA    1 
ATOM   3314  C  C     . ASN A  1  423 ? 116.956 -42.620  1.435   1.00 44.45  ? 423  ASN A C     1 
ATOM   3315  O  O     . ASN A  1  423 ? 116.135 -42.952  2.292   1.00 43.33  ? 423  ASN A O     1 
ATOM   3316  C  CB    . ASN A  1  423 ? 117.792 -40.895  3.061   1.00 32.67  ? 423  ASN A CB    1 
ATOM   3317  C  CG    . ASN A  1  423 ? 117.998 -41.725  4.320   1.00 33.04  ? 423  ASN A CG    1 
ATOM   3318  O  OD1   . ASN A  1  423 ? 118.823 -42.635  4.344   1.00 36.91  ? 423  ASN A OD1   1 
ATOM   3319  N  ND2   . ASN A  1  423 ? 117.236 -41.425  5.362   1.00 32.95  ? 423  ASN A ND2   1 
ATOM   3320  N  N     . ASN A  1  424 ? 116.884 -43.058  0.186   1.00 41.23  ? 424  ASN A N     1 
ATOM   3321  C  CA    . ASN A  1  424 ? 115.967 -44.111  -0.217  1.00 31.93  ? 424  ASN A CA    1 
ATOM   3322  C  C     . ASN A  1  424 ? 116.755 -45.403  -0.423  1.00 33.03  ? 424  ASN A C     1 
ATOM   3323  O  O     . ASN A  1  424 ? 117.979 -45.438  -0.270  1.00 40.57  ? 424  ASN A O     1 
ATOM   3324  C  CB    . ASN A  1  424 ? 115.188 -43.702  -1.471  1.00 32.25  ? 424  ASN A CB    1 
ATOM   3325  C  CG    . ASN A  1  424 ? 116.064 -43.594  -2.707  1.00 34.27  ? 424  ASN A CG    1 
ATOM   3326  O  OD1   . ASN A  1  424 ? 117.286 -43.498  -2.616  1.00 37.88  ? 424  ASN A OD1   1 
ATOM   3327  N  ND2   . ASN A  1  424 ? 115.431 -43.600  -3.877  1.00 35.09  ? 424  ASN A ND2   1 
ATOM   3328  N  N     . LEU A  1  425 ? 116.037 -46.471  -0.781  1.00 31.28  ? 425  LEU A N     1 
ATOM   3329  C  CA    . LEU A  1  425 ? 116.648 -47.795  -0.885  1.00 30.80  ? 425  LEU A CA    1 
ATOM   3330  C  C     . LEU A  1  425 ? 117.881 -47.787  -1.786  1.00 30.46  ? 425  LEU A C     1 
ATOM   3331  O  O     . LEU A  1  425 ? 118.935 -48.315  -1.417  1.00 33.40  ? 425  LEU A O     1 
ATOM   3332  C  CB    . LEU A  1  425 ? 115.616 -48.802  -1.391  1.00 35.94  ? 425  LEU A CB    1 
ATOM   3333  C  CG    . LEU A  1  425 ? 114.401 -48.998  -0.482  1.00 42.12  ? 425  LEU A CG    1 
ATOM   3334  C  CD1   . LEU A  1  425 ? 113.315 -49.739  -1.216  1.00 41.37  ? 425  LEU A CD1   1 
ATOM   3335  C  CD2   . LEU A  1  425 ? 114.774 -49.737  0.798   1.00 43.41  ? 425  LEU A CD2   1 
ATOM   3336  N  N     . LEU A  1  426 ? 117.769 -47.183  -2.971  1.00 36.36  ? 426  LEU A N     1 
ATOM   3337  C  CA    . LEU A  1  426 ? 118.911 -47.114  -3.880  1.00 35.09  ? 426  LEU A CA    1 
ATOM   3338  C  C     . LEU A  1  426 ? 120.093 -46.395  -3.235  1.00 34.48  ? 426  LEU A C     1 
ATOM   3339  O  O     . LEU A  1  426 ? 121.242 -46.854  -3.325  1.00 41.40  ? 426  LEU A O     1 
ATOM   3340  C  CB    . LEU A  1  426 ? 118.494 -46.415  -5.173  1.00 34.45  ? 426  LEU A CB    1 
ATOM   3341  C  CG    . LEU A  1  426 ? 119.564 -46.187  -6.236  1.00 35.91  ? 426  LEU A CG    1 
ATOM   3342  C  CD1   . LEU A  1  426 ? 120.214 -47.504  -6.614  1.00 37.30  ? 426  LEU A CD1   1 
ATOM   3343  C  CD2   . LEU A  1  426 ? 118.947 -45.509  -7.455  1.00 37.56  ? 426  LEU A CD2   1 
ATOM   3344  N  N     . ASP A  1  427 ? 119.824 -45.269  -2.570  1.00 32.96  ? 427  ASP A N     1 
ATOM   3345  C  CA    . ASP A  1  427 ? 120.884 -44.495  -1.933  1.00 33.19  ? 427  ASP A CA    1 
ATOM   3346  C  C     . ASP A  1  427 ? 121.603 -45.315  -0.867  1.00 37.07  ? 427  ASP A C     1 
ATOM   3347  O  O     . ASP A  1  427 ? 122.837 -45.333  -0.808  1.00 37.19  ? 427  ASP A O     1 
ATOM   3348  C  CB    . ASP A  1  427 ? 120.295 -43.221  -1.332  1.00 31.10  ? 427  ASP A CB    1 
ATOM   3349  C  CG    . ASP A  1  427 ? 121.354 -42.245  -0.878  1.00 33.08  ? 427  ASP A CG    1 
ATOM   3350  O  OD1   . ASP A  1  427 ? 122.321 -42.013  -1.635  1.00 34.17  ? 427  ASP A OD1   1 
ATOM   3351  O  OD2   . ASP A  1  427 ? 121.204 -41.694  0.231   1.00 32.44  ? 427  ASP A OD2   1 
ATOM   3352  N  N     . ARG A  1  428 ? 120.845 -46.011  -0.017  1.00 30.25  ? 428  ARG A N     1 
ATOM   3353  C  CA    . ARG A  1  428 ? 121.464 -46.809  1.036   1.00 29.98  ? 428  ARG A CA    1 
ATOM   3354  C  C     . ARG A  1  428 ? 122.226 -48.001  0.466   1.00 29.53  ? 428  ARG A C     1 
ATOM   3355  O  O     . ARG A  1  428 ? 123.259 -48.407  1.023   1.00 29.30  ? 428  ARG A O     1 
ATOM   3356  C  CB    . ARG A  1  428 ? 120.395 -47.267  2.024   1.00 30.16  ? 428  ARG A CB    1 
ATOM   3357  C  CG    . ARG A  1  428 ? 119.403 -46.174  2.363   1.00 30.67  ? 428  ARG A CG    1 
ATOM   3358  C  CD    . ARG A  1  428 ? 118.636 -46.499  3.620   1.00 38.35  ? 428  ARG A CD    1 
ATOM   3359  N  NE    . ARG A  1  428 ? 119.000 -45.589  4.695   1.00 49.79  ? 428  ARG A NE    1 
ATOM   3360  C  CZ    . ARG A  1  428 ? 119.039 -45.918  5.980   1.00 40.74  ? 428  ARG A CZ    1 
ATOM   3361  N  NH1   . ARG A  1  428 ? 118.750 -47.150  6.369   1.00 31.15  ? 428  ARG A NH1   1 
ATOM   3362  N  NH2   . ARG A  1  428 ? 119.386 -45.009  6.877   1.00 55.64  ? 428  ARG A NH2   1 
ATOM   3363  N  N     . MET A  1  429 ? 121.732 -48.579  -0.632  1.00 29.45  ? 429  MET A N     1 
ATOM   3364  C  CA    . MET A  1  429 ? 122.496 -49.613  -1.318  1.00 29.09  ? 429  MET A CA    1 
ATOM   3365  C  C     . MET A  1  429 ? 123.854 -49.075  -1.732  1.00 28.98  ? 429  MET A C     1 
ATOM   3366  O  O     . MET A  1  429 ? 124.892 -49.710  -1.505  1.00 31.90  ? 429  MET A O     1 
ATOM   3367  C  CB    . MET A  1  429 ? 121.725 -50.118  -2.537  1.00 39.88  ? 429  MET A CB    1 
ATOM   3368  C  CG    . MET A  1  429 ? 120.424 -50.844  -2.229  1.00 39.54  ? 429  MET A CG    1 
ATOM   3369  S  SD    . MET A  1  429 ? 120.606 -52.623  -2.295  1.00 51.27  ? 429  MET A SD    1 
ATOM   3370  C  CE    . MET A  1  429 ? 121.442 -52.899  -0.754  1.00 56.60  ? 429  MET A CE    1 
ATOM   3371  N  N     . LEU A  1  430 ? 123.863 -47.891  -2.340  1.00 33.43  ? 430  LEU A N     1 
ATOM   3372  C  CA    . LEU A  1  430 ? 125.134 -47.273  -2.690  1.00 38.96  ? 430  LEU A CA    1 
ATOM   3373  C  C     . LEU A  1  430 ? 125.979 -47.029  -1.447  1.00 39.47  ? 430  LEU A C     1 
ATOM   3374  O  O     . LEU A  1  430 ? 127.201 -47.202  -1.476  1.00 38.33  ? 430  LEU A O     1 
ATOM   3375  C  CB    . LEU A  1  430 ? 124.890 -45.972  -3.452  1.00 34.67  ? 430  LEU A CB    1 
ATOM   3376  C  CG    . LEU A  1  430 ? 124.135 -46.177  -4.767  1.00 29.73  ? 430  LEU A CG    1 
ATOM   3377  C  CD1   . LEU A  1  430 ? 123.885 -44.865  -5.484  1.00 30.18  ? 430  LEU A CD1   1 
ATOM   3378  C  CD2   . LEU A  1  430 ? 124.891 -47.151  -5.664  1.00 29.46  ? 430  LEU A CD2   1 
ATOM   3379  N  N     . ARG A  1  431 ? 125.342 -46.660  -0.336  1.00 29.36  ? 431  ARG A N     1 
ATOM   3380  C  CA    . ARG A  1  431 ? 126.075 -46.257  0.857   1.00 29.44  ? 431  ARG A CA    1 
ATOM   3381  C  C     . ARG A  1  431 ? 126.607 -47.427  1.678   1.00 29.15  ? 431  ARG A C     1 
ATOM   3382  O  O     . ARG A  1  431 ? 127.356 -47.188  2.632   1.00 37.64  ? 431  ARG A O     1 
ATOM   3383  C  CB    . ARG A  1  431 ? 125.199 -45.357  1.736   1.00 29.83  ? 431  ARG A CB    1 
ATOM   3384  C  CG    . ARG A  1  431 ? 124.907 -43.994  1.104   1.00 32.50  ? 431  ARG A CG    1 
ATOM   3385  C  CD    . ARG A  1  431 ? 124.515 -42.942  2.133   1.00 36.25  ? 431  ARG A CD    1 
ATOM   3386  N  NE    . ARG A  1  431 ? 123.074 -42.839  2.329   1.00 33.69  ? 431  ARG A NE    1 
ATOM   3387  C  CZ    . ARG A  1  431 ? 122.464 -42.897  3.509   1.00 35.81  ? 431  ARG A CZ    1 
ATOM   3388  N  NH1   . ARG A  1  431 ? 123.169 -43.049  4.625   1.00 31.08  ? 431  ARG A NH1   1 
ATOM   3389  N  NH2   . ARG A  1  431 ? 121.141 -42.789  3.569   1.00 31.37  ? 431  ARG A NH2   1 
ATOM   3390  N  N     . HIS A  1  432 ? 126.228 -48.678  1.364   1.00 31.98  ? 432  HIS A N     1 
ATOM   3391  C  CA    . HIS A  1  432 ? 126.941 -49.807  1.973   1.00 35.97  ? 432  HIS A CA    1 
ATOM   3392  C  C     . HIS A  1  432 ? 127.283 -50.892  0.945   1.00 36.79  ? 432  HIS A C     1 
ATOM   3393  O  O     . HIS A  1  432 ? 127.369 -52.087  1.284   1.00 40.38  ? 432  HIS A O     1 
ATOM   3394  C  CB    . HIS A  1  432 ? 126.166 -50.394  3.154   1.00 29.34  ? 432  HIS A CB    1 
ATOM   3395  C  CG    . HIS A  1  432 ? 124.949 -51.163  2.758   1.00 29.30  ? 432  HIS A CG    1 
ATOM   3396  N  ND1   . HIS A  1  432 ? 123.838 -50.567  2.201   1.00 32.68  ? 432  HIS A ND1   1 
ATOM   3397  C  CD2   . HIS A  1  432 ? 124.662 -52.481  2.852   1.00 29.13  ? 432  HIS A CD2   1 
ATOM   3398  C  CE1   . HIS A  1  432 ? 122.920 -51.485  1.967   1.00 30.71  ? 432  HIS A CE1   1 
ATOM   3399  N  NE2   . HIS A  1  432 ? 123.399 -52.656  2.347   1.00 31.70  ? 432  HIS A NE2   1 
ATOM   3400  N  N     . ARG A  1  433 ? 127.468 -50.484  -0.313  1.00 32.25  ? 433  ARG A N     1 
ATOM   3401  C  CA    . ARG A  1  433 ? 128.012 -51.334  -1.367  1.00 30.05  ? 433  ARG A CA    1 
ATOM   3402  C  C     . ARG A  1  433 ? 129.217 -52.152  -0.896  1.00 37.20  ? 433  ARG A C     1 
ATOM   3403  O  O     . ARG A  1  433 ? 129.373 -53.312  -1.289  1.00 41.27  ? 433  ARG A O     1 
ATOM   3404  C  CB    . ARG A  1  433 ? 128.368 -50.463  -2.587  1.00 36.69  ? 433  ARG A CB    1 
ATOM   3405  C  CG    . ARG A  1  433 ? 129.732 -49.775  -2.509  1.00 44.42  ? 433  ARG A CG    1 
ATOM   3406  C  CD    . ARG A  1  433 ? 129.748 -48.288  -2.869  1.00 38.78  ? 433  ARG A CD    1 
ATOM   3407  N  NE    . ARG A  1  433 ? 129.882 -48.031  -4.301  1.00 43.96  ? 433  ARG A NE    1 
ATOM   3408  C  CZ    . ARG A  1  433 ? 130.422 -46.928  -4.822  1.00 39.80  ? 433  ARG A CZ    1 
ATOM   3409  N  NH1   . ARG A  1  433 ? 130.902 -45.977  -4.036  1.00 29.26  ? 433  ARG A NH1   1 
ATOM   3410  N  NH2   . ARG A  1  433 ? 130.490 -46.778  -6.137  1.00 48.48  ? 433  ARG A NH2   1 
ATOM   3411  N  N     . ASP A  1  434 ? 130.060 -51.577  -0.035  1.00 39.09  ? 434  ASP A N     1 
ATOM   3412  C  CA    . ASP A  1  434 ? 131.246 -52.291  0.428   1.00 36.45  ? 434  ASP A CA    1 
ATOM   3413  C  C     . ASP A  1  434 ? 130.871 -53.492  1.284   1.00 32.26  ? 434  ASP A C     1 
ATOM   3414  O  O     . ASP A  1  434 ? 131.419 -54.586  1.109   1.00 31.56  ? 434  ASP A O     1 
ATOM   3415  C  CB    . ASP A  1  434 ? 132.157 -51.345  1.206   1.00 28.04  ? 434  ASP A CB    1 
ATOM   3416  C  CG    . ASP A  1  434 ? 132.909 -50.398  0.305   1.00 43.35  ? 434  ASP A CG    1 
ATOM   3417  O  OD1   . ASP A  1  434 ? 133.631 -50.887  -0.588  1.00 37.92  ? 434  ASP A OD1   1 
ATOM   3418  O  OD2   . ASP A  1  434 ? 132.764 -49.169  0.480   1.00 47.40  ? 434  ASP A OD2   1 
ATOM   3419  N  N     . ALA A  1  435 ? 129.950 -53.303  2.230   1.00 31.92  ? 435  ALA A N     1 
ATOM   3420  C  CA    . ALA A  1  435 ? 129.484 -54.423  3.036   1.00 33.11  ? 435  ALA A CA    1 
ATOM   3421  C  C     . ALA A  1  435 ? 128.871 -55.496  2.149   1.00 34.30  ? 435  ALA A C     1 
ATOM   3422  O  O     . ALA A  1  435 ? 129.230 -56.681  2.236   1.00 39.82  ? 435  ALA A O     1 
ATOM   3423  C  CB    . ALA A  1  435 ? 128.477 -53.934  4.078   1.00 28.02  ? 435  ALA A CB    1 
ATOM   3424  N  N     . ILE A  1  436 ? 127.971 -55.079  1.254   1.00 42.23  ? 436  ILE A N     1 
ATOM   3425  C  CA    . ILE A  1  436 ? 127.296 -56.031  0.371   1.00 33.68  ? 436  ILE A CA    1 
ATOM   3426  C  C     . ILE A  1  436 ? 128.313 -56.868  -0.390  1.00 34.32  ? 436  ILE A C     1 
ATOM   3427  O  O     . ILE A  1  436 ? 128.247 -58.105  -0.402  1.00 28.97  ? 436  ILE A O     1 
ATOM   3428  C  CB    . ILE A  1  436 ? 126.362 -55.294  -0.604  1.00 41.62  ? 436  ILE A CB    1 
ATOM   3429  C  CG1   . ILE A  1  436 ? 125.363 -54.436  0.155   1.00 40.58  ? 436  ILE A CG1   1 
ATOM   3430  C  CG2   . ILE A  1  436 ? 125.641 -56.285  -1.502  1.00 41.64  ? 436  ILE A CG2   1 
ATOM   3431  C  CD1   . ILE A  1  436 ? 124.823 -53.336  -0.689  1.00 36.44  ? 436  ILE A CD1   1 
ATOM   3432  N  N     . ILE A  1  437 ? 129.277 -56.201  -1.032  1.00 27.34  ? 437  ILE A N     1 
ATOM   3433  C  CA    . ILE A  1  437 ? 130.149 -56.886  -1.976  1.00 27.23  ? 437  ILE A CA    1 
ATOM   3434  C  C     . ILE A  1  437 ? 131.221 -57.691  -1.254  1.00 40.33  ? 437  ILE A C     1 
ATOM   3435  O  O     . ILE A  1  437 ? 131.550 -58.800  -1.679  1.00 46.46  ? 437  ILE A O     1 
ATOM   3436  C  CB    . ILE A  1  437 ? 130.756 -55.884  -2.975  1.00 28.16  ? 437  ILE A CB    1 
ATOM   3437  C  CG1   . ILE A  1  437 ? 129.655 -55.301  -3.861  1.00 29.12  ? 437  ILE A CG1   1 
ATOM   3438  C  CG2   . ILE A  1  437 ? 131.818 -56.554  -3.841  1.00 27.28  ? 437  ILE A CG2   1 
ATOM   3439  C  CD1   . ILE A  1  437 ? 128.868 -56.353  -4.622  1.00 30.06  ? 437  ILE A CD1   1 
ATOM   3440  N  N     . SER A  1  438 ? 131.792 -57.170  -0.161  1.00 31.86  ? 438  SER A N     1 
ATOM   3441  C  CA    . SER A  1  438 ? 132.743 -57.976  0.598   1.00 27.15  ? 438  SER A CA    1 
ATOM   3442  C  C     . SER A  1  438 ? 132.085 -59.250  1.114   1.00 31.07  ? 438  SER A C     1 
ATOM   3443  O  O     . SER A  1  438 ? 132.694 -60.332  1.082   1.00 40.78  ? 438  SER A O     1 
ATOM   3444  C  CB    . SER A  1  438 ? 133.342 -57.164  1.752   1.00 31.43  ? 438  SER A CB    1 
ATOM   3445  O  OG    . SER A  1  438 ? 132.358 -56.761  2.689   1.00 36.75  ? 438  SER A OG    1 
ATOM   3446  N  N     . HIS A  1  439 ? 130.821 -59.164  1.543   1.00 32.52  ? 439  HIS A N     1 
ATOM   3447  C  CA    . HIS A  1  439 ? 130.163 -60.376  2.022   1.00 33.96  ? 439  HIS A CA    1 
ATOM   3448  C  C     . HIS A  1  439 ? 129.842 -61.335  0.885   1.00 35.66  ? 439  HIS A C     1 
ATOM   3449  O  O     . HIS A  1  439 ? 130.014 -62.547  1.038   1.00 34.06  ? 439  HIS A O     1 
ATOM   3450  C  CB    . HIS A  1  439 ? 128.908 -60.023  2.800   1.00 31.20  ? 439  HIS A CB    1 
ATOM   3451  C  CG    . HIS A  1  439 ? 129.204 -59.360  4.099   1.00 32.17  ? 439  HIS A CG    1 
ATOM   3452  N  ND1   . HIS A  1  439 ? 129.702 -58.079  4.172   1.00 33.21  ? 439  HIS A ND1   1 
ATOM   3453  C  CD2   . HIS A  1  439 ? 129.124 -59.809  5.372   1.00 31.27  ? 439  HIS A CD2   1 
ATOM   3454  C  CE1   . HIS A  1  439 ? 129.887 -57.754  5.438   1.00 38.68  ? 439  HIS A CE1   1 
ATOM   3455  N  NE2   . HIS A  1  439 ? 129.547 -58.787  6.185   1.00 33.49  ? 439  HIS A NE2   1 
ATOM   3456  N  N     . LEU A  1  440 ? 129.356 -60.825  -0.250  1.00 37.80  ? 440  LEU A N     1 
ATOM   3457  C  CA    . LEU A  1  440 ? 129.114 -61.701  -1.395  1.00 31.69  ? 440  LEU A CA    1 
ATOM   3458  C  C     . LEU A  1  440 ? 130.412 -62.358  -1.860  1.00 28.47  ? 440  LEU A C     1 
ATOM   3459  O  O     . LEU A  1  440 ? 130.430 -63.545  -2.213  1.00 35.77  ? 440  LEU A O     1 
ATOM   3460  C  CB    . LEU A  1  440 ? 128.458 -60.901  -2.522  1.00 33.70  ? 440  LEU A CB    1 
ATOM   3461  C  CG    . LEU A  1  440 ? 127.980 -61.573  -3.815  1.00 37.15  ? 440  LEU A CG    1 
ATOM   3462  C  CD1   . LEU A  1  440 ? 127.380 -62.960  -3.571  1.00 27.20  ? 440  LEU A CD1   1 
ATOM   3463  C  CD2   . LEU A  1  440 ? 126.963 -60.666  -4.500  1.00 27.31  ? 440  LEU A CD2   1 
ATOM   3464  N  N     . ASN A  1  441 ? 131.508 -61.601  -1.840  1.00 27.49  ? 441  ASN A N     1 
ATOM   3465  C  CA    . ASN A  1  441 ? 132.833 -62.126  -2.144  1.00 35.18  ? 441  ASN A CA    1 
ATOM   3466  C  C     . ASN A  1  441 ? 133.166 -63.309  -1.242  1.00 38.09  ? 441  ASN A C     1 
ATOM   3467  O  O     . ASN A  1  441 ? 133.568 -64.385  -1.716  1.00 44.86  ? 441  ASN A O     1 
ATOM   3468  C  CB    . ASN A  1  441 ? 133.852 -60.984  -1.985  1.00 26.95  ? 441  ASN A CB    1 
ATOM   3469  C  CG    . ASN A  1  441 ? 135.284 -61.410  -2.243  1.00 33.47  ? 441  ASN A CG    1 
ATOM   3470  O  OD1   . ASN A  1  441 ? 135.836 -61.169  -3.318  1.00 38.92  ? 441  ASN A OD1   1 
ATOM   3471  N  ND2   . ASN A  1  441 ? 135.907 -62.015  -1.243  1.00 37.56  ? 441  ASN A ND2   1 
ATOM   3472  N  N     . TRP A  1  442 ? 132.977 -63.134  0.070   1.00 34.41  ? 442  TRP A N     1 
ATOM   3473  C  CA    . TRP A  1  442 ? 133.307 -64.214  0.995   1.00 36.33  ? 442  TRP A CA    1 
ATOM   3474  C  C     . TRP A  1  442 ? 132.383 -65.414  0.814   1.00 39.79  ? 442  TRP A C     1 
ATOM   3475  O  O     . TRP A  1  442 ? 132.828 -66.563  0.927   1.00 47.94  ? 442  TRP A O     1 
ATOM   3476  C  CB    . TRP A  1  442 ? 133.254 -63.731  2.443   1.00 28.94  ? 442  TRP A CB    1 
ATOM   3477  C  CG    . TRP A  1  442 ? 133.209 -64.890  3.382   1.00 27.50  ? 442  TRP A CG    1 
ATOM   3478  C  CD1   . TRP A  1  442 ? 134.264 -65.632  3.816   1.00 27.34  ? 442  TRP A CD1   1 
ATOM   3479  C  CD2   . TRP A  1  442 ? 132.039 -65.486  3.952   1.00 31.19  ? 442  TRP A CD2   1 
ATOM   3480  N  NE1   . TRP A  1  442 ? 133.830 -66.642  4.641   1.00 27.57  ? 442  TRP A NE1   1 
ATOM   3481  C  CE2   . TRP A  1  442 ? 132.465 -66.572  4.742   1.00 37.41  ? 442  TRP A CE2   1 
ATOM   3482  C  CE3   . TRP A  1  442 ? 130.675 -65.198  3.880   1.00 27.37  ? 442  TRP A CE3   1 
ATOM   3483  C  CZ2   . TRP A  1  442 ? 131.574 -67.368  5.457   1.00 33.60  ? 442  TRP A CZ2   1 
ATOM   3484  C  CZ3   . TRP A  1  442 ? 129.793 -65.987  4.586   1.00 27.56  ? 442  TRP A CZ3   1 
ATOM   3485  C  CH2   . TRP A  1  442 ? 130.244 -67.062  5.363   1.00 27.72  ? 442  TRP A CH2   1 
ATOM   3486  N  N     . VAL A  1  443 ? 131.089 -65.175  0.579   1.00 31.78  ? 443  VAL A N     1 
ATOM   3487  C  CA    . VAL A  1  443 ? 130.168 -66.291  0.377   1.00 35.46  ? 443  VAL A CA    1 
ATOM   3488  C  C     . VAL A  1  443 ? 130.573 -67.083  -0.856  1.00 31.55  ? 443  VAL A C     1 
ATOM   3489  O  O     . VAL A  1  443 ? 130.493 -68.314  -0.870  1.00 31.77  ? 443  VAL A O     1 
ATOM   3490  C  CB    . VAL A  1  443 ? 128.707 -65.809  0.272   1.00 40.89  ? 443  VAL A CB    1 
ATOM   3491  C  CG1   . VAL A  1  443 ? 127.778 -67.001  0.159   1.00 40.56  ? 443  VAL A CG1   1 
ATOM   3492  C  CG2   . VAL A  1  443 ? 128.313 -65.003  1.474   1.00 53.43  ? 443  VAL A CG2   1 
ATOM   3493  N  N     . CYS A  1  444 ? 131.027 -66.397  -1.906  1.00 27.05  ? 444  CYS A N     1 
ATOM   3494  C  CA    . CYS A  1  444 ? 131.483 -67.120  -3.088  1.00 27.10  ? 444  CYS A CA    1 
ATOM   3495  C  C     . CYS A  1  444 ? 132.731 -67.939  -2.785  1.00 27.14  ? 444  CYS A C     1 
ATOM   3496  O  O     . CYS A  1  444 ? 132.854 -69.077  -3.249  1.00 39.19  ? 444  CYS A O     1 
ATOM   3497  C  CB    . CYS A  1  444 ? 131.746 -66.154  -4.242  1.00 27.08  ? 444  CYS A CB    1 
ATOM   3498  S  SG    . CYS A  1  444 ? 130.297 -65.281  -4.810  1.00 46.39  ? 444  CYS A SG    1 
ATOM   3499  N  N     . ILE A  1  445 ? 133.666 -67.385  -2.009  1.00 36.99  ? 445  ILE A N     1 
ATOM   3500  C  CA    . ILE A  1  445 ? 134.864 -68.154  -1.662  1.00 33.63  ? 445  ILE A CA    1 
ATOM   3501  C  C     . ILE A  1  445 ? 134.484 -69.399  -0.861  1.00 28.42  ? 445  ILE A C     1 
ATOM   3502  O  O     . ILE A  1  445 ? 134.953 -70.512  -1.141  1.00 32.98  ? 445  ILE A O     1 
ATOM   3503  C  CB    . ILE A  1  445 ? 135.875 -67.278  -0.901  1.00 32.04  ? 445  ILE A CB    1 
ATOM   3504  C  CG1   . ILE A  1  445 ? 136.261 -66.056  -1.734  1.00 27.11  ? 445  ILE A CG1   1 
ATOM   3505  C  CG2   . ILE A  1  445 ? 137.125 -68.079  -0.580  1.00 28.17  ? 445  ILE A CG2   1 
ATOM   3506  C  CD1   . ILE A  1  445 ? 137.309 -65.178  -1.077  1.00 27.15  ? 445  ILE A CD1   1 
ATOM   3507  N  N     . PHE A  1  446 ? 133.618 -69.226  0.142   1.00 29.56  ? 446  PHE A N     1 
ATOM   3508  C  CA    . PHE A  1  446 ? 133.155 -70.356  0.944   1.00 29.90  ? 446  PHE A CA    1 
ATOM   3509  C  C     . PHE A  1  446 ? 132.424 -71.389  0.089   1.00 31.27  ? 446  PHE A C     1 
ATOM   3510  O  O     . PHE A  1  446 ? 132.645 -72.596  0.239   1.00 34.66  ? 446  PHE A O     1 
ATOM   3511  C  CB    . PHE A  1  446 ? 132.249 -69.862  2.076   1.00 30.11  ? 446  PHE A CB    1 
ATOM   3512  C  CG    . PHE A  1  446 ? 131.459 -70.958  2.741   1.00 35.47  ? 446  PHE A CG    1 
ATOM   3513  C  CD1   . PHE A  1  446 ? 132.016 -71.707  3.765   1.00 44.04  ? 446  PHE A CD1   1 
ATOM   3514  C  CD2   . PHE A  1  446 ? 130.160 -71.244  2.339   1.00 39.40  ? 446  PHE A CD2   1 
ATOM   3515  C  CE1   . PHE A  1  446 ? 131.298 -72.729  4.376   1.00 41.08  ? 446  PHE A CE1   1 
ATOM   3516  C  CE2   . PHE A  1  446 ? 129.434 -72.263  2.948   1.00 43.73  ? 446  PHE A CE2   1 
ATOM   3517  C  CZ    . PHE A  1  446 ? 130.006 -73.007  3.967   1.00 40.61  ? 446  PHE A CZ    1 
ATOM   3518  N  N     . LEU A  1  447 ? 131.541 -70.937  -0.806  1.00 34.44  ? 447  LEU A N     1 
ATOM   3519  C  CA    . LEU A  1  447 ? 130.783 -71.867  -1.636  1.00 36.47  ? 447  LEU A CA    1 
ATOM   3520  C  C     . LEU A  1  447 ? 131.679 -72.604  -2.622  1.00 32.91  ? 447  LEU A C     1 
ATOM   3521  O  O     . LEU A  1  447 ? 131.428 -73.774  -2.924  1.00 32.53  ? 447  LEU A O     1 
ATOM   3522  C  CB    . LEU A  1  447 ? 129.669 -71.125  -2.374  1.00 28.65  ? 447  LEU A CB    1 
ATOM   3523  C  CG    . LEU A  1  447 ? 128.479 -70.731  -1.492  1.00 36.83  ? 447  LEU A CG    1 
ATOM   3524  C  CD1   . LEU A  1  447 ? 127.496 -69.848  -2.255  1.00 32.44  ? 447  LEU A CD1   1 
ATOM   3525  C  CD2   . LEU A  1  447 ? 127.778 -71.964  -0.915  1.00 29.51  ? 447  LEU A CD2   1 
ATOM   3526  N  N     . GLY A  1  448 ? 132.723 -71.948  -3.130  1.00 31.57  ? 448  GLY A N     1 
ATOM   3527  C  CA    . GLY A  1  448 ? 133.628 -72.627  -4.039  1.00 30.07  ? 448  GLY A CA    1 
ATOM   3528  C  C     . GLY A  1  448 ? 134.474 -73.665  -3.332  1.00 31.72  ? 448  GLY A C     1 
ATOM   3529  O  O     . GLY A  1  448 ? 134.602 -74.801  -3.798  1.00 36.77  ? 448  GLY A O     1 
ATOM   3530  N  N     . PHE A  1  449 ? 135.057 -73.289  -2.188  1.00 35.93  ? 449  PHE A N     1 
ATOM   3531  C  CA    . PHE A  1  449 ? 135.851 -74.235  -1.411  1.00 28.04  ? 449  PHE A CA    1 
ATOM   3532  C  C     . PHE A  1  449 ? 135.031 -75.463  -1.034  1.00 35.47  ? 449  PHE A C     1 
ATOM   3533  O  O     . PHE A  1  449 ? 135.484 -76.601  -1.194  1.00 34.12  ? 449  PHE A O     1 
ATOM   3534  C  CB    . PHE A  1  449 ? 136.399 -73.550  -0.159  1.00 32.52  ? 449  PHE A CB    1 
ATOM   3535  C  CG    . PHE A  1  449 ? 137.695 -72.819  -0.378  1.00 29.28  ? 449  PHE A CG    1 
ATOM   3536  C  CD1   . PHE A  1  449 ? 138.664 -73.333  -1.235  1.00 28.15  ? 449  PHE A CD1   1 
ATOM   3537  C  CD2   . PHE A  1  449 ? 137.946 -71.620  0.272   1.00 27.80  ? 449  PHE A CD2   1 
ATOM   3538  C  CE1   . PHE A  1  449 ? 139.864 -72.666  -1.435  1.00 28.11  ? 449  PHE A CE1   1 
ATOM   3539  C  CE2   . PHE A  1  449 ? 139.141 -70.945  0.079   1.00 31.75  ? 449  PHE A CE2   1 
ATOM   3540  C  CZ    . PHE A  1  449 ? 140.104 -71.469  -0.777  1.00 28.19  ? 449  PHE A CZ    1 
ATOM   3541  N  N     . HIS A  1  450 ? 133.810 -75.254  -0.548  1.00 30.35  ? 450  HIS A N     1 
ATOM   3542  C  CA    . HIS A  1  450 ? 132.997 -76.341  -0.026  1.00 33.17  ? 450  HIS A CA    1 
ATOM   3543  C  C     . HIS A  1  450 ? 132.044 -76.921  -1.059  1.00 36.32  ? 450  HIS A C     1 
ATOM   3544  O  O     . HIS A  1  450 ? 131.063 -77.570  -0.681  1.00 35.52  ? 450  HIS A O     1 
ATOM   3545  C  CB    . HIS A  1  450 ? 132.225 -75.876  1.206   1.00 32.61  ? 450  HIS A CB    1 
ATOM   3546  C  CG    . HIS A  1  450 ? 133.097 -75.240  2.236   1.00 36.37  ? 450  HIS A CG    1 
ATOM   3547  N  ND1   . HIS A  1  450 ? 133.699 -74.015  2.042   1.00 37.92  ? 450  HIS A ND1   1 
ATOM   3548  C  CD2   . HIS A  1  450 ? 133.496 -75.667  3.457   1.00 35.66  ? 450  HIS A CD2   1 
ATOM   3549  C  CE1   . HIS A  1  450 ? 134.423 -73.710  3.102   1.00 41.94  ? 450  HIS A CE1   1 
ATOM   3550  N  NE2   . HIS A  1  450 ? 134.316 -74.696  3.974   1.00 43.56  ? 450  HIS A NE2   1 
ATOM   3551  N  N     . SER A  1  451 ? 132.310 -76.706  -2.347  1.00 35.64  ? 451  SER A N     1 
ATOM   3552  C  CA    . SER A  1  451 ? 131.639 -77.466  -3.394  1.00 28.73  ? 451  SER A CA    1 
ATOM   3553  C  C     . SER A  1  451 ? 132.687 -78.095  -4.309  1.00 34.89  ? 451  SER A C     1 
ATOM   3554  O  O     . SER A  1  451 ? 132.894 -79.312  -4.272  1.00 38.09  ? 451  SER A O     1 
ATOM   3555  C  CB    . SER A  1  451 ? 130.660 -76.581  -4.174  1.00 28.60  ? 451  SER A CB    1 
ATOM   3556  O  OG    . SER A  1  451 ? 131.334 -75.598  -4.937  1.00 28.39  ? 451  SER A OG    1 
ATOM   3557  N  N     . PHE A  1  452 ? 133.373 -77.274  -5.110  1.00 28.73  ? 452  PHE A N     1 
ATOM   3558  C  CA    . PHE A  1  452 ? 134.441 -77.786  -5.969  1.00 36.62  ? 452  PHE A CA    1 
ATOM   3559  C  C     . PHE A  1  452 ? 135.535 -78.470  -5.156  1.00 31.93  ? 452  PHE A C     1 
ATOM   3560  O  O     . PHE A  1  452 ? 136.034 -79.538  -5.543  1.00 35.63  ? 452  PHE A O     1 
ATOM   3561  C  CB    . PHE A  1  452 ? 135.025 -76.644  -6.799  1.00 32.13  ? 452  PHE A CB    1 
ATOM   3562  C  CG    . PHE A  1  452 ? 136.199 -77.039  -7.649  1.00 34.83  ? 452  PHE A CG    1 
ATOM   3563  C  CD1   . PHE A  1  452 ? 136.032 -77.840  -8.768  1.00 36.54  ? 452  PHE A CD1   1 
ATOM   3564  C  CD2   . PHE A  1  452 ? 137.470 -76.586  -7.346  1.00 35.49  ? 452  PHE A CD2   1 
ATOM   3565  C  CE1   . PHE A  1  452 ? 137.116 -78.191  -9.558  1.00 31.02  ? 452  PHE A CE1   1 
ATOM   3566  C  CE2   . PHE A  1  452 ? 138.555 -76.932  -8.137  1.00 33.80  ? 452  PHE A CE2   1 
ATOM   3567  C  CZ    . PHE A  1  452 ? 138.375 -77.733  -9.246  1.00 34.32  ? 452  PHE A CZ    1 
ATOM   3568  N  N     . GLY A  1  453 ? 135.925 -77.864  -4.027  1.00 28.86  ? 453  GLY A N     1 
ATOM   3569  C  CA    . GLY A  1  453 ? 136.904 -78.486  -3.149  1.00 29.03  ? 453  GLY A CA    1 
ATOM   3570  C  C     . GLY A  1  453 ? 136.520 -79.884  -2.700  1.00 29.37  ? 453  GLY A C     1 
ATOM   3571  O  O     . GLY A  1  453 ? 137.389 -80.741  -2.533  1.00 33.58  ? 453  GLY A O     1 
ATOM   3572  N  N     . LEU A  1  454 ? 135.223 -80.135  -2.496  1.00 31.57  ? 454  LEU A N     1 
ATOM   3573  C  CA    . LEU A  1  454 ? 134.774 -81.489  -2.180  1.00 30.28  ? 454  LEU A CA    1 
ATOM   3574  C  C     . LEU A  1  454 ? 135.089 -82.449  -3.322  1.00 35.20  ? 454  LEU A C     1 
ATOM   3575  O  O     . LEU A  1  454 ? 135.519 -83.588  -3.090  1.00 39.64  ? 454  LEU A O     1 
ATOM   3576  C  CB    . LEU A  1  454 ? 133.275 -81.496  -1.878  1.00 29.77  ? 454  LEU A CB    1 
ATOM   3577  C  CG    . LEU A  1  454 ? 132.747 -80.579  -0.771  1.00 29.52  ? 454  LEU A CG    1 
ATOM   3578  C  CD1   . LEU A  1  454 ? 131.239 -80.737  -0.629  1.00 29.90  ? 454  LEU A CD1   1 
ATOM   3579  C  CD2   . LEU A  1  454 ? 133.428 -80.860  0.555   1.00 29.66  ? 454  LEU A CD2   1 
ATOM   3580  N  N     . TYR A  1  455 ? 134.887 -82.003  -4.564  1.00 32.11  ? 455  TYR A N     1 
ATOM   3581  C  CA    . TYR A  1  455 ? 135.243 -82.822  -5.719  1.00 32.79  ? 455  TYR A CA    1 
ATOM   3582  C  C     . TYR A  1  455 ? 136.737 -83.108  -5.751  1.00 37.21  ? 455  TYR A C     1 
ATOM   3583  O  O     . TYR A  1  455 ? 137.153 -84.225  -6.077  1.00 37.86  ? 455  TYR A O     1 
ATOM   3584  C  CB    . TYR A  1  455 ? 134.817 -82.127  -7.017  1.00 33.58  ? 455  TYR A CB    1 
ATOM   3585  C  CG    . TYR A  1  455 ? 133.327 -82.110  -7.250  1.00 32.90  ? 455  TYR A CG    1 
ATOM   3586  C  CD1   . TYR A  1  455 ? 132.711 -83.120  -7.981  1.00 34.77  ? 455  TYR A CD1   1 
ATOM   3587  C  CD2   . TYR A  1  455 ? 132.536 -81.090  -6.739  1.00 29.90  ? 455  TYR A CD2   1 
ATOM   3588  C  CE1   . TYR A  1  455 ? 131.352 -83.115  -8.194  1.00 35.40  ? 455  TYR A CE1   1 
ATOM   3589  C  CE2   . TYR A  1  455 ? 131.176 -81.079  -6.945  1.00 31.01  ? 455  TYR A CE2   1 
ATOM   3590  C  CZ    . TYR A  1  455 ? 130.590 -82.091  -7.675  1.00 32.85  ? 455  TYR A CZ    1 
ATOM   3591  O  OH    . TYR A  1  455 ? 129.236 -82.081  -7.883  1.00 30.51  ? 455  TYR A OH    1 
ATOM   3592  N  N     . ILE A  1  456 ? 137.561 -82.097  -5.453  1.00 36.45  ? 456  ILE A N     1 
ATOM   3593  C  CA    . ILE A  1  456 ? 139.009 -82.294  -5.465  1.00 36.97  ? 456  ILE A CA    1 
ATOM   3594  C  C     . ILE A  1  456 ? 139.424 -83.266  -4.366  1.00 35.22  ? 456  ILE A C     1 
ATOM   3595  O  O     . ILE A  1  456 ? 140.284 -84.137  -4.568  1.00 31.05  ? 456  ILE A O     1 
ATOM   3596  C  CB    . ILE A  1  456 ? 139.729 -80.940  -5.329  1.00 42.40  ? 456  ILE A CB    1 
ATOM   3597  C  CG1   . ILE A  1  456 ? 139.432 -80.055  -6.541  1.00 38.01  ? 456  ILE A CG1   1 
ATOM   3598  C  CG2   . ILE A  1  456 ? 141.229 -81.140  -5.184  1.00 44.38  ? 456  ILE A CG2   1 
ATOM   3599  C  CD1   . ILE A  1  456 ? 139.881 -80.660  -7.850  1.00 30.26  ? 456  ILE A CD1   1 
ATOM   3600  N  N     . HIS A  1  457 ? 138.815 -83.133  -3.189  1.00 30.51  ? 457  HIS A N     1 
ATOM   3601  C  CA    . HIS A  1  457 ? 139.035 -84.091  -2.117  1.00 32.57  ? 457  HIS A CA    1 
ATOM   3602  C  C     . HIS A  1  457 ? 138.716 -85.506  -2.579  1.00 37.68  ? 457  HIS A C     1 
ATOM   3603  O  O     . HIS A  1  457 ? 139.505 -86.433  -2.359  1.00 45.14  ? 457  HIS A O     1 
ATOM   3604  C  CB    . HIS A  1  457 ? 138.189 -83.697  -0.905  1.00 31.33  ? 457  HIS A CB    1 
ATOM   3605  C  CG    . HIS A  1  457 ? 137.970 -84.807  0.071   1.00 37.57  ? 457  HIS A CG    1 
ATOM   3606  N  ND1   . HIS A  1  457 ? 136.968 -85.740  -0.081  1.00 43.80  ? 457  HIS A ND1   1 
ATOM   3607  C  CD2   . HIS A  1  457 ? 138.612 -85.129  1.218   1.00 39.13  ? 457  HIS A CD2   1 
ATOM   3608  C  CE1   . HIS A  1  457 ? 137.004 -86.589  0.930   1.00 45.55  ? 457  HIS A CE1   1 
ATOM   3609  N  NE2   . HIS A  1  457 ? 137.994 -86.242  1.732   1.00 40.56  ? 457  HIS A NE2   1 
ATOM   3610  N  N     . ASN A  1  458 ? 137.567 -85.686  -3.242  1.00 35.36  ? 458  ASN A N     1 
ATOM   3611  C  CA    . ASN A  1  458 ? 137.161 -87.015  -3.700  1.00 31.79  ? 458  ASN A CA    1 
ATOM   3612  C  C     . ASN A  1  458 ? 138.110 -87.563  -4.762  1.00 32.11  ? 458  ASN A C     1 
ATOM   3613  O  O     . ASN A  1  458 ? 138.492 -88.737  -4.713  1.00 38.10  ? 458  ASN A O     1 
ATOM   3614  C  CB    . ASN A  1  458 ? 135.732 -86.980  -4.237  1.00 31.74  ? 458  ASN A CB    1 
ATOM   3615  C  CG    . ASN A  1  458 ? 134.700 -87.066  -3.144  1.00 31.72  ? 458  ASN A CG    1 
ATOM   3616  O  OD1   . ASN A  1  458 ? 135.019 -87.386  -1.999  1.00 44.78  ? 458  ASN A OD1   1 
ATOM   3617  N  ND2   . ASN A  1  458 ? 133.453 -86.785  -3.487  1.00 31.62  ? 458  ASN A ND2   1 
ATOM   3618  N  N     . ASP A  1  459 ? 138.473 -86.740  -5.751  1.00 31.89  ? 459  ASP A N     1 
ATOM   3619  C  CA    . ASP A  1  459 ? 139.439 -87.163  -6.764  1.00 33.41  ? 459  ASP A CA    1 
ATOM   3620  C  C     . ASP A  1  459 ? 140.731 -87.644  -6.117  1.00 34.56  ? 459  ASP A C     1 
ATOM   3621  O  O     . ASP A  1  459 ? 141.253 -88.717  -6.449  1.00 39.72  ? 459  ASP A O     1 
ATOM   3622  C  CB    . ASP A  1  459 ? 139.733 -86.014  -7.732  1.00 31.95  ? 459  ASP A CB    1 
ATOM   3623  C  CG    . ASP A  1  459 ? 138.683 -85.875  -8.814  1.00 43.87  ? 459  ASP A CG    1 
ATOM   3624  O  OD1   . ASP A  1  459 ? 138.652 -86.725  -9.730  1.00 37.74  ? 459  ASP A OD1   1 
ATOM   3625  O  OD2   . ASP A  1  459 ? 137.883 -84.918  -8.741  1.00 38.72  ? 459  ASP A OD2   1 
ATOM   3626  N  N     . THR A  1  460 ? 141.256 -86.855  -5.176  1.00 34.72  ? 460  THR A N     1 
ATOM   3627  C  CA    . THR A  1  460 ? 142.522 -87.199  -4.543  1.00 34.49  ? 460  THR A CA    1 
ATOM   3628  C  C     . THR A  1  460 ? 142.396 -88.463  -3.698  1.00 36.20  ? 460  THR A C     1 
ATOM   3629  O  O     . THR A  1  460 ? 143.285 -89.320  -3.721  1.00 39.87  ? 460  THR A O     1 
ATOM   3630  C  CB    . THR A  1  460 ? 143.004 -86.003  -3.719  1.00 38.61  ? 460  THR A CB    1 
ATOM   3631  O  OG1   . THR A  1  460 ? 143.157 -84.875  -4.593  1.00 36.52  ? 460  THR A OG1   1 
ATOM   3632  C  CG2   . THR A  1  460 ? 144.333 -86.295  -3.047  1.00 32.36  ? 460  THR A CG2   1 
ATOM   3633  N  N     . MET A  1  461 ? 141.282 -88.617  -2.978  1.00 46.81  ? 461  MET A N     1 
ATOM   3634  C  CA    . MET A  1  461 ? 141.082 -89.817  -2.169  1.00 33.25  ? 461  MET A CA    1 
ATOM   3635  C  C     . MET A  1  461 ? 140.947 -91.062  -3.036  1.00 33.81  ? 461  MET A C     1 
ATOM   3636  O  O     . MET A  1  461 ? 141.493 -92.121  -2.701  1.00 43.35  ? 461  MET A O     1 
ATOM   3637  C  CB    . MET A  1  461 ? 139.850 -89.651  -1.281  1.00 39.83  ? 461  MET A CB    1 
ATOM   3638  C  CG    . MET A  1  461 ? 140.043 -88.663  -0.145  1.00 42.82  ? 461  MET A CG    1 
ATOM   3639  S  SD    . MET A  1  461 ? 141.552 -89.019  0.777   1.00 37.27  ? 461  MET A SD    1 
ATOM   3640  C  CE    . MET A  1  461 ? 141.425 -87.817  2.078   1.00 53.50  ? 461  MET A CE    1 
ATOM   3641  N  N     . ARG A  1  462 ? 140.216 -90.962  -4.148  1.00 38.44  ? 462  ARG A N     1 
ATOM   3642  C  CA    . ARG A  1  462 ? 140.027 -92.116  -5.016  1.00 34.26  ? 462  ARG A CA    1 
ATOM   3643  C  C     . ARG A  1  462 ? 141.326 -92.497  -5.713  1.00 34.64  ? 462  ARG A C     1 
ATOM   3644  O  O     . ARG A  1  462 ? 141.614 -93.686  -5.889  1.00 35.26  ? 462  ARG A O     1 
ATOM   3645  C  CB    . ARG A  1  462 ? 138.923 -91.832  -6.037  1.00 35.52  ? 462  ARG A CB    1 
ATOM   3646  C  CG    . ARG A  1  462 ? 138.726 -92.938  -7.067  1.00 36.84  ? 462  ARG A CG    1 
ATOM   3647  C  CD    . ARG A  1  462 ? 137.449 -92.745  -7.866  1.00 35.24  ? 462  ARG A CD    1 
ATOM   3648  N  NE    . ARG A  1  462 ? 136.277 -93.279  -7.173  1.00 34.76  ? 462  ARG A NE    1 
ATOM   3649  C  CZ    . ARG A  1  462 ? 135.017 -92.954  -7.458  1.00 43.32  ? 462  ARG A CZ    1 
ATOM   3650  N  NH1   . ARG A  1  462 ? 134.025 -93.494  -6.770  1.00 34.80  ? 462  ARG A NH1   1 
ATOM   3651  N  NH2   . ARG A  1  462 ? 134.744 -92.082  -8.421  1.00 37.20  ? 462  ARG A NH2   1 
ATOM   3652  N  N     . ALA A  1  463 ? 142.128 -91.506  -6.111  1.00 34.32  ? 463  ALA A N     1 
ATOM   3653  C  CA    . ALA A  1  463 ? 143.411 -91.817  -6.731  1.00 34.72  ? 463  ALA A CA    1 
ATOM   3654  C  C     . ALA A  1  463 ? 144.367 -92.476  -5.743  1.00 39.58  ? 463  ALA A C     1 
ATOM   3655  O  O     . ALA A  1  463 ? 145.199 -93.301  -6.136  1.00 35.68  ? 463  ALA A O     1 
ATOM   3656  C  CB    . ALA A  1  463 ? 144.032 -90.548  -7.314  1.00 34.33  ? 463  ALA A CB    1 
ATOM   3657  N  N     . LEU A  1  464 ? 144.253 -92.141  -4.463  1.00 38.77  ? 464  LEU A N     1 
ATOM   3658  C  CA    . LEU A  1  464 ? 145.120 -92.694  -3.434  1.00 44.71  ? 464  LEU A CA    1 
ATOM   3659  C  C     . LEU A  1  464 ? 144.652 -94.059  -2.932  1.00 43.48  ? 464  LEU A C     1 
ATOM   3660  O  O     . LEU A  1  464 ? 145.124 -94.520  -1.884  1.00 44.25  ? 464  LEU A O     1 
ATOM   3661  C  CB    . LEU A  1  464 ? 145.234 -91.706  -2.270  1.00 39.75  ? 464  LEU A CB    1 
ATOM   3662  C  CG    . LEU A  1  464 ? 146.020 -90.430  -2.587  1.00 34.35  ? 464  LEU A CG    1 
ATOM   3663  C  CD1   . LEU A  1  464 ? 145.859 -89.404  -1.485  1.00 33.87  ? 464  LEU A CD1   1 
ATOM   3664  C  CD2   . LEU A  1  464 ? 147.492 -90.754  -2.808  1.00 38.00  ? 464  LEU A CD2   1 
ATOM   3665  N  N     . GLY A  1  465 ? 143.753 -94.719  -3.657  1.00 36.07  ? 465  GLY A N     1 
ATOM   3666  C  CA    . GLY A  1  465 ? 143.236 -95.999  -3.209  1.00 38.16  ? 465  GLY A CA    1 
ATOM   3667  C  C     . GLY A  1  465 ? 142.492 -95.930  -1.896  1.00 38.09  ? 465  GLY A C     1 
ATOM   3668  O  O     . GLY A  1  465 ? 142.525 -96.890  -1.118  1.00 43.38  ? 465  GLY A O     1 
ATOM   3669  N  N     . ARG A  1  466 ? 141.817 -94.816  -1.624  1.00 36.91  ? 466  ARG A N     1 
ATOM   3670  C  CA    . ARG A  1  466 ? 141.141 -94.586  -0.348  1.00 44.15  ? 466  ARG A CA    1 
ATOM   3671  C  C     . ARG A  1  466 ? 139.677 -94.255  -0.608  1.00 43.81  ? 466  ARG A C     1 
ATOM   3672  O  O     . ARG A  1  466 ? 139.234 -93.123  -0.382  1.00 46.75  ? 466  ARG A O     1 
ATOM   3673  C  CB    . ARG A  1  466 ? 141.824 -93.463  0.437   1.00 43.36  ? 466  ARG A CB    1 
ATOM   3674  C  CG    . ARG A  1  466 ? 143.262 -93.764  0.845   1.00 42.05  ? 466  ARG A CG    1 
ATOM   3675  C  CD    . ARG A  1  466 ? 144.006 -92.520  1.330   1.00 35.02  ? 466  ARG A CD    1 
ATOM   3676  N  NE    . ARG A  1  466 ? 143.311 -91.835  2.416   1.00 34.68  ? 466  ARG A NE    1 
ATOM   3677  C  CZ    . ARG A  1  466 ? 143.793 -90.778  3.065   1.00 34.35  ? 466  ARG A CZ    1 
ATOM   3678  N  NH1   . ARG A  1  466 ? 144.981 -90.283  2.745   1.00 34.31  ? 466  ARG A NH1   1 
ATOM   3679  N  NH2   . ARG A  1  466 ? 143.085 -90.214  4.035   1.00 34.11  ? 466  ARG A NH2   1 
ATOM   3680  N  N     . PRO A  1  467 ? 138.892 -95.227  -1.084  1.00 39.27  ? 467  PRO A N     1 
ATOM   3681  C  CA    . PRO A  1  467 ? 137.478 -94.932  -1.357  1.00 35.38  ? 467  PRO A CA    1 
ATOM   3682  C  C     . PRO A  1  467 ? 136.686 -94.617  -0.104  1.00 41.89  ? 467  PRO A C     1 
ATOM   3683  O  O     . PRO A  1  467 ? 135.718 -93.848  -0.177  1.00 34.81  ? 467  PRO A O     1 
ATOM   3684  C  CB    . PRO A  1  467 ? 136.976 -96.212  -2.037  1.00 36.02  ? 467  PRO A CB    1 
ATOM   3685  C  CG    . PRO A  1  467 ? 137.866 -97.282  -1.503  1.00 36.66  ? 467  PRO A CG    1 
ATOM   3686  C  CD    . PRO A  1  467 ? 139.217 -96.643  -1.333  1.00 36.39  ? 467  PRO A CD    1 
ATOM   3687  N  N     . GLN A  1  468 ? 137.078 -95.170  1.048   1.00 35.60  ? 468  GLN A N     1 
ATOM   3688  C  CA    . GLN A  1  468 ? 136.350 -94.946  2.292   1.00 35.57  ? 468  GLN A CA    1 
ATOM   3689  C  C     . GLN A  1  468 ? 136.551 -93.546  2.860   1.00 34.93  ? 468  GLN A C     1 
ATOM   3690  O  O     . GLN A  1  468 ? 135.839 -93.171  3.798   1.00 34.84  ? 468  GLN A O     1 
ATOM   3691  C  CB    . GLN A  1  468 ? 136.756 -95.988  3.340   1.00 36.26  ? 468  GLN A CB    1 
ATOM   3692  C  CG    . GLN A  1  468 ? 138.060 -95.694  4.066   1.00 36.25  ? 468  GLN A CG    1 
ATOM   3693  C  CD    . GLN A  1  468 ? 139.294 -95.988  3.233   1.00 45.11  ? 468  GLN A CD    1 
ATOM   3694  O  OE1   . GLN A  1  468 ? 139.208 -96.543  2.137   1.00 36.55  ? 468  GLN A OE1   1 
ATOM   3695  N  NE2   . GLN A  1  468 ? 140.458 -95.615  3.756   1.00 41.98  ? 468  GLN A NE2   1 
ATOM   3696  N  N     . ASP A  1  469 ? 137.489 -92.765  2.323   1.00 34.52  ? 469  ASP A N     1 
ATOM   3697  C  CA    . ASP A  1  469 ? 137.687 -91.387  2.748   1.00 38.13  ? 469  ASP A CA    1 
ATOM   3698  C  C     . ASP A  1  469 ? 137.037 -90.375  1.812   1.00 43.54  ? 469  ASP A C     1 
ATOM   3699  O  O     . ASP A  1  469 ? 137.344 -89.184  1.907   1.00 46.53  ? 469  ASP A O     1 
ATOM   3700  C  CB    . ASP A  1  469 ? 139.179 -91.078  2.874   1.00 37.75  ? 469  ASP A CB    1 
ATOM   3701  C  CG    . ASP A  1  469 ? 139.823 -91.791  4.039   1.00 46.01  ? 469  ASP A CG    1 
ATOM   3702  O  OD1   . ASP A  1  469 ? 139.105 -92.087  5.018   1.00 37.33  ? 469  ASP A OD1   1 
ATOM   3703  O  OD2   . ASP A  1  469 ? 141.046 -92.049  3.972   1.00 34.66  ? 469  ASP A OD2   1 
ATOM   3704  N  N     . MET A  1  470 ? 136.154 -90.811  0.920   1.00 39.94  ? 470  MET A N     1 
ATOM   3705  C  CA    . MET A  1  470 ? 135.502 -89.915  -0.023  1.00 32.96  ? 470  MET A CA    1 
ATOM   3706  C  C     . MET A  1  470 ? 134.182 -89.389  0.527   1.00 35.00  ? 470  MET A C     1 
ATOM   3707  O  O     . MET A  1  470 ? 133.608 -89.935  1.473   1.00 39.00  ? 470  MET A O     1 
ATOM   3708  C  CB    . MET A  1  470 ? 135.231 -90.625  -1.349  1.00 33.22  ? 470  MET A CB    1 
ATOM   3709  C  CG    . MET A  1  470 ? 136.467 -91.069  -2.079  1.00 43.59  ? 470  MET A CG    1 
ATOM   3710  S  SD    . MET A  1  470 ? 136.022 -91.924  -3.594  1.00 42.08  ? 470  MET A SD    1 
ATOM   3711  C  CE    . MET A  1  470 ? 135.609 -90.549  -4.654  1.00 42.95  ? 470  MET A CE    1 
ATOM   3712  N  N     . PHE A  1  471 ? 133.700 -88.315  -0.098  1.00 35.97  ? 471  PHE A N     1 
ATOM   3713  C  CA    . PHE A  1  471 ? 132.314 -87.876  0.032   1.00 33.70  ? 471  PHE A CA    1 
ATOM   3714  C  C     . PHE A  1  471 ? 131.472 -88.637  -0.991  1.00 43.24  ? 471  PHE A C     1 
ATOM   3715  O  O     . PHE A  1  471 ? 131.554 -88.369  -2.195  1.00 40.15  ? 471  PHE A O     1 
ATOM   3716  C  CB    . PHE A  1  471 ? 132.201 -86.368  -0.183  1.00 32.62  ? 471  PHE A CB    1 
ATOM   3717  C  CG    . PHE A  1  471 ? 132.893 -85.551  0.868   1.00 36.39  ? 471  PHE A CG    1 
ATOM   3718  C  CD1   . PHE A  1  471 ? 132.388 -85.489  2.157   1.00 39.48  ? 471  PHE A CD1   1 
ATOM   3719  C  CD2   . PHE A  1  471 ? 134.039 -84.836  0.567   1.00 34.82  ? 471  PHE A CD2   1 
ATOM   3720  C  CE1   . PHE A  1  471 ? 133.019 -84.734  3.126   1.00 38.94  ? 471  PHE A CE1   1 
ATOM   3721  C  CE2   . PHE A  1  471 ? 134.676 -84.075  1.533   1.00 33.30  ? 471  PHE A CE2   1 
ATOM   3722  C  CZ    . PHE A  1  471 ? 134.166 -84.024  2.814   1.00 38.03  ? 471  PHE A CZ    1 
ATOM   3723  N  N     . SER A  1  472 ? 130.666 -89.585  -0.518  1.00 37.89  ? 472  SER A N     1 
ATOM   3724  C  CA    . SER A  1  472 ? 129.841 -90.394  -1.408  1.00 37.84  ? 472  SER A CA    1 
ATOM   3725  C  C     . SER A  1  472 ? 128.676 -90.973  -0.620  1.00 40.72  ? 472  SER A C     1 
ATOM   3726  O  O     . SER A  1  472 ? 128.591 -90.830  0.602   1.00 40.42  ? 472  SER A O     1 
ATOM   3727  C  CB    . SER A  1  472 ? 130.653 -91.515  -2.059  1.00 43.93  ? 472  SER A CB    1 
ATOM   3728  O  OG    . SER A  1  472 ? 131.044 -92.474  -1.093  1.00 47.87  ? 472  SER A OG    1 
ATOM   3729  N  N     . ASP A  1  473 ? 127.771 -91.637  -1.345  1.00 40.18  ? 473  ASP A N     1 
ATOM   3730  C  CA    . ASP A  1  473 ? 126.667 -92.341  -0.697  1.00 43.96  ? 473  ASP A CA    1 
ATOM   3731  C  C     . ASP A  1  473 ? 127.129 -93.605  0.020   1.00 48.74  ? 473  ASP A C     1 
ATOM   3732  O  O     . ASP A  1  473 ? 126.383 -94.143  0.845   1.00 51.53  ? 473  ASP A O     1 
ATOM   3733  C  CB    . ASP A  1  473 ? 125.584 -92.694  -1.722  1.00 41.61  ? 473  ASP A CB    1 
ATOM   3734  C  CG    . ASP A  1  473 ? 124.779 -91.486  -2.164  1.00 40.51  ? 473  ASP A CG    1 
ATOM   3735  O  OD1   . ASP A  1  473 ? 124.486 -90.617  -1.313  1.00 37.41  ? 473  ASP A OD1   1 
ATOM   3736  O  OD2   . ASP A  1  473 ? 124.438 -91.405  -3.365  1.00 39.30  ? 473  ASP A OD2   1 
ATOM   3737  N  N     . THR A  1  474 ? 128.339 -94.086  -0.267  1.00 42.20  ? 474  THR A N     1 
ATOM   3738  C  CA    . THR A  1  474 ? 128.864 -95.303  0.336   1.00 40.07  ? 474  THR A CA    1 
ATOM   3739  C  C     . THR A  1  474 ? 130.027 -95.033  1.285   1.00 36.31  ? 474  THR A C     1 
ATOM   3740  O  O     . THR A  1  474 ? 130.708 -95.976  1.701   1.00 39.07  ? 474  THR A O     1 
ATOM   3741  C  CB    . THR A  1  474 ? 129.301 -96.284  -0.755  1.00 43.01  ? 474  THR A CB    1 
ATOM   3742  O  OG1   . THR A  1  474 ? 130.504 -95.808  -1.367  1.00 45.99  ? 474  THR A OG1   1 
ATOM   3743  C  CG2   . THR A  1  474 ? 128.230 -96.402  -1.827  1.00 45.87  ? 474  THR A CG2   1 
ATOM   3744  N  N     . ALA A  1  475 ? 130.277 -93.773  1.629   1.00 40.21  ? 475  ALA A N     1 
ATOM   3745  C  CA    . ALA A  1  475 ? 131.372 -93.426  2.527   1.00 39.59  ? 475  ALA A CA    1 
ATOM   3746  C  C     . ALA A  1  475 ? 130.941 -92.303  3.459   1.00 39.33  ? 475  ALA A C     1 
ATOM   3747  O  O     . ALA A  1  475 ? 130.032 -92.478  4.277   1.00 50.30  ? 475  ALA A O     1 
ATOM   3748  C  CB    . ALA A  1  475 ? 132.618 -93.023  1.732   1.00 42.18  ? 475  ALA A CB    1 
ATOM   3749  N  N     . ILE A  1  476 ? 131.575 -91.142  3.339   1.00 36.15  ? 476  ILE A N     1 
ATOM   3750  C  CA    . ILE A  1  476 ? 131.158 -89.969  4.098   1.00 36.12  ? 476  ILE A CA    1 
ATOM   3751  C  C     . ILE A  1  476 ? 130.024 -89.302  3.324   1.00 36.96  ? 476  ILE A C     1 
ATOM   3752  O  O     . ILE A  1  476 ? 130.247 -88.685  2.279   1.00 35.02  ? 476  ILE A O     1 
ATOM   3753  C  CB    . ILE A  1  476 ? 132.329 -89.009  4.335   1.00 42.26  ? 476  ILE A CB    1 
ATOM   3754  C  CG1   . ILE A  1  476 ? 133.415 -89.712  5.154   1.00 39.19  ? 476  ILE A CG1   1 
ATOM   3755  C  CG2   . ILE A  1  476 ? 131.856 -87.741  5.032   1.00 34.89  ? 476  ILE A CG2   1 
ATOM   3756  C  CD1   . ILE A  1  476 ? 134.740 -88.996  5.166   1.00 35.36  ? 476  ILE A CD1   1 
ATOM   3757  N  N     . GLN A  1  477 ? 128.804 -89.428  3.838   1.00 42.98  ? 477  GLN A N     1 
ATOM   3758  C  CA    . GLN A  1  477 ? 127.607 -89.049  3.103   1.00 43.05  ? 477  GLN A CA    1 
ATOM   3759  C  C     . GLN A  1  477 ? 127.260 -87.579  3.293   1.00 49.90  ? 477  GLN A C     1 
ATOM   3760  O  O     . GLN A  1  477 ? 127.378 -87.033  4.394   1.00 52.64  ? 477  GLN A O     1 
ATOM   3761  C  CB    . GLN A  1  477 ? 126.424 -89.910  3.538   1.00 35.83  ? 477  GLN A CB    1 
ATOM   3762  C  CG    . GLN A  1  477 ? 126.595 -91.387  3.253   1.00 39.68  ? 477  GLN A CG    1 
ATOM   3763  C  CD    . GLN A  1  477 ? 125.358 -92.174  3.612   1.00 42.17  ? 477  GLN A CD    1 
ATOM   3764  O  OE1   . GLN A  1  477 ? 124.238 -91.714  3.394   1.00 48.02  ? 477  GLN A OE1   1 
ATOM   3765  N  NE2   . GLN A  1  477 ? 125.549 -93.357  4.186   1.00 37.74  ? 477  GLN A NE2   1 
ATOM   3766  N  N     . LEU A  1  478 ? 126.812 -86.952  2.204   1.00 42.06  ? 478  LEU A N     1 
ATOM   3767  C  CA    . LEU A  1  478 ? 126.288 -85.587  2.182   1.00 34.15  ? 478  LEU A CA    1 
ATOM   3768  C  C     . LEU A  1  478 ? 124.859 -85.672  1.651   1.00 38.26  ? 478  LEU A C     1 
ATOM   3769  O  O     . LEU A  1  478 ? 124.596 -85.347  0.492   1.00 49.47  ? 478  LEU A O     1 
ATOM   3770  C  CB    . LEU A  1  478 ? 127.169 -84.655  1.298   1.00 43.06  ? 478  LEU A CB    1 
ATOM   3771  C  CG    . LEU A  1  478 ? 128.676 -84.619  1.560   1.00 44.75  ? 478  LEU A CG    1 
ATOM   3772  C  CD1   . LEU A  1  478 ? 129.401 -83.781  0.507   1.00 30.81  ? 478  LEU A CD1   1 
ATOM   3773  C  CD2   . LEU A  1  478 ? 128.958 -84.097  2.959   1.00 33.82  ? 478  LEU A CD2   1 
ATOM   3774  N  N     . GLN A  1  479 ? 123.937 -86.122  2.498   1.00 40.19  ? 479  GLN A N     1 
ATOM   3775  C  CA    . GLN A  1  479 ? 122.557 -86.315  2.051   1.00 41.48  ? 479  GLN A CA    1 
ATOM   3776  C  C     . GLN A  1  479 ? 121.814 -84.984  2.025   1.00 42.66  ? 479  GLN A C     1 
ATOM   3777  O  O     . GLN A  1  479 ? 121.861 -84.236  3.008   1.00 46.66  ? 479  GLN A O     1 
ATOM   3778  C  CB    . GLN A  1  479 ? 121.819 -87.302  2.957   1.00 37.70  ? 479  GLN A CB    1 
ATOM   3779  C  CG    . GLN A  1  479 ? 122.299 -88.740  2.839   1.00 34.58  ? 479  GLN A CG    1 
ATOM   3780  C  CD    . GLN A  1  479 ? 122.110 -89.306  1.441   1.00 42.60  ? 479  GLN A CD    1 
ATOM   3781  O  OE1   . GLN A  1  479 ? 121.229 -88.875  0.698   1.00 44.67  ? 479  GLN A OE1   1 
ATOM   3782  N  NE2   . GLN A  1  479 ? 122.944 -90.276  1.076   1.00 37.15  ? 479  GLN A NE2   1 
ATOM   3783  N  N     . PRO A  1  480 ? 121.129 -84.649  0.920   1.00 39.65  ? 480  PRO A N     1 
ATOM   3784  C  CA    . PRO A  1  480 ? 120.278 -83.440  0.846   1.00 34.37  ? 480  PRO A CA    1 
ATOM   3785  C  C     . PRO A  1  480 ? 118.907 -83.682  1.471   1.00 39.96  ? 480  PRO A C     1 
ATOM   3786  O  O     . PRO A  1  480 ? 117.884 -83.849  0.801   1.00 44.52  ? 480  PRO A O     1 
ATOM   3787  C  CB    . PRO A  1  480 ? 120.186 -83.187  -0.660  1.00 33.43  ? 480  PRO A CB    1 
ATOM   3788  C  CG    . PRO A  1  480 ? 120.304 -84.529  -1.264  1.00 33.86  ? 480  PRO A CG    1 
ATOM   3789  C  CD    . PRO A  1  480 ? 121.238 -85.323  -0.384  1.00 35.73  ? 480  PRO A CD    1 
ATOM   3790  N  N     . ILE A  1  481 ? 118.887 -83.683  2.806   1.00 40.13  ? 481  ILE A N     1 
ATOM   3791  C  CA    . ILE A  1  481 ? 117.733 -84.204  3.533   1.00 40.99  ? 481  ILE A CA    1 
ATOM   3792  C  C     . ILE A  1  481 ? 116.529 -83.277  3.419   1.00 39.91  ? 481  ILE A C     1 
ATOM   3793  O  O     . ILE A  1  481 ? 115.380 -83.728  3.512   1.00 49.98  ? 481  ILE A O     1 
ATOM   3794  C  CB    . ILE A  1  481 ? 118.114 -84.470  5.000   1.00 41.04  ? 481  ILE A CB    1 
ATOM   3795  C  CG1   . ILE A  1  481 ? 118.611 -83.191  5.673   1.00 46.38  ? 481  ILE A CG1   1 
ATOM   3796  C  CG2   . ILE A  1  481 ? 119.181 -85.554  5.075   1.00 40.93  ? 481  ILE A CG2   1 
ATOM   3797  C  CD1   . ILE A  1  481 ? 118.820 -83.336  7.165   1.00 40.59  ? 481  ILE A CD1   1 
ATOM   3798  N  N     . PHE A  1  482 ? 116.756 -81.983  3.196   1.00 33.09  ? 482  PHE A N     1 
ATOM   3799  C  CA    . PHE A  1  482 ? 115.633 -81.062  3.068   1.00 43.38  ? 482  PHE A CA    1 
ATOM   3800  C  C     . PHE A  1  482 ? 114.909 -81.255  1.741   1.00 46.65  ? 482  PHE A C     1 
ATOM   3801  O  O     . PHE A  1  482 ? 113.672 -81.226  1.691   1.00 56.70  ? 482  PHE A O     1 
ATOM   3802  C  CB    . PHE A  1  482 ? 116.120 -79.624  3.224   1.00 48.78  ? 482  PHE A CB    1 
ATOM   3803  C  CG    . PHE A  1  482 ? 116.860 -79.377  4.506   1.00 48.17  ? 482  PHE A CG    1 
ATOM   3804  C  CD1   . PHE A  1  482 ? 116.236 -79.565  5.729   1.00 46.74  ? 482  PHE A CD1   1 
ATOM   3805  C  CD2   . PHE A  1  482 ? 118.178 -78.952  4.489   1.00 48.14  ? 482  PHE A CD2   1 
ATOM   3806  C  CE1   . PHE A  1  482 ? 116.913 -79.337  6.911   1.00 49.75  ? 482  PHE A CE1   1 
ATOM   3807  C  CE2   . PHE A  1  482 ? 118.861 -78.726  5.666   1.00 52.74  ? 482  PHE A CE2   1 
ATOM   3808  C  CZ    . PHE A  1  482 ? 118.228 -78.918  6.879   1.00 51.82  ? 482  PHE A CZ    1 
ATOM   3809  N  N     . ALA A  1  483 ? 115.658 -81.464  0.656   1.00 39.95  ? 483  ALA A N     1 
ATOM   3810  C  CA    . ALA A  1  483 ? 115.021 -81.754  -0.625  1.00 43.17  ? 483  ALA A CA    1 
ATOM   3811  C  C     . ALA A  1  483 ? 114.285 -83.089  -0.584  1.00 44.84  ? 483  ALA A C     1 
ATOM   3812  O  O     . ALA A  1  483 ? 113.188 -83.214  -1.140  1.00 51.33  ? 483  ALA A O     1 
ATOM   3813  C  CB    . ALA A  1  483 ? 116.058 -81.740  -1.745  1.00 32.85  ? 483  ALA A CB    1 
ATOM   3814  N  N     . GLN A  1  484 ? 114.875 -84.098  0.069   1.00 43.87  ? 484  GLN A N     1 
ATOM   3815  C  CA    . GLN A  1  484 ? 114.192 -85.377  0.250   1.00 38.68  ? 484  GLN A CA    1 
ATOM   3816  C  C     . GLN A  1  484 ? 112.894 -85.200  1.026   1.00 42.14  ? 484  GLN A C     1 
ATOM   3817  O  O     . GLN A  1  484 ? 111.866 -85.806  0.692   1.00 51.22  ? 484  GLN A O     1 
ATOM   3818  C  CB    . GLN A  1  484 ? 115.112 -86.363  0.977   1.00 38.80  ? 484  GLN A CB    1 
ATOM   3819  C  CG    . GLN A  1  484 ? 116.444 -86.620  0.285   1.00 41.69  ? 484  GLN A CG    1 
ATOM   3820  C  CD    . GLN A  1  484 ? 117.464 -87.315  1.183   1.00 49.79  ? 484  GLN A CD    1 
ATOM   3821  O  OE1   . GLN A  1  484 ? 117.379 -87.254  2.411   1.00 43.89  ? 484  GLN A OE1   1 
ATOM   3822  N  NE2   . GLN A  1  484 ? 118.440 -87.975  0.566   1.00 38.34  ? 484  GLN A NE2   1 
ATOM   3823  N  N     . TRP A  1  485 ? 112.924 -84.360  2.064   1.00 46.14  ? 485  TRP A N     1 
ATOM   3824  C  CA    . TRP A  1  485 ? 111.737 -84.129  2.877   1.00 49.80  ? 485  TRP A CA    1 
ATOM   3825  C  C     . TRP A  1  485 ? 110.646 -83.425  2.075   1.00 47.59  ? 485  TRP A C     1 
ATOM   3826  O  O     . TRP A  1  485 ? 109.468 -83.794  2.165   1.00 45.54  ? 485  TRP A O     1 
ATOM   3827  C  CB    . TRP A  1  485 ? 112.120 -83.331  4.125   1.00 47.95  ? 485  TRP A CB    1 
ATOM   3828  C  CG    . TRP A  1  485 ? 110.973 -83.006  5.033   1.00 53.71  ? 485  TRP A CG    1 
ATOM   3829  C  CD1   . TRP A  1  485 ? 110.218 -83.887  5.752   1.00 56.03  ? 485  TRP A CD1   1 
ATOM   3830  C  CD2   . TRP A  1  485 ? 110.462 -81.702  5.332   1.00 44.68  ? 485  TRP A CD2   1 
ATOM   3831  N  NE1   . TRP A  1  485 ? 109.261 -83.212  6.472   1.00 53.80  ? 485  TRP A NE1   1 
ATOM   3832  C  CE2   . TRP A  1  485 ? 109.389 -81.870  6.232   1.00 47.16  ? 485  TRP A CE2   1 
ATOM   3833  C  CE3   . TRP A  1  485 ? 110.804 -80.409  4.924   1.00 38.53  ? 485  TRP A CE3   1 
ATOM   3834  C  CZ2   . TRP A  1  485 ? 108.658 -80.793  6.731   1.00 50.05  ? 485  TRP A CZ2   1 
ATOM   3835  C  CZ3   . TRP A  1  485 ? 110.077 -79.342  5.419   1.00 45.17  ? 485  TRP A CZ3   1 
ATOM   3836  C  CH2   . TRP A  1  485 ? 109.016 -79.541  6.313   1.00 50.01  ? 485  TRP A CH2   1 
ATOM   3837  N  N     . VAL A  1  486 ? 111.016 -82.433  1.262   1.00 38.36  ? 486  VAL A N     1 
ATOM   3838  C  CA    . VAL A  1  486 ? 110.008 -81.747  0.455   1.00 40.00  ? 486  VAL A CA    1 
ATOM   3839  C  C     . VAL A  1  486 ? 109.458 -82.674  -0.631  1.00 48.27  ? 486  VAL A C     1 
ATOM   3840  O  O     . VAL A  1  486 ? 108.269 -82.617  -0.969  1.00 39.24  ? 486  VAL A O     1 
ATOM   3841  C  CB    . VAL A  1  486 ? 110.573 -80.444  -0.138  1.00 43.92  ? 486  VAL A CB    1 
ATOM   3842  C  CG1   . VAL A  1  486 ? 109.484 -79.705  -0.863  1.00 48.54  ? 486  VAL A CG1   1 
ATOM   3843  C  CG2   . VAL A  1  486 ? 111.125 -79.555  0.961   1.00 39.39  ? 486  VAL A CG2   1 
ATOM   3844  N  N     . GLN A  1  487 ? 110.305 -83.544  -1.193  1.00 43.86  ? 487  GLN A N     1 
ATOM   3845  C  CA    . GLN A  1  487 ? 109.815 -84.533  -2.150  1.00 40.52  ? 487  GLN A CA    1 
ATOM   3846  C  C     . GLN A  1  487 ? 108.793 -85.459  -1.505  1.00 48.11  ? 487  GLN A C     1 
ATOM   3847  O  O     . GLN A  1  487 ? 107.751 -85.770  -2.102  1.00 42.98  ? 487  GLN A O     1 
ATOM   3848  C  CB    . GLN A  1  487 ? 110.979 -85.349  -2.711  1.00 38.54  ? 487  GLN A CB    1 
ATOM   3849  C  CG    . GLN A  1  487 ? 111.803 -84.645  -3.769  1.00 44.31  ? 487  GLN A CG    1 
ATOM   3850  C  CD    . GLN A  1  487 ? 112.827 -85.568  -4.402  1.00 53.80  ? 487  GLN A CD    1 
ATOM   3851  O  OE1   . GLN A  1  487 ? 113.195 -86.593  -3.827  1.00 56.71  ? 487  GLN A OE1   1 
ATOM   3852  N  NE2   . GLN A  1  487 ? 113.286 -85.214  -5.596  1.00 56.04  ? 487  GLN A NE2   1 
ATOM   3853  N  N     . HIS A  1  488 ? 109.082 -85.914  -0.285  1.00 56.10  ? 488  HIS A N     1 
ATOM   3854  C  CA    . HIS A  1  488 ? 108.122 -86.736  0.443   1.00 49.89  ? 488  HIS A CA    1 
ATOM   3855  C  C     . HIS A  1  488 ? 106.825 -85.974  0.684   1.00 43.92  ? 488  HIS A C     1 
ATOM   3856  O  O     . HIS A  1  488 ? 105.731 -86.530  0.529   1.00 50.48  ? 488  HIS A O     1 
ATOM   3857  C  CB    . HIS A  1  488 ? 108.736 -87.201  1.764   1.00 48.86  ? 488  HIS A CB    1 
ATOM   3858  C  CG    . HIS A  1  488 ? 107.873 -88.151  2.531   1.00 50.25  ? 488  HIS A CG    1 
ATOM   3859  N  ND1   . HIS A  1  488 ? 107.257 -89.236  1.945   1.00 57.27  ? 488  HIS A ND1   1 
ATOM   3860  C  CD2   . HIS A  1  488 ? 107.524 -88.181  3.838   1.00 52.48  ? 488  HIS A CD2   1 
ATOM   3861  C  CE1   . HIS A  1  488 ? 106.564 -89.892  2.858   1.00 60.10  ? 488  HIS A CE1   1 
ATOM   3862  N  NE2   . HIS A  1  488 ? 106.711 -89.274  4.016   1.00 55.50  ? 488  HIS A NE2   1 
ATOM   3863  N  N     . LEU A  1  489 ? 106.929 -84.695  1.056   1.00 39.23  ? 489  LEU A N     1 
ATOM   3864  C  CA    . LEU A  1  489 ? 105.737 -83.878  1.264   1.00 39.88  ? 489  LEU A CA    1 
ATOM   3865  C  C     . LEU A  1  489 ? 104.899 -83.790  -0.005  1.00 42.90  ? 489  LEU A C     1 
ATOM   3866  O  O     . LEU A  1  489 ? 103.667 -83.883  0.047   1.00 44.27  ? 489  LEU A O     1 
ATOM   3867  C  CB    . LEU A  1  489 ? 106.134 -82.481  1.741   1.00 41.75  ? 489  LEU A CB    1 
ATOM   3868  C  CG    . LEU A  1  489 ? 106.584 -82.377  3.198   1.00 50.56  ? 489  LEU A CG    1 
ATOM   3869  C  CD1   . LEU A  1  489 ? 107.190 -81.012  3.485   1.00 53.75  ? 489  LEU A CD1   1 
ATOM   3870  C  CD2   . LEU A  1  489 ? 105.405 -82.635  4.108   1.00 51.00  ? 489  LEU A CD2   1 
ATOM   3871  N  N     . HIS A  1  490 ? 105.552 -83.614  -1.154  1.00 40.38  ? 490  HIS A N     1 
ATOM   3872  C  CA    . HIS A  1  490 ? 104.824 -83.580  -2.419  1.00 42.16  ? 490  HIS A CA    1 
ATOM   3873  C  C     . HIS A  1  490 ? 104.157 -84.916  -2.710  1.00 39.33  ? 490  HIS A C     1 
ATOM   3874  O  O     . HIS A  1  490 ? 103.056 -84.960  -3.271  1.00 44.48  ? 490  HIS A O     1 
ATOM   3875  C  CB    . HIS A  1  490 ? 105.761 -83.209  -3.565  1.00 41.08  ? 490  HIS A CB    1 
ATOM   3876  C  CG    . HIS A  1  490 ? 106.314 -81.825  -3.472  1.00 41.29  ? 490  HIS A CG    1 
ATOM   3877  N  ND1   . HIS A  1  490 ? 107.064 -81.259  -4.479  1.00 49.31  ? 490  HIS A ND1   1 
ATOM   3878  C  CD2   . HIS A  1  490 ? 106.236 -80.895  -2.492  1.00 45.19  ? 490  HIS A CD2   1 
ATOM   3879  C  CE1   . HIS A  1  490 ? 107.423 -80.038  -4.126  1.00 46.48  ? 490  HIS A CE1   1 
ATOM   3880  N  NE2   . HIS A  1  490 ? 106.938 -79.796  -2.923  1.00 46.72  ? 490  HIS A NE2   1 
ATOM   3881  N  N     . THR A  1  491 ? 104.816 -86.020  -2.356  1.00 39.55  ? 491  THR A N     1 
ATOM   3882  C  CA    . THR A  1  491 ? 104.246 -87.330  -2.650  1.00 40.42  ? 491  THR A CA    1 
ATOM   3883  C  C     . THR A  1  491 ? 103.039 -87.619  -1.763  1.00 47.07  ? 491  THR A C     1 
ATOM   3884  O  O     . THR A  1  491 ? 102.064 -88.236  -2.210  1.00 50.79  ? 491  THR A O     1 
ATOM   3885  C  CB    . THR A  1  491 ? 105.323 -88.401  -2.496  1.00 42.44  ? 491  THR A CB    1 
ATOM   3886  O  OG1   . THR A  1  491 ? 106.420 -88.076  -3.359  1.00 41.23  ? 491  THR A OG1   1 
ATOM   3887  C  CG2   . THR A  1  491 ? 104.788 -89.774  -2.871  1.00 41.23  ? 491  THR A CG2   1 
ATOM   3888  N  N     . LEU A  1  492 ? 103.079 -87.162  -0.513  1.00 50.09  ? 492  LEU A N     1 
ATOM   3889  C  CA    . LEU A  1  492 ? 101.950 -87.321  0.391   1.00 42.05  ? 492  LEU A CA    1 
ATOM   3890  C  C     . LEU A  1  492 ? 100.822 -86.345  0.096   1.00 49.97  ? 492  LEU A C     1 
ATOM   3891  O  O     . LEU A  1  492 ? 99.690  -86.573  0.541   1.00 44.37  ? 492  LEU A O     1 
ATOM   3892  C  CB    . LEU A  1  492 ? 102.408 -87.134  1.837   1.00 46.47  ? 492  LEU A CB    1 
ATOM   3893  C  CG    . LEU A  1  492 ? 103.482 -88.095  2.340   1.00 49.28  ? 492  LEU A CG    1 
ATOM   3894  C  CD1   . LEU A  1  492 ? 103.796 -87.810  3.798   1.00 51.01  ? 492  LEU A CD1   1 
ATOM   3895  C  CD2   . LEU A  1  492 ? 103.037 -89.539  2.145   1.00 44.37  ? 492  LEU A CD2   1 
ATOM   3896  N  N     . ALA A  1  493 ? 101.105 -85.274  -0.644  1.00 55.04  ? 493  ALA A N     1 
ATOM   3897  C  CA    . ALA A  1  493 ? 100.132 -84.196  -0.799  1.00 56.73  ? 493  ALA A CA    1 
ATOM   3898  C  C     . ALA A  1  493 ? 98.807  -84.628  -1.417  1.00 49.98  ? 493  ALA A C     1 
ATOM   3899  O  O     . ALA A  1  493 ? 97.760  -84.211  -0.891  1.00 46.84  ? 493  ALA A O     1 
ATOM   3900  C  CB    . ALA A  1  493 ? 100.754 -83.053  -1.607  1.00 51.01  ? 493  ALA A CB    1 
ATOM   3901  N  N     . PRO A  1  494 ? 98.759  -85.424  -2.497  1.00 47.67  ? 494  PRO A N     1 
ATOM   3902  C  CA    . PRO A  1  494 ? 97.450  -85.790  -3.071  1.00 50.22  ? 494  PRO A CA    1 
ATOM   3903  C  C     . PRO A  1  494 ? 96.456  -86.341  -2.064  1.00 55.65  ? 494  PRO A C     1 
ATOM   3904  O  O     . PRO A  1  494 ? 95.244  -86.188  -2.260  1.00 66.25  ? 494  PRO A O     1 
ATOM   3905  C  CB    . PRO A  1  494 ? 97.820  -86.840  -4.125  1.00 47.95  ? 494  PRO A CB    1 
ATOM   3906  C  CG    . PRO A  1  494 ? 99.182  -86.445  -4.556  1.00 47.01  ? 494  PRO A CG    1 
ATOM   3907  C  CD    . PRO A  1  494 ? 99.868  -85.948  -3.318  1.00 44.52  ? 494  PRO A CD    1 
ATOM   3908  N  N     . GLY A  1  495 ? 96.922  -86.957  -0.983  1.00 56.71  ? 495  GLY A N     1 
ATOM   3909  C  CA    . GLY A  1  495 ? 96.040  -87.509  0.020   1.00 63.58  ? 495  GLY A CA    1 
ATOM   3910  C  C     . GLY A  1  495 ? 95.852  -86.688  1.277   1.00 65.33  ? 495  GLY A C     1 
ATOM   3911  O  O     . GLY A  1  495 ? 95.083  -87.095  2.152   1.00 71.38  ? 495  GLY A O     1 
ATOM   3912  N  N     . ALA A  1  496 ? 96.523  -85.544  1.403   1.00 66.44  ? 496  ALA A N     1 
ATOM   3913  C  CA    . ALA A  1  496 ? 96.442  -84.773  2.638   1.00 62.12  ? 496  ALA A CA    1 
ATOM   3914  C  C     . ALA A  1  496 ? 96.301  -83.284  2.358   1.00 54.86  ? 496  ALA A C     1 
ATOM   3915  O  O     . ALA A  1  496 ? 95.207  -82.721  2.473   1.00 49.45  ? 496  ALA A O     1 
ATOM   3916  C  CB    . ALA A  1  496 ? 97.675  -85.028  3.508   1.00 61.72  ? 496  ALA A CB    1 
ATOM   3917  N  N     . THR A  1  497 ? 97.405  -82.638  1.997   1.00 55.99  ? 497  THR A N     1 
ATOM   3918  C  CA    . THR A  1  497 ? 97.420  -81.205  1.753   1.00 55.98  ? 497  THR A CA    1 
ATOM   3919  C  C     . THR A  1  497 ? 97.124  -80.855  0.295   1.00 56.08  ? 497  THR A C     1 
ATOM   3920  O  O     . THR A  1  497 ? 97.465  -79.760  -0.160  1.00 55.97  ? 497  THR A O     1 
ATOM   3921  C  CB    . THR A  1  497 ? 98.763  -80.628  2.191   1.00 48.65  ? 497  THR A CB    1 
ATOM   3922  O  OG1   . THR A  1  497 ? 99.814  -81.326  1.516   1.00 50.20  ? 497  THR A OG1   1 
ATOM   3923  C  CG2   . THR A  1  497 ? 98.934  -80.808  3.690   1.00 48.60  ? 497  THR A CG2   1 
ATOM   3924  N  N     . ALA A  1  498 ? 96.510  -81.764  -0.439  1.00 59.05  ? 498  ALA A N     1 
ATOM   3925  C  CA    . ALA A  1  498 ? 95.970  -81.482  -1.760  1.00 53.85  ? 498  ALA A CA    1 
ATOM   3926  C  C     . ALA A  1  498 ? 94.876  -82.503  -2.037  1.00 51.31  ? 498  ALA A C     1 
ATOM   3927  O  O     . ALA A  1  498 ? 94.989  -83.287  -2.987  1.00 49.57  ? 498  ALA A O     1 
ATOM   3928  C  CB    . ALA A  1  498 ? 97.060  -81.540  -2.830  1.00 42.50  ? 498  ALA A CB    1 
ATOM   3929  N  N     . PRO A  1  499 ? 93.811  -82.522  -1.226  1.00 52.57  ? 499  PRO A N     1 
ATOM   3930  C  CA    . PRO A  1  499 ? 92.848  -83.638  -1.308  1.00 56.97  ? 499  PRO A CA    1 
ATOM   3931  C  C     . PRO A  1  499 ? 92.233  -83.831  -2.684  1.00 55.10  ? 499  PRO A C     1 
ATOM   3932  O  O     . PRO A  1  499 ? 92.292  -84.937  -3.236  1.00 53.80  ? 499  PRO A O     1 
ATOM   3933  C  CB    . PRO A  1  499 ? 91.794  -83.254  -0.260  1.00 63.77  ? 499  PRO A CB    1 
ATOM   3934  C  CG    . PRO A  1  499 ? 92.499  -82.328  0.673   1.00 57.88  ? 499  PRO A CG    1 
ATOM   3935  C  CD    . PRO A  1  499 ? 93.443  -81.553  -0.179  1.00 50.69  ? 499  PRO A CD    1 
ATOM   3936  N  N     . ASN A  1  500 ? 91.646  -82.780  -3.259  1.00 60.29  ? 500  ASN A N     1 
ATOM   3937  C  CA    . ASN A  1  500 ? 90.967  -82.868  -4.552  1.00 57.89  ? 500  ASN A CA    1 
ATOM   3938  C  C     . ASN A  1  500 ? 91.921  -83.063  -5.721  1.00 51.26  ? 500  ASN A C     1 
ATOM   3939  O  O     . ASN A  1  500 ? 91.512  -82.858  -6.870  1.00 47.20  ? 500  ASN A O     1 
ATOM   3940  C  CB    . ASN A  1  500 ? 90.120  -81.617  -4.778  1.00 58.22  ? 500  ASN A CB    1 
ATOM   3941  C  CG    . ASN A  1  500 ? 89.390  -81.177  -3.527  1.00 58.07  ? 500  ASN A CG    1 
ATOM   3942  O  OD1   . ASN A  1  500 ? 89.101  -81.986  -2.646  1.00 55.07  ? 500  ASN A OD1   1 
ATOM   3943  N  ND2   . ASN A  1  500 ? 89.093  -79.885  -3.439  1.00 62.54  ? 500  ASN A ND2   1 
ATOM   3944  N  N     . ALA A  1  501 ? 93.175  -83.426  -5.481  1.00 48.43  ? 501  ALA A N     1 
ATOM   3945  C  CA    . ALA A  1  501 ? 94.093  -83.826  -6.533  1.00 46.35  ? 501  ALA A CA    1 
ATOM   3946  C  C     . ALA A  1  501 ? 94.262  -85.337  -6.477  1.00 53.41  ? 501  ALA A C     1 
ATOM   3947  O  O     . ALA A  1  501 ? 94.394  -85.916  -5.396  1.00 54.88  ? 501  ALA A O     1 
ATOM   3948  C  CB    . ALA A  1  501 ? 95.449  -83.129  -6.387  1.00 45.08  ? 501  ALA A CB    1 
ATOM   3949  N  N     . LEU A  1  502 ? 94.232  -85.977  -7.643  1.00 52.47  ? 502  LEU A N     1 
ATOM   3950  C  CA    . LEU A  1  502 ? 94.305  -87.432  -7.673  1.00 58.06  ? 502  LEU A CA    1 
ATOM   3951  C  C     . LEU A  1  502 ? 95.739  -87.944  -7.627  1.00 54.25  ? 502  LEU A C     1 
ATOM   3952  O  O     . LEU A  1  502 ? 96.026  -88.913  -6.916  1.00 62.81  ? 502  LEU A O     1 
ATOM   3953  C  CB    . LEU A  1  502 ? 93.596  -87.970  -8.919  1.00 57.30  ? 502  LEU A CB    1 
ATOM   3954  C  CG    . LEU A  1  502 ? 92.081  -87.764  -9.013  1.00 53.04  ? 502  LEU A CG    1 
ATOM   3955  C  CD1   . LEU A  1  502 ? 91.553  -88.389  -10.295 1.00 52.69  ? 502  LEU A CD1   1 
ATOM   3956  C  CD2   . LEU A  1  502 ? 91.361  -88.328  -7.791  1.00 49.72  ? 502  LEU A CD2   1 
ATOM   3957  N  N     . ALA A  1  503 ? 96.643  -87.312  -8.364  1.00 46.82  ? 503  ALA A N     1 
ATOM   3958  C  CA    . ALA A  1  503 ? 98.037  -87.726  -8.436  1.00 46.05  ? 503  ALA A CA    1 
ATOM   3959  C  C     . ALA A  1  503 ? 98.945  -86.576  -8.007  1.00 48.12  ? 503  ALA A C     1 
ATOM   3960  O  O     . ALA A  1  503 ? 98.488  -85.493  -7.635  1.00 45.48  ? 503  ALA A O     1 
ATOM   3961  C  CB    . ALA A  1  503 ? 98.393  -88.203  -9.847  1.00 46.21  ? 503  ALA A CB    1 
ATOM   3962  N  N     . THR A  1  504 ? 100.248 -86.831  -8.059  1.00 45.38  ? 504  THR A N     1 
ATOM   3963  C  CA    . THR A  1  504 ? 101.237 -85.812  -7.751  1.00 41.62  ? 504  THR A CA    1 
ATOM   3964  C  C     . THR A  1  504 ? 101.289 -84.755  -8.850  1.00 46.08  ? 504  THR A C     1 
ATOM   3965  O  O     . THR A  1  504 ? 100.856 -84.970  -9.985  1.00 52.54  ? 504  THR A O     1 
ATOM   3966  C  CB    . THR A  1  504 ? 102.623 -86.440  -7.588  1.00 41.04  ? 504  THR A CB    1 
ATOM   3967  O  OG1   . THR A  1  504 ? 103.610 -85.408  -7.470  1.00 40.51  ? 504  THR A OG1   1 
ATOM   3968  C  CG2   . THR A  1  504 ? 102.960 -87.307  -8.788  1.00 41.34  ? 504  THR A CG2   1 
ATOM   3969  N  N     . ALA A  1  505 ? 101.844 -83.593  -8.499  1.00 43.89  ? 505  ALA A N     1 
ATOM   3970  C  CA    . ALA A  1  505 ? 102.093 -82.574  -9.510  1.00 41.63  ? 505  ALA A CA    1 
ATOM   3971  C  C     . ALA A  1  505 ? 103.195 -83.008  -10.464 1.00 42.52  ? 505  ALA A C     1 
ATOM   3972  O  O     . ALA A  1  505 ? 103.225 -82.570  -11.619 1.00 45.54  ? 505  ALA A O     1 
ATOM   3973  C  CB    . ALA A  1  505 ? 102.452 -81.247  -8.845  1.00 39.29  ? 505  ALA A CB    1 
ATOM   3974  N  N     . SER A  1  506 ? 104.090 -83.878  -10.005 1.00 43.28  ? 506  SER A N     1 
ATOM   3975  C  CA    . SER A  1  506 ? 105.195 -84.366  -10.814 1.00 41.82  ? 506  SER A CA    1 
ATOM   3976  C  C     . SER A  1  506 ? 105.715 -85.659  -10.206 1.00 42.16  ? 506  SER A C     1 
ATOM   3977  O  O     . SER A  1  506 ? 105.876 -85.754  -8.987  1.00 39.10  ? 506  SER A O     1 
ATOM   3978  C  CB    . SER A  1  506 ? 106.319 -83.334  -10.895 1.00 38.22  ? 506  SER A CB    1 
ATOM   3979  O  OG    . SER A  1  506 ? 107.514 -83.919  -11.378 1.00 39.87  ? 506  SER A OG    1 
ATOM   3980  N  N     . TYR A  1  507 ? 105.979 -86.649  -11.061 1.00 40.64  ? 507  TYR A N     1 
ATOM   3981  C  CA    . TYR A  1  507 ? 106.505 -87.921  -10.581 1.00 43.28  ? 507  TYR A CA    1 
ATOM   3982  C  C     . TYR A  1  507 ? 107.987 -87.854  -10.237 1.00 41.41  ? 507  TYR A C     1 
ATOM   3983  O  O     . TYR A  1  507 ? 108.512 -88.810  -9.659  1.00 40.81  ? 507  TYR A O     1 
ATOM   3984  C  CB    . TYR A  1  507 ? 106.239 -89.029  -11.610 1.00 41.58  ? 507  TYR A CB    1 
ATOM   3985  C  CG    . TYR A  1  507 ? 104.794 -89.475  -11.601 1.00 49.24  ? 507  TYR A CG    1 
ATOM   3986  C  CD1   . TYR A  1  507 ? 104.367 -90.496  -10.762 1.00 53.47  ? 507  TYR A CD1   1 
ATOM   3987  C  CD2   . TYR A  1  507 ? 103.848 -88.845  -12.398 1.00 50.93  ? 507  TYR A CD2   1 
ATOM   3988  C  CE1   . TYR A  1  507 ? 103.045 -90.889  -10.733 1.00 58.77  ? 507  TYR A CE1   1 
ATOM   3989  C  CE2   . TYR A  1  507 ? 102.527 -89.230  -12.372 1.00 51.26  ? 507  TYR A CE2   1 
ATOM   3990  C  CZ    . TYR A  1  507 ? 102.130 -90.251  -11.542 1.00 56.86  ? 507  TYR A CZ    1 
ATOM   3991  O  OH    . TYR A  1  507 ? 100.809 -90.634  -11.524 1.00 62.58  ? 507  TYR A OH    1 
ATOM   3992  N  N     . ALA A  1  508 ? 108.664 -86.750  -10.558 1.00 38.35  ? 508  ALA A N     1 
ATOM   3993  C  CA    . ALA A  1  508 ? 110.048 -86.581  -10.130 1.00 37.57  ? 508  ALA A CA    1 
ATOM   3994  C  C     . ALA A  1  508 ? 110.156 -86.562  -8.611  1.00 42.53  ? 508  ALA A C     1 
ATOM   3995  O  O     . ALA A  1  508 ? 111.140 -87.054  -8.045  1.00 53.83  ? 508  ALA A O     1 
ATOM   3996  C  CB    . ALA A  1  508 ? 110.626 -85.297  -10.726 1.00 36.90  ? 508  ALA A CB    1 
ATOM   3997  N  N     . PHE A  1  509 ? 109.154 -85.995  -7.930  1.00 46.89  ? 509  PHE A N     1 
ATOM   3998  C  CA    . PHE A  1  509 ? 109.153 -85.980  -6.471  1.00 48.23  ? 509  PHE A CA    1 
ATOM   3999  C  C     . PHE A  1  509 ? 108.962 -87.371  -5.883  1.00 44.64  ? 509  PHE A C     1 
ATOM   4000  O  O     . PHE A  1  509 ? 109.301 -87.590  -4.714  1.00 53.08  ? 509  PHE A O     1 
ATOM   4001  C  CB    . PHE A  1  509 ? 108.055 -85.053  -5.932  1.00 44.26  ? 509  PHE A CB    1 
ATOM   4002  C  CG    . PHE A  1  509 ? 108.132 -83.636  -6.441  1.00 42.69  ? 509  PHE A CG    1 
ATOM   4003  C  CD1   . PHE A  1  509 ? 109.259 -82.855  -6.216  1.00 40.54  ? 509  PHE A CD1   1 
ATOM   4004  C  CD2   . PHE A  1  509 ? 107.061 -83.075  -7.124  1.00 37.36  ? 509  PHE A CD2   1 
ATOM   4005  C  CE1   . PHE A  1  509 ? 109.324 -81.546  -6.683  1.00 39.25  ? 509  PHE A CE1   1 
ATOM   4006  C  CE2   . PHE A  1  509 ? 107.117 -81.769  -7.589  1.00 36.81  ? 509  PHE A CE2   1 
ATOM   4007  C  CZ    . PHE A  1  509 ? 108.249 -81.002  -7.365  1.00 35.98  ? 509  PHE A CZ    1 
ATOM   4008  N  N     . GLY A  1  510 ? 108.425 -88.309  -6.656  1.00 39.10  ? 510  GLY A N     1 
ATOM   4009  C  CA    . GLY A  1  510 ? 108.179 -89.648  -6.161  1.00 45.03  ? 510  GLY A CA    1 
ATOM   4010  C  C     . GLY A  1  510 ? 106.884 -90.244  -6.675  1.00 50.96  ? 510  GLY A C     1 
ATOM   4011  O  O     . GLY A  1  510 ? 106.056 -89.540  -7.262  1.00 56.01  ? 510  GLY A O     1 
ATOM   4012  N  N     . GLY A  1  511 ? 106.698 -91.543  -6.463  1.00 47.82  ? 511  GLY A N     1 
ATOM   4013  C  CA    . GLY A  1  511 ? 105.493 -92.205  -6.920  1.00 52.54  ? 511  GLY A CA    1 
ATOM   4014  C  C     . GLY A  1  511 ? 105.729 -93.199  -8.039  1.00 53.13  ? 511  GLY A C     1 
ATOM   4015  O  O     . GLY A  1  511 ? 106.782 -93.840  -8.098  1.00 59.46  ? 511  GLY A O     1 
ATOM   4016  N  N     . GLU A  1  512 ? 104.758 -93.326  -8.939  1.00 52.01  ? 512  GLU A N     1 
ATOM   4017  C  CA    . GLU A  1  512 ? 104.818 -94.340  -9.979  1.00 56.29  ? 512  GLU A CA    1 
ATOM   4018  C  C     . GLU A  1  512 ? 105.866 -93.979  -11.032 1.00 53.10  ? 512  GLU A C     1 
ATOM   4019  O  O     . GLU A  1  512 ? 106.404 -92.869  -11.065 1.00 57.37  ? 512  GLU A O     1 
ATOM   4020  C  CB    . GLU A  1  512 ? 103.445 -94.520  -10.632 1.00 58.87  ? 512  GLU A CB    1 
ATOM   4021  C  CG    . GLU A  1  512 ? 102.431 -95.283  -9.784  1.00 64.06  ? 512  GLU A CG    1 
ATOM   4022  C  CD    . GLU A  1  512 ? 101.735 -94.412  -8.751  1.00 78.60  ? 512  GLU A CD    1 
ATOM   4023  O  OE1   . GLU A  1  512 ? 102.063 -93.209  -8.649  1.00 80.65  ? 512  GLU A OE1   1 
ATOM   4024  O  OE2   . GLU A  1  512 ? 100.849 -94.936  -8.042  1.00 84.71  ? 512  GLU A OE2   1 
ATOM   4025  N  N     . THR A  1  513 ? 106.156 -94.948  -11.899 1.00 54.64  ? 513  THR A N     1 
ATOM   4026  C  CA    . THR A  1  513 ? 107.087 -94.790  -13.015 1.00 50.08  ? 513  THR A CA    1 
ATOM   4027  C  C     . THR A  1  513 ? 106.257 -94.763  -14.296 1.00 50.56  ? 513  THR A C     1 
ATOM   4028  O  O     . THR A  1  513 ? 105.879 -95.811  -14.826 1.00 64.20  ? 513  THR A O     1 
ATOM   4029  C  CB    . THR A  1  513 ? 108.122 -95.918  -13.024 1.00 52.73  ? 513  THR A CB    1 
ATOM   4030  O  OG1   . THR A  1  513 ? 109.011 -95.763  -11.911 1.00 42.86  ? 513  THR A OG1   1 
ATOM   4031  C  CG2   . THR A  1  513 ? 108.934 -95.927  -14.322 1.00 43.52  ? 513  THR A CG2   1 
ATOM   4032  N  N     . ILE A  1  514 ? 105.959 -93.563  -14.780 1.00 49.93  ? 514  ILE A N     1 
ATOM   4033  C  CA    . ILE A  1  514 ? 105.167 -93.404  -15.995 1.00 53.02  ? 514  ILE A CA    1 
ATOM   4034  C  C     . ILE A  1  514 ? 106.052 -93.644  -17.211 1.00 58.82  ? 514  ILE A C     1 
ATOM   4035  O  O     . ILE A  1  514 ? 107.017 -92.904  -17.453 1.00 57.94  ? 514  ILE A O     1 
ATOM   4036  C  CB    . ILE A  1  514 ? 104.506 -92.022  -16.056 1.00 50.51  ? 514  ILE A CB    1 
ATOM   4037  C  CG1   . ILE A  1  514 ? 103.440 -91.911  -14.965 1.00 58.71  ? 514  ILE A CG1   1 
ATOM   4038  C  CG2   . ILE A  1  514 ? 103.910 -91.785  -17.441 1.00 45.47  ? 514  ILE A CG2   1 
ATOM   4039  C  CD1   . ILE A  1  514 ? 102.358 -90.914  -15.279 1.00 72.98  ? 514  ILE A CD1   1 
ATOM   4040  N  N     . ALA A  1  515 ? 105.709 -94.679  -17.979 1.00 65.69  ? 515  ALA A N     1 
ATOM   4041  C  CA    . ALA A  1  515 ? 106.411 -95.077  -19.189 1.00 61.67  ? 515  ALA A CA    1 
ATOM   4042  C  C     . ALA A  1  515 ? 105.409 -95.191  -20.325 1.00 55.05  ? 515  ALA A C     1 
ATOM   4043  O  O     . ALA A  1  515 ? 104.349 -95.803  -20.163 1.00 47.63  ? 515  ALA A O     1 
ATOM   4044  C  CB    . ALA A  1  515 ? 107.132 -96.413  -18.997 1.00 55.47  ? 515  ALA A CB    1 
ATOM   4045  N  N     . VAL A  1  516 ? 105.742 -94.594  -21.465 1.00 59.25  ? 516  VAL A N     1 
ATOM   4046  C  CA    . VAL A  1  516 ? 104.967 -94.709  -22.691 1.00 50.55  ? 516  VAL A CA    1 
ATOM   4047  C  C     . VAL A  1  516 ? 105.839 -95.412  -23.718 1.00 50.05  ? 516  VAL A C     1 
ATOM   4048  O  O     . VAL A  1  516 ? 107.033 -95.114  -23.830 1.00 48.20  ? 516  VAL A O     1 
ATOM   4049  C  CB    . VAL A  1  516 ? 104.504 -93.332  -23.209 1.00 54.42  ? 516  VAL A CB    1 
ATOM   4050  C  CG1   . VAL A  1  516 ? 103.741 -93.482  -24.509 1.00 49.39  ? 516  VAL A CG1   1 
ATOM   4051  C  CG2   . VAL A  1  516 ? 103.652 -92.638  -22.163 1.00 48.71  ? 516  VAL A CG2   1 
ATOM   4052  N  N     . ALA A  1  517 ? 105.241 -96.336  -24.463 1.00 51.82  ? 517  ALA A N     1 
ATOM   4053  C  CA    . ALA A  1  517 ? 105.982 -97.282  -25.314 1.00 49.83  ? 517  ALA A CA    1 
ATOM   4054  C  C     . ALA A  1  517 ? 106.905 -98.071  -24.377 1.00 62.54  ? 517  ALA A C     1 
ATOM   4055  O  O     . ALA A  1  517 ? 106.489 -98.450  -23.272 1.00 64.81  ? 517  ALA A O     1 
ATOM   4056  C  CB    . ALA A  1  517 ? 106.674 -96.559  -26.454 1.00 49.62  ? 517  ALA A CB    1 
ATOM   4057  N  N     . GLY A  1  518 ? 108.145 -98.342  -24.761 1.00 49.10  ? 518  GLY A N     1 
ATOM   4058  C  CA    . GLY A  1  518 ? 109.056 -99.046  -23.888 1.00 57.73  ? 518  GLY A CA    1 
ATOM   4059  C  C     . GLY A  1  518 ? 109.949 -98.155  -23.064 1.00 58.30  ? 518  GLY A C     1 
ATOM   4060  O  O     . GLY A  1  518 ? 110.799 -98.662  -22.329 1.00 57.95  ? 518  GLY A O     1 
ATOM   4061  N  N     . LYS A  1  519 ? 109.783 -96.840  -23.161 1.00 56.72  ? 519  LYS A N     1 
ATOM   4062  C  CA    . LYS A  1  519 ? 110.668 -95.876  -22.532 1.00 56.30  ? 519  LYS A CA    1 
ATOM   4063  C  C     . LYS A  1  519 ? 109.945 -95.156  -21.403 1.00 57.62  ? 519  LYS A C     1 
ATOM   4064  O  O     . LYS A  1  519 ? 108.732 -94.941  -21.457 1.00 59.18  ? 519  LYS A O     1 
ATOM   4065  C  CB    . LYS A  1  519 ? 111.173 -94.864  -23.561 1.00 55.11  ? 519  LYS A CB    1 
ATOM   4066  C  CG    . LYS A  1  519 ? 112.124 -95.456  -24.581 1.00 52.32  ? 519  LYS A CG    1 
ATOM   4067  C  CD    . LYS A  1  519 ? 111.741 -95.057  -25.993 1.00 53.13  ? 519  LYS A CD    1 
ATOM   4068  C  CE    . LYS A  1  519 ? 111.638 -93.551  -26.143 1.00 52.55  ? 519  LYS A CE    1 
ATOM   4069  N  NZ    . LYS A  1  519 ? 112.868 -92.847  -25.691 1.00 44.45  ? 519  LYS A NZ    1 
ATOM   4070  N  N     . VAL A  1  520 ? 110.703 -94.781  -20.378 1.00 60.77  ? 520  VAL A N     1 
ATOM   4071  C  CA    . VAL A  1  520 ? 110.144 -94.041  -19.251 1.00 54.14  ? 520  VAL A CA    1 
ATOM   4072  C  C     . VAL A  1  520 ? 109.975 -92.579  -19.643 1.00 47.39  ? 520  VAL A C     1 
ATOM   4073  O  O     . VAL A  1  520 ? 110.891 -91.955  -20.193 1.00 42.37  ? 520  VAL A O     1 
ATOM   4074  C  CB    . VAL A  1  520 ? 111.031 -94.189  -18.003 1.00 47.70  ? 520  VAL A CB    1 
ATOM   4075  C  CG1   . VAL A  1  520 ? 112.477 -94.297  -18.403 1.00 46.00  ? 520  VAL A CG1   1 
ATOM   4076  C  CG2   . VAL A  1  520 ? 110.835 -93.007  -17.052 1.00 47.92  ? 520  VAL A CG2   1 
ATOM   4077  N  N     . ALA A  1  521 ? 108.786 -92.036  -19.383 1.00 44.78  ? 521  ALA A N     1 
ATOM   4078  C  CA    . ALA A  1  521 ? 108.530 -90.613  -19.548 1.00 44.33  ? 521  ALA A CA    1 
ATOM   4079  C  C     . ALA A  1  521 ? 108.911 -89.829  -18.301 1.00 46.72  ? 521  ALA A C     1 
ATOM   4080  O  O     . ALA A  1  521 ? 109.477 -88.734  -18.402 1.00 45.39  ? 521  ALA A O     1 
ATOM   4081  C  CB    . ALA A  1  521 ? 107.056 -90.375  -19.885 1.00 44.17  ? 521  ALA A CB    1 
ATOM   4082  N  N     . MET A  1  522 ? 108.610 -90.376  -17.126 1.00 44.47  ? 522  MET A N     1 
ATOM   4083  C  CA    . MET A  1  522 ? 109.006 -89.727  -15.883 1.00 40.70  ? 522  MET A CA    1 
ATOM   4084  C  C     . MET A  1  522 ? 108.918 -90.743  -14.758 1.00 43.97  ? 522  MET A C     1 
ATOM   4085  O  O     . MET A  1  522 ? 108.088 -91.653  -14.788 1.00 41.77  ? 522  MET A O     1 
ATOM   4086  C  CB    . MET A  1  522 ? 108.133 -88.500  -15.583 1.00 40.47  ? 522  MET A CB    1 
ATOM   4087  C  CG    . MET A  1  522 ? 108.553 -87.671  -14.363 1.00 49.37  ? 522  MET A CG    1 
ATOM   4088  S  SD    . MET A  1  522 ? 110.266 -87.086  -14.355 1.00 52.95  ? 522  MET A SD    1 
ATOM   4089  C  CE    . MET A  1  522 ? 110.416 -86.339  -15.978 1.00 41.43  ? 522  MET A CE    1 
ATOM   4090  N  N     . MET A  1  523 ? 109.793 -90.582  -13.773 1.00 46.51  ? 523  MET A N     1 
ATOM   4091  C  CA    . MET A  1  523 ? 109.849 -91.467  -12.621 1.00 44.74  ? 523  MET A CA    1 
ATOM   4092  C  C     . MET A  1  523 ? 110.550 -90.721  -11.494 1.00 47.27  ? 523  MET A C     1 
ATOM   4093  O  O     . MET A  1  523 ? 111.188 -89.690  -11.739 1.00 43.84  ? 523  MET A O     1 
ATOM   4094  C  CB    . MET A  1  523 ? 110.581 -92.776  -12.963 1.00 46.75  ? 523  MET A CB    1 
ATOM   4095  C  CG    . MET A  1  523 ? 112.030 -92.592  -13.372 1.00 49.88  ? 523  MET A CG    1 
ATOM   4096  S  SD    . MET A  1  523 ? 112.836 -94.170  -13.685 1.00 50.79  ? 523  MET A SD    1 
ATOM   4097  C  CE    . MET A  1  523 ? 112.565 -94.993  -12.117 1.00 45.12  ? 523  MET A CE    1 
ATOM   4098  N  N     . PRO A  1  524 ? 110.431 -91.196  -10.252 1.00 43.99  ? 524  PRO A N     1 
ATOM   4099  C  CA    . PRO A  1  524 ? 111.063 -90.494  -9.126  1.00 40.29  ? 524  PRO A CA    1 
ATOM   4100  C  C     . PRO A  1  524 ? 112.540 -90.207  -9.358  1.00 40.32  ? 524  PRO A C     1 
ATOM   4101  O  O     . PRO A  1  524 ? 113.325 -91.100  -9.685  1.00 47.34  ? 524  PRO A O     1 
ATOM   4102  C  CB    . PRO A  1  524 ? 110.854 -91.461  -7.958  1.00 41.80  ? 524  PRO A CB    1 
ATOM   4103  C  CG    . PRO A  1  524 ? 109.577 -92.147  -8.294  1.00 50.35  ? 524  PRO A CG    1 
ATOM   4104  C  CD    . PRO A  1  524 ? 109.554 -92.288  -9.790  1.00 42.73  ? 524  PRO A CD    1 
ATOM   4105  N  N     . ILE A  1  525 ? 112.916 -88.942  -9.187  1.00 41.47  ? 525  ILE A N     1 
ATOM   4106  C  CA    . ILE A  1  525 ? 114.297 -88.497  -9.342  1.00 38.91  ? 525  ILE A CA    1 
ATOM   4107  C  C     . ILE A  1  525 ? 114.883 -88.361  -7.942  1.00 44.34  ? 525  ILE A C     1 
ATOM   4108  O  O     . ILE A  1  525 ? 114.691 -87.347  -7.266  1.00 52.54  ? 525  ILE A O     1 
ATOM   4109  C  CB    . ILE A  1  525 ? 114.393 -87.186  -10.124 1.00 46.18  ? 525  ILE A CB    1 
ATOM   4110  C  CG1   . ILE A  1  525 ? 113.659 -87.307  -11.459 1.00 36.61  ? 525  ILE A CG1   1 
ATOM   4111  C  CG2   . ILE A  1  525 ? 115.850 -86.824  -10.353 1.00 45.43  ? 525  ILE A CG2   1 
ATOM   4112  C  CD1   . ILE A  1  525 ? 113.845 -86.113  -12.358 1.00 36.23  ? 525  ILE A CD1   1 
ATOM   4113  N  N     . THR A  1  526 ? 115.612 -89.386  -7.513  1.00 45.82  ? 526  THR A N     1 
ATOM   4114  C  CA    . THR A  1  526 ? 116.168 -89.431  -6.172  1.00 35.95  ? 526  THR A CA    1 
ATOM   4115  C  C     . THR A  1  526 ? 117.397 -88.535  -6.061  1.00 43.93  ? 526  THR A C     1 
ATOM   4116  O  O     . THR A  1  526 ? 118.088 -88.259  -7.046  1.00 39.70  ? 526  THR A O     1 
ATOM   4117  C  CB    . THR A  1  526 ? 116.523 -90.868  -5.804  1.00 40.52  ? 526  THR A CB    1 
ATOM   4118  O  OG1   . THR A  1  526 ? 117.561 -91.340  -6.672  1.00 46.06  ? 526  THR A OG1   1 
ATOM   4119  C  CG2   . THR A  1  526 ? 115.298 -91.752  -5.972  1.00 44.76  ? 526  THR A CG2   1 
ATOM   4120  N  N     . LEU A  1  527 ? 117.663 -88.077  -4.839  1.00 45.03  ? 527  LEU A N     1 
ATOM   4121  C  CA    . LEU A  1  527 ? 118.721 -87.112  -4.582  1.00 38.23  ? 527  LEU A CA    1 
ATOM   4122  C  C     . LEU A  1  527 ? 119.655 -87.651  -3.509  1.00 42.67  ? 527  LEU A C     1 
ATOM   4123  O  O     . LEU A  1  527 ? 119.203 -88.063  -2.435  1.00 34.80  ? 527  LEU A O     1 
ATOM   4124  C  CB    . LEU A  1  527 ? 118.130 -85.763  -4.162  1.00 37.44  ? 527  LEU A CB    1 
ATOM   4125  C  CG    . LEU A  1  527 ? 117.145 -85.161  -5.167  1.00 37.26  ? 527  LEU A CG    1 
ATOM   4126  C  CD1   . LEU A  1  527 ? 116.407 -84.000  -4.548  1.00 33.54  ? 527  LEU A CD1   1 
ATOM   4127  C  CD2   . LEU A  1  527 ? 117.853 -84.728  -6.446  1.00 43.26  ? 527  LEU A CD2   1 
ATOM   4128  N  N     . GLY A  1  528 ? 120.953 -87.647  -3.803  1.00 38.43  ? 528  GLY A N     1 
ATOM   4129  C  CA    . GLY A  1  528 ? 121.948 -88.146  -2.875  1.00 38.17  ? 528  GLY A CA    1 
ATOM   4130  C  C     . GLY A  1  528 ? 123.173 -87.262  -2.767  1.00 42.79  ? 528  GLY A C     1 
ATOM   4131  O  O     . GLY A  1  528 ? 123.079 -86.039  -2.905  1.00 45.86  ? 528  GLY A O     1 
ATOM   4132  N  N     . THR A  1  529 ? 124.337 -87.875  -2.539  1.00 50.00  ? 529  THR A N     1 
ATOM   4133  C  CA    . THR A  1  529 ? 125.549 -87.102  -2.282  1.00 42.81  ? 529  THR A CA    1 
ATOM   4134  C  C     . THR A  1  529 ? 125.991 -86.328  -3.518  1.00 39.26  ? 529  THR A C     1 
ATOM   4135  O  O     . THR A  1  529 ? 126.316 -85.136  -3.429  1.00 40.97  ? 529  THR A O     1 
ATOM   4136  C  CB    . THR A  1  529 ? 126.668 -88.025  -1.800  1.00 41.21  ? 529  THR A CB    1 
ATOM   4137  O  OG1   . THR A  1  529 ? 126.307 -88.584  -0.533  1.00 45.02  ? 529  THR A OG1   1 
ATOM   4138  C  CG2   . THR A  1  529 ? 127.968 -87.249  -1.651  1.00 37.21  ? 529  THR A CG2   1 
ATOM   4139  N  N     . ALA A  1  530 ? 126.027 -86.993  -4.678  1.00 32.38  ? 530  ALA A N     1 
ATOM   4140  C  CA    . ALA A  1  530 ? 126.420 -86.313  -5.909  1.00 43.11  ? 530  ALA A CA    1 
ATOM   4141  C  C     . ALA A  1  530 ? 125.469 -85.170  -6.241  1.00 34.77  ? 530  ALA A C     1 
ATOM   4142  O  O     . ALA A  1  530 ? 125.901 -84.119  -6.738  1.00 31.46  ? 530  ALA A O     1 
ATOM   4143  C  CB    . ALA A  1  530 ? 126.486 -87.313  -7.064  1.00 45.32  ? 530  ALA A CB    1 
ATOM   4144  N  N     . ASP A  1  531 ? 124.182 -85.342  -5.933  1.00 34.05  ? 531  ASP A N     1 
ATOM   4145  C  CA    . ASP A  1  531 ? 123.204 -84.287  -6.175  1.00 34.96  ? 531  ASP A CA    1 
ATOM   4146  C  C     . ASP A  1  531 ? 123.415 -83.109  -5.232  1.00 31.42  ? 531  ASP A C     1 
ATOM   4147  O  O     . ASP A  1  531 ? 123.305 -81.950  -5.646  1.00 44.17  ? 531  ASP A O     1 
ATOM   4148  C  CB    . ASP A  1  531 ? 121.796 -84.864  -6.033  1.00 42.58  ? 531  ASP A CB    1 
ATOM   4149  C  CG    . ASP A  1  531 ? 121.588 -86.097  -6.898  1.00 39.62  ? 531  ASP A CG    1 
ATOM   4150  O  OD1   . ASP A  1  531 ? 121.547 -85.962  -8.137  1.00 43.28  ? 531  ASP A OD1   1 
ATOM   4151  O  OD2   . ASP A  1  531 ? 121.502 -87.209  -6.342  1.00 34.36  ? 531  ASP A OD2   1 
ATOM   4152  N  N     . PHE A  1  532 ? 123.714 -83.390  -3.960  1.00 35.67  ? 532  PHE A N     1 
ATOM   4153  C  CA    . PHE A  1  532 ? 124.106 -82.350  -3.012  1.00 35.18  ? 532  PHE A CA    1 
ATOM   4154  C  C     . PHE A  1  532 ? 125.281 -81.538  -3.548  1.00 37.71  ? 532  PHE A C     1 
ATOM   4155  O  O     . PHE A  1  532 ? 125.235 -80.297  -3.606  1.00 42.71  ? 532  PHE A O     1 
ATOM   4156  C  CB    . PHE A  1  532 ? 124.463 -83.015  -1.675  1.00 36.94  ? 532  PHE A CB    1 
ATOM   4157  C  CG    . PHE A  1  532 ? 124.930 -82.063  -0.603  1.00 38.99  ? 532  PHE A CG    1 
ATOM   4158  C  CD1   . PHE A  1  532 ? 124.075 -81.685  0.423   1.00 34.42  ? 532  PHE A CD1   1 
ATOM   4159  C  CD2   . PHE A  1  532 ? 126.231 -81.575  -0.598  1.00 33.14  ? 532  PHE A CD2   1 
ATOM   4160  C  CE1   . PHE A  1  532 ? 124.498 -80.818  1.417   1.00 30.63  ? 532  PHE A CE1   1 
ATOM   4161  C  CE2   . PHE A  1  532 ? 126.656 -80.710  0.388   1.00 39.58  ? 532  PHE A CE2   1 
ATOM   4162  C  CZ    . PHE A  1  532 ? 125.787 -80.331  1.400   1.00 36.48  ? 532  PHE A CZ    1 
ATOM   4163  N  N     . MET A  1  533 ? 126.350 -82.239  -3.938  1.00 33.86  ? 533  MET A N     1 
ATOM   4164  C  CA    . MET A  1  533 ? 127.562 -81.567  -4.392  1.00 30.22  ? 533  MET A CA    1 
ATOM   4165  C  C     . MET A  1  533 ? 127.290 -80.705  -5.617  1.00 38.82  ? 533  MET A C     1 
ATOM   4166  O  O     . MET A  1  533 ? 127.750 -79.557  -5.694  1.00 49.31  ? 533  MET A O     1 
ATOM   4167  C  CB    . MET A  1  533 ? 128.652 -82.603  -4.680  1.00 30.44  ? 533  MET A CB    1 
ATOM   4168  C  CG    . MET A  1  533 ? 128.996 -83.482  -3.480  1.00 30.66  ? 533  MET A CG    1 
ATOM   4169  S  SD    . MET A  1  533 ? 130.149 -84.826  -3.840  1.00 45.54  ? 533  MET A SD    1 
ATOM   4170  C  CE    . MET A  1  533 ? 131.591 -83.912  -4.398  1.00 30.66  ? 533  MET A CE    1 
ATOM   4171  N  N     . VAL A  1  534 ? 126.514 -81.218  -6.574  1.00 30.39  ? 534  VAL A N     1 
ATOM   4172  C  CA    . VAL A  1  534 ? 126.296 -80.420  -7.775  1.00 30.31  ? 534  VAL A CA    1 
ATOM   4173  C  C     . VAL A  1  534 ? 125.323 -79.266  -7.515  1.00 30.10  ? 534  VAL A C     1 
ATOM   4174  O  O     . VAL A  1  534 ? 125.433 -78.204  -8.145  1.00 29.87  ? 534  VAL A O     1 
ATOM   4175  C  CB    . VAL A  1  534 ? 125.840 -81.315  -8.940  1.00 30.81  ? 534  VAL A CB    1 
ATOM   4176  C  CG1   . VAL A  1  534 ? 124.375 -81.706  -8.782  1.00 31.14  ? 534  VAL A CG1   1 
ATOM   4177  C  CG2   . VAL A  1  534 ? 126.113 -80.615  -10.265 1.00 30.77  ? 534  VAL A CG2   1 
ATOM   4178  N  N     . HIS A  1  535 ? 124.383 -79.417  -6.576  1.00 30.19  ? 535  HIS A N     1 
ATOM   4179  C  CA    . HIS A  1  535 ? 123.535 -78.277  -6.236  1.00 45.54  ? 535  HIS A CA    1 
ATOM   4180  C  C     . HIS A  1  535 ? 124.353 -77.162  -5.606  1.00 35.00  ? 535  HIS A C     1 
ATOM   4181  O  O     . HIS A  1  535 ? 124.093 -75.973  -5.841  1.00 36.73  ? 535  HIS A O     1 
ATOM   4182  C  CB    . HIS A  1  535 ? 122.406 -78.699  -5.300  1.00 37.73  ? 535  HIS A CB    1 
ATOM   4183  C  CG    . HIS A  1  535 ? 121.276 -79.377  -6.000  1.00 30.76  ? 535  HIS A CG    1 
ATOM   4184  N  ND1   . HIS A  1  535 ? 121.307 -80.712  -6.337  1.00 37.12  ? 535  HIS A ND1   1 
ATOM   4185  C  CD2   . HIS A  1  535 ? 120.091 -78.903  -6.447  1.00 34.86  ? 535  HIS A CD2   1 
ATOM   4186  C  CE1   . HIS A  1  535 ? 120.186 -81.034  -6.955  1.00 38.73  ? 535  HIS A CE1   1 
ATOM   4187  N  NE2   . HIS A  1  535 ? 119.430 -79.955  -7.032  1.00 41.20  ? 535  HIS A NE2   1 
ATOM   4188  N  N     . HIS A  1  536 ? 125.354 -77.522  -4.810  1.00 31.15  ? 536  HIS A N     1 
ATOM   4189  C  CA    . HIS A  1  536 ? 126.189 -76.471  -4.245  1.00 31.94  ? 536  HIS A CA    1 
ATOM   4190  C  C     . HIS A  1  536 ? 127.130 -75.875  -5.283  1.00 37.81  ? 536  HIS A C     1 
ATOM   4191  O  O     . HIS A  1  536 ? 127.463 -74.688  -5.195  1.00 51.04  ? 536  HIS A O     1 
ATOM   4192  C  CB    . HIS A  1  536 ? 126.928 -77.003  -3.031  1.00 30.81  ? 536  HIS A CB    1 
ATOM   4193  C  CG    . HIS A  1  536 ? 126.026 -77.196  -1.861  1.00 35.14  ? 536  HIS A CG    1 
ATOM   4194  N  ND1   . HIS A  1  536 ? 124.969 -78.079  -1.884  1.00 39.58  ? 536  HIS A ND1   1 
ATOM   4195  C  CD2   . HIS A  1  536 ? 125.970 -76.569  -0.666  1.00 41.45  ? 536  HIS A CD2   1 
ATOM   4196  C  CE1   . HIS A  1  536 ? 124.322 -78.014  -0.735  1.00 42.15  ? 536  HIS A CE1   1 
ATOM   4197  N  NE2   . HIS A  1  536 ? 124.912 -77.109  0.022   1.00 39.97  ? 536  HIS A NE2   1 
ATOM   4198  N  N     . ILE A  1  537 ? 127.533 -76.658  -6.287  1.00 29.01  ? 537  ILE A N     1 
ATOM   4199  C  CA    . ILE A  1  537 ? 128.200 -76.070  -7.448  1.00 33.85  ? 537  ILE A CA    1 
ATOM   4200  C  C     . ILE A  1  537 ? 127.303 -75.018  -8.102  1.00 43.35  ? 537  ILE A C     1 
ATOM   4201  O  O     . ILE A  1  537 ? 127.765 -73.937  -8.500  1.00 36.84  ? 537  ILE A O     1 
ATOM   4202  C  CB    . ILE A  1  537 ? 128.603 -77.164  -8.454  1.00 29.28  ? 537  ILE A CB    1 
ATOM   4203  C  CG1   . ILE A  1  537 ? 129.645 -78.110  -7.850  1.00 29.35  ? 537  ILE A CG1   1 
ATOM   4204  C  CG2   . ILE A  1  537 ? 129.120 -76.537  -9.742  1.00 29.29  ? 537  ILE A CG2   1 
ATOM   4205  C  CD1   . ILE A  1  537 ? 131.015 -77.491  -7.679  1.00 30.18  ? 537  ILE A CD1   1 
ATOM   4206  N  N     . HIS A  1  538 ? 126.011 -75.324  -8.234  1.00 29.13  ? 538  HIS A N     1 
ATOM   4207  C  CA    . HIS A  1  538 ? 125.097 -74.375  -8.869  1.00 30.91  ? 538  HIS A CA    1 
ATOM   4208  C  C     . HIS A  1  538 ? 124.994 -73.099  -8.047  1.00 41.87  ? 538  HIS A C     1 
ATOM   4209  O  O     . HIS A  1  538 ? 125.082 -71.986  -8.585  1.00 42.05  ? 538  HIS A O     1 
ATOM   4210  C  CB    . HIS A  1  538 ? 123.710 -74.997  -9.054  1.00 29.53  ? 538  HIS A CB    1 
ATOM   4211  C  CG    . HIS A  1  538 ? 123.685 -76.173  -9.980  1.00 29.94  ? 538  HIS A CG    1 
ATOM   4212  N  ND1   . HIS A  1  538 ? 124.642 -76.381  -10.950 1.00 30.01  ? 538  HIS A ND1   1 
ATOM   4213  C  CD2   . HIS A  1  538 ? 122.817 -77.208  -10.081 1.00 30.37  ? 538  HIS A CD2   1 
ATOM   4214  C  CE1   . HIS A  1  538 ? 124.365 -77.492  -11.608 1.00 30.45  ? 538  HIS A CE1   1 
ATOM   4215  N  NE2   . HIS A  1  538 ? 123.264 -78.014  -11.099 1.00 31.36  ? 538  HIS A NE2   1 
ATOM   4216  N  N     . ALA A  1  539 ? 124.787 -73.248  -6.737  1.00 29.04  ? 539  ALA A N     1 
ATOM   4217  C  CA    . ALA A  1  539 ? 124.708 -72.081  -5.864  1.00 35.96  ? 539  ALA A CA    1 
ATOM   4218  C  C     . ALA A  1  539 ? 125.984 -71.252  -5.949  1.00 29.66  ? 539  ALA A C     1 
ATOM   4219  O  O     . ALA A  1  539 ? 125.930 -70.017  -5.998  1.00 32.86  ? 539  ALA A O     1 
ATOM   4220  C  CB    . ALA A  1  539 ? 124.435 -72.515  -4.425  1.00 28.80  ? 539  ALA A CB    1 
ATOM   4221  N  N     . PHE A  1  540 ? 127.136 -71.921  -6.027  1.00 28.12  ? 540  PHE A N     1 
ATOM   4222  C  CA    . PHE A  1  540 ? 128.416 -71.225  -6.111  1.00 28.27  ? 540  PHE A CA    1 
ATOM   4223  C  C     . PHE A  1  540 ? 128.532 -70.405  -7.394  1.00 37.26  ? 540  PHE A C     1 
ATOM   4224  O  O     . PHE A  1  540 ? 128.867 -69.214  -7.351  1.00 27.74  ? 540  PHE A O     1 
ATOM   4225  C  CB    . PHE A  1  540 ? 129.547 -72.251  -6.006  1.00 29.60  ? 540  PHE A CB    1 
ATOM   4226  C  CG    . PHE A  1  540 ? 130.875 -71.751  -6.484  1.00 27.85  ? 540  PHE A CG    1 
ATOM   4227  C  CD1   . PHE A  1  540 ? 131.499 -70.687  -5.858  1.00 27.63  ? 540  PHE A CD1   1 
ATOM   4228  C  CD2   . PHE A  1  540 ? 131.512 -72.365  -7.549  1.00 28.04  ? 540  PHE A CD2   1 
ATOM   4229  C  CE1   . PHE A  1  540 ? 132.728 -70.236  -6.296  1.00 27.59  ? 540  PHE A CE1   1 
ATOM   4230  C  CE2   . PHE A  1  540 ? 132.741 -71.922  -7.990  1.00 28.02  ? 540  PHE A CE2   1 
ATOM   4231  C  CZ    . PHE A  1  540 ? 133.349 -70.855  -7.363  1.00 27.79  ? 540  PHE A CZ    1 
ATOM   4232  N  N     . THR A  1  541 ? 128.269 -71.030  -8.550  1.00 33.92  ? 541  THR A N     1 
ATOM   4233  C  CA    . THR A  1  541 ? 128.447 -70.333  -9.826  1.00 28.27  ? 541  THR A CA    1 
ATOM   4234  C  C     . THR A  1  541 ? 127.432 -69.207  -9.990  1.00 30.60  ? 541  THR A C     1 
ATOM   4235  O  O     . THR A  1  541 ? 127.766 -68.126  -10.505 1.00 41.66  ? 541  THR A O     1 
ATOM   4236  C  CB    . THR A  1  541 ? 128.348 -71.315  -10.998 1.00 33.40  ? 541  THR A CB    1 
ATOM   4237  O  OG1   . THR A  1  541 ? 127.033 -71.877  -11.049 1.00 32.95  ? 541  THR A OG1   1 
ATOM   4238  C  CG2   . THR A  1  541 ? 129.374 -72.441  -10.865 1.00 33.65  ? 541  THR A CG2   1 
ATOM   4239  N  N     . ILE A  1  542 ? 126.192 -69.429  -9.549  1.00 29.60  ? 542  ILE A N     1 
ATOM   4240  C  CA    . ILE A  1  542 ? 125.210 -68.350  -9.567  1.00 34.05  ? 542  ILE A CA    1 
ATOM   4241  C  C     . ILE A  1  542 ? 125.673 -67.197  -8.686  1.00 37.16  ? 542  ILE A C     1 
ATOM   4242  O  O     . ILE A  1  542 ? 125.560 -66.024  -9.068  1.00 46.61  ? 542  ILE A O     1 
ATOM   4243  C  CB    . ILE A  1  542 ? 123.825 -68.867  -9.136  1.00 31.36  ? 542  ILE A CB    1 
ATOM   4244  C  CG1   . ILE A  1  542 ? 123.269 -69.857  -10.162 1.00 31.84  ? 542  ILE A CG1   1 
ATOM   4245  C  CG2   . ILE A  1  542 ? 122.866 -67.703  -8.940  1.00 30.19  ? 542  ILE A CG2   1 
ATOM   4246  C  CD1   . ILE A  1  542 ? 121.976 -70.529  -9.719  1.00 33.93  ? 542  ILE A CD1   1 
ATOM   4247  N  N     . HIS A  1  543 ? 126.206 -67.507  -7.497  1.00 28.25  ? 543  HIS A N     1 
ATOM   4248  C  CA    . HIS A  1  543 ? 126.661 -66.450  -6.598  1.00 28.02  ? 543  HIS A CA    1 
ATOM   4249  C  C     . HIS A  1  543 ? 127.809 -65.656  -7.199  1.00 29.48  ? 543  HIS A C     1 
ATOM   4250  O  O     . HIS A  1  543 ? 127.883 -64.439  -7.020  1.00 30.81  ? 543  HIS A O     1 
ATOM   4251  C  CB    . HIS A  1  543 ? 127.083 -67.038  -5.257  1.00 27.90  ? 543  HIS A CB    1 
ATOM   4252  C  CG    . HIS A  1  543 ? 125.947 -67.245  -4.315  1.00 33.64  ? 543  HIS A CG    1 
ATOM   4253  N  ND1   . HIS A  1  543 ? 125.097 -68.327  -4.403  1.00 28.21  ? 543  HIS A ND1   1 
ATOM   4254  C  CD2   . HIS A  1  543 ? 125.509 -66.503  -3.273  1.00 27.95  ? 543  HIS A CD2   1 
ATOM   4255  C  CE1   . HIS A  1  543 ? 124.187 -68.244  -3.450  1.00 28.30  ? 543  HIS A CE1   1 
ATOM   4256  N  NE2   . HIS A  1  543 ? 124.420 -67.151  -2.748  1.00 28.61  ? 543  HIS A NE2   1 
ATOM   4257  N  N     . VAL A  1  544 ? 128.726 -66.323  -7.900  1.00 30.04  ? 544  VAL A N     1 
ATOM   4258  C  CA    . VAL A  1  544 ? 129.838 -65.592  -8.500  1.00 27.56  ? 544  VAL A CA    1 
ATOM   4259  C  C     . VAL A  1  544 ? 129.345 -64.688  -9.632  1.00 34.11  ? 544  VAL A C     1 
ATOM   4260  O  O     . VAL A  1  544 ? 129.776 -63.530  -9.753  1.00 38.60  ? 544  VAL A O     1 
ATOM   4261  C  CB    . VAL A  1  544 ? 130.929 -66.565  -8.975  1.00 37.34  ? 544  VAL A CB    1 
ATOM   4262  C  CG1   . VAL A  1  544 ? 132.056 -65.804  -9.653  1.00 27.69  ? 544  VAL A CG1   1 
ATOM   4263  C  CG2   . VAL A  1  544 ? 131.454 -67.362  -7.801  1.00 27.51  ? 544  VAL A CG2   1 
ATOM   4264  N  N     . THR A  1  545 ? 128.443 -65.198  -10.481 1.00 34.05  ? 545  THR A N     1 
ATOM   4265  C  CA    . THR A  1  545 ? 127.879 -64.355  -11.536 1.00 29.45  ? 545  THR A CA    1 
ATOM   4266  C  C     . THR A  1  545 ? 127.177 -63.135  -10.941 1.00 34.56  ? 545  THR A C     1 
ATOM   4267  O  O     . THR A  1  545 ? 127.340 -62.002  -11.429 1.00 31.26  ? 545  THR A O     1 
ATOM   4268  C  CB    . THR A  1  545 ? 126.907 -65.171  -12.398 1.00 28.51  ? 545  THR A CB    1 
ATOM   4269  O  OG1   . THR A  1  545 ? 127.466 -66.460  -12.671 1.00 28.88  ? 545  THR A OG1   1 
ATOM   4270  C  CG2   . THR A  1  545 ? 126.630 -64.468  -13.717 1.00 28.84  ? 545  THR A CG2   1 
ATOM   4271  N  N     . ALA A  1  546 ? 126.399 -63.354  -9.874  1.00 31.91  ? 546  ALA A N     1 
ATOM   4272  C  CA    . ALA A  1  546 ? 125.731 -62.252  -9.191  1.00 34.61  ? 546  ALA A CA    1 
ATOM   4273  C  C     . ALA A  1  546 ? 126.739 -61.279  -8.599  1.00 36.18  ? 546  ALA A C     1 
ATOM   4274  O  O     . ALA A  1  546 ? 126.550 -60.063  -8.678  1.00 35.14  ? 546  ALA A O     1 
ATOM   4275  C  CB    . ALA A  1  546 ? 124.806 -62.791  -8.099  1.00 27.90  ? 546  ALA A CB    1 
ATOM   4276  N  N     . LEU A  1  547 ? 127.804 -61.796  -7.983  1.00 37.70  ? 547  LEU A N     1 
ATOM   4277  C  CA    . LEU A  1  547 ? 128.863 -60.944  -7.452  1.00 36.42  ? 547  LEU A CA    1 
ATOM   4278  C  C     . LEU A  1  547 ? 129.382 -59.998  -8.518  1.00 32.65  ? 547  LEU A C     1 
ATOM   4279  O  O     . LEU A  1  547 ? 129.449 -58.779  -8.312  1.00 28.62  ? 547  LEU A O     1 
ATOM   4280  C  CB    . LEU A  1  547 ? 130.004 -61.808  -6.909  1.00 39.41  ? 547  LEU A CB    1 
ATOM   4281  C  CG    . LEU A  1  547 ? 131.287 -61.059  -6.547  1.00 35.11  ? 547  LEU A CG    1 
ATOM   4282  C  CD1   . LEU A  1  547 ? 131.055 -60.137  -5.346  1.00 27.13  ? 547  LEU A CD1   1 
ATOM   4283  C  CD2   . LEU A  1  547 ? 132.437 -62.033  -6.299  1.00 29.11  ? 547  LEU A CD2   1 
ATOM   4284  N  N     . ILE A  1  548 ? 129.731 -60.550  -9.680  1.00 31.37  ? 548  ILE A N     1 
ATOM   4285  C  CA    . ILE A  1  548 ? 130.317 -59.738  -10.743 1.00 28.32  ? 548  ILE A CA    1 
ATOM   4286  C  C     . ILE A  1  548 ? 129.337 -58.662  -11.201 1.00 35.05  ? 548  ILE A C     1 
ATOM   4287  O  O     . ILE A  1  548 ? 129.679 -57.472  -11.265 1.00 35.97  ? 548  ILE A O     1 
ATOM   4288  C  CB    . ILE A  1  548 ? 130.769 -60.633  -11.909 1.00 36.74  ? 548  ILE A CB    1 
ATOM   4289  C  CG1   . ILE A  1  548 ? 131.889 -61.564  -11.441 1.00 34.86  ? 548  ILE A CG1   1 
ATOM   4290  C  CG2   . ILE A  1  548 ? 131.230 -59.784  -13.080 1.00 34.47  ? 548  ILE A CG2   1 
ATOM   4291  C  CD1   . ILE A  1  548 ? 132.058 -62.787  -12.296 1.00 40.14  ? 548  ILE A CD1   1 
ATOM   4292  N  N     . LEU A  1  549 ? 128.092 -59.051  -11.495 1.00 37.76  ? 549  LEU A N     1 
ATOM   4293  C  CA    . LEU A  1  549 ? 127.166 -58.077  -12.082 1.00 34.03  ? 549  LEU A CA    1 
ATOM   4294  C  C     . LEU A  1  549 ? 126.691 -57.049  -11.052 1.00 34.26  ? 549  LEU A C     1 
ATOM   4295  O  O     . LEU A  1  549 ? 126.521 -55.862  -11.375 1.00 43.90  ? 549  LEU A O     1 
ATOM   4296  C  CB    . LEU A  1  549 ? 125.990 -58.807  -12.733 1.00 34.46  ? 549  LEU A CB    1 
ATOM   4297  C  CG    . LEU A  1  549 ? 126.400 -59.734  -13.889 1.00 31.41  ? 549  LEU A CG    1 
ATOM   4298  C  CD1   . LEU A  1  549 ? 125.218 -60.481  -14.474 1.00 29.22  ? 549  LEU A CD1   1 
ATOM   4299  C  CD2   . LEU A  1  549 ? 127.131 -58.955  -14.986 1.00 29.24  ? 549  LEU A CD2   1 
ATOM   4300  N  N     . LEU A  1  550 ? 126.497 -57.473  -9.801  1.00 37.62  ? 550  LEU A N     1 
ATOM   4301  C  CA    . LEU A  1  550 ? 126.085 -56.553  -8.747  1.00 38.85  ? 550  LEU A CA    1 
ATOM   4302  C  C     . LEU A  1  550 ? 127.189 -55.556  -8.415  1.00 38.22  ? 550  LEU A C     1 
ATOM   4303  O  O     . LEU A  1  550 ? 126.911 -54.369  -8.197  1.00 34.96  ? 550  LEU A O     1 
ATOM   4304  C  CB    . LEU A  1  550 ? 125.679 -57.341  -7.501  1.00 32.78  ? 550  LEU A CB    1 
ATOM   4305  C  CG    . LEU A  1  550 ? 125.163 -56.514  -6.325  1.00 30.71  ? 550  LEU A CG    1 
ATOM   4306  C  CD1   . LEU A  1  550 ? 124.069 -55.572  -6.794  1.00 33.73  ? 550  LEU A CD1   1 
ATOM   4307  C  CD2   . LEU A  1  550 ? 124.648 -57.427  -5.221  1.00 30.82  ? 550  LEU A CD2   1 
ATOM   4308  N  N     . LYS A  1  551 ? 128.444 -56.017  -8.354  1.00 27.90  ? 551  LYS A N     1 
ATOM   4309  C  CA    . LYS A  1  551 ? 129.560 -55.087  -8.234  1.00 27.93  ? 551  LYS A CA    1 
ATOM   4310  C  C     . LYS A  1  551 ? 129.596 -54.125  -9.412  1.00 36.53  ? 551  LYS A C     1 
ATOM   4311  O  O     . LYS A  1  551 ? 129.894 -52.937  -9.240  1.00 36.74  ? 551  LYS A O     1 
ATOM   4312  C  CB    . LYS A  1  551 ? 130.876 -55.856  -8.128  1.00 35.52  ? 551  LYS A CB    1 
ATOM   4313  C  CG    . LYS A  1  551 ? 132.116 -54.984  -8.114  1.00 31.59  ? 551  LYS A CG    1 
ATOM   4314  C  CD    . LYS A  1  551 ? 133.300 -55.754  -7.570  1.00 37.34  ? 551  LYS A CD    1 
ATOM   4315  C  CE    . LYS A  1  551 ? 134.459 -55.753  -8.542  1.00 35.86  ? 551  LYS A CE    1 
ATOM   4316  N  NZ    . LYS A  1  551 ? 135.007 -54.398  -8.760  1.00 28.16  ? 551  LYS A NZ    1 
ATOM   4317  N  N     . GLY A  1  552 ? 129.295 -54.620  -10.618 1.00 28.42  ? 552  GLY A N     1 
ATOM   4318  C  CA    . GLY A  1  552 ? 129.259 -53.736  -11.770 1.00 28.80  ? 552  GLY A CA    1 
ATOM   4319  C  C     . GLY A  1  552 ? 128.264 -52.605  -11.605 1.00 37.31  ? 552  GLY A C     1 
ATOM   4320  O  O     . GLY A  1  552 ? 128.567 -51.446  -11.904 1.00 37.93  ? 552  GLY A O     1 
ATOM   4321  N  N     . VAL A  1  553 ? 127.069 -52.922  -11.109 1.00 29.17  ? 553  VAL A N     1 
ATOM   4322  C  CA    . VAL A  1  553 ? 126.046 -51.887  -10.962 1.00 31.31  ? 553  VAL A CA    1 
ATOM   4323  C  C     . VAL A  1  553 ? 126.386 -50.945  -9.807  1.00 30.48  ? 553  VAL A C     1 
ATOM   4324  O  O     . VAL A  1  553 ? 126.332 -49.718  -9.952  1.00 33.87  ? 553  VAL A O     1 
ATOM   4325  C  CB    . VAL A  1  553 ? 124.652 -52.516  -10.787 1.00 41.64  ? 553  VAL A CB    1 
ATOM   4326  C  CG1   . VAL A  1  553 ? 123.622 -51.429  -10.512 1.00 29.69  ? 553  VAL A CG1   1 
ATOM   4327  C  CG2   . VAL A  1  553 ? 124.268 -53.324  -12.025 1.00 29.61  ? 553  VAL A CG2   1 
ATOM   4328  N  N     . LEU A  1  554 ? 126.749 -51.497  -8.644  1.00 34.13  ? 554  LEU A N     1 
ATOM   4329  C  CA    . LEU A  1  554 ? 126.913 -50.666  -7.453  1.00 28.69  ? 554  LEU A CA    1 
ATOM   4330  C  C     . LEU A  1  554 ? 128.119 -49.734  -7.523  1.00 39.77  ? 554  LEU A C     1 
ATOM   4331  O  O     . LEU A  1  554 ? 128.142 -48.723  -6.811  1.00 28.92  ? 554  LEU A O     1 
ATOM   4332  C  CB    . LEU A  1  554 ? 127.018 -51.546  -6.213  1.00 30.55  ? 554  LEU A CB    1 
ATOM   4333  C  CG    . LEU A  1  554 ? 125.714 -52.190  -5.751  1.00 34.27  ? 554  LEU A CG    1 
ATOM   4334  C  CD1   . LEU A  1  554 ? 126.007 -53.252  -4.702  1.00 32.85  ? 554  LEU A CD1   1 
ATOM   4335  C  CD2   . LEU A  1  554 ? 124.767 -51.136  -5.208  1.00 28.59  ? 554  LEU A CD2   1 
ATOM   4336  N  N     . TYR A  1  555 ? 129.115 -50.038  -8.355  1.00 37.87  ? 555  TYR A N     1 
ATOM   4337  C  CA    . TYR A  1  555 ? 130.316 -49.218  -8.473  1.00 30.73  ? 555  TYR A CA    1 
ATOM   4338  C  C     . TYR A  1  555 ? 130.418 -48.515  -9.824  1.00 36.38  ? 555  TYR A C     1 
ATOM   4339  O  O     . TYR A  1  555 ? 131.502 -48.050  -10.198 1.00 36.03  ? 555  TYR A O     1 
ATOM   4340  C  CB    . TYR A  1  555 ? 131.560 -50.073  -8.232  1.00 28.73  ? 555  TYR A CB    1 
ATOM   4341  C  CG    . TYR A  1  555 ? 131.726 -50.521  -6.801  1.00 31.98  ? 555  TYR A CG    1 
ATOM   4342  C  CD1   . TYR A  1  555 ? 132.427 -49.740  -5.892  1.00 32.49  ? 555  TYR A CD1   1 
ATOM   4343  C  CD2   . TYR A  1  555 ? 131.189 -51.724  -6.359  1.00 28.16  ? 555  TYR A CD2   1 
ATOM   4344  C  CE1   . TYR A  1  555 ? 132.590 -50.145  -4.578  1.00 37.79  ? 555  TYR A CE1   1 
ATOM   4345  C  CE2   . TYR A  1  555 ? 131.342 -52.137  -5.047  1.00 33.66  ? 555  TYR A CE2   1 
ATOM   4346  C  CZ    . TYR A  1  555 ? 132.049 -51.343  -4.162  1.00 37.98  ? 555  TYR A CZ    1 
ATOM   4347  O  OH    . TYR A  1  555 ? 132.208 -51.729  -2.852  1.00 37.74  ? 555  TYR A OH    1 
ATOM   4348  N  N     . ALA A  1  556 ? 129.312 -48.435  -10.567 1.00 33.25  ? 556  ALA A N     1 
ATOM   4349  C  CA    . ALA A  1  556 ? 129.351 -47.804  -11.881 1.00 30.54  ? 556  ALA A CA    1 
ATOM   4350  C  C     . ALA A  1  556 ? 129.606 -46.307  -11.781 1.00 30.90  ? 556  ALA A C     1 
ATOM   4351  O  O     . ALA A  1  556 ? 130.177 -45.718  -12.703 1.00 45.24  ? 556  ALA A O     1 
ATOM   4352  C  CB    . ALA A  1  556 ? 128.045 -48.074  -12.627 1.00 30.72  ? 556  ALA A CB    1 
ATOM   4353  N  N     . ARG A  1  557 ? 129.199 -45.679  -10.675 1.00 32.27  ? 557  ARG A N     1 
ATOM   4354  C  CA    . ARG A  1  557 ? 129.402 -44.243  -10.502 1.00 43.02  ? 557  ARG A CA    1 
ATOM   4355  C  C     . ARG A  1  557 ? 130.820 -43.918  -10.053 1.00 42.74  ? 557  ARG A C     1 
ATOM   4356  O  O     . ARG A  1  557 ? 131.396 -42.914  -10.489 1.00 34.51  ? 557  ARG A O     1 
ATOM   4357  C  CB    . ARG A  1  557 ? 128.423 -43.686  -9.470  1.00 50.71  ? 557  ARG A CB    1 
ATOM   4358  C  CG    . ARG A  1  557 ? 126.982 -43.971  -9.750  1.00 41.89  ? 557  ARG A CG    1 
ATOM   4359  C  CD    . ARG A  1  557 ? 126.524 -43.187  -10.910 1.00 38.50  ? 557  ARG A CD    1 
ATOM   4360  N  NE    . ARG A  1  557 ? 126.610 -41.758  -10.666 1.00 31.62  ? 557  ARG A NE    1 
ATOM   4361  C  CZ    . ARG A  1  557 ? 126.131 -40.852  -11.504 1.00 32.15  ? 557  ARG A CZ    1 
ATOM   4362  N  NH1   . ARG A  1  557 ? 125.531 -41.248  -12.618 1.00 38.72  ? 557  ARG A NH1   1 
ATOM   4363  N  NH2   . ARG A  1  557 ? 126.243 -39.562  -11.227 1.00 32.55  ? 557  ARG A NH2   1 
ATOM   4364  N  N     . SER A  1  558 ? 131.382 -44.738  -9.169  1.00 37.33  ? 558  SER A N     1 
ATOM   4365  C  CA    . SER A  1  558 ? 132.616 -44.390  -8.482  1.00 37.44  ? 558  SER A CA    1 
ATOM   4366  C  C     . SER A  1  558 ? 133.138 -45.603  -7.732  1.00 47.96  ? 558  SER A C     1 
ATOM   4367  O  O     . SER A  1  558 ? 132.419 -46.582  -7.513  1.00 52.66  ? 558  SER A O     1 
ATOM   4368  C  CB    . SER A  1  558 ? 132.392 -43.236  -7.506  1.00 33.10  ? 558  SER A CB    1 
ATOM   4369  O  OG    . SER A  1  558 ? 131.307 -43.543  -6.647  1.00 34.07  ? 558  SER A OG    1 
ATOM   4370  N  N     . SER A  1  559 ? 134.404 -45.513  -7.337  1.00 46.68  ? 559  SER A N     1 
ATOM   4371  C  CA    . SER A  1  559 ? 135.007 -46.437  -6.391  1.00 39.21  ? 559  SER A CA    1 
ATOM   4372  C  C     . SER A  1  559 ? 136.138 -45.695  -5.690  1.00 43.64  ? 559  SER A C     1 
ATOM   4373  O  O     . SER A  1  559 ? 136.475 -44.564  -6.048  1.00 40.60  ? 559  SER A O     1 
ATOM   4374  C  CB    . SER A  1  559 ? 135.497 -47.713  -7.085  1.00 30.97  ? 559  SER A CB    1 
ATOM   4375  O  OG    . SER A  1  559 ? 136.498 -47.425  -8.047  1.00 33.41  ? 559  SER A OG    1 
ATOM   4376  N  N     . ARG A  1  560 ? 136.713 -46.330  -4.665  1.00 36.14  ? 560  ARG A N     1 
ATOM   4377  C  CA    . ARG A  1  560 ? 137.886 -45.742  -4.025  1.00 29.73  ? 560  ARG A CA    1 
ATOM   4378  C  C     . ARG A  1  560 ? 139.013 -45.559  -5.035  1.00 30.01  ? 560  ARG A C     1 
ATOM   4379  O  O     . ARG A  1  560 ? 139.754 -44.570  -4.982  1.00 30.42  ? 560  ARG A O     1 
ATOM   4380  C  CB    . ARG A  1  560 ? 138.348 -46.608  -2.849  1.00 29.49  ? 560  ARG A CB    1 
ATOM   4381  C  CG    . ARG A  1  560 ? 137.486 -46.509  -1.596  1.00 29.38  ? 560  ARG A CG    1 
ATOM   4382  C  CD    . ARG A  1  560 ? 138.012 -47.417  -0.487  1.00 29.20  ? 560  ARG A CD    1 
ATOM   4383  N  NE    . ARG A  1  560 ? 137.440 -47.083  0.815   1.00 29.26  ? 560  ARG A NE    1 
ATOM   4384  C  CZ    . ARG A  1  560 ? 136.329 -47.616  1.311   1.00 37.18  ? 560  ARG A CZ    1 
ATOM   4385  N  NH1   . ARG A  1  560 ? 135.655 -48.521  0.619   1.00 28.73  ? 560  ARG A NH1   1 
ATOM   4386  N  NH2   . ARG A  1  560 ? 135.889 -47.238  2.500   1.00 29.18  ? 560  ARG A NH2   1 
ATOM   4387  N  N     . LEU A  1  561 ? 139.137 -46.499  -5.975  1.00 32.37  ? 561  LEU A N     1 
ATOM   4388  C  CA    . LEU A  1  561 ? 140.127 -46.393  -7.043  1.00 30.18  ? 561  LEU A CA    1 
ATOM   4389  C  C     . LEU A  1  561 ? 139.813 -45.231  -7.981  1.00 42.25  ? 561  LEU A C     1 
ATOM   4390  O  O     . LEU A  1  561 ? 140.677 -44.388  -8.252  1.00 49.21  ? 561  LEU A O     1 
ATOM   4391  C  CB    . LEU A  1  561 ? 140.171 -47.701  -7.832  1.00 32.54  ? 561  LEU A CB    1 
ATOM   4392  C  CG    . LEU A  1  561 ? 141.494 -48.410  -8.123  1.00 37.19  ? 561  LEU A CG    1 
ATOM   4393  C  CD1   . LEU A  1  561 ? 141.431 -49.079  -9.490  1.00 30.12  ? 561  LEU A CD1   1 
ATOM   4394  C  CD2   . LEU A  1  561 ? 142.676 -47.474  -8.025  1.00 34.52  ? 561  LEU A CD2   1 
ATOM   4395  N  N     . VAL A  1  562 ? 138.591 -45.185  -8.508  1.00 33.45  ? 562  VAL A N     1 
ATOM   4396  C  CA    . VAL A  1  562 ? 138.215 -44.203  -9.527  1.00 39.62  ? 562  VAL A CA    1 
ATOM   4397  C  C     . VAL A  1  562 ? 136.973 -43.441  -9.077  1.00 34.41  ? 562  VAL A C     1 
ATOM   4398  O  O     . VAL A  1  562 ? 135.846 -43.856  -9.387  1.00 38.41  ? 562  VAL A O     1 
ATOM   4399  C  CB    . VAL A  1  562 ? 137.976 -44.879  -10.887 1.00 34.50  ? 562  VAL A CB    1 
ATOM   4400  C  CG1   . VAL A  1  562 ? 138.179 -43.884  -12.014 1.00 43.38  ? 562  VAL A CG1   1 
ATOM   4401  C  CG2   . VAL A  1  562 ? 138.889 -46.086  -11.057 1.00 30.80  ? 562  VAL A CG2   1 
ATOM   4402  N  N     . PRO A  1  563 ? 137.122 -42.327  -8.355  1.00 31.79  ? 563  PRO A N     1 
ATOM   4403  C  CA    . PRO A  1  563 ? 135.943 -41.649  -7.788  1.00 39.86  ? 563  PRO A CA    1 
ATOM   4404  C  C     . PRO A  1  563 ? 135.085 -40.906  -8.803  1.00 42.15  ? 563  PRO A C     1 
ATOM   4405  O  O     . PRO A  1  563 ? 133.998 -40.444  -8.432  1.00 43.16  ? 563  PRO A O     1 
ATOM   4406  C  CB    . PRO A  1  563 ? 136.552 -40.678  -6.771  1.00 38.41  ? 563  PRO A CB    1 
ATOM   4407  C  CG    . PRO A  1  563 ? 137.939 -40.448  -7.257  1.00 42.43  ? 563  PRO A CG    1 
ATOM   4408  C  CD    . PRO A  1  563 ? 138.384 -41.735  -7.886  1.00 35.54  ? 563  PRO A CD    1 
ATOM   4409  N  N     . ASP A  1  564 ? 135.518 -40.767  -10.055 1.00 31.91  ? 564  ASP A N     1 
ATOM   4410  C  CA    . ASP A  1  564 ? 134.718 -40.089  -11.068 1.00 34.69  ? 564  ASP A CA    1 
ATOM   4411  C  C     . ASP A  1  564 ? 134.347 -41.026  -12.211 1.00 43.92  ? 564  ASP A C     1 
ATOM   4412  O  O     . ASP A  1  564 ? 134.258 -40.597  -13.362 1.00 47.79  ? 564  ASP A O     1 
ATOM   4413  C  CB    . ASP A  1  564 ? 135.443 -38.854  -11.610 1.00 34.95  ? 564  ASP A CB    1 
ATOM   4414  C  CG    . ASP A  1  564 ? 136.729 -39.196  -12.352 1.00 38.42  ? 564  ASP A CG    1 
ATOM   4415  O  OD1   . ASP A  1  564 ? 137.208 -40.347  -12.252 1.00 42.29  ? 564  ASP A OD1   1 
ATOM   4416  O  OD2   . ASP A  1  564 ? 137.268 -38.299  -13.034 1.00 35.60  ? 564  ASP A OD2   1 
ATOM   4417  N  N     . LYS A  1  565 ? 134.125 -42.309  -11.906 1.00 42.72  ? 565  LYS A N     1 
ATOM   4418  C  CA    . LYS A  1  565 ? 133.867 -43.284  -12.963 1.00 41.94  ? 565  LYS A CA    1 
ATOM   4419  C  C     . LYS A  1  565 ? 132.641 -42.917  -13.791 1.00 41.27  ? 565  LYS A C     1 
ATOM   4420  O  O     . LYS A  1  565 ? 132.604 -43.195  -14.995 1.00 33.55  ? 565  LYS A O     1 
ATOM   4421  C  CB    . LYS A  1  565 ? 133.700 -44.681  -12.368 1.00 34.32  ? 565  LYS A CB    1 
ATOM   4422  C  CG    . LYS A  1  565 ? 133.996 -45.791  -13.358 1.00 35.85  ? 565  LYS A CG    1 
ATOM   4423  C  CD    . LYS A  1  565 ? 133.597 -47.154  -12.826 1.00 34.29  ? 565  LYS A CD    1 
ATOM   4424  C  CE    . LYS A  1  565 ? 134.424 -47.564  -11.619 1.00 37.32  ? 565  LYS A CE    1 
ATOM   4425  N  NZ    . LYS A  1  565 ? 134.065 -48.947  -11.170 1.00 35.11  ? 565  LYS A NZ    1 
ATOM   4426  N  N     . ALA A  1  566 ? 131.640 -42.286  -13.171 1.00 38.69  ? 566  ALA A N     1 
ATOM   4427  C  CA    . ALA A  1  566 ? 130.422 -41.923  -13.889 1.00 32.21  ? 566  ALA A CA    1 
ATOM   4428  C  C     . ALA A  1  566 ? 130.722 -41.037  -15.092 1.00 33.93  ? 566  ALA A C     1 
ATOM   4429  O  O     . ALA A  1  566 ? 130.169 -41.245  -16.177 1.00 52.86  ? 566  ALA A O     1 
ATOM   4430  C  CB    . ALA A  1  566 ? 129.447 -41.225  -12.942 1.00 32.20  ? 566  ALA A CB    1 
ATOM   4431  N  N     . ASN A  1  567 ? 131.593 -40.041  -14.921 1.00 33.26  ? 567  ASN A N     1 
ATOM   4432  C  CA    . ASN A  1  567 ? 131.967 -39.173  -16.032 1.00 37.78  ? 567  ASN A CA    1 
ATOM   4433  C  C     . ASN A  1  567 ? 132.619 -39.942  -17.173 1.00 41.03  ? 567  ASN A C     1 
ATOM   4434  O  O     . ASN A  1  567 ? 132.611 -39.464  -18.313 1.00 46.82  ? 567  ASN A O     1 
ATOM   4435  C  CB    . ASN A  1  567 ? 132.915 -38.075  -15.551 1.00 39.01  ? 567  ASN A CB    1 
ATOM   4436  C  CG    . ASN A  1  567 ? 132.265 -37.136  -14.560 1.00 49.48  ? 567  ASN A CG    1 
ATOM   4437  O  OD1   . ASN A  1  567 ? 131.047 -37.141  -14.390 1.00 54.12  ? 567  ASN A OD1   1 
ATOM   4438  N  ND2   . ASN A  1  567 ? 133.077 -36.313  -13.906 1.00 54.72  ? 567  ASN A ND2   1 
ATOM   4439  N  N     . LEU A  1  568 ? 133.191 -41.112  -16.888 1.00 40.25  ? 568  LEU A N     1 
ATOM   4440  C  CA    . LEU A  1  568 ? 133.821 -41.934  -17.911 1.00 37.37  ? 568  LEU A CA    1 
ATOM   4441  C  C     . LEU A  1  568 ? 132.808 -42.717  -18.732 1.00 40.02  ? 568  LEU A C     1 
ATOM   4442  O  O     . LEU A  1  568 ? 133.139 -43.169  -19.833 1.00 42.23  ? 568  LEU A O     1 
ATOM   4443  C  CB    . LEU A  1  568 ? 134.820 -42.898  -17.260 1.00 36.28  ? 568  LEU A CB    1 
ATOM   4444  C  CG    . LEU A  1  568 ? 135.786 -42.269  -16.250 1.00 34.77  ? 568  LEU A CG    1 
ATOM   4445  C  CD1   . LEU A  1  568 ? 136.621 -43.329  -15.551 1.00 32.59  ? 568  LEU A CD1   1 
ATOM   4446  C  CD2   . LEU A  1  568 ? 136.684 -41.237  -16.924 1.00 33.79  ? 568  LEU A CD2   1 
ATOM   4447  N  N     . GLY A  1  569 ? 131.596 -42.896  -18.221 1.00 38.82  ? 569  GLY A N     1 
ATOM   4448  C  CA    . GLY A  1  569 ? 130.524 -43.546  -18.947 1.00 33.45  ? 569  GLY A CA    1 
ATOM   4449  C  C     . GLY A  1  569 ? 130.259 -44.955  -18.444 1.00 36.48  ? 569  GLY A C     1 
ATOM   4450  O  O     . GLY A  1  569 ? 130.853 -45.434  -17.476 1.00 40.83  ? 569  GLY A O     1 
ATOM   4451  N  N     . PHE A  1  570 ? 129.324 -45.611  -19.132 1.00 37.17  ? 570  PHE A N     1 
ATOM   4452  C  CA    . PHE A  1  570 ? 129.025 -47.010  -18.860 1.00 37.65  ? 570  PHE A CA    1 
ATOM   4453  C  C     . PHE A  1  570 ? 130.002 -47.927  -19.577 1.00 39.05  ? 570  PHE A C     1 
ATOM   4454  O  O     . PHE A  1  570 ? 130.417 -48.952  -19.025 1.00 47.33  ? 570  PHE A O     1 
ATOM   4455  C  CB    . PHE A  1  570 ? 127.590 -47.338  -19.281 1.00 40.15  ? 570  PHE A CB    1 
ATOM   4456  C  CG    . PHE A  1  570 ? 127.352 -48.801  -19.556 1.00 38.96  ? 570  PHE A CG    1 
ATOM   4457  C  CD1   . PHE A  1  570 ? 127.224 -49.710  -18.512 1.00 36.29  ? 570  PHE A CD1   1 
ATOM   4458  C  CD2   . PHE A  1  570 ? 127.252 -49.267  -20.858 1.00 32.75  ? 570  PHE A CD2   1 
ATOM   4459  C  CE1   . PHE A  1  570 ? 127.004 -51.056  -18.762 1.00 31.54  ? 570  PHE A CE1   1 
ATOM   4460  C  CE2   . PHE A  1  570 ? 127.032 -50.612  -21.117 1.00 41.75  ? 570  PHE A CE2   1 
ATOM   4461  C  CZ    . PHE A  1  570 ? 126.909 -51.508  -20.065 1.00 36.98  ? 570  PHE A CZ    1 
ATOM   4462  N  N     . ARG A  1  571 ? 130.370 -47.577  -20.805 1.00 39.40  ? 571  ARG A N     1 
ATOM   4463  C  CA    . ARG A  1  571 ? 131.244 -48.397  -21.631 1.00 36.33  ? 571  ARG A CA    1 
ATOM   4464  C  C     . ARG A  1  571 ? 132.519 -47.616  -21.904 1.00 37.73  ? 571  ARG A C     1 
ATOM   4465  O  O     . ARG A  1  571 ? 132.476 -46.553  -22.533 1.00 43.36  ? 571  ARG A O     1 
ATOM   4466  C  CB    . ARG A  1  571 ? 130.559 -48.798  -22.940 1.00 33.80  ? 571  ARG A CB    1 
ATOM   4467  C  CG    . ARG A  1  571 ? 131.332 -49.833  -23.737 1.00 41.42  ? 571  ARG A CG    1 
ATOM   4468  C  CD    . ARG A  1  571 ? 130.541 -50.384  -24.917 1.00 40.57  ? 571  ARG A CD    1 
ATOM   4469  N  NE    . ARG A  1  571 ? 130.500 -49.466  -26.053 1.00 45.64  ? 571  ARG A NE    1 
ATOM   4470  C  CZ    . ARG A  1  571 ? 129.384 -49.092  -26.668 1.00 47.66  ? 571  ARG A CZ    1 
ATOM   4471  N  NH1   . ARG A  1  571 ? 128.212 -49.569  -26.260 1.00 48.08  ? 571  ARG A NH1   1 
ATOM   4472  N  NH2   . ARG A  1  571 ? 129.441 -48.250  -27.694 1.00 38.78  ? 571  ARG A NH2   1 
ATOM   4473  N  N     . PHE A  1  572 ? 133.641 -48.138  -21.417 1.00 36.67  ? 572  PHE A N     1 
ATOM   4474  C  CA    . PHE A  1  572 ? 134.968 -47.573  -21.627 1.00 43.26  ? 572  PHE A CA    1 
ATOM   4475  C  C     . PHE A  1  572 ? 135.999 -48.595  -21.155 1.00 44.00  ? 572  PHE A C     1 
ATOM   4476  O  O     . PHE A  1  572 ? 135.706 -49.395  -20.257 1.00 39.99  ? 572  PHE A O     1 
ATOM   4477  C  CB    . PHE A  1  572 ? 135.125 -46.238  -20.891 1.00 38.47  ? 572  PHE A CB    1 
ATOM   4478  C  CG    . PHE A  1  572 ? 135.087 -46.360  -19.394 1.00 37.04  ? 572  PHE A CG    1 
ATOM   4479  C  CD1   . PHE A  1  572 ? 136.259 -46.469  -18.667 1.00 32.72  ? 572  PHE A CD1   1 
ATOM   4480  C  CD2   . PHE A  1  572 ? 133.881 -46.361  -18.716 1.00 37.56  ? 572  PHE A CD2   1 
ATOM   4481  C  CE1   . PHE A  1  572 ? 136.231 -46.581  -17.295 1.00 34.97  ? 572  PHE A CE1   1 
ATOM   4482  C  CE2   . PHE A  1  572 ? 133.845 -46.473  -17.342 1.00 37.47  ? 572  PHE A CE2   1 
ATOM   4483  C  CZ    . PHE A  1  572 ? 135.022 -46.586  -16.630 1.00 40.95  ? 572  PHE A CZ    1 
ATOM   4484  N  N     . PRO A  1  573 ? 137.190 -48.619  -21.739 1.00 36.32  ? 573  PRO A N     1 
ATOM   4485  C  CA    . PRO A  1  573 ? 138.179 -49.653  -21.450 1.00 34.85  ? 573  PRO A CA    1 
ATOM   4486  C  C     . PRO A  1  573 ? 138.892 -49.662  -20.130 1.00 41.06  ? 573  PRO A C     1 
ATOM   4487  O  O     . PRO A  1  573 ? 139.062 -50.760  -19.648 1.00 33.80  ? 573  PRO A O     1 
ATOM   4488  C  CB    . PRO A  1  573 ? 139.191 -49.506  -22.577 1.00 34.11  ? 573  PRO A CB    1 
ATOM   4489  C  CG    . PRO A  1  573 ? 138.717 -48.407  -23.415 1.00 37.54  ? 573  PRO A CG    1 
ATOM   4490  C  CD    . PRO A  1  573 ? 137.725 -47.622  -22.651 1.00 36.14  ? 573  PRO A CD    1 
ATOM   4491  N  N     . CYS A  1  574 ? 139.154 -48.503  -19.542 1.00 35.69  ? 574  CYS A N     1 
ATOM   4492  C  CA    . CYS A  1  574 ? 139.877 -48.326  -18.305 1.00 32.58  ? 574  CYS A CA    1 
ATOM   4493  C  C     . CYS A  1  574 ? 140.078 -46.869  -18.065 1.00 37.86  ? 574  CYS A C     1 
ATOM   4494  O  O     . CYS A  1  574 ? 139.445 -46.045  -18.641 1.00 47.51  ? 574  CYS A O     1 
ATOM   4495  C  CB    . CYS A  1  574 ? 141.294 -48.828  -18.472 1.00 32.78  ? 574  CYS A CB    1 
ATOM   4496  S  SG    . CYS A  1  574 ? 142.157 -48.056  -19.831 1.00 35.91  ? 574  CYS A SG    1 
ATOM   4497  N  N     . ASP A  1  575 ? 140.989 -46.561  -17.178 1.00 39.53  ? 575  ASP A N     1 
ATOM   4498  C  CA    . ASP A  1  575 ? 141.439 -45.192  -16.956 1.00 33.24  ? 575  ASP A CA    1 
ATOM   4499  C  C     . ASP A  1  575 ? 142.962 -45.147  -16.913 1.00 35.61  ? 575  ASP A C     1 
ATOM   4500  O  O     . ASP A  1  575 ? 143.559 -44.403  -16.128 1.00 33.66  ? 575  ASP A O     1 
ATOM   4501  C  CB    . ASP A  1  575 ? 140.832 -44.607  -15.681 1.00 32.86  ? 575  ASP A CB    1 
ATOM   4502  C  CG    . ASP A  1  575 ? 141.003 -43.097  -15.588 1.00 39.14  ? 575  ASP A CG    1 
ATOM   4503  O  OD1   . ASP A  1  575 ? 141.244 -42.450  -16.630 1.00 40.79  ? 575  ASP A OD1   1 
ATOM   4504  O  OD2   . ASP A  1  575 ? 140.903 -42.560  -14.466 1.00 41.43  ? 575  ASP A OD2   1 
ATOM   4505  N  N     . GLY A  1  576 ? 143.598 -45.949  -17.734 1.00 33.78  ? 576  GLY A N     1 
ATOM   4506  C  CA    . GLY A  1  576 ? 145.032 -45.968  -17.790 1.00 34.16  ? 576  GLY A CA    1 
ATOM   4507  C  C     . GLY A  1  576 ? 145.772 -46.933  -16.905 1.00 35.58  ? 576  GLY A C     1 
ATOM   4508  O  O     . GLY A  1  576 ? 145.205 -47.533  -16.044 1.00 34.41  ? 576  GLY A O     1 
ATOM   4509  N  N     . PRO A  1  577 ? 147.057 -47.111  -17.173 1.00 36.44  ? 577  PRO A N     1 
ATOM   4510  C  CA    . PRO A  1  577 ? 147.975 -47.986  -16.469 1.00 38.13  ? 577  PRO A CA    1 
ATOM   4511  C  C     . PRO A  1  577 ? 148.312 -47.452  -15.115 1.00 37.70  ? 577  PRO A C     1 
ATOM   4512  O  O     . PRO A  1  577 ? 148.899 -48.146  -14.353 1.00 44.76  ? 577  PRO A O     1 
ATOM   4513  C  CB    . PRO A  1  577 ? 149.200 -47.971  -17.348 1.00 34.70  ? 577  PRO A CB    1 
ATOM   4514  C  CG    . PRO A  1  577 ? 149.141 -46.670  -18.003 1.00 40.23  ? 577  PRO A CG    1 
ATOM   4515  C  CD    . PRO A  1  577 ? 147.709 -46.472  -18.311 1.00 35.00  ? 577  PRO A CD    1 
ATOM   4516  N  N     . GLY A  1  578 ? 147.827 -46.275  -14.755 1.00 36.10  ? 578  GLY A N     1 
ATOM   4517  C  CA    . GLY A  1  578 ? 148.081 -45.725  -13.446 1.00 33.68  ? 578  GLY A CA    1 
ATOM   4518  C  C     . GLY A  1  578 ? 147.241 -46.367  -12.360 1.00 36.88  ? 578  GLY A C     1 
ATOM   4519  O  O     . GLY A  1  578 ? 146.442 -47.278  -12.587 1.00 32.49  ? 578  GLY A O     1 
ATOM   4520  N  N     . ARG A  1  579 ? 147.438 -45.866  -11.140 1.00 32.83  ? 579  ARG A N     1 
ATOM   4521  C  CA    . ARG A  1  579 ? 146.818 -46.448  -9.949  1.00 32.35  ? 579  ARG A CA    1 
ATOM   4522  C  C     . ARG A  1  579 ? 147.086 -47.949  -9.870  1.00 31.85  ? 579  ARG A C     1 
ATOM   4523  O  O     . ARG A  1  579 ? 146.273 -48.717  -9.351  1.00 31.32  ? 579  ARG A O     1 
ATOM   4524  C  CB    . ARG A  1  579 ? 145.313 -46.168  -9.911  1.00 31.86  ? 579  ARG A CB    1 
ATOM   4525  C  CG    . ARG A  1  579 ? 144.913 -44.714  -10.167 1.00 32.25  ? 579  ARG A CG    1 
ATOM   4526  C  CD    . ARG A  1  579 ? 143.401 -44.554  -10.075 1.00 34.40  ? 579  ARG A CD    1 
ATOM   4527  N  NE    . ARG A  1  579 ? 142.927 -43.232  -10.477 1.00 39.14  ? 579  ARG A NE    1 
ATOM   4528  C  CZ    . ARG A  1  579 ? 142.568 -42.906  -11.717 1.00 32.63  ? 579  ARG A CZ    1 
ATOM   4529  N  NH1   . ARG A  1  579 ? 142.138 -41.681  -11.983 1.00 33.03  ? 579  ARG A NH1   1 
ATOM   4530  N  NH2   . ARG A  1  579 ? 142.639 -43.803  -12.692 1.00 32.59  ? 579  ARG A NH2   1 
ATOM   4531  N  N     . GLY A  1  580 ? 148.239 -48.376  -10.389 1.00 33.67  ? 580  GLY A N     1 
ATOM   4532  C  CA    . GLY A  1  580 ? 148.533 -49.780  -10.563 1.00 33.60  ? 580  GLY A CA    1 
ATOM   4533  C  C     . GLY A  1  580 ? 147.937 -50.416  -11.799 1.00 37.66  ? 580  GLY A C     1 
ATOM   4534  O  O     . GLY A  1  580 ? 148.406 -51.480  -12.215 1.00 37.44  ? 580  GLY A O     1 
ATOM   4535  N  N     . GLY A  1  581 ? 146.932 -49.795  -12.412 1.00 40.15  ? 581  GLY A N     1 
ATOM   4536  C  CA    . GLY A  1  581 ? 146.231 -50.357  -13.575 1.00 34.59  ? 581  GLY A CA    1 
ATOM   4537  C  C     . GLY A  1  581 ? 144.749 -50.427  -13.262 1.00 34.64  ? 581  GLY A C     1 
ATOM   4538  O  O     . GLY A  1  581 ? 144.322 -50.966  -12.242 1.00 34.89  ? 581  GLY A O     1 
ATOM   4539  N  N     . THR A  1  582 ? 143.945 -49.858  -14.161 1.00 36.64  ? 582  THR A N     1 
ATOM   4540  C  CA    . THR A  1  582 ? 142.509 -49.734  -13.939 1.00 35.99  ? 582  THR A CA    1 
ATOM   4541  C  C     . THR A  1  582 ? 141.684 -50.389  -15.041 1.00 37.63  ? 582  THR A C     1 
ATOM   4542  O  O     . THR A  1  582 ? 140.519 -50.022  -15.229 1.00 34.30  ? 582  THR A O     1 
ATOM   4543  C  CB    . THR A  1  582 ? 142.114 -48.264  -13.801 1.00 31.49  ? 582  THR A CB    1 
ATOM   4544  O  OG1   . THR A  1  582 ? 142.493 -47.560  -14.987 1.00 34.49  ? 582  THR A OG1   1 
ATOM   4545  C  CG2   . THR A  1  582 ? 142.804 -47.636  -12.606 1.00 31.47  ? 582  THR A CG2   1 
ATOM   4546  N  N     . CYS A  1  583 ? 142.252 -51.327  -15.778 1.00 31.43  ? 583  CYS A N     1 
ATOM   4547  C  CA    . CYS A  1  583 ? 141.508 -51.997  -16.825 1.00 31.50  ? 583  CYS A CA    1 
ATOM   4548  C  C     . CYS A  1  583 ? 140.327 -52.709  -16.287 1.00 39.28  ? 583  CYS A C     1 
ATOM   4549  O  O     . CYS A  1  583 ? 140.423 -53.338  -15.300 1.00 49.61  ? 583  CYS A O     1 
ATOM   4550  C  CB    . CYS A  1  583 ? 142.297 -53.109  -17.474 1.00 36.03  ? 583  CYS A CB    1 
ATOM   4551  S  SG    . CYS A  1  583 ? 144.049 -53.071  -17.333 1.00 49.64  ? 583  CYS A SG    1 
ATOM   4552  N  N     . GLN A  1  584 ? 139.254 -52.695  -17.038 1.00 43.32  ? 584  GLN A N     1 
ATOM   4553  C  CA    . GLN A  1  584 ? 138.012 -53.361  -16.732 1.00 38.68  ? 584  GLN A CA    1 
ATOM   4554  C  C     . GLN A  1  584 ? 137.249 -52.919  -15.500 1.00 41.51  ? 584  GLN A C     1 
ATOM   4555  O  O     . GLN A  1  584 ? 136.616 -53.706  -14.864 1.00 38.52  ? 584  GLN A O     1 
ATOM   4556  C  CB    . GLN A  1  584 ? 138.107 -54.889  -16.863 1.00 30.48  ? 584  GLN A CB    1 
ATOM   4557  C  CG    . GLN A  1  584 ? 138.827 -55.353  -18.093 1.00 30.96  ? 584  GLN A CG    1 
ATOM   4558  C  CD    . GLN A  1  584 ? 138.907 -56.856  -18.211 1.00 35.75  ? 584  GLN A CD    1 
ATOM   4559  O  OE1   . GLN A  1  584 ? 138.356 -57.580  -17.417 1.00 34.43  ? 584  GLN A OE1   1 
ATOM   4560  N  NE2   . GLN A  1  584 ? 139.609 -57.319  -19.207 1.00 35.41  ? 584  GLN A NE2   1 
ATOM   4561  N  N     . VAL A  1  585 ? 137.293 -51.642  -15.194 1.00 31.91  ? 585  VAL A N     1 
ATOM   4562  C  CA    . VAL A  1  585 ? 136.506 -51.115  -14.082 1.00 30.14  ? 585  VAL A CA    1 
ATOM   4563  C  C     . VAL A  1  585 ? 135.074 -50.765  -14.481 1.00 40.30  ? 585  VAL A C     1 
ATOM   4564  O  O     . VAL A  1  585 ? 134.216 -50.627  -13.597 1.00 39.95  ? 585  VAL A O     1 
ATOM   4565  C  CB    . VAL A  1  585 ? 137.159 -49.872  -13.442 1.00 33.55  ? 585  VAL A CB    1 
ATOM   4566  C  CG1   . VAL A  1  585 ? 138.394 -50.259  -12.662 1.00 30.15  ? 585  VAL A CG1   1 
ATOM   4567  C  CG2   . VAL A  1  585 ? 137.502 -48.827  -14.493 1.00 30.87  ? 585  VAL A CG2   1 
ATOM   4568  N  N     . SER A  1  586 ? 134.789 -50.626  -15.776 1.00 35.17  ? 586  SER A N     1 
ATOM   4569  C  CA    . SER A  1  586 ? 133.480 -50.162  -16.221 1.00 33.44  ? 586  SER A CA    1 
ATOM   4570  C  C     . SER A  1  586 ? 132.394 -51.194  -15.930 1.00 38.52  ? 586  SER A C     1 
ATOM   4571  O  O     . SER A  1  586 ? 132.662 -52.379  -15.705 1.00 43.85  ? 586  SER A O     1 
ATOM   4572  C  CB    . SER A  1  586 ? 133.496 -49.858  -17.719 1.00 40.69  ? 586  SER A CB    1 
ATOM   4573  O  OG    . SER A  1  586 ? 133.632 -51.043  -18.484 1.00 41.38  ? 586  SER A OG    1 
ATOM   4574  N  N     . GLY A  1  587 ? 131.144 -50.725  -15.940 1.00 30.44  ? 587  GLY A N     1 
ATOM   4575  C  CA    . GLY A  1  587 ? 130.027 -51.649  -15.839 1.00 30.24  ? 587  GLY A CA    1 
ATOM   4576  C  C     . GLY A  1  587 ? 129.968 -52.587  -17.026 1.00 35.23  ? 587  GLY A C     1 
ATOM   4577  O  O     . GLY A  1  587 ? 129.616 -53.764  -16.891 1.00 30.25  ? 587  GLY A O     1 
ATOM   4578  N  N     . TRP A  1  588 ? 130.331 -52.080  -18.205 1.00 30.99  ? 588  TRP A N     1 
ATOM   4579  C  CA    . TRP A  1  588 ? 130.358 -52.916  -19.396 1.00 40.63  ? 588  TRP A CA    1 
ATOM   4580  C  C     . TRP A  1  588 ? 131.322 -54.077  -19.222 1.00 31.05  ? 588  TRP A C     1 
ATOM   4581  O  O     . TRP A  1  588 ? 131.025 -55.207  -19.619 1.00 42.39  ? 588  TRP A O     1 
ATOM   4582  C  CB    . TRP A  1  588 ? 130.740 -52.078  -20.616 1.00 32.91  ? 588  TRP A CB    1 
ATOM   4583  C  CG    . TRP A  1  588 ? 130.617 -52.816  -21.915 1.00 35.06  ? 588  TRP A CG    1 
ATOM   4584  C  CD1   . TRP A  1  588 ? 129.576 -52.755  -22.790 1.00 34.91  ? 588  TRP A CD1   1 
ATOM   4585  C  CD2   . TRP A  1  588 ? 131.566 -53.731  -22.485 1.00 32.52  ? 588  TRP A CD2   1 
ATOM   4586  N  NE1   . TRP A  1  588 ? 129.816 -53.563  -23.876 1.00 42.00  ? 588  TRP A NE1   1 
ATOM   4587  C  CE2   . TRP A  1  588 ? 131.031 -54.177  -23.712 1.00 39.89  ? 588  TRP A CE2   1 
ATOM   4588  C  CE3   . TRP A  1  588 ? 132.816 -54.212  -22.080 1.00 33.69  ? 588  TRP A CE3   1 
ATOM   4589  C  CZ2   . TRP A  1  588 ? 131.700 -55.082  -24.536 1.00 34.06  ? 588  TRP A CZ2   1 
ATOM   4590  C  CZ3   . TRP A  1  588 ? 133.479 -55.113  -22.898 1.00 40.61  ? 588  TRP A CZ3   1 
ATOM   4591  C  CH2   . TRP A  1  588 ? 132.919 -55.538  -24.113 1.00 45.22  ? 588  TRP A CH2   1 
ATOM   4592  N  N     . ASP A  1  589 ? 132.480 -53.823  -18.617 1.00 33.35  ? 589  ASP A N     1 
ATOM   4593  C  CA    . ASP A  1  589 ? 133.449 -54.894  -18.425 1.00 34.75  ? 589  ASP A CA    1 
ATOM   4594  C  C     . ASP A  1  589 ? 132.977 -55.893  -17.377 1.00 30.13  ? 589  ASP A C     1 
ATOM   4595  O  O     . ASP A  1  589 ? 133.305 -57.084  -17.464 1.00 30.04  ? 589  ASP A O     1 
ATOM   4596  C  CB    . ASP A  1  589 ? 134.800 -54.296  -18.053 1.00 30.68  ? 589  ASP A CB    1 
ATOM   4597  C  CG    . ASP A  1  589 ? 135.460 -53.589  -19.219 1.00 35.31  ? 589  ASP A CG    1 
ATOM   4598  O  OD1   . ASP A  1  589 ? 135.509 -54.187  -20.314 1.00 34.70  ? 589  ASP A OD1   1 
ATOM   4599  O  OD2   . ASP A  1  589 ? 135.922 -52.440  -19.048 1.00 31.46  ? 589  ASP A OD2   1 
ATOM   4600  N  N     . HIS A  1  590 ? 132.192 -55.439  -16.398 1.00 29.83  ? 590  HIS A N     1 
ATOM   4601  C  CA    . HIS A  1  590 ? 131.581 -56.374  -15.461 1.00 29.70  ? 590  HIS A CA    1 
ATOM   4602  C  C     . HIS A  1  590 ? 130.577 -57.270  -16.170 1.00 29.56  ? 590  HIS A C     1 
ATOM   4603  O  O     . HIS A  1  590 ? 130.499 -58.469  -15.886 1.00 36.21  ? 590  HIS A O     1 
ATOM   4604  C  CB    . HIS A  1  590 ? 130.921 -55.618  -14.306 1.00 29.16  ? 590  HIS A CB    1 
ATOM   4605  C  CG    . HIS A  1  590 ? 131.895 -55.069  -13.308 1.00 35.97  ? 590  HIS A CG    1 
ATOM   4606  N  ND1   . HIS A  1  590 ? 132.678 -53.964  -13.561 1.00 38.45  ? 590  HIS A ND1   1 
ATOM   4607  C  CD2   . HIS A  1  590 ? 132.213 -55.475  -12.055 1.00 36.46  ? 590  HIS A CD2   1 
ATOM   4608  C  CE1   . HIS A  1  590 ? 133.436 -53.712  -12.508 1.00 38.25  ? 590  HIS A CE1   1 
ATOM   4609  N  NE2   . HIS A  1  590 ? 133.171 -54.612  -11.580 1.00 39.66  ? 590  HIS A NE2   1 
ATOM   4610  N  N     . VAL A  1  591 ? 129.811 -56.711  -17.109 1.00 33.86  ? 591  VAL A N     1 
ATOM   4611  C  CA    . VAL A  1  591 ? 128.931 -57.535  -17.937 1.00 30.20  ? 591  VAL A CA    1 
ATOM   4612  C  C     . VAL A  1  591 ? 129.751 -58.513  -18.767 1.00 33.56  ? 591  VAL A C     1 
ATOM   4613  O  O     . VAL A  1  591 ? 129.390 -59.686  -18.926 1.00 33.72  ? 591  VAL A O     1 
ATOM   4614  C  CB    . VAL A  1  591 ? 128.055 -56.632  -18.822 1.00 30.67  ? 591  VAL A CB    1 
ATOM   4615  C  CG1   . VAL A  1  591 ? 127.121 -57.466  -19.704 1.00 31.00  ? 591  VAL A CG1   1 
ATOM   4616  C  CG2   . VAL A  1  591 ? 127.285 -55.672  -17.952 1.00 30.50  ? 591  VAL A CG2   1 
ATOM   4617  N  N     . PHE A  1  592 ? 130.873 -58.038  -19.301 1.00 30.62  ? 592  PHE A N     1 
ATOM   4618  C  CA    . PHE A  1  592 ? 131.752 -58.868  -20.115 1.00 36.37  ? 592  PHE A CA    1 
ATOM   4619  C  C     . PHE A  1  592 ? 132.268 -60.074  -19.328 1.00 32.62  ? 592  PHE A C     1 
ATOM   4620  O  O     . PHE A  1  592 ? 132.293 -61.196  -19.845 1.00 35.49  ? 592  PHE A O     1 
ATOM   4621  C  CB    . PHE A  1  592 ? 132.878 -57.975  -20.651 1.00 31.20  ? 592  PHE A CB    1 
ATOM   4622  C  CG    . PHE A  1  592 ? 134.144 -58.694  -21.015 1.00 36.23  ? 592  PHE A CG    1 
ATOM   4623  C  CD1   . PHE A  1  592 ? 134.290 -59.295  -22.256 1.00 37.23  ? 592  PHE A CD1   1 
ATOM   4624  C  CD2   . PHE A  1  592 ? 135.217 -58.709  -20.139 1.00 33.80  ? 592  PHE A CD2   1 
ATOM   4625  C  CE1   . PHE A  1  592 ? 135.471 -59.931  -22.599 1.00 32.07  ? 592  PHE A CE1   1 
ATOM   4626  C  CE2   . PHE A  1  592 ? 136.395 -59.346  -20.476 1.00 31.75  ? 592  PHE A CE2   1 
ATOM   4627  C  CZ    . PHE A  1  592 ? 136.523 -59.956  -21.708 1.00 31.75  ? 592  PHE A CZ    1 
ATOM   4628  N  N     . LEU A  1  593 ? 132.640 -59.872  -18.061 1.00 35.02  ? 593  LEU A N     1 
ATOM   4629  C  CA    . LEU A  1  593 ? 133.109 -60.991  -17.242 1.00 32.03  ? 593  LEU A CA    1 
ATOM   4630  C  C     . LEU A  1  593 ? 131.947 -61.878  -16.787 1.00 33.05  ? 593  LEU A C     1 
ATOM   4631  O  O     . LEU A  1  593 ? 132.062 -63.118  -16.750 1.00 36.36  ? 593  LEU A O     1 
ATOM   4632  C  CB    . LEU A  1  593 ? 133.889 -60.457  -16.040 1.00 32.31  ? 593  LEU A CB    1 
ATOM   4633  C  CG    . LEU A  1  593 ? 135.140 -59.636  -16.361 1.00 29.54  ? 593  LEU A CG    1 
ATOM   4634  C  CD1   . LEU A  1  593 ? 135.731 -59.004  -15.104 1.00 29.22  ? 593  LEU A CD1   1 
ATOM   4635  C  CD2   . LEU A  1  593 ? 136.178 -60.493  -17.074 1.00 29.81  ? 593  LEU A CD2   1 
ATOM   4636  N  N     . GLY A  1  594 ? 130.820 -61.254  -16.426 1.00 29.39  ? 594  GLY A N     1 
ATOM   4637  C  CA    . GLY A  1  594 ? 129.655 -62.011  -16.017 1.00 29.28  ? 594  GLY A CA    1 
ATOM   4638  C  C     . GLY A  1  594 ? 129.125 -62.908  -17.111 1.00 36.56  ? 594  GLY A C     1 
ATOM   4639  O  O     . GLY A  1  594 ? 128.509 -63.932  -16.826 1.00 33.91  ? 594  GLY A O     1 
ATOM   4640  N  N     . LEU A  1  595 ? 129.356 -62.540  -18.373 1.00 37.65  ? 595  LEU A N     1 
ATOM   4641  C  CA    . LEU A  1  595 ? 128.987 -63.427  -19.473 1.00 37.30  ? 595  LEU A CA    1 
ATOM   4642  C  C     . LEU A  1  595 ? 129.715 -64.762  -19.364 1.00 34.55  ? 595  LEU A C     1 
ATOM   4643  O  O     . LEU A  1  595 ? 129.092 -65.829  -19.449 1.00 34.68  ? 595  LEU A O     1 
ATOM   4644  C  CB    . LEU A  1  595 ? 129.280 -62.756  -20.817 1.00 44.74  ? 595  LEU A CB    1 
ATOM   4645  C  CG    . LEU A  1  595 ? 128.329 -61.647  -21.272 1.00 38.21  ? 595  LEU A CG    1 
ATOM   4646  C  CD1   . LEU A  1  595 ? 128.929 -60.894  -22.448 1.00 33.52  ? 595  LEU A CD1   1 
ATOM   4647  C  CD2   . LEU A  1  595 ? 126.984 -62.236  -21.647 1.00 32.02  ? 595  LEU A CD2   1 
ATOM   4648  N  N     . PHE A  1  596 ? 131.042 -64.720  -19.175 1.00 30.37  ? 596  PHE A N     1 
ATOM   4649  C  CA    . PHE A  1  596 ? 131.804 -65.956  -19.007 1.00 30.56  ? 596  PHE A CA    1 
ATOM   4650  C  C     . PHE A  1  596 ? 131.309 -66.741  -17.803 1.00 31.43  ? 596  PHE A C     1 
ATOM   4651  O  O     . PHE A  1  596 ? 131.152 -67.967  -17.869 1.00 36.20  ? 596  PHE A O     1 
ATOM   4652  C  CB    . PHE A  1  596 ? 133.296 -65.672  -18.834 1.00 30.28  ? 596  PHE A CB    1 
ATOM   4653  C  CG    . PHE A  1  596 ? 133.954 -65.020  -20.016 1.00 30.75  ? 596  PHE A CG    1 
ATOM   4654  C  CD1   . PHE A  1  596 ? 134.498 -65.782  -21.035 1.00 34.41  ? 596  PHE A CD1   1 
ATOM   4655  C  CD2   . PHE A  1  596 ? 134.073 -63.647  -20.081 1.00 30.76  ? 596  PHE A CD2   1 
ATOM   4656  C  CE1   . PHE A  1  596 ? 135.118 -65.179  -22.116 1.00 39.78  ? 596  PHE A CE1   1 
ATOM   4657  C  CE2   . PHE A  1  596 ? 134.689 -63.040  -21.155 1.00 41.40  ? 596  PHE A CE2   1 
ATOM   4658  C  CZ    . PHE A  1  596 ? 135.214 -63.808  -22.175 1.00 41.33  ? 596  PHE A CZ    1 
ATOM   4659  N  N     . TRP A  1  597 ? 131.064 -66.055  -16.689 1.00 29.52  ? 597  TRP A N     1 
ATOM   4660  C  CA    . TRP A  1  597 ? 130.663 -66.806  -15.502 1.00 34.62  ? 597  TRP A CA    1 
ATOM   4661  C  C     . TRP A  1  597 ? 129.253 -67.387  -15.626 1.00 35.07  ? 597  TRP A C     1 
ATOM   4662  O  O     . TRP A  1  597 ? 128.987 -68.479  -15.108 1.00 39.48  ? 597  TRP A O     1 
ATOM   4663  C  CB    . TRP A  1  597 ? 130.804 -65.940  -14.256 1.00 32.14  ? 597  TRP A CB    1 
ATOM   4664  C  CG    . TRP A  1  597 ? 132.043 -66.295  -13.527 1.00 31.23  ? 597  TRP A CG    1 
ATOM   4665  C  CD1   . TRP A  1  597 ? 133.251 -65.674  -13.611 1.00 28.73  ? 597  TRP A CD1   1 
ATOM   4666  C  CD2   . TRP A  1  597 ? 132.219 -67.403  -12.640 1.00 32.51  ? 597  TRP A CD2   1 
ATOM   4667  N  NE1   . TRP A  1  597 ? 134.166 -66.312  -12.808 1.00 36.22  ? 597  TRP A NE1   1 
ATOM   4668  C  CE2   . TRP A  1  597 ? 133.557 -67.377  -12.200 1.00 33.94  ? 597  TRP A CE2   1 
ATOM   4669  C  CE3   . TRP A  1  597 ? 131.370 -68.403  -12.158 1.00 28.39  ? 597  TRP A CE3   1 
ATOM   4670  C  CZ2   . TRP A  1  597 ? 134.067 -68.313  -11.297 1.00 33.22  ? 597  TRP A CZ2   1 
ATOM   4671  C  CZ3   . TRP A  1  597 ? 131.876 -69.335  -11.270 1.00 37.36  ? 597  TRP A CZ3   1 
ATOM   4672  C  CH2   . TRP A  1  597 ? 133.212 -69.282  -10.845 1.00 31.33  ? 597  TRP A CH2   1 
ATOM   4673  N  N     . MET A  1  598 ? 128.346 -66.693  -16.317 1.00 31.69  ? 598  MET A N     1 
ATOM   4674  C  CA    . MET A  1  598 ? 127.031 -67.257  -16.605 1.00 37.45  ? 598  MET A CA    1 
ATOM   4675  C  C     . MET A  1  598 ? 127.154 -68.480  -17.499 1.00 32.96  ? 598  MET A C     1 
ATOM   4676  O  O     . MET A  1  598 ? 126.466 -69.487  -17.289 1.00 37.67  ? 598  MET A O     1 
ATOM   4677  C  CB    . MET A  1  598 ? 126.139 -66.199  -17.265 1.00 37.57  ? 598  MET A CB    1 
ATOM   4678  C  CG    . MET A  1  598 ? 124.758 -66.696  -17.720 1.00 36.97  ? 598  MET A CG    1 
ATOM   4679  S  SD    . MET A  1  598 ? 124.676 -67.398  -19.392 1.00 40.67  ? 598  MET A SD    1 
ATOM   4680  C  CE    . MET A  1  598 ? 125.173 -65.999  -20.397 1.00 33.28  ? 598  MET A CE    1 
ATOM   4681  N  N     . TYR A  1  599 ? 128.010 -68.397  -18.518 1.00 35.09  ? 599  TYR A N     1 
ATOM   4682  C  CA    . TYR A  1  599 ? 128.263 -69.543  -19.382 1.00 30.90  ? 599  TYR A CA    1 
ATOM   4683  C  C     . TYR A  1  599 ? 128.771 -70.736  -18.580 1.00 39.04  ? 599  TYR A C     1 
ATOM   4684  O  O     . TYR A  1  599 ? 128.336 -71.872  -18.797 1.00 30.97  ? 599  TYR A O     1 
ATOM   4685  C  CB    . TYR A  1  599 ? 129.263 -69.141  -20.461 1.00 31.23  ? 599  TYR A CB    1 
ATOM   4686  C  CG    . TYR A  1  599 ? 129.853 -70.290  -21.225 1.00 32.68  ? 599  TYR A CG    1 
ATOM   4687  C  CD1   . TYR A  1  599 ? 129.104 -70.979  -22.170 1.00 32.20  ? 599  TYR A CD1   1 
ATOM   4688  C  CD2   . TYR A  1  599 ? 131.167 -70.674  -21.016 1.00 32.33  ? 599  TYR A CD2   1 
ATOM   4689  C  CE1   . TYR A  1  599 ? 129.648 -72.027  -22.876 1.00 38.77  ? 599  TYR A CE1   1 
ATOM   4690  C  CE2   . TYR A  1  599 ? 131.719 -71.717  -21.714 1.00 34.32  ? 599  TYR A CE2   1 
ATOM   4691  C  CZ    . TYR A  1  599 ? 130.956 -72.392  -22.641 1.00 45.60  ? 599  TYR A CZ    1 
ATOM   4692  O  OH    . TYR A  1  599 ? 131.515 -73.427  -23.340 1.00 49.62  ? 599  TYR A OH    1 
ATOM   4693  N  N     . ASN A  1  600 ? 129.681 -70.485  -17.637 1.00 30.27  ? 600  ASN A N     1 
ATOM   4694  C  CA    . ASN A  1  600 ? 130.168 -71.532  -16.738 1.00 33.26  ? 600  ASN A CA    1 
ATOM   4695  C  C     . ASN A  1  600 ? 129.021 -72.159  -15.945 1.00 35.79  ? 600  ASN A C     1 
ATOM   4696  O  O     . ASN A  1  600 ? 128.826 -73.388  -15.955 1.00 39.53  ? 600  ASN A O     1 
ATOM   4697  C  CB    . ASN A  1  600 ? 131.215 -70.921  -15.801 1.00 29.66  ? 600  ASN A CB    1 
ATOM   4698  C  CG    . ASN A  1  600 ? 132.118 -71.954  -15.159 1.00 42.92  ? 600  ASN A CG    1 
ATOM   4699  O  OD1   . ASN A  1  600 ? 132.334 -71.935  -13.946 1.00 41.92  ? 600  ASN A OD1   1 
ATOM   4700  N  ND2   . ASN A  1  600 ? 132.664 -72.854  -15.971 1.00 29.97  ? 600  ASN A ND2   1 
ATOM   4701  N  N     . SER A  1  601 ? 128.250 -71.313  -15.251 1.00 34.98  ? 601  SER A N     1 
ATOM   4702  C  CA    . SER A  1  601 ? 127.122 -71.771  -14.444 1.00 34.04  ? 601  SER A CA    1 
ATOM   4703  C  C     . SER A  1  601 ? 126.169 -72.643  -15.253 1.00 41.89  ? 601  SER A C     1 
ATOM   4704  O  O     . SER A  1  601 ? 125.793 -73.745  -14.830 1.00 36.10  ? 601  SER A O     1 
ATOM   4705  C  CB    . SER A  1  601 ? 126.380 -70.560  -13.873 1.00 29.97  ? 601  SER A CB    1 
ATOM   4706  O  OG    . SER A  1  601 ? 125.235 -70.948  -13.135 1.00 34.54  ? 601  SER A OG    1 
ATOM   4707  N  N     . LEU A  1  602 ? 125.775 -72.162  -16.435 1.00 44.64  ? 602  LEU A N     1 
ATOM   4708  C  CA    . LEU A  1  602 ? 124.761 -72.863  -17.212 1.00 37.22  ? 602  LEU A CA    1 
ATOM   4709  C  C     . LEU A  1  602 ? 125.319 -74.128  -17.849 1.00 38.85  ? 602  LEU A C     1 
ATOM   4710  O  O     . LEU A  1  602 ? 124.602 -75.127  -17.971 1.00 42.07  ? 602  LEU A O     1 
ATOM   4711  C  CB    . LEU A  1  602 ? 124.172 -71.937  -18.275 1.00 38.02  ? 602  LEU A CB    1 
ATOM   4712  C  CG    . LEU A  1  602 ? 123.381 -70.740  -17.747 1.00 31.89  ? 602  LEU A CG    1 
ATOM   4713  C  CD1   . LEU A  1  602 ? 122.457 -70.200  -18.825 1.00 31.86  ? 602  LEU A CD1   1 
ATOM   4714  C  CD2   . LEU A  1  602 ? 122.598 -71.110  -16.503 1.00 30.82  ? 602  LEU A CD2   1 
ATOM   4715  N  N     . SER A  1  603 ? 126.585 -74.110  -18.279 1.00 31.31  ? 603  SER A N     1 
ATOM   4716  C  CA    . SER A  1  603 ? 127.206 -75.341  -18.753 1.00 33.65  ? 603  SER A CA    1 
ATOM   4717  C  C     . SER A  1  603 ? 127.112 -76.426  -17.693 1.00 40.33  ? 603  SER A C     1 
ATOM   4718  O  O     . SER A  1  603 ? 126.740 -77.570  -17.985 1.00 38.26  ? 603  SER A O     1 
ATOM   4719  C  CB    . SER A  1  603 ? 128.665 -75.092  -19.136 1.00 31.62  ? 603  SER A CB    1 
ATOM   4720  O  OG    . SER A  1  603 ? 128.771 -74.159  -20.193 1.00 42.43  ? 603  SER A OG    1 
ATOM   4721  N  N     . ILE A  1  604 ? 127.415 -76.075  -16.440 1.00 39.47  ? 604  ILE A N     1 
ATOM   4722  C  CA    . ILE A  1  604 ? 127.333 -77.088  -15.390 1.00 38.86  ? 604  ILE A CA    1 
ATOM   4723  C  C     . ILE A  1  604 ? 125.885 -77.511  -15.149 1.00 36.51  ? 604  ILE A C     1 
ATOM   4724  O  O     . ILE A  1  604 ? 125.603 -78.699  -14.951 1.00 40.42  ? 604  ILE A O     1 
ATOM   4725  C  CB    . ILE A  1  604 ? 128.015 -76.592  -14.106 1.00 40.57  ? 604  ILE A CB    1 
ATOM   4726  C  CG1   . ILE A  1  604 ? 129.501 -76.380  -14.380 1.00 43.18  ? 604  ILE A CG1   1 
ATOM   4727  C  CG2   . ILE A  1  604 ? 127.828 -77.597  -12.982 1.00 30.32  ? 604  ILE A CG2   1 
ATOM   4728  C  CD1   . ILE A  1  604 ? 130.160 -77.557  -15.089 1.00 32.95  ? 604  ILE A CD1   1 
ATOM   4729  N  N     . VAL A  1  605 ? 124.945 -76.560  -15.174 1.00 32.89  ? 605  VAL A N     1 
ATOM   4730  C  CA    . VAL A  1  605 ? 123.533 -76.904  -14.981 1.00 36.46  ? 605  VAL A CA    1 
ATOM   4731  C  C     . VAL A  1  605 ? 123.079 -77.918  -16.029 1.00 40.38  ? 605  VAL A C     1 
ATOM   4732  O  O     . VAL A  1  605 ? 122.455 -78.941  -15.712 1.00 41.34  ? 605  VAL A O     1 
ATOM   4733  C  CB    . VAL A  1  605 ? 122.652 -75.638  -15.019 1.00 39.05  ? 605  VAL A CB    1 
ATOM   4734  C  CG1   . VAL A  1  605 ? 121.182 -76.023  -15.090 1.00 31.58  ? 605  VAL A CG1   1 
ATOM   4735  C  CG2   . VAL A  1  605 ? 122.908 -74.743  -13.808 1.00 30.60  ? 605  VAL A CG2   1 
ATOM   4736  N  N     . ILE A  1  606 ? 123.389 -77.652  -17.297 1.00 37.13  ? 606  ILE A N     1 
ATOM   4737  C  CA    . ILE A  1  606 ? 122.867 -78.508  -18.356 1.00 38.82  ? 606  ILE A CA    1 
ATOM   4738  C  C     . ILE A  1  606 ? 123.605 -79.841  -18.395 1.00 36.49  ? 606  ILE A C     1 
ATOM   4739  O  O     . ILE A  1  606 ? 123.003 -80.873  -18.715 1.00 34.40  ? 606  ILE A O     1 
ATOM   4740  C  CB    . ILE A  1  606 ? 122.907 -77.781  -19.715 1.00 46.86  ? 606  ILE A CB    1 
ATOM   4741  C  CG1   . ILE A  1  606 ? 124.343 -77.500  -20.153 1.00 33.51  ? 606  ILE A CG1   1 
ATOM   4742  C  CG2   . ILE A  1  606 ? 122.092 -76.494  -19.649 1.00 33.48  ? 606  ILE A CG2   1 
ATOM   4743  C  CD1   . ILE A  1  606 ? 124.442 -76.827  -21.491 1.00 33.90  ? 606  ILE A CD1   1 
ATOM   4744  N  N     . PHE A  1  607 ? 124.902 -79.862  -18.064 1.00 40.89  ? 607  PHE A N     1 
ATOM   4745  C  CA    . PHE A  1  607 ? 125.597 -81.141  -17.956 1.00 35.01  ? 607  PHE A CA    1 
ATOM   4746  C  C     . PHE A  1  607 ? 124.997 -81.986  -16.841 1.00 36.59  ? 607  PHE A C     1 
ATOM   4747  O  O     . PHE A  1  607 ? 124.792 -83.195  -17.006 1.00 34.47  ? 607  PHE A O     1 
ATOM   4748  C  CB    . PHE A  1  607 ? 127.091 -80.919  -17.719 1.00 36.73  ? 607  PHE A CB    1 
ATOM   4749  C  CG    . PHE A  1  607 ? 127.849 -80.514  -18.952 1.00 39.23  ? 607  PHE A CG    1 
ATOM   4750  C  CD1   . PHE A  1  607 ? 127.219 -80.462  -20.188 1.00 44.84  ? 607  PHE A CD1   1 
ATOM   4751  C  CD2   . PHE A  1  607 ? 129.195 -80.195  -18.879 1.00 33.03  ? 607  PHE A CD2   1 
ATOM   4752  C  CE1   . PHE A  1  607 ? 127.917 -80.096  -21.330 1.00 39.04  ? 607  PHE A CE1   1 
ATOM   4753  C  CE2   . PHE A  1  607 ? 129.899 -79.828  -20.015 1.00 39.71  ? 607  PHE A CE2   1 
ATOM   4754  C  CZ    . PHE A  1  607 ? 129.256 -79.778  -21.243 1.00 40.37  ? 607  PHE A CZ    1 
ATOM   4755  N  N     . HIS A  1  608 ? 124.709 -81.357  -15.699 1.00 32.50  ? 608  HIS A N     1 
ATOM   4756  C  CA    . HIS A  1  608 ? 124.027 -82.026  -14.598 1.00 32.51  ? 608  HIS A CA    1 
ATOM   4757  C  C     . HIS A  1  608 ? 122.697 -82.614  -15.052 1.00 37.34  ? 608  HIS A C     1 
ATOM   4758  O  O     . HIS A  1  608 ? 122.388 -83.775  -14.766 1.00 35.11  ? 608  HIS A O     1 
ATOM   4759  C  CB    . HIS A  1  608 ? 123.832 -81.022  -13.459 1.00 31.93  ? 608  HIS A CB    1 
ATOM   4760  C  CG    . HIS A  1  608 ? 122.918 -81.490  -12.372 1.00 32.00  ? 608  HIS A CG    1 
ATOM   4761  N  ND1   . HIS A  1  608 ? 122.180 -80.618  -11.602 1.00 31.71  ? 608  HIS A ND1   1 
ATOM   4762  C  CD2   . HIS A  1  608 ? 122.631 -82.732  -11.913 1.00 40.99  ? 608  HIS A CD2   1 
ATOM   4763  C  CE1   . HIS A  1  608 ? 121.471 -81.302  -10.722 1.00 31.91  ? 608  HIS A CE1   1 
ATOM   4764  N  NE2   . HIS A  1  608 ? 121.724 -82.587  -10.892 1.00 32.30  ? 608  HIS A NE2   1 
ATOM   4765  N  N     . PHE A  1  609 ? 121.896 -81.820  -15.765 1.00 44.96  ? 609  PHE A N     1 
ATOM   4766  C  CA    . PHE A  1  609 ? 120.614 -82.310  -16.264 1.00 46.47  ? 609  PHE A CA    1 
ATOM   4767  C  C     . PHE A  1  609 ? 120.803 -83.523  -17.170 1.00 41.91  ? 609  PHE A C     1 
ATOM   4768  O  O     . PHE A  1  609 ? 120.163 -84.564  -16.978 1.00 48.47  ? 609  PHE A O     1 
ATOM   4769  C  CB    . PHE A  1  609 ? 119.880 -81.193  -17.008 1.00 49.03  ? 609  PHE A CB    1 
ATOM   4770  C  CG    . PHE A  1  609 ? 118.619 -81.646  -17.698 1.00 43.25  ? 609  PHE A CG    1 
ATOM   4771  C  CD1   . PHE A  1  609 ? 117.411 -81.671  -17.019 1.00 34.68  ? 609  PHE A CD1   1 
ATOM   4772  C  CD2   . PHE A  1  609 ? 118.643 -82.040  -19.026 1.00 40.92  ? 609  PHE A CD2   1 
ATOM   4773  C  CE1   . PHE A  1  609 ? 116.257 -82.083  -17.645 1.00 35.37  ? 609  PHE A CE1   1 
ATOM   4774  C  CE2   . PHE A  1  609 ? 117.493 -82.456  -19.656 1.00 36.53  ? 609  PHE A CE2   1 
ATOM   4775  C  CZ    . PHE A  1  609 ? 116.296 -82.476  -18.964 1.00 36.46  ? 609  PHE A CZ    1 
ATOM   4776  N  N     . SER A  1  610 ? 121.676 -83.399  -18.168 1.00 34.54  ? 610  SER A N     1 
ATOM   4777  C  CA    . SER A  1  610 ? 121.885 -84.484  -19.120 1.00 35.43  ? 610  SER A CA    1 
ATOM   4778  C  C     . SER A  1  610 ? 122.319 -85.763  -18.413 1.00 47.81  ? 610  SER A C     1 
ATOM   4779  O  O     . SER A  1  610 ? 121.715 -86.829  -18.604 1.00 52.25  ? 610  SER A O     1 
ATOM   4780  C  CB    . SER A  1  610 ? 122.921 -84.064  -20.162 1.00 35.26  ? 610  SER A CB    1 
ATOM   4781  O  OG    . SER A  1  610 ? 123.255 -85.141  -21.015 1.00 35.93  ? 610  SER A OG    1 
ATOM   4782  N  N     . TRP A  1  611 ? 123.357 -85.673  -17.575 1.00 42.75  ? 611  TRP A N     1 
ATOM   4783  C  CA    . TRP A  1  611 ? 123.892 -86.873  -16.941 1.00 36.91  ? 611  TRP A CA    1 
ATOM   4784  C  C     . TRP A  1  611 ? 122.896 -87.480  -15.963 1.00 35.19  ? 611  TRP A C     1 
ATOM   4785  O  O     . TRP A  1  611 ? 122.730 -88.703  -15.925 1.00 35.78  ? 611  TRP A O     1 
ATOM   4786  C  CB    . TRP A  1  611 ? 125.215 -86.567  -16.237 1.00 39.73  ? 611  TRP A CB    1 
ATOM   4787  C  CG    . TRP A  1  611 ? 126.016 -87.805  -15.936 1.00 39.46  ? 611  TRP A CG    1 
ATOM   4788  C  CD1   . TRP A  1  611 ? 125.672 -89.091  -16.232 1.00 35.46  ? 611  TRP A CD1   1 
ATOM   4789  C  CD2   . TRP A  1  611 ? 127.293 -87.873  -15.286 1.00 43.51  ? 611  TRP A CD2   1 
ATOM   4790  N  NE1   . TRP A  1  611 ? 126.648 -89.955  -15.805 1.00 39.41  ? 611  TRP A NE1   1 
ATOM   4791  C  CE2   . TRP A  1  611 ? 127.657 -89.233  -15.224 1.00 46.60  ? 611  TRP A CE2   1 
ATOM   4792  C  CE3   . TRP A  1  611 ? 128.164 -86.916  -14.753 1.00 38.40  ? 611  TRP A CE3   1 
ATOM   4793  C  CZ2   . TRP A  1  611 ? 128.856 -89.661  -14.649 1.00 47.56  ? 611  TRP A CZ2   1 
ATOM   4794  C  CZ3   . TRP A  1  611 ? 129.354 -87.342  -14.185 1.00 33.71  ? 611  TRP A CZ3   1 
ATOM   4795  C  CH2   . TRP A  1  611 ? 129.688 -88.703  -14.136 1.00 40.52  ? 611  TRP A CH2   1 
ATOM   4796  N  N     . LYS A  1  612 ? 122.211 -86.654  -15.169 1.00 37.58  ? 612  LYS A N     1 
ATOM   4797  C  CA    . LYS A  1  612 ? 121.300 -87.209  -14.177 1.00 37.15  ? 612  LYS A CA    1 
ATOM   4798  C  C     . LYS A  1  612 ? 120.090 -87.853  -14.838 1.00 38.55  ? 612  LYS A C     1 
ATOM   4799  O  O     . LYS A  1  612 ? 119.631 -88.914  -14.398 1.00 39.47  ? 612  LYS A O     1 
ATOM   4800  C  CB    . LYS A  1  612 ? 120.866 -86.123  -13.200 1.00 38.53  ? 612  LYS A CB    1 
ATOM   4801  C  CG    . LYS A  1  612 ? 119.837 -86.576  -12.183 1.00 35.41  ? 612  LYS A CG    1 
ATOM   4802  C  CD    . LYS A  1  612 ? 120.445 -87.488  -11.143 1.00 35.42  ? 612  LYS A CD    1 
ATOM   4803  C  CE    . LYS A  1  612 ? 119.473 -87.696  -10.007 1.00 35.56  ? 612  LYS A CE    1 
ATOM   4804  N  NZ    . LYS A  1  612 ? 120.087 -88.436  -8.889  1.00 35.54  ? 612  LYS A NZ    1 
ATOM   4805  N  N     . MET A  1  613 ? 119.562 -87.240  -15.901 1.00 47.14  ? 613  MET A N     1 
ATOM   4806  C  CA    . MET A  1  613 ? 118.415 -87.832  -16.577 1.00 41.49  ? 613  MET A CA    1 
ATOM   4807  C  C     . MET A  1  613 ? 118.810 -89.108  -17.310 1.00 45.73  ? 613  MET A C     1 
ATOM   4808  O  O     . MET A  1  613 ? 118.053 -90.086  -17.309 1.00 46.41  ? 613  MET A O     1 
ATOM   4809  C  CB    . MET A  1  613 ? 117.786 -86.823  -17.537 1.00 43.71  ? 613  MET A CB    1 
ATOM   4810  C  CG    . MET A  1  613 ? 117.268 -85.550  -16.863 1.00 46.99  ? 613  MET A CG    1 
ATOM   4811  S  SD    . MET A  1  613 ? 115.946 -85.815  -15.662 1.00 38.72  ? 613  MET A SD    1 
ATOM   4812  C  CE    . MET A  1  613 ? 114.664 -86.482  -16.719 1.00 39.13  ? 613  MET A CE    1 
ATOM   4813  N  N     . GLN A  1  614 ? 119.995 -89.130  -17.929 1.00 42.41  ? 614  GLN A N     1 
ATOM   4814  C  CA    . GLN A  1  614 ? 120.424 -90.346  -18.610 1.00 43.28  ? 614  GLN A CA    1 
ATOM   4815  C  C     . GLN A  1  614 ? 120.747 -91.464  -17.625 1.00 47.83  ? 614  GLN A C     1 
ATOM   4816  O  O     . GLN A  1  614 ? 120.542 -92.642  -17.942 1.00 51.50  ? 614  GLN A O     1 
ATOM   4817  C  CB    . GLN A  1  614 ? 121.633 -90.057  -19.503 1.00 44.09  ? 614  GLN A CB    1 
ATOM   4818  C  CG    . GLN A  1  614 ? 121.286 -89.383  -20.829 1.00 45.37  ? 614  GLN A CG    1 
ATOM   4819  C  CD    . GLN A  1  614 ? 122.520 -89.029  -21.646 1.00 43.40  ? 614  GLN A CD    1 
ATOM   4820  O  OE1   . GLN A  1  614 ? 123.073 -89.869  -22.357 1.00 40.01  ? 614  GLN A OE1   1 
ATOM   4821  N  NE2   . GLN A  1  614 ? 122.957 -87.779  -21.542 1.00 40.43  ? 614  GLN A NE2   1 
ATOM   4822  N  N     . SER A  1  615 ? 121.235 -91.125  -16.430 1.00 43.39  ? 615  SER A N     1 
ATOM   4823  C  CA    . SER A  1  615 ? 121.665 -92.136  -15.471 1.00 43.79  ? 615  SER A CA    1 
ATOM   4824  C  C     . SER A  1  615 ? 120.530 -92.677  -14.618 1.00 47.70  ? 615  SER A C     1 
ATOM   4825  O  O     . SER A  1  615 ? 120.467 -93.888  -14.381 1.00 42.08  ? 615  SER A O     1 
ATOM   4826  C  CB    . SER A  1  615 ? 122.755 -91.564  -14.558 1.00 52.47  ? 615  SER A CB    1 
ATOM   4827  O  OG    . SER A  1  615 ? 122.885 -92.327  -13.368 1.00 36.58  ? 615  SER A OG    1 
ATOM   4828  N  N     . ASP A  1  616 ? 119.632 -91.811  -14.142 1.00 47.77  ? 616  ASP A N     1 
ATOM   4829  C  CA    . ASP A  1  616 ? 118.686 -92.193  -13.106 1.00 46.72  ? 616  ASP A CA    1 
ATOM   4830  C  C     . ASP A  1  616 ? 117.219 -92.066  -13.492 1.00 43.38  ? 616  ASP A C     1 
ATOM   4831  O  O     . ASP A  1  616 ? 116.363 -92.503  -12.716 1.00 44.23  ? 616  ASP A O     1 
ATOM   4832  C  CB    . ASP A  1  616 ? 118.930 -91.357  -11.839 1.00 46.13  ? 616  ASP A CB    1 
ATOM   4833  C  CG    . ASP A  1  616 ? 120.319 -91.551  -11.274 1.00 43.10  ? 616  ASP A CG    1 
ATOM   4834  O  OD1   . ASP A  1  616 ? 120.924 -92.615  -11.519 1.00 48.88  ? 616  ASP A OD1   1 
ATOM   4835  O  OD2   . ASP A  1  616 ? 120.806 -90.639  -10.580 1.00 49.22  ? 616  ASP A OD2   1 
ATOM   4836  N  N     . VAL A  1  617 ? 116.893 -91.480  -14.642 1.00 43.03  ? 617  VAL A N     1 
ATOM   4837  C  CA    . VAL A  1  617 ? 115.492 -91.267  -14.991 1.00 45.85  ? 617  VAL A CA    1 
ATOM   4838  C  C     . VAL A  1  617 ? 115.186 -91.946  -16.317 1.00 53.96  ? 617  VAL A C     1 
ATOM   4839  O  O     . VAL A  1  617 ? 114.439 -92.930  -16.369 1.00 40.14  ? 617  VAL A O     1 
ATOM   4840  C  CB    . VAL A  1  617 ? 115.147 -89.768  -15.056 1.00 42.42  ? 617  VAL A CB    1 
ATOM   4841  C  CG1   . VAL A  1  617 ? 113.637 -89.578  -15.108 1.00 43.95  ? 617  VAL A CG1   1 
ATOM   4842  C  CG2   . VAL A  1  617 ? 115.748 -89.026  -13.872 1.00 42.94  ? 617  VAL A CG2   1 
ATOM   4843  N  N     . TRP A  1  618 ? 115.768 -91.424  -17.392 1.00 45.86  ? 618  TRP A N     1 
ATOM   4844  C  CA    . TRP A  1  618 ? 115.516 -91.943  -18.724 1.00 41.26  ? 618  TRP A CA    1 
ATOM   4845  C  C     . TRP A  1  618 ? 115.986 -93.389  -18.836 1.00 40.63  ? 618  TRP A C     1 
ATOM   4846  O  O     . TRP A  1  618 ? 116.835 -93.857  -18.073 1.00 48.80  ? 618  TRP A O     1 
ATOM   4847  C  CB    . TRP A  1  618 ? 116.215 -91.070  -19.766 1.00 48.57  ? 618  TRP A CB    1 
ATOM   4848  C  CG    . TRP A  1  618 ? 115.617 -89.695  -19.871 1.00 46.07  ? 618  TRP A CG    1 
ATOM   4849  C  CD1   . TRP A  1  618 ? 114.387 -89.297  -19.423 1.00 39.44  ? 618  TRP A CD1   1 
ATOM   4850  C  CD2   . TRP A  1  618 ? 116.223 -88.537  -20.456 1.00 43.04  ? 618  TRP A CD2   1 
ATOM   4851  N  NE1   . TRP A  1  618 ? 114.190 -87.967  -19.700 1.00 42.24  ? 618  TRP A NE1   1 
ATOM   4852  C  CE2   . TRP A  1  618 ? 115.302 -87.476  -20.332 1.00 41.20  ? 618  TRP A CE2   1 
ATOM   4853  C  CE3   . TRP A  1  618 ? 117.453 -88.294  -21.074 1.00 44.12  ? 618  TRP A CE3   1 
ATOM   4854  C  CZ2   . TRP A  1  618 ? 115.574 -86.195  -20.801 1.00 44.72  ? 618  TRP A CZ2   1 
ATOM   4855  C  CZ3   . TRP A  1  618 ? 117.721 -87.018  -21.540 1.00 46.11  ? 618  TRP A CZ3   1 
ATOM   4856  C  CH2   . TRP A  1  618 ? 116.786 -85.986  -21.402 1.00 49.94  ? 618  TRP A CH2   1 
ATOM   4857  N  N     . GLY A  1  619 ? 115.416 -94.098  -19.795 1.00 41.73  ? 619  GLY A N     1 
ATOM   4858  C  CA    . GLY A  1  619 ? 115.770 -95.485  -20.021 1.00 42.44  ? 619  GLY A CA    1 
ATOM   4859  C  C     . GLY A  1  619 ? 114.622 -96.240  -20.658 1.00 43.51  ? 619  GLY A C     1 
ATOM   4860  O  O     . GLY A  1  619 ? 113.581 -95.682  -20.993 1.00 50.29  ? 619  GLY A O     1 
ATOM   4861  N  N     . THR A  1  620 ? 114.841 -97.538  -20.824 1.00 47.23  ? 620  THR A N     1 
ATOM   4862  C  CA    . THR A  1  620 ? 113.825 -98.416  -21.379 1.00 49.97  ? 620  THR A CA    1 
ATOM   4863  C  C     . THR A  1  620 ? 113.337 -99.382  -20.307 1.00 49.76  ? 620  THR A C     1 
ATOM   4864  O  O     . THR A  1  620 ? 114.095 -99.794  -19.428 1.00 49.54  ? 620  THR A O     1 
ATOM   4865  C  CB    . THR A  1  620 ? 114.355 -99.181  -22.597 1.00 47.84  ? 620  THR A CB    1 
ATOM   4866  O  OG1   . THR A  1  620 ? 113.274 -99.885  -23.219 1.00 65.17  ? 620  THR A OG1   1 
ATOM   4867  C  CG2   . THR A  1  620 ? 115.445 -100.166 -22.198 1.00 46.35  ? 620  THR A CG2   1 
ATOM   4868  N  N     . VAL A  1  621 ? 112.055 -99.728  -20.366 1.00 52.21  ? 621  VAL A N     1 
ATOM   4869  C  CA    . VAL A  1  621 ? 111.432 -100.561 -19.345 1.00 60.58  ? 621  VAL A CA    1 
ATOM   4870  C  C     . VAL A  1  621 ? 110.970 -101.860 -19.990 1.00 62.00  ? 621  VAL A C     1 
ATOM   4871  O  O     . VAL A  1  621 ? 110.401 -101.851 -21.088 1.00 67.00  ? 621  VAL A O     1 
ATOM   4872  C  CB    . VAL A  1  621 ? 110.274 -99.830  -18.633 1.00 63.57  ? 621  VAL A CB    1 
ATOM   4873  C  CG1   . VAL A  1  621 ? 110.045 -98.457  -19.248 1.00 48.12  ? 621  VAL A CG1   1 
ATOM   4874  C  CG2   . VAL A  1  621 ? 108.996 -100.666 -18.636 1.00 61.05  ? 621  VAL A CG2   1 
ATOM   4875  N  N     . SER A  1  622 ? 111.255 -102.972 -19.322 1.00 64.44  ? 622  SER A N     1 
ATOM   4876  C  CA    . SER A  1  622 ? 110.865 -104.286 -19.793 1.00 69.00  ? 622  SER A CA    1 
ATOM   4877  C  C     . SER A  1  622 ? 109.390 -104.528 -19.501 1.00 85.58  ? 622  SER A C     1 
ATOM   4878  O  O     . SER A  1  622 ? 108.822 -103.927 -18.585 1.00 89.25  ? 622  SER A O     1 
ATOM   4879  C  CB    . SER A  1  622 ? 111.710 -105.357 -19.112 1.00 74.69  ? 622  SER A CB    1 
ATOM   4880  O  OG    . SER A  1  622 ? 113.059 -104.944 -18.979 1.00 79.05  ? 622  SER A OG    1 
ATOM   4881  N  N     . PRO A  1  623 ? 108.740 -105.408 -20.266 1.00 88.05  ? 623  PRO A N     1 
ATOM   4882  C  CA    . PRO A  1  623 ? 107.362 -105.793 -19.918 1.00 92.03  ? 623  PRO A CA    1 
ATOM   4883  C  C     . PRO A  1  623 ? 107.241 -106.418 -18.537 1.00 93.80  ? 623  PRO A C     1 
ATOM   4884  O  O     . PRO A  1  623 ? 106.124 -106.512 -18.012 1.00 90.33  ? 623  PRO A O     1 
ATOM   4885  C  CB    . PRO A  1  623 ? 106.982 -106.787 -21.026 1.00 92.90  ? 623  PRO A CB    1 
ATOM   4886  C  CG    . PRO A  1  623 ? 108.286 -107.244 -21.605 1.00 90.52  ? 623  PRO A CG    1 
ATOM   4887  C  CD    . PRO A  1  623 ? 109.204 -106.069 -21.497 1.00 88.68  ? 623  PRO A CD    1 
ATOM   4888  N  N     . ASP A  1  624 ? 108.353 -106.844 -17.930 1.00 94.90  ? 624  ASP A N     1 
ATOM   4889  C  CA    . ASP A  1  624 ? 108.320 -107.350 -16.562 1.00 91.68  ? 624  ASP A CA    1 
ATOM   4890  C  C     . ASP A  1  624 ? 108.114 -106.236 -15.541 1.00 82.88  ? 624  ASP A C     1 
ATOM   4891  O  O     . ASP A  1  624 ? 107.700 -106.515 -14.410 1.00 79.98  ? 624  ASP A O     1 
ATOM   4892  C  CB    . ASP A  1  624 ? 109.610 -108.121 -16.265 1.00 96.96  ? 624  ASP A CB    1 
ATOM   4893  C  CG    . ASP A  1  624 ? 110.403 -107.522 -15.119 1.00 104.87 ? 624  ASP A CG    1 
ATOM   4894  O  OD1   . ASP A  1  624 ? 110.084 -107.820 -13.948 1.00 108.05 ? 624  ASP A OD1   1 
ATOM   4895  O  OD2   . ASP A  1  624 ? 111.349 -106.754 -15.390 1.00 106.85 ? 624  ASP A OD2   1 
ATOM   4896  N  N     . GLY A  1  625 ? 108.381 -104.983 -15.915 1.00 87.03  ? 625  GLY A N     1 
ATOM   4897  C  CA    . GLY A  1  625 ? 108.185 -103.833 -15.048 1.00 79.34  ? 625  GLY A CA    1 
ATOM   4898  C  C     . GLY A  1  625 ? 109.468 -103.097 -14.713 1.00 73.30  ? 625  GLY A C     1 
ATOM   4899  O  O     . GLY A  1  625 ? 109.430 -101.895 -14.430 1.00 63.81  ? 625  GLY A O     1 
ATOM   4900  N  N     . SER A  1  626 ? 110.603 -103.792 -14.748 1.00 78.60  ? 626  SER A N     1 
ATOM   4901  C  CA    . SER A  1  626 ? 111.873 -103.197 -14.359 1.00 78.10  ? 626  SER A CA    1 
ATOM   4902  C  C     . SER A  1  626 ? 112.335 -102.157 -15.380 1.00 66.59  ? 626  SER A C     1 
ATOM   4903  O  O     . SER A  1  626 ? 111.913 -102.147 -16.539 1.00 72.59  ? 626  SER A O     1 
ATOM   4904  C  CB    . SER A  1  626 ? 112.940 -104.279 -14.198 1.00 77.95  ? 626  SER A CB    1 
ATOM   4905  O  OG    . SER A  1  626 ? 113.004 -105.092 -15.355 1.00 81.59  ? 626  SER A OG    1 
ATOM   4906  N  N     . VAL A  1  627 ? 113.226 -101.275 -14.931 1.00 54.63  ? 627  VAL A N     1 
ATOM   4907  C  CA    . VAL A  1  627 ? 113.738 -100.175 -15.739 1.00 53.44  ? 627  VAL A CA    1 
ATOM   4908  C  C     . VAL A  1  627 ? 115.241 -100.344 -15.905 1.00 51.89  ? 627  VAL A C     1 
ATOM   4909  O  O     . VAL A  1  627 ? 115.933 -100.768 -14.974 1.00 59.49  ? 627  VAL A O     1 
ATOM   4910  C  CB    . VAL A  1  627 ? 113.409 -98.805  -15.106 1.00 48.98  ? 627  VAL A CB    1 
ATOM   4911  C  CG1   . VAL A  1  627 ? 114.015 -97.679  -15.921 1.00 47.07  ? 627  VAL A CG1   1 
ATOM   4912  C  CG2   . VAL A  1  627 ? 111.902 -98.622  -14.980 1.00 46.93  ? 627  VAL A CG2   1 
ATOM   4913  N  N     . THR A  1  628 ? 115.745 -100.013 -17.093 1.00 51.07  ? 628  THR A N     1 
ATOM   4914  C  CA    . THR A  1  628 ? 117.168 -100.054 -17.406 1.00 48.55  ? 628  THR A CA    1 
ATOM   4915  C  C     . THR A  1  628 ? 117.533 -98.714  -18.025 1.00 48.95  ? 628  THR A C     1 
ATOM   4916  O  O     . THR A  1  628 ? 117.055 -98.381  -19.115 1.00 47.08  ? 628  THR A O     1 
ATOM   4917  C  CB    . THR A  1  628 ? 117.495 -101.204 -18.356 1.00 51.21  ? 628  THR A CB    1 
ATOM   4918  O  OG1   . THR A  1  628 ? 117.387 -102.447 -17.652 1.00 61.24  ? 628  THR A OG1   1 
ATOM   4919  C  CG2   . THR A  1  628 ? 118.901 -101.055 -18.913 1.00 45.28  ? 628  THR A CG2   1 
ATOM   4920  N  N     . HIS A  1  629 ? 118.374 -97.952  -17.333 1.00 47.11  ? 629  HIS A N     1 
ATOM   4921  C  CA    . HIS A  1  629 ? 118.612 -96.561  -17.681 1.00 49.06  ? 629  HIS A CA    1 
ATOM   4922  C  C     . HIS A  1  629 ? 119.666 -96.435  -18.776 1.00 42.82  ? 629  HIS A C     1 
ATOM   4923  O  O     . HIS A  1  629 ? 120.414 -97.372  -19.071 1.00 41.55  ? 629  HIS A O     1 
ATOM   4924  C  CB    . HIS A  1  629 ? 119.032 -95.773  -16.444 1.00 40.16  ? 629  HIS A CB    1 
ATOM   4925  C  CG    . HIS A  1  629 ? 117.991 -95.754  -15.370 1.00 40.15  ? 629  HIS A CG    1 
ATOM   4926  N  ND1   . HIS A  1  629 ? 116.836 -95.009  -15.469 1.00 40.13  ? 629  HIS A ND1   1 
ATOM   4927  C  CD2   . HIS A  1  629 ? 117.923 -96.399  -14.182 1.00 40.21  ? 629  HIS A CD2   1 
ATOM   4928  C  CE1   . HIS A  1  629 ? 116.103 -95.191  -14.386 1.00 40.19  ? 629  HIS A CE1   1 
ATOM   4929  N  NE2   . HIS A  1  629 ? 116.741 -96.027  -13.587 1.00 50.85  ? 629  HIS A NE2   1 
ATOM   4930  N  N     . VAL A  1  630 ? 119.720 -95.241  -19.374 1.00 47.53  ? 630  VAL A N     1 
ATOM   4931  C  CA    . VAL A  1  630 ? 120.556 -95.023  -20.553 1.00 50.16  ? 630  VAL A CA    1 
ATOM   4932  C  C     . VAL A  1  630 ? 122.030 -95.208  -20.212 1.00 47.39  ? 630  VAL A C     1 
ATOM   4933  O  O     . VAL A  1  630 ? 122.788 -95.808  -20.985 1.00 47.38  ? 630  VAL A O     1 
ATOM   4934  C  CB    . VAL A  1  630 ? 120.283 -93.631  -21.155 1.00 48.63  ? 630  VAL A CB    1 
ATOM   4935  C  CG1   . VAL A  1  630 ? 121.015 -93.469  -22.479 1.00 40.67  ? 630  VAL A CG1   1 
ATOM   4936  C  CG2   . VAL A  1  630 ? 118.787 -93.408  -21.338 1.00 46.56  ? 630  VAL A CG2   1 
ATOM   4937  N  N     . THR A  1  631 ? 122.462 -94.701  -19.055 1.00 42.41  ? 631  THR A N     1 
ATOM   4938  C  CA    . THR A  1  631 ? 123.847 -94.842  -18.617 1.00 39.22  ? 631  THR A CA    1 
ATOM   4939  C  C     . THR A  1  631 ? 123.948 -95.632  -17.314 1.00 39.44  ? 631  THR A C     1 
ATOM   4940  O  O     . THR A  1  631 ? 124.860 -95.414  -16.513 1.00 48.37  ? 631  THR A O     1 
ATOM   4941  C  CB    . THR A  1  631 ? 124.525 -93.476  -18.484 1.00 41.56  ? 631  THR A CB    1 
ATOM   4942  O  OG1   . THR A  1  631 ? 123.831 -92.673  -17.523 1.00 47.52  ? 631  THR A OG1   1 
ATOM   4943  C  CG2   . THR A  1  631 ? 124.527 -92.755  -19.822 1.00 38.48  ? 631  THR A CG2   1 
ATOM   4944  N  N     . LEU A  1  632 ? 122.993 -96.537  -17.087 1.00 39.80  ? 632  LEU A N     1 
ATOM   4945  C  CA    . LEU A  1  632 ? 123.119 -97.617  -16.103 1.00 40.07  ? 632  LEU A CA    1 
ATOM   4946  C  C     . LEU A  1  632 ? 123.445 -97.106  -14.701 1.00 39.32  ? 632  LEU A C     1 
ATOM   4947  O  O     . LEU A  1  632 ? 124.299 -97.660  -14.005 1.00 41.06  ? 632  LEU A O     1 
ATOM   4948  C  CB    . LEU A  1  632 ? 124.159 -98.640  -16.562 1.00 40.60  ? 632  LEU A CB    1 
ATOM   4949  C  CG    . LEU A  1  632 ? 123.836 -99.315  -17.898 1.00 41.49  ? 632  LEU A CG    1 
ATOM   4950  C  CD1   . LEU A  1  632 ? 124.963 -100.235 -18.329 1.00 41.98  ? 632  LEU A CD1   1 
ATOM   4951  C  CD2   . LEU A  1  632 ? 122.522 -100.079 -17.808 1.00 42.21  ? 632  LEU A CD2   1 
ATOM   4952  N  N     . GLY A  1  633 ? 122.756 -96.048  -14.278 1.00 38.87  ? 633  GLY A N     1 
ATOM   4953  C  CA    . GLY A  1  633 ? 122.885 -95.559  -12.915 1.00 38.14  ? 633  GLY A CA    1 
ATOM   4954  C  C     . GLY A  1  633 ? 124.291 -95.190  -12.494 1.00 45.47  ? 633  GLY A C     1 
ATOM   4955  O  O     . GLY A  1  633 ? 124.640 -95.352  -11.320 1.00 41.71  ? 633  GLY A O     1 
ATOM   4956  N  N     . ASN A  1  634 ? 125.109 -94.679  -13.417 1.00 37.35  ? 634  ASN A N     1 
ATOM   4957  C  CA    . ASN A  1  634 ? 126.507 -94.397  -13.108 1.00 36.91  ? 634  ASN A CA    1 
ATOM   4958  C  C     . ASN A  1  634 ? 126.718 -93.076  -12.374 1.00 36.92  ? 634  ASN A C     1 
ATOM   4959  O  O     . ASN A  1  634 ? 127.836 -92.821  -11.915 1.00 41.64  ? 634  ASN A O     1 
ATOM   4960  C  CB    . ASN A  1  634 ? 127.339 -94.403  -14.396 1.00 37.12  ? 634  ASN A CB    1 
ATOM   4961  C  CG    . ASN A  1  634 ? 126.868 -93.369  -15.405 1.00 42.32  ? 634  ASN A CG    1 
ATOM   4962  O  OD1   . ASN A  1  634 ? 125.787 -92.798  -15.272 1.00 49.31  ? 634  ASN A OD1   1 
ATOM   4963  N  ND2   . ASN A  1  634 ? 127.680 -93.130  -16.427 1.00 41.49  ? 634  ASN A ND2   1 
ATOM   4964  N  N     . PHE A  1  635 ? 125.679 -92.246  -12.239 1.00 39.80  ? 635  PHE A N     1 
ATOM   4965  C  CA    . PHE A  1  635 ? 125.854 -90.892  -11.715 1.00 34.98  ? 635  PHE A CA    1 
ATOM   4966  C  C     . PHE A  1  635 ? 126.390 -90.904  -10.287 1.00 37.85  ? 635  PHE A C     1 
ATOM   4967  O  O     . PHE A  1  635 ? 127.347 -90.190  -9.968  1.00 39.35  ? 635  PHE A O     1 
ATOM   4968  C  CB    . PHE A  1  635 ? 124.527 -90.134  -11.782 1.00 37.25  ? 635  PHE A CB    1 
ATOM   4969  C  CG    . PHE A  1  635 ? 124.648 -88.654  -11.535 1.00 45.21  ? 635  PHE A CG    1 
ATOM   4970  C  CD1   . PHE A  1  635 ? 125.107 -87.806  -12.532 1.00 46.57  ? 635  PHE A CD1   1 
ATOM   4971  C  CD2   . PHE A  1  635 ? 124.280 -88.106  -10.316 1.00 44.33  ? 635  PHE A CD2   1 
ATOM   4972  C  CE1   . PHE A  1  635 ? 125.208 -86.443  -12.310 1.00 41.83  ? 635  PHE A CE1   1 
ATOM   4973  C  CE2   . PHE A  1  635 ? 124.379 -86.745  -10.091 1.00 33.14  ? 635  PHE A CE2   1 
ATOM   4974  C  CZ    . PHE A  1  635 ? 124.845 -85.916  -11.087 1.00 32.92  ? 635  PHE A CZ    1 
ATOM   4975  N  N     . ALA A  1  636 ? 125.791 -91.720  -9.416  1.00 37.03  ? 636  ALA A N     1 
ATOM   4976  C  CA    . ALA A  1  636 ? 126.096 -91.631  -7.989  1.00 34.69  ? 636  ALA A CA    1 
ATOM   4977  C  C     . ALA A  1  636 ? 127.573 -91.882  -7.708  1.00 38.20  ? 636  ALA A C     1 
ATOM   4978  O  O     . ALA A  1  636 ? 128.177 -91.195  -6.877  1.00 41.53  ? 636  ALA A O     1 
ATOM   4979  C  CB    . ALA A  1  636 ? 125.228 -92.610  -7.202  1.00 35.22  ? 636  ALA A CB    1 
ATOM   4980  N  N     . GLN A  1  637 ? 128.177 -92.850  -8.393  1.00 42.92  ? 637  GLN A N     1 
ATOM   4981  C  CA    . GLN A  1  637 ? 129.570 -93.186  -8.128  1.00 36.38  ? 637  GLN A CA    1 
ATOM   4982  C  C     . GLN A  1  637 ? 130.557 -92.400  -8.978  1.00 41.24  ? 637  GLN A C     1 
ATOM   4983  O  O     . GLN A  1  637 ? 131.716 -92.253  -8.573  1.00 43.28  ? 637  GLN A O     1 
ATOM   4984  C  CB    . GLN A  1  637 ? 129.806 -94.686  -8.335  1.00 35.80  ? 637  GLN A CB    1 
ATOM   4985  C  CG    . GLN A  1  637 ? 129.367 -95.554  -7.156  1.00 42.20  ? 637  GLN A CG    1 
ATOM   4986  C  CD    . GLN A  1  637 ? 130.134 -95.246  -5.875  1.00 56.17  ? 637  GLN A CD    1 
ATOM   4987  O  OE1   . GLN A  1  637 ? 129.546 -95.112  -4.800  1.00 63.88  ? 637  GLN A OE1   1 
ATOM   4988  N  NE2   . GLN A  1  637 ? 131.451 -95.139  -5.985  1.00 61.93  ? 637  GLN A NE2   1 
ATOM   4989  N  N     . SER A  1  638 ? 130.134 -91.886  -10.133 1.00 34.65  ? 638  SER A N     1 
ATOM   4990  C  CA    . SER A  1  638 ? 131.041 -91.201  -11.046 1.00 34.43  ? 638  SER A CA    1 
ATOM   4991  C  C     . SER A  1  638 ? 130.949 -89.685  -10.979 1.00 33.74  ? 638  SER A C     1 
ATOM   4992  O  O     . SER A  1  638 ? 131.962 -89.008  -11.176 1.00 42.28  ? 638  SER A O     1 
ATOM   4993  C  CB    . SER A  1  638 ? 130.779 -91.645  -12.488 1.00 46.98  ? 638  SER A CB    1 
ATOM   4994  O  OG    . SER A  1  638 ? 131.025 -93.028  -12.650 1.00 46.76  ? 638  SER A OG    1 
ATOM   4995  N  N     . ALA A  1  639 ? 129.768 -89.128  -10.713 1.00 33.54  ? 639  ALA A N     1 
ATOM   4996  C  CA    . ALA A  1  639 ? 129.631 -87.677  -10.668 1.00 36.44  ? 639  ALA A CA    1 
ATOM   4997  C  C     . ALA A  1  639 ? 130.258 -87.043  -9.435  1.00 36.28  ? 639  ALA A C     1 
ATOM   4998  O  O     . ALA A  1  639 ? 130.186 -85.817  -9.297  1.00 39.31  ? 639  ALA A O     1 
ATOM   4999  C  CB    . ALA A  1  639 ? 128.155 -87.287  -10.739 1.00 37.49  ? 639  ALA A CB    1 
ATOM   5000  N  N     . ILE A  1  640 ? 130.866 -87.824  -8.539  1.00 37.93  ? 640  ILE A N     1 
ATOM   5001  C  CA    . ILE A  1  640 ? 131.444 -87.269  -7.316  1.00 32.15  ? 640  ILE A CA    1 
ATOM   5002  C  C     . ILE A  1  640 ? 132.923 -86.943  -7.472  1.00 36.44  ? 640  ILE A C     1 
ATOM   5003  O  O     . ILE A  1  640 ? 133.583 -86.562  -6.491  1.00 31.72  ? 640  ILE A O     1 
ATOM   5004  C  CB    . ILE A  1  640 ? 131.245 -88.218  -6.124  1.00 32.43  ? 640  ILE A CB    1 
ATOM   5005  C  CG1   . ILE A  1  640 ? 131.865 -89.584  -6.418  1.00 33.00  ? 640  ILE A CG1   1 
ATOM   5006  C  CG2   . ILE A  1  640 ? 129.774 -88.318  -5.765  1.00 36.59  ? 640  ILE A CG2   1 
ATOM   5007  C  CD1   . ILE A  1  640 ? 131.947 -90.480  -5.211  1.00 33.30  ? 640  ILE A CD1   1 
ATOM   5008  N  N     . THR A  1  641 ? 133.469 -87.087  -8.679  1.00 37.33  ? 641  THR A N     1 
ATOM   5009  C  CA    . THR A  1  641 ? 134.843 -86.698  -8.965  1.00 32.08  ? 641  THR A CA    1 
ATOM   5010  C  C     . THR A  1  641 ? 134.906 -85.998  -10.314 1.00 39.17  ? 641  THR A C     1 
ATOM   5011  O  O     . THR A  1  641 ? 134.085 -86.253  -11.197 1.00 41.72  ? 641  THR A O     1 
ATOM   5012  C  CB    . THR A  1  641 ? 135.806 -87.893  -8.994  1.00 32.58  ? 641  THR A CB    1 
ATOM   5013  O  OG1   . THR A  1  641 ? 135.344 -88.844  -9.961  1.00 33.12  ? 641  THR A OG1   1 
ATOM   5014  C  CG2   . THR A  1  641 ? 135.911 -88.547  -7.623  1.00 32.66  ? 641  THR A CG2   1 
ATOM   5015  N  N     . ILE A  1  642 ? 135.903 -85.121  -10.467 1.00 41.99  ? 642  ILE A N     1 
ATOM   5016  C  CA    . ILE A  1  642 ? 136.126 -84.465  -11.751 1.00 32.54  ? 642  ILE A CA    1 
ATOM   5017  C  C     . ILE A  1  642 ? 136.522 -85.491  -12.805 1.00 42.29  ? 642  ILE A C     1 
ATOM   5018  O  O     . ILE A  1  642 ? 136.123 -85.389  -13.972 1.00 49.66  ? 642  ILE A O     1 
ATOM   5019  C  CB    . ILE A  1  642 ? 137.184 -83.352  -11.606 1.00 33.31  ? 642  ILE A CB    1 
ATOM   5020  C  CG1   . ILE A  1  642 ? 136.826 -82.422  -10.452 1.00 30.93  ? 642  ILE A CG1   1 
ATOM   5021  C  CG2   . ILE A  1  642 ? 137.291 -82.529  -12.879 1.00 31.52  ? 642  ILE A CG2   1 
ATOM   5022  C  CD1   . ILE A  1  642 ? 135.484 -81.749  -10.612 1.00 30.69  ? 642  ILE A CD1   1 
ATOM   5023  N  N     . ASN A  1  643 ? 137.304 -86.503  -12.410 1.00 40.60  ? 643  ASN A N     1 
ATOM   5024  C  CA    . ASN A  1  643 ? 137.652 -87.576  -13.339 1.00 33.63  ? 643  ASN A CA    1 
ATOM   5025  C  C     . ASN A  1  643 ? 136.410 -88.318  -13.811 1.00 37.37  ? 643  ASN A C     1 
ATOM   5026  O  O     . ASN A  1  643 ? 136.329 -88.723  -14.976 1.00 38.99  ? 643  ASN A O     1 
ATOM   5027  C  CB    . ASN A  1  643 ? 138.628 -88.555  -12.685 1.00 36.13  ? 643  ASN A CB    1 
ATOM   5028  C  CG    . ASN A  1  643 ? 139.373 -89.408  -13.704 1.00 40.39  ? 643  ASN A CG    1 
ATOM   5029  O  OD1   . ASN A  1  643 ? 139.644 -88.965  -14.821 1.00 38.07  ? 643  ASN A OD1   1 
ATOM   5030  N  ND2   . ASN A  1  643 ? 139.705 -90.637  -13.321 1.00 40.80  ? 643  ASN A ND2   1 
ATOM   5031  N  N     . GLY A  1  644 ? 135.439 -88.518  -12.914 1.00 42.43  ? 644  GLY A N     1 
ATOM   5032  C  CA    . GLY A  1  644 ? 134.193 -89.153  -13.313 1.00 34.10  ? 644  GLY A CA    1 
ATOM   5033  C  C     . GLY A  1  644 ? 133.455 -88.378  -14.388 1.00 34.06  ? 644  GLY A C     1 
ATOM   5034  O  O     . GLY A  1  644 ? 132.935 -88.963  -15.337 1.00 35.67  ? 644  GLY A O     1 
ATOM   5035  N  N     . TRP A  1  645 ? 133.412 -87.049  -14.263 1.00 37.89  ? 645  TRP A N     1 
ATOM   5036  C  CA    . TRP A  1  645 ? 132.777 -86.232  -15.293 1.00 38.32  ? 645  TRP A CA    1 
ATOM   5037  C  C     . TRP A  1  645 ? 133.593 -86.228  -16.581 1.00 43.86  ? 645  TRP A C     1 
ATOM   5038  O  O     . TRP A  1  645 ? 133.028 -86.184  -17.680 1.00 38.62  ? 645  TRP A O     1 
ATOM   5039  C  CB    . TRP A  1  645 ? 132.582 -84.801  -14.792 1.00 33.32  ? 645  TRP A CB    1 
ATOM   5040  C  CG    . TRP A  1  645 ? 131.473 -84.634  -13.797 1.00 34.10  ? 645  TRP A CG    1 
ATOM   5041  C  CD1   . TRP A  1  645 ? 131.534 -84.860  -12.453 1.00 34.85  ? 645  TRP A CD1   1 
ATOM   5042  C  CD2   . TRP A  1  645 ? 130.141 -84.183  -14.067 1.00 43.68  ? 645  TRP A CD2   1 
ATOM   5043  N  NE1   . TRP A  1  645 ? 130.320 -84.589  -11.869 1.00 36.50  ? 645  TRP A NE1   1 
ATOM   5044  C  CE2   . TRP A  1  645 ? 129.447 -84.172  -12.838 1.00 42.35  ? 645  TRP A CE2   1 
ATOM   5045  C  CE3   . TRP A  1  645 ? 129.465 -83.797  -15.229 1.00 40.54  ? 645  TRP A CE3   1 
ATOM   5046  C  CZ2   . TRP A  1  645 ? 128.113 -83.785  -12.737 1.00 35.03  ? 645  TRP A CZ2   1 
ATOM   5047  C  CZ3   . TRP A  1  645 ? 128.139 -83.415  -15.127 1.00 38.64  ? 645  TRP A CZ3   1 
ATOM   5048  C  CH2   . TRP A  1  645 ? 127.477 -83.411  -13.889 1.00 34.04  ? 645  TRP A CH2   1 
ATOM   5049  N  N     . LEU A  1  646 ? 134.922 -86.263  -16.466 1.00 42.56  ? 646  LEU A N     1 
ATOM   5050  C  CA    . LEU A  1  646 ? 135.763 -86.219  -17.658 1.00 41.27  ? 646  LEU A CA    1 
ATOM   5051  C  C     . LEU A  1  646 ? 135.672 -87.518  -18.446 1.00 44.34  ? 646  LEU A C     1 
ATOM   5052  O  O     . LEU A  1  646 ? 135.712 -87.506  -19.682 1.00 42.50  ? 646  LEU A O     1 
ATOM   5053  C  CB    . LEU A  1  646 ? 137.215 -85.933  -17.268 1.00 38.55  ? 646  LEU A CB    1 
ATOM   5054  C  CG    . LEU A  1  646 ? 138.225 -85.936  -18.420 1.00 40.04  ? 646  LEU A CG    1 
ATOM   5055  C  CD1   . LEU A  1  646 ? 138.083 -84.683  -19.269 1.00 34.31  ? 646  LEU A CD1   1 
ATOM   5056  C  CD2   . LEU A  1  646 ? 139.650 -86.096  -17.914 1.00 42.68  ? 646  LEU A CD2   1 
ATOM   5057  N  N     . ARG A  1  647 ? 135.536 -88.647  -17.748 1.00 37.12  ? 647  ARG A N     1 
ATOM   5058  C  CA    . ARG A  1  647 ? 135.584 -89.966  -18.366 1.00 44.58  ? 647  ARG A CA    1 
ATOM   5059  C  C     . ARG A  1  647 ? 134.194 -90.525  -18.652 1.00 48.76  ? 647  ARG A C     1 
ATOM   5060  O  O     . ARG A  1  647 ? 133.878 -90.855  -19.798 1.00 52.24  ? 647  ARG A O     1 
ATOM   5061  C  CB    . ARG A  1  647 ? 136.363 -90.936  -17.464 1.00 48.16  ? 647  ARG A CB    1 
ATOM   5062  C  CG    . ARG A  1  647 ? 136.270 -92.397  -17.896 1.00 36.81  ? 647  ARG A CG    1 
ATOM   5063  C  CD    . ARG A  1  647 ? 136.715 -93.345  -16.791 1.00 36.91  ? 647  ARG A CD    1 
ATOM   5064  N  NE    . ARG A  1  647 ? 135.822 -93.287  -15.640 1.00 36.49  ? 647  ARG A NE    1 
ATOM   5065  C  CZ    . ARG A  1  647 ? 136.164 -92.814  -14.446 1.00 37.26  ? 647  ARG A CZ    1 
ATOM   5066  N  NH1   . ARG A  1  647 ? 137.397 -92.369  -14.231 1.00 35.72  ? 647  ARG A NH1   1 
ATOM   5067  N  NH2   . ARG A  1  647 ? 135.273 -92.798  -13.463 1.00 35.63  ? 647  ARG A NH2   1 
ATOM   5068  N  N     . ASP A  1  648 ? 133.360 -90.654  -17.619 1.00 40.51  ? 648  ASP A N     1 
ATOM   5069  C  CA    . ASP A  1  648 ? 132.076 -91.322  -17.771 1.00 38.57  ? 648  ASP A CA    1 
ATOM   5070  C  C     . ASP A  1  648 ? 131.008 -90.421  -18.376 1.00 41.64  ? 648  ASP A C     1 
ATOM   5071  O  O     . ASP A  1  648 ? 130.051 -90.931  -18.968 1.00 50.53  ? 648  ASP A O     1 
ATOM   5072  C  CB    . ASP A  1  648 ? 131.616 -91.868  -16.417 1.00 36.08  ? 648  ASP A CB    1 
ATOM   5073  C  CG    . ASP A  1  648 ? 132.583 -92.905  -15.848 1.00 38.52  ? 648  ASP A CG    1 
ATOM   5074  O  OD1   . ASP A  1  648 ? 133.380 -93.480  -16.623 1.00 37.83  ? 648  ASP A OD1   1 
ATOM   5075  O  OD2   . ASP A  1  648 ? 132.553 -93.145  -14.625 1.00 40.56  ? 648  ASP A OD2   1 
ATOM   5076  N  N     . PHE A  1  649 ? 131.151 -89.102  -18.264 1.00 40.42  ? 649  PHE A N     1 
ATOM   5077  C  CA    . PHE A  1  649 ? 130.218 -88.203  -18.931 1.00 38.58  ? 649  PHE A CA    1 
ATOM   5078  C  C     . PHE A  1  649 ? 130.785 -87.719  -20.262 1.00 42.30  ? 649  PHE A C     1 
ATOM   5079  O  O     . PHE A  1  649 ? 130.322 -88.147  -21.324 1.00 51.33  ? 649  PHE A O     1 
ATOM   5080  C  CB    . PHE A  1  649 ? 129.867 -87.013  -18.036 1.00 40.30  ? 649  PHE A CB    1 
ATOM   5081  C  CG    . PHE A  1  649 ? 128.969 -86.003  -18.698 1.00 43.43  ? 649  PHE A CG    1 
ATOM   5082  C  CD1   . PHE A  1  649 ? 127.624 -86.273  -18.896 1.00 39.02  ? 649  PHE A CD1   1 
ATOM   5083  C  CD2   . PHE A  1  649 ? 129.471 -84.783  -19.122 1.00 46.29  ? 649  PHE A CD2   1 
ATOM   5084  C  CE1   . PHE A  1  649 ? 126.797 -85.344  -19.506 1.00 37.38  ? 649  PHE A CE1   1 
ATOM   5085  C  CE2   . PHE A  1  649 ? 128.651 -83.849  -19.730 1.00 43.38  ? 649  PHE A CE2   1 
ATOM   5086  C  CZ    . PHE A  1  649 ? 127.312 -84.131  -19.923 1.00 36.76  ? 649  PHE A CZ    1 
ATOM   5087  N  N     . LEU A  1  650 ? 131.790 -86.841  -20.220 1.00 40.39  ? 650  LEU A N     1 
ATOM   5088  C  CA    . LEU A  1  650 ? 132.290 -86.221  -21.446 1.00 38.99  ? 650  LEU A CA    1 
ATOM   5089  C  C     . LEU A  1  650 ? 132.854 -87.260  -22.409 1.00 38.95  ? 650  LEU A C     1 
ATOM   5090  O  O     . LEU A  1  650 ? 132.426 -87.347  -23.564 1.00 36.96  ? 650  LEU A O     1 
ATOM   5091  C  CB    . LEU A  1  650 ? 133.351 -85.168  -21.120 1.00 42.27  ? 650  LEU A CB    1 
ATOM   5092  C  CG    . LEU A  1  650 ? 132.859 -83.757  -20.793 1.00 49.44  ? 650  LEU A CG    1 
ATOM   5093  C  CD1   . LEU A  1  650 ? 134.015 -82.757  -20.821 1.00 38.65  ? 650  LEU A CD1   1 
ATOM   5094  C  CD2   . LEU A  1  650 ? 131.742 -83.330  -21.739 1.00 56.13  ? 650  LEU A CD2   1 
ATOM   5095  N  N     . TRP A  1  651 ? 133.823 -88.057  -21.946 1.00 40.91  ? 651  TRP A N     1 
ATOM   5096  C  CA    . TRP A  1  651 ? 134.508 -88.999  -22.829 1.00 39.25  ? 651  TRP A CA    1 
ATOM   5097  C  C     . TRP A  1  651 ? 133.552 -90.062  -23.355 1.00 39.61  ? 651  TRP A C     1 
ATOM   5098  O  O     . TRP A  1  651 ? 133.514 -90.340  -24.560 1.00 40.77  ? 651  TRP A O     1 
ATOM   5099  C  CB    . TRP A  1  651 ? 135.681 -89.650  -22.091 1.00 45.93  ? 651  TRP A CB    1 
ATOM   5100  C  CG    . TRP A  1  651 ? 136.440 -90.653  -22.915 1.00 44.43  ? 651  TRP A CG    1 
ATOM   5101  C  CD1   . TRP A  1  651 ? 137.499 -90.401  -23.738 1.00 38.59  ? 651  TRP A CD1   1 
ATOM   5102  C  CD2   . TRP A  1  651 ? 136.198 -92.063  -22.993 1.00 44.07  ? 651  TRP A CD2   1 
ATOM   5103  N  NE1   . TRP A  1  651 ? 137.929 -91.565  -24.325 1.00 39.27  ? 651  TRP A NE1   1 
ATOM   5104  C  CE2   . TRP A  1  651 ? 137.148 -92.600  -23.885 1.00 41.69  ? 651  TRP A CE2   1 
ATOM   5105  C  CE3   . TRP A  1  651 ? 135.269 -92.923  -22.400 1.00 43.47  ? 651  TRP A CE3   1 
ATOM   5106  C  CZ2   . TRP A  1  651 ? 137.196 -93.955  -24.198 1.00 42.09  ? 651  TRP A CZ2   1 
ATOM   5107  C  CZ3   . TRP A  1  651 ? 135.320 -94.270  -22.710 1.00 39.64  ? 651  TRP A CZ3   1 
ATOM   5108  C  CH2   . TRP A  1  651 ? 136.277 -94.772  -23.601 1.00 42.43  ? 651  TRP A CH2   1 
ATOM   5109  N  N     . ALA A  1  652 ? 132.767 -90.667  -22.462 1.00 38.57  ? 652  ALA A N     1 
ATOM   5110  C  CA    . ALA A  1  652 ? 131.884 -91.755  -22.869 1.00 38.52  ? 652  ALA A CA    1 
ATOM   5111  C  C     . ALA A  1  652 ? 130.819 -91.270  -23.844 1.00 38.81  ? 652  ALA A C     1 
ATOM   5112  O  O     . ALA A  1  652 ? 130.624 -91.860  -24.911 1.00 39.62  ? 652  ALA A O     1 
ATOM   5113  C  CB    . ALA A  1  652 ? 131.243 -92.395  -21.637 1.00 38.30  ? 652  ALA A CB    1 
ATOM   5114  N  N     . GLN A  1  653 ? 130.128 -90.183  -23.503 1.00 38.20  ? 653  GLN A N     1 
ATOM   5115  C  CA    . GLN A  1  653 ? 129.010 -89.736  -24.323 1.00 42.91  ? 653  GLN A CA    1 
ATOM   5116  C  C     . GLN A  1  653 ? 129.442 -88.993  -25.581 1.00 41.95  ? 653  GLN A C     1 
ATOM   5117  O  O     . GLN A  1  653 ? 128.623 -88.828  -26.491 1.00 47.14  ? 653  GLN A O     1 
ATOM   5118  C  CB    . GLN A  1  653 ? 128.078 -88.855  -23.492 1.00 38.32  ? 653  GLN A CB    1 
ATOM   5119  C  CG    . GLN A  1  653 ? 127.637 -89.517  -22.203 1.00 41.33  ? 653  GLN A CG    1 
ATOM   5120  C  CD    . GLN A  1  653 ? 126.428 -88.853  -21.590 1.00 46.52  ? 653  GLN A CD    1 
ATOM   5121  O  OE1   . GLN A  1  653 ? 125.775 -88.020  -22.220 1.00 47.36  ? 653  GLN A OE1   1 
ATOM   5122  N  NE2   . GLN A  1  653 ? 126.120 -89.220  -20.352 1.00 45.84  ? 653  GLN A NE2   1 
ATOM   5123  N  N     . ALA A  1  654 ? 130.694 -88.538  -25.662 1.00 44.90  ? 654  ALA A N     1 
ATOM   5124  C  CA    . ALA A  1  654 ? 131.149 -87.900  -26.892 1.00 39.52  ? 654  ALA A CA    1 
ATOM   5125  C  C     . ALA A  1  654 ? 131.389 -88.895  -28.017 1.00 39.97  ? 654  ALA A C     1 
ATOM   5126  O  O     . ALA A  1  654 ? 131.704 -88.473  -29.136 1.00 43.88  ? 654  ALA A O     1 
ATOM   5127  C  CB    . ALA A  1  654 ? 132.425 -87.096  -26.639 1.00 38.44  ? 654  ALA A CB    1 
ATOM   5128  N  N     . ALA A  1  655 ? 131.243 -90.196  -27.752 1.00 40.37  ? 655  ALA A N     1 
ATOM   5129  C  CA    . ALA A  1  655 ? 131.489 -91.194  -28.784 1.00 41.40  ? 655  ALA A CA    1 
ATOM   5130  C  C     . ALA A  1  655 ? 130.500 -91.065  -29.934 1.00 51.60  ? 655  ALA A C     1 
ATOM   5131  O  O     . ALA A  1  655 ? 130.847 -91.350  -31.086 1.00 52.43  ? 655  ALA A O     1 
ATOM   5132  C  CB    . ALA A  1  655 ? 131.430 -92.595  -28.178 1.00 41.70  ? 655  ALA A CB    1 
ATOM   5133  N  N     . ASN A  1  656 ? 129.272 -90.630  -29.647 1.00 41.79  ? 656  ASN A N     1 
ATOM   5134  C  CA    . ASN A  1  656 ? 128.289 -90.454  -30.709 1.00 42.46  ? 656  ASN A CA    1 
ATOM   5135  C  C     . ASN A  1  656 ? 128.657 -89.285  -31.611 1.00 42.51  ? 656  ASN A C     1 
ATOM   5136  O  O     . ASN A  1  656 ? 128.518 -89.368  -32.836 1.00 49.07  ? 656  ASN A O     1 
ATOM   5137  C  CB    . ASN A  1  656 ? 126.902 -90.247  -30.106 1.00 42.14  ? 656  ASN A CB    1 
ATOM   5138  C  CG    . ASN A  1  656 ? 126.568 -91.279  -29.051 1.00 42.00  ? 656  ASN A CG    1 
ATOM   5139  O  OD1   . ASN A  1  656 ? 126.463 -90.958  -27.867 1.00 41.18  ? 656  ASN A OD1   1 
ATOM   5140  N  ND2   . ASN A  1  656 ? 126.396 -92.528  -29.474 1.00 42.87  ? 656  ASN A ND2   1 
ATOM   5141  N  N     . VAL A  1  657 ? 129.136 -88.190  -31.019 1.00 42.80  ? 657  VAL A N     1 
ATOM   5142  C  CA    . VAL A  1  657 ? 129.471 -86.998  -31.791 1.00 45.28  ? 657  VAL A CA    1 
ATOM   5143  C  C     . VAL A  1  657 ? 130.623 -87.281  -32.741 1.00 42.34  ? 657  VAL A C     1 
ATOM   5144  O  O     . VAL A  1  657 ? 130.598 -86.882  -33.910 1.00 43.00  ? 657  VAL A O     1 
ATOM   5145  C  CB    . VAL A  1  657 ? 129.812 -85.835  -30.843 1.00 53.55  ? 657  VAL A CB    1 
ATOM   5146  C  CG1   . VAL A  1  657 ? 129.731 -84.511  -31.581 1.00 53.66  ? 657  VAL A CG1   1 
ATOM   5147  C  CG2   . VAL A  1  657 ? 128.903 -85.860  -29.627 1.00 64.10  ? 657  VAL A CG2   1 
ATOM   5148  N  N     . ILE A  1  658 ? 131.659 -87.962  -32.248 1.00 44.18  ? 658  ILE A N     1 
ATOM   5149  C  CA    . ILE A  1  658 ? 132.886 -88.129  -33.021 1.00 47.76  ? 658  ILE A CA    1 
ATOM   5150  C  C     . ILE A  1  658 ? 132.799 -89.257  -34.032 1.00 50.96  ? 658  ILE A C     1 
ATOM   5151  O  O     . ILE A  1  658 ? 133.644 -89.329  -34.933 1.00 58.28  ? 658  ILE A O     1 
ATOM   5152  C  CB    . ILE A  1  658 ? 134.081 -88.360  -32.080 1.00 53.01  ? 658  ILE A CB    1 
ATOM   5153  C  CG1   . ILE A  1  658 ? 133.842 -89.595  -31.213 1.00 50.87  ? 658  ILE A CG1   1 
ATOM   5154  C  CG2   . ILE A  1  658 ? 134.307 -87.139  -31.203 1.00 41.21  ? 658  ILE A CG2   1 
ATOM   5155  C  CD1   . ILE A  1  658 ? 134.968 -89.892  -30.271 1.00 52.35  ? 658  ILE A CD1   1 
ATOM   5156  N  N     . ASN A  1  659 ? 131.806 -90.136  -33.914 1.00 49.66  ? 659  ASN A N     1 
ATOM   5157  C  CA    . ASN A  1  659 ? 131.585 -91.198  -34.886 1.00 45.90  ? 659  ASN A CA    1 
ATOM   5158  C  C     . ASN A  1  659 ? 130.460 -90.872  -35.861 1.00 46.07  ? 659  ASN A C     1 
ATOM   5159  O  O     . ASN A  1  659 ? 130.081 -91.728  -36.665 1.00 47.09  ? 659  ASN A O     1 
ATOM   5160  C  CB    . ASN A  1  659 ? 131.297 -92.517  -34.169 1.00 45.54  ? 659  ASN A CB    1 
ATOM   5161  C  CG    . ASN A  1  659 ? 132.465 -92.986  -33.325 1.00 52.36  ? 659  ASN A CG    1 
ATOM   5162  O  OD1   . ASN A  1  659 ? 133.469 -93.470  -33.849 1.00 60.55  ? 659  ASN A OD1   1 
ATOM   5163  N  ND2   . ASN A  1  659 ? 132.340 -92.847  -32.011 1.00 54.03  ? 659  ASN A ND2   1 
ATOM   5164  N  N     . SER A  1  660 ? 129.939 -89.645  -35.825 1.00 45.54  ? 660  SER A N     1 
ATOM   5165  C  CA    . SER A  1  660 ? 128.792 -89.272  -36.640 1.00 46.08  ? 660  SER A CA    1 
ATOM   5166  C  C     . SER A  1  660 ? 129.109 -89.180  -38.127 1.00 49.28  ? 660  SER A C     1 
ATOM   5167  O  O     . SER A  1  660 ? 128.174 -89.097  -38.931 1.00 50.73  ? 660  SER A O     1 
ATOM   5168  C  CB    . SER A  1  660 ? 128.237 -87.939  -36.153 1.00 48.40  ? 660  SER A CB    1 
ATOM   5169  O  OG    . SER A  1  660 ? 129.222 -86.926  -36.257 1.00 55.92  ? 660  SER A OG    1 
ATOM   5170  N  N     . TYR A  1  661 ? 130.385 -89.180  -38.511 1.00 48.12  ? 661  TYR A N     1 
ATOM   5171  C  CA    . TYR A  1  661 ? 130.736 -89.129  -39.923 1.00 48.56  ? 661  TYR A CA    1 
ATOM   5172  C  C     . TYR A  1  661 ? 130.178 -90.346  -40.649 1.00 51.54  ? 661  TYR A C     1 
ATOM   5173  O  O     . TYR A  1  661 ? 130.146 -91.455  -40.108 1.00 54.17  ? 661  TYR A O     1 
ATOM   5174  C  CB    . TYR A  1  661 ? 132.255 -89.060  -40.101 1.00 50.72  ? 661  TYR A CB    1 
ATOM   5175  C  CG    . TYR A  1  661 ? 132.847 -87.681  -39.901 1.00 53.43  ? 661  TYR A CG    1 
ATOM   5176  C  CD1   . TYR A  1  661 ? 132.131 -86.679  -39.258 1.00 56.39  ? 661  TYR A CD1   1 
ATOM   5177  C  CD2   . TYR A  1  661 ? 134.118 -87.377  -40.371 1.00 53.02  ? 661  TYR A CD2   1 
ATOM   5178  C  CE1   . TYR A  1  661 ? 132.668 -85.418  -39.079 1.00 52.16  ? 661  TYR A CE1   1 
ATOM   5179  C  CE2   . TYR A  1  661 ? 134.662 -86.119  -40.200 1.00 47.64  ? 661  TYR A CE2   1 
ATOM   5180  C  CZ    . TYR A  1  661 ? 133.934 -85.144  -39.553 1.00 50.16  ? 661  TYR A CZ    1 
ATOM   5181  O  OH    . TYR A  1  661 ? 134.477 -83.890  -39.381 1.00 51.09  ? 661  TYR A OH    1 
ATOM   5182  N  N     . GLY A  1  662 ? 129.724 -90.129  -41.881 1.00 50.73  ? 662  GLY A N     1 
ATOM   5183  C  CA    . GLY A  1  662 ? 129.153 -91.194  -42.675 1.00 51.94  ? 662  GLY A CA    1 
ATOM   5184  C  C     . GLY A  1  662 ? 127.693 -91.472  -42.413 1.00 56.56  ? 662  GLY A C     1 
ATOM   5185  O  O     . GLY A  1  662 ? 127.161 -92.455  -42.943 1.00 59.90  ? 662  GLY A O     1 
ATOM   5186  N  N     . SER A  1  663 ? 127.024 -90.642  -41.616 1.00 50.94  ? 663  SER A N     1 
ATOM   5187  C  CA    . SER A  1  663 ? 125.614 -90.821  -41.318 1.00 50.93  ? 663  SER A CA    1 
ATOM   5188  C  C     . SER A  1  663 ? 124.928 -89.464  -41.374 1.00 50.48  ? 663  SER A C     1 
ATOM   5189  O  O     . SER A  1  663 ? 125.547 -88.443  -41.690 1.00 50.25  ? 663  SER A O     1 
ATOM   5190  C  CB    . SER A  1  663 ? 125.416 -91.484  -39.951 1.00 50.09  ? 663  SER A CB    1 
ATOM   5191  O  OG    . SER A  1  663 ? 125.875 -90.638  -38.913 1.00 48.93  ? 663  SER A OG    1 
ATOM   5192  N  N     . ALA A  1  664 ? 123.631 -89.460  -41.057 1.00 50.42  ? 664  ALA A N     1 
ATOM   5193  C  CA    . ALA A  1  664 ? 122.862 -88.222  -41.026 1.00 50.00  ? 664  ALA A CA    1 
ATOM   5194  C  C     . ALA A  1  664 ? 123.269 -87.307  -39.877 1.00 49.91  ? 664  ALA A C     1 
ATOM   5195  O  O     . ALA A  1  664 ? 122.908 -86.126  -39.887 1.00 64.27  ? 664  ALA A O     1 
ATOM   5196  C  CB    . ALA A  1  664 ? 121.369 -88.538  -40.934 1.00 50.35  ? 664  ALA A CB    1 
ATOM   5197  N  N     . LEU A  1  665 ? 123.999 -87.818  -38.889 1.00 47.85  ? 665  LEU A N     1 
ATOM   5198  C  CA    . LEU A  1  665 ? 124.485 -87.008  -37.782 1.00 47.03  ? 665  LEU A CA    1 
ATOM   5199  C  C     . LEU A  1  665 ? 125.813 -86.328  -38.086 1.00 51.87  ? 665  LEU A C     1 
ATOM   5200  O  O     . LEU A  1  665 ? 126.362 -85.655  -37.208 1.00 48.33  ? 665  LEU A O     1 
ATOM   5201  C  CB    . LEU A  1  665 ? 124.628 -87.868  -36.523 1.00 49.72  ? 665  LEU A CB    1 
ATOM   5202  C  CG    . LEU A  1  665 ? 123.363 -88.594  -36.063 1.00 50.64  ? 665  LEU A CG    1 
ATOM   5203  C  CD1   . LEU A  1  665 ? 123.604 -89.326  -34.750 1.00 45.35  ? 665  LEU A CD1   1 
ATOM   5204  C  CD2   . LEU A  1  665 ? 122.202 -87.619  -35.939 1.00 48.65  ? 665  LEU A CD2   1 
ATOM   5205  N  N     . SER A  1  666 ? 126.328 -86.479  -39.311 1.00 49.37  ? 666  SER A N     1 
ATOM   5206  C  CA    . SER A  1  666 ? 127.653 -85.967  -39.646 1.00 48.38  ? 666  SER A CA    1 
ATOM   5207  C  C     . SER A  1  666 ? 127.760 -84.466  -39.406 1.00 49.28  ? 666  SER A C     1 
ATOM   5208  O  O     . SER A  1  666 ? 128.803 -83.975  -38.951 1.00 57.68  ? 666  SER A O     1 
ATOM   5209  C  CB    . SER A  1  666 ? 127.977 -86.297  -41.100 1.00 49.11  ? 666  SER A CB    1 
ATOM   5210  O  OG    . SER A  1  666 ? 127.011 -85.723  -41.963 1.00 52.54  ? 666  SER A OG    1 
ATOM   5211  N  N     . ALA A  1  667 ? 126.693 -83.717  -39.708 1.00 46.67  ? 667  ALA A N     1 
ATOM   5212  C  CA    . ALA A  1  667 ? 126.723 -82.274  -39.488 1.00 50.04  ? 667  ALA A CA    1 
ATOM   5213  C  C     . ALA A  1  667 ? 126.966 -81.935  -38.025 1.00 47.87  ? 667  ALA A C     1 
ATOM   5214  O  O     . ALA A  1  667 ? 127.530 -80.879  -37.720 1.00 49.63  ? 667  ALA A O     1 
ATOM   5215  C  CB    . ALA A  1  667 ? 125.423 -81.627  -39.965 1.00 46.38  ? 667  ALA A CB    1 
ATOM   5216  N  N     . TYR A  1  668 ? 126.576 -82.823  -37.109 1.00 46.87  ? 668  TYR A N     1 
ATOM   5217  C  CA    . TYR A  1  668 ? 126.808 -82.553  -35.695 1.00 48.53  ? 668  TYR A CA    1 
ATOM   5218  C  C     . TYR A  1  668 ? 128.281 -82.698  -35.336 1.00 48.97  ? 668  TYR A C     1 
ATOM   5219  O  O     . TYR A  1  668 ? 128.803 -81.913  -34.541 1.00 41.86  ? 668  TYR A O     1 
ATOM   5220  C  CB    . TYR A  1  668 ? 125.924 -83.456  -34.838 1.00 50.23  ? 668  TYR A CB    1 
ATOM   5221  C  CG    . TYR A  1  668 ? 124.485 -83.003  -34.868 1.00 52.15  ? 668  TYR A CG    1 
ATOM   5222  C  CD1   . TYR A  1  668 ? 124.155 -81.689  -34.570 1.00 48.97  ? 668  TYR A CD1   1 
ATOM   5223  C  CD2   . TYR A  1  668 ? 123.465 -83.868  -35.238 1.00 58.71  ? 668  TYR A CD2   1 
ATOM   5224  C  CE1   . TYR A  1  668 ? 122.852 -81.254  -34.609 1.00 46.91  ? 668  TYR A CE1   1 
ATOM   5225  C  CE2   . TYR A  1  668 ? 122.149 -83.440  -35.283 1.00 56.45  ? 668  TYR A CE2   1 
ATOM   5226  C  CZ    . TYR A  1  668 ? 121.850 -82.131  -34.967 1.00 50.63  ? 668  TYR A CZ    1 
ATOM   5227  O  OH    . TYR A  1  668 ? 120.544 -81.694  -35.011 1.00 46.38  ? 668  TYR A OH    1 
ATOM   5228  N  N     . GLY A  1  669 ? 128.980 -83.668  -35.930 1.00 43.43  ? 669  GLY A N     1 
ATOM   5229  C  CA    . GLY A  1  669 ? 130.428 -83.701  -35.784 1.00 43.26  ? 669  GLY A CA    1 
ATOM   5230  C  C     . GLY A  1  669 ? 131.094 -82.487  -36.407 1.00 43.96  ? 669  GLY A C     1 
ATOM   5231  O  O     . GLY A  1  669 ? 132.035 -81.913  -35.839 1.00 46.33  ? 669  GLY A O     1 
ATOM   5232  N  N     . ILE A  1  670 ? 130.607 -82.075  -37.581 1.00 44.14  ? 670  ILE A N     1 
ATOM   5233  C  CA    . ILE A  1  670 ? 131.125 -80.872  -38.230 1.00 49.28  ? 670  ILE A CA    1 
ATOM   5234  C  C     . ILE A  1  670 ? 131.025 -79.674  -37.292 1.00 43.23  ? 670  ILE A C     1 
ATOM   5235  O  O     . ILE A  1  670 ? 132.001 -78.947  -37.076 1.00 46.84  ? 670  ILE A O     1 
ATOM   5236  C  CB    . ILE A  1  670 ? 130.375 -80.613  -39.548 1.00 48.15  ? 670  ILE A CB    1 
ATOM   5237  C  CG1   . ILE A  1  670 ? 130.616 -81.750  -40.539 1.00 46.90  ? 670  ILE A CG1   1 
ATOM   5238  C  CG2   . ILE A  1  670 ? 130.786 -79.278  -40.143 1.00 45.48  ? 670  ILE A CG2   1 
ATOM   5239  C  CD1   . ILE A  1  670 ? 129.848 -81.583  -41.837 1.00 57.66  ? 670  ILE A CD1   1 
ATOM   5240  N  N     . MET A  1  671 ? 129.843 -79.456  -36.711 1.00 42.75  ? 671  MET A N     1 
ATOM   5241  C  CA    . MET A  1  671 ? 129.627 -78.303  -35.844 1.00 41.81  ? 671  MET A CA    1 
ATOM   5242  C  C     . MET A  1  671 ? 130.264 -78.464  -34.467 1.00 40.80  ? 671  MET A C     1 
ATOM   5243  O  O     . MET A  1  671 ? 130.534 -77.458  -33.807 1.00 40.08  ? 671  MET A O     1 
ATOM   5244  C  CB    . MET A  1  671 ? 128.129 -78.023  -35.700 1.00 46.25  ? 671  MET A CB    1 
ATOM   5245  C  CG    . MET A  1  671 ? 127.441 -77.676  -37.011 1.00 43.10  ? 671  MET A CG    1 
ATOM   5246  S  SD    . MET A  1  671 ? 128.369 -76.471  -37.982 1.00 44.65  ? 671  MET A SD    1 
ATOM   5247  C  CE    . MET A  1  671 ? 128.314 -75.026  -36.922 1.00 42.02  ? 671  MET A CE    1 
ATOM   5248  N  N     . PHE A  1  672 ? 130.513 -79.698  -34.027 1.00 40.78  ? 672  PHE A N     1 
ATOM   5249  C  CA    . PHE A  1  672 ? 131.334 -79.941  -32.845 1.00 44.74  ? 672  PHE A CA    1 
ATOM   5250  C  C     . PHE A  1  672 ? 132.737 -79.381  -33.047 1.00 47.18  ? 672  PHE A C     1 
ATOM   5251  O  O     . PHE A  1  672 ? 133.234 -78.572  -32.242 1.00 41.44  ? 672  PHE A O     1 
ATOM   5252  C  CB    . PHE A  1  672 ? 131.369 -81.452  -32.586 1.00 51.06  ? 672  PHE A CB    1 
ATOM   5253  C  CG    . PHE A  1  672 ? 131.916 -81.852  -31.245 1.00 50.56  ? 672  PHE A CG    1 
ATOM   5254  C  CD1   . PHE A  1  672 ? 131.219 -81.569  -30.081 1.00 44.44  ? 672  PHE A CD1   1 
ATOM   5255  C  CD2   . PHE A  1  672 ? 133.100 -82.570  -31.157 1.00 44.43  ? 672  PHE A CD2   1 
ATOM   5256  C  CE1   . PHE A  1  672 ? 131.715 -81.962  -28.846 1.00 44.48  ? 672  PHE A CE1   1 
ATOM   5257  C  CE2   . PHE A  1  672 ? 133.602 -82.966  -29.927 1.00 39.61  ? 672  PHE A CE2   1 
ATOM   5258  C  CZ    . PHE A  1  672 ? 132.908 -82.663  -28.770 1.00 39.25  ? 672  PHE A CZ    1 
ATOM   5259  N  N     . LEU A  1  673 ? 133.378 -79.782  -34.147 1.00 40.87  ? 673  LEU A N     1 
ATOM   5260  C  CA    . LEU A  1  673 ? 134.671 -79.200  -34.489 1.00 41.01  ? 673  LEU A CA    1 
ATOM   5261  C  C     . LEU A  1  673 ? 134.566 -77.693  -34.702 1.00 48.64  ? 673  LEU A C     1 
ATOM   5262  O  O     . LEU A  1  673 ? 135.497 -76.950  -34.365 1.00 40.45  ? 673  LEU A O     1 
ATOM   5263  C  CB    . LEU A  1  673 ? 135.241 -79.883  -35.731 1.00 42.14  ? 673  LEU A CB    1 
ATOM   5264  C  CG    . LEU A  1  673 ? 135.442 -81.396  -35.601 1.00 42.46  ? 673  LEU A CG    1 
ATOM   5265  C  CD1   . LEU A  1  673 ? 136.353 -81.918  -36.702 1.00 47.77  ? 673  LEU A CD1   1 
ATOM   5266  C  CD2   . LEU A  1  673 ? 135.977 -81.780  -34.220 1.00 41.58  ? 673  LEU A CD2   1 
ATOM   5267  N  N     . ALA A  1  674 ? 133.438 -77.225  -35.243 1.00 41.07  ? 674  ALA A N     1 
ATOM   5268  C  CA    . ALA A  1  674 ? 133.263 -75.798  -35.503 1.00 45.69  ? 674  ALA A CA    1 
ATOM   5269  C  C     . ALA A  1  674 ? 133.249 -74.995  -34.209 1.00 40.95  ? 674  ALA A C     1 
ATOM   5270  O  O     . ALA A  1  674 ? 133.937 -73.971  -34.089 1.00 41.93  ? 674  ALA A O     1 
ATOM   5271  C  CB    . ALA A  1  674 ? 131.978 -75.574  -36.300 1.00 41.52  ? 674  ALA A CB    1 
ATOM   5272  N  N     . GLY A  1  675 ? 132.446 -75.433  -33.239 1.00 39.23  ? 675  GLY A N     1 
ATOM   5273  C  CA    . GLY A  1  675 ? 132.450 -74.795  -31.936 1.00 44.32  ? 675  GLY A CA    1 
ATOM   5274  C  C     . GLY A  1  675 ? 133.821 -74.803  -31.291 1.00 41.71  ? 675  GLY A C     1 
ATOM   5275  O  O     . GLY A  1  675 ? 134.248 -73.797  -30.715 1.00 42.21  ? 675  GLY A O     1 
ATOM   5276  N  N     . HIS A  1  676 ? 134.531 -75.936  -31.377 1.00 40.74  ? 676  HIS A N     1 
ATOM   5277  C  CA    . HIS A  1  676 ? 135.896 -75.982  -30.851 1.00 38.87  ? 676  HIS A CA    1 
ATOM   5278  C  C     . HIS A  1  676 ? 136.771 -74.906  -31.488 1.00 45.96  ? 676  HIS A C     1 
ATOM   5279  O  O     . HIS A  1  676 ? 137.510 -74.188  -30.794 1.00 48.61  ? 676  HIS A O     1 
ATOM   5280  C  CB    . HIS A  1  676 ? 136.506 -77.366  -31.079 1.00 39.33  ? 676  HIS A CB    1 
ATOM   5281  C  CG    . HIS A  1  676 ? 136.165 -78.354  -30.011 1.00 38.02  ? 676  HIS A CG    1 
ATOM   5282  N  ND1   . HIS A  1  676 ? 135.039 -79.147  -30.060 1.00 45.30  ? 676  HIS A ND1   1 
ATOM   5283  C  CD2   . HIS A  1  676 ? 136.791 -78.663  -28.852 1.00 42.86  ? 676  HIS A CD2   1 
ATOM   5284  C  CE1   . HIS A  1  676 ? 134.992 -79.910  -28.983 1.00 45.38  ? 676  HIS A CE1   1 
ATOM   5285  N  NE2   . HIS A  1  676 ? 136.043 -79.632  -28.232 1.00 42.47  ? 676  HIS A NE2   1 
ATOM   5286  N  N     . PHE A  1  677 ? 136.698 -74.782  -32.815 1.00 43.49  ? 677  PHE A N     1 
ATOM   5287  C  CA    . PHE A  1  677 ? 137.532 -73.811  -33.514 1.00 45.15  ? 677  PHE A CA    1 
ATOM   5288  C  C     . PHE A  1  677 ? 137.188 -72.387  -33.107 1.00 45.51  ? 677  PHE A C     1 
ATOM   5289  O  O     . PHE A  1  677 ? 138.084 -71.557  -32.921 1.00 40.82  ? 677  PHE A O     1 
ATOM   5290  C  CB    . PHE A  1  677 ? 137.381 -73.974  -35.022 1.00 40.54  ? 677  PHE A CB    1 
ATOM   5291  C  CG    . PHE A  1  677 ? 138.185 -72.991  -35.817 1.00 41.38  ? 677  PHE A CG    1 
ATOM   5292  C  CD1   . PHE A  1  677 ? 139.517 -73.239  -36.099 1.00 41.52  ? 677  PHE A CD1   1 
ATOM   5293  C  CD2   . PHE A  1  677 ? 137.608 -71.823  -36.294 1.00 45.46  ? 677  PHE A CD2   1 
ATOM   5294  C  CE1   . PHE A  1  677 ? 140.259 -72.346  -36.837 1.00 42.09  ? 677  PHE A CE1   1 
ATOM   5295  C  CE2   . PHE A  1  677 ? 138.345 -70.925  -37.034 1.00 41.80  ? 677  PHE A CE2   1 
ATOM   5296  C  CZ    . PHE A  1  677 ? 139.672 -71.188  -37.306 1.00 42.24  ? 677  PHE A CZ    1 
ATOM   5297  N  N     . VAL A  1  678 ? 135.896 -72.079  -32.980 1.00 45.65  ? 678  VAL A N     1 
ATOM   5298  C  CA    . VAL A  1  678 ? 135.504 -70.719  -32.615 1.00 44.60  ? 678  VAL A CA    1 
ATOM   5299  C  C     . VAL A  1  678 ? 135.949 -70.400  -31.190 1.00 38.34  ? 678  VAL A C     1 
ATOM   5300  O  O     . VAL A  1  678 ? 136.408 -69.286  -30.898 1.00 41.64  ? 678  VAL A O     1 
ATOM   5301  C  CB    . VAL A  1  678 ? 133.987 -70.530  -32.806 1.00 41.97  ? 678  VAL A CB    1 
ATOM   5302  C  CG1   . VAL A  1  678 ? 133.542 -69.156  -32.321 1.00 38.81  ? 678  VAL A CG1   1 
ATOM   5303  C  CG2   . VAL A  1  678 ? 133.617 -70.709  -34.269 1.00 39.28  ? 678  VAL A CG2   1 
ATOM   5304  N  N     . PHE A  1  679 ? 135.842 -71.377  -30.287 1.00 45.65  ? 679  PHE A N     1 
ATOM   5305  C  CA    . PHE A  1  679 ? 136.348 -71.197  -28.929 1.00 42.03  ? 679  PHE A CA    1 
ATOM   5306  C  C     . PHE A  1  679 ? 137.835 -70.867  -28.935 1.00 36.73  ? 679  PHE A C     1 
ATOM   5307  O  O     . PHE A  1  679 ? 138.270 -69.900  -28.298 1.00 39.07  ? 679  PHE A O     1 
ATOM   5308  C  CB    . PHE A  1  679 ? 136.085 -72.453  -28.106 1.00 35.56  ? 679  PHE A CB    1 
ATOM   5309  C  CG    . PHE A  1  679 ? 136.915 -72.549  -26.852 1.00 44.46  ? 679  PHE A CG    1 
ATOM   5310  C  CD1   . PHE A  1  679 ? 136.480 -71.965  -25.674 1.00 34.46  ? 679  PHE A CD1   1 
ATOM   5311  C  CD2   . PHE A  1  679 ? 138.119 -73.249  -26.846 1.00 40.50  ? 679  PHE A CD2   1 
ATOM   5312  C  CE1   . PHE A  1  679 ? 137.233 -72.061  -24.523 1.00 40.94  ? 679  PHE A CE1   1 
ATOM   5313  C  CE2   . PHE A  1  679 ? 138.873 -73.349  -25.699 1.00 41.56  ? 679  PHE A CE2   1 
ATOM   5314  C  CZ    . PHE A  1  679 ? 138.431 -72.754  -24.534 1.00 43.88  ? 679  PHE A CZ    1 
ATOM   5315  N  N     . ALA A  1  680 ? 138.635 -71.679  -29.632 1.00 36.64  ? 680  ALA A N     1 
ATOM   5316  C  CA    . ALA A  1  680 ? 140.066 -71.396  -29.714 1.00 36.86  ? 680  ALA A CA    1 
ATOM   5317  C  C     . ALA A  1  680 ? 140.324 -70.028  -30.333 1.00 37.15  ? 680  ALA A C     1 
ATOM   5318  O  O     . ALA A  1  680 ? 141.216 -69.295  -29.890 1.00 42.77  ? 680  ALA A O     1 
ATOM   5319  C  CB    . ALA A  1  680 ? 140.772 -72.487  -30.515 1.00 38.07  ? 680  ALA A CB    1 
ATOM   5320  N  N     . PHE A  1  681 ? 139.535 -69.662  -31.347 1.00 37.67  ? 681  PHE A N     1 
ATOM   5321  C  CA    . PHE A  1  681 ? 139.718 -68.395  -32.047 1.00 39.27  ? 681  PHE A CA    1 
ATOM   5322  C  C     . PHE A  1  681 ? 139.484 -67.213  -31.116 1.00 41.20  ? 681  PHE A C     1 
ATOM   5323  O  O     . PHE A  1  681 ? 140.179 -66.194  -31.208 1.00 42.84  ? 681  PHE A O     1 
ATOM   5324  C  CB    . PHE A  1  681 ? 138.767 -68.357  -33.247 1.00 42.44  ? 681  PHE A CB    1 
ATOM   5325  C  CG    . PHE A  1  681 ? 138.893 -67.132  -34.110 1.00 39.35  ? 681  PHE A CG    1 
ATOM   5326  C  CD1   . PHE A  1  681 ? 139.983 -66.961  -34.944 1.00 40.13  ? 681  PHE A CD1   1 
ATOM   5327  C  CD2   . PHE A  1  681 ? 137.889 -66.178  -34.126 1.00 39.19  ? 681  PHE A CD2   1 
ATOM   5328  C  CE1   . PHE A  1  681 ? 140.084 -65.844  -35.756 1.00 40.73  ? 681  PHE A CE1   1 
ATOM   5329  C  CE2   . PHE A  1  681 ? 137.982 -65.058  -34.937 1.00 39.78  ? 681  PHE A CE2   1 
ATOM   5330  C  CZ    . PHE A  1  681 ? 139.083 -64.890  -35.750 1.00 40.55  ? 681  PHE A CZ    1 
ATOM   5331  N  N     . SER A  1  682 ? 138.520 -67.342  -30.200 1.00 38.32  ? 682  SER A N     1 
ATOM   5332  C  CA    . SER A  1  682 ? 138.228 -66.252  -29.269 1.00 35.94  ? 682  SER A CA    1 
ATOM   5333  C  C     . SER A  1  682 ? 139.420 -65.924  -28.375 1.00 38.12  ? 682  SER A C     1 
ATOM   5334  O  O     . SER A  1  682 ? 139.533 -64.794  -27.877 1.00 39.46  ? 682  SER A O     1 
ATOM   5335  C  CB    . SER A  1  682 ? 137.013 -66.604  -28.404 1.00 42.07  ? 682  SER A CB    1 
ATOM   5336  O  OG    . SER A  1  682 ? 137.344 -67.526  -27.377 1.00 39.64  ? 682  SER A OG    1 
ATOM   5337  N  N     . LEU A  1  683 ? 140.307 -66.900  -28.151 1.00 37.47  ? 683  LEU A N     1 
ATOM   5338  C  CA    . LEU A  1  683 ? 141.419 -66.697  -27.229 1.00 35.21  ? 683  LEU A CA    1 
ATOM   5339  C  C     . LEU A  1  683 ? 142.425 -65.695  -27.774 1.00 41.53  ? 683  LEU A C     1 
ATOM   5340  O  O     . LEU A  1  683 ? 143.109 -65.023  -26.993 1.00 42.48  ? 683  LEU A O     1 
ATOM   5341  C  CB    . LEU A  1  683 ? 142.098 -68.033  -26.918 1.00 35.22  ? 683  LEU A CB    1 
ATOM   5342  C  CG    . LEU A  1  683 ? 141.156 -69.113  -26.378 1.00 34.82  ? 683  LEU A CG    1 
ATOM   5343  C  CD1   . LEU A  1  683 ? 141.902 -70.396  -26.016 1.00 34.87  ? 683  LEU A CD1   1 
ATOM   5344  C  CD2   . LEU A  1  683 ? 140.372 -68.578  -25.192 1.00 34.00  ? 683  LEU A CD2   1 
ATOM   5345  N  N     . MET A  1  684 ? 142.524 -65.566  -29.100 1.00 36.52  ? 684  MET A N     1 
ATOM   5346  C  CA    . MET A  1  684 ? 143.370 -64.526  -29.675 1.00 38.54  ? 684  MET A CA    1 
ATOM   5347  C  C     . MET A  1  684 ? 142.907 -63.148  -29.220 1.00 36.68  ? 684  MET A C     1 
ATOM   5348  O  O     . MET A  1  684 ? 143.714 -62.314  -28.795 1.00 36.62  ? 684  MET A O     1 
ATOM   5349  C  CB    . MET A  1  684 ? 143.371 -64.621  -31.204 1.00 38.06  ? 684  MET A CB    1 
ATOM   5350  C  CG    . MET A  1  684 ? 144.031 -63.432  -31.900 1.00 41.39  ? 684  MET A CG    1 
ATOM   5351  S  SD    . MET A  1  684 ? 144.219 -63.608  -33.690 1.00 40.63  ? 684  MET A SD    1 
ATOM   5352  C  CE    . MET A  1  684 ? 142.573 -64.123  -34.161 1.00 41.54  ? 684  MET A CE    1 
ATOM   5353  N  N     . PHE A  1  685 ? 141.600 -62.903  -29.278 1.00 38.93  ? 685  PHE A N     1 
ATOM   5354  C  CA    . PHE A  1  685 ? 141.088 -61.589  -28.911 1.00 39.83  ? 685  PHE A CA    1 
ATOM   5355  C  C     . PHE A  1  685 ? 141.128 -61.385  -27.405 1.00 44.06  ? 685  PHE A C     1 
ATOM   5356  O  O     . PHE A  1  685 ? 141.414 -60.279  -26.931 1.00 49.92  ? 685  PHE A O     1 
ATOM   5357  C  CB    . PHE A  1  685 ? 139.669 -61.414  -29.441 1.00 37.13  ? 685  PHE A CB    1 
ATOM   5358  C  CG    . PHE A  1  685 ? 139.573 -61.452  -30.937 1.00 38.84  ? 685  PHE A CG    1 
ATOM   5359  C  CD1   . PHE A  1  685 ? 139.664 -60.283  -31.680 1.00 42.84  ? 685  PHE A CD1   1 
ATOM   5360  C  CD2   . PHE A  1  685 ? 139.380 -62.651  -31.605 1.00 37.60  ? 685  PHE A CD2   1 
ATOM   5361  C  CE1   . PHE A  1  685 ? 139.569 -60.308  -33.063 1.00 42.07  ? 685  PHE A CE1   1 
ATOM   5362  C  CE2   . PHE A  1  685 ? 139.285 -62.685  -32.987 1.00 42.43  ? 685  PHE A CE2   1 
ATOM   5363  C  CZ    . PHE A  1  685 ? 139.379 -61.511  -33.718 1.00 39.14  ? 685  PHE A CZ    1 
ATOM   5364  N  N     . LEU A  1  686 ? 140.861 -62.405  -26.621 1.00 39.30  ? 686  LEU A N     1 
ATOM   5365  C  CA    . LEU A  1  686 ? 140.881 -62.220  -25.193 1.00 40.68  ? 686  LEU A CA    1 
ATOM   5366  C  C     . LEU A  1  686 ? 142.246 -62.143  -24.563 1.00 39.17  ? 686  LEU A C     1 
ATOM   5367  O  O     . LEU A  1  686 ? 142.414 -61.438  -23.612 1.00 33.46  ? 686  LEU A O     1 
ATOM   5368  C  CB    . LEU A  1  686 ? 140.070 -63.309  -24.497 1.00 38.90  ? 686  LEU A CB    1 
ATOM   5369  C  CG    . LEU A  1  686 ? 138.597 -63.430  -24.848 1.00 39.59  ? 686  LEU A CG    1 
ATOM   5370  C  CD1   . LEU A  1  686 ? 138.016 -64.745  -24.413 1.00 33.10  ? 686  LEU A CD1   1 
ATOM   5371  C  CD2   . LEU A  1  686 ? 137.773 -62.273  -24.357 1.00 36.47  ? 686  LEU A CD2   1 
ATOM   5372  N  N     . PHE A  1  687 ? 143.234 -62.840  -25.099 1.00 34.35  ? 687  PHE A N     1 
ATOM   5373  C  CA    . PHE A  1  687 ? 144.547 -62.862  -24.453 1.00 34.31  ? 687  PHE A CA    1 
ATOM   5374  C  C     . PHE A  1  687 ? 145.480 -61.741  -24.913 1.00 42.73  ? 687  PHE A C     1 
ATOM   5375  O  O     . PHE A  1  687 ? 146.584 -61.617  -24.368 1.00 44.45  ? 687  PHE A O     1 
ATOM   5376  C  CB    . PHE A  1  687 ? 145.255 -64.208  -24.680 1.00 36.43  ? 687  PHE A CB    1 
ATOM   5377  C  CG    . PHE A  1  687 ? 144.548 -65.402  -24.089 1.00 34.11  ? 687  PHE A CG    1 
ATOM   5378  C  CD1   . PHE A  1  687 ? 143.398 -65.258  -23.331 1.00 33.46  ? 687  PHE A CD1   1 
ATOM   5379  C  CD2   . PHE A  1  687 ? 145.051 -66.677  -24.295 1.00 34.37  ? 687  PHE A CD2   1 
ATOM   5380  C  CE1   . PHE A  1  687 ? 142.759 -66.359  -22.801 1.00 36.42  ? 687  PHE A CE1   1 
ATOM   5381  C  CE2   . PHE A  1  687 ? 144.418 -67.786  -23.763 1.00 37.16  ? 687  PHE A CE2   1 
ATOM   5382  C  CZ    . PHE A  1  687 ? 143.272 -67.627  -23.015 1.00 40.82  ? 687  PHE A CZ    1 
ATOM   5383  N  N     . SER A  1  688 ? 145.086 -60.957  -25.899 1.00 35.31  ? 688  SER A N     1 
ATOM   5384  C  CA    . SER A  1  688 ? 145.930 -59.893  -26.419 1.00 39.55  ? 688  SER A CA    1 
ATOM   5385  C  C     . SER A  1  688 ? 145.377 -58.494  -26.286 1.00 39.29  ? 688  SER A C     1 
ATOM   5386  O  O     . SER A  1  688 ? 144.398 -58.275  -25.624 1.00 44.43  ? 688  SER A O     1 
ATOM   5387  C  CB    . SER A  1  688 ? 146.342 -60.157  -27.869 1.00 39.42  ? 688  SER A CB    1 
ATOM   5388  O  OG    . SER A  1  688 ? 145.241 -60.287  -28.716 1.00 38.46  ? 688  SER A OG    1 
ATOM   5389  N  N     . GLY A  1  689 ? 146.027 -57.547  -26.932 1.00 37.16  ? 689  GLY A N     1 
ATOM   5390  C  CA    . GLY A  1  689 ? 145.620 -56.157  -26.852 1.00 36.47  ? 689  GLY A CA    1 
ATOM   5391  C  C     . GLY A  1  689 ? 145.913 -55.457  -28.161 1.00 43.07  ? 689  GLY A C     1 
ATOM   5392  O  O     . GLY A  1  689 ? 146.752 -55.898  -28.953 1.00 47.85  ? 689  GLY A O     1 
ATOM   5393  N  N     . ARG A  1  690 ? 145.226 -54.334  -28.365 1.00 44.55  ? 690