data_5PRC
# 
_entry.id   5PRC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5PRC         
WWPDB D_1000179759 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        5PRC 
_pdbx_database_status.recvd_initial_deposition_date   1997-08-01 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lancaster, C.R.D.' 1 
'Michel, H.'        2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;Refined crystal structures of reaction centres from Rhodopseudomonas viridis in complexes with the herbicide atrazine and two chiral atrazine derivatives also lead to a new model of the bound carotenoid.
;
J.Mol.Biol.          286  883  898 1999 JMOBAK UK 0022-2836 0070 ? 10024457 10.1006/jmbi.1998.2532 
1       
;Ubiquinone Reduction and Protonation in the Reaction Centre of Rhodopseudomonas Viridis: X-Ray Structures and Their Functional Implications
;
Biochim.Biophys.Acta 1365 143  ?   1998 BBACAQ NE 0006-3002 0113 ? ?        ?                      
2       
;The Coupling of Light-Induced Electron Transfer and Proton Uptake as Derived from Crystal Structures of Reaction Centres from Rhodopseudomonas Viridis Modified at the Binding Site of the Secondary Quinone, Qb
;
Structure            5    1339 ?   1997 STRUE6 UK 0969-2126 2005 ? ?        ?                      
3       
;Crystallographic Refinement at 2.3 A Resolution and Refined Model of the Photosynthetic Reaction Centre from Rhodopseudomonas Viridis
;
J.Mol.Biol.          246  429  ?   1995 JMOBAK UK 0022-2836 0070 ? ?        ?                      
4       'The Photosynthetic Reaction Center from the Purple Bacterium Rhodopseudomonas Viridis' Science              245  1463 ?   
1989 SCIEAS US 0036-8075 0038 ? ?        ?                      
5       
'Structure of the Protein Subunits in the Photosynthetic Reaction Centre of Rhodopseudomonas Viridis at 3 Angstroms Resolution' 
Nature               318  618  ?   1985 NATUAS UK 0028-0836 0006 ? ?        ?                      
6       
;X-Ray Structure Analysis of a Membrane Protein Complex. Electron Density Map at 3 A Resolution and a Model of the Chromophores of the Photosynthetic Reaction Center from Rhodopseudomonas Viridis
;
J.Mol.Biol.          180  385  ?   1984 JMOBAK UK 0022-2836 0070 ? ?        ?                      
7       
'Three-Dimensional Crystals of a Membrane Protein Complex. The Photosynthetic Reaction Centre from Rhodopseudomonas Viridis' 
J.Mol.Biol.          158  567  ?   1982 JMOBAK UK 0022-2836 0070 ? ?        ?                      
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lancaster, C.R.'   1  
primary 'Michel, H.'        2  
1       'Lancaster, C.R.D.' 3  
2       'Lancaster, C.R.'   4  
2       'Michel, H.'        5  
3       'Deisenhofer, J.'   6  
3       'Epp, O.'           7  
3       'Sinning, I.'       8  
3       'Michel, H.'        9  
4       'Deisenhofer, J.'   10 
4       'Michel, H.'        11 
5       'Deisenhofer, J.'   12 
5       'Epp, O.'           13 
5       'Miki, K.'          14 
5       'Huber, R.'         15 
5       'Michel, H.'        16 
6       'Deisenhofer, J.'   17 
6       'Epp, O.'           18 
6       'Miki, K.'          19 
6       'Huber, R.'         20 
6       'Michel, H.'        21 
7       'Michel, H.'        22 
# 
_cell.entry_id           5PRC 
_cell.length_a           223.500 
_cell.length_b           223.500 
_cell.length_c           113.600 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5PRC 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                         37450.801 1   ? ? ? ? 
2  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                         30469.104 1   ? ? ? ? 
3  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                         35932.188 1   ? ? ? ? 
4  polymer     nat 'PHOTOSYNTHETIC REACTION CENTER'                         28557.453 1   ? ? ? ? 
5  non-polymer syn 'PROTOPORPHYRIN IX CONTAINING FE'                        616.487   4   ? ? ? ? 
6  non-polymer syn 'BACTERIOCHLOROPHYLL B'                                  909.488   4   ? ? ? ? 
7  non-polymer syn 'BACTERIOPHEOPHYTIN B'                                   887.199   2   ? ? ? ? 
8  non-polymer syn '2-CHLORO-4-ISOPROPYLAMINO-6-ETHYLAMINO -1,3,5-TRIAZINE' 215.683   1   ? ? ? ? 
9  non-polymer syn 'LAURYL DIMETHYLAMINE-N-OXIDE'                           229.402   6   ? ? ? ? 
10 non-polymer syn 'FE (II) ION'                                            55.845    1   ? ? ? ? 
11 non-polymer syn 'SULFATE ION'                                            96.063    4   ? ? ? ? 
12 non-polymer syn MENAQUINONE-7                                            648.999   1   ? ? ? ? 
13 non-polymer syn 15-cis-1,2-dihydroneurosporene                           540.904   1   ? ? ? ? 
14 water       nat water                                                    18.015    343 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEW
VSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETP
THVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSL
GTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGAS
RLKDYPELGPIKAAAK
;
;CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVKVLGNLTEAEFLRTMTAITEW
VSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEPTLPLNNRETP
THVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSL
GTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEAPQADCRTCHQGVTKPLFGAS
RLKDYPELGPIKAAAK
;
C ? 
2 'polypeptide(L)' no no  
;ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPL
LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNF
GYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNI
FLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
;
;ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPL
LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNF
GYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNI
FLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
;
L ? 
3 'polypeptide(L)' no no  
;ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFD
PLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGC
IHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRG
TAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPG
APK
;
;ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFD
PLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGC
IHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRG
TAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPG
APK
;
M ? 
4 'polypeptide(L)' no yes 
;(FME)YHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTV
TVPRRRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLP
VVAADGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREED
KVSAYYAGGLLYATPERAESLL
;
;MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPR
RRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAA
DGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSA
YYAGGLLYATPERAESLL
;
H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   CYS n 
1 2   PHE n 
1 3   GLU n 
1 4   PRO n 
1 5   PRO n 
1 6   PRO n 
1 7   ALA n 
1 8   THR n 
1 9   THR n 
1 10  THR n 
1 11  GLN n 
1 12  THR n 
1 13  GLY n 
1 14  PHE n 
1 15  ARG n 
1 16  GLY n 
1 17  LEU n 
1 18  SER n 
1 19  MET n 
1 20  GLY n 
1 21  GLU n 
1 22  VAL n 
1 23  LEU n 
1 24  HIS n 
1 25  PRO n 
1 26  ALA n 
1 27  THR n 
1 28  VAL n 
1 29  LYS n 
1 30  ALA n 
1 31  LYS n 
1 32  LYS n 
1 33  GLU n 
1 34  ARG n 
1 35  ASP n 
1 36  ALA n 
1 37  GLN n 
1 38  TYR n 
1 39  PRO n 
1 40  PRO n 
1 41  ALA n 
1 42  LEU n 
1 43  ALA n 
1 44  ALA n 
1 45  VAL n 
1 46  LYS n 
1 47  ALA n 
1 48  GLU n 
1 49  GLY n 
1 50  PRO n 
1 51  PRO n 
1 52  VAL n 
1 53  SER n 
1 54  GLN n 
1 55  VAL n 
1 56  TYR n 
1 57  LYS n 
1 58  ASN n 
1 59  VAL n 
1 60  LYS n 
1 61  VAL n 
1 62  LEU n 
1 63  GLY n 
1 64  ASN n 
1 65  LEU n 
1 66  THR n 
1 67  GLU n 
1 68  ALA n 
1 69  GLU n 
1 70  PHE n 
1 71  LEU n 
1 72  ARG n 
1 73  THR n 
1 74  MET n 
1 75  THR n 
1 76  ALA n 
1 77  ILE n 
1 78  THR n 
1 79  GLU n 
1 80  TRP n 
1 81  VAL n 
1 82  SER n 
1 83  PRO n 
1 84  GLN n 
1 85  GLU n 
1 86  GLY n 
1 87  CYS n 
1 88  THR n 
1 89  TYR n 
1 90  CYS n 
1 91  HIS n 
1 92  ASP n 
1 93  GLU n 
1 94  ASN n 
1 95  ASN n 
1 96  LEU n 
1 97  ALA n 
1 98  SER n 
1 99  GLU n 
1 100 ALA n 
1 101 LYS n 
1 102 TYR n 
1 103 PRO n 
1 104 TYR n 
1 105 VAL n 
1 106 VAL n 
1 107 ALA n 
1 108 ARG n 
1 109 ARG n 
1 110 MET n 
1 111 LEU n 
1 112 GLU n 
1 113 MET n 
1 114 THR n 
1 115 ARG n 
1 116 ALA n 
1 117 ILE n 
1 118 ASN n 
1 119 THR n 
1 120 ASN n 
1 121 TRP n 
1 122 THR n 
1 123 GLN n 
1 124 HIS n 
1 125 VAL n 
1 126 ALA n 
1 127 GLN n 
1 128 THR n 
1 129 GLY n 
1 130 VAL n 
1 131 THR n 
1 132 CYS n 
1 133 TYR n 
1 134 THR n 
1 135 CYS n 
1 136 HIS n 
1 137 ARG n 
1 138 GLY n 
1 139 THR n 
1 140 PRO n 
1 141 LEU n 
1 142 PRO n 
1 143 PRO n 
1 144 TYR n 
1 145 VAL n 
1 146 ARG n 
1 147 TYR n 
1 148 LEU n 
1 149 GLU n 
1 150 PRO n 
1 151 THR n 
1 152 LEU n 
1 153 PRO n 
1 154 LEU n 
1 155 ASN n 
1 156 ASN n 
1 157 ARG n 
1 158 GLU n 
1 159 THR n 
1 160 PRO n 
1 161 THR n 
1 162 HIS n 
1 163 VAL n 
1 164 GLU n 
1 165 ARG n 
1 166 VAL n 
1 167 GLU n 
1 168 THR n 
1 169 ARG n 
1 170 SER n 
1 171 GLY n 
1 172 TYR n 
1 173 VAL n 
1 174 VAL n 
1 175 ARG n 
1 176 LEU n 
1 177 ALA n 
1 178 LYS n 
1 179 TYR n 
1 180 THR n 
1 181 ALA n 
1 182 TYR n 
1 183 SER n 
1 184 ALA n 
1 185 LEU n 
1 186 ASN n 
1 187 TYR n 
1 188 ASP n 
1 189 PRO n 
1 190 PHE n 
1 191 THR n 
1 192 MET n 
1 193 PHE n 
1 194 LEU n 
1 195 ALA n 
1 196 ASN n 
1 197 ASP n 
1 198 LYS n 
1 199 ARG n 
1 200 GLN n 
1 201 VAL n 
1 202 ARG n 
1 203 VAL n 
1 204 VAL n 
1 205 PRO n 
1 206 GLN n 
1 207 THR n 
1 208 ALA n 
1 209 LEU n 
1 210 PRO n 
1 211 LEU n 
1 212 VAL n 
1 213 GLY n 
1 214 VAL n 
1 215 SER n 
1 216 ARG n 
1 217 GLY n 
1 218 LYS n 
1 219 GLU n 
1 220 ARG n 
1 221 ARG n 
1 222 PRO n 
1 223 LEU n 
1 224 SER n 
1 225 ASP n 
1 226 ALA n 
1 227 TYR n 
1 228 ALA n 
1 229 THR n 
1 230 PHE n 
1 231 ALA n 
1 232 LEU n 
1 233 MET n 
1 234 MET n 
1 235 SER n 
1 236 ILE n 
1 237 SER n 
1 238 ASP n 
1 239 SER n 
1 240 LEU n 
1 241 GLY n 
1 242 THR n 
1 243 ASN n 
1 244 CYS n 
1 245 THR n 
1 246 PHE n 
1 247 CYS n 
1 248 HIS n 
1 249 ASN n 
1 250 ALA n 
1 251 GLN n 
1 252 THR n 
1 253 PHE n 
1 254 GLU n 
1 255 SER n 
1 256 TRP n 
1 257 GLY n 
1 258 LYS n 
1 259 LYS n 
1 260 SER n 
1 261 THR n 
1 262 PRO n 
1 263 GLN n 
1 264 ARG n 
1 265 ALA n 
1 266 ILE n 
1 267 ALA n 
1 268 TRP n 
1 269 TRP n 
1 270 GLY n 
1 271 ILE n 
1 272 ARG n 
1 273 MET n 
1 274 VAL n 
1 275 ARG n 
1 276 ASP n 
1 277 LEU n 
1 278 ASN n 
1 279 MET n 
1 280 ASN n 
1 281 TYR n 
1 282 LEU n 
1 283 ALA n 
1 284 PRO n 
1 285 LEU n 
1 286 ASN n 
1 287 ALA n 
1 288 SER n 
1 289 LEU n 
1 290 PRO n 
1 291 ALA n 
1 292 SER n 
1 293 ARG n 
1 294 LEU n 
1 295 GLY n 
1 296 ARG n 
1 297 GLN n 
1 298 GLY n 
1 299 GLU n 
1 300 ALA n 
1 301 PRO n 
1 302 GLN n 
1 303 ALA n 
1 304 ASP n 
1 305 CYS n 
1 306 ARG n 
1 307 THR n 
1 308 CYS n 
1 309 HIS n 
1 310 GLN n 
1 311 GLY n 
1 312 VAL n 
1 313 THR n 
1 314 LYS n 
1 315 PRO n 
1 316 LEU n 
1 317 PHE n 
1 318 GLY n 
1 319 ALA n 
1 320 SER n 
1 321 ARG n 
1 322 LEU n 
1 323 LYS n 
1 324 ASP n 
1 325 TYR n 
1 326 PRO n 
1 327 GLU n 
1 328 LEU n 
1 329 GLY n 
1 330 PRO n 
1 331 ILE n 
1 332 LYS n 
1 333 ALA n 
1 334 ALA n 
1 335 ALA n 
1 336 LYS n 
2 1   ALA n 
2 2   LEU n 
2 3   LEU n 
2 4   SER n 
2 5   PHE n 
2 6   GLU n 
2 7   ARG n 
2 8   LYS n 
2 9   TYR n 
2 10  ARG n 
2 11  VAL n 
2 12  ARG n 
2 13  GLY n 
2 14  GLY n 
2 15  THR n 
2 16  LEU n 
2 17  ILE n 
2 18  GLY n 
2 19  GLY n 
2 20  ASP n 
2 21  LEU n 
2 22  PHE n 
2 23  ASP n 
2 24  PHE n 
2 25  TRP n 
2 26  VAL n 
2 27  GLY n 
2 28  PRO n 
2 29  TYR n 
2 30  PHE n 
2 31  VAL n 
2 32  GLY n 
2 33  PHE n 
2 34  PHE n 
2 35  GLY n 
2 36  VAL n 
2 37  SER n 
2 38  ALA n 
2 39  ILE n 
2 40  PHE n 
2 41  PHE n 
2 42  ILE n 
2 43  PHE n 
2 44  LEU n 
2 45  GLY n 
2 46  VAL n 
2 47  SER n 
2 48  LEU n 
2 49  ILE n 
2 50  GLY n 
2 51  TYR n 
2 52  ALA n 
2 53  ALA n 
2 54  SER n 
2 55  GLN n 
2 56  GLY n 
2 57  PRO n 
2 58  THR n 
2 59  TRP n 
2 60  ASP n 
2 61  PRO n 
2 62  PHE n 
2 63  ALA n 
2 64  ILE n 
2 65  SER n 
2 66  ILE n 
2 67  ASN n 
2 68  PRO n 
2 69  PRO n 
2 70  ASP n 
2 71  LEU n 
2 72  LYS n 
2 73  TYR n 
2 74  GLY n 
2 75  LEU n 
2 76  GLY n 
2 77  ALA n 
2 78  ALA n 
2 79  PRO n 
2 80  LEU n 
2 81  LEU n 
2 82  GLU n 
2 83  GLY n 
2 84  GLY n 
2 85  PHE n 
2 86  TRP n 
2 87  GLN n 
2 88  ALA n 
2 89  ILE n 
2 90  THR n 
2 91  VAL n 
2 92  CYS n 
2 93  ALA n 
2 94  LEU n 
2 95  GLY n 
2 96  ALA n 
2 97  PHE n 
2 98  ILE n 
2 99  SER n 
2 100 TRP n 
2 101 MET n 
2 102 LEU n 
2 103 ARG n 
2 104 GLU n 
2 105 VAL n 
2 106 GLU n 
2 107 ILE n 
2 108 SER n 
2 109 ARG n 
2 110 LYS n 
2 111 LEU n 
2 112 GLY n 
2 113 ILE n 
2 114 GLY n 
2 115 TRP n 
2 116 HIS n 
2 117 VAL n 
2 118 PRO n 
2 119 LEU n 
2 120 ALA n 
2 121 PHE n 
2 122 CYS n 
2 123 VAL n 
2 124 PRO n 
2 125 ILE n 
2 126 PHE n 
2 127 MET n 
2 128 PHE n 
2 129 CYS n 
2 130 VAL n 
2 131 LEU n 
2 132 GLN n 
2 133 VAL n 
2 134 PHE n 
2 135 ARG n 
2 136 PRO n 
2 137 LEU n 
2 138 LEU n 
2 139 LEU n 
2 140 GLY n 
2 141 SER n 
2 142 TRP n 
2 143 GLY n 
2 144 HIS n 
2 145 ALA n 
2 146 PHE n 
2 147 PRO n 
2 148 TYR n 
2 149 GLY n 
2 150 ILE n 
2 151 LEU n 
2 152 SER n 
2 153 HIS n 
2 154 LEU n 
2 155 ASP n 
2 156 TRP n 
2 157 VAL n 
2 158 ASN n 
2 159 ASN n 
2 160 PHE n 
2 161 GLY n 
2 162 TYR n 
2 163 GLN n 
2 164 TYR n 
2 165 LEU n 
2 166 ASN n 
2 167 TRP n 
2 168 HIS n 
2 169 TYR n 
2 170 ASN n 
2 171 PRO n 
2 172 GLY n 
2 173 HIS n 
2 174 MET n 
2 175 SER n 
2 176 SER n 
2 177 VAL n 
2 178 SER n 
2 179 PHE n 
2 180 LEU n 
2 181 PHE n 
2 182 VAL n 
2 183 ASN n 
2 184 ALA n 
2 185 MET n 
2 186 ALA n 
2 187 LEU n 
2 188 GLY n 
2 189 LEU n 
2 190 HIS n 
2 191 GLY n 
2 192 GLY n 
2 193 LEU n 
2 194 ILE n 
2 195 LEU n 
2 196 SER n 
2 197 VAL n 
2 198 ALA n 
2 199 ASN n 
2 200 PRO n 
2 201 GLY n 
2 202 ASP n 
2 203 GLY n 
2 204 ASP n 
2 205 LYS n 
2 206 VAL n 
2 207 LYS n 
2 208 THR n 
2 209 ALA n 
2 210 GLU n 
2 211 HIS n 
2 212 GLU n 
2 213 ASN n 
2 214 GLN n 
2 215 TYR n 
2 216 PHE n 
2 217 ARG n 
2 218 ASP n 
2 219 VAL n 
2 220 VAL n 
2 221 GLY n 
2 222 TYR n 
2 223 SER n 
2 224 ILE n 
2 225 GLY n 
2 226 ALA n 
2 227 LEU n 
2 228 SER n 
2 229 ILE n 
2 230 HIS n 
2 231 ARG n 
2 232 LEU n 
2 233 GLY n 
2 234 LEU n 
2 235 PHE n 
2 236 LEU n 
2 237 ALA n 
2 238 SER n 
2 239 ASN n 
2 240 ILE n 
2 241 PHE n 
2 242 LEU n 
2 243 THR n 
2 244 GLY n 
2 245 ALA n 
2 246 PHE n 
2 247 GLY n 
2 248 THR n 
2 249 ILE n 
2 250 ALA n 
2 251 SER n 
2 252 GLY n 
2 253 PRO n 
2 254 PHE n 
2 255 TRP n 
2 256 THR n 
2 257 ARG n 
2 258 GLY n 
2 259 TRP n 
2 260 PRO n 
2 261 GLU n 
2 262 TRP n 
2 263 TRP n 
2 264 GLY n 
2 265 TRP n 
2 266 TRP n 
2 267 LEU n 
2 268 ASP n 
2 269 ILE n 
2 270 PRO n 
2 271 PHE n 
2 272 TRP n 
2 273 SER n 
3 1   ALA n 
3 2   ASP n 
3 3   TYR n 
3 4   GLN n 
3 5   THR n 
3 6   ILE n 
3 7   TYR n 
3 8   THR n 
3 9   GLN n 
3 10  ILE n 
3 11  GLN n 
3 12  ALA n 
3 13  ARG n 
3 14  GLY n 
3 15  PRO n 
3 16  HIS n 
3 17  ILE n 
3 18  THR n 
3 19  VAL n 
3 20  SER n 
3 21  GLY n 
3 22  GLU n 
3 23  TRP n 
3 24  GLY n 
3 25  ASP n 
3 26  ASN n 
3 27  ASP n 
3 28  ARG n 
3 29  VAL n 
3 30  GLY n 
3 31  LYS n 
3 32  PRO n 
3 33  PHE n 
3 34  TYR n 
3 35  SER n 
3 36  TYR n 
3 37  TRP n 
3 38  LEU n 
3 39  GLY n 
3 40  LYS n 
3 41  ILE n 
3 42  GLY n 
3 43  ASP n 
3 44  ALA n 
3 45  GLN n 
3 46  ILE n 
3 47  GLY n 
3 48  PRO n 
3 49  ILE n 
3 50  TYR n 
3 51  LEU n 
3 52  GLY n 
3 53  ALA n 
3 54  SER n 
3 55  GLY n 
3 56  ILE n 
3 57  ALA n 
3 58  ALA n 
3 59  PHE n 
3 60  ALA n 
3 61  PHE n 
3 62  GLY n 
3 63  SER n 
3 64  THR n 
3 65  ALA n 
3 66  ILE n 
3 67  LEU n 
3 68  ILE n 
3 69  ILE n 
3 70  LEU n 
3 71  PHE n 
3 72  ASN n 
3 73  MET n 
3 74  ALA n 
3 75  ALA n 
3 76  GLU n 
3 77  VAL n 
3 78  HIS n 
3 79  PHE n 
3 80  ASP n 
3 81  PRO n 
3 82  LEU n 
3 83  GLN n 
3 84  PHE n 
3 85  PHE n 
3 86  ARG n 
3 87  GLN n 
3 88  PHE n 
3 89  PHE n 
3 90  TRP n 
3 91  LEU n 
3 92  GLY n 
3 93  LEU n 
3 94  TYR n 
3 95  PRO n 
3 96  PRO n 
3 97  LYS n 
3 98  ALA n 
3 99  GLN n 
3 100 TYR n 
3 101 GLY n 
3 102 MET n 
3 103 GLY n 
3 104 ILE n 
3 105 PRO n 
3 106 PRO n 
3 107 LEU n 
3 108 HIS n 
3 109 ASP n 
3 110 GLY n 
3 111 GLY n 
3 112 TRP n 
3 113 TRP n 
3 114 LEU n 
3 115 MET n 
3 116 ALA n 
3 117 GLY n 
3 118 LEU n 
3 119 PHE n 
3 120 MET n 
3 121 THR n 
3 122 LEU n 
3 123 SER n 
3 124 LEU n 
3 125 GLY n 
3 126 SER n 
3 127 TRP n 
3 128 TRP n 
3 129 ILE n 
3 130 ARG n 
3 131 VAL n 
3 132 TYR n 
3 133 SER n 
3 134 ARG n 
3 135 ALA n 
3 136 ARG n 
3 137 ALA n 
3 138 LEU n 
3 139 GLY n 
3 140 LEU n 
3 141 GLY n 
3 142 THR n 
3 143 HIS n 
3 144 ILE n 
3 145 ALA n 
3 146 TRP n 
3 147 ASN n 
3 148 PHE n 
3 149 ALA n 
3 150 ALA n 
3 151 ALA n 
3 152 ILE n 
3 153 PHE n 
3 154 PHE n 
3 155 VAL n 
3 156 LEU n 
3 157 CYS n 
3 158 ILE n 
3 159 GLY n 
3 160 CYS n 
3 161 ILE n 
3 162 HIS n 
3 163 PRO n 
3 164 THR n 
3 165 LEU n 
3 166 VAL n 
3 167 GLY n 
3 168 SER n 
3 169 TRP n 
3 170 SER n 
3 171 GLU n 
3 172 GLY n 
3 173 VAL n 
3 174 PRO n 
3 175 PHE n 
3 176 GLY n 
3 177 ILE n 
3 178 TRP n 
3 179 PRO n 
3 180 HIS n 
3 181 ILE n 
3 182 ASP n 
3 183 TRP n 
3 184 LEU n 
3 185 THR n 
3 186 ALA n 
3 187 PHE n 
3 188 SER n 
3 189 ILE n 
3 190 ARG n 
3 191 TYR n 
3 192 GLY n 
3 193 ASN n 
3 194 PHE n 
3 195 TYR n 
3 196 TYR n 
3 197 CYS n 
3 198 PRO n 
3 199 TRP n 
3 200 HIS n 
3 201 GLY n 
3 202 PHE n 
3 203 SER n 
3 204 ILE n 
3 205 GLY n 
3 206 PHE n 
3 207 ALA n 
3 208 TYR n 
3 209 GLY n 
3 210 CYS n 
3 211 GLY n 
3 212 LEU n 
3 213 LEU n 
3 214 PHE n 
3 215 ALA n 
3 216 ALA n 
3 217 HIS n 
3 218 GLY n 
3 219 ALA n 
3 220 THR n 
3 221 ILE n 
3 222 LEU n 
3 223 ALA n 
3 224 VAL n 
3 225 ALA n 
3 226 ARG n 
3 227 PHE n 
3 228 GLY n 
3 229 GLY n 
3 230 ASP n 
3 231 ARG n 
3 232 GLU n 
3 233 ILE n 
3 234 GLU n 
3 235 GLN n 
3 236 ILE n 
3 237 THR n 
3 238 ASP n 
3 239 ARG n 
3 240 GLY n 
3 241 THR n 
3 242 ALA n 
3 243 VAL n 
3 244 GLU n 
3 245 ARG n 
3 246 ALA n 
3 247 ALA n 
3 248 LEU n 
3 249 PHE n 
3 250 TRP n 
3 251 ARG n 
3 252 TRP n 
3 253 THR n 
3 254 ILE n 
3 255 GLY n 
3 256 PHE n 
3 257 ASN n 
3 258 ALA n 
3 259 THR n 
3 260 ILE n 
3 261 GLU n 
3 262 SER n 
3 263 VAL n 
3 264 HIS n 
3 265 ARG n 
3 266 TRP n 
3 267 GLY n 
3 268 TRP n 
3 269 PHE n 
3 270 PHE n 
3 271 SER n 
3 272 LEU n 
3 273 MET n 
3 274 VAL n 
3 275 MET n 
3 276 VAL n 
3 277 SER n 
3 278 ALA n 
3 279 SER n 
3 280 VAL n 
3 281 GLY n 
3 282 ILE n 
3 283 LEU n 
3 284 LEU n 
3 285 THR n 
3 286 GLY n 
3 287 THR n 
3 288 PHE n 
3 289 VAL n 
3 290 ASP n 
3 291 ASN n 
3 292 TRP n 
3 293 TYR n 
3 294 LEU n 
3 295 TRP n 
3 296 CYS n 
3 297 VAL n 
3 298 LYS n 
3 299 HIS n 
3 300 GLY n 
3 301 ALA n 
3 302 ALA n 
3 303 PRO n 
3 304 ASP n 
3 305 TYR n 
3 306 PRO n 
3 307 ALA n 
3 308 TYR n 
3 309 LEU n 
3 310 PRO n 
3 311 ALA n 
3 312 THR n 
3 313 PRO n 
3 314 ASP n 
3 315 PRO n 
3 316 ALA n 
3 317 SER n 
3 318 LEU n 
3 319 PRO n 
3 320 GLY n 
3 321 ALA n 
3 322 PRO n 
3 323 LYS n 
4 1   FME n 
4 2   TYR n 
4 3   HIS n 
4 4   GLY n 
4 5   ALA n 
4 6   LEU n 
4 7   ALA n 
4 8   GLN n 
4 9   HIS n 
4 10  LEU n 
4 11  ASP n 
4 12  ILE n 
4 13  ALA n 
4 14  GLN n 
4 15  LEU n 
4 16  VAL n 
4 17  TRP n 
4 18  TYR n 
4 19  ALA n 
4 20  GLN n 
4 21  TRP n 
4 22  LEU n 
4 23  VAL n 
4 24  ILE n 
4 25  TRP n 
4 26  THR n 
4 27  VAL n 
4 28  VAL n 
4 29  LEU n 
4 30  LEU n 
4 31  TYR n 
4 32  LEU n 
4 33  ARG n 
4 34  ARG n 
4 35  GLU n 
4 36  ASP n 
4 37  ARG n 
4 38  ARG n 
4 39  GLU n 
4 40  GLY n 
4 41  TYR n 
4 42  PRO n 
4 43  LEU n 
4 44  VAL n 
4 45  GLU n 
4 46  PRO n 
4 47  LEU n 
4 48  GLY n 
4 49  LEU n 
4 50  VAL n 
4 51  LYS n 
4 52  LEU n 
4 53  ALA n 
4 54  PRO n 
4 55  GLU n 
4 56  ASP n 
4 57  GLY n 
4 58  GLN n 
4 59  VAL n 
4 60  TYR n 
4 61  GLU n 
4 62  LEU n 
4 63  PRO n 
4 64  TYR n 
4 65  PRO n 
4 66  LYS n 
4 67  THR n 
4 68  PHE n 
4 69  VAL n 
4 70  LEU n 
4 71  PRO n 
4 72  HIS n 
4 73  GLY n 
4 74  GLY n 
4 75  THR n 
4 76  VAL n 
4 77  THR n 
4 78  VAL n 
4 79  PRO n 
4 80  ARG n 
4 81  ARG n 
4 82  ARG n 
4 83  PRO n 
4 84  GLU n 
4 85  THR n 
4 86  ARG n 
4 87  GLU n 
4 88  LEU n 
4 89  LYS n 
4 90  LEU n 
4 91  ALA n 
4 92  GLN n 
4 93  THR n 
4 94  ASP n 
4 95  GLY n 
4 96  PHE n 
4 97  GLU n 
4 98  GLY n 
4 99  ALA n 
4 100 PRO n 
4 101 LEU n 
4 102 GLN n 
4 103 PRO n 
4 104 THR n 
4 105 GLY n 
4 106 ASN n 
4 107 PRO n 
4 108 LEU n 
4 109 VAL n 
4 110 ASP n 
4 111 ALA n 
4 112 VAL n 
4 113 GLY n 
4 114 PRO n 
4 115 ALA n 
4 116 SER n 
4 117 TYR n 
4 118 ALA n 
4 119 GLU n 
4 120 ARG n 
4 121 ALA n 
4 122 GLU n 
4 123 VAL n 
4 124 VAL n 
4 125 ASP n 
4 126 ALA n 
4 127 THR n 
4 128 VAL n 
4 129 ASP n 
4 130 GLY n 
4 131 LYS n 
4 132 ALA n 
4 133 LYS n 
4 134 ILE n 
4 135 VAL n 
4 136 PRO n 
4 137 LEU n 
4 138 ARG n 
4 139 VAL n 
4 140 ALA n 
4 141 THR n 
4 142 ASP n 
4 143 PHE n 
4 144 SER n 
4 145 ILE n 
4 146 ALA n 
4 147 GLU n 
4 148 GLY n 
4 149 ASP n 
4 150 VAL n 
4 151 ASP n 
4 152 PRO n 
4 153 ARG n 
4 154 GLY n 
4 155 LEU n 
4 156 PRO n 
4 157 VAL n 
4 158 VAL n 
4 159 ALA n 
4 160 ALA n 
4 161 ASP n 
4 162 GLY n 
4 163 VAL n 
4 164 GLU n 
4 165 ALA n 
4 166 GLY n 
4 167 THR n 
4 168 VAL n 
4 169 THR n 
4 170 ASP n 
4 171 LEU n 
4 172 TRP n 
4 173 VAL n 
4 174 ASP n 
4 175 ARG n 
4 176 SER n 
4 177 GLU n 
4 178 HIS n 
4 179 TYR n 
4 180 PHE n 
4 181 ARG n 
4 182 TYR n 
4 183 LEU n 
4 184 GLU n 
4 185 LEU n 
4 186 SER n 
4 187 VAL n 
4 188 ALA n 
4 189 GLY n 
4 190 SER n 
4 191 ALA n 
4 192 ARG n 
4 193 THR n 
4 194 ALA n 
4 195 LEU n 
4 196 ILE n 
4 197 PRO n 
4 198 LEU n 
4 199 GLY n 
4 200 PHE n 
4 201 CYS n 
4 202 ASP n 
4 203 VAL n 
4 204 LYS n 
4 205 LYS n 
4 206 ASP n 
4 207 LYS n 
4 208 ILE n 
4 209 VAL n 
4 210 VAL n 
4 211 THR n 
4 212 SER n 
4 213 ILE n 
4 214 LEU n 
4 215 SER n 
4 216 GLU n 
4 217 GLN n 
4 218 PHE n 
4 219 ALA n 
4 220 ASN n 
4 221 VAL n 
4 222 PRO n 
4 223 ARG n 
4 224 LEU n 
4 225 GLN n 
4 226 SER n 
4 227 ARG n 
4 228 ASP n 
4 229 GLN n 
4 230 ILE n 
4 231 THR n 
4 232 LEU n 
4 233 ARG n 
4 234 GLU n 
4 235 GLU n 
4 236 ASP n 
4 237 LYS n 
4 238 VAL n 
4 239 SER n 
4 240 ALA n 
4 241 TYR n 
4 242 TYR n 
4 243 ALA n 
4 244 GLY n 
4 245 GLY n 
4 246 LEU n 
4 247 LEU n 
4 248 TYR n 
4 249 ALA n 
4 250 THR n 
4 251 PRO n 
4 252 GLU n 
4 253 ARG n 
4 254 ALA n 
4 255 GLU n 
4 256 SER n 
4 257 LEU n 
4 258 LEU n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? 'DSM 133' 'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
2 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? ?         'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
3 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? ?         'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
4 1 sample ? ? ? 'Blastochloris viridis' 1079 Blastochloris ? ? ? ? ? ? ? ? ?         'INTRACYTOPLASMIC MEMBRANE (ICM)' ? ? ? ? ? 
? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 UNP CYCR_RHOVI 1 P07173 1 
;MKQLIVNSVATVALASLVAGCFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGPPVSQVYKNVK
VLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEAKYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTP
LPPYVRYLEPTLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQVRVVPQTALPLVGVSRGKER
RPLSDAYATFALMMSISDSLGTNCTFCHNAQTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEA
PQADCRTCHQGVTKPLFGASRLKDYPELGPIKAAAK
;
? 
2 UNP RCEL_RHOVI 2 P06009 1 
;ALLSFERKYRVRGGTLIGGDLFDFWVGPYFVGFFGVSAIFFIFLGVSLIGYAASQGPTWDPFAISINPPDLKYGLGAAPL
LEGGFWQAITVCALGAFISWMLREVEISRKLGIGWHVPLAFCVPIFMFCVLQVFRPLLLGSWGHAFPYGILSHLDWVNNF
GYQYLNWHYNPGHMSSVSFLFVNAMALGLHGGLILSVANPGDGDKVKTAEHENQYFRDVVGYSIGALSIHRLGLFLASNI
FLTGAFGTIASGPFWTRGWPEWWGWWLDIPFWS
;
? 
3 UNP RCEM_RHOVI 3 P06010 1 
;ADYQTIYTQIQARGPHITVSGEWGDNDRVGKPFYSYWLGKIGDAQIGPIYLGASGIAAFAFGSTAILIILFNMAAEVHFD
PLQFFRQFFWLGLYPPKAQYGMGIPPLHDGGWWLMAGLFMTLSLGSWWIRVYSRARALGLGTHIAWNFAAAIFFVLCIGC
IHPTLVGSWSEGVPFGIWPHIDWLTAFSIRYGNFYYCPWHGFSIGFAYGCGLLFAAHGATILAVARFGGDREIEQITDRG
TAVERAALFWRWTIGFNATIESVHRWGWFFSLMVMVSASVGILLTGTFVDNWYLWCVKHGAAPDYPAYLPATPDPASLPG
APK
;
? 
4 UNP RCEH_RHOVI 4 P06008 1 
;MYHGALAQHLDIAQLVWYAQWLVIWTVVLLYLRREDRREGYPLVEPLGLVKLAPEDGQVYELPYPKTFVLPHGGTVTVPR
RRPETRELKLAQTDGFEGAPLQPTGNPLVDAVGPASYAERAEVVDATVDGKAKIVPLRVATDFSIAEGDVDPRGLPVVAA
DGVEAGTVTDLWVDRSEHYFRYLELSVAGSARTALIPLGFCDVKKDKIVVTSILSEQFANVPRLQSRDQITLREEDKVSA
YYAGGLLYATPERAESLL
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5PRC C 1 ? 336 ? P07173 21 ? 356 ? 1 336 
2 2 5PRC L 1 ? 273 ? P06009 1  ? 273 ? 1 273 
3 3 5PRC M 1 ? 323 ? P06010 1  ? 323 ? 1 323 
4 4 5PRC H 2 ? 258 ? P06008 2  ? 258 ? 2 258 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                  ?        'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE                                                 ?        'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE                                               ?        'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                          ?        'C4 H7 N O4'         133.103 
ATZ non-polymer         . '2-CHLORO-4-ISOPROPYLAMINO-6-ETHYLAMINO -1,3,5-TRIAZINE' ATRAZINE 'C8 H14 Cl N5'       215.683 
BCB non-polymer         . 'BACTERIOCHLOROPHYLL B'                                  ?        'C55 H72 Mg N4 O6 2' 909.488 
BPB non-polymer         . 'BACTERIOPHEOPHYTIN B'                                   ?        'C55 H74 N4 O6'      887.199 
CYS 'L-peptide linking' y CYSTEINE                                                 ?        'C3 H7 N O2 S'       121.158 
FE2 non-polymer         . 'FE (II) ION'                                            ?        'Fe 2'               55.845  
FME 'L-peptide linking' n N-FORMYLMETHIONINE                                       ?        'C6 H11 N O3 S'      177.221 
GLN 'L-peptide linking' y GLUTAMINE                                                ?        'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                          ?        'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE                                                  ?        'C2 H5 N O2'         75.067  
HEM non-polymer         . 'PROTOPORPHYRIN IX CONTAINING FE'                        HEME     'C34 H32 Fe N4 O4'   616.487 
HIS 'L-peptide linking' y HISTIDINE                                                ?        'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER                                                    ?        'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                               ?        'C6 H13 N O2'        131.173 
LDA non-polymer         . 'LAURYL DIMETHYLAMINE-N-OXIDE'                           ?        'C14 H31 N O'        229.402 
LEU 'L-peptide linking' y LEUCINE                                                  ?        'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE                                                   ?        'C6 H15 N2 O2 1'     147.195 
MET 'L-peptide linking' y METHIONINE                                               ?        'C5 H11 N O2 S'      149.211 
MQ7 non-polymer         . MENAQUINONE-7                                            ?        'C46 H64 O2'         648.999 
NS5 non-polymer         . 15-cis-1,2-dihydroneurosporene                           ?        'C40 H60'            540.904 
PHE 'L-peptide linking' y PHENYLALANINE                                            ?        'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE                                                  ?        'C5 H9 N O2'         115.130 
SER 'L-peptide linking' y SERINE                                                   ?        'C3 H7 N O3'         105.093 
SO4 non-polymer         . 'SULFATE ION'                                            ?        'O4 S -2'            96.063  
THR 'L-peptide linking' y THREONINE                                                ?        'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                               ?        'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE                                                 ?        'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE                                                   ?        'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          5PRC 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   6 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.9 
_exptl_crystal.density_percent_sol   70 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6.0' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           263 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1993-09 
_diffrn_detector.details                'TOROIDAL MIRROR' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MPG/DESY, HAMBURG BEAMLINE BW6' 
_diffrn_source.pdbx_synchrotron_site       'MPG/DESY, HAMBURG' 
_diffrn_source.pdbx_synchrotron_beamline   BW6 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     5PRC 
_reflns.observed_criterion_sigma_I   1.5 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   96950 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         76.2 
_reflns.pdbx_Rmerge_I_obs            0.0790000 
_reflns.pdbx_Rsym_value              0.0790000 
_reflns.pdbx_netI_over_sigmaI        7.8 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.7 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.36 
_reflns_shell.percent_possible_all   48.0 
_reflns_shell.Rmerge_I_obs           0.2820000 
_reflns_shell.pdbx_Rsym_value        0.2820000 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        1.6 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 5PRC 
_refine.ls_number_reflns_obs                     92322 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.0 
_refine.ls_d_res_high                            2.35 
_refine.ls_percent_reflns_obs                    78.5 
_refine.ls_R_factor_obs                          0.1900000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1900000 
_refine.ls_R_factor_R_free                       0.2360000 
_refine.ls_R_factor_R_free_error                 0.0024 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  9237 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               33.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               'A POSTERIORI' 
_refine.details                                  'N(OBS)/N(PAR) = 2.20' 
_refine.pdbx_starting_model                      'PDB ENTRY 6PRC' 
_refine.pdbx_method_to_determine_struct          'DIFFERENCE FOURIER / SA OMIT MAPS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        5PRC 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9342 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         785 
_refine_hist.number_atoms_solvent             343 
_refine_hist.number_atoms_total               10470 
_refine_hist.d_res_high                       2.35 
_refine_hist.d_res_low                        10.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.40  ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      23.8  ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      2.22  ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.5   ? ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.0   ? ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            2.5   ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   8 
_refine_ls_shell.d_res_high                       2.35 
_refine_ls_shell.d_res_low                        2.46 
_refine_ls_shell.number_reflns_R_work             7493 
_refine_ls_shell.R_factor_R_work                  0.2960000 
_refine_ls_shell.percent_reflns_obs               57.4 
_refine_ls_shell.R_factor_R_free                  0.3360000 
_refine_ls_shell.R_factor_R_free_error            0.011 
_refine_ls_shell.percent_reflns_R_free            10.0 
_refine_ls_shell.number_reflns_R_free             854 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX_TEST.PRO           TOPHCSDX.PRO               'X-RAY DIFFRACTION' 
2 PARAM19.ION                 TOPH19.ION                 'X-RAY DIFFRACTION' 
3 PARHCSDX_IUB.RCV            TOPHCSDX_IUB.RCV           'X-RAY DIFFRACTION' 
4 'PARAM19.SOL, PARHCSDX.TRZ' 'TOPH19.SOL, TOPHCSDX.TRZ' 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  5PRC 
_struct.title                     'PHOTOSYNTHETIC REACTION CENTER FROM RHODOPSEUDOMONAS VIRIDIS (ATRAZINE COMPLEX)' 
_struct.pdbx_descriptor           
;PHOTOSYNTHETIC REACTION CENTER, BACTERIOCHLOROPHYLL B, BACTERIOPHEOPHYTIN B, MENAQUINONE-7 (ALTERED), PROTOPORPHYRIN IX CONTAINING FE, DIHYDRO-NEUROSPORENE, 2-CHLORO-4-ISOPROPYLAMINO-6-ETHYLAMINO -1,3,5-TRIAZINE, LAURYL DIMETHYLAMINE-N-OXIDE
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        5PRC 
_struct_keywords.pdbx_keywords   'PHOTOSYNTHETIC REACTION CENTER' 
_struct_keywords.text            'PHOTOSYNTHETIC REACTION CENTER, SECONDARY QUINONE (QB), TRIAZINE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 5  ? 
G  N N 5  ? 
H  N N 5  ? 
I  N N 6  ? 
J  N N 6  ? 
K  N N 7  ? 
L  N N 8  ? 
M  N N 9  ? 
N  N N 9  ? 
O  N N 10 ? 
P  N N 11 ? 
Q  N N 11 ? 
R  N N 11 ? 
S  N N 6  ? 
T  N N 6  ? 
U  N N 7  ? 
V  N N 12 ? 
W  N N 13 ? 
X  N N 9  ? 
Y  N N 9  ? 
Z  N N 11 ? 
AA N N 9  ? 
BA N N 9  ? 
CA N N 14 ? 
DA N N 14 ? 
EA N N 14 ? 
FA N N 14 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 25  ? GLN A 37  ? PRO C 25  GLN C 37  1 'N-TERMINAL HELIX'           13 
HELX_P HELX_P2  3  GLU A 67  ? TRP A 80  ? GLU C 67  TRP C 80  1 'ASSOCIATED WITH HEME 1'     14 
HELX_P HELX_P3  5  TYR A 102 ? ASN A 120 ? TYR C 102 ASN C 120 1 'ASSOCIATED WITH HEME 2'     19 
HELX_P HELX_P4  7  CYS A 132 ? HIS A 136 ? CYS C 132 HIS C 136 1 'HEME 2 ATTACHMENT SITE'     5  
HELX_P HELX_P5  8  ARG A 169 ? TYR A 179 ? ARG C 169 TYR C 179 5 ?                            11 
HELX_P HELX_P6  9  PRO A 189 ? PHE A 193 ? PRO C 189 PHE C 193 1 ?                            5  
HELX_P HELX_P7  11 LEU A 223 ? LEU A 240 ? LEU C 223 LEU C 240 5 'ASSOCIATED WITH HEME 3'     18 
HELX_P HELX_P8  15 PRO A 262 ? ASN A 280 ? PRO C 262 ASN C 280 1 'ASSOCIATED WITH HEME 4'     19 
HELX_P HELX_P9  16 ALA A 283 ? ALA A 287 ? ALA C 283 ALA C 287 5 ?                            5  
HELX_P HELX_P10 18 CYS A 305 ? HIS A 309 ? CYS C 305 HIS C 309 1 'HEME 4 ATTACHMENT SITE'     5  
HELX_P HELX_P11 22 GLY B 32  ? GLN B 55  ? GLY L 32  GLN L 55  1 'TRANSMEMBRANE HELIX LA'     24 
HELX_P HELX_P12 25 GLY B 84  ? LEU B 111 ? GLY L 84  LEU L 111 1 'TRANSMEMBRANE HELIX LB'     28 
HELX_P HELX_P13 26 HIS B 116 ? LEU B 139 ? HIS L 116 LEU L 139 1 'TRANSMEMBRANE HELIX LC'     24 
HELX_P HELX_P14 29 SER B 152 ? TYR B 164 ? SER L 152 TYR L 164 1 'PERIPLASMIC HELIX LCD'      13 
HELX_P HELX_P15 31 PRO B 171 ? ALA B 198 ? PRO L 171 ALA L 198 1 'TRANSMEMBRANE HELIX LD'     28 
HELX_P HELX_P16 32 ALA B 209 ? VAL B 220 ? ALA L 209 VAL L 220 1 'CYTOPLASMIC HELIX LDE'      12 
HELX_P HELX_P17 33 ALA B 226 ? PRO B 253 ? ALA L 226 PRO L 253 1 'TRANSMEMBRANE HELIX LE'     28 
HELX_P HELX_P18 34 TRP B 259 ? LEU B 267 ? TRP L 259 LEU L 267 1 'PERIPLASMIC C-TERMINAL'     9  
HELX_P HELX_P19 37 ALA C 53  ? VAL C 77  ? ALA M 53  VAL M 77  1 'TRANSMEMBRANE HELIX MA'     25 
HELX_P HELX_P20 38 PRO C 81  ? ARG C 86  ? PRO M 81  ARG M 86  1 'PERIPLASMIC HELIX MAB'      6  
HELX_P HELX_P21 41 GLY C 111 ? LEU C 138 ? GLY M 111 LEU M 138 1 'TRANSMEMBRANE HELIX MB'     28 
HELX_P HELX_P22 42 HIS C 143 ? VAL C 166 ? HIS M 143 VAL M 166 1 'TRANSMEMBRANE HELIX MC'     24 
HELX_P HELX_P23 45 ILE C 177 ? ARG C 190 ? ILE M 177 ARG M 190 1 'PERIPLASMIC HELIX MCD'      14 
HELX_P HELX_P24 47 PRO C 198 ? PHE C 227 ? PRO M 198 PHE M 227 1 'TRANSMEMBRANE HELIX MD'     30 
HELX_P HELX_P25 48 GLU C 232 ? THR C 237 ? GLU M 232 THR M 237 1 'CYTOPLASMIC HELIX'          6  
HELX_P HELX_P26 49 THR C 241 ? ILE C 254 ? THR M 241 ILE M 254 1 'CYTOPLASMIC HELIX MDE'      14 
HELX_P HELX_P27 50 SER C 262 ? LEU C 284 ? SER M 262 LEU M 284 1 'TRANSMEMBRANE HELIX ME'     23 
HELX_P HELX_P28 51 TRP C 292 ? HIS C 299 ? TRP M 292 HIS M 299 1 'PERIPLASMIC C-TERMINAL'     8  
HELX_P HELX_P29 53 ILE D 12  ? LEU D 30  ? ILE H 12  LEU H 30  1 'TRANSMEMBRANE HELIX'        19 
HELX_P HELX_P30 54 LEU D 32  ? ARG D 37  ? LEU H 32  ARG H 37  1 'PI-HELICAL EXTENSION OF TM' 6  
HELX_P HELX_P31 55 ASP D 56  ? TYR D 60  ? ASP H 56  TYR H 60  1 'SHORT HELIX'                5  
HELX_P HELX_P32 56 PRO D 107 ? ASP D 110 ? PRO H 107 ASP H 110 1 'SHORT HELIX'                4  
HELX_P HELX_P33 59 SER D 215 ? ASN D 220 ? SER H 215 ASN H 220 5 'SHORT HELIX'                6  
HELX_P HELX_P34 60 LEU D 232 ? TYR D 248 ? LEU H 232 TYR H 248 1 'C-TERMINAL HELIX'           17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? D FME 1 C   ? ? ? 1_555 D TYR 2   N   ? ? H FME 1   H TYR 2   1_555 ? ? ? ? ? ? ? 1.332 ? 
metalc1  metalc ? ? S BCB . MG  ? ? ? 1_555 C HIS 180 NE2 ? ? M BCB 805 M HIS 180 1_555 ? ? ? ? ? ? ? 2.062 ? 
metalc2  metalc ? ? I BCB . MG  ? ? ? 1_555 B HIS 173 NE2 ? ? L BCB 302 L HIS 173 1_555 ? ? ? ? ? ? ? 2.043 ? 
metalc3  metalc ? ? T BCB . MG  ? ? ? 1_555 C HIS 200 NE2 ? ? M BCB 806 M HIS 200 1_555 ? ? ? ? ? ? ? 2.064 ? 
metalc4  metalc ? ? J BCB . MG  ? ? ? 1_555 B HIS 153 NE2 ? ? L BCB 304 L HIS 153 1_555 ? ? ? ? ? ? ? 2.107 ? 
metalc5  metalc ? ? O FE2 . FE  ? ? ? 1_555 B HIS 190 NE2 ? ? M FE2 500 L HIS 190 1_555 ? ? ? ? ? ? ? 1.855 ? 
metalc6  metalc ? ? O FE2 . FE  ? ? ? 1_555 B HIS 230 NE2 ? ? M FE2 500 L HIS 230 1_555 ? ? ? ? ? ? ? 2.251 ? 
metalc7  metalc ? ? O FE2 . FE  ? ? ? 1_555 C HIS 217 NE2 ? ? M FE2 500 M HIS 217 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc8  metalc ? ? O FE2 . FE  ? ? ? 1_555 C GLU 232 OE2 ? ? M FE2 500 M GLU 232 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc9  metalc ? ? O FE2 . FE  ? ? ? 1_555 C HIS 264 NE2 ? ? M FE2 500 M HIS 264 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc10 metalc ? ? E HEM . FE  ? ? ? 1_555 A MET 74  SD  ? ? C HEM 337 C MET 74  1_555 ? ? ? ? ? ? ? 2.181 ? 
metalc11 metalc ? ? E HEM . FE  ? ? ? 1_555 A HIS 91  NE2 ? ? C HEM 337 C HIS 91  1_555 ? ? ? ? ? ? ? 1.896 ? 
covale2  covale ? ? E HEM . CAB ? ? ? 1_555 A CYS 87  SG  ? ? C HEM 337 C CYS 87  1_555 ? ? ? ? ? ? ? 1.754 ? 
covale3  covale ? ? E HEM . CAC ? ? ? 1_555 A CYS 90  SG  ? ? C HEM 337 C CYS 90  1_555 ? ? ? ? ? ? ? 1.786 ? 
metalc12 metalc ? ? F HEM . FE  ? ? ? 1_555 A MET 110 SD  ? ? C HEM 338 C MET 110 1_555 ? ? ? ? ? ? ? 2.164 ? 
metalc13 metalc ? ? F HEM . FE  ? ? ? 1_555 A HIS 136 NE2 ? ? C HEM 338 C HIS 136 1_555 ? ? ? ? ? ? ? 1.967 ? 
covale4  covale ? ? F HEM . CAB ? ? ? 1_555 A CYS 132 SG  ? ? C HEM 338 C CYS 132 1_555 ? ? ? ? ? ? ? 1.805 ? 
covale5  covale ? ? F HEM . CAC ? ? ? 1_555 A CYS 135 SG  ? ? C HEM 338 C CYS 135 1_555 ? ? ? ? ? ? ? 1.776 ? 
metalc14 metalc ? ? G HEM . FE  ? ? ? 1_555 A MET 233 SD  ? ? C HEM 339 C MET 233 1_555 ? ? ? ? ? ? ? 2.094 ? 
metalc15 metalc ? ? G HEM . FE  ? ? ? 1_555 A HIS 248 NE2 ? ? C HEM 339 C HIS 248 1_555 ? ? ? ? ? ? ? 1.935 ? 
covale6  covale ? ? G HEM . CAB ? ? ? 1_555 A CYS 244 SG  ? ? C HEM 339 C CYS 244 1_555 ? ? ? ? ? ? ? 1.774 ? 
covale7  covale ? ? G HEM . CAC ? ? ? 1_555 A CYS 247 SG  ? ? C HEM 339 C CYS 247 1_555 ? ? ? ? ? ? ? 1.793 ? 
metalc16 metalc ? ? H HEM . FE  ? ? ? 1_555 A HIS 124 NE2 ? ? C HEM 340 C HIS 124 1_555 ? ? ? ? ? ? ? 1.941 ? 
metalc17 metalc ? ? H HEM . FE  ? ? ? 1_555 A HIS 309 NE2 ? ? C HEM 340 C HIS 309 1_555 ? ? ? ? ? ? ? 1.983 ? 
covale8  covale ? ? H HEM . CAB ? ? ? 1_555 A CYS 305 SG  ? ? C HEM 340 C CYS 305 1_555 ? ? ? ? ? ? ? 1.764 ? 
covale9  covale ? ? H HEM . CAC ? ? ? 1_555 A CYS 308 SG  ? ? C HEM 340 C CYS 308 1_555 ? ? ? ? ? ? ? 1.757 ? 
metalc18 metalc ? ? O FE2 . FE  ? ? ? 1_555 C GLU 232 OE1 ? ? M FE2 500 M GLU 232 1_555 ? ? ? ? ? ? ? 2.451 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 PRO 5   A . ? PRO 5   C PRO 6   A ? PRO 6   C 1 -1.18  
2 LEU 152 A . ? LEU 152 C PRO 153 A ? PRO 153 C 1 -16.13 
3 GLY 329 A . ? GLY 329 C PRO 330 A ? PRO 330 C 1 7.41   
4 GLY 47  C . ? GLY 47  M PRO 48  C ? PRO 48  M 1 -11.89 
5 TYR 41  D . ? TYR 41  H PRO 42  D ? PRO 42  H 1 8.44   
6 VAL 78  D . ? VAL 78  H PRO 79  D ? PRO 79  H 1 1.83   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 2 ? 
C ? 2 ? 
D ? 4 ? 
E ? 2 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 7   ? THR A 9   ? ALA C 7   THR C 9   
A 2 VAL A 22  ? HIS A 24  ? VAL C 22  HIS C 24  
B 1 LYS D 66  ? VAL D 69  ? LYS H 66  VAL H 69  
B 2 THR D 75  ? VAL D 78  ? THR H 75  VAL H 78  
C 1 LEU D 90  ? GLN D 92  ? LEU H 90  GLN H 92  
C 2 LEU D 101 ? PRO D 103 ? LEU H 101 PRO H 103 
D 1 ILE D 134 ? PRO D 136 ? ILE H 134 PRO H 136 
D 2 GLY D 166 ? ASP D 174 ? GLY H 166 ASP H 174 
D 3 TYR D 182 ? VAL D 187 ? TYR H 182 VAL H 187 
D 4 THR D 193 ? PRO D 197 ? THR H 193 PRO H 197 
E 1 CYS D 201 ? VAL D 203 ? CYS H 201 VAL H 203 
E 2 ILE D 208 ? VAL D 210 ? ILE H 208 VAL H 210 
F 1 PRO D 156 ? VAL D 158 ? PRO H 156 VAL H 158 
F 2 GLU D 164 ? THR D 167 ? GLU H 164 THR H 167 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O THR A 8   ? O THR C 8   N LEU A 23  ? N LEU C 23  
B 1 2 O LYS D 66  ? O LYS H 66  N VAL D 78  ? N VAL H 78  
C 1 2 O ALA D 91  ? O ALA H 91  N GLN D 102 ? N GLN H 102 
D 1 2 O VAL D 135 ? O VAL H 135 N VAL D 173 ? N VAL H 173 
D 2 3 O THR D 167 ? O THR H 167 N SER D 186 ? N SER H 186 
D 3 4 O LEU D 183 ? O LEU H 183 N ILE D 196 ? N ILE H 196 
E 1 2 O ASP D 202 ? O ASP H 202 N VAL D 209 ? N VAL H 209 
F 1 2 O VAL D 157 ? O VAL H 157 N GLY D 166 ? N GLY H 166 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE FE2 M 500' 
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 H 801' 
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 M 802' 
AC4 Software ? ? ? ? 4  'BINDING SITE FOR RESIDUE SO4 M 803' 
AC5 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE SO4 M 804' 
AC6 Software ? ? ? ? 19 'BINDING SITE FOR RESIDUE BCB M 805' 
AC7 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE BCB L 302' 
AC8 Software ? ? ? ? 22 'BINDING SITE FOR RESIDUE BCB M 806' 
AC9 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE BCB L 304' 
BC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE BPB M 401' 
BC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE BPB L 402' 
BC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE MQ7 M 501' 
BC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE HEM C 337' 
BC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE HEM C 338' 
BC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE HEM C 339' 
BC7 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE HEM C 340' 
BC8 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE NS5 M 600' 
BC9 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE ATZ L 502' 
CC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE LDA H 701' 
CC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE LDA L 702' 
CC3 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE LDA H 703' 
CC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE LDA M 704' 
CC5 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE LDA L 705' 
CC6 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE LDA M 706' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 5  HIS B  190 ? HIS L 190  . ? 1_555 ? 
2   AC1 5  HIS B  230 ? HIS L 230  . ? 1_555 ? 
3   AC1 5  HIS C  217 ? HIS M 217  . ? 1_555 ? 
4   AC1 5  GLU C  232 ? GLU M 232  . ? 1_555 ? 
5   AC1 5  HIS C  264 ? HIS M 264  . ? 1_555 ? 
6   AC2 7  ARG D  33  ? ARG H 33   . ? 1_555 ? 
7   AC2 7  ARG D  37  ? ARG H 37   . ? 1_555 ? 
8   AC2 7  TYR D  41  ? TYR H 41   . ? 1_555 ? 
9   AC2 7  HOH FA .   ? HOH H 1059 . ? 1_555 ? 
10  AC2 7  HOH FA .   ? HOH H 1060 . ? 1_555 ? 
11  AC2 7  HOH FA .   ? HOH H 1061 . ? 1_555 ? 
12  AC2 7  ARG C  251 ? ARG M 251  . ? 1_555 ? 
13  AC3 5  HOH FA .   ? HOH H 1224 . ? 1_555 ? 
14  AC3 5  ASN B  199 ? ASN L 199  . ? 1_555 ? 
15  AC3 5  HOH DA .   ? HOH L 1127 . ? 1_555 ? 
16  AC3 5  HIS C  143 ? HIS M 143  . ? 1_555 ? 
17  AC3 5  ARG C  265 ? ARG M 265  . ? 1_555 ? 
18  AC4 4  LEU D  246 ? LEU H 246  . ? 1_555 ? 
19  AC4 4  ALA C  1   ? ALA M 1    . ? 1_555 ? 
20  AC4 4  ARG C  226 ? ARG M 226  . ? 1_555 ? 
21  AC4 4  HOH EA .   ? HOH M 1226 . ? 1_555 ? 
22  AC5 8  TRP C  23  ? TRP M 23   . ? 1_555 ? 
23  AC5 8  TYR C  50  ? TYR M 50   . ? 1_555 ? 
24  AC5 8  ALA C  53  ? ALA M 53   . ? 1_555 ? 
25  AC5 8  SER C  54  ? SER M 54   . ? 1_555 ? 
26  AC5 8  SER C  133 ? SER M 133  . ? 1_555 ? 
27  AC5 8  LDA X  .   ? LDA M 704  . ? 1_555 ? 
28  AC5 8  HOH EA .   ? HOH M 1030 . ? 1_555 ? 
29  AC5 8  HOH EA .   ? HOH M 1064 . ? 1_555 ? 
30  AC6 19 HIS B  168 ? HIS L 168  . ? 1_555 ? 
31  AC6 19 MET B  174 ? MET L 174  . ? 1_555 ? 
32  AC6 19 VAL B  177 ? VAL L 177  . ? 1_555 ? 
33  AC6 19 SER B  178 ? SER L 178  . ? 1_555 ? 
34  AC6 19 VAL B  182 ? VAL L 182  . ? 1_555 ? 
35  AC6 19 MET B  185 ? MET L 185  . ? 1_555 ? 
36  AC6 19 VAL B  220 ? VAL L 220  . ? 1_555 ? 
37  AC6 19 BCB I  .   ? BCB L 302  . ? 1_555 ? 
38  AC6 19 HOH DA .   ? HOH L 993  . ? 1_555 ? 
39  AC6 19 MET C  120 ? MET M 120  . ? 1_555 ? 
40  AC6 19 VAL C  155 ? VAL M 155  . ? 1_555 ? 
41  AC6 19 ILE C  177 ? ILE M 177  . ? 1_555 ? 
42  AC6 19 TRP C  178 ? TRP M 178  . ? 1_555 ? 
43  AC6 19 HIS C  180 ? HIS M 180  . ? 1_555 ? 
44  AC6 19 ILE C  181 ? ILE M 181  . ? 1_555 ? 
45  AC6 19 LEU C  184 ? LEU M 184  . ? 1_555 ? 
46  AC6 19 BPB U  .   ? BPB M 401  . ? 1_555 ? 
47  AC6 19 NS5 W  .   ? NS5 M 600  . ? 1_555 ? 
48  AC6 19 BCB T  .   ? BCB M 806  . ? 1_555 ? 
49  AC7 20 PRO B  124 ? PRO L 124  . ? 1_555 ? 
50  AC7 20 MET B  127 ? MET L 127  . ? 1_555 ? 
51  AC7 20 PHE B  128 ? PHE L 128  . ? 1_555 ? 
52  AC7 20 VAL B  157 ? VAL L 157  . ? 1_555 ? 
53  AC7 20 PHE B  160 ? PHE L 160  . ? 1_555 ? 
54  AC7 20 GLY B  161 ? GLY L 161  . ? 1_555 ? 
55  AC7 20 TRP B  167 ? TRP L 167  . ? 1_555 ? 
56  AC7 20 HIS B  168 ? HIS L 168  . ? 1_555 ? 
57  AC7 20 HIS B  173 ? HIS L 173  . ? 1_555 ? 
58  AC7 20 SER B  176 ? SER L 176  . ? 1_555 ? 
59  AC7 20 VAL B  177 ? VAL L 177  . ? 1_555 ? 
60  AC7 20 PHE B  241 ? PHE L 241  . ? 1_555 ? 
61  AC7 20 GLY B  244 ? GLY L 244  . ? 1_555 ? 
62  AC7 20 THR B  248 ? THR L 248  . ? 1_555 ? 
63  AC7 20 BCB J  .   ? BCB L 304  . ? 1_555 ? 
64  AC7 20 BPB K  .   ? BPB L 402  . ? 1_555 ? 
65  AC7 20 TYR C  195 ? TYR M 195  . ? 1_555 ? 
66  AC7 20 TYR C  208 ? TYR M 208  . ? 1_555 ? 
67  AC7 20 BCB S  .   ? BCB M 805  . ? 1_555 ? 
68  AC7 20 BCB T  .   ? BCB M 806  . ? 1_555 ? 
69  AC8 22 VAL B  157 ? VAL L 157  . ? 1_555 ? 
70  AC8 22 TYR B  162 ? TYR L 162  . ? 1_555 ? 
71  AC8 22 PHE B  181 ? PHE L 181  . ? 1_555 ? 
72  AC8 22 BCB I  .   ? BCB L 302  . ? 1_555 ? 
73  AC8 22 BCB J  .   ? BCB L 304  . ? 1_555 ? 
74  AC8 22 PHE C  148 ? PHE M 148  . ? 1_555 ? 
75  AC8 22 PHE C  154 ? PHE M 154  . ? 1_555 ? 
76  AC8 22 VAL C  155 ? VAL M 155  . ? 1_555 ? 
77  AC8 22 LEU C  184 ? LEU M 184  . ? 1_555 ? 
78  AC8 22 PHE C  187 ? PHE M 187  . ? 1_555 ? 
79  AC8 22 SER C  188 ? SER M 188  . ? 1_555 ? 
80  AC8 22 PHE C  194 ? PHE M 194  . ? 1_555 ? 
81  AC8 22 TYR C  195 ? TYR M 195  . ? 1_555 ? 
82  AC8 22 HIS C  200 ? HIS M 200  . ? 1_555 ? 
83  AC8 22 SER C  203 ? SER M 203  . ? 1_555 ? 
84  AC8 22 ILE C  204 ? ILE M 204  . ? 1_555 ? 
85  AC8 22 TYR C  208 ? TYR M 208  . ? 1_555 ? 
86  AC8 22 MET C  275 ? MET M 275  . ? 1_555 ? 
87  AC8 22 ALA C  278 ? ALA M 278  . ? 1_555 ? 
88  AC8 22 ILE C  282 ? ILE M 282  . ? 1_555 ? 
89  AC8 22 BPB U  .   ? BPB M 401  . ? 1_555 ? 
90  AC8 22 BCB S  .   ? BCB M 805  . ? 1_555 ? 
91  AC9 15 PHE B  128 ? PHE L 128  . ? 1_555 ? 
92  AC9 15 PHE B  146 ? PHE L 146  . ? 1_555 ? 
93  AC9 15 ILE B  150 ? ILE L 150  . ? 1_555 ? 
94  AC9 15 HIS B  153 ? HIS L 153  . ? 1_555 ? 
95  AC9 15 LEU B  154 ? LEU L 154  . ? 1_555 ? 
96  AC9 15 VAL B  157 ? VAL L 157  . ? 1_555 ? 
97  AC9 15 BCB I  .   ? BCB L 302  . ? 1_555 ? 
98  AC9 15 BPB K  .   ? BPB L 402  . ? 1_555 ? 
99  AC9 15 GLY C  201 ? GLY M 201  . ? 1_555 ? 
100 AC9 15 ILE C  204 ? ILE M 204  . ? 1_555 ? 
101 AC9 15 GLY C  205 ? GLY M 205  . ? 1_555 ? 
102 AC9 15 TYR C  208 ? TYR M 208  . ? 1_555 ? 
103 AC9 15 GLY C  209 ? GLY M 209  . ? 1_555 ? 
104 AC9 15 BCB T  .   ? BCB M 806  . ? 1_555 ? 
105 AC9 15 HOH EA .   ? HOH M 991  . ? 1_555 ? 
106 BC1 17 PHE B  181 ? PHE L 181  . ? 1_555 ? 
107 BC1 17 MET B  185 ? MET L 185  . ? 1_555 ? 
108 BC1 17 LEU B  189 ? LEU L 189  . ? 1_555 ? 
109 BC1 17 VAL B  220 ? VAL L 220  . ? 1_555 ? 
110 BC1 17 PHE C  59  ? PHE M 59   . ? 1_555 ? 
111 BC1 17 SER C  63  ? SER M 63   . ? 1_555 ? 
112 BC1 17 ILE C  66  ? ILE M 66   . ? 1_555 ? 
113 BC1 17 SER C  123 ? SER M 123  . ? 1_555 ? 
114 BC1 17 LEU C  124 ? LEU M 124  . ? 1_555 ? 
115 BC1 17 TRP C  127 ? TRP M 127  . ? 1_555 ? 
116 BC1 17 ILE C  144 ? ILE M 144  . ? 1_555 ? 
117 BC1 17 ASN C  147 ? ASN M 147  . ? 1_555 ? 
118 BC1 17 PHE C  148 ? PHE M 148  . ? 1_555 ? 
119 BC1 17 SER C  271 ? SER M 271  . ? 1_555 ? 
120 BC1 17 MET C  275 ? MET M 275  . ? 1_555 ? 
121 BC1 17 BCB S  .   ? BCB M 805  . ? 1_555 ? 
122 BC1 17 BCB T  .   ? BCB M 806  . ? 1_555 ? 
123 BC2 16 PHE B  97  ? PHE L 97   . ? 1_555 ? 
124 BC2 16 TRP B  100 ? TRP L 100  . ? 1_555 ? 
125 BC2 16 GLU B  104 ? GLU L 104  . ? 1_555 ? 
126 BC2 16 VAL B  117 ? VAL L 117  . ? 1_555 ? 
127 BC2 16 PHE B  121 ? PHE L 121  . ? 1_555 ? 
128 BC2 16 PRO B  124 ? PRO L 124  . ? 1_555 ? 
129 BC2 16 TYR B  148 ? TYR L 148  . ? 1_555 ? 
130 BC2 16 HIS B  153 ? HIS L 153  . ? 1_555 ? 
131 BC2 16 ALA B  237 ? ALA L 237  . ? 1_555 ? 
132 BC2 16 BCB I  .   ? BCB L 302  . ? 1_555 ? 
133 BC2 16 BCB J  .   ? BCB L 304  . ? 1_555 ? 
134 BC2 16 TYR C  208 ? TYR M 208  . ? 1_555 ? 
135 BC2 16 LEU C  212 ? LEU M 212  . ? 1_555 ? 
136 BC2 16 TRP C  250 ? TRP M 250  . ? 1_555 ? 
137 BC2 16 ILE C  254 ? ILE M 254  . ? 1_555 ? 
138 BC2 16 MQ7 V  .   ? MQ7 M 501  . ? 1_555 ? 
139 BC3 10 TYR B  29  ? TYR L 29   . ? 1_555 ? 
140 BC3 10 BPB K  .   ? BPB L 402  . ? 1_555 ? 
141 BC3 10 ALA C  216 ? ALA M 216  . ? 1_555 ? 
142 BC3 10 HIS C  217 ? HIS M 217  . ? 1_555 ? 
143 BC3 10 THR C  220 ? THR M 220  . ? 1_555 ? 
144 BC3 10 ALA C  246 ? ALA M 246  . ? 1_555 ? 
145 BC3 10 TRP C  250 ? TRP M 250  . ? 1_555 ? 
146 BC3 10 ALA C  258 ? ALA M 258  . ? 1_555 ? 
147 BC3 10 VAL C  263 ? VAL M 263  . ? 1_555 ? 
148 BC3 10 PHE C  270 ? PHE M 270  . ? 1_555 ? 
149 BC4 21 TYR A  56  ? TYR C 56   . ? 1_555 ? 
150 BC4 21 LYS A  57  ? LYS C 57   . ? 1_555 ? 
151 BC4 21 ASN A  58  ? ASN C 58   . ? 1_555 ? 
152 BC4 21 VAL A  59  ? VAL C 59   . ? 1_555 ? 
153 BC4 21 LYS A  60  ? LYS C 60   . ? 1_555 ? 
154 BC4 21 VAL A  61  ? VAL C 61   . ? 1_555 ? 
155 BC4 21 LEU A  62  ? LEU C 62   . ? 1_555 ? 
156 BC4 21 PHE A  70  ? PHE C 70   . ? 1_555 ? 
157 BC4 21 LEU A  71  ? LEU C 71   . ? 1_555 ? 
158 BC4 21 MET A  74  ? MET C 74   . ? 1_555 ? 
159 BC4 21 THR A  78  ? THR C 78   . ? 1_555 ? 
160 BC4 21 SER A  82  ? SER C 82   . ? 1_555 ? 
161 BC4 21 CYS A  87  ? CYS C 87   . ? 1_555 ? 
162 BC4 21 CYS A  90  ? CYS C 90   . ? 1_555 ? 
163 BC4 21 HIS A  91  ? HIS C 91   . ? 1_555 ? 
164 BC4 21 LEU A  96  ? LEU C 96   . ? 1_555 ? 
165 BC4 21 ALA A  97  ? ALA C 97   . ? 1_555 ? 
166 BC4 21 TYR A  104 ? TYR C 104  . ? 1_555 ? 
167 BC4 21 ALA A  107 ? ALA C 107  . ? 1_555 ? 
168 BC4 21 ARG A  108 ? ARG C 108  . ? 1_555 ? 
169 BC4 21 VAL A  212 ? VAL C 212  . ? 3_544 ? 
170 BC5 16 TYR A  89  ? TYR C 89   . ? 1_555 ? 
171 BC5 16 TYR A  102 ? TYR C 102  . ? 1_555 ? 
172 BC5 16 VAL A  106 ? VAL C 106  . ? 1_555 ? 
173 BC5 16 MET A  110 ? MET C 110  . ? 1_555 ? 
174 BC5 16 LEU A  111 ? LEU C 111  . ? 1_555 ? 
175 BC5 16 MET A  113 ? MET C 113  . ? 1_555 ? 
176 BC5 16 THR A  114 ? THR C 114  . ? 1_555 ? 
177 BC5 16 CYS A  132 ? CYS C 132  . ? 1_555 ? 
178 BC5 16 CYS A  135 ? CYS C 135  . ? 1_555 ? 
179 BC5 16 HIS A  136 ? HIS C 136  . ? 1_555 ? 
180 BC5 16 PRO A  140 ? PRO C 140  . ? 1_555 ? 
181 BC5 16 LEU A  141 ? LEU C 141  . ? 1_555 ? 
182 BC5 16 PRO A  142 ? PRO C 142  . ? 1_555 ? 
183 BC5 16 LEU A  289 ? LEU C 289  . ? 1_555 ? 
184 BC5 16 ARG A  293 ? ARG C 293  . ? 1_555 ? 
185 BC5 16 PRO A  301 ? PRO C 301  . ? 1_555 ? 
186 BC6 20 VAL A  201 ? VAL C 201  . ? 1_555 ? 
187 BC6 20 ARG A  202 ? ARG C 202  . ? 1_555 ? 
188 BC6 20 VAL A  203 ? VAL C 203  . ? 1_555 ? 
189 BC6 20 VAL A  204 ? VAL C 204  . ? 1_555 ? 
190 BC6 20 MET A  233 ? MET C 233  . ? 1_555 ? 
191 BC6 20 SER A  237 ? SER C 237  . ? 1_555 ? 
192 BC6 20 LEU A  240 ? LEU C 240  . ? 1_555 ? 
193 BC6 20 ASN A  243 ? ASN C 243  . ? 1_555 ? 
194 BC6 20 CYS A  244 ? CYS C 244  . ? 1_555 ? 
195 BC6 20 CYS A  247 ? CYS C 247  . ? 1_555 ? 
196 BC6 20 HIS A  248 ? HIS C 248  . ? 1_555 ? 
197 BC6 20 PHE A  253 ? PHE C 253  . ? 1_555 ? 
198 BC6 20 GLU A  254 ? GLU C 254  . ? 1_555 ? 
199 BC6 20 ARG A  264 ? ARG C 264  . ? 1_555 ? 
200 BC6 20 ALA A  267 ? ALA C 267  . ? 1_555 ? 
201 BC6 20 TRP A  268 ? TRP C 268  . ? 1_555 ? 
202 BC6 20 ARG A  272 ? ARG C 272  . ? 1_555 ? 
203 BC6 20 HOH CA .   ? HOH C 938  . ? 1_555 ? 
204 BC6 20 HOH CA .   ? HOH C 940  . ? 1_555 ? 
205 BC6 20 HOH CA .   ? HOH C 973  . ? 1_555 ? 
206 BC7 21 HIS A  124 ? HIS C 124  . ? 1_555 ? 
207 BC7 21 THR A  128 ? THR C 128  . ? 1_555 ? 
208 BC7 21 GLY A  129 ? GLY C 129  . ? 1_555 ? 
209 BC7 21 VAL A  130 ? VAL C 130  . ? 1_555 ? 
210 BC7 21 ILE A  236 ? ILE C 236  . ? 1_555 ? 
211 BC7 21 GLN A  263 ? GLN C 263  . ? 1_555 ? 
212 BC7 21 ILE A  266 ? ILE C 266  . ? 1_555 ? 
213 BC7 21 GLY A  270 ? GLY C 270  . ? 1_555 ? 
214 BC7 21 ILE A  271 ? ILE C 271  . ? 1_555 ? 
215 BC7 21 MET A  273 ? MET C 273  . ? 1_555 ? 
216 BC7 21 VAL A  274 ? VAL C 274  . ? 1_555 ? 
217 BC7 21 ASP A  304 ? ASP C 304  . ? 1_555 ? 
218 BC7 21 CYS A  305 ? CYS C 305  . ? 1_555 ? 
219 BC7 21 CYS A  308 ? CYS C 308  . ? 1_555 ? 
220 BC7 21 HIS A  309 ? HIS C 309  . ? 1_555 ? 
221 BC7 21 THR A  313 ? THR C 313  . ? 1_555 ? 
222 BC7 21 LYS A  314 ? LYS C 314  . ? 1_555 ? 
223 BC7 21 PRO A  315 ? PRO C 315  . ? 1_555 ? 
224 BC7 21 HOH CA .   ? HOH C 967  . ? 1_555 ? 
225 BC7 21 HOH CA .   ? HOH C 1203 . ? 1_555 ? 
226 BC7 21 HOH CA .   ? HOH C 1235 . ? 1_555 ? 
227 BC8 8  GLY C  117 ? GLY M 117  . ? 1_555 ? 
228 BC8 8  THR C  121 ? THR M 121  . ? 1_555 ? 
229 BC8 8  GLY C  159 ? GLY M 159  . ? 1_555 ? 
230 BC8 8  CYS C  160 ? CYS M 160  . ? 1_555 ? 
231 BC8 8  VAL C  173 ? VAL M 173  . ? 1_555 ? 
232 BC8 8  GLY C  176 ? GLY M 176  . ? 1_555 ? 
233 BC8 8  HIS C  180 ? HIS M 180  . ? 1_555 ? 
234 BC8 8  BCB S  .   ? BCB M 805  . ? 1_555 ? 
235 BC9 8  GLU B  212 ? GLU L 212  . ? 1_555 ? 
236 BC9 8  ASN B  213 ? ASN L 213  . ? 1_555 ? 
237 BC9 8  PHE B  216 ? PHE L 216  . ? 1_555 ? 
238 BC9 8  TYR B  222 ? TYR L 222  . ? 1_555 ? 
239 BC9 8  SER B  223 ? SER L 223  . ? 1_555 ? 
240 BC9 8  ILE B  224 ? ILE L 224  . ? 1_555 ? 
241 BC9 8  GLY B  225 ? GLY L 225  . ? 1_555 ? 
242 BC9 8  ALA B  226 ? ALA L 226  . ? 1_555 ? 
243 CC1 5  ARG D  33  ? ARG H 33   . ? 1_555 ? 
244 CC1 5  PRO D  54  ? PRO H 54   . ? 8_665 ? 
245 CC1 5  ASP D  56  ? ASP H 56   . ? 8_665 ? 
246 CC1 5  LDA N  .   ? LDA L 705  . ? 1_555 ? 
247 CC1 5  TRP C  266 ? TRP M 266  . ? 1_555 ? 
248 CC2 6  ASP B  60  ? ASP L 60   . ? 1_555 ? 
249 CC2 6  PHE B  62  ? PHE L 62   . ? 1_555 ? 
250 CC2 6  TYR C  195 ? TYR M 195  . ? 1_555 ? 
251 CC2 6  TRP C  295 ? TRP M 295  . ? 1_555 ? 
252 CC2 6  CYS C  296 ? CYS M 296  . ? 1_555 ? 
253 CC2 6  ALA C  301 ? ALA M 301  . ? 1_555 ? 
254 CC3 7  PRO D  42  ? PRO H 42   . ? 1_555 ? 
255 CC3 7  VAL D  59  ? VAL H 59   . ? 1_555 ? 
256 CC3 7  TYR D  60  ? TYR H 60   . ? 1_555 ? 
257 CC3 7  LEU D  62  ? LEU H 62   . ? 1_555 ? 
258 CC3 7  TYR D  64  ? TYR H 64   . ? 1_555 ? 
259 CC3 7  PRO D  65  ? PRO H 65   . ? 1_555 ? 
260 CC3 7  ARG D  80  ? ARG H 80   . ? 1_555 ? 
261 CC4 7  TRP C  23  ? TRP M 23   . ? 1_555 ? 
262 CC4 7  ALA C  53  ? ALA M 53   . ? 1_555 ? 
263 CC4 7  SER C  54  ? SER M 54   . ? 1_555 ? 
264 CC4 7  ALA C  57  ? ALA M 57   . ? 1_555 ? 
265 CC4 7  SER C  126 ? SER M 126  . ? 1_555 ? 
266 CC4 7  SER C  133 ? SER M 133  . ? 1_555 ? 
267 CC4 7  SO4 R  .   ? SO4 M 804  . ? 1_555 ? 
268 CC5 3  LDA AA .   ? LDA H 701  . ? 1_555 ? 
269 CC5 3  HOH FA .   ? HOH H 1060 . ? 1_555 ? 
270 CC5 3  PHE C  256 ? PHE M 256  . ? 1_555 ? 
271 CC6 3  PHE C  71  ? PHE M 71   . ? 1_555 ? 
272 CC6 3  ASN C  72  ? ASN M 72   . ? 1_555 ? 
273 CC6 3  TRP C  112 ? TRP M 112  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          5PRC 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5PRC 
_atom_sites.fract_transf_matrix[1][1]   0.004474 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.004474 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008803 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
FE 
MG 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . CYS A  1  1   ? 99.788  51.350  -4.487  1.00 82.20  ? 1    CYS C N   1 
ATOM   2     C  CA  . CYS A  1  1   ? 99.619  50.662  -3.175  1.00 81.01  ? 1    CYS C CA  1 
ATOM   3     C  C   . CYS A  1  1   ? 99.228  51.731  -2.146  1.00 78.46  ? 1    CYS C C   1 
ATOM   4     O  O   . CYS A  1  1   ? 100.106 52.466  -1.702  1.00 81.57  ? 1    CYS C O   1 
ATOM   5     C  CB  . CYS A  1  1   ? 100.957 49.994  -2.775  1.00 83.09  ? 1    CYS C CB  1 
ATOM   6     S  SG  . CYS A  1  1   ? 100.880 48.568  -1.646  1.00 87.90  ? 1    CYS C SG  1 
ATOM   7     N  N   . PHE A  1  2   ? 97.922  51.954  -1.933  1.00 73.40  ? 2    PHE C N   1 
ATOM   8     C  CA  . PHE A  1  2   ? 97.431  52.845  -0.857  1.00 68.48  ? 2    PHE C CA  1 
ATOM   9     C  C   . PHE A  1  2   ? 95.966  52.637  -0.492  1.00 64.26  ? 2    PHE C C   1 
ATOM   10    O  O   . PHE A  1  2   ? 95.208  52.066  -1.271  1.00 67.28  ? 2    PHE C O   1 
ATOM   11    C  CB  . PHE A  1  2   ? 97.655  54.325  -1.201  1.00 68.01  ? 2    PHE C CB  1 
ATOM   12    C  CG  . PHE A  1  2   ? 98.962  54.870  -0.682  1.00 68.77  ? 2    PHE C CG  1 
ATOM   13    C  CD1 . PHE A  1  2   ? 99.344  54.645  0.634   1.00 67.91  ? 2    PHE C CD1 1 
ATOM   14    C  CD2 . PHE A  1  2   ? 99.881  55.457  -1.546  1.00 69.95  ? 2    PHE C CD2 1 
ATOM   15    C  CE1 . PHE A  1  2   ? 100.622 54.981  1.074   1.00 69.40  ? 2    PHE C CE1 1 
ATOM   16    C  CE2 . PHE A  1  2   ? 101.168 55.793  -1.111  1.00 69.40  ? 2    PHE C CE2 1 
ATOM   17    C  CZ  . PHE A  1  2   ? 101.537 55.553  0.199   1.00 67.72  ? 2    PHE C CZ  1 
ATOM   18    N  N   . GLU A  1  3   ? 95.580  53.088  0.699   1.00 57.48  ? 3    GLU C N   1 
ATOM   19    C  CA  . GLU A  1  3   ? 94.208  52.952  1.184   1.00 51.40  ? 3    GLU C CA  1 
ATOM   20    C  C   . GLU A  1  3   ? 93.602  54.319  1.475   1.00 50.20  ? 3    GLU C C   1 
ATOM   21    O  O   . GLU A  1  3   ? 94.233  55.159  2.097   1.00 55.46  ? 3    GLU C O   1 
ATOM   22    C  CB  . GLU A  1  3   ? 94.181  52.129  2.463   1.00 45.59  ? 3    GLU C CB  1 
ATOM   23    C  CG  . GLU A  1  3   ? 94.970  50.845  2.401   1.00 43.09  ? 3    GLU C CG  1 
ATOM   24    C  CD  . GLU A  1  3   ? 94.832  50.031  3.678   1.00 44.65  ? 3    GLU C CD  1 
ATOM   25    O  OE1 . GLU A  1  3   ? 95.123  50.581  4.759   1.00 38.78  ? 3    GLU C OE1 1 
ATOM   26    O  OE2 . GLU A  1  3   ? 94.395  48.861  3.611   1.00 44.67  ? 3    GLU C OE2 1 
ATOM   27    N  N   . PRO A  1  4   ? 92.340  54.537  1.090   1.00 47.12  ? 4    PRO C N   1 
ATOM   28    C  CA  . PRO A  1  4   ? 91.755  55.882  1.146   1.00 44.77  ? 4    PRO C CA  1 
ATOM   29    C  C   . PRO A  1  4   ? 91.095  56.215  2.472   1.00 41.27  ? 4    PRO C C   1 
ATOM   30    O  O   . PRO A  1  4   ? 90.507  55.343  3.111   1.00 43.89  ? 4    PRO C O   1 
ATOM   31    C  CB  . PRO A  1  4   ? 90.736  55.869  0.013   1.00 46.11  ? 4    PRO C CB  1 
ATOM   32    C  CG  . PRO A  1  4   ? 90.329  54.457  -0.076  1.00 46.27  ? 4    PRO C CG  1 
ATOM   33    C  CD  . PRO A  1  4   ? 91.580  53.660  0.186   1.00 47.25  ? 4    PRO C CD  1 
ATOM   34    N  N   . PRO A  1  5   ? 91.107  57.503  2.859   1.00 39.59  ? 5    PRO C N   1 
ATOM   35    C  CA  . PRO A  1  5   ? 90.383  57.959  4.044   1.00 38.57  ? 5    PRO C CA  1 
ATOM   36    C  C   . PRO A  1  5   ? 88.930  57.572  3.935   1.00 40.09  ? 5    PRO C C   1 
ATOM   37    O  O   . PRO A  1  5   ? 88.416  57.351  2.836   1.00 43.90  ? 5    PRO C O   1 
ATOM   38    C  CB  . PRO A  1  5   ? 90.549  59.475  4.011   1.00 37.47  ? 5    PRO C CB  1 
ATOM   39    C  CG  . PRO A  1  5   ? 91.784  59.690  3.255   1.00 38.93  ? 5    PRO C CG  1 
ATOM   40    C  CD  . PRO A  1  5   ? 91.813  58.613  2.207   1.00 38.45  ? 5    PRO C CD  1 
ATOM   41    N  N   . PRO A  1  6   ? 88.238  57.514  5.070   1.00 37.54  ? 6    PRO C N   1 
ATOM   42    C  CA  . PRO A  1  6   ? 88.863  57.787  6.368   1.00 36.12  ? 6    PRO C CA  1 
ATOM   43    C  C   . PRO A  1  6   ? 89.408  56.518  7.006   1.00 35.37  ? 6    PRO C C   1 
ATOM   44    O  O   . PRO A  1  6   ? 89.239  55.416  6.468   1.00 38.74  ? 6    PRO C O   1 
ATOM   45    C  CB  . PRO A  1  6   ? 87.724  58.372  7.175   1.00 34.98  ? 6    PRO C CB  1 
ATOM   46    C  CG  . PRO A  1  6   ? 86.467  58.146  6.454   1.00 31.29  ? 6    PRO C CG  1 
ATOM   47    C  CD  . PRO A  1  6   ? 86.846  57.960  5.010   1.00 30.28  ? 6    PRO C CD  1 
ATOM   48    N  N   . ALA A  1  7   ? 90.190  56.706  8.060   1.00 30.73  ? 7    ALA C N   1 
ATOM   49    C  CA  . ALA A  1  7   ? 90.621  55.606  8.894   1.00 29.34  ? 7    ALA C CA  1 
ATOM   50    C  C   . ALA A  1  7   ? 89.813  55.648  10.176  1.00 29.36  ? 7    ALA C C   1 
ATOM   51    O  O   . ALA A  1  7   ? 89.280  56.688  10.561  1.00 29.93  ? 7    ALA C O   1 
ATOM   52    C  CB  . ALA A  1  7   ? 92.096  55.731  9.199   1.00 29.37  ? 7    ALA C CB  1 
ATOM   53    N  N   . THR A  1  8   ? 89.660  54.491  10.794  1.00 31.01  ? 8    THR C N   1 
ATOM   54    C  CA  . THR A  1  8   ? 88.966  54.379  12.059  1.00 30.80  ? 8    THR C CA  1 
ATOM   55    C  C   . THR A  1  8   ? 90.057  54.341  13.095  1.00 31.14  ? 8    THR C C   1 
ATOM   56    O  O   . THR A  1  8   ? 90.934  53.472  13.028  1.00 34.92  ? 8    THR C O   1 
ATOM   57    C  CB  . THR A  1  8   ? 88.207  53.059  12.129  1.00 34.28  ? 8    THR C CB  1 
ATOM   58    O  OG1 . THR A  1  8   ? 87.201  53.028  11.112  1.00 37.36  ? 8    THR C OG1 1 
ATOM   59    C  CG2 . THR A  1  8   ? 87.563  52.897  13.491  1.00 37.63  ? 8    THR C CG2 1 
ATOM   60    N  N   . THR A  1  9   ? 90.081  55.318  13.989  1.00 28.15  ? 9    THR C N   1 
ATOM   61    C  CA  . THR A  1  9   ? 91.113  55.334  15.014  1.00 25.56  ? 9    THR C CA  1 
ATOM   62    C  C   . THR A  1  9   ? 90.493  55.178  16.398  1.00 25.28  ? 9    THR C C   1 
ATOM   63    O  O   . THR A  1  9   ? 89.365  55.636  16.632  1.00 25.91  ? 9    THR C O   1 
ATOM   64    C  CB  . THR A  1  9   ? 91.965  56.635  14.953  1.00 24.12  ? 9    THR C CB  1 
ATOM   65    O  OG1 . THR A  1  9   ? 91.112  57.780  14.844  1.00 26.46  ? 9    THR C OG1 1 
ATOM   66    C  CG2 . THR A  1  9   ? 92.901  56.601  13.763  1.00 18.34  ? 9    THR C CG2 1 
ATOM   67    N  N   . THR A  1  10  ? 91.153  54.399  17.253  1.00 23.33  ? 10   THR C N   1 
ATOM   68    C  CA  . THR A  1  10  ? 90.798  54.340  18.668  1.00 21.53  ? 10   THR C CA  1 
ATOM   69    C  C   . THR A  1  10  ? 91.930  54.834  19.560  1.00 21.16  ? 10   THR C C   1 
ATOM   70    O  O   . THR A  1  10  ? 93.066  55.033  19.105  1.00 19.74  ? 10   THR C O   1 
ATOM   71    C  CB  . THR A  1  10  ? 90.420  52.911  19.113  1.00 21.99  ? 10   THR C CB  1 
ATOM   72    O  OG1 . THR A  1  10  ? 91.598  52.115  19.255  1.00 23.35  ? 10   THR C OG1 1 
ATOM   73    C  CG2 . THR A  1  10  ? 89.513  52.269  18.112  1.00 24.50  ? 10   THR C CG2 1 
ATOM   74    N  N   . GLN A  1  11  ? 91.618  55.010  20.837  1.00 22.21  ? 11   GLN C N   1 
ATOM   75    C  CA  . GLN A  1  11  ? 92.622  55.402  21.814  1.00 22.73  ? 11   GLN C CA  1 
ATOM   76    C  C   . GLN A  1  11  ? 92.771  54.330  22.891  1.00 21.94  ? 11   GLN C C   1 
ATOM   77    O  O   . GLN A  1  11  ? 91.776  53.860  23.451  1.00 24.44  ? 11   GLN C O   1 
ATOM   78    C  CB  . GLN A  1  11  ? 92.231  56.735  22.443  1.00 18.95  ? 11   GLN C CB  1 
ATOM   79    C  CG  . GLN A  1  11  ? 93.239  57.279  23.408  1.00 14.23  ? 11   GLN C CG  1 
ATOM   80    C  CD  . GLN A  1  11  ? 92.789  58.583  23.987  1.00 13.88  ? 11   GLN C CD  1 
ATOM   81    O  OE1 . GLN A  1  11  ? 91.955  59.286  23.399  1.00 18.87  ? 11   GLN C OE1 1 
ATOM   82    N  NE2 . GLN A  1  11  ? 93.337  58.936  25.136  1.00 11.38  ? 11   GLN C NE2 1 
ATOM   83    N  N   . THR A  1  12  ? 94.008  53.907  23.130  1.00 21.13  ? 12   THR C N   1 
ATOM   84    C  CA  . THR A  1  12  ? 94.303  52.819  24.058  1.00 18.49  ? 12   THR C CA  1 
ATOM   85    C  C   . THR A  1  12  ? 95.306  53.288  25.111  1.00 22.44  ? 12   THR C C   1 
ATOM   86    O  O   . THR A  1  12  ? 95.724  52.518  25.999  1.00 21.10  ? 12   THR C O   1 
ATOM   87    C  CB  . THR A  1  12  ? 94.919  51.616  23.328  1.00 18.88  ? 12   THR C CB  1 
ATOM   88    O  OG1 . THR A  1  12  ? 96.040  52.057  22.558  1.00 19.96  ? 12   THR C OG1 1 
ATOM   89    C  CG2 . THR A  1  12  ? 93.920  50.981  22.407  1.00 16.96  ? 12   THR C CG2 1 
ATOM   90    N  N   . GLY A  1  13  ? 95.699  54.552  24.998  1.00 19.88  ? 13   GLY C N   1 
ATOM   91    C  CA  . GLY A  1  13  ? 96.651  55.112  25.928  1.00 18.50  ? 13   GLY C CA  1 
ATOM   92    C  C   . GLY A  1  13  ? 96.258  56.529  26.259  1.00 19.91  ? 13   GLY C C   1 
ATOM   93    O  O   . GLY A  1  13  ? 95.376  57.113  25.630  1.00 15.80  ? 13   GLY C O   1 
ATOM   94    N  N   . PHE A  1  14  ? 96.881  57.065  27.293  1.00 21.76  ? 14   PHE C N   1 
ATOM   95    C  CA  . PHE A  1  14  ? 96.638  58.440  27.707  1.00 21.31  ? 14   PHE C CA  1 
ATOM   96    C  C   . PHE A  1  14  ? 96.841  59.390  26.520  1.00 21.68  ? 14   PHE C C   1 
ATOM   97    O  O   . PHE A  1  14  ? 97.639  59.106  25.636  1.00 25.95  ? 14   PHE C O   1 
ATOM   98    C  CB  . PHE A  1  14  ? 97.592  58.757  28.844  1.00 19.93  ? 14   PHE C CB  1 
ATOM   99    C  CG  . PHE A  1  14  ? 97.521  60.154  29.313  1.00 21.71  ? 14   PHE C CG  1 
ATOM   100   C  CD1 . PHE A  1  14  ? 96.459  60.573  30.109  1.00 22.84  ? 14   PHE C CD1 1 
ATOM   101   C  CD2 . PHE A  1  14  ? 98.543  61.051  29.007  1.00 19.06  ? 14   PHE C CD2 1 
ATOM   102   C  CE1 . PHE A  1  14  ? 96.413  61.876  30.602  1.00 21.27  ? 14   PHE C CE1 1 
ATOM   103   C  CE2 . PHE A  1  14  ? 98.512  62.346  29.484  1.00 23.12  ? 14   PHE C CE2 1 
ATOM   104   C  CZ  . PHE A  1  14  ? 97.436  62.766  30.290  1.00 19.77  ? 14   PHE C CZ  1 
ATOM   105   N  N   . ARG A  1  15  ? 95.956  60.372  26.383  1.00 23.65  ? 15   ARG C N   1 
ATOM   106   C  CA  . ARG A  1  15  ? 96.023  61.371  25.304  1.00 20.36  ? 15   ARG C CA  1 
ATOM   107   C  C   . ARG A  1  15  ? 97.435  61.931  25.040  1.00 20.68  ? 15   ARG C C   1 
ATOM   108   O  O   . ARG A  1  15  ? 98.152  62.307  25.968  1.00 23.22  ? 15   ARG C O   1 
ATOM   109   C  CB  . ARG A  1  15  ? 95.058  62.530  25.608  1.00 19.33  ? 15   ARG C CB  1 
ATOM   110   C  CG  . ARG A  1  15  ? 95.139  62.996  27.045  1.00 28.82  ? 15   ARG C CG  1 
ATOM   111   C  CD  . ARG A  1  15  ? 93.958  63.816  27.479  1.00 30.12  ? 15   ARG C CD  1 
ATOM   112   N  NE  . ARG A  1  15  ? 94.387  65.194  27.580  1.00 33.20  ? 15   ARG C NE  1 
ATOM   113   C  CZ  . ARG A  1  15  ? 95.077  65.677  28.594  1.00 27.54  ? 15   ARG C CZ  1 
ATOM   114   N  NH1 . ARG A  1  15  ? 94.996  65.105  29.773  1.00 31.25  ? 15   ARG C NH1 1 
ATOM   115   N  NH2 . ARG A  1  15  ? 95.683  66.835  28.475  1.00 31.88  ? 15   ARG C NH2 1 
ATOM   116   N  N   . GLY A  1  16  ? 97.825  61.996  23.767  1.00 22.42  ? 16   GLY C N   1 
ATOM   117   C  CA  . GLY A  1  16  ? 99.136  62.509  23.395  1.00 19.91  ? 16   GLY C CA  1 
ATOM   118   C  C   . GLY A  1  16  ? 100.260 61.489  23.300  1.00 21.69  ? 16   GLY C C   1 
ATOM   119   O  O   . GLY A  1  16  ? 101.420 61.868  23.151  1.00 26.20  ? 16   GLY C O   1 
ATOM   120   N  N   . LEU A  1  17  ? 99.952  60.210  23.484  1.00 19.70  ? 17   LEU C N   1 
ATOM   121   C  CA  . LEU A  1  17  ? 100.958 59.174  23.350  1.00 16.74  ? 17   LEU C CA  1 
ATOM   122   C  C   . LEU A  1  17  ? 100.820 58.448  22.036  1.00 17.77  ? 17   LEU C C   1 
ATOM   123   O  O   . LEU A  1  17  ? 101.593 57.553  21.742  1.00 21.70  ? 17   LEU C O   1 
ATOM   124   C  CB  . LEU A  1  17  ? 100.851 58.175  24.484  1.00 13.56  ? 17   LEU C CB  1 
ATOM   125   C  CG  . LEU A  1  17  ? 101.246 58.713  25.847  1.00 17.09  ? 17   LEU C CG  1 
ATOM   126   C  CD1 . LEU A  1  17  ? 101.085 57.612  26.891  1.00 16.32  ? 17   LEU C CD1 1 
ATOM   127   C  CD2 . LEU A  1  17  ? 102.683 59.162  25.796  1.00 19.73  ? 17   LEU C CD2 1 
ATOM   128   N  N   . SER A  1  18  ? 99.833  58.828  21.242  1.00 17.84  ? 18   SER C N   1 
ATOM   129   C  CA  . SER A  1  18  ? 99.588  58.175  19.964  1.00 18.90  ? 18   SER C CA  1 
ATOM   130   C  C   . SER A  1  18  ? 99.489  56.662  20.070  1.00 15.90  ? 18   SER C C   1 
ATOM   131   O  O   . SER A  1  18  ? 99.996  55.954  19.218  1.00 18.31  ? 18   SER C O   1 
ATOM   132   C  CB  . SER A  1  18  ? 100.673 58.535  18.957  1.00 19.45  ? 18   SER C CB  1 
ATOM   133   O  OG  . SER A  1  18  ? 100.197 58.313  17.641  1.00 20.05  ? 18   SER C OG  1 
ATOM   134   N  N   . MET A  1  19  ? 98.639  56.199  20.974  1.00 14.55  ? 19   MET C N   1 
ATOM   135   C  CA  . MET A  1  19  ? 98.403  54.782  21.165  1.00 13.66  ? 19   MET C CA  1 
ATOM   136   C  C   . MET A  1  19  ? 96.975  54.456  20.705  1.00 14.60  ? 19   MET C C   1 
ATOM   137   O  O   . MET A  1  19  ? 96.031  55.123  21.097  1.00 14.75  ? 19   MET C O   1 
ATOM   138   C  CB  . MET A  1  19  ? 98.550  54.440  22.654  1.00 14.10  ? 19   MET C CB  1 
ATOM   139   C  CG  . MET A  1  19  ? 99.980  54.418  23.204  1.00 12.63  ? 19   MET C CG  1 
ATOM   140   S  SD  . MET A  1  19  ? 100.020 54.078  24.950  1.00 19.96  ? 19   MET C SD  1 
ATOM   141   C  CE  . MET A  1  19  ? 99.467  52.371  24.977  1.00 15.52  ? 19   MET C CE  1 
ATOM   142   N  N   . GLY A  1  20  ? 96.815  53.459  19.847  1.00 16.56  ? 20   GLY C N   1 
ATOM   143   C  CA  . GLY A  1  20  ? 95.486  52.975  19.537  1.00 17.80  ? 20   GLY C CA  1 
ATOM   144   C  C   . GLY A  1  20  ? 95.464  52.216  18.239  1.00 20.58  ? 20   GLY C C   1 
ATOM   145   O  O   . GLY A  1  20  ? 96.496  52.108  17.578  1.00 22.29  ? 20   GLY C O   1 
ATOM   146   N  N   . GLU A  1  21  ? 94.270  51.814  17.808  1.00 22.39  ? 21   GLU C N   1 
ATOM   147   C  CA  . GLU A  1  21  ? 94.099  51.063  16.567  1.00 19.99  ? 21   GLU C CA  1 
ATOM   148   C  C   . GLU A  1  21  ? 93.907  52.009  15.420  1.00 22.66  ? 21   GLU C C   1 
ATOM   149   O  O   . GLU A  1  21  ? 93.369  53.109  15.582  1.00 20.56  ? 21   GLU C O   1 
ATOM   150   C  CB  . GLU A  1  21  ? 92.885  50.155  16.635  1.00 18.95  ? 21   GLU C CB  1 
ATOM   151   C  CG  . GLU A  1  21  ? 92.889  49.297  17.845  1.00 20.26  ? 21   GLU C CG  1 
ATOM   152   C  CD  . GLU A  1  21  ? 91.911  48.192  17.734  1.00 23.73  ? 21   GLU C CD  1 
ATOM   153   O  OE1 . GLU A  1  21  ? 92.145  47.291  16.902  1.00 22.44  ? 21   GLU C OE1 1 
ATOM   154   O  OE2 . GLU A  1  21  ? 90.907  48.223  18.473  1.00 21.39  ? 21   GLU C OE2 1 
ATOM   155   N  N   . VAL A  1  22  ? 94.402  51.587  14.268  1.00 22.65  ? 22   VAL C N   1 
ATOM   156   C  CA  . VAL A  1  22  ? 94.201  52.300  13.029  1.00 26.20  ? 22   VAL C CA  1 
ATOM   157   C  C   . VAL A  1  22  ? 93.606  51.295  12.029  1.00 30.37  ? 22   VAL C C   1 
ATOM   158   O  O   . VAL A  1  22  ? 94.292  50.344  11.616  1.00 34.64  ? 22   VAL C O   1 
ATOM   159   C  CB  . VAL A  1  22  ? 95.531  52.839  12.502  1.00 26.07  ? 22   VAL C CB  1 
ATOM   160   C  CG1 . VAL A  1  22  ? 95.287  53.571  11.219  1.00 28.70  ? 22   VAL C CG1 1 
ATOM   161   C  CG2 . VAL A  1  22  ? 96.182  53.765  13.535  1.00 26.23  ? 22   VAL C CG2 1 
ATOM   162   N  N   . LEU A  1  23  ? 92.312  51.450  11.738  1.00 26.08  ? 23   LEU C N   1 
ATOM   163   C  CA  . LEU A  1  23  ? 91.536  50.458  11.006  1.00 24.89  ? 23   LEU C CA  1 
ATOM   164   C  C   . LEU A  1  23  ? 91.080  51.068  9.713   1.00 27.11  ? 23   LEU C C   1 
ATOM   165   O  O   . LEU A  1  23  ? 90.546  52.172  9.698   1.00 27.85  ? 23   LEU C O   1 
ATOM   166   C  CB  . LEU A  1  23  ? 90.293  50.073  11.796  1.00 23.62  ? 23   LEU C CB  1 
ATOM   167   C  CG  . LEU A  1  23  ? 90.388  49.004  12.886  1.00 28.17  ? 23   LEU C CG  1 
ATOM   168   C  CD1 . LEU A  1  23  ? 91.709  48.233  12.840  1.00 25.70  ? 23   LEU C CD1 1 
ATOM   169   C  CD2 . LEU A  1  23  ? 90.203  49.675  14.216  1.00 32.45  ? 23   LEU C CD2 1 
ATOM   170   N  N   . HIS A  1  24  ? 91.170  50.305  8.639   1.00 28.32  ? 24   HIS C N   1 
ATOM   171   C  CA  . HIS A  1  24  ? 90.606  50.746  7.372   1.00 28.15  ? 24   HIS C CA  1 
ATOM   172   C  C   . HIS A  1  24  ? 89.190  50.205  7.311   1.00 28.88  ? 24   HIS C C   1 
ATOM   173   O  O   . HIS A  1  24  ? 88.969  49.000  7.428   1.00 29.21  ? 24   HIS C O   1 
ATOM   174   C  CB  . HIS A  1  24  ? 91.423  50.187  6.215   1.00 28.31  ? 24   HIS C CB  1 
ATOM   175   C  CG  . HIS A  1  24  ? 90.923  50.603  4.868   1.00 31.01  ? 24   HIS C CG  1 
ATOM   176   N  ND1 . HIS A  1  24  ? 90.558  51.899  4.579   1.00 33.52  ? 24   HIS C ND1 1 
ATOM   177   C  CD2 . HIS A  1  24  ? 90.758  49.900  3.721   1.00 30.19  ? 24   HIS C CD2 1 
ATOM   178   C  CE1 . HIS A  1  24  ? 90.185  51.976  3.313   1.00 34.27  ? 24   HIS C CE1 1 
ATOM   179   N  NE2 . HIS A  1  24  ? 90.304  50.779  2.769   1.00 26.73  ? 24   HIS C NE2 1 
ATOM   180   N  N   . PRO A  1  25  ? 88.201  51.084  7.171   1.00 29.01  ? 25   PRO C N   1 
ATOM   181   C  CA  . PRO A  1  25  ? 86.833  50.620  7.411   1.00 33.25  ? 25   PRO C CA  1 
ATOM   182   C  C   . PRO A  1  25  ? 86.385  49.450  6.512   1.00 33.10  ? 25   PRO C C   1 
ATOM   183   O  O   . PRO A  1  25  ? 85.841  48.450  6.989   1.00 38.56  ? 25   PRO C O   1 
ATOM   184   C  CB  . PRO A  1  25  ? 85.996  51.884  7.210   1.00 29.90  ? 25   PRO C CB  1 
ATOM   185   C  CG  . PRO A  1  25  ? 86.919  52.979  7.640   1.00 28.73  ? 25   PRO C CG  1 
ATOM   186   C  CD  . PRO A  1  25  ? 88.273  52.552  7.099   1.00 30.48  ? 25   PRO C CD  1 
ATOM   187   N  N   . ALA A  1  26  ? 86.785  49.482  5.254   1.00 32.54  ? 26   ALA C N   1 
ATOM   188   C  CA  . ALA A  1  26  ? 86.413  48.408  4.342   1.00 35.08  ? 26   ALA C CA  1 
ATOM   189   C  C   . ALA A  1  26  ? 86.966  47.024  4.728   1.00 35.28  ? 26   ALA C C   1 
ATOM   190   O  O   . ALA A  1  26  ? 86.288  46.000  4.560   1.00 39.74  ? 26   ALA C O   1 
ATOM   191   C  CB  . ALA A  1  26  ? 86.832  48.770  2.920   1.00 36.40  ? 26   ALA C CB  1 
ATOM   192   N  N   . THR A  1  27  ? 88.198  46.984  5.221   1.00 31.87  ? 27   THR C N   1 
ATOM   193   C  CA  . THR A  1  27  ? 88.803  45.716  5.584   1.00 25.82  ? 27   THR C CA  1 
ATOM   194   C  C   . THR A  1  27  ? 88.040  45.132  6.752   1.00 26.44  ? 27   THR C C   1 
ATOM   195   O  O   . THR A  1  27  ? 87.709  43.945  6.765   1.00 26.13  ? 27   THR C O   1 
ATOM   196   C  CB  . THR A  1  27  ? 90.240  45.907  5.995   1.00 23.77  ? 27   THR C CB  1 
ATOM   197   O  OG1 . THR A  1  27  ? 91.017  46.257  4.849   1.00 26.45  ? 27   THR C OG1 1 
ATOM   198   C  CG2 . THR A  1  27  ? 90.774  44.653  6.574   1.00 22.77  ? 27   THR C CG2 1 
ATOM   199   N  N   . VAL A  1  28  ? 87.697  45.995  7.701   1.00 25.98  ? 28   VAL C N   1 
ATOM   200   C  CA  . VAL A  1  28  ? 87.023  45.553  8.903   1.00 24.83  ? 28   VAL C CA  1 
ATOM   201   C  C   . VAL A  1  28  ? 85.703  44.956  8.485   1.00 24.89  ? 28   VAL C C   1 
ATOM   202   O  O   . VAL A  1  28  ? 85.382  43.845  8.859   1.00 28.02  ? 28   VAL C O   1 
ATOM   203   C  CB  . VAL A  1  28  ? 86.800  46.717  9.874   1.00 23.39  ? 28   VAL C CB  1 
ATOM   204   C  CG1 . VAL A  1  28  ? 85.868  46.307  10.961  1.00 24.04  ? 28   VAL C CG1 1 
ATOM   205   C  CG2 . VAL A  1  28  ? 88.122  47.133  10.501  1.00 24.40  ? 28   VAL C CG2 1 
ATOM   206   N  N   . LYS A  1  29  ? 85.102  45.560  7.475   1.00 30.38  ? 29   LYS C N   1 
ATOM   207   C  CA  . LYS A  1  29  ? 83.786  45.143  7.037   1.00 31.29  ? 29   LYS C CA  1 
ATOM   208   C  C   . LYS A  1  29  ? 83.859  43.792  6.382   1.00 29.31  ? 29   LYS C C   1 
ATOM   209   O  O   . LYS A  1  29  ? 83.027  42.926  6.623   1.00 32.87  ? 29   LYS C O   1 
ATOM   210   C  CB  . LYS A  1  29  ? 83.211  46.148  6.060   1.00 37.85  ? 29   LYS C CB  1 
ATOM   211   C  CG  . LYS A  1  29  ? 81.707  46.264  6.164   1.00 54.04  ? 29   LYS C CG  1 
ATOM   212   C  CD  . LYS A  1  29  ? 81.072  46.701  4.844   1.00 66.20  ? 29   LYS C CD  1 
ATOM   213   C  CE  . LYS A  1  29  ? 81.102  45.597  3.782   1.00 70.86  ? 29   LYS C CE  1 
ATOM   214   N  NZ  . LYS A  1  29  ? 82.395  45.506  3.024   1.00 79.44  ? 29   LYS C NZ  1 
ATOM   215   N  N   . ALA A  1  30  ? 84.895  43.591  5.587   1.00 26.09  ? 30   ALA C N   1 
ATOM   216   C  CA  . ALA A  1  30  ? 85.052  42.340  4.892   1.00 22.58  ? 30   ALA C CA  1 
ATOM   217   C  C   . ALA A  1  30  ? 85.373  41.209  5.867   1.00 28.14  ? 30   ALA C C   1 
ATOM   218   O  O   . ALA A  1  30  ? 84.969  40.066  5.653   1.00 34.02  ? 30   ALA C O   1 
ATOM   219   C  CB  . ALA A  1  30  ? 86.125  42.468  3.842   1.00 22.55  ? 30   ALA C CB  1 
ATOM   220   N  N   . LYS A  1  31  ? 86.048  41.502  6.969   1.00 26.19  ? 31   LYS C N   1 
ATOM   221   C  CA  . LYS A  1  31  ? 86.303  40.434  7.908   1.00 25.77  ? 31   LYS C CA  1 
ATOM   222   C  C   . LYS A  1  31  ? 85.030  40.185  8.680   1.00 28.08  ? 31   LYS C C   1 
ATOM   223   O  O   . LYS A  1  31  ? 84.673  39.038  8.933   1.00 29.15  ? 31   LYS C O   1 
ATOM   224   C  CB  . LYS A  1  31  ? 87.432  40.793  8.856   1.00 29.24  ? 31   LYS C CB  1 
ATOM   225   C  CG  . LYS A  1  31  ? 88.778  40.810  8.192   1.00 31.45  ? 31   LYS C CG  1 
ATOM   226   C  CD  . LYS A  1  31  ? 89.883  40.806  9.231   1.00 38.01  ? 31   LYS C CD  1 
ATOM   227   C  CE  . LYS A  1  31  ? 91.083  41.662  8.822   1.00 37.03  ? 31   LYS C CE  1 
ATOM   228   N  NZ  . LYS A  1  31  ? 91.110  42.930  9.638   1.00 42.52  ? 31   LYS C NZ  1 
ATOM   229   N  N   . LYS A  1  32  ? 84.291  41.254  8.953   1.00 27.27  ? 32   LYS C N   1 
ATOM   230   C  CA  . LYS A  1  32  ? 83.042  41.147  9.689   1.00 31.31  ? 32   LYS C CA  1 
ATOM   231   C  C   . LYS A  1  32  ? 82.108  40.206  8.948   1.00 35.17  ? 32   LYS C C   1 
ATOM   232   O  O   . LYS A  1  32  ? 81.519  39.310  9.545   1.00 36.60  ? 32   LYS C O   1 
ATOM   233   C  CB  . LYS A  1  32  ? 82.381  42.515  9.833   1.00 33.51  ? 32   LYS C CB  1 
ATOM   234   C  CG  . LYS A  1  32  ? 82.266  43.034  11.271  1.00 34.92  ? 32   LYS C CG  1 
ATOM   235   C  CD  . LYS A  1  32  ? 81.791  44.477  11.310  0.00 34.98  ? 32   LYS C CD  1 
ATOM   236   C  CE  . LYS A  1  32  ? 81.935  45.069  12.704  0.00 35.37  ? 32   LYS C CE  1 
ATOM   237   N  NZ  . LYS A  1  32  ? 81.164  44.309  13.729  0.00 35.52  ? 32   LYS C NZ  1 
ATOM   238   N  N   . GLU A  1  33  ? 82.158  40.272  7.625   1.00 37.24  ? 33   GLU C N   1 
ATOM   239   C  CA  . GLU A  1  33  ? 81.275  39.472  6.793   1.00 37.79  ? 33   GLU C CA  1 
ATOM   240   C  C   . GLU A  1  33  ? 81.679  38.014  6.720   1.00 35.01  ? 33   GLU C C   1 
ATOM   241   O  O   . GLU A  1  33  ? 80.828  37.126  6.745   1.00 38.67  ? 33   GLU C O   1 
ATOM   242   C  CB  . GLU A  1  33  ? 81.209  40.055  5.391   1.00 42.41  ? 33   GLU C CB  1 
ATOM   243   C  CG  . GLU A  1  33  ? 79.941  40.837  5.139   1.00 45.66  ? 33   GLU C CG  1 
ATOM   244   C  CD  . GLU A  1  33  ? 80.130  41.922  4.108   0.50 45.36  ? 33   GLU C CD  1 
ATOM   245   O  OE1 . GLU A  1  33  ? 80.840  41.685  3.102   0.50 43.45  ? 33   GLU C OE1 1 
ATOM   246   O  OE2 . GLU A  1  33  ? 79.567  43.017  4.319   0.50 44.64  ? 33   GLU C OE2 1 
ATOM   247   N  N   . ARG A  1  34  ? 82.969  37.766  6.556   1.00 32.35  ? 34   ARG C N   1 
ATOM   248   C  CA  . ARG A  1  34  ? 83.493  36.405  6.608   1.00 28.01  ? 34   ARG C CA  1 
ATOM   249   C  C   . ARG A  1  34  ? 83.164  35.764  7.958   1.00 25.89  ? 34   ARG C C   1 
ATOM   250   O  O   . ARG A  1  34  ? 82.697  34.638  8.014   1.00 29.59  ? 34   ARG C O   1 
ATOM   251   C  CB  . ARG A  1  34  ? 85.007  36.428  6.365   1.00 28.22  ? 34   ARG C CB  1 
ATOM   252   C  CG  . ARG A  1  34  ? 85.746  35.138  6.656   1.00 28.25  ? 34   ARG C CG  1 
ATOM   253   C  CD  . ARG A  1  34  ? 87.223  35.411  6.859   1.00 25.39  ? 34   ARG C CD  1 
ATOM   254   N  NE  . ARG A  1  34  ? 87.491  35.705  8.262   1.00 33.96  ? 34   ARG C NE  1 
ATOM   255   C  CZ  . ARG A  1  34  ? 88.548  36.371  8.716   1.00 34.08  ? 34   ARG C CZ  1 
ATOM   256   N  NH1 . ARG A  1  34  ? 89.605  36.556  7.934   1.00 32.32  ? 34   ARG C NH1 1 
ATOM   257   N  NH2 . ARG A  1  34  ? 88.592  36.736  9.998   1.00 35.74  ? 34   ARG C NH2 1 
ATOM   258   N  N   . ASP A  1  35  ? 83.290  36.515  9.040   1.00 26.64  ? 35   ASP C N   1 
ATOM   259   C  CA  . ASP A  1  35  ? 83.064  35.936  10.352  1.00 25.34  ? 35   ASP C CA  1 
ATOM   260   C  C   . ASP A  1  35  ? 81.574  35.756  10.623  1.00 27.08  ? 35   ASP C C   1 
ATOM   261   O  O   . ASP A  1  35  ? 81.167  34.883  11.392  1.00 28.39  ? 35   ASP C O   1 
ATOM   262   C  CB  . ASP A  1  35  ? 83.713  36.816  11.409  1.00 23.44  ? 35   ASP C CB  1 
ATOM   263   C  CG  . ASP A  1  35  ? 85.235  36.769  11.357  1.00 24.09  ? 35   ASP C CG  1 
ATOM   264   O  OD1 . ASP A  1  35  ? 85.793  36.031  10.523  1.00 20.81  ? 35   ASP C OD1 1 
ATOM   265   O  OD2 . ASP A  1  35  ? 85.879  37.390  12.226  1.00 23.02  ? 35   ASP C OD2 1 
ATOM   266   N  N   . ALA A  1  36  ? 80.761  36.469  9.854   1.00 29.09  ? 36   ALA C N   1 
ATOM   267   C  CA  . ALA A  1  36  ? 79.310  36.433  10.004  1.00 32.47  ? 36   ALA C CA  1 
ATOM   268   C  C   . ALA A  1  36  ? 78.725  35.093  9.600   1.00 36.55  ? 36   ALA C C   1 
ATOM   269   O  O   . ALA A  1  36  ? 77.564  34.798  9.881   1.00 40.89  ? 36   ALA C O   1 
ATOM   270   C  CB  . ALA A  1  36  ? 78.678  37.525  9.174   1.00 32.51  ? 36   ALA C CB  1 
ATOM   271   N  N   . GLN A  1  37  ? 79.531  34.284  8.932   1.00 37.08  ? 37   GLN C N   1 
ATOM   272   C  CA  . GLN A  1  37  ? 79.088  32.989  8.473   1.00 36.72  ? 37   GLN C CA  1 
ATOM   273   C  C   . GLN A  1  37  ? 79.000  31.942  9.590   1.00 34.72  ? 37   GLN C C   1 
ATOM   274   O  O   . GLN A  1  37  ? 78.558  30.823  9.345   1.00 38.00  ? 37   GLN C O   1 
ATOM   275   C  CB  . GLN A  1  37  ? 80.013  32.497  7.363   1.00 41.76  ? 37   GLN C CB  1 
ATOM   276   C  CG  . GLN A  1  37  ? 80.085  33.431  6.171   1.00 53.00  ? 37   GLN C CG  1 
ATOM   277   C  CD  . GLN A  1  37  ? 80.920  32.868  5.023   1.00 62.19  ? 37   GLN C CD  1 
ATOM   278   O  OE1 . GLN A  1  37  ? 80.431  32.751  3.896   1.00 70.93  ? 37   GLN C OE1 1 
ATOM   279   N  NE2 . GLN A  1  37  ? 82.176  32.507  5.303   1.00 60.52  ? 37   GLN C NE2 1 
ATOM   280   N  N   . TYR A  1  38  ? 79.431  32.290  10.799  1.00 29.52  ? 38   TYR C N   1 
ATOM   281   C  CA  . TYR A  1  38  ? 79.218  31.438  11.963  1.00 27.01  ? 38   TYR C CA  1 
ATOM   282   C  C   . TYR A  1  38  ? 77.748  31.018  11.962  1.00 28.99  ? 38   TYR C C   1 
ATOM   283   O  O   . TYR A  1  38  ? 76.854  31.857  12.129  1.00 31.04  ? 38   TYR C O   1 
ATOM   284   C  CB  . TYR A  1  38  ? 79.519  32.234  13.235  1.00 26.62  ? 38   TYR C CB  1 
ATOM   285   C  CG  . TYR A  1  38  ? 79.980  31.449  14.449  1.00 22.71  ? 38   TYR C CG  1 
ATOM   286   C  CD1 . TYR A  1  38  ? 79.926  30.061  14.491  1.00 23.35  ? 38   TYR C CD1 1 
ATOM   287   C  CD2 . TYR A  1  38  ? 80.472  32.114  15.573  1.00 25.00  ? 38   TYR C CD2 1 
ATOM   288   C  CE1 . TYR A  1  38  ? 80.364  29.356  15.630  1.00 21.07  ? 38   TYR C CE1 1 
ATOM   289   C  CE2 . TYR A  1  38  ? 80.901  31.420  16.706  1.00 25.07  ? 38   TYR C CE2 1 
ATOM   290   C  CZ  . TYR A  1  38  ? 80.843  30.048  16.722  1.00 17.31  ? 38   TYR C CZ  1 
ATOM   291   O  OH  . TYR A  1  38  ? 81.258  29.385  17.837  1.00 21.58  ? 38   TYR C OH  1 
ATOM   292   N  N   . PRO A  1  39  ? 77.473  29.737  11.647  1.00 26.73  ? 39   PRO C N   1 
ATOM   293   C  CA  . PRO A  1  39  ? 76.124  29.189  11.735  1.00 25.73  ? 39   PRO C CA  1 
ATOM   294   C  C   . PRO A  1  39  ? 75.537  29.473  13.086  1.00 27.34  ? 39   PRO C C   1 
ATOM   295   O  O   . PRO A  1  39  ? 76.221  29.435  14.107  1.00 31.55  ? 39   PRO C O   1 
ATOM   296   C  CB  . PRO A  1  39  ? 76.328  27.696  11.553  1.00 24.86  ? 39   PRO C CB  1 
ATOM   297   C  CG  . PRO A  1  39  ? 77.616  27.580  10.867  1.00 26.31  ? 39   PRO C CG  1 
ATOM   298   C  CD  . PRO A  1  39  ? 78.456  28.674  11.405  1.00 29.61  ? 39   PRO C CD  1 
ATOM   299   N  N   . PRO A  1  40  ? 74.260  29.795  13.104  1.00 29.36  ? 40   PRO C N   1 
ATOM   300   C  CA  . PRO A  1  40  ? 73.582  30.080  14.367  1.00 27.85  ? 40   PRO C CA  1 
ATOM   301   C  C   . PRO A  1  40  ? 73.407  28.809  15.134  1.00 27.05  ? 40   PRO C C   1 
ATOM   302   O  O   . PRO A  1  40  ? 73.549  27.721  14.586  1.00 27.52  ? 40   PRO C O   1 
ATOM   303   C  CB  . PRO A  1  40  ? 72.239  30.662  13.935  1.00 28.14  ? 40   PRO C CB  1 
ATOM   304   C  CG  . PRO A  1  40  ? 72.102  30.295  12.472  1.00 30.23  ? 40   PRO C CG  1 
ATOM   305   C  CD  . PRO A  1  40  ? 73.486  30.248  11.940  1.00 31.47  ? 40   PRO C CD  1 
ATOM   306   N  N   . ALA A  1  41  ? 73.125  28.954  16.415  1.00 26.18  ? 41   ALA C N   1 
ATOM   307   C  CA  . ALA A  1  41  ? 72.898  27.811  17.255  1.00 28.67  ? 41   ALA C CA  1 
ATOM   308   C  C   . ALA A  1  41  ? 71.665  27.077  16.755  1.00 31.96  ? 41   ALA C C   1 
ATOM   309   O  O   . ALA A  1  41  ? 70.680  27.697  16.333  1.00 33.85  ? 41   ALA C O   1 
ATOM   310   C  CB  . ALA A  1  41  ? 72.703  28.255  18.680  1.00 29.29  ? 41   ALA C CB  1 
ATOM   311   N  N   . LEU A  1  42  ? 71.795  25.760  16.656  1.00 31.80  ? 42   LEU C N   1 
ATOM   312   C  CA  . LEU A  1  42  ? 70.652  24.892  16.479  1.00 31.66  ? 42   LEU C CA  1 
ATOM   313   C  C   . LEU A  1  42  ? 69.668  25.156  17.603  1.00 37.03  ? 42   LEU C C   1 
ATOM   314   O  O   . LEU A  1  42  ? 70.047  25.280  18.773  1.00 37.12  ? 42   LEU C O   1 
ATOM   315   C  CB  . LEU A  1  42  ? 71.083  23.436  16.546  1.00 27.41  ? 42   LEU C CB  1 
ATOM   316   C  CG  . LEU A  1  42  ? 72.037  23.059  15.427  1.00 26.29  ? 42   LEU C CG  1 
ATOM   317   C  CD1 . LEU A  1  42  ? 72.627  21.690  15.693  1.00 21.91  ? 42   LEU C CD1 1 
ATOM   318   C  CD2 . LEU A  1  42  ? 71.285  23.112  14.113  1.00 18.28  ? 42   LEU C CD2 1 
ATOM   319   N  N   . ALA A  1  43  ? 68.397  25.224  17.237  1.00 41.84  ? 43   ALA C N   1 
ATOM   320   C  CA  . ALA A  1  43  ? 67.301  25.120  18.190  1.00 43.57  ? 43   ALA C CA  1 
ATOM   321   C  C   . ALA A  1  43  ? 67.620  24.175  19.344  1.00 45.06  ? 43   ALA C C   1 
ATOM   322   O  O   . ALA A  1  43  ? 68.147  23.070  19.143  1.00 42.69  ? 43   ALA C O   1 
ATOM   323   C  CB  . ALA A  1  43  ? 66.057  24.646  17.472  1.00 46.47  ? 43   ALA C CB  1 
ATOM   324   N  N   . ALA A  1  44  ? 67.189  24.575  20.534  1.00 49.04  ? 44   ALA C N   1 
ATOM   325   C  CA  . ALA A  1  44  ? 67.461  23.822  21.746  1.00 52.00  ? 44   ALA C CA  1 
ATOM   326   C  C   . ALA A  1  44  ? 66.480  22.668  21.838  1.00 54.79  ? 44   ALA C C   1 
ATOM   327   O  O   . ALA A  1  44  ? 65.315  22.811  21.465  1.00 56.92  ? 44   ALA C O   1 
ATOM   328   C  CB  . ALA A  1  44  ? 67.324  24.723  22.951  1.00 50.11  ? 44   ALA C CB  1 
ATOM   329   N  N   . VAL A  1  45  ? 66.966  21.511  22.270  1.00 56.65  ? 45   VAL C N   1 
ATOM   330   C  CA  . VAL A  1  45  ? 66.101  20.362  22.463  1.00 59.01  ? 45   VAL C CA  1 
ATOM   331   C  C   . VAL A  1  45  ? 65.918  20.101  23.949  1.00 66.30  ? 45   VAL C C   1 
ATOM   332   O  O   . VAL A  1  45  ? 66.806  20.410  24.761  1.00 68.56  ? 45   VAL C O   1 
ATOM   333   C  CB  . VAL A  1  45  ? 66.679  19.113  21.779  1.00 54.42  ? 45   VAL C CB  1 
ATOM   334   C  CG1 . VAL A  1  45  ? 66.816  19.370  20.295  1.00 53.55  ? 45   VAL C CG1 1 
ATOM   335   C  CG2 . VAL A  1  45  ? 68.022  18.742  22.384  1.00 50.87  ? 45   VAL C CG2 1 
ATOM   336   N  N   . LYS A  1  46  ? 64.731  19.627  24.319  1.00 71.72  ? 46   LYS C N   1 
ATOM   337   C  CA  . LYS A  1  46  ? 64.474  19.272  25.710  1.00 75.44  ? 46   LYS C CA  1 
ATOM   338   C  C   . LYS A  1  46  ? 65.095  17.914  25.998  1.00 74.35  ? 46   LYS C C   1 
ATOM   339   O  O   . LYS A  1  46  ? 65.087  17.013  25.150  1.00 73.28  ? 46   LYS C O   1 
ATOM   340   C  CB  . LYS A  1  46  ? 62.972  19.231  26.005  1.00 79.33  ? 46   LYS C CB  1 
ATOM   341   C  CG  . LYS A  1  46  ? 62.633  19.090  27.491  1.00 83.16  ? 46   LYS C CG  1 
ATOM   342   C  CD  . LYS A  1  46  ? 61.155  18.798  27.689  0.00 84.65  ? 46   LYS C CD  1 
ATOM   343   C  CE  . LYS A  1  46  ? 60.774  18.850  29.159  0.00 86.02  ? 46   LYS C CE  1 
ATOM   344   N  NZ  . LYS A  1  46  ? 60.690  20.250  29.659  0.00 87.00  ? 46   LYS C NZ  1 
ATOM   345   N  N   . ALA A  1  47  ? 65.621  17.770  27.204  1.00 73.66  ? 47   ALA C N   1 
ATOM   346   C  CA  . ALA A  1  47  ? 66.399  16.597  27.538  1.00 74.37  ? 47   ALA C CA  1 
ATOM   347   C  C   . ALA A  1  47  ? 65.529  15.499  28.126  1.00 74.23  ? 47   ALA C C   1 
ATOM   348   O  O   . ALA A  1  47  ? 65.686  15.117  29.286  1.00 76.73  ? 47   ALA C O   1 
ATOM   349   C  CB  . ALA A  1  47  ? 67.506  16.970  28.501  1.00 76.17  ? 47   ALA C CB  1 
ATOM   350   N  N   . GLU A  1  48  ? 64.567  15.029  27.343  1.00 72.36  ? 48   GLU C N   1 
ATOM   351   C  CA  . GLU A  1  48  ? 63.922  13.759  27.650  1.00 69.89  ? 48   GLU C CA  1 
ATOM   352   C  C   . GLU A  1  48  ? 65.001  12.704  27.381  1.00 69.96  ? 48   GLU C C   1 
ATOM   353   O  O   . GLU A  1  48  ? 65.840  12.898  26.493  1.00 73.82  ? 48   GLU C O   1 
ATOM   354   C  CB  . GLU A  1  48  ? 62.699  13.518  26.740  1.00 65.96  ? 48   GLU C CB  1 
ATOM   355   C  CG  . GLU A  1  48  ? 62.150  14.758  26.033  0.00 65.72  ? 48   GLU C CG  1 
ATOM   356   C  CD  . GLU A  1  48  ? 62.803  15.022  24.680  0.00 64.72  ? 48   GLU C CD  1 
ATOM   357   O  OE1 . GLU A  1  48  ? 63.781  14.328  24.324  0.00 64.33  ? 48   GLU C OE1 1 
ATOM   358   O  OE2 . GLU A  1  48  ? 62.344  15.946  23.977  0.00 64.33  ? 48   GLU C OE2 1 
ATOM   359   N  N   . GLY A  1  49  ? 65.106  11.697  28.244  1.00 67.74  ? 49   GLY C N   1 
ATOM   360   C  CA  . GLY A  1  49  ? 65.941  10.558  27.911  1.00 65.39  ? 49   GLY C CA  1 
ATOM   361   C  C   . GLY A  1  49  ? 66.889  10.089  29.009  1.00 65.63  ? 49   GLY C C   1 
ATOM   362   O  O   . GLY A  1  49  ? 66.984  10.716  30.069  1.00 66.26  ? 49   GLY C O   1 
ATOM   363   N  N   . PRO A  1  50  ? 67.481  8.902   28.754  1.00 66.24  ? 50   PRO C N   1 
ATOM   364   C  CA  . PRO A  1  50  ? 68.691  8.410   29.444  1.00 63.82  ? 50   PRO C CA  1 
ATOM   365   C  C   . PRO A  1  50  ? 69.930  9.103   28.869  1.00 60.45  ? 50   PRO C C   1 
ATOM   366   O  O   . PRO A  1  50  ? 69.925  9.563   27.720  1.00 62.47  ? 50   PRO C O   1 
ATOM   367   C  CB  . PRO A  1  50  ? 68.885  6.994   28.905  1.00 64.46  ? 50   PRO C CB  1 
ATOM   368   C  CG  . PRO A  1  50  ? 67.588  6.633   28.306  1.00 64.86  ? 50   PRO C CG  1 
ATOM   369   C  CD  . PRO A  1  50  ? 66.986  7.910   27.792  1.00 65.74  ? 50   PRO C CD  1 
ATOM   370   N  N   . PRO A  1  51  ? 71.023  9.130   29.646  1.00 54.75  ? 51   PRO C N   1 
ATOM   371   C  CA  . PRO A  1  51  ? 72.376  9.350   29.145  1.00 49.53  ? 51   PRO C CA  1 
ATOM   372   C  C   . PRO A  1  51  ? 72.655  8.446   27.984  1.00 44.37  ? 51   PRO C C   1 
ATOM   373   O  O   . PRO A  1  51  ? 72.364  7.254   28.027  1.00 44.20  ? 51   PRO C O   1 
ATOM   374   C  CB  . PRO A  1  51  ? 73.252  8.999   30.332  1.00 52.10  ? 51   PRO C CB  1 
ATOM   375   C  CG  . PRO A  1  51  ? 72.428  9.358   31.501  1.00 55.70  ? 51   PRO C CG  1 
ATOM   376   C  CD  . PRO A  1  51  ? 71.010  9.003   31.112  1.00 56.01  ? 51   PRO C CD  1 
ATOM   377   N  N   . VAL A  1  52  ? 73.208  9.025   26.933  1.00 42.35  ? 52   VAL C N   1 
ATOM   378   C  CA  . VAL A  1  52  ? 73.523  8.274   25.744  1.00 39.57  ? 52   VAL C CA  1 
ATOM   379   C  C   . VAL A  1  52  ? 74.598  7.264   26.105  1.00 43.28  ? 52   VAL C C   1 
ATOM   380   O  O   . VAL A  1  52  ? 74.863  6.338   25.349  1.00 44.19  ? 52   VAL C O   1 
ATOM   381   C  CB  . VAL A  1  52  ? 74.007  9.197   24.584  1.00 34.80  ? 52   VAL C CB  1 
ATOM   382   C  CG1 . VAL A  1  52  ? 72.902  10.172  24.189  1.00 28.70  ? 52   VAL C CG1 1 
ATOM   383   C  CG2 . VAL A  1  52  ? 75.284  9.929   24.971  1.00 32.00  ? 52   VAL C CG2 1 
ATOM   384   N  N   . SER A  1  53  ? 75.183  7.410   27.287  1.00 46.56  ? 53   SER C N   1 
ATOM   385   C  CA  . SER A  1  53  ? 76.115  6.403   27.799  1.00 53.71  ? 53   SER C CA  1 
ATOM   386   C  C   . SER A  1  53  ? 75.422  5.048   27.946  1.00 55.98  ? 53   SER C C   1 
ATOM   387   O  O   . SER A  1  53  ? 76.039  3.991   27.768  1.00 57.50  ? 53   SER C O   1 
ATOM   388   C  CB  . SER A  1  53  ? 76.657  6.841   29.152  1.00 53.93  ? 53   SER C CB  1 
ATOM   389   O  OG  . SER A  1  53  ? 75.676  7.596   29.842  1.00 56.82  ? 53   SER C OG  1 
ATOM   390   N  N   . GLN A  1  54  ? 74.176  5.106   28.410  1.00 57.00  ? 54   GLN C N   1 
ATOM   391   C  CA  . GLN A  1  54  ? 73.289  3.953   28.428  1.00 56.70  ? 54   GLN C CA  1 
ATOM   392   C  C   . GLN A  1  54  ? 72.895  3.616   26.984  1.00 56.43  ? 54   GLN C C   1 
ATOM   393   O  O   . GLN A  1  54  ? 73.379  2.628   26.425  1.00 59.73  ? 54   GLN C O   1 
ATOM   394   C  CB  . GLN A  1  54  ? 72.041  4.262   29.283  1.00 57.41  ? 54   GLN C CB  1 
ATOM   395   C  CG  . GLN A  1  54  ? 72.279  4.258   30.808  1.00 53.45  ? 54   GLN C CG  1 
ATOM   396   C  CD  . GLN A  1  54  ? 71.232  5.045   31.566  0.00 53.45  ? 54   GLN C CD  1 
ATOM   397   O  OE1 . GLN A  1  54  ? 71.529  6.072   32.170  0.00 52.71  ? 54   GLN C OE1 1 
ATOM   398   N  NE2 . GLN A  1  54  ? 69.997  4.570   31.534  0.00 52.71  ? 54   GLN C NE2 1 
ATOM   399   N  N   . VAL A  1  55  ? 72.182  4.540   26.340  1.00 53.40  ? 55   VAL C N   1 
ATOM   400   C  CA  . VAL A  1  55  ? 71.661  4.350   24.987  1.00 50.18  ? 55   VAL C CA  1 
ATOM   401   C  C   . VAL A  1  55  ? 72.690  3.875   23.950  1.00 51.37  ? 55   VAL C C   1 
ATOM   402   O  O   . VAL A  1  55  ? 72.480  2.861   23.289  1.00 55.93  ? 55   VAL C O   1 
ATOM   403   C  CB  . VAL A  1  55  ? 71.017  5.643   24.461  1.00 48.25  ? 55   VAL C CB  1 
ATOM   404   C  CG1 . VAL A  1  55  ? 70.329  5.384   23.151  1.00 48.86  ? 55   VAL C CG1 1 
ATOM   405   C  CG2 . VAL A  1  55  ? 70.033  6.178   25.461  1.00 47.28  ? 55   VAL C CG2 1 
ATOM   406   N  N   . TYR A  1  56  ? 73.707  4.688   23.688  1.00 51.90  ? 56   TYR C N   1 
ATOM   407   C  CA  . TYR A  1  56  ? 74.706  4.369   22.666  1.00 51.01  ? 56   TYR C CA  1 
ATOM   408   C  C   . TYR A  1  56  ? 75.859  3.553   23.240  1.00 50.04  ? 56   TYR C C   1 
ATOM   409   O  O   . TYR A  1  56  ? 75.993  3.411   24.454  1.00 49.19  ? 56   TYR C O   1 
ATOM   410   C  CB  . TYR A  1  56  ? 75.255  5.653   22.018  1.00 53.89  ? 56   TYR C CB  1 
ATOM   411   C  CG  . TYR A  1  56  ? 74.225  6.519   21.298  1.00 55.13  ? 56   TYR C CG  1 
ATOM   412   C  CD1 . TYR A  1  56  ? 73.699  6.137   20.068  1.00 55.78  ? 56   TYR C CD1 1 
ATOM   413   C  CD2 . TYR A  1  56  ? 73.764  7.708   21.862  1.00 54.90  ? 56   TYR C CD2 1 
ATOM   414   C  CE1 . TYR A  1  56  ? 72.731  6.917   19.422  1.00 56.56  ? 56   TYR C CE1 1 
ATOM   415   C  CE2 . TYR A  1  56  ? 72.795  8.487   21.230  1.00 55.10  ? 56   TYR C CE2 1 
ATOM   416   C  CZ  . TYR A  1  56  ? 72.281  8.085   20.012  1.00 54.29  ? 56   TYR C CZ  1 
ATOM   417   O  OH  . TYR A  1  56  ? 71.297  8.825   19.392  1.00 51.72  ? 56   TYR C OH  1 
ATOM   418   N  N   . LYS A  1  57  ? 76.784  3.176   22.367  1.00 52.08  ? 57   LYS C N   1 
ATOM   419   C  CA  . LYS A  1  57  ? 77.837  2.228   22.714  1.00 55.61  ? 57   LYS C CA  1 
ATOM   420   C  C   . LYS A  1  57  ? 79.191  2.878   23.024  1.00 57.97  ? 57   LYS C C   1 
ATOM   421   O  O   . LYS A  1  57  ? 79.735  2.707   24.113  1.00 62.07  ? 57   LYS C O   1 
ATOM   422   C  CB  . LYS A  1  57  ? 78.019  1.215   21.579  1.00 56.54  ? 57   LYS C CB  1 
ATOM   423   C  CG  . LYS A  1  57  ? 76.769  0.407   21.221  1.00 60.31  ? 57   LYS C CG  1 
ATOM   424   C  CD  . LYS A  1  57  ? 77.049  -0.584  20.103  0.00 59.47  ? 57   LYS C CD  1 
ATOM   425   C  CE  . LYS A  1  57  ? 78.130  -1.578  20.498  0.00 59.97  ? 57   LYS C CE  1 
ATOM   426   N  NZ  . LYS A  1  57  ? 78.439  -2.520  19.391  0.00 59.99  ? 57   LYS C NZ  1 
ATOM   427   N  N   . ASN A  1  58  ? 79.738  3.602   22.051  1.00 57.38  ? 58   ASN C N   1 
ATOM   428   C  CA  . ASN A  1  58  ? 81.144  4.006   22.052  1.00 53.13  ? 58   ASN C CA  1 
ATOM   429   C  C   . ASN A  1  58  ? 81.236  5.503   22.322  1.00 54.20  ? 58   ASN C C   1 
ATOM   430   O  O   . ASN A  1  58  ? 81.868  6.244   21.562  1.00 54.99  ? 58   ASN C O   1 
ATOM   431   C  CB  . ASN A  1  58  ? 81.759  3.679   20.685  1.00 49.30  ? 58   ASN C CB  1 
ATOM   432   C  CG  . ASN A  1  58  ? 83.247  3.885   20.645  1.00 47.06  ? 58   ASN C CG  1 
ATOM   433   O  OD1 . ASN A  1  58  ? 83.942  3.630   21.622  1.00 49.65  ? 58   ASN C OD1 1 
ATOM   434   N  ND2 . ASN A  1  58  ? 83.756  4.281   19.493  1.00 40.57  ? 58   ASN C ND2 1 
ATOM   435   N  N   . VAL A  1  59  ? 80.519  5.957   23.347  1.00 51.98  ? 59   VAL C N   1 
ATOM   436   C  CA  . VAL A  1  59  ? 80.440  7.379   23.637  1.00 52.09  ? 59   VAL C CA  1 
ATOM   437   C  C   . VAL A  1  59  ? 81.153  7.669   24.928  1.00 54.18  ? 59   VAL C C   1 
ATOM   438   O  O   . VAL A  1  59  ? 80.618  7.428   26.017  1.00 52.90  ? 59   VAL C O   1 
ATOM   439   C  CB  . VAL A  1  59  ? 78.992  7.859   23.762  1.00 52.77  ? 59   VAL C CB  1 
ATOM   440   C  CG1 . VAL A  1  59  ? 78.954  9.294   24.257  1.00 51.51  ? 59   VAL C CG1 1 
ATOM   441   C  CG2 . VAL A  1  59  ? 78.303  7.760   22.426  1.00 54.66  ? 59   VAL C CG2 1 
ATOM   442   N  N   . LYS A  1  60  ? 82.300  8.325   24.798  1.00 56.91  ? 60   LYS C N   1 
ATOM   443   C  CA  . LYS A  1  60  ? 83.216  8.507   25.920  1.00 58.21  ? 60   LYS C CA  1 
ATOM   444   C  C   . LYS A  1  60  ? 83.131  9.890   26.561  1.00 58.61  ? 60   LYS C C   1 
ATOM   445   O  O   . LYS A  1  60  ? 83.094  10.018  27.790  1.00 60.62  ? 60   LYS C O   1 
ATOM   446   C  CB  . LYS A  1  60  ? 84.651  8.239   25.468  1.00 58.87  ? 60   LYS C CB  1 
ATOM   447   C  CG  . LYS A  1  60  ? 84.888  6.817   24.959  1.00 58.48  ? 60   LYS C CG  1 
ATOM   448   C  CD  . LYS A  1  60  ? 85.982  6.115   25.755  0.00 58.17  ? 60   LYS C CD  1 
ATOM   449   C  CE  . LYS A  1  60  ? 87.322  6.831   25.632  0.00 58.00  ? 60   LYS C CE  1 
ATOM   450   N  NZ  . LYS A  1  60  ? 87.658  7.617   26.853  0.00 57.86  ? 60   LYS C NZ  1 
ATOM   451   N  N   . VAL A  1  61  ? 83.087  10.925  25.732  1.00 55.96  ? 61   VAL C N   1 
ATOM   452   C  CA  . VAL A  1  61  ? 83.129  12.283  26.246  1.00 51.56  ? 61   VAL C CA  1 
ATOM   453   C  C   . VAL A  1  61  ? 81.725  12.783  26.566  1.00 49.62  ? 61   VAL C C   1 
ATOM   454   O  O   . VAL A  1  61  ? 81.420  13.091  27.713  1.00 50.77  ? 61   VAL C O   1 
ATOM   455   C  CB  . VAL A  1  61  ? 83.811  13.247  25.240  1.00 51.94  ? 61   VAL C CB  1 
ATOM   456   C  CG1 . VAL A  1  61  ? 84.148  14.564  25.924  1.00 51.72  ? 61   VAL C CG1 1 
ATOM   457   C  CG2 . VAL A  1  61  ? 85.070  12.610  24.656  1.00 49.56  ? 61   VAL C CG2 1 
ATOM   458   N  N   . LEU A  1  62  ? 80.840  12.751  25.576  1.00 48.63  ? 62   LEU C N   1 
ATOM   459   C  CA  . LEU A  1  62  ? 79.523  13.370  25.710  1.00 46.18  ? 62   LEU C CA  1 
ATOM   460   C  C   . LEU A  1  62  ? 78.517  12.386  26.295  1.00 47.18  ? 62   LEU C C   1 
ATOM   461   O  O   . LEU A  1  62  ? 77.304  12.600  26.204  1.00 46.47  ? 62   LEU C O   1 
ATOM   462   C  CB  . LEU A  1  62  ? 79.043  13.872  24.347  1.00 43.21  ? 62   LEU C CB  1 
ATOM   463   C  CG  . LEU A  1  62  ? 80.019  14.796  23.613  1.00 41.70  ? 62   LEU C CG  1 
ATOM   464   C  CD1 . LEU A  1  62  ? 79.491  15.068  22.243  1.00 40.67  ? 62   LEU C CD1 1 
ATOM   465   C  CD2 . LEU A  1  62  ? 80.229  16.096  24.386  1.00 40.72  ? 62   LEU C CD2 1 
ATOM   466   N  N   . GLY A  1  63  ? 79.036  11.378  26.999  1.00 46.40  ? 63   GLY C N   1 
ATOM   467   C  CA  . GLY A  1  63  ? 78.225  10.261  27.442  1.00 44.97  ? 63   GLY C CA  1 
ATOM   468   C  C   . GLY A  1  63  ? 77.019  10.652  28.269  1.00 43.67  ? 63   GLY C C   1 
ATOM   469   O  O   . GLY A  1  63  ? 75.992  9.973   28.234  1.00 46.12  ? 63   GLY C O   1 
ATOM   470   N  N   . ASN A  1  64  ? 77.129  11.767  28.982  1.00 45.44  ? 64   ASN C N   1 
ATOM   471   C  CA  . ASN A  1  64  ? 76.091  12.216  29.918  1.00 46.14  ? 64   ASN C CA  1 
ATOM   472   C  C   . ASN A  1  64  ? 74.899  12.915  29.233  1.00 44.87  ? 64   ASN C C   1 
ATOM   473   O  O   . ASN A  1  64  ? 73.900  13.258  29.875  1.00 46.41  ? 64   ASN C O   1 
ATOM   474   C  CB  . ASN A  1  64  ? 76.713  13.152  30.974  1.00 48.59  ? 64   ASN C CB  1 
ATOM   475   C  CG  . ASN A  1  64  ? 77.474  14.326  30.354  1.00 51.57  ? 64   ASN C CG  1 
ATOM   476   O  OD1 . ASN A  1  64  ? 77.480  14.509  29.137  0.00 50.12  ? 64   ASN C OD1 1 
ATOM   477   N  ND2 . ASN A  1  64  ? 78.148  15.100  31.192  0.00 50.12  ? 64   ASN C ND2 1 
ATOM   478   N  N   . LEU A  1  65  ? 75.028  13.169  27.941  1.00 42.24  ? 65   LEU C N   1 
ATOM   479   C  CA  . LEU A  1  65  ? 73.999  13.875  27.209  1.00 39.87  ? 65   LEU C CA  1 
ATOM   480   C  C   . LEU A  1  65  ? 72.813  12.960  26.971  1.00 40.39  ? 65   LEU C C   1 
ATOM   481   O  O   . LEU A  1  65  ? 72.980  11.763  26.722  1.00 38.34  ? 65   LEU C O   1 
ATOM   482   C  CB  . LEU A  1  65  ? 74.565  14.349  25.870  1.00 41.10  ? 65   LEU C CB  1 
ATOM   483   C  CG  . LEU A  1  65  ? 75.585  15.488  25.896  1.00 38.06  ? 65   LEU C CG  1 
ATOM   484   C  CD1 . LEU A  1  65  ? 75.861  15.975  24.480  1.00 36.66  ? 65   LEU C CD1 1 
ATOM   485   C  CD2 . LEU A  1  65  ? 75.030  16.618  26.731  1.00 39.60  ? 65   LEU C CD2 1 
ATOM   486   N  N   . THR A  1  66  ? 71.612  13.504  27.065  1.00 39.45  ? 66   THR C N   1 
ATOM   487   C  CA  . THR A  1  66  ? 70.468  12.759  26.582  1.00 43.28  ? 66   THR C CA  1 
ATOM   488   C  C   . THR A  1  66  ? 70.608  12.574  25.075  1.00 44.06  ? 66   THR C C   1 
ATOM   489   O  O   . THR A  1  66  ? 71.327  13.315  24.409  1.00 46.37  ? 66   THR C O   1 
ATOM   490   C  CB  . THR A  1  66  ? 69.157  13.477  26.877  1.00 42.07  ? 66   THR C CB  1 
ATOM   491   O  OG1 . THR A  1  66  ? 69.080  14.669  26.091  1.00 45.36  ? 66   THR C OG1 1 
ATOM   492   C  CG2 . THR A  1  66  ? 69.069  13.831  28.344  1.00 40.58  ? 66   THR C CG2 1 
ATOM   493   N  N   . GLU A  1  67  ? 69.922  11.576  24.548  1.00 45.82  ? 67   GLU C N   1 
ATOM   494   C  CA  . GLU A  1  67  ? 69.952  11.282  23.127  1.00 47.29  ? 67   GLU C CA  1 
ATOM   495   C  C   . GLU A  1  67  ? 69.734  12.497  22.221  1.00 45.10  ? 67   GLU C C   1 
ATOM   496   O  O   . GLU A  1  67  ? 70.518  12.738  21.313  1.00 46.54  ? 67   GLU C O   1 
ATOM   497   C  CB  . GLU A  1  67  ? 68.904  10.232  22.825  1.00 53.06  ? 67   GLU C CB  1 
ATOM   498   C  CG  . GLU A  1  67  ? 69.017  9.640   21.447  1.00 62.29  ? 67   GLU C CG  1 
ATOM   499   C  CD  . GLU A  1  67  ? 68.309  8.302   21.325  1.00 68.56  ? 67   GLU C CD  1 
ATOM   500   O  OE1 . GLU A  1  67  ? 67.648  7.873   22.312  1.00 74.44  ? 67   GLU C OE1 1 
ATOM   501   O  OE2 . GLU A  1  67  ? 68.430  7.679   20.241  1.00 71.44  ? 67   GLU C OE2 1 
ATOM   502   N  N   . ALA A  1  68  ? 68.663  13.247  22.452  1.00 42.62  ? 68   ALA C N   1 
ATOM   503   C  CA  . ALA A  1  68  ? 68.323  14.405  21.616  1.00 40.88  ? 68   ALA C CA  1 
ATOM   504   C  C   . ALA A  1  68  ? 69.385  15.496  21.665  1.00 38.28  ? 68   ALA C C   1 
ATOM   505   O  O   . ALA A  1  68  ? 69.710  16.109  20.648  1.00 36.04  ? 68   ALA C O   1 
ATOM   506   C  CB  . ALA A  1  68  ? 66.986  14.978  22.045  1.00 42.48  ? 68   ALA C CB  1 
ATOM   507   N  N   . GLU A  1  69  ? 69.845  15.797  22.873  1.00 35.69  ? 69   GLU C N   1 
ATOM   508   C  CA  . GLU A  1  69  ? 70.964  16.698  23.061  1.00 34.10  ? 69   GLU C CA  1 
ATOM   509   C  C   . GLU A  1  69  ? 72.171  16.241  22.252  1.00 32.86  ? 69   GLU C C   1 
ATOM   510   O  O   . GLU A  1  69  ? 72.751  17.029  21.517  1.00 37.47  ? 69   GLU C O   1 
ATOM   511   C  CB  . GLU A  1  69  ? 71.339  16.770  24.538  1.00 37.03  ? 69   GLU C CB  1 
ATOM   512   C  CG  . GLU A  1  69  ? 70.326  17.497  25.431  1.00 38.05  ? 69   GLU C CG  1 
ATOM   513   C  CD  . GLU A  1  69  ? 70.679  17.378  26.907  1.00 38.55  ? 69   GLU C CD  1 
ATOM   514   O  OE1 . GLU A  1  69  ? 70.849  16.241  27.386  1.00 42.22  ? 69   GLU C OE1 1 
ATOM   515   O  OE2 . GLU A  1  69  ? 70.843  18.413  27.585  1.00 43.52  ? 69   GLU C OE2 1 
ATOM   516   N  N   . PHE A  1  70  ? 72.500  14.958  22.328  1.00 30.03  ? 70   PHE C N   1 
ATOM   517   C  CA  . PHE A  1  70  ? 73.695  14.416  21.683  1.00 29.01  ? 70   PHE C CA  1 
ATOM   518   C  C   . PHE A  1  70  ? 73.693  14.578  20.160  1.00 31.78  ? 70   PHE C C   1 
ATOM   519   O  O   . PHE A  1  70  ? 74.705  14.972  19.565  1.00 30.87  ? 70   PHE C O   1 
ATOM   520   C  CB  . PHE A  1  70  ? 73.853  12.933  22.050  1.00 31.31  ? 70   PHE C CB  1 
ATOM   521   C  CG  . PHE A  1  70  ? 75.117  12.291  21.521  1.00 32.19  ? 70   PHE C CG  1 
ATOM   522   C  CD1 . PHE A  1  70  ? 75.157  11.748  20.245  1.00 32.06  ? 70   PHE C CD1 1 
ATOM   523   C  CD2 . PHE A  1  70  ? 76.245  12.168  22.331  1.00 31.95  ? 70   PHE C CD2 1 
ATOM   524   C  CE1 . PHE A  1  70  ? 76.295  11.094  19.791  1.00 31.76  ? 70   PHE C CE1 1 
ATOM   525   C  CE2 . PHE A  1  70  ? 77.385  11.513  21.874  1.00 30.85  ? 70   PHE C CE2 1 
ATOM   526   C  CZ  . PHE A  1  70  ? 77.406  10.976  20.605  1.00 27.71  ? 70   PHE C CZ  1 
ATOM   527   N  N   . LEU A  1  71  ? 72.576  14.240  19.518  1.00 33.64  ? 71   LEU C N   1 
ATOM   528   C  CA  . LEU A  1  71  ? 72.487  14.344  18.065  1.00 31.74  ? 71   LEU C CA  1 
ATOM   529   C  C   . LEU A  1  71  ? 72.466  15.808  17.630  1.00 33.15  ? 71   LEU C C   1 
ATOM   530   O  O   . LEU A  1  71  ? 72.992  16.160  16.580  1.00 36.29  ? 71   LEU C O   1 
ATOM   531   C  CB  . LEU A  1  71  ? 71.252  13.604  17.555  1.00 31.67  ? 71   LEU C CB  1 
ATOM   532   C  CG  . LEU A  1  71  ? 71.151  12.129  17.978  1.00 32.34  ? 71   LEU C CG  1 
ATOM   533   C  CD1 . LEU A  1  71  ? 69.844  11.536  17.492  1.00 28.64  ? 71   LEU C CD1 1 
ATOM   534   C  CD2 . LEU A  1  71  ? 72.339  11.353  17.441  1.00 29.87  ? 71   LEU C CD2 1 
ATOM   535   N  N   . ARG A  1  72  ? 71.998  16.681  18.510  1.00 30.62  ? 72   ARG C N   1 
ATOM   536   C  CA  . ARG A  1  72  ? 72.112  18.107  18.275  1.00 29.43  ? 72   ARG C CA  1 
ATOM   537   C  C   . ARG A  1  72  ? 73.573  18.519  18.160  1.00 28.95  ? 72   ARG C C   1 
ATOM   538   O  O   . ARG A  1  72  ? 73.950  19.243  17.237  1.00 28.38  ? 72   ARG C O   1 
ATOM   539   C  CB  . ARG A  1  72  ? 71.444  18.886  19.407  1.00 30.13  ? 72   ARG C CB  1 
ATOM   540   C  CG  . ARG A  1  72  ? 71.609  20.373  19.277  1.00 27.60  ? 72   ARG C CG  1 
ATOM   541   C  CD  . ARG A  1  72  ? 70.525  21.078  20.009  1.00 26.52  ? 72   ARG C CD  1 
ATOM   542   N  NE  . ARG A  1  72  ? 70.819  22.497  20.098  1.00 29.84  ? 72   ARG C NE  1 
ATOM   543   C  CZ  . ARG A  1  72  ? 71.656  23.022  20.978  1.00 27.65  ? 72   ARG C CZ  1 
ATOM   544   N  NH1 . ARG A  1  72  ? 72.348  22.224  21.774  1.00 33.16  ? 72   ARG C NH1 1 
ATOM   545   N  NH2 . ARG A  1  72  ? 71.774  24.339  21.083  1.00 26.32  ? 72   ARG C NH2 1 
ATOM   546   N  N   . THR A  1  73  ? 74.386  18.051  19.106  1.00 29.02  ? 73   THR C N   1 
ATOM   547   C  CA  . THR A  1  73  ? 75.825  18.270  19.084  1.00 26.32  ? 73   THR C CA  1 
ATOM   548   C  C   . THR A  1  73  ? 76.421  17.727  17.795  1.00 28.99  ? 73   THR C C   1 
ATOM   549   O  O   . THR A  1  73  ? 77.082  18.465  17.063  1.00 31.83  ? 73   THR C O   1 
ATOM   550   C  CB  . THR A  1  73  ? 76.526  17.582  20.270  1.00 26.36  ? 73   THR C CB  1 
ATOM   551   O  OG1 . THR A  1  73  ? 75.998  18.076  21.508  1.00 27.09  ? 73   THR C OG1 1 
ATOM   552   C  CG2 . THR A  1  73  ? 78.004  17.856  20.228  1.00 26.61  ? 73   THR C CG2 1 
ATOM   553   N  N   . MET A  1  74  ? 76.112  16.474  17.466  1.00 29.93  ? 74   MET C N   1 
ATOM   554   C  CA  . MET A  1  74  ? 76.664  15.844  16.265  1.00 27.11  ? 74   MET C CA  1 
ATOM   555   C  C   . MET A  1  74  ? 76.289  16.624  15.028  1.00 25.46  ? 74   MET C C   1 
ATOM   556   O  O   . MET A  1  74  ? 77.073  16.726  14.090  1.00 23.91  ? 74   MET C O   1 
ATOM   557   C  CB  . MET A  1  74  ? 76.167  14.412  16.135  1.00 28.74  ? 74   MET C CB  1 
ATOM   558   C  CG  . MET A  1  74  ? 76.818  13.492  17.127  1.00 28.40  ? 74   MET C CG  1 
ATOM   559   S  SD  . MET A  1  74  ? 78.485  13.125  16.639  1.00 31.56  ? 74   MET C SD  1 
ATOM   560   C  CE  . MET A  1  74  ? 79.250  13.319  18.245  1.00 23.15  ? 74   MET C CE  1 
ATOM   561   N  N   . THR A  1  75  ? 75.145  17.291  15.081  1.00 27.21  ? 75   THR C N   1 
ATOM   562   C  CA  . THR A  1  75  ? 74.720  18.121  13.962  1.00 28.38  ? 75   THR C CA  1 
ATOM   563   C  C   . THR A  1  75  ? 75.514  19.434  13.888  1.00 28.19  ? 75   THR C C   1 
ATOM   564   O  O   . THR A  1  75  ? 76.017  19.793  12.817  1.00 30.10  ? 75   THR C O   1 
ATOM   565   C  CB  . THR A  1  75  ? 73.187  18.410  13.998  1.00 30.09  ? 75   THR C CB  1 
ATOM   566   O  OG1 . THR A  1  75  ? 72.460  17.182  14.132  1.00 28.94  ? 75   THR C OG1 1 
ATOM   567   C  CG2 . THR A  1  75  ? 72.746  19.072  12.702  1.00 33.40  ? 75   THR C CG2 1 
ATOM   568   N  N   . ALA A  1  76  ? 75.717  20.087  15.033  1.00 25.86  ? 76   ALA C N   1 
ATOM   569   C  CA  . ALA A  1  76  ? 76.557  21.281  15.096  1.00 21.34  ? 76   ALA C CA  1 
ATOM   570   C  C   . ALA A  1  76  ? 77.987  20.948  14.670  1.00 22.95  ? 76   ALA C C   1 
ATOM   571   O  O   . ALA A  1  76  ? 78.545  21.595  13.779  1.00 26.82  ? 76   ALA C O   1 
ATOM   572   C  CB  . ALA A  1  76  ? 76.546  21.840  16.488  1.00 12.69  ? 76   ALA C CB  1 
ATOM   573   N  N   . ILE A  1  77  ? 78.546  19.888  15.242  1.00 21.27  ? 77   ILE C N   1 
ATOM   574   C  CA  . ILE A  1  77  ? 79.894  19.449  14.900  1.00 24.13  ? 77   ILE C CA  1 
ATOM   575   C  C   . ILE A  1  77  ? 80.009  19.291  13.392  1.00 27.02  ? 77   ILE C C   1 
ATOM   576   O  O   . ILE A  1  77  ? 80.939  19.805  12.772  1.00 28.11  ? 77   ILE C O   1 
ATOM   577   C  CB  . ILE A  1  77  ? 80.212  18.097  15.564  1.00 26.39  ? 77   ILE C CB  1 
ATOM   578   C  CG1 . ILE A  1  77  ? 80.445  18.299  17.057  1.00 29.84  ? 77   ILE C CG1 1 
ATOM   579   C  CG2 . ILE A  1  77  ? 81.409  17.417  14.890  1.00 28.30  ? 77   ILE C CG2 1 
ATOM   580   C  CD1 . ILE A  1  77  ? 80.941  17.056  17.739  1.00 34.68  ? 77   ILE C CD1 1 
ATOM   581   N  N   . THR A  1  78  ? 79.011  18.650  12.796  1.00 28.82  ? 78   THR C N   1 
ATOM   582   C  CA  . THR A  1  78  ? 79.041  18.354  11.371  1.00 28.64  ? 78   THR C CA  1 
ATOM   583   C  C   . THR A  1  78  ? 79.003  19.643  10.569  1.00 26.80  ? 78   THR C C   1 
ATOM   584   O  O   . THR A  1  78  ? 79.766  19.833  9.630   1.00 28.99  ? 78   THR C O   1 
ATOM   585   C  CB  . THR A  1  78  ? 77.851  17.463  10.970  1.00 26.75  ? 78   THR C CB  1 
ATOM   586   O  OG1 . THR A  1  78  ? 77.984  16.191  11.610  1.00 31.90  ? 78   THR C OG1 1 
ATOM   587   C  CG2 . THR A  1  78  ? 77.829  17.245  9.474   1.00 28.96  ? 78   THR C CG2 1 
ATOM   588   N  N   . GLU A  1  79  ? 78.233  20.586  11.070  1.00 25.53  ? 79   GLU C N   1 
ATOM   589   C  CA  . GLU A  1  79  ? 78.014  21.852  10.399  1.00 28.28  ? 79   GLU C CA  1 
ATOM   590   C  C   . GLU A  1  79  ? 79.241  22.781  10.526  1.00 27.84  ? 79   GLU C C   1 
ATOM   591   O  O   . GLU A  1  79  ? 79.462  23.673  9.690   1.00 28.43  ? 79   GLU C O   1 
ATOM   592   C  CB  . GLU A  1  79  ? 76.776  22.475  11.036  1.00 30.23  ? 79   GLU C CB  1 
ATOM   593   C  CG  . GLU A  1  79  ? 76.253  23.736  10.442  1.00 36.16  ? 79   GLU C CG  1 
ATOM   594   C  CD  . GLU A  1  79  ? 75.164  24.313  11.312  1.00 42.91  ? 79   GLU C CD  1 
ATOM   595   O  OE1 . GLU A  1  79  ? 75.348  24.370  12.553  1.00 46.46  ? 79   GLU C OE1 1 
ATOM   596   O  OE2 . GLU A  1  79  ? 74.110  24.674  10.762  1.00 48.90  ? 79   GLU C OE2 1 
ATOM   597   N  N   . TRP A  1  80  ? 80.036  22.568  11.572  1.00 24.97  ? 80   TRP C N   1 
ATOM   598   C  CA  . TRP A  1  80  ? 81.210  23.394  11.814  1.00 21.54  ? 80   TRP C CA  1 
ATOM   599   C  C   . TRP A  1  80  ? 82.446  22.893  11.102  1.00 22.90  ? 80   TRP C C   1 
ATOM   600   O  O   . TRP A  1  80  ? 83.300  23.692  10.727  1.00 27.71  ? 80   TRP C O   1 
ATOM   601   C  CB  . TRP A  1  80  ? 81.517  23.461  13.296  1.00 20.85  ? 80   TRP C CB  1 
ATOM   602   C  CG  . TRP A  1  80  ? 80.548  24.248  14.112  1.00 16.04  ? 80   TRP C CG  1 
ATOM   603   C  CD1 . TRP A  1  80  ? 79.806  25.335  13.714  1.00 19.18  ? 80   TRP C CD1 1 
ATOM   604   C  CD2 . TRP A  1  80  ? 80.225  24.018  15.476  1.00 10.90  ? 80   TRP C CD2 1 
ATOM   605   N  NE1 . TRP A  1  80  ? 79.027  25.784  14.763  1.00 15.43  ? 80   TRP C NE1 1 
ATOM   606   C  CE2 . TRP A  1  80  ? 79.267  24.991  15.854  1.00 14.51  ? 80   TRP C CE2 1 
ATOM   607   C  CE3 . TRP A  1  80  ? 80.636  23.070  16.420  1.00 16.03  ? 80   TRP C CE3 1 
ATOM   608   C  CZ2 . TRP A  1  80  ? 78.713  25.037  17.137  1.00 16.42  ? 80   TRP C CZ2 1 
ATOM   609   C  CZ3 . TRP A  1  80  ? 80.081  23.118  17.706  1.00 18.22  ? 80   TRP C CZ3 1 
ATOM   610   C  CH2 . TRP A  1  80  ? 79.132  24.095  18.048  1.00 19.39  ? 80   TRP C CH2 1 
ATOM   611   N  N   . VAL A  1  81  ? 82.607  21.575  11.042  1.00 22.65  ? 81   VAL C N   1 
ATOM   612   C  CA  . VAL A  1  81  ? 83.856  20.967  10.589  1.00 23.47  ? 81   VAL C CA  1 
ATOM   613   C  C   . VAL A  1  81  ? 83.764  20.360  9.204   1.00 24.99  ? 81   VAL C C   1 
ATOM   614   O  O   . VAL A  1  81  ? 84.602  20.641  8.341   1.00 26.23  ? 81   VAL C O   1 
ATOM   615   C  CB  . VAL A  1  81  ? 84.316  19.848  11.540  1.00 21.27  ? 81   VAL C CB  1 
ATOM   616   C  CG1 . VAL A  1  81  ? 85.596  19.226  11.031  1.00 18.52  ? 81   VAL C CG1 1 
ATOM   617   C  CG2 . VAL A  1  81  ? 84.494  20.389  12.938  1.00 23.52  ? 81   VAL C CG2 1 
ATOM   618   N  N   . SER A  1  82  ? 82.832  19.425  9.035   1.00 26.64  ? 82   SER C N   1 
ATOM   619   C  CA  . SER A  1  82  ? 82.710  18.685  7.780   1.00 30.66  ? 82   SER C CA  1 
ATOM   620   C  C   . SER A  1  82  ? 81.328  18.823  7.160   1.00 32.01  ? 82   SER C C   1 
ATOM   621   O  O   . SER A  1  82  ? 80.689  17.824  6.841   1.00 34.61  ? 82   SER C O   1 
ATOM   622   C  CB  . SER A  1  82  ? 82.990  17.208  8.008   1.00 31.86  ? 82   SER C CB  1 
ATOM   623   O  OG  . SER A  1  82  ? 81.981  16.653  8.832   1.00 31.36  ? 82   SER C OG  1 
ATOM   624   N  N   . PRO A  1  83  ? 80.892  20.059  6.885   1.00 33.38  ? 83   PRO C N   1 
ATOM   625   C  CA  . PRO A  1  83  ? 79.551  20.305  6.357   1.00 33.52  ? 83   PRO C CA  1 
ATOM   626   C  C   . PRO A  1  83  ? 79.344  19.763  4.957   1.00 35.18  ? 83   PRO C C   1 
ATOM   627   O  O   . PRO A  1  83  ? 78.258  19.314  4.618   1.00 36.80  ? 83   PRO C O   1 
ATOM   628   C  CB  . PRO A  1  83  ? 79.442  21.826  6.371   1.00 34.50  ? 83   PRO C CB  1 
ATOM   629   C  CG  . PRO A  1  83  ? 80.854  22.283  6.224   1.00 34.93  ? 83   PRO C CG  1 
ATOM   630   C  CD  . PRO A  1  83  ? 81.618  21.324  7.088   1.00 33.26  ? 83   PRO C CD  1 
ATOM   631   N  N   . GLN A  1  84  ? 80.346  19.907  4.102   1.00 36.05  ? 84   GLN C N   1 
ATOM   632   C  CA  . GLN A  1  84  ? 80.189  19.453  2.734   1.00 39.57  ? 84   GLN C CA  1 
ATOM   633   C  C   . GLN A  1  84  ? 80.234  17.933  2.660   1.00 38.20  ? 84   GLN C C   1 
ATOM   634   O  O   . GLN A  1  84  ? 79.570  17.330  1.834   1.00 42.16  ? 84   GLN C O   1 
ATOM   635   C  CB  . GLN A  1  84  ? 81.267  20.064  1.862   1.00 42.41  ? 84   GLN C CB  1 
ATOM   636   C  CG  . GLN A  1  84  ? 81.368  21.550  2.041   1.00 56.39  ? 84   GLN C CG  1 
ATOM   637   C  CD  . GLN A  1  84  ? 81.605  22.261  0.735   1.00 67.03  ? 84   GLN C CD  1 
ATOM   638   O  OE1 . GLN A  1  84  ? 80.769  22.199  -0.179  1.00 72.78  ? 84   GLN C OE1 1 
ATOM   639   N  NE2 . GLN A  1  84  ? 82.751  22.937  0.625   1.00 70.85  ? 84   GLN C NE2 1 
ATOM   640   N  N   . GLU A  1  85  ? 80.855  17.317  3.652   1.00 38.38  ? 85   GLU C N   1 
ATOM   641   C  CA  . GLU A  1  85  ? 81.077  15.883  3.637   1.00 37.42  ? 85   GLU C CA  1 
ATOM   642   C  C   . GLU A  1  85  ? 79.959  15.131  4.359   1.00 36.39  ? 85   GLU C C   1 
ATOM   643   O  O   . GLU A  1  85  ? 79.580  14.043  3.946   1.00 37.96  ? 85   GLU C O   1 
ATOM   644   C  CB  . GLU A  1  85  ? 82.438  15.581  4.267   1.00 44.91  ? 85   GLU C CB  1 
ATOM   645   C  CG  . GLU A  1  85  ? 83.653  16.168  3.493   1.00 51.67  ? 85   GLU C CG  1 
ATOM   646   C  CD  . GLU A  1  85  ? 83.937  17.661  3.766   1.00 55.37  ? 85   GLU C CD  1 
ATOM   647   O  OE1 . GLU A  1  85  ? 83.577  18.175  4.856   1.00 53.73  ? 85   GLU C OE1 1 
ATOM   648   O  OE2 . GLU A  1  85  ? 84.562  18.310  2.889   1.00 55.89  ? 85   GLU C OE2 1 
ATOM   649   N  N   . GLY A  1  86  ? 79.374  15.761  5.375   1.00 35.46  ? 86   GLY C N   1 
ATOM   650   C  CA  . GLY A  1  86  ? 78.268  15.162  6.097   1.00 29.91  ? 86   GLY C CA  1 
ATOM   651   C  C   . GLY A  1  86  ? 78.803  14.252  7.175   1.00 30.55  ? 86   GLY C C   1 
ATOM   652   O  O   . GLY A  1  86  ? 80.020  14.073  7.255   1.00 33.50  ? 86   GLY C O   1 
ATOM   653   N  N   . CYS A  1  87  ? 77.910  13.621  7.943   1.00 31.42  ? 87   CYS C N   1 
ATOM   654   C  CA  . CYS A  1  87  ? 78.280  12.764  9.079   1.00 31.35  ? 87   CYS C CA  1 
ATOM   655   C  C   . CYS A  1  87  ? 79.343  11.762  8.731   1.00 32.56  ? 87   CYS C C   1 
ATOM   656   O  O   . CYS A  1  87  ? 80.081  11.312  9.599   1.00 36.51  ? 87   CYS C O   1 
ATOM   657   C  CB  . CYS A  1  87  ? 77.099  11.957  9.576   1.00 30.04  ? 87   CYS C CB  1 
ATOM   658   S  SG  . CYS A  1  87  ? 75.618  12.903  9.955   1.00 30.19  ? 87   CYS C SG  1 
ATOM   659   N  N   . THR A  1  88  ? 79.280  11.273  7.503   1.00 34.24  ? 88   THR C N   1 
ATOM   660   C  CA  . THR A  1  88  ? 80.108  10.157  7.069   1.00 38.32  ? 88   THR C CA  1 
ATOM   661   C  C   . THR A  1  88  ? 81.594  10.442  7.049   1.00 35.55  ? 88   THR C C   1 
ATOM   662   O  O   . THR A  1  88  ? 82.389  9.528   6.930   1.00 39.40  ? 88   THR C O   1 
ATOM   663   C  CB  . THR A  1  88  ? 79.706  9.685   5.672   1.00 41.63  ? 88   THR C CB  1 
ATOM   664   O  OG1 . THR A  1  88  ? 79.019  10.741  4.978   1.00 44.37  ? 88   THR C OG1 1 
ATOM   665   C  CG2 . THR A  1  88  ? 78.816  8.480   5.787   1.00 42.54  ? 88   THR C CG2 1 
ATOM   666   N  N   . TYR A  1  89  ? 81.961  11.713  7.080   1.00 34.92  ? 89   TYR C N   1 
ATOM   667   C  CA  . TYR A  1  89  ? 83.360  12.100  7.149   1.00 31.71  ? 89   TYR C CA  1 
ATOM   668   C  C   . TYR A  1  89  ? 84.052  11.349  8.269   1.00 30.62  ? 89   TYR C C   1 
ATOM   669   O  O   . TYR A  1  89  ? 85.210  10.961  8.135   1.00 29.55  ? 89   TYR C O   1 
ATOM   670   C  CB  . TYR A  1  89  ? 83.469  13.593  7.422   1.00 34.52  ? 89   TYR C CB  1 
ATOM   671   C  CG  . TYR A  1  89  ? 84.842  14.101  7.156   1.00 33.06  ? 89   TYR C CG  1 
ATOM   672   C  CD1 . TYR A  1  89  ? 85.376  13.990  5.891   1.00 33.56  ? 89   TYR C CD1 1 
ATOM   673   C  CD2 . TYR A  1  89  ? 85.675  14.520  8.195   1.00 34.43  ? 89   TYR C CD2 1 
ATOM   674   C  CE1 . TYR A  1  89  ? 86.696  14.263  5.646   1.00 34.11  ? 89   TYR C CE1 1 
ATOM   675   C  CE2 . TYR A  1  89  ? 87.020  14.801  7.961   1.00 34.06  ? 89   TYR C CE2 1 
ATOM   676   C  CZ  . TYR A  1  89  ? 87.519  14.669  6.670   1.00 35.78  ? 89   TYR C CZ  1 
ATOM   677   O  OH  . TYR A  1  89  ? 88.814  14.997  6.335   1.00 40.36  ? 89   TYR C OH  1 
ATOM   678   N  N   . CYS A  1  90  ? 83.325  11.171  9.372   1.00 31.22  ? 90   CYS C N   1 
ATOM   679   C  CA  . CYS A  1  90  ? 83.842  10.569  10.602  1.00 33.52  ? 90   CYS C CA  1 
ATOM   680   C  C   . CYS A  1  90  ? 83.269  9.186   10.929  1.00 35.80  ? 90   CYS C C   1 
ATOM   681   O  O   . CYS A  1  90  ? 83.855  8.437   11.711  1.00 39.77  ? 90   CYS C O   1 
ATOM   682   C  CB  . CYS A  1  90  ? 83.566  11.497  11.790  1.00 32.83  ? 90   CYS C CB  1 
ATOM   683   S  SG  . CYS A  1  90  ? 84.219  13.196  11.628  1.00 36.82  ? 90   CYS C SG  1 
ATOM   684   N  N   . HIS A  1  91  ? 82.056  8.908   10.469  1.00 39.50  ? 91   HIS C N   1 
ATOM   685   C  CA  . HIS A  1  91  ? 81.364  7.701   10.897  1.00 41.40  ? 91   HIS C CA  1 
ATOM   686   C  C   . HIS A  1  91  ? 81.386  6.658   9.848   1.00 45.13  ? 91   HIS C C   1 
ATOM   687   O  O   . HIS A  1  91  ? 81.218  6.970   8.665   1.00 42.37  ? 91   HIS C O   1 
ATOM   688   C  CB  . HIS A  1  91  ? 79.923  7.997   11.206  1.00 37.10  ? 91   HIS C CB  1 
ATOM   689   C  CG  . HIS A  1  91  ? 79.739  8.617   12.536  1.00 36.43  ? 91   HIS C CG  1 
ATOM   690   N  ND1 . HIS A  1  91  ? 80.006  7.964   13.715  1.00 37.36  ? 91   HIS C ND1 1 
ATOM   691   C  CD2 . HIS A  1  91  ? 79.543  9.916   12.870  1.00 37.93  ? 91   HIS C CD2 1 
ATOM   692   C  CE1 . HIS A  1  91  ? 79.968  8.872   14.696  1.00 36.88  ? 91   HIS C CE1 1 
ATOM   693   N  NE2 . HIS A  1  91  ? 79.691  10.073  14.226  1.00 33.05  ? 91   HIS C NE2 1 
ATOM   694   N  N   . ASP A  1  92  ? 81.372  5.405   10.280  1.00 50.87  ? 92   ASP C N   1 
ATOM   695   C  CA  . ASP A  1  92  ? 81.092  4.379   9.303   1.00 54.94  ? 92   ASP C CA  1 
ATOM   696   C  C   . ASP A  1  92  ? 79.611  4.439   8.986   1.00 52.67  ? 92   ASP C C   1 
ATOM   697   O  O   . ASP A  1  92  ? 78.774  4.350   9.884   1.00 48.31  ? 92   ASP C O   1 
ATOM   698   C  CB  . ASP A  1  92  ? 81.466  2.979   9.778   1.00 60.73  ? 92   ASP C CB  1 
ATOM   699   C  CG  . ASP A  1  92  ? 81.257  1.939   8.685   1.00 65.20  ? 92   ASP C CG  1 
ATOM   700   O  OD1 . ASP A  1  92  ? 81.861  2.086   7.592   1.00 69.10  ? 92   ASP C OD1 1 
ATOM   701   O  OD2 . ASP A  1  92  ? 80.375  1.074   8.857   1.00 65.18  ? 92   ASP C OD2 1 
ATOM   702   N  N   . GLU A  1  93  ? 79.318  4.544   7.692   1.00 53.85  ? 93   GLU C N   1 
ATOM   703   C  CA  . GLU A  1  93  ? 77.971  4.738   7.173   1.00 54.45  ? 93   GLU C CA  1 
ATOM   704   C  C   . GLU A  1  93  ? 76.978  3.849   7.912   1.00 58.01  ? 93   GLU C C   1 
ATOM   705   O  O   . GLU A  1  93  ? 75.930  4.317   8.338   1.00 58.47  ? 93   GLU C O   1 
ATOM   706   C  CB  . GLU A  1  93  ? 77.959  4.433   5.666   1.00 51.64  ? 93   GLU C CB  1 
ATOM   707   C  CG  . GLU A  1  93  ? 76.759  4.972   4.903   1.00 50.46  ? 93   GLU C CG  1 
ATOM   708   C  CD  . GLU A  1  93  ? 76.597  4.334   3.537   0.00 50.68  ? 93   GLU C CD  1 
ATOM   709   O  OE1 . GLU A  1  93  ? 77.345  4.708   2.609   0.00 50.52  ? 93   GLU C OE1 1 
ATOM   710   O  OE2 . GLU A  1  93  ? 75.717  3.460   3.388   0.00 50.52  ? 93   GLU C OE2 1 
ATOM   711   N  N   . ASN A  1  94  ? 77.430  2.647   8.267   1.00 64.00  ? 94   ASN C N   1 
ATOM   712   C  CA  . ASN A  1  94  ? 76.551  1.591   8.787   1.00 67.40  ? 94   ASN C CA  1 
ATOM   713   C  C   . ASN A  1  94  ? 76.764  1.318   10.262  1.00 66.42  ? 94   ASN C C   1 
ATOM   714   O  O   . ASN A  1  94  ? 76.007  0.560   10.864  1.00 67.34  ? 94   ASN C O   1 
ATOM   715   C  CB  . ASN A  1  94  ? 76.762  0.276   8.015   1.00 70.99  ? 94   ASN C CB  1 
ATOM   716   C  CG  . ASN A  1  94  ? 76.163  0.310   6.618   1.00 71.67  ? 94   ASN C CG  1 
ATOM   717   O  OD1 . ASN A  1  94  ? 76.851  0.607   5.643   0.00 71.56  ? 94   ASN C OD1 1 
ATOM   718   N  ND2 . ASN A  1  94  ? 74.878  0.005   6.518   0.00 71.56  ? 94   ASN C ND2 1 
ATOM   719   N  N   . ASN A  1  95  ? 77.891  1.783   10.790  1.00 65.43  ? 95   ASN C N   1 
ATOM   720   C  CA  . ASN A  1  95  ? 78.179  1.623   12.204  1.00 63.18  ? 95   ASN C CA  1 
ATOM   721   C  C   . ASN A  1  95  ? 78.733  2.907   12.782  1.00 60.06  ? 95   ASN C C   1 
ATOM   722   O  O   . ASN A  1  95  ? 79.859  3.322   12.471  1.00 62.51  ? 95   ASN C O   1 
ATOM   723   C  CB  . ASN A  1  95  ? 79.165  0.481   12.438  1.00 66.48  ? 95   ASN C CB  1 
ATOM   724   C  CG  . ASN A  1  95  ? 79.252  0.080   13.906  1.00 68.84  ? 95   ASN C CG  1 
ATOM   725   O  OD1 . ASN A  1  95  ? 78.780  0.796   14.800  1.00 71.45  ? 95   ASN C OD1 1 
ATOM   726   N  ND2 . ASN A  1  95  ? 79.839  -1.078  14.159  1.00 70.84  ? 95   ASN C ND2 1 
ATOM   727   N  N   . LEU A  1  96  ? 77.977  3.479   13.707  1.00 54.39  ? 96   LEU C N   1 
ATOM   728   C  CA  . LEU A  1  96  ? 78.273  4.810   14.184  1.00 51.87  ? 96   LEU C CA  1 
ATOM   729   C  C   . LEU A  1  96  ? 79.175  4.814   15.402  1.00 50.37  ? 96   LEU C C   1 
ATOM   730   O  O   . LEU A  1  96  ? 79.869  5.793   15.652  1.00 52.05  ? 96   LEU C O   1 
ATOM   731   C  CB  . LEU A  1  96  ? 76.972  5.559   14.451  1.00 49.96  ? 96   LEU C CB  1 
ATOM   732   C  CG  . LEU A  1  96  ? 76.126  5.740   13.182  1.00 49.24  ? 96   LEU C CG  1 
ATOM   733   C  CD1 . LEU A  1  96  ? 75.146  6.871   13.371  1.00 49.66  ? 96   LEU C CD1 1 
ATOM   734   C  CD2 . LEU A  1  96  ? 77.016  6.031   11.983  1.00 50.35  ? 96   LEU C CD2 1 
ATOM   735   N  N   . ALA A  1  97  ? 79.323  3.655   16.028  1.00 49.50  ? 97   ALA C N   1 
ATOM   736   C  CA  . ALA A  1  97  ? 80.324  3.484   17.071  1.00 48.02  ? 97   ALA C CA  1 
ATOM   737   C  C   . ALA A  1  97  ? 81.705  3.225   16.478  1.00 49.79  ? 97   ALA C C   1 
ATOM   738   O  O   . ALA A  1  97  ? 82.705  3.203   17.195  1.00 53.08  ? 97   ALA C O   1 
ATOM   739   C  CB  . ALA A  1  97  ? 79.937  2.349   17.965  1.00 45.15  ? 97   ALA C CB  1 
ATOM   740   N  N   . SER A  1  98  ? 81.761  3.024   15.167  1.00 50.21  ? 98   SER C N   1 
ATOM   741   C  CA  . SER A  1  98  ? 83.009  2.669   14.504  1.00 50.30  ? 98   SER C CA  1 
ATOM   742   C  C   . SER A  1  98  ? 84.024  3.811   14.457  1.00 49.14  ? 98   SER C C   1 
ATOM   743   O  O   . SER A  1  98  ? 83.825  4.819   13.744  1.00 47.92  ? 98   SER C O   1 
ATOM   744   C  CB  . SER A  1  98  ? 82.731  2.165   13.080  1.00 54.42  ? 98   SER C CB  1 
ATOM   745   O  OG  . SER A  1  98  ? 83.937  1.918   12.361  1.00 54.60  ? 98   SER C OG  1 
ATOM   746   N  N   . GLU A  1  99  ? 85.203  3.497   14.997  1.00 47.00  ? 99   GLU C N   1 
ATOM   747   C  CA  . GLU A  1  99  ? 86.362  4.381   14.995  1.00 46.24  ? 99   GLU C CA  1 
ATOM   748   C  C   . GLU A  1  99  ? 87.222  4.160   13.774  1.00 47.44  ? 99   GLU C C   1 
ATOM   749   O  O   . GLU A  1  99  ? 88.389  4.569   13.738  1.00 46.63  ? 99   GLU C O   1 
ATOM   750   C  CB  . GLU A  1  99  ? 87.217  4.130   16.221  1.00 45.06  ? 99   GLU C CB  1 
ATOM   751   C  CG  . GLU A  1  99  ? 86.438  4.052   17.491  1.00 52.10  ? 99   GLU C CG  1 
ATOM   752   C  CD  . GLU A  1  99  ? 87.326  3.905   18.705  1.00 58.60  ? 99   GLU C CD  1 
ATOM   753   O  OE1 . GLU A  1  99  ? 88.564  3.732   18.537  1.00 61.02  ? 99   GLU C OE1 1 
ATOM   754   O  OE2 . GLU A  1  99  ? 86.774  3.949   19.832  1.00 59.57  ? 99   GLU C OE2 1 
ATOM   755   N  N   . ALA A  1  100 ? 86.654  3.484   12.785  1.00 50.80  ? 100  ALA C N   1 
ATOM   756   C  CA  . ALA A  1  100 ? 87.413  3.042   11.616  1.00 53.88  ? 100  ALA C CA  1 
ATOM   757   C  C   . ALA A  1  100 ? 88.158  4.187   10.907  1.00 52.95  ? 100  ALA C C   1 
ATOM   758   O  O   . ALA A  1  100 ? 89.260  3.986   10.373  1.00 55.22  ? 100  ALA C O   1 
ATOM   759   C  CB  . ALA A  1  100 ? 86.475  2.309   10.624  1.00 53.58  ? 100  ALA C CB  1 
ATOM   760   N  N   . LYS A  1  101 ? 87.536  5.366   10.872  1.00 47.70  ? 101  LYS C N   1 
ATOM   761   C  CA  . LYS A  1  101 ? 88.076  6.495   10.129  1.00 44.21  ? 101  LYS C CA  1 
ATOM   762   C  C   . LYS A  1  101 ? 88.791  7.394   11.114  1.00 41.85  ? 101  LYS C C   1 
ATOM   763   O  O   . LYS A  1  101 ? 88.287  7.626   12.215  1.00 40.47  ? 101  LYS C O   1 
ATOM   764   C  CB  . LYS A  1  101 ? 86.950  7.273   9.461   1.00 43.23  ? 101  LYS C CB  1 
ATOM   765   C  CG  . LYS A  1  101 ? 85.782  6.427   9.037   1.00 40.06  ? 101  LYS C CG  1 
ATOM   766   C  CD  . LYS A  1  101 ? 85.343  6.811   7.647   1.00 41.22  ? 101  LYS C CD  1 
ATOM   767   C  CE  . LYS A  1  101 ? 83.879  6.479   7.417   1.00 43.74  ? 101  LYS C CE  1 
ATOM   768   N  NZ  . LYS A  1  101 ? 83.336  7.038   6.128   1.00 46.98  ? 101  LYS C NZ  1 
ATOM   769   N  N   . TYR A  1  102 ? 89.938  7.938   10.721  1.00 39.98  ? 102  TYR C N   1 
ATOM   770   C  CA  . TYR A  1  102 ? 90.694  8.771   11.655  1.00 38.74  ? 102  TYR C CA  1 
ATOM   771   C  C   . TYR A  1  102 ? 89.953  10.041  12.154  1.00 36.51  ? 102  TYR C C   1 
ATOM   772   O  O   . TYR A  1  102 ? 89.948  10.313  13.366  1.00 38.54  ? 102  TYR C O   1 
ATOM   773   C  CB  . TYR A  1  102 ? 92.081  9.111   11.088  1.00 37.70  ? 102  TYR C CB  1 
ATOM   774   C  CG  . TYR A  1  102 ? 92.109  10.190  10.028  1.00 36.94  ? 102  TYR C CG  1 
ATOM   775   C  CD1 . TYR A  1  102 ? 92.190  11.542  10.374  1.00 37.21  ? 102  TYR C CD1 1 
ATOM   776   C  CD2 . TYR A  1  102 ? 92.012  9.864   8.686   1.00 33.83  ? 102  TYR C CD2 1 
ATOM   777   C  CE1 . TYR A  1  102 ? 92.154  12.542  9.401   1.00 35.39  ? 102  TYR C CE1 1 
ATOM   778   C  CE2 . TYR A  1  102 ? 91.980  10.859  7.707   1.00 36.62  ? 102  TYR C CE2 1 
ATOM   779   C  CZ  . TYR A  1  102 ? 92.042  12.193  8.069   1.00 35.16  ? 102  TYR C CZ  1 
ATOM   780   O  OH  . TYR A  1  102 ? 91.945  13.153  7.089   1.00 31.81  ? 102  TYR C OH  1 
ATOM   781   N  N   . PRO A  1  103 ? 89.163  10.704  11.280  1.00 31.64  ? 103  PRO C N   1 
ATOM   782   C  CA  . PRO A  1  103 ? 88.394  11.836  11.788  1.00 28.58  ? 103  PRO C CA  1 
ATOM   783   C  C   . PRO A  1  103 ? 87.631  11.526  13.052  1.00 30.41  ? 103  PRO C C   1 
ATOM   784   O  O   . PRO A  1  103 ? 87.637  12.336  13.949  1.00 35.20  ? 103  PRO C O   1 
ATOM   785   C  CB  . PRO A  1  103 ? 87.471  12.169  10.637  1.00 27.68  ? 103  PRO C CB  1 
ATOM   786   C  CG  . PRO A  1  103 ? 88.279  11.827  9.458   1.00 28.14  ? 103  PRO C CG  1 
ATOM   787   C  CD  . PRO A  1  103 ? 88.903  10.517  9.843   1.00 31.43  ? 103  PRO C CD  1 
ATOM   788   N  N   . TYR A  1  104 ? 87.176  10.293  13.224  1.00 30.68  ? 104  TYR C N   1 
ATOM   789   C  CA  . TYR A  1  104 ? 86.465  9.942   14.448  1.00 30.72  ? 104  TYR C CA  1 
ATOM   790   C  C   . TYR A  1  104 ? 87.343  10.230  15.659  1.00 32.06  ? 104  TYR C C   1 
ATOM   791   O  O   . TYR A  1  104 ? 86.966  10.978  16.557  1.00 35.01  ? 104  TYR C O   1 
ATOM   792   C  CB  . TYR A  1  104 ? 86.040  8.456   14.453  1.00 30.60  ? 104  TYR C CB  1 
ATOM   793   C  CG  . TYR A  1  104 ? 85.116  8.029   15.615  1.00 30.19  ? 104  TYR C CG  1 
ATOM   794   C  CD1 . TYR A  1  104 ? 85.616  7.767   16.908  1.00 28.44  ? 104  TYR C CD1 1 
ATOM   795   C  CD2 . TYR A  1  104 ? 83.746  7.857   15.411  1.00 28.85  ? 104  TYR C CD2 1 
ATOM   796   C  CE1 . TYR A  1  104 ? 84.749  7.351   17.967  1.00 26.69  ? 104  TYR C CE1 1 
ATOM   797   C  CE2 . TYR A  1  104 ? 82.884  7.437   16.461  1.00 31.46  ? 104  TYR C CE2 1 
ATOM   798   C  CZ  . TYR A  1  104 ? 83.385  7.190   17.731  1.00 29.51  ? 104  TYR C CZ  1 
ATOM   799   O  OH  . TYR A  1  104 ? 82.499  6.815   18.740  1.00 32.57  ? 104  TYR C OH  1 
ATOM   800   N  N   . VAL A  1  105 ? 88.501  9.602   15.722  1.00 33.45  ? 105  VAL C N   1 
ATOM   801   C  CA  . VAL A  1  105 ? 89.242  9.657   16.965  1.00 34.28  ? 105  VAL C CA  1 
ATOM   802   C  C   . VAL A  1  105 ? 89.836  11.042  17.109  1.00 31.30  ? 105  VAL C C   1 
ATOM   803   O  O   . VAL A  1  105 ? 89.852  11.592  18.202  1.00 33.01  ? 105  VAL C O   1 
ATOM   804   C  CB  . VAL A  1  105 ? 90.357  8.592   17.023  1.00 38.32  ? 105  VAL C CB  1 
ATOM   805   C  CG1 . VAL A  1  105 ? 89.818  7.264   16.555  1.00 36.59  ? 105  VAL C CG1 1 
ATOM   806   C  CG2 . VAL A  1  105 ? 91.547  9.012   16.174  1.00 41.92  ? 105  VAL C CG2 1 
ATOM   807   N  N   . VAL A  1  106 ? 90.189  11.655  15.986  1.00 27.62  ? 106  VAL C N   1 
ATOM   808   C  CA  . VAL A  1  106 ? 90.708  13.002  16.028  1.00 27.35  ? 106  VAL C CA  1 
ATOM   809   C  C   . VAL A  1  106 ? 89.607  13.909  16.571  1.00 28.88  ? 106  VAL C C   1 
ATOM   810   O  O   . VAL A  1  106 ? 89.760  14.480  17.640  1.00 28.74  ? 106  VAL C O   1 
ATOM   811   C  CB  . VAL A  1  106 ? 91.150  13.473  14.645  1.00 30.10  ? 106  VAL C CB  1 
ATOM   812   C  CG1 . VAL A  1  106 ? 91.623  14.916  14.724  1.00 30.74  ? 106  VAL C CG1 1 
ATOM   813   C  CG2 . VAL A  1  106 ? 92.259  12.576  14.116  1.00 25.85  ? 106  VAL C CG2 1 
ATOM   814   N  N   . ALA A  1  107 ? 88.429  13.849  15.959  1.00 28.35  ? 107  ALA C N   1 
ATOM   815   C  CA  . ALA A  1  107 ? 87.261  14.562  16.458  1.00 28.53  ? 107  ALA C CA  1 
ATOM   816   C  C   . ALA A  1  107 ? 87.009  14.261  17.912  1.00 31.31  ? 107  ALA C C   1 
ATOM   817   O  O   . ALA A  1  107 ? 86.653  15.169  18.654  1.00 34.79  ? 107  ALA C O   1 
ATOM   818   C  CB  . ALA A  1  107 ? 86.039  14.218  15.665  1.00 24.62  ? 107  ALA C CB  1 
ATOM   819   N  N   . ARG A  1  108 ? 87.243  13.022  18.346  1.00 34.81  ? 108  ARG C N   1 
ATOM   820   C  CA  . ARG A  1  108 ? 87.042  12.690  19.757  1.00 37.03  ? 108  ARG C CA  1 
ATOM   821   C  C   . ARG A  1  108 ? 87.973  13.500  20.650  1.00 39.47  ? 108  ARG C C   1 
ATOM   822   O  O   . ARG A  1  108 ? 87.526  14.161  21.599  1.00 40.38  ? 108  ARG C O   1 
ATOM   823   C  CB  . ARG A  1  108 ? 87.250  11.208  20.046  1.00 37.97  ? 108  ARG C CB  1 
ATOM   824   C  CG  . ARG A  1  108 ? 86.458  10.781  21.303  1.00 46.54  ? 108  ARG C CG  1 
ATOM   825   C  CD  . ARG A  1  108 ? 86.995  9.525   22.007  1.00 51.91  ? 108  ARG C CD  1 
ATOM   826   N  NE  . ARG A  1  108 ? 86.848  8.293   21.222  1.00 55.44  ? 108  ARG C NE  1 
ATOM   827   C  CZ  . ARG A  1  108 ? 85.721  7.591   21.108  1.00 53.00  ? 108  ARG C CZ  1 
ATOM   828   N  NH1 . ARG A  1  108 ? 84.583  8.029   21.631  1.00 52.96  ? 108  ARG C NH1 1 
ATOM   829   N  NH2 . ARG A  1  108 ? 85.725  6.466   20.418  1.00 52.72  ? 108  ARG C NH2 1 
ATOM   830   N  N   . ARG A  1  109 ? 89.244  13.553  20.259  1.00 41.48  ? 109  ARG C N   1 
ATOM   831   C  CA  . ARG A  1  109 ? 90.279  14.285  20.998  1.00 41.73  ? 109  ARG C CA  1 
ATOM   832   C  C   . ARG A  1  109 ? 90.018  15.804  20.979  1.00 41.78  ? 109  ARG C C   1 
ATOM   833   O  O   . ARG A  1  109 ? 90.203  16.501  21.988  1.00 42.64  ? 109  ARG C O   1 
ATOM   834   C  CB  . ARG A  1  109 ? 91.656  13.956  20.398  1.00 40.31  ? 109  ARG C CB  1 
ATOM   835   C  CG  . ARG A  1  109 ? 92.834  14.663  21.033  1.00 43.58  ? 109  ARG C CG  1 
ATOM   836   C  CD  . ARG A  1  109 ? 92.826  14.516  22.536  1.00 44.85  ? 109  ARG C CD  1 
ATOM   837   N  NE  . ARG A  1  109 ? 94.069  14.989  23.128  1.00 49.45  ? 109  ARG C NE  1 
ATOM   838   C  CZ  . ARG A  1  109 ? 94.246  15.180  24.431  1.00 54.67  ? 109  ARG C CZ  1 
ATOM   839   N  NH1 . ARG A  1  109 ? 93.214  15.127  25.268  1.00 57.10  ? 109  ARG C NH1 1 
ATOM   840   N  NH2 . ARG A  1  109 ? 95.444  15.507  24.891  1.00 59.32  ? 109  ARG C NH2 1 
ATOM   841   N  N   . MET A  1  110 ? 89.456  16.277  19.871  1.00 40.88  ? 110  MET C N   1 
ATOM   842   C  CA  . MET A  1  110 ? 89.137  17.686  19.686  1.00 37.22  ? 110  MET C CA  1 
ATOM   843   C  C   . MET A  1  110 ? 87.956  18.166  20.527  1.00 36.43  ? 110  MET C C   1 
ATOM   844   O  O   . MET A  1  110 ? 87.902  19.342  20.887  1.00 35.41  ? 110  MET C O   1 
ATOM   845   C  CB  . MET A  1  110 ? 88.867  17.950  18.221  1.00 32.49  ? 110  MET C CB  1 
ATOM   846   C  CG  . MET A  1  110 ? 90.057  17.703  17.369  1.00 30.75  ? 110  MET C CG  1 
ATOM   847   S  SD  . MET A  1  110 ? 90.657  19.242  16.757  1.00 32.65  ? 110  MET C SD  1 
ATOM   848   C  CE  . MET A  1  110 ? 92.396  18.988  17.055  1.00 32.00  ? 110  MET C CE  1 
ATOM   849   N  N   . LEU A  1  111 ? 86.990  17.280  20.780  1.00 35.04  ? 111  LEU C N   1 
ATOM   850   C  CA  . LEU A  1  111 ? 85.949  17.531  21.777  1.00 31.16  ? 111  LEU C CA  1 
ATOM   851   C  C   . LEU A  1  111 ? 86.577  17.711  23.156  1.00 30.88  ? 111  LEU C C   1 
ATOM   852   O  O   . LEU A  1  111 ? 86.219  18.635  23.886  1.00 28.22  ? 111  LEU C O   1 
ATOM   853   C  CB  . LEU A  1  111 ? 84.963  16.371  21.827  1.00 28.85  ? 111  LEU C CB  1 
ATOM   854   C  CG  . LEU A  1  111 ? 83.792  16.403  20.860  1.00 25.99  ? 111  LEU C CG  1 
ATOM   855   C  CD1 . LEU A  1  111 ? 83.126  15.062  20.912  1.00 26.44  ? 111  LEU C CD1 1 
ATOM   856   C  CD2 . LEU A  1  111 ? 82.821  17.478  21.245  1.00 26.19  ? 111  LEU C CD2 1 
ATOM   857   N  N   . GLU A  1  112 ? 87.579  16.891  23.468  1.00 30.39  ? 112  GLU C N   1 
ATOM   858   C  CA  . GLU A  1  112 ? 88.307  17.024  24.728  1.00 32.63  ? 112  GLU C CA  1 
ATOM   859   C  C   . GLU A  1  112 ? 89.067  18.350  24.818  1.00 31.79  ? 112  GLU C C   1 
ATOM   860   O  O   . GLU A  1  112 ? 88.829  19.151  25.722  1.00 33.47  ? 112  GLU C O   1 
ATOM   861   C  CB  . GLU A  1  112 ? 89.264  15.846  24.919  1.00 34.45  ? 112  GLU C CB  1 
ATOM   862   C  CG  . GLU A  1  112 ? 88.647  14.694  25.705  1.00 40.23  ? 112  GLU C CG  1 
ATOM   863   C  CD  . GLU A  1  112 ? 89.414  13.381  25.588  1.00 43.25  ? 112  GLU C CD  1 
ATOM   864   O  OE1 . GLU A  1  112 ? 90.312  13.268  24.729  1.00 42.80  ? 112  GLU C OE1 1 
ATOM   865   O  OE2 . GLU A  1  112 ? 89.078  12.432  26.337  1.00 50.66  ? 112  GLU C OE2 1 
ATOM   866   N  N   . MET A  1  113 ? 89.882  18.632  23.808  1.00 31.55  ? 113  MET C N   1 
ATOM   867   C  CA  . MET A  1  113 ? 90.632  19.879  23.724  1.00 28.82  ? 113  MET C CA  1 
ATOM   868   C  C   . MET A  1  113 ? 89.726  21.098  23.782  1.00 28.86  ? 113  MET C C   1 
ATOM   869   O  O   . MET A  1  113 ? 89.997  22.049  24.519  1.00 25.77  ? 113  MET C O   1 
ATOM   870   C  CB  . MET A  1  113 ? 91.419  19.908  22.424  1.00 27.28  ? 113  MET C CB  1 
ATOM   871   C  CG  . MET A  1  113 ? 92.122  21.209  22.156  1.00 25.21  ? 113  MET C CG  1 
ATOM   872   S  SD  . MET A  1  113 ? 92.883  21.111  20.578  1.00 25.25  ? 113  MET C SD  1 
ATOM   873   C  CE  . MET A  1  113 ? 91.695  22.014  19.591  1.00 25.89  ? 113  MET C CE  1 
ATOM   874   N  N   . THR A  1  114 ? 88.685  21.080  22.951  1.00 30.11  ? 114  THR C N   1 
ATOM   875   C  CA  . THR A  1  114 ? 87.669  22.126  22.953  1.00 30.74  ? 114  THR C CA  1 
ATOM   876   C  C   . THR A  1  114 ? 87.121  22.335  24.363  1.00 32.38  ? 114  THR C C   1 
ATOM   877   O  O   . THR A  1  114 ? 87.201  23.437  24.902  1.00 36.23  ? 114  THR C O   1 
ATOM   878   C  CB  . THR A  1  114 ? 86.499  21.800  21.980  1.00 28.94  ? 114  THR C CB  1 
ATOM   879   O  OG1 . THR A  1  114 ? 86.986  21.772  20.631  1.00 27.41  ? 114  THR C OG1 1 
ATOM   880   C  CG2 . THR A  1  114 ? 85.423  22.860  22.072  1.00 27.96  ? 114  THR C CG2 1 
ATOM   881   N  N   . ARG A  1  115 ? 86.737  21.259  25.033  1.00 30.77  ? 115  ARG C N   1 
ATOM   882   C  CA  . ARG A  1  115 ? 86.285  21.397  26.403  1.00 30.59  ? 115  ARG C CA  1 
ATOM   883   C  C   . ARG A  1  115 ? 87.380  21.881  27.350  1.00 33.64  ? 115  ARG C C   1 
ATOM   884   O  O   . ARG A  1  115 ? 87.097  22.671  28.258  1.00 36.09  ? 115  ARG C O   1 
ATOM   885   C  CB  . ARG A  1  115 ? 85.677  20.093  26.886  1.00 31.08  ? 115  ARG C CB  1 
ATOM   886   C  CG  . ARG A  1  115 ? 84.468  19.714  26.076  1.00 33.98  ? 115  ARG C CG  1 
ATOM   887   C  CD  . ARG A  1  115 ? 84.210  18.238  26.102  1.00 38.53  ? 115  ARG C CD  1 
ATOM   888   N  NE  . ARG A  1  115 ? 83.011  17.945  26.872  1.00 42.96  ? 115  ARG C NE  1 
ATOM   889   C  CZ  . ARG A  1  115 ? 83.025  17.404  28.077  1.00 39.89  ? 115  ARG C CZ  1 
ATOM   890   N  NH1 . ARG A  1  115 ? 84.143  16.873  28.543  1.00 44.43  ? 115  ARG C NH1 1 
ATOM   891   N  NH2 . ARG A  1  115 ? 81.904  17.290  28.762  1.00 41.30  ? 115  ARG C NH2 1 
ATOM   892   N  N   . ALA A  1  116 ? 88.642  21.565  27.049  1.00 33.67  ? 116  ALA C N   1 
ATOM   893   C  CA  . ALA A  1  116 ? 89.766  22.096  27.836  1.00 31.96  ? 116  ALA C CA  1 
ATOM   894   C  C   . ALA A  1  116 ? 89.847  23.614  27.698  1.00 32.57  ? 116  ALA C C   1 
ATOM   895   O  O   . ALA A  1  116 ? 89.748  24.344  28.685  1.00 32.70  ? 116  ALA C O   1 
ATOM   896   C  CB  . ALA A  1  116 ? 91.070  21.481  27.388  1.00 30.89  ? 116  ALA C CB  1 
ATOM   897   N  N   . ILE A  1  117 ? 89.939  24.088  26.462  1.00 30.50  ? 117  ILE C N   1 
ATOM   898   C  CA  . ILE A  1  117 ? 90.013  25.515  26.197  1.00 27.13  ? 117  ILE C CA  1 
ATOM   899   C  C   . ILE A  1  117 ? 88.943  26.294  26.919  1.00 24.82  ? 117  ILE C C   1 
ATOM   900   O  O   . ILE A  1  117 ? 89.239  27.240  27.641  1.00 28.81  ? 117  ILE C O   1 
ATOM   901   C  CB  . ILE A  1  117 ? 89.901  25.778  24.727  1.00 24.36  ? 117  ILE C CB  1 
ATOM   902   C  CG1 . ILE A  1  117 ? 91.155  25.225  24.054  1.00 21.31  ? 117  ILE C CG1 1 
ATOM   903   C  CG2 . ILE A  1  117 ? 89.681  27.267  24.471  1.00 20.48  ? 117  ILE C CG2 1 
ATOM   904   C  CD1 . ILE A  1  117 ? 91.035  25.126  22.567  1.00 22.51  ? 117  ILE C CD1 1 
ATOM   905   N  N   . ASN A  1  118 ? 87.724  25.793  26.860  1.00 24.96  ? 118  ASN C N   1 
ATOM   906   C  CA  . ASN A  1  118 ? 86.605  26.484  27.483  1.00 26.94  ? 118  ASN C CA  1 
ATOM   907   C  C   . ASN A  1  118 ? 86.535  26.377  28.992  1.00 27.82  ? 118  ASN C C   1 
ATOM   908   O  O   . ASN A  1  118 ? 85.807  27.126  29.642  1.00 32.12  ? 118  ASN C O   1 
ATOM   909   C  CB  . ASN A  1  118 ? 85.297  26.007  26.883  1.00 22.77  ? 118  ASN C CB  1 
ATOM   910   C  CG  . ASN A  1  118 ? 85.103  26.513  25.480  1.00 27.68  ? 118  ASN C CG  1 
ATOM   911   O  OD1 . ASN A  1  118 ? 85.504  27.632  25.144  1.00 28.99  ? 118  ASN C OD1 1 
ATOM   912   N  ND2 . ASN A  1  118 ? 84.599  25.650  24.618  1.00 34.02  ? 118  ASN C ND2 1 
ATOM   913   N  N   . THR A  1  119 ? 87.249  25.416  29.551  1.00 30.51  ? 119  THR C N   1 
ATOM   914   C  CA  . THR A  1  119 ? 87.175  25.194  30.976  1.00 30.19  ? 119  THR C CA  1 
ATOM   915   C  C   . THR A  1  119 ? 88.392  25.750  31.694  1.00 29.94  ? 119  THR C C   1 
ATOM   916   O  O   . THR A  1  119 ? 88.268  26.392  32.726  1.00 29.35  ? 119  THR C O   1 
ATOM   917   C  CB  . THR A  1  119 ? 87.026  23.703  31.277  1.00 30.25  ? 119  THR C CB  1 
ATOM   918   O  OG1 . THR A  1  119 ? 85.847  23.205  30.625  1.00 34.81  ? 119  THR C OG1 1 
ATOM   919   C  CG2 . THR A  1  119 ? 86.890  23.483  32.751  1.00 29.40  ? 119  THR C CG2 1 
ATOM   920   N  N   . ASN A  1  120 ? 89.555  25.611  31.082  1.00 32.22  ? 120  ASN C N   1 
ATOM   921   C  CA  . ASN A  1  120 ? 90.799  25.857  31.787  1.00 35.86  ? 120  ASN C CA  1 
ATOM   922   C  C   . ASN A  1  120 ? 91.547  27.058  31.280  1.00 37.84  ? 120  ASN C C   1 
ATOM   923   O  O   . ASN A  1  120 ? 92.551  27.444  31.876  1.00 42.98  ? 120  ASN C O   1 
ATOM   924   C  CB  . ASN A  1  120 ? 91.715  24.649  31.686  1.00 40.03  ? 120  ASN C CB  1 
ATOM   925   C  CG  . ASN A  1  120 ? 91.152  23.433  32.386  1.00 45.23  ? 120  ASN C CG  1 
ATOM   926   O  OD1 . ASN A  1  120 ? 90.283  23.541  33.260  1.00 48.90  ? 120  ASN C OD1 1 
ATOM   927   N  ND2 . ASN A  1  120 ? 91.625  22.260  31.989  1.00 45.34  ? 120  ASN C ND2 1 
ATOM   928   N  N   . TRP A  1  121 ? 91.171  27.542  30.099  1.00 36.38  ? 121  TRP C N   1 
ATOM   929   C  CA  . TRP A  1  121 ? 91.840  28.690  29.503  1.00 33.23  ? 121  TRP C CA  1 
ATOM   930   C  C   . TRP A  1  121 ? 90.889  29.842  29.427  1.00 32.93  ? 121  TRP C C   1 
ATOM   931   O  O   . TRP A  1  121 ? 91.088  30.796  28.694  1.00 35.70  ? 121  TRP C O   1 
ATOM   932   C  CB  . TRP A  1  121 ? 92.395  28.326  28.150  1.00 34.05  ? 121  TRP C CB  1 
ATOM   933   C  CG  . TRP A  1  121 ? 93.588  27.501  28.345  1.00 33.58  ? 121  TRP C CG  1 
ATOM   934   C  CD1 . TRP A  1  121 ? 93.709  26.165  28.108  1.00 32.33  ? 121  TRP C CD1 1 
ATOM   935   C  CD2 . TRP A  1  121 ? 94.814  27.917  28.951  1.00 34.58  ? 121  TRP C CD2 1 
ATOM   936   N  NE1 . TRP A  1  121 ? 94.940  25.724  28.520  1.00 30.65  ? 121  TRP C NE1 1 
ATOM   937   C  CE2 . TRP A  1  121 ? 95.643  26.780  29.036  1.00 32.86  ? 121  TRP C CE2 1 
ATOM   938   C  CE3 . TRP A  1  121 ? 95.293  29.141  29.435  1.00 31.31  ? 121  TRP C CE3 1 
ATOM   939   C  CZ2 . TRP A  1  121 ? 96.931  26.832  29.573  1.00 29.59  ? 121  TRP C CZ2 1 
ATOM   940   C  CZ3 . TRP A  1  121 ? 96.566  29.185  29.980  1.00 30.57  ? 121  TRP C CZ3 1 
ATOM   941   C  CH2 . TRP A  1  121 ? 97.372  28.039  30.040  1.00 27.09  ? 121  TRP C CH2 1 
ATOM   942   N  N   . THR A  1  122 ? 90.138  29.905  30.501  1.00 32.97  ? 122  THR C N   1 
ATOM   943   C  CA  . THR A  1  122 ? 89.186  30.939  30.756  1.00 30.40  ? 122  THR C CA  1 
ATOM   944   C  C   . THR A  1  122 ? 89.823  32.342  30.849  1.00 29.95  ? 122  THR C C   1 
ATOM   945   O  O   . THR A  1  122 ? 89.214  33.336  30.433  1.00 28.86  ? 122  THR C O   1 
ATOM   946   C  CB  . THR A  1  122 ? 88.409  30.512  32.023  1.00 31.89  ? 122  THR C CB  1 
ATOM   947   O  OG1 . THR A  1  122 ? 87.154  29.944  31.623  1.00 38.71  ? 122  THR C OG1 1 
ATOM   948   C  CG2 . THR A  1  122 ? 88.209  31.648  32.989  1.00 38.52  ? 122  THR C CG2 1 
ATOM   949   N  N   A GLN A  1  123 ? 91.062  32.419  31.314  0.50 25.79  ? 123  GLN C N   1 
ATOM   950   N  N   B GLN A  1  123 ? 91.076  32.404  31.306  0.50 27.30  ? 123  GLN C N   1 
ATOM   951   C  CA  A GLN A  1  123 ? 91.716  33.715  31.438  0.50 24.35  ? 123  GLN C CA  1 
ATOM   952   C  CA  B GLN A  1  123 ? 91.766  33.684  31.452  0.50 26.98  ? 123  GLN C CA  1 
ATOM   953   C  C   A GLN A  1  123 ? 92.051  34.298  30.074  0.50 24.99  ? 123  GLN C C   1 
ATOM   954   C  C   B GLN A  1  123 ? 92.133  34.271  30.092  0.50 26.70  ? 123  GLN C C   1 
ATOM   955   O  O   A GLN A  1  123 ? 92.362  35.481  29.948  0.50 25.36  ? 123  GLN C O   1 
ATOM   956   O  O   B GLN A  1  123 ? 92.539  35.426  29.988  0.50 27.17  ? 123  GLN C O   1 
ATOM   957   C  CB  A GLN A  1  123 ? 92.980  33.604  32.282  0.50 24.93  ? 123  GLN C CB  1 
ATOM   958   C  CB  B GLN A  1  123 ? 93.024  33.534  32.320  0.50 30.22  ? 123  GLN C CB  1 
ATOM   959   C  CG  A GLN A  1  123 ? 93.784  32.369  32.007  0.50 24.35  ? 123  GLN C CG  1 
ATOM   960   C  CG  B GLN A  1  123 ? 92.771  33.576  33.837  0.50 33.39  ? 123  GLN C CG  1 
ATOM   961   C  CD  A GLN A  1  123 ? 93.305  31.181  32.797  0.50 23.83  ? 123  GLN C CD  1 
ATOM   962   C  CD  B GLN A  1  123 ? 92.948  34.972  34.462  0.50 38.27  ? 123  GLN C CD  1 
ATOM   963   O  OE1 A GLN A  1  123 ? 93.387  31.157  34.019  0.50 24.26  ? 123  GLN C OE1 1 
ATOM   964   O  OE1 B GLN A  1  123 ? 92.086  35.843  34.328  0.50 38.99  ? 123  GLN C OE1 1 
ATOM   965   N  NE2 A GLN A  1  123 ? 92.752  30.204  32.102  0.50 20.64  ? 123  GLN C NE2 1 
ATOM   966   N  NE2 B GLN A  1  123 ? 94.028  35.150  35.222  0.50 39.17  ? 123  GLN C NE2 1 
ATOM   967   N  N   . HIS A  1  124 ? 92.020  33.457  29.051  1.00 24.53  ? 124  HIS C N   1 
ATOM   968   C  CA  . HIS A  1  124 ? 92.161  33.954  27.710  1.00 24.01  ? 124  HIS C CA  1 
ATOM   969   C  C   . HIS A  1  124 ? 90.830  34.071  27.014  1.00 24.70  ? 124  HIS C C   1 
ATOM   970   O  O   . HIS A  1  124 ? 90.540  35.111  26.440  1.00 25.92  ? 124  HIS C O   1 
ATOM   971   C  CB  . HIS A  1  124 ? 93.061  33.084  26.861  1.00 21.58  ? 124  HIS C CB  1 
ATOM   972   C  CG  . HIS A  1  124 ? 93.421  33.737  25.569  1.00 20.33  ? 124  HIS C CG  1 
ATOM   973   N  ND1 . HIS A  1  124 ? 94.184  34.875  25.490  1.00 20.28  ? 124  HIS C ND1 1 
ATOM   974   C  CD2 . HIS A  1  124 ? 92.969  33.513  24.309  1.00 23.67  ? 124  HIS C CD2 1 
ATOM   975   C  CE1 . HIS A  1  124 ? 94.185  35.283  24.217  1.00 22.28  ? 124  HIS C CE1 1 
ATOM   976   N  NE2 . HIS A  1  124 ? 93.460  34.493  23.462  1.00 23.37  ? 124  HIS C NE2 1 
ATOM   977   N  N   . VAL A  1  125 ? 90.106  32.954  26.907  1.00 26.47  ? 125  VAL C N   1 
ATOM   978   C  CA  . VAL A  1  125 ? 88.892  32.908  26.079  1.00 26.37  ? 125  VAL C CA  1 
ATOM   979   C  C   . VAL A  1  125 ? 87.690  33.440  26.816  1.00 26.56  ? 125  VAL C C   1 
ATOM   980   O  O   . VAL A  1  125 ? 86.647  33.675  26.219  1.00 28.67  ? 125  VAL C O   1 
ATOM   981   C  CB  . VAL A  1  125 ? 88.557  31.481  25.558  1.00 22.98  ? 125  VAL C CB  1 
ATOM   982   C  CG1 . VAL A  1  125 ? 89.701  30.949  24.680  1.00 19.02  ? 125  VAL C CG1 1 
ATOM   983   C  CG2 . VAL A  1  125 ? 88.263  30.549  26.707  1.00 19.27  ? 125  VAL C CG2 1 
ATOM   984   N  N   . ALA A  1  126 ? 87.827  33.566  28.129  1.00 28.99  ? 126  ALA C N   1 
ATOM   985   C  CA  . ALA A  1  126 ? 86.799  34.154  28.959  1.00 31.41  ? 126  ALA C CA  1 
ATOM   986   C  C   . ALA A  1  126 ? 85.465  33.427  28.775  1.00 33.14  ? 126  ALA C C   1 
ATOM   987   O  O   . ALA A  1  126 ? 85.418  32.196  28.769  1.00 37.22  ? 126  ALA C O   1 
ATOM   988   C  CB  . ALA A  1  126 ? 86.668  35.631  28.626  1.00 27.35  ? 126  ALA C CB  1 
ATOM   989   N  N   . GLN A  1  127 ? 84.402  34.198  28.568  1.00 36.08  ? 127  GLN C N   1 
ATOM   990   C  CA  . GLN A  1  127 ? 83.051  33.676  28.443  1.00 36.73  ? 127  GLN C CA  1 
ATOM   991   C  C   . GLN A  1  127 ? 82.594  33.716  26.974  1.00 37.87  ? 127  GLN C C   1 
ATOM   992   O  O   . GLN A  1  127 ? 81.402  33.602  26.675  1.00 42.76  ? 127  GLN C O   1 
ATOM   993   C  CB  . GLN A  1  127 ? 82.100  34.510  29.323  1.00 40.28  ? 127  GLN C CB  1 
ATOM   994   C  CG  . GLN A  1  127 ? 82.066  34.116  30.798  1.00 36.98  ? 127  GLN C CG  1 
ATOM   995   C  CD  . GLN A  1  127 ? 81.453  32.743  31.019  0.00 37.69  ? 127  GLN C CD  1 
ATOM   996   O  OE1 . GLN A  1  127 ? 80.264  32.622  31.308  0.00 37.22  ? 127  GLN C OE1 1 
ATOM   997   N  NE2 . GLN A  1  127 ? 82.263  31.702  30.873  0.00 37.22  ? 127  GLN C NE2 1 
ATOM   998   N  N   . THR A  1  128 ? 83.529  33.999  26.073  1.00 36.50  ? 128  THR C N   1 
ATOM   999   C  CA  . THR A  1  128 ? 83.298  33.843  24.641  1.00 30.99  ? 128  THR C CA  1 
ATOM   1000  C  C   . THR A  1  128 ? 83.517  32.390  24.239  1.00 27.26  ? 128  THR C C   1 
ATOM   1001  O  O   . THR A  1  128 ? 82.621  31.757  23.705  1.00 30.83  ? 128  THR C O   1 
ATOM   1002  C  CB  . THR A  1  128 ? 84.232  34.763  23.868  1.00 31.14  ? 128  THR C CB  1 
ATOM   1003  O  OG1 . THR A  1  128 ? 83.959  36.106  24.274  1.00 28.77  ? 128  THR C OG1 1 
ATOM   1004  C  CG2 . THR A  1  128 ? 84.045  34.617  22.364  1.00 28.25  ? 128  THR C CG2 1 
ATOM   1005  N  N   . GLY A  1  129 ? 84.617  31.815  24.702  1.00 24.23  ? 129  GLY C N   1 
ATOM   1006  C  CA  . GLY A  1  129 ? 84.862  30.409  24.472  1.00 25.34  ? 129  GLY C CA  1 
ATOM   1007  C  C   . GLY A  1  129 ? 85.107  30.173  23.002  1.00 26.95  ? 129  GLY C C   1 
ATOM   1008  O  O   . GLY A  1  129 ? 84.918  31.080  22.184  1.00 26.99  ? 129  GLY C O   1 
ATOM   1009  N  N   . VAL A  1  130 ? 85.639  29.008  22.668  1.00 25.14  ? 130  VAL C N   1 
ATOM   1010  C  CA  . VAL A  1  130 ? 85.689  28.612  21.276  1.00 25.63  ? 130  VAL C CA  1 
ATOM   1011  C  C   . VAL A  1  130 ? 84.725  27.442  21.034  1.00 27.83  ? 130  VAL C C   1 
ATOM   1012  O  O   . VAL A  1  130 ? 84.105  26.946  21.972  1.00 28.12  ? 130  VAL C O   1 
ATOM   1013  C  CB  . VAL A  1  130 ? 87.120  28.240  20.857  1.00 24.01  ? 130  VAL C CB  1 
ATOM   1014  C  CG1 . VAL A  1  130 ? 88.071  29.278  21.346  1.00 24.70  ? 130  VAL C CG1 1 
ATOM   1015  C  CG2 . VAL A  1  130 ? 87.503  26.916  21.422  1.00 25.43  ? 130  VAL C CG2 1 
ATOM   1016  N  N   . THR A  1  131 ? 84.444  27.161  19.765  1.00 26.40  ? 131  THR C N   1 
ATOM   1017  C  CA  . THR A  1  131 ? 83.726  25.957  19.358  1.00 23.19  ? 131  THR C CA  1 
ATOM   1018  C  C   . THR A  1  131 ? 84.607  25.387  18.254  1.00 27.61  ? 131  THR C C   1 
ATOM   1019  O  O   . THR A  1  131 ? 85.534  26.072  17.816  1.00 26.21  ? 131  THR C O   1 
ATOM   1020  C  CB  . THR A  1  131 ? 82.359  26.307  18.749  1.00 22.21  ? 131  THR C CB  1 
ATOM   1021  O  OG1 . THR A  1  131 ? 82.551  27.115  17.581  1.00 19.05  ? 131  THR C OG1 1 
ATOM   1022  C  CG2 . THR A  1  131 ? 81.487  27.074  19.740  1.00 21.59  ? 131  THR C CG2 1 
ATOM   1023  N  N   . CYS A  1  132 ? 84.227  24.252  17.669  1.00 26.73  ? 132  CYS C N   1 
ATOM   1024  C  CA  . CYS A  1  132 ? 84.978  23.730  16.530  1.00 25.02  ? 132  CYS C CA  1 
ATOM   1025  C  C   . CYS A  1  132 ? 85.057  24.747  15.389  1.00 27.35  ? 132  CYS C C   1 
ATOM   1026  O  O   . CYS A  1  132 ? 86.081  24.848  14.704  1.00 27.74  ? 132  CYS C O   1 
ATOM   1027  C  CB  . CYS A  1  132 ? 84.346  22.447  16.012  1.00 25.31  ? 132  CYS C CB  1 
ATOM   1028  S  SG  . CYS A  1  132 ? 83.746  21.365  17.329  1.00 28.42  ? 132  CYS C SG  1 
ATOM   1029  N  N   . TYR A  1  133 ? 83.995  25.528  15.204  1.00 26.32  ? 133  TYR C N   1 
ATOM   1030  C  CA  . TYR A  1  133 ? 83.939  26.471  14.090  1.00 25.29  ? 133  TYR C CA  1 
ATOM   1031  C  C   . TYR A  1  133 ? 85.044  27.527  14.165  1.00 24.69  ? 133  TYR C C   1 
ATOM   1032  O  O   . TYR A  1  133 ? 85.492  28.028  13.142  1.00 24.71  ? 133  TYR C O   1 
ATOM   1033  C  CB  . TYR A  1  133 ? 82.574  27.169  14.036  1.00 22.52  ? 133  TYR C CB  1 
ATOM   1034  C  CG  . TYR A  1  133 ? 82.395  28.040  12.809  1.00 22.72  ? 133  TYR C CG  1 
ATOM   1035  C  CD1 . TYR A  1  133 ? 82.020  27.487  11.595  1.00 21.21  ? 133  TYR C CD1 1 
ATOM   1036  C  CD2 . TYR A  1  133 ? 82.636  29.416  12.856  1.00 24.75  ? 133  TYR C CD2 1 
ATOM   1037  C  CE1 . TYR A  1  133 ? 81.892  28.274  10.452  1.00 22.88  ? 133  TYR C CE1 1 
ATOM   1038  C  CE2 . TYR A  1  133 ? 82.499  30.216  11.722  1.00 26.24  ? 133  TYR C CE2 1 
ATOM   1039  C  CZ  . TYR A  1  133 ? 82.133  29.634  10.520  1.00 27.15  ? 133  TYR C CZ  1 
ATOM   1040  O  OH  . TYR A  1  133 ? 82.049  30.389  9.369   1.00 29.78  ? 133  TYR C OH  1 
ATOM   1041  N  N   . THR A  1  134 ? 85.476  27.860  15.379  1.00 27.66  ? 134  THR C N   1 
ATOM   1042  C  CA  . THR A  1  134 ? 86.421  28.946  15.588  1.00 21.95  ? 134  THR C CA  1 
ATOM   1043  C  C   . THR A  1  134 ? 87.685  28.714  14.791  1.00 19.95  ? 134  THR C C   1 
ATOM   1044  O  O   . THR A  1  134 ? 88.098  29.580  14.043  1.00 21.91  ? 134  THR C O   1 
ATOM   1045  C  CB  . THR A  1  134 ? 86.774  29.119  17.079  1.00 24.95  ? 134  THR C CB  1 
ATOM   1046  O  OG1 . THR A  1  134 ? 85.570  29.264  17.850  1.00 29.26  ? 134  THR C OG1 1 
ATOM   1047  C  CG2 . THR A  1  134 ? 87.598  30.362  17.276  1.00 24.90  ? 134  THR C CG2 1 
ATOM   1048  N  N   . CYS A  1  135 ? 88.186  27.486  14.794  1.00 21.85  ? 135  CYS C N   1 
ATOM   1049  C  CA  . CYS A  1  135 ? 89.360  27.157  13.984  1.00 18.62  ? 135  CYS C CA  1 
ATOM   1050  C  C   . CYS A  1  135 ? 89.003  26.634  12.615  1.00 22.14  ? 135  CYS C C   1 
ATOM   1051  O  O   . CYS A  1  135 ? 89.598  27.045  11.621  1.00 21.13  ? 135  CYS C O   1 
ATOM   1052  C  CB  . CYS A  1  135 ? 90.215  26.120  14.681  1.00 18.07  ? 135  CYS C CB  1 
ATOM   1053  S  SG  . CYS A  1  135 ? 90.831  26.669  16.290  1.00 22.92  ? 135  CYS C SG  1 
ATOM   1054  N  N   . HIS A  1  136 ? 88.068  25.687  12.567  1.00 25.31  ? 136  HIS C N   1 
ATOM   1055  C  CA  . HIS A  1  136 ? 87.775  24.954  11.332  1.00 26.11  ? 136  HIS C CA  1 
ATOM   1056  C  C   . HIS A  1  136 ? 87.050  25.749  10.260  1.00 23.52  ? 136  HIS C C   1 
ATOM   1057  O  O   . HIS A  1  136 ? 87.248  25.509  9.081   1.00 27.32  ? 136  HIS C O   1 
ATOM   1058  C  CB  . HIS A  1  136 ? 86.989  23.682  11.631  1.00 26.46  ? 136  HIS C CB  1 
ATOM   1059  C  CG  . HIS A  1  136 ? 87.828  22.581  12.194  1.00 29.77  ? 136  HIS C CG  1 
ATOM   1060  N  ND1 . HIS A  1  136 ? 88.485  21.641  11.432  1.00 27.70  ? 136  HIS C ND1 1 
ATOM   1061  C  CD2 . HIS A  1  136 ? 88.179  22.317  13.480  1.00 31.05  ? 136  HIS C CD2 1 
ATOM   1062  C  CE1 . HIS A  1  136 ? 89.201  20.865  12.267  1.00 30.91  ? 136  HIS C CE1 1 
ATOM   1063  N  NE2 . HIS A  1  136 ? 89.045  21.241  13.525  1.00 26.12  ? 136  HIS C NE2 1 
ATOM   1064  N  N   . ARG A  1  137 ? 86.223  26.705  10.653  1.00 22.22  ? 137  ARG C N   1 
ATOM   1065  C  CA  . ARG A  1  137 ? 85.512  27.523  9.679   1.00 20.90  ? 137  ARG C CA  1 
ATOM   1066  C  C   . ARG A  1  137 ? 84.874  26.676  8.568   1.00 23.34  ? 137  ARG C C   1 
ATOM   1067  O  O   . ARG A  1  137 ? 85.046  26.974  7.383   1.00 28.00  ? 137  ARG C O   1 
ATOM   1068  C  CB  . ARG A  1  137 ? 86.469  28.550  9.065   1.00 19.68  ? 137  ARG C CB  1 
ATOM   1069  C  CG  . ARG A  1  137 ? 87.169  29.448  10.074  1.00 20.13  ? 137  ARG C CG  1 
ATOM   1070  C  CD  . ARG A  1  137 ? 86.185  30.321  10.829  1.00 23.38  ? 137  ARG C CD  1 
ATOM   1071  N  NE  . ARG A  1  137 ? 86.845  31.150  11.837  1.00 26.90  ? 137  ARG C NE  1 
ATOM   1072  C  CZ  . ARG A  1  137 ? 86.858  32.479  11.830  1.00 29.98  ? 137  ARG C CZ  1 
ATOM   1073  N  NH1 . ARG A  1  137 ? 86.316  33.160  10.825  1.00 31.33  ? 137  ARG C NH1 1 
ATOM   1074  N  NH2 . ARG A  1  137 ? 87.446  33.132  12.822  1.00 35.20  ? 137  ARG C NH2 1 
ATOM   1075  N  N   . GLY A  1  138 ? 84.246  25.561  8.941   1.00 23.32  ? 138  GLY C N   1 
ATOM   1076  C  CA  . GLY A  1  138 ? 83.493  24.775  7.971   1.00 19.64  ? 138  GLY C CA  1 
ATOM   1077  C  C   . GLY A  1  138 ? 84.268  23.847  7.045   1.00 20.20  ? 138  GLY C C   1 
ATOM   1078  O  O   . GLY A  1  138 ? 83.738  23.435  6.017   1.00 20.01  ? 138  GLY C O   1 
ATOM   1079  N  N   . THR A  1  139 ? 85.524  23.557  7.365   1.00 19.80  ? 139  THR C N   1 
ATOM   1080  C  CA  . THR A  1  139 ? 86.299  22.564  6.646   1.00 22.59  ? 139  THR C CA  1 
ATOM   1081  C  C   . THR A  1  139 ? 87.111  21.729  7.610   1.00 25.23  ? 139  THR C C   1 
ATOM   1082  O  O   . THR A  1  139 ? 87.468  22.170  8.698   1.00 29.01  ? 139  THR C O   1 
ATOM   1083  C  CB  . THR A  1  139 ? 87.293  23.187  5.662   1.00 28.01  ? 139  THR C CB  1 
ATOM   1084  O  OG1 . THR A  1  139 ? 88.226  24.040  6.350   1.00 29.96  ? 139  THR C OG1 1 
ATOM   1085  C  CG2 . THR A  1  139 ? 86.563  23.949  4.625   1.00 30.40  ? 139  THR C CG2 1 
ATOM   1086  N  N   . PRO A  1  140 ? 87.371  20.476  7.244   1.00 27.07  ? 140  PRO C N   1 
ATOM   1087  C  CA  . PRO A  1  140 ? 88.018  19.569  8.192   1.00 24.66  ? 140  PRO C CA  1 
ATOM   1088  C  C   . PRO A  1  140 ? 89.403  20.062  8.553   1.00 22.64  ? 140  PRO C C   1 
ATOM   1089  O  O   . PRO A  1  140 ? 89.756  20.115  9.716   1.00 21.63  ? 140  PRO C O   1 
ATOM   1090  C  CB  . PRO A  1  140 ? 88.048  18.250  7.440   1.00 25.36  ? 140  PRO C CB  1 
ATOM   1091  C  CG  . PRO A  1  140 ? 86.820  18.315  6.584   1.00 28.90  ? 140  PRO C CG  1 
ATOM   1092  C  CD  . PRO A  1  140 ? 86.726  19.749  6.138   1.00 27.56  ? 140  PRO C CD  1 
ATOM   1093  N  N   . LEU A  1  141 ? 90.175  20.448  7.548   1.00 22.84  ? 141  LEU C N   1 
ATOM   1094  C  CA  . LEU A  1  141 ? 91.444  21.122  7.784   1.00 24.15  ? 141  LEU C CA  1 
ATOM   1095  C  C   . LEU A  1  141 ? 91.166  22.593  8.037   1.00 24.04  ? 141  LEU C C   1 
ATOM   1096  O  O   . LEU A  1  141 ? 90.715  23.294  7.130   1.00 24.51  ? 141  LEU C O   1 
ATOM   1097  C  CB  . LEU A  1  141 ? 92.363  20.990  6.559   1.00 22.72  ? 141  LEU C CB  1 
ATOM   1098  C  CG  . LEU A  1  141 ? 93.715  21.729  6.610   1.00 26.23  ? 141  LEU C CG  1 
ATOM   1099  C  CD1 . LEU A  1  141 ? 94.624  21.100  7.653   1.00 27.34  ? 141  LEU C CD1 1 
ATOM   1100  C  CD2 . LEU A  1  141 ? 94.389  21.693  5.272   1.00 20.27  ? 141  LEU C CD2 1 
ATOM   1101  N  N   . PRO A  1  142 ? 91.558  23.107  9.220   1.00 24.07  ? 142  PRO C N   1 
ATOM   1102  C  CA  . PRO A  1  142 ? 91.478  24.555  9.474   1.00 23.96  ? 142  PRO C CA  1 
ATOM   1103  C  C   . PRO A  1  142 ? 92.321  25.371  8.477   1.00 25.82  ? 142  PRO C C   1 
ATOM   1104  O  O   . PRO A  1  142 ? 93.378  24.933  8.032   1.00 28.03  ? 142  PRO C O   1 
ATOM   1105  C  CB  . PRO A  1  142 ? 91.987  24.703  10.910  1.00 23.22  ? 142  PRO C CB  1 
ATOM   1106  C  CG  . PRO A  1  142 ? 92.029  23.285  11.472  1.00 22.22  ? 142  PRO C CG  1 
ATOM   1107  C  CD  . PRO A  1  142 ? 92.258  22.394  10.305  1.00 20.96  ? 142  PRO C CD  1 
ATOM   1108  N  N   . PRO A  1  143 ? 91.817  26.527  8.046   1.00 22.99  ? 143  PRO C N   1 
ATOM   1109  C  CA  . PRO A  1  143 ? 92.509  27.267  6.990   1.00 23.62  ? 143  PRO C CA  1 
ATOM   1110  C  C   . PRO A  1  143 ? 93.861  27.856  7.403   1.00 27.73  ? 143  PRO C C   1 
ATOM   1111  O  O   . PRO A  1  143 ? 94.670  28.222  6.545   1.00 31.44  ? 143  PRO C O   1 
ATOM   1112  C  CB  . PRO A  1  143 ? 91.512  28.360  6.611   1.00 26.31  ? 143  PRO C CB  1 
ATOM   1113  C  CG  . PRO A  1  143 ? 90.577  28.466  7.761   1.00 20.84  ? 143  PRO C CG  1 
ATOM   1114  C  CD  . PRO A  1  143 ? 90.491  27.087  8.333   1.00 23.64  ? 143  PRO C CD  1 
ATOM   1115  N  N   . TYR A  1  144 ? 94.036  28.089  8.701   1.00 28.02  ? 144  TYR C N   1 
ATOM   1116  C  CA  . TYR A  1  144 ? 95.252  28.696  9.220   1.00 27.88  ? 144  TYR C CA  1 
ATOM   1117  C  C   . TYR A  1  144 ? 95.869  27.820  10.270  1.00 30.14  ? 144  TYR C C   1 
ATOM   1118  O  O   . TYR A  1  144 ? 95.443  27.815  11.440  1.00 28.56  ? 144  TYR C O   1 
ATOM   1119  C  CB  . TYR A  1  144 ? 94.959  30.039  9.844   1.00 25.68  ? 144  TYR C CB  1 
ATOM   1120  C  CG  . TYR A  1  144 ? 94.475  31.044  8.857   1.00 23.60  ? 144  TYR C CG  1 
ATOM   1121  C  CD1 . TYR A  1  144 ? 95.363  31.706  8.026   1.00 18.21  ? 144  TYR C CD1 1 
ATOM   1122  C  CD2 . TYR A  1  144 ? 93.118  31.348  8.763   1.00 23.82  ? 144  TYR C CD2 1 
ATOM   1123  C  CE1 . TYR A  1  144 ? 94.910  32.642  7.114   1.00 18.62  ? 144  TYR C CE1 1 
ATOM   1124  C  CE2 . TYR A  1  144 ? 92.655  32.301  7.871   1.00 22.37  ? 144  TYR C CE2 1 
ATOM   1125  C  CZ  . TYR A  1  144 ? 93.555  32.937  7.046   1.00 21.86  ? 144  TYR C CZ  1 
ATOM   1126  O  OH  . TYR A  1  144 ? 93.086  33.853  6.131   1.00 28.15  ? 144  TYR C OH  1 
ATOM   1127  N  N   . VAL A  1  145 ? 96.880  27.081  9.831   1.00 32.23  ? 145  VAL C N   1 
ATOM   1128  C  CA  . VAL A  1  145 ? 97.632  26.168  10.676  1.00 29.13  ? 145  VAL C CA  1 
ATOM   1129  C  C   . VAL A  1  145 ? 99.121  26.397  10.444  1.00 28.39  ? 145  VAL C C   1 
ATOM   1130  O  O   . VAL A  1  145 ? 99.524  27.082  9.492   1.00 26.75  ? 145  VAL C O   1 
ATOM   1131  C  CB  . VAL A  1  145 ? 97.268  24.692  10.366  1.00 31.87  ? 145  VAL C CB  1 
ATOM   1132  C  CG1 . VAL A  1  145 ? 95.867  24.398  10.888  1.00 30.98  ? 145  VAL C CG1 1 
ATOM   1133  C  CG2 . VAL A  1  145 ? 97.355  24.410  8.859   1.00 24.44  ? 145  VAL C CG2 1 
ATOM   1134  N  N   . ARG A  1  146 ? 99.940  25.865  11.334  1.00 28.84  ? 146  ARG C N   1 
ATOM   1135  C  CA  . ARG A  1  146 ? 101.371 26.090  11.250  1.00 29.85  ? 146  ARG C CA  1 
ATOM   1136  C  C   . ARG A  1  146 ? 102.090 24.752  11.306  1.00 29.97  ? 146  ARG C C   1 
ATOM   1137  O  O   . ARG A  1  146 ? 101.628 23.838  11.997  1.00 29.68  ? 146  ARG C O   1 
ATOM   1138  C  CB  . ARG A  1  146 ? 101.817 26.996  12.397  1.00 26.92  ? 146  ARG C CB  1 
ATOM   1139  C  CG  . ARG A  1  146 ? 102.654 28.190  11.970  1.00 29.95  ? 146  ARG C CG  1 
ATOM   1140  C  CD  . ARG A  1  146 ? 102.183 28.821  10.681  1.00 34.10  ? 146  ARG C CD  1 
ATOM   1141  N  NE  . ARG A  1  146 ? 103.331 29.317  9.917   1.00 42.14  ? 146  ARG C NE  1 
ATOM   1142  C  CZ  . ARG A  1  146 ? 103.277 29.833  8.687   1.00 42.14  ? 146  ARG C CZ  1 
ATOM   1143  N  NH1 . ARG A  1  146 ? 102.111 30.131  8.114   1.00 37.66  ? 146  ARG C NH1 1 
ATOM   1144  N  NH2 . ARG A  1  146 ? 104.408 30.187  8.089   1.00 42.44  ? 146  ARG C NH2 1 
ATOM   1145  N  N   . TYR A  1  147 ? 103.054 24.580  10.400  1.00 32.36  ? 147  TYR C N   1 
ATOM   1146  C  CA  . TYR A  1  147 ? 104.001 23.460  10.423  1.00 37.18  ? 147  TYR C CA  1 
ATOM   1147  C  C   . TYR A  1  147 ? 105.310 23.904  11.059  1.00 37.39  ? 147  TYR C C   1 
ATOM   1148  O  O   . TYR A  1  147 ? 105.546 25.102  11.250  1.00 42.67  ? 147  TYR C O   1 
ATOM   1149  C  CB  . TYR A  1  147 ? 104.287 22.949  9.003   1.00 37.62  ? 147  TYR C CB  1 
ATOM   1150  C  CG  . TYR A  1  147 ? 103.130 22.219  8.384   1.00 44.05  ? 147  TYR C CG  1 
ATOM   1151  C  CD1 . TYR A  1  147 ? 102.884 20.880  8.683   1.00 48.48  ? 147  TYR C CD1 1 
ATOM   1152  C  CD2 . TYR A  1  147 ? 102.185 22.905  7.625   1.00 51.09  ? 147  TYR C CD2 1 
ATOM   1153  C  CE1 . TYR A  1  147 ? 101.709 20.245  8.252   1.00 53.79  ? 147  TYR C CE1 1 
ATOM   1154  C  CE2 . TYR A  1  147 ? 101.002 22.287  7.190   1.00 55.20  ? 147  TYR C CE2 1 
ATOM   1155  C  CZ  . TYR A  1  147 ? 100.766 20.958  7.508   1.00 57.21  ? 147  TYR C CZ  1 
ATOM   1156  O  OH  . TYR A  1  147 ? 99.574  20.374  7.106   1.00 61.56  ? 147  TYR C OH  1 
ATOM   1157  N  N   . LEU A  1  148 ? 106.218 22.953  11.251  1.00 36.43  ? 148  LEU C N   1 
ATOM   1158  C  CA  . LEU A  1  148 ? 107.488 23.251  11.886  1.00 33.68  ? 148  LEU C CA  1 
ATOM   1159  C  C   . LEU A  1  148 ? 108.410 23.967  10.920  1.00 34.05  ? 148  LEU C C   1 
ATOM   1160  O  O   . LEU A  1  148 ? 109.555 24.230  11.238  1.00 36.99  ? 148  LEU C O   1 
ATOM   1161  C  CB  . LEU A  1  148 ? 108.145 21.976  12.429  1.00 33.54  ? 148  LEU C CB  1 
ATOM   1162  C  CG  . LEU A  1  148 ? 107.398 21.313  13.598  1.00 36.38  ? 148  LEU C CG  1 
ATOM   1163  C  CD1 . LEU A  1  148 ? 108.205 20.174  14.137  1.00 36.00  ? 148  LEU C CD1 1 
ATOM   1164  C  CD2 . LEU A  1  148 ? 107.105 22.310  14.703  1.00 36.98  ? 148  LEU C CD2 1 
ATOM   1165  N  N   . GLU A  1  149 ? 107.865 24.402  9.796   1.00 34.41  ? 149  GLU C N   1 
ATOM   1166  C  CA  . GLU A  1  149 ? 108.559 25.323  8.920   1.00 36.14  ? 149  GLU C CA  1 
ATOM   1167  C  C   . GLU A  1  149 ? 107.526 26.267  8.330   1.00 35.03  ? 149  GLU C C   1 
ATOM   1168  O  O   . GLU A  1  149 ? 106.357 25.911  8.199   1.00 32.43  ? 149  GLU C O   1 
ATOM   1169  C  CB  . GLU A  1  149 ? 109.287 24.559  7.811   1.00 41.56  ? 149  GLU C CB  1 
ATOM   1170  C  CG  . GLU A  1  149 ? 108.387 23.697  6.932   1.00 57.65  ? 149  GLU C CG  1 
ATOM   1171  C  CD  . GLU A  1  149 ? 108.974 22.319  6.637   1.00 62.25  ? 149  GLU C CD  1 
ATOM   1172  O  OE1 . GLU A  1  149 ? 110.072 22.276  6.033   1.00 60.92  ? 149  GLU C OE1 1 
ATOM   1173  O  OE2 . GLU A  1  149 ? 108.322 21.296  6.993   1.00 65.48  ? 149  GLU C OE2 1 
ATOM   1174  N  N   . PRO A  1  150 ? 107.930 27.504  8.011   1.00 35.32  ? 150  PRO C N   1 
ATOM   1175  C  CA  . PRO A  1  150 ? 106.999 28.436  7.375   1.00 36.05  ? 150  PRO C CA  1 
ATOM   1176  C  C   . PRO A  1  150 ? 106.454 27.875  6.080   1.00 36.25  ? 150  PRO C C   1 
ATOM   1177  O  O   . PRO A  1  150 ? 107.197 27.338  5.254   1.00 40.47  ? 150  PRO C O   1 
ATOM   1178  C  CB  . PRO A  1  150 ? 107.849 29.678  7.119   1.00 33.77  ? 150  PRO C CB  1 
ATOM   1179  C  CG  . PRO A  1  150 ? 108.985 29.549  8.033   1.00 30.52  ? 150  PRO C CG  1 
ATOM   1180  C  CD  . PRO A  1  150 ? 109.269 28.095  8.131   1.00 36.61  ? 150  PRO C CD  1 
ATOM   1181  N  N   . THR A  1  151 ? 105.195 28.176  5.827   1.00 35.60  ? 151  THR C N   1 
ATOM   1182  C  CA  . THR A  1  151 ? 104.545 27.760  4.600   1.00 33.84  ? 151  THR C CA  1 
ATOM   1183  C  C   . THR A  1  151 ? 103.728 28.937  4.071   1.00 31.24  ? 151  THR C C   1 
ATOM   1184  O  O   . THR A  1  151 ? 103.412 29.856  4.830   1.00 32.09  ? 151  THR C O   1 
ATOM   1185  C  CB  . THR A  1  151 ? 103.622 26.552  4.878   1.00 36.00  ? 151  THR C CB  1 
ATOM   1186  O  OG1 . THR A  1  151 ? 102.871 26.788  6.083   1.00 37.22  ? 151  THR C OG1 1 
ATOM   1187  C  CG2 . THR A  1  151 ? 104.445 25.274  5.039   1.00 30.81  ? 151  THR C CG2 1 
ATOM   1188  N  N   . LEU A  1  152 ? 103.401 28.914  2.782   1.00 28.66  ? 152  LEU C N   1 
ATOM   1189  C  CA  . LEU A  1  152 ? 102.535 29.920  2.175   1.00 30.96  ? 152  LEU C CA  1 
ATOM   1190  C  C   . LEU A  1  152 ? 101.620 29.257  1.154   1.00 31.37  ? 152  LEU C C   1 
ATOM   1191  O  O   . LEU A  1  152 ? 101.949 28.202  0.613   1.00 35.50  ? 152  LEU C O   1 
ATOM   1192  C  CB  . LEU A  1  152 ? 103.376 30.985  1.479   1.00 31.02  ? 152  LEU C CB  1 
ATOM   1193  C  CG  . LEU A  1  152 ? 103.378 32.416  2.018   1.00 35.10  ? 152  LEU C CG  1 
ATOM   1194  C  CD1 . LEU A  1  152 ? 103.057 32.490  3.510   1.00 32.91  ? 152  LEU C CD1 1 
ATOM   1195  C  CD2 . LEU A  1  152 ? 104.750 33.001  1.726   1.00 36.44  ? 152  LEU C CD2 1 
ATOM   1196  N  N   . PRO A  1  153 ? 100.519 29.924  0.792   1.00 28.73  ? 153  PRO C N   1 
ATOM   1197  C  CA  . PRO A  1  153 ? 99.835  31.066  1.413   1.00 29.47  ? 153  PRO C CA  1 
ATOM   1198  C  C   . PRO A  1  153 ? 99.374  30.727  2.816   1.00 31.03  ? 153  PRO C C   1 
ATOM   1199  O  O   . PRO A  1  153 ? 99.185  29.550  3.137   1.00 33.06  ? 153  PRO C O   1 
ATOM   1200  C  CB  . PRO A  1  153 ? 98.657  31.286  0.488   1.00 32.36  ? 153  PRO C CB  1 
ATOM   1201  C  CG  . PRO A  1  153 ? 98.750  30.304  -0.626  1.00 31.12  ? 153  PRO C CG  1 
ATOM   1202  C  CD  . PRO A  1  153 ? 99.650  29.188  -0.123  1.00 26.06  ? 153  PRO C CD  1 
ATOM   1203  N  N   . LEU A  1  154 ? 99.208  31.748  3.655   1.00 27.95  ? 154  LEU C N   1 
ATOM   1204  C  CA  . LEU A  1  154 ? 98.827  31.519  5.042   1.00 27.83  ? 154  LEU C CA  1 
ATOM   1205  C  C   . LEU A  1  154 ? 97.494  30.802  5.082   1.00 28.00  ? 154  LEU C C   1 
ATOM   1206  O  O   . LEU A  1  154 ? 97.297  29.868  5.859   1.00 29.52  ? 154  LEU C O   1 
ATOM   1207  C  CB  . LEU A  1  154 ? 98.732  32.831  5.818   1.00 25.88  ? 154  LEU C CB  1 
ATOM   1208  C  CG  . LEU A  1  154 ? 100.032 33.607  6.042   1.00 28.42  ? 154  LEU C CG  1 
ATOM   1209  C  CD1 . LEU A  1  154 ? 99.741  34.855  6.868   1.00 22.69  ? 154  LEU C CD1 1 
ATOM   1210  C  CD2 . LEU A  1  154 ? 101.071 32.719  6.728   1.00 27.99  ? 154  LEU C CD2 1 
ATOM   1211  N  N   . ASN A  1  155 ? 96.599  31.190  4.191   1.00 26.58  ? 155  ASN C N   1 
ATOM   1212  C  CA  . ASN A  1  155 ? 95.342  30.500  4.091   1.00 26.83  ? 155  ASN C CA  1 
ATOM   1213  C  C   . ASN A  1  155 ? 95.577  29.313  3.194   1.00 28.05  ? 155  ASN C C   1 
ATOM   1214  O  O   . ASN A  1  155 ? 95.951  29.464  2.022   1.00 25.01  ? 155  ASN C O   1 
ATOM   1215  C  CB  . ASN A  1  155 ? 94.287  31.398  3.491   1.00 29.93  ? 155  ASN C CB  1 
ATOM   1216  C  CG  . ASN A  1  155 ? 92.921  30.834  3.650   1.00 33.32  ? 155  ASN C CG  1 
ATOM   1217  O  OD1 . ASN A  1  155 ? 92.759  29.627  3.674   1.00 35.79  ? 155  ASN C OD1 1 
ATOM   1218  N  ND2 . ASN A  1  155 ? 91.939  31.692  3.862   1.00 38.22  ? 155  ASN C ND2 1 
ATOM   1219  N  N   . ASN A  1  156 ? 95.482  28.130  3.783   1.00 27.19  ? 156  ASN C N   1 
ATOM   1220  C  CA  . ASN A  1  156 ? 95.787  26.913  3.051   1.00 32.51  ? 156  ASN C CA  1 
ATOM   1221  C  C   . ASN A  1  156 ? 94.688  26.539  2.052   1.00 36.09  ? 156  ASN C C   1 
ATOM   1222  O  O   . ASN A  1  156 ? 94.844  25.623  1.242   1.00 41.45  ? 156  ASN C O   1 
ATOM   1223  C  CB  . ASN A  1  156 ? 96.079  25.750  4.014   1.00 30.59  ? 156  ASN C CB  1 
ATOM   1224  C  CG  . ASN A  1  156 ? 94.913  25.416  4.923   1.00 32.65  ? 156  ASN C CG  1 
ATOM   1225  O  OD1 . ASN A  1  156 ? 93.773  25.249  4.473   1.00 31.85  ? 156  ASN C OD1 1 
ATOM   1226  N  ND2 . ASN A  1  156 ? 95.201  25.278  6.211   1.00 28.63  ? 156  ASN C ND2 1 
ATOM   1227  N  N   . ARG A  1  157 ? 93.648  27.355  1.997   1.00 35.07  ? 157  ARG C N   1 
ATOM   1228  C  CA  . ARG A  1  157 ? 92.633  27.174  0.982   1.00 35.74  ? 157  ARG C CA  1 
ATOM   1229  C  C   . ARG A  1  157 ? 93.030  27.802  -0.347  1.00 40.97  ? 157  ARG C C   1 
ATOM   1230  O  O   . ARG A  1  157 ? 92.247  27.767  -1.301  1.00 49.71  ? 157  ARG C O   1 
ATOM   1231  C  CB  . ARG A  1  157 ? 91.300  27.752  1.464   1.00 33.35  ? 157  ARG C CB  1 
ATOM   1232  C  CG  . ARG A  1  157 ? 90.719  27.002  2.656   1.00 29.87  ? 157  ARG C CG  1 
ATOM   1233  C  CD  . ARG A  1  157 ? 89.441  27.626  3.145   1.00 26.53  ? 157  ARG C CD  1 
ATOM   1234  N  NE  . ARG A  1  157 ? 88.931  26.972  4.344   1.00 24.36  ? 157  ARG C NE  1 
ATOM   1235  C  CZ  . ARG A  1  157 ? 87.923  27.441  5.064   1.00 25.99  ? 157  ARG C CZ  1 
ATOM   1236  N  NH1 . ARG A  1  157 ? 87.363  28.599  4.738   1.00 29.40  ? 157  ARG C NH1 1 
ATOM   1237  N  NH2 . ARG A  1  157 ? 87.499  26.779  6.132   1.00 30.85  ? 157  ARG C NH2 1 
ATOM   1238  N  N   . GLU A  1  158 ? 94.198  28.437  -0.401  1.00 40.10  ? 158  GLU C N   1 
ATOM   1239  C  CA  . GLU A  1  158 ? 94.677  29.029  -1.643  1.00 39.34  ? 158  GLU C CA  1 
ATOM   1240  C  C   . GLU A  1  158 ? 95.739  28.129  -2.272  1.00 42.00  ? 158  GLU C C   1 
ATOM   1241  O  O   . GLU A  1  158 ? 96.348  27.307  -1.579  1.00 44.42  ? 158  GLU C O   1 
ATOM   1242  C  CB  . GLU A  1  158 ? 95.241  30.411  -1.365  1.00 41.11  ? 158  GLU C CB  1 
ATOM   1243  C  CG  . GLU A  1  158 ? 94.180  31.421  -0.982  1.00 48.01  ? 158  GLU C CG  1 
ATOM   1244  C  CD  . GLU A  1  158 ? 94.758  32.719  -0.436  1.00 54.71  ? 158  GLU C CD  1 
ATOM   1245  O  OE1 . GLU A  1  158 ? 95.825  33.156  -0.921  1.00 55.05  ? 158  GLU C OE1 1 
ATOM   1246  O  OE2 . GLU A  1  158 ? 94.124  33.322  0.466   1.00 58.99  ? 158  GLU C OE2 1 
ATOM   1247  N  N   . THR A  1  159 ? 95.864  28.179  -3.596  1.00 42.48  ? 159  THR C N   1 
ATOM   1248  C  CA  . THR A  1  159 ? 96.818  27.325  -4.298  1.00 41.87  ? 159  THR C CA  1 
ATOM   1249  C  C   . THR A  1  159 ? 98.213  27.950  -4.243  1.00 41.94  ? 159  THR C C   1 
ATOM   1250  O  O   . THR A  1  159 ? 98.378  29.137  -4.555  1.00 45.98  ? 159  THR C O   1 
ATOM   1251  C  CB  . THR A  1  159 ? 96.408  27.126  -5.773  0.00 42.14  ? 159  THR C CB  1 
ATOM   1252  O  OG1 . THR A  1  159 ? 95.818  28.332  -6.277  0.00 42.22  ? 159  THR C OG1 1 
ATOM   1253  C  CG2 . THR A  1  159 ? 95.408  25.988  -5.896  0.00 42.22  ? 159  THR C CG2 1 
ATOM   1254  N  N   . PRO A  1  160 ? 99.222  27.192  -3.772  1.00 39.15  ? 160  PRO C N   1 
ATOM   1255  C  CA  . PRO A  1  160 ? 100.574 27.739  -3.634  1.00 40.11  ? 160  PRO C CA  1 
ATOM   1256  C  C   . PRO A  1  160 ? 101.133 28.023  -5.000  1.00 41.58  ? 160  PRO C C   1 
ATOM   1257  O  O   . PRO A  1  160 ? 100.896 27.255  -5.928  1.00 50.05  ? 160  PRO C O   1 
ATOM   1258  C  CB  . PRO A  1  160 ? 101.362 26.611  -2.969  1.00 37.84  ? 160  PRO C CB  1 
ATOM   1259  C  CG  . PRO A  1  160 ? 100.351 25.727  -2.387  1.00 37.68  ? 160  PRO C CG  1 
ATOM   1260  C  CD  . PRO A  1  160 ? 99.165  25.803  -3.305  1.00 36.88  ? 160  PRO C CD  1 
ATOM   1261  N  N   . THR A  1  161 ? 101.923 29.076  -5.126  1.00 40.36  ? 161  THR C N   1 
ATOM   1262  C  CA  . THR A  1  161 ? 102.752 29.202  -6.312  1.00 41.15  ? 161  THR C CA  1 
ATOM   1263  C  C   . THR A  1  161 ? 103.948 28.252  -6.175  1.00 43.84  ? 161  THR C C   1 
ATOM   1264  O  O   . THR A  1  161 ? 104.098 27.546  -5.159  1.00 42.44  ? 161  THR C O   1 
ATOM   1265  C  CB  . THR A  1  161 ? 103.251 30.630  -6.496  1.00 38.56  ? 161  THR C CB  1 
ATOM   1266  O  OG1 . THR A  1  161 ? 104.044 30.997  -5.364  1.00 42.17  ? 161  THR C OG1 1 
ATOM   1267  C  CG2 . THR A  1  161 ? 102.080 31.585  -6.617  1.00 37.96  ? 161  THR C CG2 1 
ATOM   1268  N  N   . HIS A  1  162 ? 104.765 28.184  -7.222  1.00 45.26  ? 162  HIS C N   1 
ATOM   1269  C  CA  . HIS A  1  162 ? 105.914 27.296  -7.189  1.00 45.68  ? 162  HIS C CA  1 
ATOM   1270  C  C   . HIS A  1  162 ? 106.800 27.731  -6.034  1.00 43.65  ? 162  HIS C C   1 
ATOM   1271  O  O   . HIS A  1  162 ? 107.006 26.970  -5.083  1.00 38.74  ? 162  HIS C O   1 
ATOM   1272  C  CB  . HIS A  1  162 ? 106.700 27.372  -8.499  1.00 51.57  ? 162  HIS C CB  1 
ATOM   1273  C  CG  . HIS A  1  162 ? 107.873 26.441  -8.548  1.00 58.94  ? 162  HIS C CG  1 
ATOM   1274  N  ND1 . HIS A  1  162 ? 107.810 25.140  -8.089  1.00 64.19  ? 162  HIS C ND1 1 
ATOM   1275  C  CD2 . HIS A  1  162 ? 109.163 26.650  -8.905  1.00 62.32  ? 162  HIS C CD2 1 
ATOM   1276  C  CE1 . HIS A  1  162 ? 109.011 24.592  -8.150  1.00 64.79  ? 162  HIS C CE1 1 
ATOM   1277  N  NE2 . HIS A  1  162 ? 109.850 25.488  -8.641  1.00 66.55  ? 162  HIS C NE2 1 
ATOM   1278  N  N   . VAL A  1  163 ? 107.103 29.030  -6.038  1.00 41.09  ? 163  VAL C N   1 
ATOM   1279  C  CA  . VAL A  1  163 ? 108.022 29.645  -5.099  1.00 36.35  ? 163  VAL C CA  1 
ATOM   1280  C  C   . VAL A  1  163 ? 107.481 29.541  -3.683  1.00 36.59  ? 163  VAL C C   1 
ATOM   1281  O  O   . VAL A  1  163 ? 108.255 29.409  -2.743  1.00 40.27  ? 163  VAL C O   1 
ATOM   1282  C  CB  . VAL A  1  163 ? 108.245 31.119  -5.454  1.00 34.52  ? 163  VAL C CB  1 
ATOM   1283  C  CG1 . VAL A  1  163 ? 109.446 31.659  -4.708  1.00 34.00  ? 163  VAL C CG1 1 
ATOM   1284  C  CG2 . VAL A  1  163 ? 108.430 31.265  -6.957  1.00 33.70  ? 163  VAL C CG2 1 
ATOM   1285  N  N   . GLU A  1  164 ? 106.152 29.507  -3.542  1.00 36.40  ? 164  GLU C N   1 
ATOM   1286  C  CA  . GLU A  1  164 ? 105.518 29.378  -2.226  1.00 32.07  ? 164  GLU C CA  1 
ATOM   1287  C  C   . GLU A  1  164 ? 105.642 27.994  -1.663  1.00 32.76  ? 164  GLU C C   1 
ATOM   1288  O  O   . GLU A  1  164 ? 105.538 27.808  -0.461  1.00 31.13  ? 164  GLU C O   1 
ATOM   1289  C  CB  . GLU A  1  164 ? 104.042 29.741  -2.281  1.00 30.51  ? 164  GLU C CB  1 
ATOM   1290  C  CG  . GLU A  1  164 ? 103.803 31.220  -2.444  1.00 30.43  ? 164  GLU C CG  1 
ATOM   1291  C  CD  . GLU A  1  164 ? 102.345 31.589  -2.564  1.00 32.66  ? 164  GLU C CD  1 
ATOM   1292  O  OE1 . GLU A  1  164 ? 101.488 30.690  -2.686  1.00 35.62  ? 164  GLU C OE1 1 
ATOM   1293  O  OE2 . GLU A  1  164 ? 102.052 32.796  -2.507  1.00 36.08  ? 164  GLU C OE2 1 
ATOM   1294  N  N   . ARG A  1  165 ? 105.731 27.006  -2.541  1.00 38.22  ? 165  ARG C N   1 
ATOM   1295  C  CA  . ARG A  1  165 ? 105.815 25.620  -2.103  1.00 40.93  ? 165  ARG C CA  1 
ATOM   1296  C  C   . ARG A  1  165 ? 107.012 25.453  -1.195  1.00 38.85  ? 165  ARG C C   1 
ATOM   1297  O  O   . ARG A  1  165 ? 108.096 25.934  -1.497  1.00 38.53  ? 165  ARG C O   1 
ATOM   1298  C  CB  . ARG A  1  165 ? 105.937 24.683  -3.302  1.00 47.88  ? 165  ARG C CB  1 
ATOM   1299  C  CG  . ARG A  1  165 ? 104.728 24.705  -4.217  1.00 52.61  ? 165  ARG C CG  1 
ATOM   1300  C  CD  . ARG A  1  165 ? 104.450 23.323  -4.790  1.00 59.48  ? 165  ARG C CD  1 
ATOM   1301  N  NE  . ARG A  1  165 ? 103.216 23.306  -5.583  1.00 66.26  ? 165  ARG C NE  1 
ATOM   1302  C  CZ  . ARG A  1  165 ? 102.028 22.916  -5.121  1.00 62.93  ? 165  ARG C CZ  1 
ATOM   1303  N  NH1 . ARG A  1  165 ? 101.912 22.434  -3.891  0.00 63.15  ? 165  ARG C NH1 1 
ATOM   1304  N  NH2 . ARG A  1  165 ? 100.959 22.975  -5.903  0.00 63.15  ? 165  ARG C NH2 1 
ATOM   1305  N  N   . VAL A  1  166 ? 106.813 24.729  -0.102  1.00 38.00  ? 166  VAL C N   1 
ATOM   1306  C  CA  . VAL A  1  166 ? 107.807 24.626  0.946   1.00 41.58  ? 166  VAL C CA  1 
ATOM   1307  C  C   . VAL A  1  166 ? 109.062 23.960  0.403   1.00 46.85  ? 166  VAL C C   1 
ATOM   1308  O  O   . VAL A  1  166 ? 110.132 24.021  1.014   1.00 49.66  ? 166  VAL C O   1 
ATOM   1309  C  CB  . VAL A  1  166 ? 107.243 23.828  2.158   1.00 41.80  ? 166  VAL C CB  1 
ATOM   1310  C  CG1 . VAL A  1  166 ? 107.375 22.336  1.934   1.00 41.41  ? 166  VAL C CG1 1 
ATOM   1311  C  CG2 . VAL A  1  166 ? 107.945 24.241  3.442   1.00 42.77  ? 166  VAL C CG2 1 
ATOM   1312  N  N   . GLU A  1  167 ? 108.926 23.345  -0.768  1.00 50.44  ? 167  GLU C N   1 
ATOM   1313  C  CA  . GLU A  1  167 ? 110.030 22.641  -1.406  1.00 52.83  ? 167  GLU C CA  1 
ATOM   1314  C  C   . GLU A  1  167 ? 110.934 23.593  -2.173  1.00 51.94  ? 167  GLU C C   1 
ATOM   1315  O  O   . GLU A  1  167 ? 112.108 23.294  -2.395  1.00 55.25  ? 167  GLU C O   1 
ATOM   1316  C  CB  . GLU A  1  167 ? 109.503 21.579  -2.371  1.00 56.33  ? 167  GLU C CB  1 
ATOM   1317  C  CG  . GLU A  1  167 ? 108.755 20.445  -1.712  1.00 60.82  ? 167  GLU C CG  1 
ATOM   1318  C  CD  . GLU A  1  167 ? 107.250 20.633  -1.737  1.00 65.06  ? 167  GLU C CD  1 
ATOM   1319  O  OE1 . GLU A  1  167 ? 106.738 21.414  -2.583  1.00 67.33  ? 167  GLU C OE1 1 
ATOM   1320  O  OE2 . GLU A  1  167 ? 106.578 19.966  -0.916  1.00 67.22  ? 167  GLU C OE2 1 
ATOM   1321  N  N   . THR A  1  168 ? 110.359 24.680  -2.673  1.00 49.15  ? 168  THR C N   1 
ATOM   1322  C  CA  . THR A  1  168 ? 111.105 25.680  -3.430  1.00 46.88  ? 168  THR C CA  1 
ATOM   1323  C  C   . THR A  1  168 ? 111.948 26.567  -2.493  1.00 49.76  ? 168  THR C C   1 
ATOM   1324  O  O   . THR A  1  168 ? 111.442 27.528  -1.906  1.00 54.53  ? 168  THR C O   1 
ATOM   1325  C  CB  . THR A  1  168 ? 110.118 26.541  -4.220  1.00 43.75  ? 168  THR C CB  1 
ATOM   1326  O  OG1 . THR A  1  168 ? 109.157 25.681  -4.848  1.00 40.47  ? 168  THR C OG1 1 
ATOM   1327  C  CG2 . THR A  1  168 ? 110.832 27.382  -5.256  1.00 40.20  ? 168  THR C CG2 1 
ATOM   1328  N  N   . ARG A  1  169 ? 113.233 26.247  -2.347  1.00 49.52  ? 169  ARG C N   1 
ATOM   1329  C  CA  . ARG A  1  169 ? 114.073 26.885  -1.326  1.00 45.12  ? 169  ARG C CA  1 
ATOM   1330  C  C   . ARG A  1  169 ? 114.307 28.363  -1.579  1.00 42.08  ? 169  ARG C C   1 
ATOM   1331  O  O   . ARG A  1  169 ? 114.472 29.135  -0.637  1.00 41.08  ? 169  ARG C O   1 
ATOM   1332  C  CB  . ARG A  1  169 ? 115.428 26.187  -1.227  1.00 47.84  ? 169  ARG C CB  1 
ATOM   1333  C  CG  . ARG A  1  169 ? 115.364 24.714  -0.825  1.00 47.33  ? 169  ARG C CG  1 
ATOM   1334  C  CD  . ARG A  1  169 ? 116.080 23.842  -1.837  0.00 43.48  ? 169  ARG C CD  1 
ATOM   1335  N  NE  . ARG A  1  169 ? 115.384 23.821  -3.120  0.00 40.97  ? 169  ARG C NE  1 
ATOM   1336  C  CZ  . ARG A  1  169 ? 115.567 22.895  -4.056  0.00 39.50  ? 169  ARG C CZ  1 
ATOM   1337  N  NH1 . ARG A  1  169 ? 116.478 21.945  -3.889  0.00 38.62  ? 169  ARG C NH1 1 
ATOM   1338  N  NH2 . ARG A  1  169 ? 114.858 22.936  -5.175  0.00 38.62  ? 169  ARG C NH2 1 
ATOM   1339  N  N   . SER A  1  170 ? 114.385 28.733  -2.855  1.00 38.28  ? 170  SER C N   1 
ATOM   1340  C  CA  . SER A  1  170 ? 114.535 30.124  -3.253  1.00 37.83  ? 170  SER C CA  1 
ATOM   1341  C  C   . SER A  1  170 ? 113.423 31.013  -2.709  1.00 39.01  ? 170  SER C C   1 
ATOM   1342  O  O   . SER A  1  170 ? 113.531 32.243  -2.741  1.00 41.19  ? 170  SER C O   1 
ATOM   1343  C  CB  . SER A  1  170 ? 114.556 30.239  -4.770  1.00 40.64  ? 170  SER C CB  1 
ATOM   1344  O  OG  . SER A  1  170 ? 113.431 29.599  -5.354  1.00 45.59  ? 170  SER C OG  1 
ATOM   1345  N  N   . GLY A  1  171 ? 112.345 30.390  -2.244  1.00 38.55  ? 171  GLY C N   1 
ATOM   1346  C  CA  . GLY A  1  171 ? 111.209 31.134  -1.740  1.00 36.46  ? 171  GLY C CA  1 
ATOM   1347  C  C   . GLY A  1  171 ? 111.140 31.173  -0.227  1.00 36.72  ? 171  GLY C C   1 
ATOM   1348  O  O   . GLY A  1  171 ? 110.172 31.709  0.332   1.00 38.91  ? 171  GLY C O   1 
ATOM   1349  N  N   . TYR A  1  172 ? 112.209 30.732  0.436   1.00 32.09  ? 172  TYR C N   1 
ATOM   1350  C  CA  . TYR A  1  172 ? 112.233 30.684  1.892   1.00 32.66  ? 172  TYR C CA  1 
ATOM   1351  C  C   . TYR A  1  172 ? 112.001 32.043  2.543   1.00 33.56  ? 172  TYR C C   1 
ATOM   1352  O  O   . TYR A  1  172 ? 111.113 32.191  3.388   1.00 34.81  ? 172  TYR C O   1 
ATOM   1353  C  CB  . TYR A  1  172 ? 113.559 30.134  2.398   1.00 35.63  ? 172  TYR C CB  1 
ATOM   1354  C  CG  . TYR A  1  172 ? 113.569 29.950  3.892   1.00 40.45  ? 172  TYR C CG  1 
ATOM   1355  C  CD1 . TYR A  1  172 ? 112.686 29.049  4.502   1.00 45.03  ? 172  TYR C CD1 1 
ATOM   1356  C  CD2 . TYR A  1  172 ? 114.478 30.635  4.700   1.00 39.87  ? 172  TYR C CD2 1 
ATOM   1357  C  CE1 . TYR A  1  172 ? 112.714 28.816  5.881   1.00 46.65  ? 172  TYR C CE1 1 
ATOM   1358  C  CE2 . TYR A  1  172 ? 114.517 30.410  6.092   1.00 46.07  ? 172  TYR C CE2 1 
ATOM   1359  C  CZ  . TYR A  1  172 ? 113.633 29.491  6.671   1.00 48.35  ? 172  TYR C CZ  1 
ATOM   1360  O  OH  . TYR A  1  172 ? 113.695 29.203  8.026   1.00 55.70  ? 172  TYR C OH  1 
ATOM   1361  N  N   . VAL A  1  173 ? 112.832 33.017  2.176   1.00 33.04  ? 173  VAL C N   1 
ATOM   1362  C  CA  . VAL A  1  173 ? 112.832 34.333  2.803   1.00 29.59  ? 173  VAL C CA  1 
ATOM   1363  C  C   . VAL A  1  173 ? 111.455 34.985  2.740   1.00 29.17  ? 173  VAL C C   1 
ATOM   1364  O  O   . VAL A  1  173 ? 111.003 35.589  3.707   1.00 32.22  ? 173  VAL C O   1 
ATOM   1365  C  CB  . VAL A  1  173 ? 113.891 35.245  2.141   1.00 28.21  ? 173  VAL C CB  1 
ATOM   1366  C  CG1 . VAL A  1  173 ? 113.624 36.718  2.473   1.00 22.46  ? 173  VAL C CG1 1 
ATOM   1367  C  CG2 . VAL A  1  173 ? 115.270 34.817  2.605   1.00 20.73  ? 173  VAL C CG2 1 
ATOM   1368  N  N   . VAL A  1  174 ? 110.733 34.723  1.660   1.00 28.83  ? 174  VAL C N   1 
ATOM   1369  C  CA  . VAL A  1  174 ? 109.395 35.257  1.492   1.00 23.96  ? 174  VAL C CA  1 
ATOM   1370  C  C   . VAL A  1  174 ? 108.389 34.505  2.355   1.00 23.08  ? 174  VAL C C   1 
ATOM   1371  O  O   . VAL A  1  174 ? 107.533 35.119  2.974   1.00 27.45  ? 174  VAL C O   1 
ATOM   1372  C  CB  . VAL A  1  174 ? 108.991 35.205  0.022   1.00 22.41  ? 174  VAL C CB  1 
ATOM   1373  C  CG1 . VAL A  1  174 ? 107.616 35.763  -0.164  1.00 21.99  ? 174  VAL C CG1 1 
ATOM   1374  C  CG2 . VAL A  1  174 ? 109.984 36.003  -0.786  1.00 21.15  ? 174  VAL C CG2 1 
ATOM   1375  N  N   . ARG A  1  175 ? 108.540 33.191  2.472   1.00 24.64  ? 175  ARG C N   1 
ATOM   1376  C  CA  . ARG A  1  175 ? 107.644 32.399  3.307   1.00 23.35  ? 175  ARG C CA  1 
ATOM   1377  C  C   . ARG A  1  175 ? 107.714 32.964  4.691   1.00 26.42  ? 175  ARG C C   1 
ATOM   1378  O  O   . ARG A  1  175 ? 106.723 32.979  5.412   1.00 27.95  ? 175  ARG C O   1 
ATOM   1379  C  CB  . ARG A  1  175 ? 108.078 30.937  3.368   1.00 27.08  ? 175  ARG C CB  1 
ATOM   1380  C  CG  . ARG A  1  175 ? 107.796 30.136  2.115   1.00 26.15  ? 175  ARG C CG  1 
ATOM   1381  C  CD  . ARG A  1  175 ? 107.780 28.651  2.439   1.00 29.05  ? 175  ARG C CD  1 
ATOM   1382  N  NE  . ARG A  1  175 ? 109.036 27.994  2.124   1.00 25.17  ? 175  ARG C NE  1 
ATOM   1383  C  CZ  . ARG A  1  175 ? 109.590 27.992  0.920   1.00 26.38  ? 175  ARG C CZ  1 
ATOM   1384  N  NH1 . ARG A  1  175 ? 108.900 28.372  -0.148  1.00 21.32  ? 175  ARG C NH1 1 
ATOM   1385  N  NH2 . ARG A  1  175 ? 110.810 27.507  0.777   1.00 29.53  ? 175  ARG C NH2 1 
ATOM   1386  N  N   . LEU A  1  176 ? 108.911 33.412  5.057   1.00 27.42  ? 176  LEU C N   1 
ATOM   1387  C  CA  . LEU A  1  176 ? 109.194 33.906  6.397   1.00 28.93  ? 176  LEU C CA  1 
ATOM   1388  C  C   . LEU A  1  176 ? 108.737 35.359  6.542   1.00 29.55  ? 176  LEU C C   1 
ATOM   1389  O  O   . LEU A  1  176 ? 108.024 35.689  7.487   1.00 30.75  ? 176  LEU C O   1 
ATOM   1390  C  CB  . LEU A  1  176 ? 110.696 33.776  6.691   1.00 30.25  ? 176  LEU C CB  1 
ATOM   1391  C  CG  . LEU A  1  176 ? 111.220 33.831  8.134   1.00 34.43  ? 176  LEU C CG  1 
ATOM   1392  C  CD1 . LEU A  1  176 ? 110.281 33.061  9.093   1.00 34.01  ? 176  LEU C CD1 1 
ATOM   1393  C  CD2 . LEU A  1  176 ? 112.636 33.260  8.176   1.00 28.21  ? 176  LEU C CD2 1 
ATOM   1394  N  N   . ALA A  1  177 ? 109.039 36.192  5.548   1.00 28.74  ? 177  ALA C N   1 
ATOM   1395  C  CA  . ALA A  1  177 ? 108.597 37.590  5.557   1.00 28.62  ? 177  ALA C CA  1 
ATOM   1396  C  C   . ALA A  1  177 ? 107.082 37.682  5.738   1.00 26.81  ? 177  ALA C C   1 
ATOM   1397  O  O   . ALA A  1  177 ? 106.584 38.427  6.582   1.00 33.28  ? 177  ALA C O   1 
ATOM   1398  C  CB  . ALA A  1  177 ? 109.026 38.305  4.268   1.00 18.82  ? 177  ALA C CB  1 
ATOM   1399  N  N   . LYS A  1  178 ? 106.362 36.806  5.064   1.00 24.71  ? 178  LYS C N   1 
ATOM   1400  C  CA  . LYS A  1  178 ? 104.919 36.862  5.100   1.00 23.42  ? 178  LYS C CA  1 
ATOM   1401  C  C   . LYS A  1  178 ? 104.318 36.337  6.405   1.00 24.81  ? 178  LYS C C   1 
ATOM   1402  O  O   . LYS A  1  178 ? 103.146 36.597  6.688   1.00 28.49  ? 178  LYS C O   1 
ATOM   1403  C  CB  . LYS A  1  178 ? 104.347 36.108  3.910   1.00 23.02  ? 178  LYS C CB  1 
ATOM   1404  C  CG  . LYS A  1  178 ? 104.625 36.789  2.590   1.00 22.15  ? 178  LYS C CG  1 
ATOM   1405  C  CD  . LYS A  1  178 ? 103.420 36.676  1.724   1.00 26.01  ? 178  LYS C CD  1 
ATOM   1406  C  CE  . LYS A  1  178 ? 103.671 37.227  0.352   1.00 30.53  ? 178  LYS C CE  1 
ATOM   1407  N  NZ  . LYS A  1  178 ? 102.448 36.988  -0.466  1.00 38.40  ? 178  LYS C NZ  1 
ATOM   1408  N  N   . TYR A  1  179 ? 105.127 35.684  7.240   1.00 19.49  ? 179  TYR C N   1 
ATOM   1409  C  CA  . TYR A  1  179 ? 104.659 35.278  8.556   1.00 18.06  ? 179  TYR C CA  1 
ATOM   1410  C  C   . TYR A  1  179 ? 104.978 36.328  9.641   1.00 21.01  ? 179  TYR C C   1 
ATOM   1411  O  O   . TYR A  1  179 ? 104.344 36.340  10.700  1.00 26.40  ? 179  TYR C O   1 
ATOM   1412  C  CB  . TYR A  1  179 ? 105.245 33.928  8.928   1.00 14.83  ? 179  TYR C CB  1 
ATOM   1413  C  CG  . TYR A  1  179 ? 104.578 33.291  10.133  1.00 25.56  ? 179  TYR C CG  1 
ATOM   1414  C  CD1 . TYR A  1  179 ? 103.224 32.940  10.110  1.00 22.42  ? 179  TYR C CD1 1 
ATOM   1415  C  CD2 . TYR A  1  179 ? 105.281 33.110  11.333  1.00 24.73  ? 179  TYR C CD2 1 
ATOM   1416  C  CE1 . TYR A  1  179 ? 102.583 32.409  11.265  1.00 21.87  ? 179  TYR C CE1 1 
ATOM   1417  C  CE2 . TYR A  1  179 ? 104.645 32.612  12.487  1.00 24.46  ? 179  TYR C CE2 1 
ATOM   1418  C  CZ  . TYR A  1  179 ? 103.306 32.254  12.442  1.00 23.82  ? 179  TYR C CZ  1 
ATOM   1419  O  OH  . TYR A  1  179 ? 102.719 31.722  13.571  1.00 29.40  ? 179  TYR C OH  1 
ATOM   1420  N  N   . THR A  1  180 ? 105.899 37.244  9.347   1.00 20.24  ? 180  THR C N   1 
ATOM   1421  C  CA  . THR A  1  180 ? 106.243 38.322  10.261  1.00 15.12  ? 180  THR C CA  1 
ATOM   1422  C  C   . THR A  1  180 ? 105.924 39.696  9.643   1.00 16.97  ? 180  THR C C   1 
ATOM   1423  O  O   . THR A  1  180 ? 106.759 40.588  9.618   1.00 15.53  ? 180  THR C O   1 
ATOM   1424  C  CB  . THR A  1  180 ? 107.721 38.253  10.642  1.00 13.67  ? 180  THR C CB  1 
ATOM   1425  O  OG1 . THR A  1  180 ? 108.526 38.471  9.477   1.00 15.64  ? 180  THR C OG1 1 
ATOM   1426  C  CG2 . THR A  1  180 ? 108.056 36.899  11.220  1.00 11.37  ? 180  THR C CG2 1 
ATOM   1427  N  N   . ALA A  1  181 ? 104.733 39.817  9.076   1.00 18.05  ? 181  ALA C N   1 
ATOM   1428  C  CA  . ALA A  1  181 ? 104.225 41.070  8.534   1.00 18.80  ? 181  ALA C CA  1 
ATOM   1429  C  C   . ALA A  1  181 ? 105.185 41.763  7.576   1.00 21.90  ? 181  ALA C C   1 
ATOM   1430  O  O   . ALA A  1  181 ? 105.259 42.995  7.514   1.00 20.63  ? 181  ALA C O   1 
ATOM   1431  C  CB  . ALA A  1  181 ? 103.857 41.977  9.644   1.00 16.19  ? 181  ALA C CB  1 
ATOM   1432  N  N   . TYR A  1  182 ? 105.901 40.948  6.815   1.00 23.30  ? 182  TYR C N   1 
ATOM   1433  C  CA  . TYR A  1  182 ? 106.760 41.405  5.726   1.00 25.51  ? 182  TYR C CA  1 
ATOM   1434  C  C   . TYR A  1  182 ? 108.108 41.937  6.155   1.00 27.74  ? 182  TYR C C   1 
ATOM   1435  O  O   . TYR A  1  182 ? 108.829 42.525  5.347   1.00 29.98  ? 182  TYR C O   1 
ATOM   1436  C  CB  . TYR A  1  182 ? 106.064 42.464  4.874   1.00 30.19  ? 182  TYR C CB  1 
ATOM   1437  C  CG  . TYR A  1  182 ? 105.067 41.876  3.928   1.00 34.37  ? 182  TYR C CG  1 
ATOM   1438  C  CD1 . TYR A  1  182 ? 103.839 41.428  4.390   1.00 35.52  ? 182  TYR C CD1 1 
ATOM   1439  C  CD2 . TYR A  1  182 ? 105.351 41.755  2.574   1.00 36.75  ? 182  TYR C CD2 1 
ATOM   1440  C  CE1 . TYR A  1  182 ? 102.915 40.883  3.534   1.00 35.59  ? 182  TYR C CE1 1 
ATOM   1441  C  CE2 . TYR A  1  182 ? 104.428 41.208  1.700   1.00 36.32  ? 182  TYR C CE2 1 
ATOM   1442  C  CZ  . TYR A  1  182 ? 103.208 40.782  2.190   1.00 37.93  ? 182  TYR C CZ  1 
ATOM   1443  O  OH  . TYR A  1  182 ? 102.239 40.309  1.336   1.00 47.66  ? 182  TYR C OH  1 
ATOM   1444  N  N   . SER A  1  183 ? 108.446 41.783  7.425   1.00 28.06  ? 183  SER C N   1 
ATOM   1445  C  CA  . SER A  1  183 ? 109.756 42.201  7.866   1.00 26.56  ? 183  SER C CA  1 
ATOM   1446  C  C   . SER A  1  183 ? 110.761 41.221  7.277   1.00 27.28  ? 183  SER C C   1 
ATOM   1447  O  O   . SER A  1  183 ? 110.384 40.137  6.829   1.00 31.23  ? 183  SER C O   1 
ATOM   1448  C  CB  . SER A  1  183 ? 109.828 42.148  9.376   1.00 24.15  ? 183  SER C CB  1 
ATOM   1449  O  OG  . SER A  1  183 ? 110.013 40.813  9.771   1.00 22.55  ? 183  SER C OG  1 
ATOM   1450  N  N   . ALA A  1  184 ? 112.044 41.549  7.385   1.00 26.58  ? 184  ALA C N   1 
ATOM   1451  C  CA  . ALA A  1  184 ? 113.107 40.654  6.936   1.00 23.68  ? 184  ALA C CA  1 
ATOM   1452  C  C   . ALA A  1  184 ? 113.721 39.864  8.099   1.00 21.72  ? 184  ALA C C   1 
ATOM   1453  O  O   . ALA A  1  184 ? 114.850 39.383  8.020   1.00 24.61  ? 184  ALA C O   1 
ATOM   1454  C  CB  . ALA A  1  184 ? 114.173 41.461  6.206   1.00 16.78  ? 184  ALA C CB  1 
ATOM   1455  N  N   . LEU A  1  185 ? 112.988 39.776  9.198   1.00 20.44  ? 185  LEU C N   1 
ATOM   1456  C  CA  . LEU A  1  185 ? 113.514 39.213  10.420  1.00 17.02  ? 185  LEU C CA  1 
ATOM   1457  C  C   . LEU A  1  185 ? 113.709 37.754  10.213  1.00 21.18  ? 185  LEU C C   1 
ATOM   1458  O  O   . LEU A  1  185 ? 112.787 37.015  9.883   1.00 21.86  ? 185  LEU C O   1 
ATOM   1459  C  CB  . LEU A  1  185 ? 112.553 39.455  11.568  1.00 13.55  ? 185  LEU C CB  1 
ATOM   1460  C  CG  . LEU A  1  185 ? 112.661 40.897  12.059  1.00 12.87  ? 185  LEU C CG  1 
ATOM   1461  C  CD1 . LEU A  1  185 ? 111.402 41.362  12.737  1.00 7.85   ? 185  LEU C CD1 1 
ATOM   1462  C  CD2 . LEU A  1  185 ? 113.819 40.953  13.015  1.00 14.97  ? 185  LEU C CD2 1 
ATOM   1463  N  N   . ASN A  1  186 ? 114.927 37.319  10.433  1.00 25.33  ? 186  ASN C N   1 
ATOM   1464  C  CA  . ASN A  1  186 ? 115.296 36.012  9.967   1.00 24.22  ? 186  ASN C CA  1 
ATOM   1465  C  C   . ASN A  1  186 ? 114.949 34.939  10.987  1.00 23.18  ? 186  ASN C C   1 
ATOM   1466  O  O   . ASN A  1  186 ? 115.750 34.045  11.252  1.00 20.18  ? 186  ASN C O   1 
ATOM   1467  C  CB  . ASN A  1  186 ? 116.779 36.001  9.632   1.00 24.71  ? 186  ASN C CB  1 
ATOM   1468  C  CG  . ASN A  1  186 ? 117.136 34.909  8.656   1.00 28.10  ? 186  ASN C CG  1 
ATOM   1469  O  OD1 . ASN A  1  186 ? 117.866 33.997  8.995   1.00 32.17  ? 186  ASN C OD1 1 
ATOM   1470  N  ND2 . ASN A  1  186 ? 116.552 34.950  7.465   1.00 28.91  ? 186  ASN C ND2 1 
ATOM   1471  N  N   . TYR A  1  187 ? 113.763 35.036  11.581  1.00 23.16  ? 187  TYR C N   1 
ATOM   1472  C  CA  . TYR A  1  187 ? 113.353 34.069  12.609  1.00 24.21  ? 187  TYR C CA  1 
ATOM   1473  C  C   . TYR A  1  187 ? 111.937 33.570  12.400  1.00 22.83  ? 187  TYR C C   1 
ATOM   1474  O  O   . TYR A  1  187 ? 111.101 34.272  11.847  1.00 24.57  ? 187  TYR C O   1 
ATOM   1475  C  CB  . TYR A  1  187 ? 113.473 34.693  13.992  1.00 24.48  ? 187  TYR C CB  1 
ATOM   1476  C  CG  . TYR A  1  187 ? 114.852 35.240  14.255  1.00 33.07  ? 187  TYR C CG  1 
ATOM   1477  C  CD1 . TYR A  1  187 ? 115.250 36.457  13.699  1.00 36.11  ? 187  TYR C CD1 1 
ATOM   1478  C  CD2 . TYR A  1  187 ? 115.805 34.482  14.933  1.00 28.81  ? 187  TYR C CD2 1 
ATOM   1479  C  CE1 . TYR A  1  187 ? 116.562 36.887  13.790  1.00 37.57  ? 187  TYR C CE1 1 
ATOM   1480  C  CE2 . TYR A  1  187 ? 117.111 34.914  15.048  1.00 30.65  ? 187  TYR C CE2 1 
ATOM   1481  C  CZ  . TYR A  1  187 ? 117.490 36.111  14.471  1.00 36.33  ? 187  TYR C CZ  1 
ATOM   1482  O  OH  . TYR A  1  187 ? 118.799 36.543  14.556  1.00 39.41  ? 187  TYR C OH  1 
ATOM   1483  N  N   . ASP A  1  188 ? 111.664 32.353  12.839  1.00 23.88  ? 188  ASP C N   1 
ATOM   1484  C  CA  . ASP A  1  188 ? 110.305 31.838  12.784  1.00 26.94  ? 188  ASP C CA  1 
ATOM   1485  C  C   . ASP A  1  188 ? 109.780 31.774  14.206  1.00 27.11  ? 188  ASP C C   1 
ATOM   1486  O  O   . ASP A  1  188 ? 110.041 30.819  14.936  1.00 35.04  ? 188  ASP C O   1 
ATOM   1487  C  CB  . ASP A  1  188 ? 110.278 30.453  12.098  1.00 32.06  ? 188  ASP C CB  1 
ATOM   1488  C  CG  . ASP A  1  188 ? 108.926 29.726  12.222  1.00 36.53  ? 188  ASP C CG  1 
ATOM   1489  O  OD1 . ASP A  1  188 ? 107.873 30.373  12.388  1.00 41.33  ? 188  ASP C OD1 1 
ATOM   1490  O  OD2 . ASP A  1  188 ? 108.910 28.486  12.084  1.00 38.86  ? 188  ASP C OD2 1 
ATOM   1491  N  N   . PRO A  1  189 ? 108.955 32.753  14.591  1.00 24.49  ? 189  PRO C N   1 
ATOM   1492  C  CA  . PRO A  1  189 ? 108.454 32.822  15.965  1.00 21.13  ? 189  PRO C CA  1 
ATOM   1493  C  C   . PRO A  1  189 ? 107.556 31.659  16.359  1.00 22.94  ? 189  PRO C C   1 
ATOM   1494  O  O   . PRO A  1  189 ? 107.311 31.441  17.545  1.00 27.13  ? 189  PRO C O   1 
ATOM   1495  C  CB  . PRO A  1  189 ? 107.708 34.147  16.002  1.00 19.78  ? 189  PRO C CB  1 
ATOM   1496  C  CG  . PRO A  1  189 ? 107.312 34.379  14.607  1.00 21.14  ? 189  PRO C CG  1 
ATOM   1497  C  CD  . PRO A  1  189 ? 108.443 33.860  13.771  1.00 19.48  ? 189  PRO C CD  1 
ATOM   1498  N  N   . PHE A  1  190 ? 107.045 30.920  15.379  1.00 26.51  ? 190  PHE C N   1 
ATOM   1499  C  CA  . PHE A  1  190 ? 106.116 29.836  15.693  1.00 26.27  ? 190  PHE C CA  1 
ATOM   1500  C  C   . PHE A  1  190 ? 106.873 28.701  16.339  1.00 26.24  ? 190  PHE C C   1 
ATOM   1501  O  O   . PHE A  1  190 ? 106.584 28.310  17.467  1.00 29.47  ? 190  PHE C O   1 
ATOM   1502  C  CB  . PHE A  1  190 ? 105.374 29.319  14.451  1.00 25.61  ? 190  PHE C CB  1 
ATOM   1503  C  CG  . PHE A  1  190 ? 104.580 28.071  14.714  1.00 22.72  ? 190  PHE C CG  1 
ATOM   1504  C  CD1 . PHE A  1  190 ? 103.471 28.113  15.557  1.00 19.26  ? 190  PHE C CD1 1 
ATOM   1505  C  CD2 . PHE A  1  190 ? 105.097 26.824  14.358  1.00 26.66  ? 190  PHE C CD2 1 
ATOM   1506  C  CE1 . PHE A  1  190 ? 102.911 26.941  16.067  1.00 18.03  ? 190  PHE C CE1 1 
ATOM   1507  C  CE2 . PHE A  1  190 ? 104.550 25.649  14.868  1.00 21.38  ? 190  PHE C CE2 1 
ATOM   1508  C  CZ  . PHE A  1  190 ? 103.459 25.712  15.729  1.00 21.61  ? 190  PHE C CZ  1 
ATOM   1509  N  N   . THR A  1  191 ? 107.912 28.244  15.664  1.00 26.28  ? 191  THR C N   1 
ATOM   1510  C  CA  . THR A  1  191 ? 108.682 27.120  16.163  1.00 30.16  ? 191  THR C CA  1 
ATOM   1511  C  C   . THR A  1  191 ? 109.565 27.524  17.359  1.00 28.54  ? 191  THR C C   1 
ATOM   1512  O  O   . THR A  1  191 ? 109.726 26.758  18.320  1.00 30.11  ? 191  THR C O   1 
ATOM   1513  C  CB  . THR A  1  191 ? 109.535 26.503  15.029  1.00 31.61  ? 191  THR C CB  1 
ATOM   1514  O  OG1 . THR A  1  191 ? 110.463 27.475  14.541  1.00 38.77  ? 191  THR C OG1 1 
ATOM   1515  C  CG2 . THR A  1  191 ? 108.648 26.077  13.874  1.00 29.67  ? 191  THR C CG2 1 
ATOM   1516  N  N   . MET A  1  192 ? 110.009 28.775  17.371  1.00 24.58  ? 192  MET C N   1 
ATOM   1517  C  CA  . MET A  1  192 ? 110.768 29.282  18.509  1.00 21.60  ? 192  MET C CA  1 
ATOM   1518  C  C   . MET A  1  192 ? 109.941 29.475  19.763  1.00 19.81  ? 192  MET C C   1 
ATOM   1519  O  O   . MET A  1  192 ? 110.391 29.180  20.862  1.00 24.30  ? 192  MET C O   1 
ATOM   1520  C  CB  . MET A  1  192 ? 111.442 30.589  18.138  1.00 21.25  ? 192  MET C CB  1 
ATOM   1521  C  CG  . MET A  1  192 ? 112.487 30.395  17.107  1.00 20.12  ? 192  MET C CG  1 
ATOM   1522  S  SD  . MET A  1  192 ? 113.444 31.853  16.764  1.00 29.43  ? 192  MET C SD  1 
ATOM   1523  C  CE  . MET A  1  192 ? 113.959 32.335  18.402  1.00 23.35  ? 192  MET C CE  1 
ATOM   1524  N  N   . PHE A  1  193 ? 108.709 29.925  19.597  1.00 21.79  ? 193  PHE C N   1 
ATOM   1525  C  CA  . PHE A  1  193 ? 107.962 30.429  20.724  1.00 20.53  ? 193  PHE C CA  1 
ATOM   1526  C  C   . PHE A  1  193 ? 106.690 29.694  21.031  1.00 23.87  ? 193  PHE C C   1 
ATOM   1527  O  O   . PHE A  1  193 ? 106.305 29.619  22.199  1.00 25.99  ? 193  PHE C O   1 
ATOM   1528  C  CB  . PHE A  1  193 ? 107.647 31.903  20.514  1.00 18.53  ? 193  PHE C CB  1 
ATOM   1529  C  CG  . PHE A  1  193 ? 108.803 32.784  20.758  1.00 20.95  ? 193  PHE C CG  1 
ATOM   1530  C  CD1 . PHE A  1  193 ? 109.525 32.669  21.940  1.00 20.61  ? 193  PHE C CD1 1 
ATOM   1531  C  CD2 . PHE A  1  193 ? 109.295 33.588  19.748  1.00 22.51  ? 193  PHE C CD2 1 
ATOM   1532  C  CE1 . PHE A  1  193 ? 110.736 33.324  22.107  1.00 20.81  ? 193  PHE C CE1 1 
ATOM   1533  C  CE2 . PHE A  1  193 ? 110.507 34.252  19.909  1.00 25.55  ? 193  PHE C CE2 1 
ATOM   1534  C  CZ  . PHE A  1  193 ? 111.232 34.111  21.095  1.00 20.87  ? 193  PHE C CZ  1 
ATOM   1535  N  N   . LEU A  1  194 ? 105.937 29.341  19.988  1.00 24.60  ? 194  LEU C N   1 
ATOM   1536  C  CA  . LEU A  1  194 ? 104.564 28.867  20.176  1.00 25.51  ? 194  LEU C CA  1 
ATOM   1537  C  C   . LEU A  1  194 ? 104.379 27.347  20.139  1.00 24.48  ? 194  LEU C C   1 
ATOM   1538  O  O   . LEU A  1  194 ? 103.381 26.821  20.625  1.00 23.86  ? 194  LEU C O   1 
ATOM   1539  C  CB  . LEU A  1  194 ? 103.648 29.530  19.153  1.00 26.52  ? 194  LEU C CB  1 
ATOM   1540  C  CG  . LEU A  1  194 ? 103.563 31.048  19.320  1.00 30.37  ? 194  LEU C CG  1 
ATOM   1541  C  CD1 . LEU A  1  194 ? 102.785 31.670  18.172  1.00 25.44  ? 194  LEU C CD1 1 
ATOM   1542  C  CD2 . LEU A  1  194 ? 102.915 31.372  20.665  1.00 30.43  ? 194  LEU C CD2 1 
ATOM   1543  N  N   . ALA A  1  195 ? 105.356 26.641  19.591  1.00 25.14  ? 195  ALA C N   1 
ATOM   1544  C  CA  . ALA A  1  195 ? 105.259 25.196  19.458  1.00 25.44  ? 195  ALA C CA  1 
ATOM   1545  C  C   . ALA A  1  195 ? 105.386 24.555  20.822  1.00 29.48  ? 195  ALA C C   1 
ATOM   1546  O  O   . ALA A  1  195 ? 104.820 23.493  21.074  1.00 32.65  ? 195  ALA C O   1 
ATOM   1547  C  CB  . ALA A  1  195 ? 106.354 24.678  18.540  1.00 23.89  ? 195  ALA C CB  1 
ATOM   1548  N  N   . ASN A  1  196 ? 106.165 25.185  21.690  1.00 31.53  ? 196  ASN C N   1 
ATOM   1549  C  CA  . ASN A  1  196 ? 106.453 24.627  23.001  1.00 34.72  ? 196  ASN C CA  1 
ATOM   1550  C  C   . ASN A  1  196 ? 106.853 25.745  23.941  1.00 36.13  ? 196  ASN C C   1 
ATOM   1551  O  O   . ASN A  1  196 ? 106.992 26.901  23.527  1.00 38.32  ? 196  ASN C O   1 
ATOM   1552  C  CB  . ASN A  1  196 ? 107.599 23.639  22.903  1.00 37.04  ? 196  ASN C CB  1 
ATOM   1553  C  CG  . ASN A  1  196 ? 108.838 24.267  22.340  1.00 41.20  ? 196  ASN C CG  1 
ATOM   1554  O  OD1 . ASN A  1  196 ? 109.211 25.372  22.729  1.00 50.26  ? 196  ASN C OD1 1 
ATOM   1555  N  ND2 . ASN A  1  196 ? 109.435 23.621  21.356  1.00 40.99  ? 196  ASN C ND2 1 
ATOM   1556  N  N   . ASP A  1  197 ? 107.245 25.359  25.143  1.00 35.72  ? 197  ASP C N   1 
ATOM   1557  C  CA  . ASP A  1  197 ? 107.555 26.330  26.178  1.00 36.96  ? 197  ASP C CA  1 
ATOM   1558  C  C   . ASP A  1  197 ? 109.052 26.480  26.451  1.00 35.88  ? 197  ASP C C   1 
ATOM   1559  O  O   . ASP A  1  197 ? 109.440 26.939  27.523  1.00 35.92  ? 197  ASP C O   1 
ATOM   1560  C  CB  . ASP A  1  197 ? 106.831 25.957  27.465  1.00 37.29  ? 197  ASP C CB  1 
ATOM   1561  C  CG  . ASP A  1  197 ? 107.237 24.593  28.002  1.00 39.12  ? 197  ASP C CG  1 
ATOM   1562  O  OD1 . ASP A  1  197 ? 107.940 23.813  27.309  1.00 41.39  ? 197  ASP C OD1 1 
ATOM   1563  O  OD2 . ASP A  1  197 ? 106.807 24.289  29.134  1.00 45.89  ? 197  ASP C OD2 1 
ATOM   1564  N  N   . LYS A  1  198 ? 109.879 26.154  25.463  1.00 34.58  ? 198  LYS C N   1 
ATOM   1565  C  CA  . LYS A  1  198 ? 111.328 26.128  25.664  1.00 34.88  ? 198  LYS C CA  1 
ATOM   1566  C  C   . LYS A  1  198 ? 111.967 27.512  25.759  1.00 33.69  ? 198  LYS C C   1 
ATOM   1567  O  O   . LYS A  1  198 ? 112.964 27.674  26.457  1.00 36.15  ? 198  LYS C O   1 
ATOM   1568  C  CB  . LYS A  1  198 ? 112.016 25.327  24.551  1.00 36.28  ? 198  LYS C CB  1 
ATOM   1569  C  CG  . LYS A  1  198 ? 111.934 23.793  24.703  1.00 39.94  ? 198  LYS C CG  1 
ATOM   1570  C  CD  . LYS A  1  198 ? 112.445 23.075  23.455  0.00 38.57  ? 198  LYS C CD  1 
ATOM   1571  C  CE  . LYS A  1  198 ? 113.941 23.282  23.247  0.00 38.88  ? 198  LYS C CE  1 
ATOM   1572  N  NZ  . LYS A  1  198 ? 114.244 24.400  22.306  0.00 38.51  ? 198  LYS C NZ  1 
ATOM   1573  N  N   . ARG A  1  199 ? 111.459 28.481  25.001  1.00 31.70  ? 199  ARG C N   1 
ATOM   1574  C  CA  . ARG A  1  199 ? 112.080 29.798  24.960  1.00 28.57  ? 199  ARG C CA  1 
ATOM   1575  C  C   . ARG A  1  199 ? 111.323 30.881  25.739  1.00 27.65  ? 199  ARG C C   1 
ATOM   1576  O  O   . ARG A  1  199 ? 110.177 30.694  26.137  1.00 28.39  ? 199  ARG C O   1 
ATOM   1577  C  CB  . ARG A  1  199 ? 112.318 30.223  23.516  1.00 24.16  ? 199  ARG C CB  1 
ATOM   1578  C  CG  . ARG A  1  199 ? 113.175 29.230  22.759  1.00 30.39  ? 199  ARG C CG  1 
ATOM   1579  C  CD  . ARG A  1  199 ? 113.903 29.862  21.588  1.00 34.73  ? 199  ARG C CD  1 
ATOM   1580  N  NE  . ARG A  1  199 ? 114.885 30.866  22.010  1.00 43.83  ? 199  ARG C NE  1 
ATOM   1581  C  CZ  . ARG A  1  199 ? 116.198 30.748  21.838  0.00 43.47  ? 199  ARG C CZ  1 
ATOM   1582  N  NH1 . ARG A  1  199 ? 116.702 29.683  21.227  0.00 45.02  ? 199  ARG C NH1 1 
ATOM   1583  N  NH2 . ARG A  1  199 ? 117.011 31.704  22.262  0.00 45.02  ? 199  ARG C NH2 1 
ATOM   1584  N  N   . GLN A  1  200 ? 112.079 31.884  26.174  1.00 27.93  ? 200  GLN C N   1 
ATOM   1585  C  CA  . GLN A  1  200 ? 111.565 32.989  26.974  1.00 28.52  ? 200  GLN C CA  1 
ATOM   1586  C  C   . GLN A  1  200 ? 111.392 34.207  26.049  1.00 28.47  ? 200  GLN C C   1 
ATOM   1587  O  O   . GLN A  1  200 ? 112.263 34.491  25.206  1.00 28.87  ? 200  GLN C O   1 
ATOM   1588  C  CB  . GLN A  1  200 ? 112.555 33.285  28.109  1.00 27.97  ? 200  GLN C CB  1 
ATOM   1589  C  CG  . GLN A  1  200 ? 112.223 34.485  28.995  1.00 43.14  ? 200  GLN C CG  1 
ATOM   1590  C  CD  . GLN A  1  200 ? 110.827 34.422  29.626  1.00 49.81  ? 200  GLN C CD  1 
ATOM   1591  O  OE1 . GLN A  1  200 ? 109.949 35.258  29.335  1.00 47.91  ? 200  GLN C OE1 1 
ATOM   1592  N  NE2 . GLN A  1  200 ? 110.633 33.465  30.532  1.00 52.88  ? 200  GLN C NE2 1 
ATOM   1593  N  N   . VAL A  1  201 ? 110.211 34.822  26.095  1.00 25.54  ? 201  VAL C N   1 
ATOM   1594  C  CA  . VAL A  1  201 ? 109.890 35.903  25.174  1.00 22.35  ? 201  VAL C CA  1 
ATOM   1595  C  C   . VAL A  1  201 ? 110.564 37.212  25.592  1.00 21.97  ? 201  VAL C C   1 
ATOM   1596  O  O   . VAL A  1  201 ? 110.964 38.003  24.742  1.00 23.42  ? 201  VAL C O   1 
ATOM   1597  C  CB  . VAL A  1  201 ? 108.366 36.119  25.062  1.00 18.82  ? 201  VAL C CB  1 
ATOM   1598  C  CG1 . VAL A  1  201 ? 108.069 37.224  24.109  1.00 20.91  ? 201  VAL C CG1 1 
ATOM   1599  C  CG2 . VAL A  1  201 ? 107.705 34.882  24.579  1.00 15.86  ? 201  VAL C CG2 1 
ATOM   1600  N  N   . ARG A  1  202 ? 110.738 37.413  26.895  1.00 23.94  ? 202  ARG C N   1 
ATOM   1601  C  CA  . ARG A  1  202 ? 111.252 38.684  27.412  1.00 23.62  ? 202  ARG C CA  1 
ATOM   1602  C  C   . ARG A  1  202 ? 112.742 38.726  27.253  1.00 24.45  ? 202  ARG C C   1 
ATOM   1603  O  O   . ARG A  1  202 ? 113.386 37.695  27.375  1.00 27.31  ? 202  ARG C O   1 
ATOM   1604  C  CB  . ARG A  1  202 ? 110.878 38.861  28.871  1.00 19.81  ? 202  ARG C CB  1 
ATOM   1605  C  CG  . ARG A  1  202 ? 109.385 39.013  29.026  1.00 23.73  ? 202  ARG C CG  1 
ATOM   1606  C  CD  . ARG A  1  202 ? 108.937 39.309  30.438  1.00 25.82  ? 202  ARG C CD  1 
ATOM   1607  N  NE  . ARG A  1  202 ? 107.535 38.947  30.605  1.00 27.56  ? 202  ARG C NE  1 
ATOM   1608  C  CZ  . ARG A  1  202 ? 106.789 39.319  31.633  1.00 28.64  ? 202  ARG C CZ  1 
ATOM   1609  N  NH1 . ARG A  1  202 ? 107.282 40.168  32.518  1.00 32.67  ? 202  ARG C NH1 1 
ATOM   1610  N  NH2 . ARG A  1  202 ? 105.553 38.849  31.771  1.00 28.88  ? 202  ARG C NH2 1 
ATOM   1611  N  N   . VAL A  1  203 ? 113.231 39.819  26.679  1.00 24.79  ? 203  VAL C N   1 
ATOM   1612  C  CA  . VAL A  1  203 ? 114.648 39.945  26.364  1.00 22.63  ? 203  VAL C CA  1 
ATOM   1613  C  C   . VAL A  1  203 ? 115.237 41.213  26.928  1.00 25.15  ? 203  VAL C C   1 
ATOM   1614  O  O   . VAL A  1  203 ? 116.418 41.466  26.725  1.00 32.12  ? 203  VAL C O   1 
ATOM   1615  C  CB  . VAL A  1  203 ? 114.887 39.995  24.887  1.00 20.18  ? 203  VAL C CB  1 
ATOM   1616  C  CG1 . VAL A  1  203 ? 114.759 38.625  24.309  1.00 24.61  ? 203  VAL C CG1 1 
ATOM   1617  C  CG2 . VAL A  1  203 ? 113.906 40.955  24.245  1.00 16.89  ? 203  VAL C CG2 1 
ATOM   1618  N  N   . VAL A  1  204 ? 114.392 42.052  27.527  1.00 22.84  ? 204  VAL C N   1 
ATOM   1619  C  CA  . VAL A  1  204 ? 114.786 43.384  27.975  1.00 20.15  ? 204  VAL C CA  1 
ATOM   1620  C  C   . VAL A  1  204 ? 115.136 43.307  29.445  1.00 21.65  ? 204  VAL C C   1 
ATOM   1621  O  O   . VAL A  1  204 ? 114.384 42.728  30.225  1.00 24.92  ? 204  VAL C O   1 
ATOM   1622  C  CB  . VAL A  1  204 ? 113.625 44.410  27.821  1.00 20.47  ? 204  VAL C CB  1 
ATOM   1623  C  CG1 . VAL A  1  204 ? 114.090 45.802  28.259  1.00 16.39  ? 204  VAL C CG1 1 
ATOM   1624  C  CG2 . VAL A  1  204 ? 113.135 44.443  26.391  1.00 10.92  ? 204  VAL C CG2 1 
ATOM   1625  N  N   . PRO A  1  205 ? 116.223 43.978  29.863  1.00 21.05  ? 205  PRO C N   1 
ATOM   1626  C  CA  . PRO A  1  205 ? 116.673 44.041  31.261  1.00 19.11  ? 205  PRO C CA  1 
ATOM   1627  C  C   . PRO A  1  205 ? 115.767 44.843  32.190  1.00 21.23  ? 205  PRO C C   1 
ATOM   1628  O  O   . PRO A  1  205 ? 115.195 45.857  31.799  1.00 24.75  ? 205  PRO C O   1 
ATOM   1629  C  CB  . PRO A  1  205 ? 118.045 44.675  31.155  1.00 17.21  ? 205  PRO C CB  1 
ATOM   1630  C  CG  . PRO A  1  205 ? 118.475 44.361  29.756  1.00 19.73  ? 205  PRO C CG  1 
ATOM   1631  C  CD  . PRO A  1  205 ? 117.250 44.505  28.953  1.00 18.59  ? 205  PRO C CD  1 
ATOM   1632  N  N   . GLN A  1  206 ? 115.721 44.447  33.452  1.00 20.45  ? 206  GLN C N   1 
ATOM   1633  C  CA  . GLN A  1  206 ? 114.851 45.123  34.398  1.00 27.50  ? 206  GLN C CA  1 
ATOM   1634  C  C   . GLN A  1  206 ? 115.647 45.944  35.423  1.00 26.64  ? 206  GLN C C   1 
ATOM   1635  O  O   . GLN A  1  206 ? 115.132 46.308  36.490  1.00 24.51  ? 206  GLN C O   1 
ATOM   1636  C  CB  . GLN A  1  206 ? 113.946 44.101  35.099  1.00 31.72  ? 206  GLN C CB  1 
ATOM   1637  C  CG  . GLN A  1  206 ? 112.921 43.441  34.186  1.00 43.47  ? 206  GLN C CG  1 
ATOM   1638  C  CD  . GLN A  1  206 ? 111.706 44.321  33.857  1.00 52.70  ? 206  GLN C CD  1 
ATOM   1639  O  OE1 . GLN A  1  206 ? 111.610 45.482  34.274  1.00 54.63  ? 206  GLN C OE1 1 
ATOM   1640  N  NE2 . GLN A  1  206 ? 110.762 43.753  33.116  1.00 56.54  ? 206  GLN C NE2 1 
ATOM   1641  N  N   . THR A  1  207 ? 116.919 46.189  35.117  1.00 24.57  ? 207  THR C N   1 
ATOM   1642  C  CA  . THR A  1  207 ? 117.759 47.049  35.942  1.00 23.66  ? 207  THR C CA  1 
ATOM   1643  C  C   . THR A  1  207 ? 118.398 48.051  34.999  1.00 23.57  ? 207  THR C C   1 
ATOM   1644  O  O   . THR A  1  207 ? 118.532 47.771  33.808  1.00 26.43  ? 207  THR C O   1 
ATOM   1645  C  CB  . THR A  1  207 ? 118.876 46.246  36.644  1.00 24.90  ? 207  THR C CB  1 
ATOM   1646  O  OG1 . THR A  1  207 ? 119.691 45.582  35.671  1.00 32.08  ? 207  THR C OG1 1 
ATOM   1647  C  CG2 . THR A  1  207 ? 118.290 45.202  37.541  1.00 27.00  ? 207  THR C CG2 1 
ATOM   1648  N  N   . ALA A  1  208 ? 118.731 49.232  35.511  1.00 21.55  ? 208  ALA C N   1 
ATOM   1649  C  CA  . ALA A  1  208 ? 119.343 50.270  34.692  1.00 18.12  ? 208  ALA C CA  1 
ATOM   1650  C  C   . ALA A  1  208 ? 120.733 49.868  34.238  1.00 20.75  ? 208  ALA C C   1 
ATOM   1651  O  O   . ALA A  1  208 ? 121.081 50.053  33.075  1.00 26.41  ? 208  ALA C O   1 
ATOM   1652  C  CB  . ALA A  1  208 ? 119.411 51.568  35.461  1.00 16.25  ? 208  ALA C CB  1 
ATOM   1653  N  N   . LEU A  1  209 ? 121.547 49.363  35.159  1.00 20.99  ? 209  LEU C N   1 
ATOM   1654  C  CA  . LEU A  1  209 ? 122.932 49.034  34.852  1.00 18.42  ? 209  LEU C CA  1 
ATOM   1655  C  C   . LEU A  1  209 ? 123.079 47.545  34.640  1.00 19.02  ? 209  LEU C C   1 
ATOM   1656  O  O   . LEU A  1  209 ? 122.295 46.761  35.171  1.00 21.33  ? 209  LEU C O   1 
ATOM   1657  C  CB  . LEU A  1  209 ? 123.842 49.460  35.993  1.00 20.63  ? 209  LEU C CB  1 
ATOM   1658  C  CG  . LEU A  1  209 ? 123.653 50.846  36.580  1.00 15.66  ? 209  LEU C CG  1 
ATOM   1659  C  CD1 . LEU A  1  209 ? 124.533 50.970  37.781  1.00 22.33  ? 209  LEU C CD1 1 
ATOM   1660  C  CD2 . LEU A  1  209 ? 124.025 51.898  35.572  1.00 19.88  ? 209  LEU C CD2 1 
ATOM   1661  N  N   . PRO A  1  210 ? 124.118 47.127  33.904  1.00 17.01  ? 210  PRO C N   1 
ATOM   1662  C  CA  . PRO A  1  210 ? 124.311 45.712  33.629  1.00 18.36  ? 210  PRO C CA  1 
ATOM   1663  C  C   . PRO A  1  210 ? 124.732 45.010  34.911  1.00 22.89  ? 210  PRO C C   1 
ATOM   1664  O  O   . PRO A  1  210 ? 125.671 45.456  35.570  1.00 29.80  ? 210  PRO C O   1 
ATOM   1665  C  CB  . PRO A  1  210 ? 125.433 45.711  32.588  1.00 18.65  ? 210  PRO C CB  1 
ATOM   1666  C  CG  . PRO A  1  210 ? 125.494 47.124  32.077  1.00 17.03  ? 210  PRO C CG  1 
ATOM   1667  C  CD  . PRO A  1  210 ? 125.155 47.942  33.258  1.00 15.85  ? 210  PRO C CD  1 
ATOM   1668  N  N   . LEU A  1  211 ? 124.002 43.970  35.307  1.00 22.17  ? 211  LEU C N   1 
ATOM   1669  C  CA  . LEU A  1  211 ? 124.379 43.159  36.470  1.00 20.18  ? 211  LEU C CA  1 
ATOM   1670  C  C   . LEU A  1  211 ? 125.622 42.311  36.212  1.00 22.36  ? 211  LEU C C   1 
ATOM   1671  O  O   . LEU A  1  211 ? 125.746 41.624  35.194  1.00 19.73  ? 211  LEU C O   1 
ATOM   1672  C  CB  . LEU A  1  211 ? 123.229 42.245  36.874  1.00 16.23  ? 211  LEU C CB  1 
ATOM   1673  C  CG  . LEU A  1  211 ? 123.465 41.203  37.962  1.00 16.48  ? 211  LEU C CG  1 
ATOM   1674  C  CD1 . LEU A  1  211 ? 123.522 41.836  39.319  1.00 18.47  ? 211  LEU C CD1 1 
ATOM   1675  C  CD2 . LEU A  1  211 ? 122.300 40.240  37.932  1.00 14.76  ? 211  LEU C CD2 1 
ATOM   1676  N  N   . VAL A  1  212 ? 126.510 42.298  37.194  1.00 26.40  ? 212  VAL C N   1 
ATOM   1677  C  CA  . VAL A  1  212 ? 127.767 41.596  37.075  1.00 23.12  ? 212  VAL C CA  1 
ATOM   1678  C  C   . VAL A  1  212 ? 127.463 40.134  37.204  1.00 25.77  ? 212  VAL C C   1 
ATOM   1679  O  O   . VAL A  1  212 ? 126.791 39.714  38.156  1.00 28.22  ? 212  VAL C O   1 
ATOM   1680  C  CB  . VAL A  1  212 ? 128.707 41.988  38.188  1.00 26.83  ? 212  VAL C CB  1 
ATOM   1681  C  CG1 . VAL A  1  212 ? 129.937 41.136  38.138  1.00 20.08  ? 212  VAL C CG1 1 
ATOM   1682  C  CG2 . VAL A  1  212 ? 129.065 43.439  38.046  1.00 24.65  ? 212  VAL C CG2 1 
ATOM   1683  N  N   . GLY A  1  213 ? 127.892 39.372  36.211  1.00 23.07  ? 213  GLY C N   1 
ATOM   1684  C  CA  . GLY A  1  213 ? 127.561 37.962  36.197  1.00 27.08  ? 213  GLY C CA  1 
ATOM   1685  C  C   . GLY A  1  213 ? 126.725 37.477  35.028  1.00 27.33  ? 213  GLY C C   1 
ATOM   1686  O  O   . GLY A  1  213 ? 126.784 36.300  34.694  1.00 32.00  ? 213  GLY C O   1 
ATOM   1687  N  N   . VAL A  1  214 ? 125.978 38.355  34.372  1.00 27.40  ? 214  VAL C N   1 
ATOM   1688  C  CA  . VAL A  1  214 ? 125.177 37.917  33.229  1.00 26.94  ? 214  VAL C CA  1 
ATOM   1689  C  C   . VAL A  1  214 ? 125.385 38.850  32.046  1.00 28.44  ? 214  VAL C C   1 
ATOM   1690  O  O   . VAL A  1  214 ? 124.687 38.756  31.040  1.00 33.89  ? 214  VAL C O   1 
ATOM   1691  C  CB  . VAL A  1  214 ? 123.675 37.893  33.566  1.00 25.82  ? 214  VAL C CB  1 
ATOM   1692  C  CG1 . VAL A  1  214 ? 123.404 37.072  34.820  1.00 20.92  ? 214  VAL C CG1 1 
ATOM   1693  C  CG2 . VAL A  1  214 ? 123.190 39.290  33.776  1.00 24.92  ? 214  VAL C CG2 1 
ATOM   1694  N  N   . SER A  1  215 ? 126.381 39.718  32.132  1.00 25.58  ? 215  SER C N   1 
ATOM   1695  C  CA  . SER A  1  215 ? 126.441 40.794  31.180  1.00 21.41  ? 215  SER C CA  1 
ATOM   1696  C  C   . SER A  1  215 ? 127.645 40.759  30.293  1.00 20.98  ? 215  SER C C   1 
ATOM   1697  O  O   . SER A  1  215 ? 127.886 41.705  29.567  1.00 18.95  ? 215  SER C O   1 
ATOM   1698  C  CB  . SER A  1  215 ? 126.357 42.126  31.910  1.00 20.30  ? 215  SER C CB  1 
ATOM   1699  O  OG  . SER A  1  215 ? 125.231 42.111  32.769  1.00 21.27  ? 215  SER C OG  1 
ATOM   1700  N  N   . ARG A  1  216 ? 128.392 39.667  30.305  1.00 22.18  ? 216  ARG C N   1 
ATOM   1701  C  CA  . ARG A  1  216 ? 129.560 39.591  29.426  1.00 27.01  ? 216  ARG C CA  1 
ATOM   1702  C  C   . ARG A  1  216 ? 129.782 38.223  28.794  1.00 27.85  ? 216  ARG C C   1 
ATOM   1703  O  O   . ARG A  1  216 ? 129.494 37.183  29.403  1.00 32.67  ? 216  ARG C O   1 
ATOM   1704  C  CB  . ARG A  1  216 ? 130.822 40.005  30.173  1.00 27.08  ? 216  ARG C CB  1 
ATOM   1705  C  CG  . ARG A  1  216 ? 130.805 41.427  30.740  1.00 32.72  ? 216  ARG C CG  1 
ATOM   1706  C  CD  . ARG A  1  216 ? 131.131 42.502  29.701  1.00 32.04  ? 216  ARG C CD  1 
ATOM   1707  N  NE  . ARG A  1  216 ? 131.259 43.829  30.317  1.00 35.82  ? 216  ARG C NE  1 
ATOM   1708  C  CZ  . ARG A  1  216 ? 130.271 44.716  30.424  1.00 32.51  ? 216  ARG C CZ  1 
ATOM   1709  N  NH1 . ARG A  1  216 ? 129.080 44.446  29.917  1.00 32.26  ? 216  ARG C NH1 1 
ATOM   1710  N  NH2 . ARG A  1  216 ? 130.491 45.898  30.985  1.00 31.77  ? 216  ARG C NH2 1 
ATOM   1711  N  N   . GLY A  1  217 ? 130.270 38.228  27.559  1.00 26.60  ? 217  GLY C N   1 
ATOM   1712  C  CA  . GLY A  1  217 ? 130.659 36.992  26.908  1.00 27.99  ? 217  GLY C CA  1 
ATOM   1713  C  C   . GLY A  1  217 ? 129.530 35.987  26.801  1.00 30.15  ? 217  GLY C C   1 
ATOM   1714  O  O   . GLY A  1  217 ? 128.378 36.375  26.618  1.00 30.78  ? 217  GLY C O   1 
ATOM   1715  N  N   . LYS A  1  218 ? 129.840 34.708  26.999  1.00 27.10  ? 218  LYS C N   1 
ATOM   1716  C  CA  . LYS A  1  218 ? 128.844 33.656  26.879  1.00 27.68  ? 218  LYS C CA  1 
ATOM   1717  C  C   . LYS A  1  218 ? 127.761 33.694  27.978  1.00 26.78  ? 218  LYS C C   1 
ATOM   1718  O  O   . LYS A  1  218 ? 126.819 32.904  27.952  1.00 28.54  ? 218  LYS C O   1 
ATOM   1719  C  CB  . LYS A  1  218 ? 129.541 32.283  26.851  1.00 29.55  ? 218  LYS C CB  1 
ATOM   1720  C  CG  . LYS A  1  218 ? 130.295 31.964  25.551  1.00 26.91  ? 218  LYS C CG  1 
ATOM   1721  C  CD  . LYS A  1  218 ? 129.593 30.865  24.776  0.00 27.97  ? 218  LYS C CD  1 
ATOM   1722  C  CE  . LYS A  1  218 ? 130.517 30.232  23.754  0.00 27.79  ? 218  LYS C CE  1 
ATOM   1723  N  NZ  . LYS A  1  218 ? 129.856 29.097  23.061  0.00 27.97  ? 218  LYS C NZ  1 
ATOM   1724  N  N   . GLU A  1  219 ? 127.866 34.617  28.928  1.00 27.22  ? 219  GLU C N   1 
ATOM   1725  C  CA  . GLU A  1  219 ? 126.843 34.702  29.961  1.00 28.72  ? 219  GLU C CA  1 
ATOM   1726  C  C   . GLU A  1  219 ? 125.595 35.289  29.340  1.00 31.07  ? 219  GLU C C   1 
ATOM   1727  O  O   . GLU A  1  219 ? 124.531 35.298  29.963  1.00 33.80  ? 219  GLU C O   1 
ATOM   1728  C  CB  . GLU A  1  219 ? 127.265 35.623  31.091  1.00 27.74  ? 219  GLU C CB  1 
ATOM   1729  C  CG  . GLU A  1  219 ? 128.540 35.274  31.785  1.00 28.57  ? 219  GLU C CG  1 
ATOM   1730  C  CD  . GLU A  1  219 ? 129.045 36.421  32.636  1.00 31.40  ? 219  GLU C CD  1 
ATOM   1731  O  OE1 . GLU A  1  219 ? 128.552 37.562  32.496  1.00 35.84  ? 219  GLU C OE1 1 
ATOM   1732  O  OE2 . GLU A  1  219 ? 129.939 36.190  33.457  1.00 34.67  ? 219  GLU C OE2 1 
ATOM   1733  N  N   . ARG A  1  220 ? 125.798 35.987  28.226  1.00 30.74  ? 220  ARG C N   1 
ATOM   1734  C  CA  . ARG A  1  220 ? 124.771 36.835  27.628  1.00 29.89  ? 220  ARG C CA  1 
ATOM   1735  C  C   . ARG A  1  220 ? 123.876 36.082  26.673  1.00 29.82  ? 220  ARG C C   1 
ATOM   1736  O  O   . ARG A  1  220 ? 124.324 35.230  25.898  1.00 30.06  ? 220  ARG C O   1 
ATOM   1737  C  CB  . ARG A  1  220 ? 125.392 37.990  26.850  1.00 26.43  ? 220  ARG C CB  1 
ATOM   1738  C  CG  . ARG A  1  220 ? 126.272 38.864  27.646  1.00 24.04  ? 220  ARG C CG  1 
ATOM   1739  C  CD  . ARG A  1  220 ? 126.913 39.850  26.729  1.00 25.16  ? 220  ARG C CD  1 
ATOM   1740  N  NE  . ARG A  1  220 ? 126.420 41.176  27.036  1.00 29.60  ? 220  ARG C NE  1 
ATOM   1741  C  CZ  . ARG A  1  220 ? 125.494 41.784  26.326  1.00 26.35  ? 220  ARG C CZ  1 
ATOM   1742  N  NH1 . ARG A  1  220 ? 125.190 41.318  25.135  1.00 28.33  ? 220  ARG C NH1 1 
ATOM   1743  N  NH2 . ARG A  1  220 ? 124.975 42.913  26.753  1.00 29.79  ? 220  ARG C NH2 1 
ATOM   1744  N  N   . ARG A  1  221 ? 122.635 36.531  26.620  1.00 29.51  ? 221  ARG C N   1 
ATOM   1745  C  CA  . ARG A  1  221 ? 121.765 36.140  25.544  1.00 29.11  ? 221  ARG C CA  1 
ATOM   1746  C  C   . ARG A  1  221 ? 122.202 36.912  24.317  1.00 27.71  ? 221  ARG C C   1 
ATOM   1747  O  O   . ARG A  1  221 ? 122.623 38.077  24.409  1.00 30.37  ? 221  ARG C O   1 
ATOM   1748  C  CB  . ARG A  1  221 ? 120.332 36.472  25.902  1.00 32.70  ? 221  ARG C CB  1 
ATOM   1749  C  CG  . ARG A  1  221 ? 119.807 35.637  27.036  1.00 33.69  ? 221  ARG C CG  1 
ATOM   1750  C  CD  . ARG A  1  221 ? 118.406 36.069  27.433  1.00 43.08  ? 221  ARG C CD  1 
ATOM   1751  N  NE  . ARG A  1  221 ? 117.445 35.969  26.339  1.00 44.87  ? 221  ARG C NE  1 
ATOM   1752  C  CZ  . ARG A  1  221 ? 116.129 36.053  26.497  1.00 49.56  ? 221  ARG C CZ  1 
ATOM   1753  N  NH1 . ARG A  1  221 ? 115.629 36.375  27.683  1.00 51.58  ? 221  ARG C NH1 1 
ATOM   1754  N  NH2 . ARG A  1  221 ? 115.317 35.867  25.459  1.00 53.38  ? 221  ARG C NH2 1 
ATOM   1755  N  N   . PRO A  1  222 ? 122.280 36.217  23.181  1.00 22.95  ? 222  PRO C N   1 
ATOM   1756  C  CA  . PRO A  1  222 ? 122.694 36.854  21.937  1.00 22.63  ? 222  PRO C CA  1 
ATOM   1757  C  C   . PRO A  1  222 ? 121.627 37.828  21.465  1.00 24.43  ? 222  PRO C C   1 
ATOM   1758  O  O   . PRO A  1  222 ? 120.434 37.671  21.774  1.00 23.46  ? 222  PRO C O   1 
ATOM   1759  C  CB  . PRO A  1  222 ? 122.876 35.673  20.978  1.00 17.73  ? 222  PRO C CB  1 
ATOM   1760  C  CG  . PRO A  1  222 ? 121.950 34.668  21.470  1.00 17.45  ? 222  PRO C CG  1 
ATOM   1761  C  CD  . PRO A  1  222 ? 121.841 34.833  22.966  1.00 17.01  ? 222  PRO C CD  1 
ATOM   1762  N  N   . LEU A  1  223 ? 122.061 38.837  20.720  1.00 26.15  ? 223  LEU C N   1 
ATOM   1763  C  CA  . LEU A  1  223 ? 121.167 39.900  20.300  1.00 24.83  ? 223  LEU C CA  1 
ATOM   1764  C  C   . LEU A  1  223 ? 120.080 39.294  19.450  1.00 25.60  ? 223  LEU C C   1 
ATOM   1765  O  O   . LEU A  1  223 ? 118.955 39.787  19.433  1.00 29.76  ? 223  LEU C O   1 
ATOM   1766  C  CB  . LEU A  1  223 ? 121.917 40.965  19.499  1.00 20.04  ? 223  LEU C CB  1 
ATOM   1767  C  CG  . LEU A  1  223 ? 121.072 42.195  19.186  1.00 15.63  ? 223  LEU C CG  1 
ATOM   1768  C  CD1 . LEU A  1  223 ? 120.624 42.823  20.489  1.00 10.78  ? 223  LEU C CD1 1 
ATOM   1769  C  CD2 . LEU A  1  223 ? 121.864 43.166  18.345  1.00 14.32  ? 223  LEU C CD2 1 
ATOM   1770  N  N   . SER A  1  224 ? 120.382 38.169  18.825  1.00 24.11  ? 224  SER C N   1 
ATOM   1771  C  CA  . SER A  1  224 ? 119.410 37.498  17.991  1.00 25.30  ? 224  SER C CA  1 
ATOM   1772  C  C   . SER A  1  224 ? 118.106 37.239  18.731  1.00 23.58  ? 224  SER C C   1 
ATOM   1773  O  O   . SER A  1  224 ? 117.043 37.282  18.121  1.00 32.56  ? 224  SER C O   1 
ATOM   1774  C  CB  . SER A  1  224 ? 119.981 36.184  17.496  1.00 23.63  ? 224  SER C CB  1 
ATOM   1775  O  OG  . SER A  1  224 ? 120.275 35.370  18.601  1.00 27.41  ? 224  SER C OG  1 
ATOM   1776  N  N   . ASP A  1  225 ? 118.165 37.080  20.049  1.00 25.02  ? 225  ASP C N   1 
ATOM   1777  C  CA  . ASP A  1  225 ? 116.949 36.897  20.863  1.00 23.46  ? 225  ASP C CA  1 
ATOM   1778  C  C   . ASP A  1  225 ? 115.999 38.072  20.843  1.00 23.69  ? 225  ASP C C   1 
ATOM   1779  O  O   . ASP A  1  225 ? 114.788 37.896  20.951  1.00 26.75  ? 225  ASP C O   1 
ATOM   1780  C  CB  . ASP A  1  225 ? 117.291 36.581  22.314  1.00 25.45  ? 225  ASP C CB  1 
ATOM   1781  C  CG  . ASP A  1  225 ? 117.709 35.141  22.508  1.00 27.47  ? 225  ASP C CG  1 
ATOM   1782  O  OD1 . ASP A  1  225 ? 117.811 34.404  21.505  1.00 36.08  ? 225  ASP C OD1 1 
ATOM   1783  O  OD2 . ASP A  1  225 ? 117.931 34.737  23.660  1.00 31.67  ? 225  ASP C OD2 1 
ATOM   1784  N  N   . ALA A  1  226 ? 116.550 39.272  20.787  1.00 20.06  ? 226  ALA C N   1 
ATOM   1785  C  CA  . ALA A  1  226 ? 115.751 40.459  20.629  1.00 18.19  ? 226  ALA C CA  1 
ATOM   1786  C  C   . ALA A  1  226 ? 115.084 40.477  19.233  1.00 17.46  ? 226  ALA C C   1 
ATOM   1787  O  O   . ALA A  1  226 ? 113.883 40.735  19.115  1.00 20.61  ? 226  ALA C O   1 
ATOM   1788  C  CB  . ALA A  1  226 ? 116.622 41.677  20.837  1.00 13.22  ? 226  ALA C CB  1 
ATOM   1789  N  N   . TYR A  1  227 ? 115.832 40.152  18.187  1.00 16.61  ? 227  TYR C N   1 
ATOM   1790  C  CA  . TYR A  1  227 ? 115.258 40.049  16.847  1.00 18.19  ? 227  TYR C CA  1 
ATOM   1791  C  C   . TYR A  1  227 ? 114.087 39.067  16.843  1.00 18.85  ? 227  TYR C C   1 
ATOM   1792  O  O   . TYR A  1  227 ? 112.994 39.386  16.408  1.00 24.53  ? 227  TYR C O   1 
ATOM   1793  C  CB  . TYR A  1  227 ? 116.291 39.542  15.857  1.00 17.85  ? 227  TYR C CB  1 
ATOM   1794  C  CG  . TYR A  1  227 ? 117.403 40.503  15.481  1.00 15.48  ? 227  TYR C CG  1 
ATOM   1795  C  CD1 . TYR A  1  227 ? 118.590 40.524  16.204  1.00 18.70  ? 227  TYR C CD1 1 
ATOM   1796  C  CD2 . TYR A  1  227 ? 117.393 41.149  14.238  1.00 14.61  ? 227  TYR C CD2 1 
ATOM   1797  C  CE1 . TYR A  1  227 ? 119.745 41.136  15.697  1.00 15.51  ? 227  TYR C CE1 1 
ATOM   1798  C  CE2 . TYR A  1  227 ? 118.537 41.761  13.724  1.00 14.58  ? 227  TYR C CE2 1 
ATOM   1799  C  CZ  . TYR A  1  227 ? 119.708 41.746  14.465  1.00 18.08  ? 227  TYR C CZ  1 
ATOM   1800  O  OH  . TYR A  1  227 ? 120.848 42.328  13.969  1.00 20.89  ? 227  TYR C OH  1 
ATOM   1801  N  N   . ALA A  1  228 ? 114.324 37.875  17.352  1.00 17.80  ? 228  ALA C N   1 
ATOM   1802  C  CA  . ALA A  1  228 ? 113.295 36.860  17.461  1.00 16.38  ? 228  ALA C CA  1 
ATOM   1803  C  C   . ALA A  1  228 ? 112.012 37.379  18.104  1.00 17.02  ? 228  ALA C C   1 
ATOM   1804  O  O   . ALA A  1  228 ? 110.912 37.160  17.585  1.00 18.80  ? 228  ALA C O   1 
ATOM   1805  C  CB  . ALA A  1  228 ? 113.831 35.704  18.251  1.00 13.36  ? 228  ALA C CB  1 
ATOM   1806  N  N   . THR A  1  229 ? 112.146 37.948  19.294  1.00 15.84  ? 229  THR C N   1 
ATOM   1807  C  CA  . THR A  1  229 ? 111.006 38.446  20.039  1.00 14.74  ? 229  THR C CA  1 
ATOM   1808  C  C   . THR A  1  229 ? 110.250 39.480  19.214  1.00 19.71  ? 229  THR C C   1 
ATOM   1809  O  O   . THR A  1  229 ? 109.023 39.454  19.162  1.00 22.80  ? 229  THR C O   1 
ATOM   1810  C  CB  . THR A  1  229 ? 111.464 39.059  21.382  1.00 17.27  ? 229  THR C CB  1 
ATOM   1811  O  OG1 . THR A  1  229 ? 111.729 37.999  22.298  1.00 18.05  ? 229  THR C OG1 1 
ATOM   1812  C  CG2 . THR A  1  229 ? 110.401 39.987  21.998  1.00 13.64  ? 229  THR C CG2 1 
ATOM   1813  N  N   . PHE A  1  230 ? 110.986 40.364  18.542  1.00 18.13  ? 230  PHE C N   1 
ATOM   1814  C  CA  . PHE A  1  230 ? 110.397 41.363  17.668  1.00 14.44  ? 230  PHE C CA  1 
ATOM   1815  C  C   . PHE A  1  230 ? 109.574 40.654  16.581  1.00 21.20  ? 230  PHE C C   1 
ATOM   1816  O  O   . PHE A  1  230 ? 108.382 40.946  16.408  1.00 22.62  ? 230  PHE C O   1 
ATOM   1817  C  CB  . PHE A  1  230 ? 111.514 42.207  17.055  1.00 14.19  ? 230  PHE C CB  1 
ATOM   1818  C  CG  . PHE A  1  230 ? 111.034 43.383  16.256  1.00 14.71  ? 230  PHE C CG  1 
ATOM   1819  C  CD1 . PHE A  1  230 ? 109.793 43.950  16.491  1.00 14.08  ? 230  PHE C CD1 1 
ATOM   1820  C  CD2 . PHE A  1  230 ? 111.831 43.907  15.233  1.00 20.55  ? 230  PHE C CD2 1 
ATOM   1821  C  CE1 . PHE A  1  230 ? 109.341 45.010  15.714  1.00 19.09  ? 230  PHE C CE1 1 
ATOM   1822  C  CE2 . PHE A  1  230 ? 111.392 44.982  14.447  1.00 19.08  ? 230  PHE C CE2 1 
ATOM   1823  C  CZ  . PHE A  1  230 ? 110.144 45.529  14.693  1.00 16.41  ? 230  PHE C CZ  1 
ATOM   1824  N  N   . ALA A  1  231 ? 110.154 39.598  16.006  1.00 19.83  ? 231  ALA C N   1 
ATOM   1825  C  CA  . ALA A  1  231 ? 109.509 38.799  14.974  1.00 17.01  ? 231  ALA C CA  1 
ATOM   1826  C  C   . ALA A  1  231 ? 108.201 38.244  15.480  1.00 17.61  ? 231  ALA C C   1 
ATOM   1827  O  O   . ALA A  1  231 ? 107.174 38.421  14.838  1.00 21.22  ? 231  ALA C O   1 
ATOM   1828  C  CB  . ALA A  1  231 ? 110.420 37.657  14.540  1.00 17.96  ? 231  ALA C CB  1 
ATOM   1829  N  N   . LEU A  1  232 ? 108.232 37.623  16.654  1.00 17.80  ? 232  LEU C N   1 
ATOM   1830  C  CA  . LEU A  1  232 ? 107.026 37.117  17.290  1.00 14.65  ? 232  LEU C CA  1 
ATOM   1831  C  C   . LEU A  1  232 ? 105.949 38.172  17.425  1.00 17.47  ? 232  LEU C C   1 
ATOM   1832  O  O   . LEU A  1  232 ? 104.779 37.891  17.206  1.00 24.39  ? 232  LEU C O   1 
ATOM   1833  C  CB  . LEU A  1  232 ? 107.342 36.561  18.670  1.00 13.35  ? 232  LEU C CB  1 
ATOM   1834  C  CG  . LEU A  1  232 ? 106.106 36.199  19.496  1.00 13.76  ? 232  LEU C CG  1 
ATOM   1835  C  CD1 . LEU A  1  232 ? 105.402 35.000  18.869  1.00 11.49  ? 232  LEU C CD1 1 
ATOM   1836  C  CD2 . LEU A  1  232 ? 106.498 35.890  20.909  1.00 11.08  ? 232  LEU C CD2 1 
ATOM   1837  N  N   . MET A  1  233 ? 106.330 39.379  17.819  1.00 21.22  ? 233  MET C N   1 
ATOM   1838  C  CA  . MET A  1  233 ? 105.365 40.452  18.034  1.00 20.69  ? 233  MET C CA  1 
ATOM   1839  C  C   . MET A  1  233 ? 104.804 40.986  16.733  1.00 22.91  ? 233  MET C C   1 
ATOM   1840  O  O   . MET A  1  233 ? 103.648 41.402  16.678  1.00 25.65  ? 233  MET C O   1 
ATOM   1841  C  CB  . MET A  1  233 ? 106.006 41.585  18.807  1.00 20.44  ? 233  MET C CB  1 
ATOM   1842  C  CG  . MET A  1  233 ? 106.418 41.162  20.164  1.00 15.34  ? 233  MET C CG  1 
ATOM   1843  S  SD  . MET A  1  233 ? 105.079 41.168  21.358  1.00 17.87  ? 233  MET C SD  1 
ATOM   1844  C  CE  . MET A  1  233 ? 105.488 39.555  22.066  1.00 8.50   ? 233  MET C CE  1 
ATOM   1845  N  N   . MET A  1  234 ? 105.647 41.038  15.707  1.00 23.58  ? 234  MET C N   1 
ATOM   1846  C  CA  . MET A  1  234 ? 105.208 41.374  14.366  1.00 21.55  ? 234  MET C CA  1 
ATOM   1847  C  C   . MET A  1  234 ? 104.136 40.381  13.937  1.00 22.38  ? 234  MET C C   1 
ATOM   1848  O  O   . MET A  1  234 ? 103.051 40.768  13.532  1.00 27.65  ? 234  MET C O   1 
ATOM   1849  C  CB  . MET A  1  234 ? 106.387 41.309  13.406  1.00 19.51  ? 234  MET C CB  1 
ATOM   1850  C  CG  . MET A  1  234 ? 107.347 42.461  13.537  1.00 22.00  ? 234  MET C CG  1 
ATOM   1851  S  SD  . MET A  1  234 ? 106.593 43.963  13.039  1.00 27.82  ? 234  MET C SD  1 
ATOM   1852  C  CE  . MET A  1  234 ? 107.404 44.202  11.463  1.00 21.54  ? 234  MET C CE  1 
ATOM   1853  N  N   . SER A  1  235 ? 104.379 39.110  14.214  1.00 23.95  ? 235  SER C N   1 
ATOM   1854  C  CA  . SER A  1  235 ? 103.458 38.036  13.861  1.00 25.28  ? 235  SER C CA  1 
ATOM   1855  C  C   . SER A  1  235 ? 102.124 38.172  14.602  1.00 24.46  ? 235  SER C C   1 
ATOM   1856  O  O   . SER A  1  235 ? 101.067 38.233  13.975  1.00 27.32  ? 235  SER C O   1 
ATOM   1857  C  CB  . SER A  1  235 ? 104.120 36.686  14.169  1.00 26.58  ? 235  SER C CB  1 
ATOM   1858  O  OG  . SER A  1  235 ? 103.201 35.600  14.169  1.00 37.62  ? 235  SER C OG  1 
ATOM   1859  N  N   . ILE A  1  236 ? 102.186 38.296  15.926  1.00 23.44  ? 236  ILE C N   1 
ATOM   1860  C  CA  . ILE A  1  236 ? 101.004 38.475  16.768  1.00 18.91  ? 236  ILE C CA  1 
ATOM   1861  C  C   . ILE A  1  236 ? 100.172 39.670  16.305  1.00 18.15  ? 236  ILE C C   1 
ATOM   1862  O  O   . ILE A  1  236 ? 98.971  39.558  16.105  1.00 22.02  ? 236  ILE C O   1 
ATOM   1863  C  CB  . ILE A  1  236 ? 101.441 38.652  18.226  1.00 16.45  ? 236  ILE C CB  1 
ATOM   1864  C  CG1 . ILE A  1  236 ? 101.800 37.300  18.809  1.00 19.81  ? 236  ILE C CG1 1 
ATOM   1865  C  CG2 . ILE A  1  236 ? 100.354 39.247  19.057  1.00 16.68  ? 236  ILE C CG2 1 
ATOM   1866  C  CD1 . ILE A  1  236 ? 102.141 37.392  20.272  1.00 26.53  ? 236  ILE C CD1 1 
ATOM   1867  N  N   . SER A  1  237 ? 100.822 40.804  16.096  1.00 17.83  ? 237  SER C N   1 
ATOM   1868  C  CA  . SER A  1  237 ? 100.133 41.997  15.638  1.00 19.61  ? 237  SER C CA  1 
ATOM   1869  C  C   . SER A  1  237 ? 99.331  41.675  14.401  1.00 19.10  ? 237  SER C C   1 
ATOM   1870  O  O   . SER A  1  237 ? 98.114  41.785  14.407  1.00 26.44  ? 237  SER C O   1 
ATOM   1871  C  CB  . SER A  1  237 ? 101.133 43.100  15.317  1.00 17.17  ? 237  SER C CB  1 
ATOM   1872  O  OG  . SER A  1  237 ? 101.811 43.498  16.487  1.00 16.19  ? 237  SER C OG  1 
ATOM   1873  N  N   . ASP A  1  238 ? 99.987  41.090  13.417  1.00 18.02  ? 238  ASP C N   1 
ATOM   1874  C  CA  . ASP A  1  238 ? 99.345  40.811  12.144  1.00 19.78  ? 238  ASP C CA  1 
ATOM   1875  C  C   . ASP A  1  238 ? 98.236  39.775  12.304  1.00 23.28  ? 238  ASP C C   1 
ATOM   1876  O  O   . ASP A  1  238 ? 97.116  39.986  11.840  1.00 26.76  ? 238  ASP C O   1 
ATOM   1877  C  CB  . ASP A  1  238 ? 100.387 40.335  11.135  1.00 24.69  ? 238  ASP C CB  1 
ATOM   1878  C  CG  . ASP A  1  238 ? 99.889  40.379  9.708   1.00 26.05  ? 238  ASP C CG  1 
ATOM   1879  O  OD1 . ASP A  1  238 ? 99.187  41.349  9.332   1.00 35.95  ? 238  ASP C OD1 1 
ATOM   1880  O  OD2 . ASP A  1  238 ? 100.206 39.431  8.961   1.00 26.71  ? 238  ASP C OD2 1 
ATOM   1881  N  N   . SER A  1  239 ? 98.500  38.742  13.092  1.00 20.70  ? 239  SER C N   1 
ATOM   1882  C  CA  . SER A  1  239 ? 97.487  37.771  13.431  1.00 16.46  ? 239  SER C CA  1 
ATOM   1883  C  C   . SER A  1  239 ? 96.241  38.393  13.987  1.00 17.06  ? 239  SER C C   1 
ATOM   1884  O  O   . SER A  1  239 ? 95.167  37.805  13.863  1.00 18.38  ? 239  SER C O   1 
ATOM   1885  C  CB  . SER A  1  239 ? 98.017  36.794  14.459  1.00 18.59  ? 239  SER C CB  1 
ATOM   1886  O  OG  . SER A  1  239 ? 99.121  36.107  13.929  1.00 22.04  ? 239  SER C OG  1 
ATOM   1887  N  N   . LEU A  1  240 ? 96.396  39.438  14.790  1.00 15.98  ? 240  LEU C N   1 
ATOM   1888  C  CA  . LEU A  1  240 ? 95.232  40.052  15.405  1.00 17.58  ? 240  LEU C CA  1 
ATOM   1889  C  C   . LEU A  1  240 ? 94.703  41.228  14.584  1.00 20.62  ? 240  LEU C C   1 
ATOM   1890  O  O   . LEU A  1  240 ? 93.703  41.852  14.959  1.00 23.27  ? 240  LEU C O   1 
ATOM   1891  C  CB  . LEU A  1  240 ? 95.550  40.522  16.816  1.00 17.95  ? 240  LEU C CB  1 
ATOM   1892  C  CG  . LEU A  1  240 ? 96.136  39.496  17.783  1.00 20.26  ? 240  LEU C CG  1 
ATOM   1893  C  CD1 . LEU A  1  240 ? 95.987  40.016  19.177  1.00 12.87  ? 240  LEU C CD1 1 
ATOM   1894  C  CD2 . LEU A  1  240 ? 95.440  38.174  17.639  1.00 14.19  ? 240  LEU C CD2 1 
ATOM   1895  N  N   . GLY A  1  241 ? 95.339  41.495  13.444  1.00 19.02  ? 241  GLY C N   1 
ATOM   1896  C  CA  . GLY A  1  241 ? 95.059  42.709  12.690  1.00 21.50  ? 241  GLY C CA  1 
ATOM   1897  C  C   . GLY A  1  241 ? 95.173  43.986  13.518  1.00 25.18  ? 241  GLY C C   1 
ATOM   1898  O  O   . GLY A  1  241 ? 94.277  44.847  13.485  1.00 28.12  ? 241  GLY C O   1 
ATOM   1899  N  N   . THR A  1  242 ? 96.256  44.099  14.288  1.00 23.90  ? 242  THR C N   1 
ATOM   1900  C  CA  . THR A  1  242 ? 96.443  45.220  15.206  1.00 23.82  ? 242  THR C CA  1 
ATOM   1901  C  C   . THR A  1  242 ? 97.915  45.634  15.312  1.00 25.33  ? 242  THR C C   1 
ATOM   1902  O  O   . THR A  1  242 ? 98.776  45.050  14.640  1.00 29.27  ? 242  THR C O   1 
ATOM   1903  C  CB  . THR A  1  242 ? 95.839  44.902  16.615  1.00 21.22  ? 242  THR C CB  1 
ATOM   1904  O  OG1 . THR A  1  242 ? 95.530  46.132  17.278  1.00 20.02  ? 242  THR C OG1 1 
ATOM   1905  C  CG2 . THR A  1  242 ? 96.787  44.048  17.476  1.00 19.79  ? 242  THR C CG2 1 
ATOM   1906  N  N   . ASN A  1  243 ? 98.180  46.709  16.053  1.00 25.46  ? 243  ASN C N   1 
ATOM   1907  C  CA  . ASN A  1  243 ? 99.538  47.236  16.181  1.00 22.84  ? 243  ASN C CA  1 
ATOM   1908  C  C   . ASN A  1  243 ? 100.023 47.139  17.619  1.00 21.09  ? 243  ASN C C   1 
ATOM   1909  O  O   . ASN A  1  243 ? 99.260  46.766  18.519  1.00 22.51  ? 243  ASN C O   1 
ATOM   1910  C  CB  . ASN A  1  243 ? 99.623  48.688  15.675  1.00 21.74  ? 243  ASN C CB  1 
ATOM   1911  C  CG  . ASN A  1  243 ? 98.851  49.675  16.556  1.00 24.14  ? 243  ASN C CG  1 
ATOM   1912  O  OD1 . ASN A  1  243 ? 99.320  50.072  17.624  1.00 24.57  ? 243  ASN C OD1 1 
ATOM   1913  N  ND2 . ASN A  1  243 ? 97.665  50.073  16.107  1.00 19.16  ? 243  ASN C ND2 1 
ATOM   1914  N  N   . CYS A  1  244 ? 101.311 47.399  17.817  1.00 18.03  ? 244  CYS C N   1 
ATOM   1915  C  CA  . CYS A  1  244 ? 101.929 47.231  19.113  1.00 16.33  ? 244  CYS C CA  1 
ATOM   1916  C  C   . CYS A  1  244 ? 101.152 47.953  20.204  1.00 16.57  ? 244  CYS C C   1 
ATOM   1917  O  O   . CYS A  1  244 ? 101.004 47.429  21.295  1.00 18.31  ? 244  CYS C O   1 
ATOM   1918  C  CB  . CYS A  1  244 ? 103.358 47.745  19.075  1.00 17.38  ? 244  CYS C CB  1 
ATOM   1919  S  SG  . CYS A  1  244 ? 104.254 47.311  17.563  1.00 18.98  ? 244  CYS C SG  1 
ATOM   1920  N  N   . THR A  1  245 ? 100.600 49.124  19.906  1.00 14.60  ? 245  THR C N   1 
ATOM   1921  C  CA  . THR A  1  245 ? 99.992  49.930  20.956  1.00 14.10  ? 245  THR C CA  1 
ATOM   1922  C  C   . THR A  1  245 ? 98.615  49.447  21.373  1.00 12.43  ? 245  THR C C   1 
ATOM   1923  O  O   . THR A  1  245 ? 98.048  49.929  22.342  1.00 13.25  ? 245  THR C O   1 
ATOM   1924  C  CB  . THR A  1  245 ? 99.922  51.402  20.574  1.00 11.02  ? 245  THR C CB  1 
ATOM   1925  O  OG1 . THR A  1  245 ? 98.915  51.592  19.584  1.00 15.14  ? 245  THR C OG1 1 
ATOM   1926  C  CG2 . THR A  1  245 ? 101.254 51.854  20.023  1.00 9.02   ? 245  THR C CG2 1 
ATOM   1927  N  N   . PHE A  1  246 ? 98.157  48.377  20.754  1.00 10.69  ? 246  PHE C N   1 
ATOM   1928  C  CA  . PHE A  1  246 ? 97.004  47.686  21.267  1.00 11.89  ? 246  PHE C CA  1 
ATOM   1929  C  C   . PHE A  1  246 ? 97.381  47.133  22.627  1.00 15.20  ? 246  PHE C C   1 
ATOM   1930  O  O   . PHE A  1  246 ? 96.539  47.021  23.505  1.00 20.74  ? 246  PHE C O   1 
ATOM   1931  C  CB  . PHE A  1  246 ? 96.630  46.536  20.344  1.00 13.58  ? 246  PHE C CB  1 
ATOM   1932  C  CG  . PHE A  1  246 ? 95.294  45.954  20.638  1.00 12.04  ? 246  PHE C CG  1 
ATOM   1933  C  CD1 . PHE A  1  246 ? 94.149  46.691  20.419  1.00 12.69  ? 246  PHE C CD1 1 
ATOM   1934  C  CD2 . PHE A  1  246 ? 95.176  44.666  21.091  1.00 14.57  ? 246  PHE C CD2 1 
ATOM   1935  C  CE1 . PHE A  1  246 ? 92.905  46.140  20.634  1.00 15.88  ? 246  PHE C CE1 1 
ATOM   1936  C  CE2 . PHE A  1  246 ? 93.941  44.106  21.317  1.00 12.28  ? 246  PHE C CE2 1 
ATOM   1937  C  CZ  . PHE A  1  246 ? 92.803  44.839  21.084  1.00 16.62  ? 246  PHE C CZ  1 
ATOM   1938  N  N   . CYS A  1  247 ? 98.666  46.864  22.830  1.00 15.04  ? 247  CYS C N   1 
ATOM   1939  C  CA  . CYS A  1  247 ? 99.120  46.208  24.053  1.00 16.00  ? 247  CYS C CA  1 
ATOM   1940  C  C   . CYS A  1  247 ? 100.164 46.956  24.853  1.00 15.49  ? 247  CYS C C   1 
ATOM   1941  O  O   . CYS A  1  247 ? 100.179 46.858  26.066  1.00 18.40  ? 247  CYS C O   1 
ATOM   1942  C  CB  . CYS A  1  247 ? 99.641  44.812  23.737  1.00 15.69  ? 247  CYS C CB  1 
ATOM   1943  S  SG  . CYS A  1  247 ? 98.305  43.706  23.215  1.00 19.71  ? 247  CYS C SG  1 
ATOM   1944  N  N   . HIS A  1  248 ? 101.040 47.699  24.187  1.00 19.54  ? 248  HIS C N   1 
ATOM   1945  C  CA  . HIS A  1  248 ? 102.200 48.288  24.851  1.00 15.07  ? 248  HIS C CA  1 
ATOM   1946  C  C   . HIS A  1  248 ? 102.101 49.790  24.789  1.00 16.28  ? 248  HIS C C   1 
ATOM   1947  O  O   . HIS A  1  248 ? 101.623 50.335  23.799  1.00 20.05  ? 248  HIS C O   1 
ATOM   1948  C  CB  . HIS A  1  248 ? 103.481 47.862  24.136  1.00 14.25  ? 248  HIS C CB  1 
ATOM   1949  C  CG  . HIS A  1  248 ? 103.797 46.406  24.256  1.00 13.93  ? 248  HIS C CG  1 
ATOM   1950  N  ND1 . HIS A  1  248 ? 104.453 45.850  25.332  1.00 15.67  ? 248  HIS C ND1 1 
ATOM   1951  C  CD2 . HIS A  1  248 ? 103.764 45.434  23.313  1.00 15.87  ? 248  HIS C CD2 1 
ATOM   1952  C  CE1 . HIS A  1  248 ? 104.814 44.609  24.991  1.00 16.16  ? 248  HIS C CE1 1 
ATOM   1953  N  NE2 . HIS A  1  248 ? 104.408 44.313  23.778  1.00 16.75  ? 248  HIS C NE2 1 
ATOM   1954  N  N   . ASN A  1  249 ? 102.666 50.472  25.772  1.00 12.70  ? 249  ASN C N   1 
ATOM   1955  C  CA  . ASN A  1  249 ? 103.083 51.830  25.530  1.00 13.30  ? 249  ASN C CA  1 
ATOM   1956  C  C   . ASN A  1  249 ? 104.561 51.708  25.239  1.00 14.75  ? 249  ASN C C   1 
ATOM   1957  O  O   . ASN A  1  249 ? 105.322 51.208  26.065  1.00 19.04  ? 249  ASN C O   1 
ATOM   1958  C  CB  . ASN A  1  249 ? 102.840 52.714  26.749  1.00 12.10  ? 249  ASN C CB  1 
ATOM   1959  C  CG  . ASN A  1  249 ? 103.520 54.073  26.636  1.00 21.00  ? 249  ASN C CG  1 
ATOM   1960  O  OD1 . ASN A  1  249 ? 104.338 54.326  25.728  1.00 24.62  ? 249  ASN C OD1 1 
ATOM   1961  N  ND2 . ASN A  1  249 ? 103.175 54.971  27.548  1.00 21.93  ? 249  ASN C ND2 1 
ATOM   1962  N  N   . ALA A  1  250 ? 104.958 52.122  24.045  1.00 17.10  ? 250  ALA C N   1 
ATOM   1963  C  CA  . ALA A  1  250 ? 106.282 51.806  23.516  1.00 17.38  ? 250  ALA C CA  1 
ATOM   1964  C  C   . ALA A  1  250 ? 107.378 52.504  24.276  1.00 19.12  ? 250  ALA C C   1 
ATOM   1965  O  O   . ALA A  1  250 ? 108.551 52.244  24.013  1.00 24.24  ? 250  ALA C O   1 
ATOM   1966  C  CB  . ALA A  1  250 ? 106.378 52.171  22.065  1.00 16.29  ? 250  ALA C CB  1 
ATOM   1967  N  N   . GLN A  1  251 ? 107.007 53.476  25.111  1.00 11.73  ? 251  GLN C N   1 
ATOM   1968  C  CA  . GLN A  1  251 ? 107.941 54.079  26.053  1.00 14.51  ? 251  GLN C CA  1 
ATOM   1969  C  C   . GLN A  1  251 ? 108.763 53.006  26.774  1.00 16.70  ? 251  GLN C C   1 
ATOM   1970  O  O   . GLN A  1  251 ? 109.981 53.092  26.848  1.00 16.06  ? 251  GLN C O   1 
ATOM   1971  C  CB  . GLN A  1  251 ? 107.188 54.933  27.093  1.00 18.51  ? 251  GLN C CB  1 
ATOM   1972  C  CG  . GLN A  1  251 ? 108.097 55.811  27.969  1.00 12.90  ? 251  GLN C CG  1 
ATOM   1973  C  CD  . GLN A  1  251 ? 107.398 56.302  29.206  1.00 9.62   ? 251  GLN C CD  1 
ATOM   1974  O  OE1 . GLN A  1  251 ? 106.509 55.639  29.709  1.00 7.13   ? 251  GLN C OE1 1 
ATOM   1975  N  NE2 . GLN A  1  251 ? 107.918 57.359  29.800  1.00 9.27   ? 251  GLN C NE2 1 
ATOM   1976  N  N   . THR A  1  252 ? 108.092 51.959  27.238  1.00 20.73  ? 252  THR C N   1 
ATOM   1977  C  CA  . THR A  1  252 ? 108.776 50.842  27.860  1.00 17.38  ? 252  THR C CA  1 
ATOM   1978  C  C   . THR A  1  252 ? 107.971 49.568  27.607  1.00 17.37  ? 252  THR C C   1 
ATOM   1979  O  O   . THR A  1  252 ? 106.918 49.328  28.201  1.00 17.59  ? 252  THR C O   1 
ATOM   1980  C  CB  . THR A  1  252 ? 108.995 51.116  29.368  1.00 15.61  ? 252  THR C CB  1 
ATOM   1981  O  OG1 . THR A  1  252 ? 109.527 49.954  30.004  1.00 22.20  ? 252  THR C OG1 1 
ATOM   1982  C  CG2 . THR A  1  252 ? 107.698 51.506  30.034  1.00 16.42  ? 252  THR C CG2 1 
ATOM   1983  N  N   . PHE A  1  253 ? 108.434 48.818  26.618  1.00 17.64  ? 253  PHE C N   1 
ATOM   1984  C  CA  . PHE A  1  253 ? 107.792 47.599  26.168  1.00 13.70  ? 253  PHE C CA  1 
ATOM   1985  C  C   . PHE A  1  253 ? 107.789 46.571  27.259  1.00 13.92  ? 253  PHE C C   1 
ATOM   1986  O  O   . PHE A  1  253 ? 106.885 45.755  27.343  1.00 19.07  ? 253  PHE C O   1 
ATOM   1987  C  CB  . PHE A  1  253 ? 108.553 47.028  24.986  1.00 15.71  ? 253  PHE C CB  1 
ATOM   1988  C  CG  . PHE A  1  253 ? 108.242 47.684  23.681  1.00 9.60   ? 253  PHE C CG  1 
ATOM   1989  C  CD1 . PHE A  1  253 ? 106.950 47.682  23.180  1.00 13.77  ? 253  PHE C CD1 1 
ATOM   1990  C  CD2 . PHE A  1  253 ? 109.256 48.242  22.919  1.00 15.81  ? 253  PHE C CD2 1 
ATOM   1991  C  CE1 . PHE A  1  253 ? 106.677 48.222  21.934  1.00 14.42  ? 253  PHE C CE1 1 
ATOM   1992  C  CE2 . PHE A  1  253 ? 108.996 48.788  21.669  1.00 14.31  ? 253  PHE C CE2 1 
ATOM   1993  C  CZ  . PHE A  1  253 ? 107.704 48.774  21.176  1.00 21.51  ? 253  PHE C CZ  1 
ATOM   1994  N  N   . GLU A  1  254 ? 108.797 46.639  28.114  1.00 14.32  ? 254  GLU C N   1 
ATOM   1995  C  CA  . GLU A  1  254 ? 109.021 45.638  29.146  1.00 16.78  ? 254  GLU C CA  1 
ATOM   1996  C  C   . GLU A  1  254 ? 108.156 45.843  30.371  1.00 17.89  ? 254  GLU C C   1 
ATOM   1997  O  O   . GLU A  1  254 ? 108.105 44.979  31.234  1.00 20.90  ? 254  GLU C O   1 
ATOM   1998  C  CB  . GLU A  1  254 ? 110.495 45.642  29.566  1.00 20.09  ? 254  GLU C CB  1 
ATOM   1999  C  CG  . GLU A  1  254 ? 110.973 46.941  30.235  1.00 22.28  ? 254  GLU C CG  1 
ATOM   2000  C  CD  . GLU A  1  254 ? 111.522 47.980  29.260  1.00 24.98  ? 254  GLU C CD  1 
ATOM   2001  O  OE1 . GLU A  1  254 ? 111.307 47.879  28.030  1.00 26.21  ? 254  GLU C OE1 1 
ATOM   2002  O  OE2 . GLU A  1  254 ? 112.164 48.932  29.740  1.00 28.78  ? 254  GLU C OE2 1 
ATOM   2003  N  N   . SER A  1  255 ? 107.574 47.031  30.503  1.00 19.42  ? 255  SER C N   1 
ATOM   2004  C  CA  . SER A  1  255 ? 106.813 47.380  31.693  1.00 15.82  ? 255  SER C CA  1 
ATOM   2005  C  C   . SER A  1  255 ? 105.341 47.037  31.616  1.00 16.88  ? 255  SER C C   1 
ATOM   2006  O  O   . SER A  1  255 ? 104.674 47.267  30.612  1.00 21.29  ? 255  SER C O   1 
ATOM   2007  C  CB  . SER A  1  255 ? 106.953 48.865  32.006  1.00 11.64  ? 255  SER C CB  1 
ATOM   2008  O  OG  . SER A  1  255 ? 108.304 49.208  32.245  1.00 21.67  ? 255  SER C OG  1 
ATOM   2009  N  N   . TRP A  1  256 ? 104.793 46.721  32.772  1.00 17.51  ? 256  TRP C N   1 
ATOM   2010  C  CA  . TRP A  1  256 ? 103.389 46.442  32.869  1.00 18.30  ? 256  TRP C CA  1 
ATOM   2011  C  C   . TRP A  1  256 ? 102.778 47.578  33.672  1.00 19.26  ? 256  TRP C C   1 
ATOM   2012  O  O   . TRP A  1  256 ? 103.246 48.710  33.576  1.00 23.63  ? 256  TRP C O   1 
ATOM   2013  C  CB  . TRP A  1  256 ? 103.194 45.080  33.531  1.00 18.40  ? 256  TRP C CB  1 
ATOM   2014  C  CG  . TRP A  1  256 ? 103.577 43.923  32.621  1.00 19.69  ? 256  TRP C CG  1 
ATOM   2015  C  CD1 . TRP A  1  256 ? 104.840 43.445  32.375  1.00 16.19  ? 256  TRP C CD1 1 
ATOM   2016  C  CD2 . TRP A  1  256 ? 102.680 43.107  31.846  1.00 19.89  ? 256  TRP C CD2 1 
ATOM   2017  N  NE1 . TRP A  1  256 ? 104.784 42.382  31.499  1.00 20.82  ? 256  TRP C NE1 1 
ATOM   2018  C  CE2 . TRP A  1  256 ? 103.474 42.142  31.166  1.00 19.51  ? 256  TRP C CE2 1 
ATOM   2019  C  CE3 . TRP A  1  256 ? 101.280 43.094  31.658  1.00 17.88  ? 256  TRP C CE3 1 
ATOM   2020  C  CZ2 . TRP A  1  256 ? 102.914 41.168  30.315  1.00 18.62  ? 256  TRP C CZ2 1 
ATOM   2021  C  CZ3 . TRP A  1  256 ? 100.718 42.122  30.800  1.00 17.20  ? 256  TRP C CZ3 1 
ATOM   2022  C  CH2 . TRP A  1  256 ? 101.541 41.174  30.144  1.00 18.06  ? 256  TRP C CH2 1 
ATOM   2023  N  N   . GLY A  1  257 ? 101.663 47.321  34.343  1.00 15.53  ? 257  GLY C N   1 
ATOM   2024  C  CA  . GLY A  1  257 ? 101.019 48.362  35.115  1.00 16.67  ? 257  GLY C CA  1 
ATOM   2025  C  C   . GLY A  1  257 ? 100.360 49.348  34.195  1.00 20.36  ? 257  GLY C C   1 
ATOM   2026  O  O   . GLY A  1  257 ? 99.538  48.948  33.376  1.00 27.43  ? 257  GLY C O   1 
ATOM   2027  N  N   . LYS A  1  258 ? 100.737 50.619  34.292  1.00 19.56  ? 258  LYS C N   1 
ATOM   2028  C  CA  . LYS A  1  258 ? 100.156 51.657  33.445  1.00 18.69  ? 258  LYS C CA  1 
ATOM   2029  C  C   . LYS A  1  258 ? 100.719 51.637  32.040  1.00 19.39  ? 258  LYS C C   1 
ATOM   2030  O  O   . LYS A  1  258 ? 100.200 52.314  31.167  1.00 22.42  ? 258  LYS C O   1 
ATOM   2031  C  CB  . LYS A  1  258 ? 100.433 53.029  34.026  1.00 23.97  ? 258  LYS C CB  1 
ATOM   2032  C  CG  . LYS A  1  258 ? 99.660  53.368  35.272  1.00 23.62  ? 258  LYS C CG  1 
ATOM   2033  C  CD  . LYS A  1  258 ? 99.850  54.831  35.632  1.00 21.44  ? 258  LYS C CD  1 
ATOM   2034  C  CE  . LYS A  1  258 ? 101.316 55.182  35.824  1.00 23.72  ? 258  LYS C CE  1 
ATOM   2035  N  NZ  . LYS A  1  258 ? 101.429 56.505  36.488  1.00 22.48  ? 258  LYS C NZ  1 
ATOM   2036  N  N   . LYS A  1  259 ? 101.857 50.969  31.862  1.00 19.52  ? 259  LYS C N   1 
ATOM   2037  C  CA  . LYS A  1  259 ? 102.519 50.880  30.565  1.00 16.84  ? 259  LYS C CA  1 
ATOM   2038  C  C   . LYS A  1  259 ? 101.987 49.755  29.691  1.00 19.04  ? 259  LYS C C   1 
ATOM   2039  O  O   . LYS A  1  259 ? 102.556 49.451  28.640  1.00 24.01  ? 259  LYS C O   1 
ATOM   2040  C  CB  . LYS A  1  259 ? 104.002 50.661  30.772  1.00 11.73  ? 259  LYS C CB  1 
ATOM   2041  C  CG  . LYS A  1  259 ? 104.591 51.585  31.804  1.00 16.39  ? 259  LYS C CG  1 
ATOM   2042  C  CD  . LYS A  1  259 ? 104.397 53.026  31.423  1.00 15.32  ? 259  LYS C CD  1 
ATOM   2043  C  CE  . LYS A  1  259 ? 105.250 53.882  32.290  1.00 16.78  ? 259  LYS C CE  1 
ATOM   2044  N  NZ  . LYS A  1  259 ? 105.003 55.300  32.014  1.00 20.06  ? 259  LYS C NZ  1 
ATOM   2045  N  N   . SER A  1  260 ? 100.996 49.033  30.184  1.00 18.89  ? 260  SER C N   1 
ATOM   2046  C  CA  . SER A  1  260 ? 100.442 47.941  29.413  1.00 19.33  ? 260  SER C CA  1 
ATOM   2047  C  C   . SER A  1  260 ? 98.920  47.955  29.551  1.00 21.11  ? 260  SER C C   1 
ATOM   2048  O  O   . SER A  1  260 ? 98.392  48.505  30.536  1.00 19.49  ? 260  SER C O   1 
ATOM   2049  C  CB  . SER A  1  260 ? 101.060 46.608  29.880  1.00 21.57  ? 260  SER C CB  1 
ATOM   2050  O  OG  . SER A  1  260 ? 102.420 46.491  29.453  1.00 19.73  ? 260  SER C OG  1 
ATOM   2051  N  N   . THR A  1  261 ? 98.230  47.577  28.467  1.00 22.35  ? 261  THR C N   1 
ATOM   2052  C  CA  . THR A  1  261 ? 96.765  47.513  28.454  1.00 21.40  ? 261  THR C CA  1 
ATOM   2053  C  C   . THR A  1  261 ? 96.250  46.143  28.913  1.00 23.63  ? 261  THR C C   1 
ATOM   2054  O  O   . THR A  1  261 ? 96.949  45.131  28.823  1.00 21.53  ? 261  THR C O   1 
ATOM   2055  C  CB  . THR A  1  261 ? 96.186  47.821  27.058  1.00 17.76  ? 261  THR C CB  1 
ATOM   2056  O  OG1 . THR A  1  261 ? 96.516  46.762  26.155  1.00 24.67  ? 261  THR C OG1 1 
ATOM   2057  C  CG2 . THR A  1  261 ? 96.725  49.126  26.525  1.00 17.80  ? 261  THR C CG2 1 
ATOM   2058  N  N   . PRO A  1  262 ? 94.988  46.081  29.350  1.00 25.24  ? 262  PRO C N   1 
ATOM   2059  C  CA  . PRO A  1  262 ? 94.362  44.792  29.662  1.00 24.47  ? 262  PRO C CA  1 
ATOM   2060  C  C   . PRO A  1  262 ? 94.586  43.713  28.595  1.00 23.66  ? 262  PRO C C   1 
ATOM   2061  O  O   . PRO A  1  262 ? 94.782  42.544  28.917  1.00 26.15  ? 262  PRO C O   1 
ATOM   2062  C  CB  . PRO A  1  262 ? 92.892  45.155  29.808  1.00 26.40  ? 262  PRO C CB  1 
ATOM   2063  C  CG  . PRO A  1  262 ? 92.925  46.565  30.338  1.00 26.42  ? 262  PRO C CG  1 
ATOM   2064  C  CD  . PRO A  1  262 ? 94.116  47.222  29.697  1.00 24.36  ? 262  PRO C CD  1 
ATOM   2065  N  N   . GLN A  1  263 ? 94.720  44.122  27.341  1.00 23.59  ? 263  GLN C N   1 
ATOM   2066  C  CA  . GLN A  1  263 ? 94.873  43.153  26.266  1.00 25.56  ? 263  GLN C CA  1 
ATOM   2067  C  C   . GLN A  1  263 ? 96.230  42.455  26.218  1.00 24.49  ? 263  GLN C C   1 
ATOM   2068  O  O   . GLN A  1  263 ? 96.354  41.368  25.648  1.00 28.51  ? 263  GLN C O   1 
ATOM   2069  C  CB  . GLN A  1  263 ? 94.573  43.800  24.920  1.00 24.23  ? 263  GLN C CB  1 
ATOM   2070  C  CG  . GLN A  1  263 ? 93.100  43.890  24.637  1.00 24.00  ? 263  GLN C CG  1 
ATOM   2071  C  CD  . GLN A  1  263 ? 92.404  44.846  25.571  1.00 27.40  ? 263  GLN C CD  1 
ATOM   2072  O  OE1 . GLN A  1  263 ? 92.982  45.850  25.995  1.00 30.97  ? 263  GLN C OE1 1 
ATOM   2073  N  NE2 . GLN A  1  263 ? 91.181  44.520  25.943  1.00 28.96  ? 263  GLN C NE2 1 
ATOM   2074  N  N   . ARG A  1  264 ? 97.220  43.021  26.895  1.00 22.70  ? 264  ARG C N   1 
ATOM   2075  C  CA  . ARG A  1  264 ? 98.546  42.417  26.925  1.00 19.48  ? 264  ARG C CA  1 
ATOM   2076  C  C   . ARG A  1  264 ? 98.558  41.242  27.877  1.00 19.70  ? 264  ARG C C   1 
ATOM   2077  O  O   . ARG A  1  264 ? 99.201  40.235  27.625  1.00 20.10  ? 264  ARG C O   1 
ATOM   2078  C  CB  . ARG A  1  264 ? 99.598  43.437  27.365  1.00 21.11  ? 264  ARG C CB  1 
ATOM   2079  C  CG  . ARG A  1  264 ? 101.008 43.070  26.925  1.00 23.83  ? 264  ARG C CG  1 
ATOM   2080  C  CD  . ARG A  1  264 ? 102.059 43.814  27.719  1.00 24.91  ? 264  ARG C CD  1 
ATOM   2081  N  NE  . ARG A  1  264 ? 103.373 43.211  27.528  1.00 23.44  ? 264  ARG C NE  1 
ATOM   2082  C  CZ  . ARG A  1  264 ? 104.479 43.626  28.130  1.00 24.84  ? 264  ARG C CZ  1 
ATOM   2083  N  NH1 . ARG A  1  264 ? 104.448 44.675  28.938  1.00 26.33  ? 264  ARG C NH1 1 
ATOM   2084  N  NH2 . ARG A  1  264 ? 105.618 42.998  27.912  1.00 21.74  ? 264  ARG C NH2 1 
ATOM   2085  N  N   . ALA A  1  265 ? 97.853  41.374  28.990  1.00 19.93  ? 265  ALA C N   1 
ATOM   2086  C  CA  . ALA A  1  265 ? 97.787  40.285  29.932  1.00 20.72  ? 265  ALA C CA  1 
ATOM   2087  C  C   . ALA A  1  265 ? 96.952  39.155  29.335  1.00 20.35  ? 265  ALA C C   1 
ATOM   2088  O  O   . ALA A  1  265 ? 97.375  37.994  29.381  1.00 20.93  ? 265  ALA C O   1 
ATOM   2089  C  CB  . ALA A  1  265 ? 97.210  40.755  31.214  1.00 18.22  ? 265  ALA C CB  1 
ATOM   2090  N  N   . ILE A  1  266 ? 95.895  39.507  28.598  1.00 18.82  ? 266  ILE C N   1 
ATOM   2091  C  CA  . ILE A  1  266 ? 95.125  38.477  27.896  1.00 21.16  ? 266  ILE C CA  1 
ATOM   2092  C  C   . ILE A  1  266 ? 96.006  37.788  26.862  1.00 22.43  ? 266  ILE C C   1 
ATOM   2093  O  O   . ILE A  1  266 ? 95.957  36.572  26.726  1.00 24.03  ? 266  ILE C O   1 
ATOM   2094  C  CB  . ILE A  1  266 ? 93.877  39.025  27.172  1.00 19.33  ? 266  ILE C CB  1 
ATOM   2095  C  CG1 . ILE A  1  266 ? 92.931  39.655  28.168  1.00 19.32  ? 266  ILE C CG1 1 
ATOM   2096  C  CG2 . ILE A  1  266 ? 93.078  37.880  26.523  1.00 20.14  ? 266  ILE C CG2 1 
ATOM   2097  C  CD1 . ILE A  1  266 ? 91.863  40.487  27.498  1.00 21.83  ? 266  ILE C CD1 1 
ATOM   2098  N  N   . ALA A  1  267 ? 96.844  38.553  26.167  1.00 20.82  ? 267  ALA C N   1 
ATOM   2099  C  CA  . ALA A  1  267 ? 97.733  37.974  25.172  1.00 20.49  ? 267  ALA C CA  1 
ATOM   2100  C  C   . ALA A  1  267 ? 98.788  37.084  25.819  1.00 23.10  ? 267  ALA C C   1 
ATOM   2101  O  O   . ALA A  1  267 ? 99.137  36.024  25.275  1.00 22.24  ? 267  ALA C O   1 
ATOM   2102  C  CB  . ALA A  1  267 ? 98.391  39.054  24.377  1.00 18.61  ? 267  ALA C CB  1 
ATOM   2103  N  N   . TRP A  1  268 ? 99.238  37.480  27.008  1.00 19.85  ? 268  TRP C N   1 
ATOM   2104  C  CA  . TRP A  1  268 ? 100.175 36.687  27.767  1.00 20.04  ? 268  TRP C CA  1 
ATOM   2105  C  C   . TRP A  1  268 ? 99.591  35.317  27.989  1.00 23.10  ? 268  TRP C C   1 
ATOM   2106  O  O   . TRP A  1  268 ? 100.237 34.329  27.697  1.00 27.36  ? 268  TRP C O   1 
ATOM   2107  C  CB  . TRP A  1  268 ? 100.461 37.331  29.110  1.00 24.03  ? 268  TRP C CB  1 
ATOM   2108  C  CG  . TRP A  1  268 ? 101.547 36.636  29.880  1.00 21.10  ? 268  TRP C CG  1 
ATOM   2109  C  CD1 . TRP A  1  268 ? 102.879 36.894  29.821  1.00 19.86  ? 268  TRP C CD1 1 
ATOM   2110  C  CD2 . TRP A  1  268 ? 101.382 35.604  30.854  1.00 21.01  ? 268  TRP C CD2 1 
ATOM   2111  N  NE1 . TRP A  1  268 ? 103.556 36.101  30.710  1.00 21.69  ? 268  TRP C NE1 1 
ATOM   2112  C  CE2 . TRP A  1  268 ? 102.660 35.288  31.347  1.00 19.58  ? 268  TRP C CE2 1 
ATOM   2113  C  CE3 . TRP A  1  268 ? 100.277 34.909  31.351  1.00 22.97  ? 268  TRP C CE3 1 
ATOM   2114  C  CZ2 . TRP A  1  268 ? 102.866 34.304  32.298  1.00 19.14  ? 268  TRP C CZ2 1 
ATOM   2115  C  CZ3 . TRP A  1  268 ? 100.484 33.935  32.308  1.00 23.57  ? 268  TRP C CZ3 1 
ATOM   2116  C  CH2 . TRP A  1  268 ? 101.769 33.639  32.768  1.00 20.47  ? 268  TRP C CH2 1 
ATOM   2117  N  N   . TRP A  1  269 ? 98.345  35.262  28.443  1.00 24.41  ? 269  TRP C N   1 
ATOM   2118  C  CA  . TRP A  1  269 ? 97.625  33.995  28.592  1.00 25.63  ? 269  TRP C CA  1 
ATOM   2119  C  C   . TRP A  1  269 ? 97.479  33.174  27.310  1.00 28.03  ? 269  TRP C C   1 
ATOM   2120  O  O   . TRP A  1  269 ? 97.518  31.937  27.337  1.00 26.23  ? 269  TRP C O   1 
ATOM   2121  C  CB  . TRP A  1  269 ? 96.242  34.248  29.173  1.00 26.50  ? 269  TRP C CB  1 
ATOM   2122  C  CG  . TRP A  1  269 ? 96.313  34.604  30.591  1.00 30.22  ? 269  TRP C CG  1 
ATOM   2123  C  CD1 . TRP A  1  269 ? 96.162  35.839  31.125  1.00 28.52  ? 269  TRP C CD1 1 
ATOM   2124  C  CD2 . TRP A  1  269 ? 96.627  33.723  31.680  1.00 33.15  ? 269  TRP C CD2 1 
ATOM   2125  N  NE1 . TRP A  1  269 ? 96.346  35.787  32.484  1.00 31.63  ? 269  TRP C NE1 1 
ATOM   2126  C  CE2 . TRP A  1  269 ? 96.626  34.497  32.852  1.00 31.65  ? 269  TRP C CE2 1 
ATOM   2127  C  CE3 . TRP A  1  269 ? 96.898  32.349  31.776  1.00 34.50  ? 269  TRP C CE3 1 
ATOM   2128  C  CZ2 . TRP A  1  269 ? 96.881  33.949  34.113  1.00 33.29  ? 269  TRP C CZ2 1 
ATOM   2129  C  CZ3 . TRP A  1  269 ? 97.147  31.801  33.030  1.00 34.05  ? 269  TRP C CZ3 1 
ATOM   2130  C  CH2 . TRP A  1  269 ? 97.136  32.603  34.181  1.00 34.06  ? 269  TRP C CH2 1 
ATOM   2131  N  N   . GLY A  1  270 ? 97.228  33.861  26.202  1.00 25.06  ? 270  GLY C N   1 
ATOM   2132  C  CA  . GLY A  1  270 ? 97.064  33.180  24.939  1.00 23.77  ? 270  GLY C CA  1 
ATOM   2133  C  C   . GLY A  1  270 ? 98.303  32.464  24.445  1.00 24.44  ? 270  GLY C C   1 
ATOM   2134  O  O   . GLY A  1  270 ? 98.187  31.451  23.767  1.00 27.98  ? 270  GLY C O   1 
ATOM   2135  N  N   . ILE A  1  271 ? 99.473  33.040  24.687  1.00 21.78  ? 271  ILE C N   1 
ATOM   2136  C  CA  . ILE A  1  271 ? 100.724 32.339  24.457  1.00 23.89  ? 271  ILE C CA  1 
ATOM   2137  C  C   . ILE A  1  271 ? 100.775 31.034  25.262  1.00 24.62  ? 271  ILE C C   1 
ATOM   2138  O  O   . ILE A  1  271 ? 101.135 29.975  24.738  1.00 24.40  ? 271  ILE C O   1 
ATOM   2139  C  CB  . ILE A  1  271 ? 101.920 33.216  24.843  1.00 19.91  ? 271  ILE C CB  1 
ATOM   2140  C  CG1 . ILE A  1  271 ? 102.021 34.401  23.897  1.00 19.58  ? 271  ILE C CG1 1 
ATOM   2141  C  CG2 . ILE A  1  271 ? 103.190 32.428  24.741  1.00 20.54  ? 271  ILE C CG2 1 
ATOM   2142  C  CD1 . ILE A  1  271 ? 103.007 35.407  24.361  1.00 16.35  ? 271  ILE C CD1 1 
ATOM   2143  N  N   . ARG A  1  272 ? 100.402 31.108  26.533  1.00 27.57  ? 272  ARG C N   1 
ATOM   2144  C  CA  . ARG A  1  272 ? 100.425 29.935  27.411  1.00 27.49  ? 272  ARG C CA  1 
ATOM   2145  C  C   . ARG A  1  272 ? 99.440  28.901  26.877  1.00 30.14  ? 272  ARG C C   1 
ATOM   2146  O  O   . ARG A  1  272 ? 99.829  27.765  26.582  1.00 33.29  ? 272  ARG C O   1 
ATOM   2147  C  CB  . ARG A  1  272 ? 100.073 30.331  28.863  1.00 29.20  ? 272  ARG C CB  1 
ATOM   2148  C  CG  . ARG A  1  272 ? 101.276 30.689  29.796  1.00 29.16  ? 272  ARG C CG  1 
ATOM   2149  C  CD  . ARG A  1  272 ? 102.445 31.314  29.018  1.00 29.95  ? 272  ARG C CD  1 
ATOM   2150  N  NE  . ARG A  1  272 ? 103.311 32.180  29.811  1.00 31.13  ? 272  ARG C NE  1 
ATOM   2151  C  CZ  . ARG A  1  272 ? 104.053 33.153  29.297  1.00 30.84  ? 272  ARG C CZ  1 
ATOM   2152  N  NH1 . ARG A  1  272 ? 103.740 33.695  28.133  1.00 31.29  ? 272  ARG C NH1 1 
ATOM   2153  N  NH2 . ARG A  1  272 ? 105.008 33.697  30.020  1.00 35.85  ? 272  ARG C NH2 1 
ATOM   2154  N  N   . MET A  1  273 ? 98.230  29.362  26.558  1.00 30.91  ? 273  MET C N   1 
ATOM   2155  C  CA  . MET A  1  273 ? 97.199  28.510  25.990  1.00 27.70  ? 273  MET C CA  1 
ATOM   2156  C  C   . MET A  1  273 ? 97.644  27.810  24.697  1.00 27.62  ? 273  MET C C   1 
ATOM   2157  O  O   . MET A  1  273 ? 97.576  26.591  24.581  1.00 26.42  ? 273  MET C O   1 
ATOM   2158  C  CB  . MET A  1  273 ? 95.947  29.320  25.727  1.00 24.61  ? 273  MET C CB  1 
ATOM   2159  C  CG  . MET A  1  273 ? 94.912  28.515  24.989  1.00 28.49  ? 273  MET C CG  1 
ATOM   2160  S  SD  . MET A  1  273 ? 93.382  29.382  24.806  1.00 26.96  ? 273  MET C SD  1 
ATOM   2161  C  CE  . MET A  1  273 ? 93.741  30.129  23.223  1.00 33.47  ? 273  MET C CE  1 
ATOM   2162  N  N   . VAL A  1  274 ? 98.149  28.575  23.744  1.00 27.16  ? 274  VAL C N   1 
ATOM   2163  C  CA  . VAL A  1  274 ? 98.615  28.005  22.487  1.00 28.10  ? 274  VAL C CA  1 
ATOM   2164  C  C   . VAL A  1  274 ? 99.649  26.894  22.683  1.00 28.51  ? 274  VAL C C   1 
ATOM   2165  O  O   . VAL A  1  274 ? 99.649  25.903  21.950  1.00 32.70  ? 274  VAL C O   1 
ATOM   2166  C  CB  . VAL A  1  274 ? 99.189  29.112  21.566  1.00 26.11  ? 274  VAL C CB  1 
ATOM   2167  C  CG1 . VAL A  1  274 ? 100.243 28.559  20.619  1.00 27.35  ? 274  VAL C CG1 1 
ATOM   2168  C  CG2 . VAL A  1  274 ? 98.061  29.737  20.767  1.00 29.57  ? 274  VAL C CG2 1 
ATOM   2169  N  N   . ARG A  1  275 ? 100.538 27.072  23.653  1.00 27.46  ? 275  ARG C N   1 
ATOM   2170  C  CA  . ARG A  1  275 ? 101.617 26.118  23.888  1.00 27.39  ? 275  ARG C CA  1 
ATOM   2171  C  C   . ARG A  1  275 ? 101.045 24.799  24.404  1.00 29.16  ? 275  ARG C C   1 
ATOM   2172  O  O   . ARG A  1  275 ? 101.391 23.715  23.930  1.00 32.04  ? 275  ARG C O   1 
ATOM   2173  C  CB  . ARG A  1  275 ? 102.607 26.696  24.903  1.00 26.84  ? 275  ARG C CB  1 
ATOM   2174  C  CG  . ARG A  1  275 ? 103.567 27.722  24.311  1.00 22.73  ? 275  ARG C CG  1 
ATOM   2175  C  CD  . ARG A  1  275 ? 104.372 28.405  25.387  1.00 22.94  ? 275  ARG C CD  1 
ATOM   2176  N  NE  . ARG A  1  275 ? 105.491 29.180  24.843  1.00 24.34  ? 275  ARG C NE  1 
ATOM   2177  C  CZ  . ARG A  1  275 ? 106.311 29.922  25.584  1.00 20.04  ? 275  ARG C CZ  1 
ATOM   2178  N  NH1 . ARG A  1  275 ? 106.154 29.976  26.898  1.00 20.95  ? 275  ARG C NH1 1 
ATOM   2179  N  NH2 . ARG A  1  275 ? 107.299 30.589  25.017  1.00 18.17  ? 275  ARG C NH2 1 
ATOM   2180  N  N   . ASP A  1  276 ? 100.080 24.910  25.298  1.00 29.85  ? 276  ASP C N   1 
ATOM   2181  C  CA  . ASP A  1  276 ? 99.368  23.761  25.808  1.00 31.02  ? 276  ASP C CA  1 
ATOM   2182  C  C   . ASP A  1  276 ? 98.640  22.965  24.713  1.00 31.30  ? 276  ASP C C   1 
ATOM   2183  O  O   . ASP A  1  276 ? 98.764  21.746  24.632  1.00 30.36  ? 276  ASP C O   1 
ATOM   2184  C  CB  . ASP A  1  276 ? 98.372  24.237  26.849  1.00 36.08  ? 276  ASP C CB  1 
ATOM   2185  C  CG  . ASP A  1  276 ? 97.751  23.104  27.618  1.00 39.46  ? 276  ASP C CG  1 
ATOM   2186  O  OD1 . ASP A  1  276 ? 98.444  22.091  27.855  1.00 46.68  ? 276  ASP C OD1 1 
ATOM   2187  O  OD2 . ASP A  1  276 ? 96.582  23.249  28.027  1.00 41.88  ? 276  ASP C OD2 1 
ATOM   2188  N  N   . LEU A  1  277 ? 97.844  23.638  23.897  1.00 28.39  ? 277  LEU C N   1 
ATOM   2189  C  CA  . LEU A  1  277 ? 97.165  22.953  22.817  1.00 26.65  ? 277  LEU C CA  1 
ATOM   2190  C  C   . LEU A  1  277 ? 98.186  22.230  21.952  1.00 31.33  ? 277  LEU C C   1 
ATOM   2191  O  O   . LEU A  1  277 ? 98.062  21.034  21.708  1.00 35.22  ? 277  LEU C O   1 
ATOM   2192  C  CB  . LEU A  1  277 ? 96.405  23.944  21.958  1.00 25.66  ? 277  LEU C CB  1 
ATOM   2193  C  CG  . LEU A  1  277 ? 95.456  24.896  22.678  1.00 28.33  ? 277  LEU C CG  1 
ATOM   2194  C  CD1 . LEU A  1  277 ? 94.790  25.814  21.649  1.00 26.09  ? 277  LEU C CD1 1 
ATOM   2195  C  CD2 . LEU A  1  277 ? 94.427  24.104  23.468  1.00 27.82  ? 277  LEU C CD2 1 
ATOM   2196  N  N   . ASN A  1  278 ? 99.207  22.952  21.506  1.00 31.47  ? 278  ASN C N   1 
ATOM   2197  C  CA  . ASN A  1  278 ? 100.233 22.385  20.635  1.00 29.77  ? 278  ASN C CA  1 
ATOM   2198  C  C   . ASN A  1  278 ? 100.947 21.172  21.252  1.00 30.25  ? 278  ASN C C   1 
ATOM   2199  O  O   . ASN A  1  278 ? 100.865 20.044  20.744  1.00 28.59  ? 278  ASN C O   1 
ATOM   2200  C  CB  . ASN A  1  278 ? 101.245 23.469  20.274  1.00 28.39  ? 278  ASN C CB  1 
ATOM   2201  C  CG  . ASN A  1  278 ? 100.681 24.476  19.308  1.00 25.86  ? 278  ASN C CG  1 
ATOM   2202  O  OD1 . ASN A  1  278 ? 99.694  24.200  18.626  1.00 23.90  ? 278  ASN C OD1 1 
ATOM   2203  N  ND2 . ASN A  1  278 ? 101.317 25.634  19.205  1.00 26.05  ? 278  ASN C ND2 1 
ATOM   2204  N  N   . MET A  1  279 ? 101.508 21.371  22.431  1.00 26.57  ? 279  MET C N   1 
ATOM   2205  C  CA  . MET A  1  279 ? 102.238 20.312  23.074  1.00 28.50  ? 279  MET C CA  1 
ATOM   2206  C  C   . MET A  1  279 ? 101.384 19.130  23.475  1.00 26.28  ? 279  MET C C   1 
ATOM   2207  O  O   . MET A  1  279 ? 101.781 18.012  23.235  1.00 33.79  ? 279  MET C O   1 
ATOM   2208  C  CB  . MET A  1  279 ? 102.985 20.854  24.277  1.00 30.49  ? 279  MET C CB  1 
ATOM   2209  C  CG  . MET A  1  279 ? 104.073 21.811  23.880  1.00 33.87  ? 279  MET C CG  1 
ATOM   2210  S  SD  . MET A  1  279 ? 105.166 22.145  25.239  1.00 41.57  ? 279  MET C SD  1 
ATOM   2211  C  CE  . MET A  1  279 ? 104.048 22.835  26.451  1.00 34.98  ? 279  MET C CE  1 
ATOM   2212  N  N   . ASN A  1  280 ? 100.156 19.364  23.915  1.00 26.91  ? 280  ASN C N   1 
ATOM   2213  C  CA  . ASN A  1  280 ? 99.367  18.308  24.542  1.00 24.60  ? 280  ASN C CA  1 
ATOM   2214  C  C   . ASN A  1  280 ? 98.187  17.741  23.781  1.00 26.83  ? 280  ASN C C   1 
ATOM   2215  O  O   . ASN A  1  280 ? 97.599  16.754  24.216  1.00 27.63  ? 280  ASN C O   1 
ATOM   2216  C  CB  . ASN A  1  280 ? 98.865  18.763  25.889  1.00 29.61  ? 280  ASN C CB  1 
ATOM   2217  C  CG  . ASN A  1  280 ? 99.974  19.099  26.815  1.00 34.43  ? 280  ASN C CG  1 
ATOM   2218  O  OD1 . ASN A  1  280 ? 101.135 18.868  26.503  1.00 43.09  ? 280  ASN C OD1 1 
ATOM   2219  N  ND2 . ASN A  1  280 ? 99.643  19.682  27.954  1.00 43.83  ? 280  ASN C ND2 1 
ATOM   2220  N  N   . TYR A  1  281 ? 97.734  18.436  22.750  1.00 27.63  ? 281  TYR C N   1 
ATOM   2221  C  CA  . TYR A  1  281 ? 96.634  17.933  21.946  1.00 26.11  ? 281  TYR C CA  1 
ATOM   2222  C  C   . TYR A  1  281 ? 97.028  17.786  20.490  1.00 28.78  ? 281  TYR C C   1 
ATOM   2223  O  O   . TYR A  1  281 ? 96.770  16.757  19.868  1.00 33.83  ? 281  TYR C O   1 
ATOM   2224  C  CB  . TYR A  1  281 ? 95.440  18.858  22.055  1.00 21.43  ? 281  TYR C CB  1 
ATOM   2225  C  CG  . TYR A  1  281 ? 94.961  19.030  23.458  1.00 24.47  ? 281  TYR C CG  1 
ATOM   2226  C  CD1 . TYR A  1  281 ? 95.681  19.777  24.373  1.00 27.16  ? 281  TYR C CD1 1 
ATOM   2227  C  CD2 . TYR A  1  281 ? 93.795  18.425  23.880  1.00 28.51  ? 281  TYR C CD2 1 
ATOM   2228  C  CE1 . TYR A  1  281 ? 95.253  19.900  25.684  1.00 30.44  ? 281  TYR C CE1 1 
ATOM   2229  C  CE2 . TYR A  1  281 ? 93.344  18.548  25.180  1.00 33.01  ? 281  TYR C CE2 1 
ATOM   2230  C  CZ  . TYR A  1  281 ? 94.081  19.275  26.083  1.00 35.11  ? 281  TYR C CZ  1 
ATOM   2231  O  OH  . TYR A  1  281 ? 93.676  19.315  27.399  1.00 37.50  ? 281  TYR C OH  1 
ATOM   2232  N  N   . LEU A  1  282 ? 97.678  18.800  19.942  1.00 28.14  ? 282  LEU C N   1 
ATOM   2233  C  CA  . LEU A  1  282 ? 97.737  18.908  18.500  1.00 27.84  ? 282  LEU C CA  1 
ATOM   2234  C  C   . LEU A  1  282 ? 98.945  18.197  17.955  1.00 30.61  ? 282  LEU C C   1 
ATOM   2235  O  O   . LEU A  1  282 ? 98.849  17.460  16.979  1.00 31.31  ? 282  LEU C O   1 
ATOM   2236  C  CB  . LEU A  1  282 ? 97.729  20.373  18.080  1.00 23.58  ? 282  LEU C CB  1 
ATOM   2237  C  CG  . LEU A  1  282 ? 96.378  21.063  18.303  1.00 23.58  ? 282  LEU C CG  1 
ATOM   2238  C  CD1 . LEU A  1  282 ? 96.454  22.558  17.982  1.00 18.93  ? 282  LEU C CD1 1 
ATOM   2239  C  CD2 . LEU A  1  282 ? 95.349  20.381  17.430  1.00 20.75  ? 282  LEU C CD2 1 
ATOM   2240  N  N   . ALA A  1  283 ? 100.078 18.363  18.623  1.00 33.76  ? 283  ALA C N   1 
ATOM   2241  C  CA  . ALA A  1  283 ? 101.309 17.735  18.163  1.00 33.30  ? 283  ALA C CA  1 
ATOM   2242  C  C   . ALA A  1  283 ? 101.178 16.216  18.171  1.00 34.80  ? 283  ALA C C   1 
ATOM   2243  O  O   . ALA A  1  283 ? 101.469 15.580  17.166  1.00 36.92  ? 283  ALA C O   1 
ATOM   2244  C  CB  . ALA A  1  283 ? 102.474 18.167  19.020  1.00 32.83  ? 283  ALA C CB  1 
ATOM   2245  N  N   . PRO A  1  284 ? 100.653 15.626  19.268  1.00 33.64  ? 284  PRO C N   1 
ATOM   2246  C  CA  . PRO A  1  284 ? 100.447 14.175  19.349  1.00 33.84  ? 284  PRO C CA  1 
ATOM   2247  C  C   . PRO A  1  284 ? 99.632  13.567  18.197  1.00 36.08  ? 284  PRO C C   1 
ATOM   2248  O  O   . PRO A  1  284 ? 99.798  12.396  17.853  1.00 42.57  ? 284  PRO C O   1 
ATOM   2249  C  CB  . PRO A  1  284 ? 99.726  13.995  20.679  1.00 34.13  ? 284  PRO C CB  1 
ATOM   2250  C  CG  . PRO A  1  284 ? 100.103 15.164  21.472  1.00 32.74  ? 284  PRO C CG  1 
ATOM   2251  C  CD  . PRO A  1  284 ? 100.227 16.289  20.513  1.00 33.21  ? 284  PRO C CD  1 
ATOM   2252  N  N   . LEU A  1  285 ? 98.782  14.365  17.570  1.00 34.11  ? 285  LEU C N   1 
ATOM   2253  C  CA  . LEU A  1  285 ? 97.938  13.857  16.504  1.00 33.05  ? 285  LEU C CA  1 
ATOM   2254  C  C   . LEU A  1  285 ? 98.687  13.392  15.258  1.00 33.76  ? 285  LEU C C   1 
ATOM   2255  O  O   . LEU A  1  285 ? 98.058  12.958  14.300  1.00 38.79  ? 285  LEU C O   1 
ATOM   2256  C  CB  . LEU A  1  285 ? 96.901  14.912  16.107  1.00 30.69  ? 285  LEU C CB  1 
ATOM   2257  C  CG  . LEU A  1  285 ? 95.956  15.423  17.203  1.00 33.18  ? 285  LEU C CG  1 
ATOM   2258  C  CD1 . LEU A  1  285 ? 94.936  16.374  16.599  1.00 34.42  ? 285  LEU C CD1 1 
ATOM   2259  C  CD2 . LEU A  1  285 ? 95.258  14.271  17.882  1.00 33.08  ? 285  LEU C CD2 1 
ATOM   2260  N  N   . ASN A  1  286 ? 100.010 13.466  15.231  1.00 31.42  ? 286  ASN C N   1 
ATOM   2261  C  CA  . ASN A  1  286 ? 100.712 12.903  14.082  1.00 39.67  ? 286  ASN C CA  1 
ATOM   2262  C  C   . ASN A  1  286 ? 100.627 11.386  14.125  1.00 43.00  ? 286  ASN C C   1 
ATOM   2263  O  O   . ASN A  1  286 ? 100.727 10.710  13.094  1.00 43.00  ? 286  ASN C O   1 
ATOM   2264  C  CB  . ASN A  1  286 ? 102.177 13.340  14.032  1.00 40.94  ? 286  ASN C CB  1 
ATOM   2265  C  CG  . ASN A  1  286 ? 102.945 12.983  15.290  1.00 40.89  ? 286  ASN C CG  1 
ATOM   2266  O  OD1 . ASN A  1  286 ? 102.363 12.609  16.310  1.00 43.02  ? 286  ASN C OD1 1 
ATOM   2267  N  ND2 . ASN A  1  286 ? 104.254 13.183  15.247  1.00 41.29  ? 286  ASN C ND2 1 
ATOM   2268  N  N   . ALA A  1  287 ? 100.393 10.859  15.324  1.00 47.10  ? 287  ALA C N   1 
ATOM   2269  C  CA  . ALA A  1  287 ? 100.076 9.443   15.503  1.00 48.94  ? 287  ALA C CA  1 
ATOM   2270  C  C   . ALA A  1  287 ? 98.818  9.063   14.717  1.00 50.61  ? 287  ALA C C   1 
ATOM   2271  O  O   . ALA A  1  287 ? 98.841  8.144   13.901  1.00 53.10  ? 287  ALA C O   1 
ATOM   2272  C  CB  . ALA A  1  287 ? 99.877  9.135   16.989  1.00 48.87  ? 287  ALA C CB  1 
ATOM   2273  N  N   . SER A  1  288 ? 97.768  9.864   14.869  1.00 50.41  ? 288  SER C N   1 
ATOM   2274  C  CA  . SER A  1  288 ? 96.447  9.493   14.398  1.00 47.16  ? 288  SER C CA  1 
ATOM   2275  C  C   . SER A  1  288 ? 96.110  10.008  13.009  1.00 45.54  ? 288  SER C C   1 
ATOM   2276  O  O   . SER A  1  288 ? 95.019  9.752   12.517  1.00 48.57  ? 288  SER C O   1 
ATOM   2277  C  CB  . SER A  1  288 ? 95.394  9.975   15.391  1.00 47.18  ? 288  SER C CB  1 
ATOM   2278  O  OG  . SER A  1  288 ? 95.953  10.123  16.693  1.00 55.51  ? 288  SER C OG  1 
ATOM   2279  N  N   . LEU A  1  289 ? 97.021  10.722  12.360  1.00 43.95  ? 289  LEU C N   1 
ATOM   2280  C  CA  . LEU A  1  289 ? 96.686  11.321  11.067  1.00 41.89  ? 289  LEU C CA  1 
ATOM   2281  C  C   . LEU A  1  289 ? 97.342  10.623  9.880   1.00 42.97  ? 289  LEU C C   1 
ATOM   2282  O  O   . LEU A  1  289 ? 98.418  10.014  9.995   1.00 46.22  ? 289  LEU C O   1 
ATOM   2283  C  CB  . LEU A  1  289 ? 97.048  12.804  11.042  1.00 38.61  ? 289  LEU C CB  1 
ATOM   2284  C  CG  . LEU A  1  289 ? 96.248  13.800  11.881  1.00 37.01  ? 289  LEU C CG  1 
ATOM   2285  C  CD1 . LEU A  1  289 ? 97.006  15.099  11.836  1.00 38.27  ? 289  LEU C CD1 1 
ATOM   2286  C  CD2 . LEU A  1  289 ? 94.828  14.000  11.359  1.00 35.26  ? 289  LEU C CD2 1 
ATOM   2287  N  N   . PRO A  1  290 ? 96.714  10.727  8.703   1.00 40.85  ? 290  PRO C N   1 
ATOM   2288  C  CA  . PRO A  1  290 ? 97.342  10.211  7.489   1.00 40.78  ? 290  PRO C CA  1 
ATOM   2289  C  C   . PRO A  1  290 ? 98.612  10.972  7.223   1.00 42.97  ? 290  PRO C C   1 
ATOM   2290  O  O   . PRO A  1  290 ? 98.697  12.160  7.512   1.00 45.57  ? 290  PRO C O   1 
ATOM   2291  C  CB  . PRO A  1  290 ? 96.299  10.486  6.404   1.00 38.12  ? 290  PRO C CB  1 
ATOM   2292  C  CG  . PRO A  1  290 ? 95.540  11.632  6.912   1.00 40.96  ? 290  PRO C CG  1 
ATOM   2293  C  CD  . PRO A  1  290 ? 95.448  11.414  8.402   1.00 40.87  ? 290  PRO C CD  1 
ATOM   2294  N  N   . ALA A  1  291 ? 99.538  10.339  6.529   1.00 45.88  ? 291  ALA C N   1 
ATOM   2295  C  CA  . ALA A  1  291 ? 100.702 11.059  6.044   1.00 50.23  ? 291  ALA C CA  1 
ATOM   2296  C  C   . ALA A  1  291 ? 100.279 12.322  5.301   1.00 53.28  ? 291  ALA C C   1 
ATOM   2297  O  O   . ALA A  1  291 ? 100.893 13.374  5.462   1.00 57.29  ? 291  ALA C O   1 
ATOM   2298  C  CB  . ALA A  1  291 ? 101.497 10.185  5.132   1.00 50.99  ? 291  ALA C CB  1 
ATOM   2299  N  N   . SER A  1  292 ? 99.190  12.212  4.544   1.00 55.76  ? 292  SER C N   1 
ATOM   2300  C  CA  . SER A  1  292 ? 98.645  13.307  3.742   1.00 57.03  ? 292  SER C CA  1 
ATOM   2301  C  C   . SER A  1  292 ? 98.604  14.622  4.523   1.00 56.46  ? 292  SER C C   1 
ATOM   2302  O  O   . SER A  1  292 ? 98.758  15.702  3.951   1.00 58.04  ? 292  SER C O   1 
ATOM   2303  C  CB  . SER A  1  292 ? 97.228  12.939  3.274   1.00 61.63  ? 292  SER C CB  1 
ATOM   2304  O  OG  . SER A  1  292 ? 97.100  11.538  3.007   1.00 71.70  ? 292  SER C OG  1 
ATOM   2305  N  N   . ARG A  1  293 ? 98.403  14.513  5.833   1.00 54.93  ? 293  ARG C N   1 
ATOM   2306  C  CA  . ARG A  1  293 ? 98.221  15.674  6.688   1.00 53.32  ? 293  ARG C CA  1 
ATOM   2307  C  C   . ARG A  1  293 ? 99.528  16.288  7.133   1.00 51.01  ? 293  ARG C C   1 
ATOM   2308  O  O   . ARG A  1  293 ? 99.592  17.493  7.374   1.00 53.89  ? 293  ARG C O   1 
ATOM   2309  C  CB  . ARG A  1  293 ? 97.413  15.305  7.930   1.00 51.91  ? 293  ARG C CB  1 
ATOM   2310  C  CG  . ARG A  1  293 ? 95.943  15.187  7.672   1.00 52.66  ? 293  ARG C CG  1 
ATOM   2311  C  CD  . ARG A  1  293 ? 95.464  16.314  6.785   1.00 53.73  ? 293  ARG C CD  1 
ATOM   2312  N  NE  . ARG A  1  293 ? 94.023  16.486  6.908   1.00 56.06  ? 293  ARG C NE  1 
ATOM   2313  C  CZ  . ARG A  1  293 ? 93.252  17.040  5.978   1.00 56.53  ? 293  ARG C CZ  1 
ATOM   2314  N  NH1 . ARG A  1  293 ? 93.790  17.525  4.866   1.00 55.67  ? 293  ARG C NH1 1 
ATOM   2315  N  NH2 . ARG A  1  293 ? 91.942  17.135  6.173   1.00 59.22  ? 293  ARG C NH2 1 
ATOM   2316  N  N   . LEU A  1  294 ? 100.536 15.447  7.328   1.00 45.96  ? 294  LEU C N   1 
ATOM   2317  C  CA  . LEU A  1  294 ? 101.718 15.831  8.084   1.00 41.26  ? 294  LEU C CA  1 
ATOM   2318  C  C   . LEU A  1  294 ? 102.751 16.549  7.227   1.00 39.10  ? 294  LEU C C   1 
ATOM   2319  O  O   . LEU A  1  294 ? 102.748 16.433  6.007   1.00 40.55  ? 294  LEU C O   1 
ATOM   2320  C  CB  . LEU A  1  294 ? 102.338 14.599  8.733   1.00 40.14  ? 294  LEU C CB  1 
ATOM   2321  C  CG  . LEU A  1  294 ? 101.379 13.600  9.375   1.00 36.31  ? 294  LEU C CG  1 
ATOM   2322  C  CD1 . LEU A  1  294 ? 102.192 12.526  10.041  1.00 31.32  ? 294  LEU C CD1 1 
ATOM   2323  C  CD2 . LEU A  1  294 ? 100.446 14.286  10.375  1.00 38.20  ? 294  LEU C CD2 1 
ATOM   2324  N  N   . GLY A  1  295 ? 103.580 17.362  7.871   1.00 40.61  ? 295  GLY C N   1 
ATOM   2325  C  CA  . GLY A  1  295 ? 104.567 18.147  7.149   1.00 44.70  ? 295  GLY C CA  1 
ATOM   2326  C  C   . GLY A  1  295 ? 105.896 17.431  6.974   1.00 47.06  ? 295  GLY C C   1 
ATOM   2327  O  O   . GLY A  1  295 ? 106.024 16.243  7.304   1.00 48.13  ? 295  GLY C O   1 
ATOM   2328  N  N   . ARG A  1  296 ? 106.934 18.189  6.636   1.00 46.25  ? 296  ARG C N   1 
ATOM   2329  C  CA  . ARG A  1  296 ? 108.190 17.565  6.249   1.00 44.75  ? 296  ARG C CA  1 
ATOM   2330  C  C   . ARG A  1  296 ? 108.995 16.923  7.386   1.00 45.18  ? 296  ARG C C   1 
ATOM   2331  O  O   . ARG A  1  296 ? 109.894 16.136  7.130   1.00 48.61  ? 296  ARG C O   1 
ATOM   2332  C  CB  . ARG A  1  296 ? 109.046 18.552  5.454   1.00 42.92  ? 296  ARG C CB  1 
ATOM   2333  C  CG  . ARG A  1  296 ? 108.342 19.069  4.209   1.00 41.72  ? 296  ARG C CG  1 
ATOM   2334  C  CD  . ARG A  1  296 ? 109.320 19.539  3.166   1.00 44.66  ? 296  ARG C CD  1 
ATOM   2335  N  NE  . ARG A  1  296 ? 110.004 20.752  3.591   1.00 55.35  ? 296  ARG C NE  1 
ATOM   2336  C  CZ  . ARG A  1  296 ? 111.141 21.202  3.067   1.00 58.67  ? 296  ARG C CZ  1 
ATOM   2337  N  NH1 . ARG A  1  296 ? 111.687 20.597  2.019   1.00 59.68  ? 296  ARG C NH1 1 
ATOM   2338  N  NH2 . ARG A  1  296 ? 111.697 22.306  3.552   1.00 62.06  ? 296  ARG C NH2 1 
ATOM   2339  N  N   . GLN A  1  297 ? 108.619 17.156  8.637   1.00 45.39  ? 297  GLN C N   1 
ATOM   2340  C  CA  . GLN A  1  297 ? 109.210 16.378  9.728   1.00 44.76  ? 297  GLN C CA  1 
ATOM   2341  C  C   . GLN A  1  297 ? 108.198 15.492  10.439  1.00 42.94  ? 297  GLN C C   1 
ATOM   2342  O  O   . GLN A  1  297 ? 108.330 15.212  11.635  1.00 44.81  ? 297  GLN C O   1 
ATOM   2343  C  CB  . GLN A  1  297 ? 109.888 17.293  10.749  1.00 50.92  ? 297  GLN C CB  1 
ATOM   2344  C  CG  . GLN A  1  297 ? 111.030 18.110  10.187  1.00 59.59  ? 297  GLN C CG  1 
ATOM   2345  C  CD  . GLN A  1  297 ? 110.656 19.562  10.011  1.00 66.28  ? 297  GLN C CD  1 
ATOM   2346  O  OE1 . GLN A  1  297 ? 109.586 19.892  9.470   1.00 72.77  ? 297  GLN C OE1 1 
ATOM   2347  N  NE2 . GLN A  1  297 ? 111.537 20.446  10.451  1.00 67.83  ? 297  GLN C NE2 1 
ATOM   2348  N  N   . GLY A  1  298 ? 107.147 15.115  9.717   1.00 41.65  ? 298  GLY C N   1 
ATOM   2349  C  CA  . GLY A  1  298 ? 106.115 14.275  10.289  1.00 38.10  ? 298  GLY C CA  1 
ATOM   2350  C  C   . GLY A  1  298 ? 105.419 14.915  11.467  1.00 39.31  ? 298  GLY C C   1 
ATOM   2351  O  O   . GLY A  1  298 ? 104.909 14.204  12.350  1.00 41.05  ? 298  GLY C O   1 
ATOM   2352  N  N   . GLU A  1  299 ? 105.368 16.251  11.460  1.00 36.66  ? 299  GLU C N   1 
ATOM   2353  C  CA  . GLU A  1  299 ? 104.615 17.010  12.454  1.00 37.76  ? 299  GLU C CA  1 
ATOM   2354  C  C   . GLU A  1  299 ? 103.169 17.195  11.980  1.00 37.80  ? 299  GLU C C   1 
ATOM   2355  O  O   . GLU A  1  299 ? 102.926 17.391  10.791  1.00 41.51  ? 299  GLU C O   1 
ATOM   2356  C  CB  . GLU A  1  299 ? 105.273 18.377  12.704  1.00 37.60  ? 299  GLU C CB  1 
ATOM   2357  C  CG  . GLU A  1  299 ? 105.066 19.452  11.617  1.00 38.71  ? 299  GLU C CG  1 
ATOM   2358  C  CD  . GLU A  1  299 ? 106.156 19.448  10.553  1.00 39.96  ? 299  GLU C CD  1 
ATOM   2359  O  OE1 . GLU A  1  299 ? 106.723 18.376  10.301  1.00 41.49  ? 299  GLU C OE1 1 
ATOM   2360  O  OE2 . GLU A  1  299 ? 106.427 20.498  9.930   1.00 40.33  ? 299  GLU C OE2 1 
ATOM   2361  N  N   . ALA A  1  300 ? 102.213 16.984  12.876  1.00 34.79  ? 300  ALA C N   1 
ATOM   2362  C  CA  . ALA A  1  300 ? 100.832 17.372  12.631  1.00 34.43  ? 300  ALA C CA  1 
ATOM   2363  C  C   . ALA A  1  300 ? 100.776 18.881  12.444  1.00 36.46  ? 300  ALA C C   1 
ATOM   2364  O  O   . ALA A  1  300 ? 101.589 19.613  13.029  1.00 40.19  ? 300  ALA C O   1 
ATOM   2365  C  CB  . ALA A  1  300 ? 99.980  16.979  13.804  1.00 33.49  ? 300  ALA C CB  1 
ATOM   2366  N  N   . PRO A  1  301 ? 99.798  19.372  11.657  1.00 35.63  ? 301  PRO C N   1 
ATOM   2367  C  CA  . PRO A  1  301 ? 99.486  20.808  11.620  1.00 33.90  ? 301  PRO C CA  1 
ATOM   2368  C  C   . PRO A  1  301 ? 99.166  21.310  13.018  1.00 32.89  ? 301  PRO C C   1 
ATOM   2369  O  O   . PRO A  1  301 ? 98.601  20.576  13.819  1.00 35.28  ? 301  PRO C O   1 
ATOM   2370  C  CB  . PRO A  1  301 ? 98.261  20.886  10.711  1.00 33.30  ? 301  PRO C CB  1 
ATOM   2371  C  CG  . PRO A  1  301 ? 98.289  19.638  9.925   1.00 32.63  ? 301  PRO C CG  1 
ATOM   2372  C  CD  . PRO A  1  301 ? 98.844  18.598  10.848  1.00 34.65  ? 301  PRO C CD  1 
ATOM   2373  N  N   . GLN A  1  302 ? 99.606  22.517  13.346  1.00 32.26  ? 302  GLN C N   1 
ATOM   2374  C  CA  . GLN A  1  302 ? 99.350  23.060  14.669  1.00 31.88  ? 302  GLN C CA  1 
ATOM   2375  C  C   . GLN A  1  302 ? 98.817  24.495  14.606  1.00 31.80  ? 302  GLN C C   1 
ATOM   2376  O  O   . GLN A  1  302 ? 98.701  25.070  13.524  1.00 27.59  ? 302  GLN C O   1 
ATOM   2377  C  CB  . GLN A  1  302 ? 100.624 22.992  15.514  1.00 33.86  ? 302  GLN C CB  1 
ATOM   2378  C  CG  . GLN A  1  302 ? 101.144 21.572  15.738  1.00 40.07  ? 302  GLN C CG  1 
ATOM   2379  C  CD  . GLN A  1  302 ? 102.522 21.539  16.373  1.00 39.98  ? 302  GLN C CD  1 
ATOM   2380  O  OE1 . GLN A  1  302 ? 103.546 21.540  15.679  1.00 44.36  ? 302  GLN C OE1 1 
ATOM   2381  N  NE2 . GLN A  1  302 ? 102.555 21.521  17.699  1.00 40.90  ? 302  GLN C NE2 1 
ATOM   2382  N  N   . ALA A  1  303 ? 98.560  25.076  15.780  1.00 32.78  ? 303  ALA C N   1 
ATOM   2383  C  CA  . ALA A  1  303 ? 97.841  26.345  15.930  1.00 31.20  ? 303  ALA C CA  1 
ATOM   2384  C  C   . ALA A  1  303 ? 98.732  27.493  16.434  1.00 29.02  ? 303  ALA C C   1 
ATOM   2385  O  O   . ALA A  1  303 ? 99.646  27.304  17.243  1.00 27.15  ? 303  ALA C O   1 
ATOM   2386  C  CB  . ALA A  1  303 ? 96.650  26.157  16.883  1.00 32.25  ? 303  ALA C CB  1 
ATOM   2387  N  N   . ASP A  1  304 ? 98.477  28.687  15.925  1.00 28.20  ? 304  ASP C N   1 
ATOM   2388  C  CA  . ASP A  1  304 ? 99.106  29.877  16.461  1.00 25.58  ? 304  ASP C CA  1 
ATOM   2389  C  C   . ASP A  1  304 ? 97.983  30.845  16.791  1.00 23.32  ? 304  ASP C C   1 
ATOM   2390  O  O   . ASP A  1  304 ? 96.849  30.421  16.957  1.00 24.38  ? 304  ASP C O   1 
ATOM   2391  C  CB  . ASP A  1  304 ? 100.119 30.463  15.459  1.00 22.03  ? 304  ASP C CB  1 
ATOM   2392  C  CG  . ASP A  1  304 ? 99.504  30.825  14.132  1.00 25.28  ? 304  ASP C CG  1 
ATOM   2393  O  OD1 . ASP A  1  304 ? 98.262  30.924  14.064  1.00 29.37  ? 304  ASP C OD1 1 
ATOM   2394  O  OD2 . ASP A  1  304 ? 100.265 31.052  13.159  1.00 22.31  ? 304  ASP C OD2 1 
ATOM   2395  N  N   . CYS A  1  305 ? 98.267  32.140  16.809  1.00 26.89  ? 305  CYS C N   1 
ATOM   2396  C  CA  . CYS A  1  305 ? 97.247  33.114  17.177  1.00 27.56  ? 305  CYS C CA  1 
ATOM   2397  C  C   . CYS A  1  305 ? 96.241  33.260  16.040  1.00 27.78  ? 305  CYS C C   1 
ATOM   2398  O  O   . CYS A  1  305 ? 95.035  33.409  16.267  1.00 27.92  ? 305  CYS C O   1 
ATOM   2399  C  CB  . CYS A  1  305 ? 97.887  34.466  17.503  1.00 25.22  ? 305  CYS C CB  1 
ATOM   2400  S  SG  . CYS A  1  305 ? 99.118  34.368  18.831  1.00 23.18  ? 305  CYS C SG  1 
ATOM   2401  N  N   . ARG A  1  306 ? 96.727  33.117  14.812  1.00 27.43  ? 306  ARG C N   1 
ATOM   2402  C  CA  . ARG A  1  306 ? 95.857  33.226  13.658  1.00 25.23  ? 306  ARG C CA  1 
ATOM   2403  C  C   . ARG A  1  306 ? 94.792  32.126  13.632  1.00 24.47  ? 306  ARG C C   1 
ATOM   2404  O  O   . ARG A  1  306 ? 93.641  32.420  13.352  1.00 29.26  ? 306  ARG C O   1 
ATOM   2405  C  CB  . ARG A  1  306 ? 96.677  33.219  12.358  1.00 23.96  ? 306  ARG C CB  1 
ATOM   2406  C  CG  . ARG A  1  306 ? 96.110  34.120  11.253  1.00 21.21  ? 306  ARG C CG  1 
ATOM   2407  C  CD  . ARG A  1  306 ? 97.018  34.159  10.038  1.00 22.08  ? 306  ARG C CD  1 
ATOM   2408  N  NE  . ARG A  1  306 ? 97.656  35.462  9.856   1.00 30.37  ? 306  ARG C NE  1 
ATOM   2409  C  CZ  . ARG A  1  306 ? 98.914  35.735  10.187  1.00 31.53  ? 306  ARG C CZ  1 
ATOM   2410  N  NH1 . ARG A  1  306 ? 99.690  34.798  10.728  1.00 41.31  ? 306  ARG C NH1 1 
ATOM   2411  N  NH2 . ARG A  1  306 ? 99.392  36.956  10.016  1.00 35.52  ? 306  ARG C NH2 1 
ATOM   2412  N  N   . THR A  1  307 ? 95.131  30.909  14.059  1.00 22.69  ? 307  THR C N   1 
ATOM   2413  C  CA  . THR A  1  307 ? 94.247  29.768  13.851  1.00 21.22  ? 307  THR C CA  1 
ATOM   2414  C  C   . THR A  1  307 ? 92.826  30.085  14.320  1.00 23.02  ? 307  THR C C   1 
ATOM   2415  O  O   . THR A  1  307 ? 91.854  29.893  13.575  1.00 22.17  ? 307  THR C O   1 
ATOM   2416  C  CB  . THR A  1  307 ? 94.796  28.508  14.562  1.00 19.44  ? 307  THR C CB  1 
ATOM   2417  O  OG1 . THR A  1  307 ? 96.062  28.167  13.984  1.00 12.81  ? 307  THR C OG1 1 
ATOM   2418  C  CG2 . THR A  1  307 ? 93.855  27.324  14.367  1.00 15.88  ? 307  THR C CG2 1 
ATOM   2419  N  N   . CYS A  1  308 ? 92.736  30.767  15.457  1.00 22.29  ? 308  CYS C N   1 
ATOM   2420  C  CA  . CYS A  1  308 ? 91.477  31.338  15.902  1.00 21.46  ? 308  CYS C CA  1 
ATOM   2421  C  C   . CYS A  1  308 ? 91.186  32.742  15.389  1.00 23.49  ? 308  CYS C C   1 
ATOM   2422  O  O   . CYS A  1  308 ? 90.074  33.019  14.949  1.00 28.18  ? 308  CYS C O   1 
ATOM   2423  C  CB  . CYS A  1  308 ? 91.441  31.355  17.403  1.00 18.64  ? 308  CYS C CB  1 
ATOM   2424  S  SG  . CYS A  1  308 ? 91.542  29.688  18.053  1.00 23.24  ? 308  CYS C SG  1 
ATOM   2425  N  N   . HIS A  1  309 ? 92.134  33.658  15.566  1.00 24.33  ? 309  HIS C N   1 
ATOM   2426  C  CA  . HIS A  1  309 ? 91.850  35.077  15.422  1.00 22.96  ? 309  HIS C CA  1 
ATOM   2427  C  C   . HIS A  1  309 ? 91.644  35.484  13.973  1.00 19.79  ? 309  HIS C C   1 
ATOM   2428  O  O   . HIS A  1  309 ? 90.733  36.241  13.657  1.00 24.72  ? 309  HIS C O   1 
ATOM   2429  C  CB  . HIS A  1  309 ? 92.957  35.910  16.093  1.00 20.53  ? 309  HIS C CB  1 
ATOM   2430  C  CG  . HIS A  1  309 ? 92.791  36.044  17.580  1.00 17.62  ? 309  HIS C CG  1 
ATOM   2431  N  ND1 . HIS A  1  309 ? 92.164  37.102  18.199  1.00 16.04  ? 309  HIS C ND1 1 
ATOM   2432  C  CD2 . HIS A  1  309 ? 93.138  35.197  18.581  1.00 19.62  ? 309  HIS C CD2 1 
ATOM   2433  C  CE1 . HIS A  1  309 ? 92.154  36.863  19.522  1.00 16.46  ? 309  HIS C CE1 1 
ATOM   2434  N  NE2 . HIS A  1  309 ? 92.739  35.713  19.804  1.00 18.45  ? 309  HIS C NE2 1 
ATOM   2435  N  N   . GLN A  1  310 ? 92.399  34.869  13.083  1.00 18.91  ? 310  GLN C N   1 
ATOM   2436  C  CA  . GLN A  1  310 ? 92.268  35.099  11.648  1.00 19.75  ? 310  GLN C CA  1 
ATOM   2437  C  C   . GLN A  1  310 ? 92.125  36.575  11.338  1.00 20.72  ? 310  GLN C C   1 
ATOM   2438  O  O   . GLN A  1  310 ? 91.212  36.981  10.635  1.00 25.65  ? 310  GLN C O   1 
ATOM   2439  C  CB  . GLN A  1  310 ? 91.071  34.306  11.070  1.00 21.55  ? 310  GLN C CB  1 
ATOM   2440  C  CG  . GLN A  1  310 ? 90.872  32.910  11.690  1.00 20.70  ? 310  GLN C CG  1 
ATOM   2441  C  CD  . GLN A  1  310 ? 90.229  31.865  10.771  1.00 21.98  ? 310  GLN C CD  1 
ATOM   2442  O  OE1 . GLN A  1  310 ? 89.759  32.167  9.681   1.00 24.74  ? 310  GLN C OE1 1 
ATOM   2443  N  NE2 . GLN A  1  310 ? 90.225  30.616  11.223  1.00 23.90  ? 310  GLN C NE2 1 
ATOM   2444  N  N   . GLY A  1  311 ? 92.942  37.390  11.989  1.00 21.99  ? 311  GLY C N   1 
ATOM   2445  C  CA  . GLY A  1  311 ? 93.031  38.795  11.629  1.00 19.33  ? 311  GLY C CA  1 
ATOM   2446  C  C   . GLY A  1  311 ? 92.183  39.767  12.431  1.00 21.09  ? 311  GLY C C   1 
ATOM   2447  O  O   . GLY A  1  311 ? 92.076  40.932  12.064  1.00 22.23  ? 311  GLY C O   1 
ATOM   2448  N  N   . VAL A  1  312 ? 91.550  39.298  13.500  1.00 22.97  ? 312  VAL C N   1 
ATOM   2449  C  CA  . VAL A  1  312 ? 90.648  40.139  14.296  1.00 23.34  ? 312  VAL C CA  1 
ATOM   2450  C  C   . VAL A  1  312 ? 91.059  40.039  15.773  1.00 26.04  ? 312  VAL C C   1 
ATOM   2451  O  O   . VAL A  1  312 ? 91.507  38.974  16.224  1.00 26.10  ? 312  VAL C O   1 
ATOM   2452  C  CB  . VAL A  1  312 ? 89.179  39.664  14.123  1.00 19.51  ? 312  VAL C CB  1 
ATOM   2453  C  CG1 . VAL A  1  312 ? 88.210  40.698  14.652  1.00 15.65  ? 312  VAL C CG1 1 
ATOM   2454  C  CG2 . VAL A  1  312 ? 88.891  39.384  12.654  1.00 13.82  ? 312  VAL C CG2 1 
ATOM   2455  N  N   . THR A  1  313 ? 90.990  41.149  16.505  1.00 23.16  ? 313  THR C N   1 
ATOM   2456  C  CA  . THR A  1  313 ? 91.410  41.129  17.901  1.00 21.29  ? 313  THR C CA  1 
ATOM   2457  C  C   . THR A  1  313 ? 90.620  40.170  18.808  1.00 22.10  ? 313  THR C C   1 
ATOM   2458  O  O   . THR A  1  313 ? 91.188  39.509  19.685  1.00 20.62  ? 313  THR C O   1 
ATOM   2459  C  CB  . THR A  1  313 ? 91.433  42.546  18.503  1.00 21.37  ? 313  THR C CB  1 
ATOM   2460  O  OG1 . THR A  1  313 ? 90.206  43.219  18.212  1.00 18.80  ? 313  THR C OG1 1 
ATOM   2461  C  CG2 . THR A  1  313 ? 92.597  43.347  17.919  1.00 17.53  ? 313  THR C CG2 1 
ATOM   2462  N  N   . LYS A  1  314 ? 89.336  40.007  18.534  1.00 25.08  ? 314  LYS C N   1 
ATOM   2463  C  CA  . LYS A  1  314 ? 88.585  38.889  19.102  1.00 23.72  ? 314  LYS C CA  1 
ATOM   2464  C  C   . LYS A  1  314 ? 88.119  38.013  17.958  1.00 23.21  ? 314  LYS C C   1 
ATOM   2465  O  O   . LYS A  1  314 ? 87.544  38.508  16.993  1.00 26.86  ? 314  LYS C O   1 
ATOM   2466  C  CB  . LYS A  1  314 ? 87.371  39.391  19.846  1.00 26.20  ? 314  LYS C CB  1 
ATOM   2467  C  CG  . LYS A  1  314 ? 87.681  40.126  21.095  1.00 31.50  ? 314  LYS C CG  1 
ATOM   2468  C  CD  . LYS A  1  314 ? 86.436  40.834  21.547  1.00 37.05  ? 314  LYS C CD  1 
ATOM   2469  C  CE  . LYS A  1  314 ? 86.538  41.287  22.985  1.00 43.63  ? 314  LYS C CE  1 
ATOM   2470  N  NZ  . LYS A  1  314 ? 85.441  42.252  23.294  1.00 49.76  ? 314  LYS C NZ  1 
ATOM   2471  N  N   . PRO A  1  315 ? 88.326  36.697  18.057  1.00 22.34  ? 315  PRO C N   1 
ATOM   2472  C  CA  . PRO A  1  315 ? 87.894  35.775  17.007  1.00 19.24  ? 315  PRO C CA  1 
ATOM   2473  C  C   . PRO A  1  315 ? 86.439  35.982  16.697  1.00 19.38  ? 315  PRO C C   1 
ATOM   2474  O  O   . PRO A  1  315 ? 85.643  36.182  17.612  1.00 17.78  ? 315  PRO C O   1 
ATOM   2475  C  CB  . PRO A  1  315 ? 88.121  34.406  17.615  1.00 20.87  ? 315  PRO C CB  1 
ATOM   2476  C  CG  . PRO A  1  315 ? 89.186  34.637  18.624  1.00 24.79  ? 315  PRO C CG  1 
ATOM   2477  C  CD  . PRO A  1  315 ? 88.888  35.980  19.208  1.00 24.20  ? 315  PRO C CD  1 
ATOM   2478  N  N   . LEU A  1  316 ? 86.119  36.026  15.405  1.00 21.23  ? 316  LEU C N   1 
ATOM   2479  C  CA  . LEU A  1  316 ? 84.751  36.228  14.929  1.00 23.87  ? 316  LEU C CA  1 
ATOM   2480  C  C   . LEU A  1  316 ? 84.090  37.410  15.621  1.00 22.77  ? 316  LEU C C   1 
ATOM   2481  O  O   . LEU A  1  316 ? 82.931  37.335  16.020  1.00 23.64  ? 316  LEU C O   1 
ATOM   2482  C  CB  . LEU A  1  316 ? 83.912  34.955  15.141  1.00 20.40  ? 316  LEU C CB  1 
ATOM   2483  C  CG  . LEU A  1  316 ? 84.504  33.690  14.520  1.00 24.07  ? 316  LEU C CG  1 
ATOM   2484  C  CD1 . LEU A  1  316 ? 84.356  32.576  15.508  1.00 21.77  ? 316  LEU C CD1 1 
ATOM   2485  C  CD2 . LEU A  1  316 ? 83.817  33.337  13.192  1.00 15.83  ? 316  LEU C CD2 1 
ATOM   2486  N  N   . PHE A  1  317 ? 84.889  38.436  15.899  1.00 24.51  ? 317  PHE C N   1 
ATOM   2487  C  CA  . PHE A  1  317 ? 84.406  39.674  16.504  1.00 22.39  ? 317  PHE C CA  1 
ATOM   2488  C  C   . PHE A  1  317 ? 83.652  39.397  17.800  1.00 24.45  ? 317  PHE C C   1 
ATOM   2489  O  O   . PHE A  1  317 ? 82.710  40.104  18.143  1.00 24.93  ? 317  PHE C O   1 
ATOM   2490  C  CB  . PHE A  1  317 ? 83.517  40.440  15.519  1.00 23.27  ? 317  PHE C CB  1 
ATOM   2491  C  CG  . PHE A  1  317 ? 84.236  40.896  14.274  1.00 23.76  ? 317  PHE C CG  1 
ATOM   2492  C  CD1 . PHE A  1  317 ? 84.693  39.976  13.337  1.00 25.42  ? 317  PHE C CD1 1 
ATOM   2493  C  CD2 . PHE A  1  317 ? 84.551  42.236  14.090  1.00 23.67  ? 317  PHE C CD2 1 
ATOM   2494  C  CE1 . PHE A  1  317 ? 85.465  40.386  12.256  1.00 24.44  ? 317  PHE C CE1 1 
ATOM   2495  C  CE2 . PHE A  1  317 ? 85.323  42.645  13.012  1.00 19.26  ? 317  PHE C CE2 1 
ATOM   2496  C  CZ  . PHE A  1  317 ? 85.780  41.723  12.103  1.00 25.42  ? 317  PHE C CZ  1 
ATOM   2497  N  N   . GLY A  1  318 ? 84.044  38.329  18.486  1.00 23.20  ? 318  GLY C N   1 
ATOM   2498  C  CA  . GLY A  1  318 ? 83.544  38.083  19.822  1.00 23.75  ? 318  GLY C CA  1 
ATOM   2499  C  C   . GLY A  1  318 ? 82.295  37.235  19.870  1.00 26.86  ? 318  GLY C C   1 
ATOM   2500  O  O   . GLY A  1  318 ? 81.768  36.995  20.948  1.00 29.10  ? 318  GLY C O   1 
ATOM   2501  N  N   . ALA A  1  319 ? 81.834  36.741  18.723  1.00 29.08  ? 319  ALA C N   1 
ATOM   2502  C  CA  . ALA A  1  319 ? 80.670  35.847  18.685  1.00 27.03  ? 319  ALA C CA  1 
ATOM   2503  C  C   . ALA A  1  319 ? 80.911  34.685  19.619  1.00 27.43  ? 319  ALA C C   1 
ATOM   2504  O  O   . ALA A  1  319 ? 82.039  34.211  19.721  1.00 33.94  ? 319  ALA C O   1 
ATOM   2505  C  CB  . ALA A  1  319 ? 80.436  35.337  17.275  1.00 20.07  ? 319  ALA C CB  1 
ATOM   2506  N  N   . SER A  1  320 ? 79.869  34.263  20.330  1.00 28.56  ? 320  SER C N   1 
ATOM   2507  C  CA  . SER A  1  320 ? 79.936  33.109  21.233  1.00 28.05  ? 320  SER C CA  1 
ATOM   2508  C  C   . SER A  1  320 ? 78.776  32.139  20.960  1.00 30.02  ? 320  SER C C   1 
ATOM   2509  O  O   . SER A  1  320 ? 77.711  32.548  20.488  1.00 31.60  ? 320  SER C O   1 
ATOM   2510  C  CB  . SER A  1  320 ? 79.869  33.588  22.685  1.00 26.89  ? 320  SER C CB  1 
ATOM   2511  O  OG  . SER A  1  320 ? 79.708  32.513  23.591  1.00 33.58  ? 320  SER C OG  1 
ATOM   2512  N  N   . ARG A  1  321 ? 78.992  30.852  21.199  1.00 29.51  ? 321  ARG C N   1 
ATOM   2513  C  CA  . ARG A  1  321 ? 77.885  29.899  21.210  1.00 31.11  ? 321  ARG C CA  1 
ATOM   2514  C  C   . ARG A  1  321 ? 77.909  29.119  22.507  1.00 32.74  ? 321  ARG C C   1 
ATOM   2515  O  O   . ARG A  1  321 ? 77.283  28.066  22.620  1.00 36.47  ? 321  ARG C O   1 
ATOM   2516  C  CB  . ARG A  1  321 ? 77.979  28.936  20.031  1.00 27.96  ? 321  ARG C CB  1 
ATOM   2517  C  CG  . ARG A  1  321 ? 77.986  29.611  18.675  1.00 28.15  ? 321  ARG C CG  1 
ATOM   2518  C  CD  . ARG A  1  321 ? 76.603  30.043  18.224  1.00 28.17  ? 321  ARG C CD  1 
ATOM   2519  N  NE  . ARG A  1  321 ? 76.637  30.526  16.845  1.00 36.88  ? 321  ARG C NE  1 
ATOM   2520  C  CZ  . ARG A  1  321 ? 76.781  31.805  16.492  1.00 41.81  ? 321  ARG C CZ  1 
ATOM   2521  N  NH1 . ARG A  1  321 ? 76.768  32.763  17.405  1.00 43.22  ? 321  ARG C NH1 1 
ATOM   2522  N  NH2 . ARG A  1  321 ? 76.902  32.135  15.210  1.00 46.71  ? 321  ARG C NH2 1 
ATOM   2523  N  N   . LEU A  1  322 ? 78.477  29.737  23.534  1.00 33.35  ? 322  LEU C N   1 
ATOM   2524  C  CA  . LEU A  1  322 ? 78.935  29.005  24.695  1.00 34.20  ? 322  LEU C CA  1 
ATOM   2525  C  C   . LEU A  1  322 ? 77.769  28.523  25.537  1.00 36.07  ? 322  LEU C C   1 
ATOM   2526  O  O   . LEU A  1  322 ? 77.818  27.450  26.123  1.00 40.59  ? 322  LEU C O   1 
ATOM   2527  C  CB  . LEU A  1  322 ? 79.861  29.883  25.529  1.00 31.92  ? 322  LEU C CB  1 
ATOM   2528  C  CG  . LEU A  1  322 ? 80.423  29.169  26.745  1.00 27.85  ? 322  LEU C CG  1 
ATOM   2529  C  CD1 . LEU A  1  322 ? 81.924  29.070  26.655  1.00 29.64  ? 322  LEU C CD1 1 
ATOM   2530  C  CD2 . LEU A  1  322 ? 79.988  29.930  27.967  1.00 27.34  ? 322  LEU C CD2 1 
ATOM   2531  N  N   . LYS A  1  323 ? 76.750  29.359  25.656  1.00 36.67  ? 323  LYS C N   1 
ATOM   2532  C  CA  . LYS A  1  323 ? 75.536  28.989  26.376  1.00 36.06  ? 323  LYS C CA  1 
ATOM   2533  C  C   . LYS A  1  323 ? 74.666  28.082  25.518  1.00 37.76  ? 323  LYS C C   1 
ATOM   2534  O  O   . LYS A  1  323 ? 73.806  27.367  26.030  1.00 38.86  ? 323  LYS C O   1 
ATOM   2535  C  CB  . LYS A  1  323 ? 74.731  30.228  26.766  1.00 38.16  ? 323  LYS C CB  1 
ATOM   2536  C  CG  . LYS A  1  323 ? 75.131  31.539  26.071  1.00 50.36  ? 323  LYS C CG  1 
ATOM   2537  C  CD  . LYS A  1  323 ? 75.032  31.488  24.522  1.00 51.12  ? 323  LYS C CD  1 
ATOM   2538  C  CE  . LYS A  1  323 ? 75.301  32.854  23.923  0.00 45.36  ? 323  LYS C CE  1 
ATOM   2539  N  NZ  . LYS A  1  323 ? 75.826  32.757  22.535  0.00 43.35  ? 323  LYS C NZ  1 
ATOM   2540  N  N   . ASP A  1  324 ? 74.934  28.071  24.217  1.00 37.23  ? 324  ASP C N   1 
ATOM   2541  C  CA  . ASP A  1  324 ? 74.181  27.247  23.292  1.00 32.98  ? 324  ASP C CA  1 
ATOM   2542  C  C   . ASP A  1  324 ? 74.705  25.829  23.231  1.00 33.69  ? 324  ASP C C   1 
ATOM   2543  O  O   . ASP A  1  324 ? 73.963  24.916  22.916  1.00 35.07  ? 324  ASP C O   1 
ATOM   2544  C  CB  . ASP A  1  324 ? 74.200  27.881  21.909  1.00 35.28  ? 324  ASP C CB  1 
ATOM   2545  C  CG  . ASP A  1  324 ? 73.558  29.248  21.905  1.00 39.71  ? 324  ASP C CG  1 
ATOM   2546  O  OD1 . ASP A  1  324 ? 72.467  29.381  22.504  1.00 42.01  ? 324  ASP C OD1 1 
ATOM   2547  O  OD2 . ASP A  1  324 ? 74.186  30.212  21.414  1.00 43.38  ? 324  ASP C OD2 1 
ATOM   2548  N  N   . TYR A  1  325 ? 75.987  25.635  23.504  1.00 34.19  ? 325  TYR C N   1 
ATOM   2549  C  CA  . TYR A  1  325 ? 76.542  24.289  23.528  1.00 34.00  ? 325  TYR C CA  1 
ATOM   2550  C  C   . TYR A  1  325 ? 77.429  24.025  24.759  1.00 35.39  ? 325  TYR C C   1 
ATOM   2551  O  O   . TYR A  1  325 ? 78.664  24.059  24.688  1.00 41.90  ? 325  TYR C O   1 
ATOM   2552  C  CB  . TYR A  1  325 ? 77.289  24.026  22.218  1.00 32.10  ? 325  TYR C CB  1 
ATOM   2553  C  CG  . TYR A  1  325 ? 76.403  24.158  20.982  1.00 36.36  ? 325  TYR C CG  1 
ATOM   2554  C  CD1 . TYR A  1  325 ? 76.268  25.388  20.320  1.00 32.71  ? 325  TYR C CD1 1 
ATOM   2555  C  CD2 . TYR A  1  325 ? 75.732  23.043  20.450  1.00 30.31  ? 325  TYR C CD2 1 
ATOM   2556  C  CE1 . TYR A  1  325 ? 75.504  25.498  19.160  1.00 32.00  ? 325  TYR C CE1 1 
ATOM   2557  C  CE2 . TYR A  1  325 ? 74.972  23.145  19.284  1.00 27.30  ? 325  TYR C CE2 1 
ATOM   2558  C  CZ  . TYR A  1  325 ? 74.872  24.369  18.638  1.00 31.30  ? 325  TYR C CZ  1 
ATOM   2559  O  OH  . TYR A  1  325 ? 74.281  24.439  17.395  1.00 24.22  ? 325  TYR C OH  1 
ATOM   2560  N  N   . PRO A  1  326 ? 76.796  23.780  25.921  1.00 36.14  ? 326  PRO C N   1 
ATOM   2561  C  CA  . PRO A  1  326 ? 77.479  23.617  27.211  1.00 33.23  ? 326  PRO C CA  1 
ATOM   2562  C  C   . PRO A  1  326 ? 78.353  22.381  27.274  1.00 34.62  ? 326  PRO C C   1 
ATOM   2563  O  O   . PRO A  1  326 ? 79.234  22.284  28.128  1.00 37.38  ? 326  PRO C O   1 
ATOM   2564  C  CB  . PRO A  1  326 ? 76.334  23.527  28.212  1.00 34.68  ? 326  PRO C CB  1 
ATOM   2565  C  CG  . PRO A  1  326 ? 75.242  24.284  27.585  1.00 37.66  ? 326  PRO C CG  1 
ATOM   2566  C  CD  . PRO A  1  326 ? 75.351  23.993  26.108  1.00 36.72  ? 326  PRO C CD  1 
ATOM   2567  N  N   . GLU A  1  327 ? 78.041  21.408  26.419  1.00 32.26  ? 327  GLU C N   1 
ATOM   2568  C  CA  . GLU A  1  327 ? 78.857  20.209  26.231  1.00 30.09  ? 327  GLU C CA  1 
ATOM   2569  C  C   . GLU A  1  327 ? 80.307  20.576  26.064  1.00 30.73  ? 327  GLU C C   1 
ATOM   2570  O  O   . GLU A  1  327 ? 81.192  19.804  26.404  1.00 32.33  ? 327  GLU C O   1 
ATOM   2571  C  CB  . GLU A  1  327 ? 78.451  19.474  24.959  1.00 32.14  ? 327  GLU C CB  1 
ATOM   2572  C  CG  . GLU A  1  327 ? 76.989  19.395  24.725  1.00 30.99  ? 327  GLU C CG  1 
ATOM   2573  C  CD  . GLU A  1  327 ? 76.481  20.513  23.886  1.00 29.83  ? 327  GLU C CD  1 
ATOM   2574  O  OE1 . GLU A  1  327 ? 76.670  20.469  22.658  1.00 32.88  ? 327  GLU C OE1 1 
ATOM   2575  O  OE2 . GLU A  1  327 ? 75.804  21.386  24.448  1.00 33.44  ? 327  GLU C OE2 1 
ATOM   2576  N  N   . LEU A  1  328 ? 80.520  21.644  25.309  1.00 30.52  ? 328  LEU C N   1 
ATOM   2577  C  CA  . LEU A  1  328 ? 81.851  22.052  24.916  1.00 31.84  ? 328  LEU C CA  1 
ATOM   2578  C  C   . LEU A  1  328 ? 82.538  22.823  26.034  1.00 30.39  ? 328  LEU C C   1 
ATOM   2579  O  O   . LEU A  1  328 ? 83.715  23.165  25.939  1.00 27.76  ? 328  LEU C O   1 
ATOM   2580  C  CB  . LEU A  1  328 ? 81.769  22.890  23.643  1.00 33.59  ? 328  LEU C CB  1 
ATOM   2581  C  CG  . LEU A  1  328 ? 81.194  22.158  22.425  1.00 33.91  ? 328  LEU C CG  1 
ATOM   2582  C  CD1 . LEU A  1  328 ? 81.177  23.095  21.215  1.00 34.02  ? 328  LEU C CD1 1 
ATOM   2583  C  CD2 . LEU A  1  328 ? 82.021  20.884  22.142  1.00 33.21  ? 328  LEU C CD2 1 
ATOM   2584  N  N   . GLY A  1  329 ? 81.842  22.962  27.149  1.00 33.03  ? 329  GLY C N   1 
ATOM   2585  C  CA  . GLY A  1  329 ? 82.438  23.594  28.303  1.00 36.90  ? 329  GLY C CA  1 
ATOM   2586  C  C   . GLY A  1  329 ? 81.871  24.979  28.528  1.00 39.05  ? 329  GLY C C   1 
ATOM   2587  O  O   . GLY A  1  329 ? 81.242  25.549  27.633  1.00 42.97  ? 329  GLY C O   1 
ATOM   2588  N  N   . PRO A  1  330 ? 82.127  25.579  29.696  1.00 40.81  ? 330  PRO C N   1 
ATOM   2589  C  CA  . PRO A  1  330 ? 83.038  25.088  30.737  1.00 42.73  ? 330  PRO C CA  1 
ATOM   2590  C  C   . PRO A  1  330 ? 82.474  23.869  31.440  1.00 46.38  ? 330  PRO C C   1 
ATOM   2591  O  O   . PRO A  1  330 ? 81.303  23.829  31.792  1.00 47.88  ? 330  PRO C O   1 
ATOM   2592  C  CB  . PRO A  1  330 ? 83.137  26.263  31.679  1.00 40.70  ? 330  PRO C CB  1 
ATOM   2593  C  CG  . PRO A  1  330 ? 82.142  27.307  31.289  1.00 40.92  ? 330  PRO C CG  1 
ATOM   2594  C  CD  . PRO A  1  330 ? 81.327  26.737  30.150  1.00 39.87  ? 330  PRO C CD  1 
ATOM   2595  N  N   . ILE A  1  331 ? 83.314  22.869  31.633  1.00 51.30  ? 331  ILE C N   1 
ATOM   2596  C  CA  . ILE A  1  331 ? 82.881  21.636  32.256  1.00 56.32  ? 331  ILE C CA  1 
ATOM   2597  C  C   . ILE A  1  331 ? 83.078  21.749  33.777  1.00 61.28  ? 331  ILE C C   1 
ATOM   2598  O  O   . ILE A  1  331 ? 84.205  21.915  34.253  1.00 62.74  ? 331  ILE C O   1 
ATOM   2599  C  CB  . ILE A  1  331 ? 83.684  20.440  31.676  1.00 54.75  ? 331  ILE C CB  1 
ATOM   2600  C  CG1 . ILE A  1  331 ? 83.476  20.352  30.158  1.00 50.58  ? 331  ILE C CG1 1 
ATOM   2601  C  CG2 . ILE A  1  331 ? 83.284  19.152  32.362  1.00 54.45  ? 331  ILE C CG2 1 
ATOM   2602  C  CD1 . ILE A  1  331 ? 82.027  20.386  29.727  1.00 51.12  ? 331  ILE C CD1 1 
ATOM   2603  N  N   . LYS A  1  332 ? 81.970  21.752  34.522  1.00 67.17  ? 332  LYS C N   1 
ATOM   2604  C  CA  . LYS A  1  332 ? 81.994  21.829  35.994  1.00 71.73  ? 332  LYS C CA  1 
ATOM   2605  C  C   . LYS A  1  332 ? 82.921  20.781  36.643  1.00 74.64  ? 332  LYS C C   1 
ATOM   2606  O  O   . LYS A  1  332 ? 82.569  19.600  36.793  1.00 75.97  ? 332  LYS C O   1 
ATOM   2607  C  CB  . LYS A  1  332 ? 80.561  21.695  36.562  1.00 71.06  ? 332  LYS C CB  1 
ATOM   2608  N  N   . ALA B  2  1   ? 128.146 98.669  20.653  1.00 45.94  ? 1    ALA L N   1 
ATOM   2609  C  CA  . ALA B  2  1   ? 126.736 98.269  20.366  1.00 44.61  ? 1    ALA L CA  1 
ATOM   2610  C  C   . ALA B  2  1   ? 126.432 98.069  18.875  1.00 41.30  ? 1    ALA L C   1 
ATOM   2611  O  O   . ALA B  2  1   ? 125.569 97.251  18.539  1.00 42.60  ? 1    ALA L O   1 
ATOM   2612  C  CB  . ALA B  2  1   ? 125.791 99.294  20.965  1.00 47.43  ? 1    ALA L CB  1 
ATOM   2613  N  N   . LEU B  2  2   ? 127.125 98.807  17.999  1.00 35.61  ? 2    LEU L N   1 
ATOM   2614  C  CA  . LEU B  2  2   ? 127.080 98.562  16.553  1.00 30.86  ? 2    LEU L CA  1 
ATOM   2615  C  C   . LEU B  2  2   ? 128.352 97.882  16.100  1.00 28.13  ? 2    LEU L C   1 
ATOM   2616  O  O   . LEU B  2  2   ? 129.419 98.173  16.617  1.00 29.85  ? 2    LEU L O   1 
ATOM   2617  C  CB  . LEU B  2  2   ? 126.934 99.869  15.793  1.00 31.05  ? 2    LEU L CB  1 
ATOM   2618  C  CG  . LEU B  2  2   ? 125.521 100.279 15.385  1.00 33.95  ? 2    LEU L CG  1 
ATOM   2619  C  CD1 . LEU B  2  2   ? 124.572 100.136 16.556  1.00 32.76  ? 2    LEU L CD1 1 
ATOM   2620  C  CD2 . LEU B  2  2   ? 125.539 101.719 14.882  1.00 32.15  ? 2    LEU L CD2 1 
ATOM   2621  N  N   . LEU B  2  3   ? 128.234 96.900  15.220  1.00 24.96  ? 3    LEU L N   1 
ATOM   2622  C  CA  . LEU B  2  3   ? 129.415 96.300  14.623  1.00 24.49  ? 3    LEU L CA  1 
ATOM   2623  C  C   . LEU B  2  3   ? 130.185 97.407  13.903  1.00 27.43  ? 3    LEU L C   1 
ATOM   2624  O  O   . LEU B  2  3   ? 129.593 98.421  13.519  1.00 25.77  ? 3    LEU L O   1 
ATOM   2625  C  CB  . LEU B  2  3   ? 129.003 95.218  13.638  1.00 20.88  ? 3    LEU L CB  1 
ATOM   2626  C  CG  . LEU B  2  3   ? 128.681 93.859  14.238  1.00 22.19  ? 3    LEU L CG  1 
ATOM   2627  C  CD1 . LEU B  2  3   ? 128.062 92.951  13.185  1.00 24.73  ? 3    LEU L CD1 1 
ATOM   2628  C  CD2 . LEU B  2  3   ? 129.958 93.248  14.754  1.00 25.78  ? 3    LEU L CD2 1 
ATOM   2629  N  N   . SER B  2  4   ? 131.470 97.196  13.630  1.00 27.80  ? 4    SER L N   1 
ATOM   2630  C  CA  . SER B  2  4   ? 132.282 98.289  13.094  1.00 28.59  ? 4    SER L CA  1 
ATOM   2631  C  C   . SER B  2  4   ? 131.769 98.838  11.751  1.00 29.45  ? 4    SER L C   1 
ATOM   2632  O  O   . SER B  2  4   ? 131.798 100.054 11.522  1.00 33.03  ? 4    SER L O   1 
ATOM   2633  C  CB  . SER B  2  4   ? 133.760 97.874  13.003  1.00 25.20  ? 4    SER L CB  1 
ATOM   2634  O  OG  . SER B  2  4   ? 134.072 97.182  11.809  1.00 32.62  ? 4    SER L OG  1 
ATOM   2635  N  N   . PHE B  2  5   ? 131.049 97.986  11.020  1.00 30.88  ? 5    PHE L N   1 
ATOM   2636  C  CA  . PHE B  2  5   ? 130.571 98.269  9.658   1.00 25.52  ? 5    PHE L CA  1 
ATOM   2637  C  C   . PHE B  2  5   ? 129.050 98.433  9.578   1.00 25.15  ? 5    PHE L C   1 
ATOM   2638  O  O   . PHE B  2  5   ? 128.481 98.612  8.498   1.00 22.98  ? 5    PHE L O   1 
ATOM   2639  C  CB  . PHE B  2  5   ? 131.011 97.137  8.722   1.00 24.38  ? 5    PHE L CB  1 
ATOM   2640  C  CG  . PHE B  2  5   ? 130.636 95.752  9.207   1.00 21.28  ? 5    PHE L CG  1 
ATOM   2641  C  CD1 . PHE B  2  5   ? 129.316 95.302  9.143   1.00 24.51  ? 5    PHE L CD1 1 
ATOM   2642  C  CD2 . PHE B  2  5   ? 131.625 94.850  9.605   1.00 24.07  ? 5    PHE L CD2 1 
ATOM   2643  C  CE1 . PHE B  2  5   ? 128.991 93.965  9.458   1.00 22.75  ? 5    PHE L CE1 1 
ATOM   2644  C  CE2 . PHE B  2  5   ? 131.312 93.512  9.919   1.00 19.51  ? 5    PHE L CE2 1 
ATOM   2645  C  CZ  . PHE B  2  5   ? 130.001 93.074  9.844   1.00 15.02  ? 5    PHE L CZ  1 
ATOM   2646  N  N   . GLU B  2  6   ? 128.393 98.355  10.723  1.00 23.84  ? 6    GLU L N   1 
ATOM   2647  C  CA  . GLU B  2  6   ? 126.958 98.200  10.734  1.00 27.12  ? 6    GLU L CA  1 
ATOM   2648  C  C   . GLU B  2  6   ? 126.231 99.487  10.382  1.00 29.18  ? 6    GLU L C   1 
ATOM   2649  O  O   . GLU B  2  6   ? 125.186 99.448  9.722   1.00 32.32  ? 6    GLU L O   1 
ATOM   2650  C  CB  . GLU B  2  6   ? 126.498 97.690  12.096  1.00 23.37  ? 6    GLU L CB  1 
ATOM   2651  C  CG  . GLU B  2  6   ? 125.001 97.666  12.267  1.00 22.42  ? 6    GLU L CG  1 
ATOM   2652  C  CD  . GLU B  2  6   ? 124.578 96.907  13.498  1.00 29.48  ? 6    GLU L CD  1 
ATOM   2653  O  OE1 . GLU B  2  6   ? 125.456 96.356  14.203  1.00 31.17  ? 6    GLU L OE1 1 
ATOM   2654  O  OE2 . GLU B  2  6   ? 123.361 96.828  13.749  1.00 27.32  ? 6    GLU L OE2 1 
ATOM   2655  N  N   . ARG B  2  7   ? 126.787 100.632 10.776  1.00 32.61  ? 7    ARG L N   1 
ATOM   2656  C  CA  . ARG B  2  7   ? 125.983 101.854 10.808  1.00 31.48  ? 7    ARG L CA  1 
ATOM   2657  C  C   . ARG B  2  7   ? 125.446 102.257 9.450   1.00 30.76  ? 7    ARG L C   1 
ATOM   2658  O  O   . ARG B  2  7   ? 124.312 102.720 9.334   1.00 30.72  ? 7    ARG L O   1 
ATOM   2659  C  CB  . ARG B  2  7   ? 126.750 103.026 11.414  1.00 36.29  ? 7    ARG L CB  1 
ATOM   2660  C  CG  . ARG B  2  7   ? 125.842 104.233 11.711  1.00 47.04  ? 7    ARG L CG  1 
ATOM   2661  C  CD  . ARG B  2  7   ? 126.520 105.329 12.531  1.00 56.32  ? 7    ARG L CD  1 
ATOM   2662  N  NE  . ARG B  2  7   ? 125.823 106.612 12.401  1.00 65.91  ? 7    ARG L NE  1 
ATOM   2663  C  CZ  . ARG B  2  7   ? 126.207 107.607 11.597  1.00 69.69  ? 7    ARG L CZ  1 
ATOM   2664  N  NH1 . ARG B  2  7   ? 127.397 107.581 10.999  1.00 69.36  ? 7    ARG L NH1 1 
ATOM   2665  N  NH2 . ARG B  2  7   ? 125.428 108.673 11.447  1.00 73.03  ? 7    ARG L NH2 1 
ATOM   2666  N  N   . LYS B  2  8   ? 126.220 102.008 8.405   1.00 31.29  ? 8    LYS L N   1 
ATOM   2667  C  CA  . LYS B  2  8   ? 125.809 102.458 7.090   1.00 29.50  ? 8    LYS L CA  1 
ATOM   2668  C  C   . LYS B  2  8   ? 124.609 101.672 6.566   1.00 30.90  ? 8    LYS L C   1 
ATOM   2669  O  O   . LYS B  2  8   ? 123.909 102.143 5.667   1.00 31.97  ? 8    LYS L O   1 
ATOM   2670  C  CB  . LYS B  2  8   ? 126.972 102.367 6.121   1.00 25.38  ? 8    LYS L CB  1 
ATOM   2671  C  CG  . LYS B  2  8   ? 127.598 101.018 6.037   1.00 17.93  ? 8    LYS L CG  1 
ATOM   2672  C  CD  . LYS B  2  8   ? 128.770 101.139 5.124   1.00 19.60  ? 8    LYS L CD  1 
ATOM   2673  C  CE  . LYS B  2  8   ? 129.376 99.809  4.851   1.00 23.12  ? 8    LYS L CE  1 
ATOM   2674  N  NZ  . LYS B  2  8   ? 129.865 99.279  6.125   1.00 33.49  ? 8    LYS L NZ  1 
ATOM   2675  N  N   . TYR B  2  9   ? 124.319 100.526 7.181   1.00 27.75  ? 9    TYR L N   1 
ATOM   2676  C  CA  . TYR B  2  9   ? 123.208 99.695  6.745   1.00 24.01  ? 9    TYR L CA  1 
ATOM   2677  C  C   . TYR B  2  9   ? 121.931 100.002 7.485   1.00 25.82  ? 9    TYR L C   1 
ATOM   2678  O  O   . TYR B  2  9   ? 120.845 99.650  7.019   1.00 28.98  ? 9    TYR L O   1 
ATOM   2679  C  CB  . TYR B  2  9   ? 123.532 98.238  6.939   1.00 18.37  ? 9    TYR L CB  1 
ATOM   2680  C  CG  . TYR B  2  9   ? 124.694 97.798  6.125   1.00 19.20  ? 9    TYR L CG  1 
ATOM   2681  C  CD1 . TYR B  2  9   ? 124.516 97.355  4.834   1.00 19.02  ? 9    TYR L CD1 1 
ATOM   2682  C  CD2 . TYR B  2  9   ? 125.967 97.745  6.670   1.00 19.93  ? 9    TYR L CD2 1 
ATOM   2683  C  CE1 . TYR B  2  9   ? 125.580 96.861  4.101   1.00 22.33  ? 9    TYR L CE1 1 
ATOM   2684  C  CE2 . TYR B  2  9   ? 127.030 97.243  5.949   1.00 23.83  ? 9    TYR L CE2 1 
ATOM   2685  C  CZ  . TYR B  2  9   ? 126.830 96.809  4.662   1.00 19.23  ? 9    TYR L CZ  1 
ATOM   2686  O  OH  . TYR B  2  9   ? 127.889 96.366  3.910   1.00 21.22  ? 9    TYR L OH  1 
ATOM   2687  N  N   . ARG B  2  10  ? 122.048 100.703 8.605   1.00 24.58  ? 10   ARG L N   1 
ATOM   2688  C  CA  . ARG B  2  10  ? 120.893 100.985 9.454   1.00 26.61  ? 10   ARG L CA  1 
ATOM   2689  C  C   . ARG B  2  10  ? 119.933 102.075 8.936   1.00 28.79  ? 10   ARG L C   1 
ATOM   2690  O  O   . ARG B  2  10  ? 119.544 102.988 9.676   1.00 30.51  ? 10   ARG L O   1 
ATOM   2691  C  CB  . ARG B  2  10  ? 121.372 101.326 10.863  1.00 29.49  ? 10   ARG L CB  1 
ATOM   2692  C  CG  . ARG B  2  10  ? 121.880 100.122 11.663  1.00 29.27  ? 10   ARG L CG  1 
ATOM   2693  C  CD  . ARG B  2  10  ? 121.083 99.956  12.937  1.00 29.50  ? 10   ARG L CD  1 
ATOM   2694  N  NE  . ARG B  2  10  ? 121.698 99.006  13.851  1.00 27.24  ? 10   ARG L NE  1 
ATOM   2695  C  CZ  . ARG B  2  10  ? 121.352 98.871  15.123  1.00 28.06  ? 10   ARG L CZ  1 
ATOM   2696  N  NH1 . ARG B  2  10  ? 120.552 99.757  15.690  1.00 29.77  ? 10   ARG L NH1 1 
ATOM   2697  N  NH2 . ARG B  2  10  ? 121.871 97.895  15.851  1.00 29.70  ? 10   ARG L NH2 1 
ATOM   2698  N  N   . VAL B  2  11  ? 119.427 101.879 7.724   1.00 27.68  ? 11   VAL L N   1 
ATOM   2699  C  CA  . VAL B  2  11  ? 118.573 102.858 7.076   1.00 26.09  ? 11   VAL L CA  1 
ATOM   2700  C  C   . VAL B  2  11  ? 117.125 102.424 7.247   1.00 30.50  ? 11   VAL L C   1 
ATOM   2701  O  O   . VAL B  2  11  ? 116.849 101.235 7.416   1.00 33.31  ? 11   VAL L O   1 
ATOM   2702  C  CB  . VAL B  2  11  ? 118.893 102.977 5.559   1.00 24.50  ? 11   VAL L CB  1 
ATOM   2703  C  CG1 . VAL B  2  11  ? 120.307 103.468 5.359   1.00 19.28  ? 11   VAL L CG1 1 
ATOM   2704  C  CG2 . VAL B  2  11  ? 118.681 101.647 4.859   1.00 24.31  ? 11   VAL L CG2 1 
ATOM   2705  N  N   . ARG B  2  12  ? 116.213 103.394 7.266   1.00 33.22  ? 12   ARG L N   1 
ATOM   2706  C  CA  . ARG B  2  12  ? 114.778 103.124 7.324   1.00 34.99  ? 12   ARG L CA  1 
ATOM   2707  C  C   . ARG B  2  12  ? 114.331 102.511 6.000   1.00 36.20  ? 12   ARG L C   1 
ATOM   2708  O  O   . ARG B  2  12  ? 114.943 102.756 4.960   1.00 37.22  ? 12   ARG L O   1 
ATOM   2709  C  CB  . ARG B  2  12  ? 113.982 104.417 7.583   1.00 37.03  ? 12   ARG L CB  1 
ATOM   2710  C  CG  . ARG B  2  12  ? 113.938 105.387 6.386   1.00 40.77  ? 12   ARG L CG  1 
ATOM   2711  C  CD  . ARG B  2  12  ? 113.026 106.607 6.613   1.00 43.48  ? 12   ARG L CD  1 
ATOM   2712  N  NE  . ARG B  2  12  ? 111.605 106.302 6.426   1.00 42.87  ? 12   ARG L NE  1 
ATOM   2713  C  CZ  . ARG B  2  12  ? 111.023 106.058 5.254   1.00 39.56  ? 12   ARG L CZ  1 
ATOM   2714  N  NH1 . ARG B  2  12  ? 111.632 106.360 4.117   1.00 34.94  ? 12   ARG L NH1 1 
ATOM   2715  N  NH2 . ARG B  2  12  ? 109.806 105.536 5.231   1.00 39.70  ? 12   ARG L NH2 1 
ATOM   2716  N  N   . GLY B  2  13  ? 113.302 101.668 6.060   1.00 36.43  ? 13   GLY L N   1 
ATOM   2717  C  CA  . GLY B  2  13  ? 112.713 101.111 4.856   1.00 34.71  ? 13   GLY L CA  1 
ATOM   2718  C  C   . GLY B  2  13  ? 112.597 99.608  4.944   1.00 32.96  ? 13   GLY L C   1 
ATOM   2719  O  O   . GLY B  2  13  ? 113.139 98.989  5.863   1.00 35.45  ? 13   GLY L O   1 
ATOM   2720  N  N   . GLY B  2  14  ? 111.839 99.021  4.028   1.00 32.01  ? 14   GLY L N   1 
ATOM   2721  C  CA  . GLY B  2  14  ? 111.843 97.574  3.895   1.00 28.83  ? 14   GLY L CA  1 
ATOM   2722  C  C   . GLY B  2  14  ? 110.693 96.850  4.570   1.00 29.41  ? 14   GLY L C   1 
ATOM   2723  O  O   . GLY B  2  14  ? 110.525 95.647  4.360   1.00 31.00  ? 14   GLY L O   1 
ATOM   2724  N  N   . THR B  2  15  ? 109.888 97.565  5.355   1.00 26.62  ? 15   THR L N   1 
ATOM   2725  C  CA  . THR B  2  15  ? 108.813 96.939  6.111   1.00 30.25  ? 15   THR L CA  1 
ATOM   2726  C  C   . THR B  2  15  ? 107.768 96.296  5.187   1.00 32.78  ? 15   THR L C   1 
ATOM   2727  O  O   . THR B  2  15  ? 107.536 96.757  4.068   1.00 35.34  ? 15   THR L O   1 
ATOM   2728  C  CB  . THR B  2  15  ? 108.118 97.968  7.027   1.00 33.95  ? 15   THR L CB  1 
ATOM   2729  O  OG1 . THR B  2  15  ? 107.997 99.205  6.322   1.00 40.16  ? 15   THR L OG1 1 
ATOM   2730  C  CG2 . THR B  2  15  ? 108.923 98.210  8.313   1.00 26.10  ? 15   THR L CG2 1 
ATOM   2731  N  N   . LEU B  2  16  ? 107.257 95.149  5.602   1.00 30.85  ? 16   LEU L N   1 
ATOM   2732  C  CA  . LEU B  2  16  ? 106.124 94.545  4.948   1.00 30.00  ? 16   LEU L CA  1 
ATOM   2733  C  C   . LEU B  2  16  ? 104.877 95.267  5.335   1.00 32.65  ? 16   LEU L C   1 
ATOM   2734  O  O   . LEU B  2  16  ? 103.893 95.195  4.645   1.00 36.95  ? 16   LEU L O   1 
ATOM   2735  C  CB  . LEU B  2  16  ? 105.978 93.114  5.389   1.00 27.85  ? 16   LEU L CB  1 
ATOM   2736  C  CG  . LEU B  2  16  ? 106.191 92.158  4.251   1.00 29.17  ? 16   LEU L CG  1 
ATOM   2737  C  CD1 . LEU B  2  16  ? 107.264 92.673  3.310   1.00 29.32  ? 16   LEU L CD1 1 
ATOM   2738  C  CD2 . LEU B  2  16  ? 106.603 90.853  4.868   1.00 34.66  ? 16   LEU L CD2 1 
ATOM   2739  N  N   . ILE B  2  17  ? 104.881 95.857  6.514   1.00 34.91  ? 17   ILE L N   1 
ATOM   2740  C  CA  . ILE B  2  17  ? 103.657 96.370  7.104   1.00 35.15  ? 17   ILE L CA  1 
ATOM   2741  C  C   . ILE B  2  17  ? 104.113 97.203  8.295   1.00 37.20  ? 17   ILE L C   1 
ATOM   2742  O  O   . ILE B  2  17  ? 105.217 96.994  8.807   1.00 42.66  ? 17   ILE L O   1 
ATOM   2743  C  CB  . ILE B  2  17  ? 102.761 95.202  7.582   1.00 35.74  ? 17   ILE L CB  1 
ATOM   2744  C  CG1 . ILE B  2  17  ? 101.388 95.703  8.015   1.00 35.52  ? 17   ILE L CG1 1 
ATOM   2745  C  CG2 . ILE B  2  17  ? 103.393 94.528  8.747   1.00 37.86  ? 17   ILE L CG2 1 
ATOM   2746  C  CD1 . ILE B  2  17  ? 100.415 94.600  8.384   0.00 35.54  ? 17   ILE L CD1 1 
ATOM   2747  N  N   . GLY B  2  18  ? 103.347 98.229  8.642   1.00 36.35  ? 18   GLY L N   1 
ATOM   2748  C  CA  . GLY B  2  18  ? 103.739 99.115  9.722   1.00 38.00  ? 18   GLY L CA  1 
ATOM   2749  C  C   . GLY B  2  18  ? 104.514 100.333 9.247   1.00 39.43  ? 18   GLY L C   1 
ATOM   2750  O  O   . GLY B  2  18  ? 104.318 101.434 9.753   1.00 39.55  ? 18   GLY L O   1 
ATOM   2751  N  N   . GLY B  2  19  ? 105.417 100.142 8.294   1.00 38.88  ? 19   GLY L N   1 
ATOM   2752  C  CA  . GLY B  2  19  ? 106.226 101.247 7.833   1.00 40.41  ? 19   GLY L CA  1 
ATOM   2753  C  C   . GLY B  2  19  ? 107.134 101.767 8.927   1.00 44.35  ? 19   GLY L C   1 
ATOM   2754  O  O   . GLY B  2  19  ? 107.776 100.996 9.652   1.00 46.57  ? 19   GLY L O   1 
ATOM   2755  N  N   . ASP B  2  20  ? 107.136 103.084 9.087   1.00 45.29  ? 20   ASP L N   1 
ATOM   2756  C  CA  . ASP B  2  20  ? 108.046 103.756 10.002  1.00 46.72  ? 20   ASP L CA  1 
ATOM   2757  C  C   . ASP B  2  20  ? 107.802 103.416 11.467  1.00 45.60  ? 20   ASP L C   1 
ATOM   2758  O  O   . ASP B  2  20  ? 108.712 103.486 12.292  1.00 47.82  ? 20   ASP L O   1 
ATOM   2759  C  CB  . ASP B  2  20  ? 107.936 105.266 9.809   1.00 52.50  ? 20   ASP L CB  1 
ATOM   2760  C  CG  . ASP B  2  20  ? 108.885 105.787 8.756   1.00 57.74  ? 20   ASP L CG  1 
ATOM   2761  O  OD1 . ASP B  2  20  ? 110.042 105.299 8.695   1.00 61.55  ? 20   ASP L OD1 1 
ATOM   2762  O  OD2 . ASP B  2  20  ? 108.484 106.717 8.023   1.00 61.58  ? 20   ASP L OD2 1 
ATOM   2763  N  N   . LEU B  2  21  ? 106.591 102.973 11.767  1.00 43.70  ? 21   LEU L N   1 
ATOM   2764  C  CA  . LEU B  2  21  ? 106.124 102.836 13.140  1.00 41.38  ? 21   LEU L CA  1 
ATOM   2765  C  C   . LEU B  2  21  ? 107.008 101.965 14.032  1.00 38.79  ? 21   LEU L C   1 
ATOM   2766  O  O   . LEU B  2  21  ? 107.367 102.389 15.123  1.00 38.38  ? 21   LEU L O   1 
ATOM   2767  C  CB  . LEU B  2  21  ? 104.693 102.295 13.127  1.00 46.76  ? 21   LEU L CB  1 
ATOM   2768  C  CG  . LEU B  2  21  ? 103.909 102.219 14.434  1.00 47.40  ? 21   LEU L CG  1 
ATOM   2769  C  CD1 . LEU B  2  21  ? 103.924 103.576 15.062  1.00 48.57  ? 21   LEU L CD1 1 
ATOM   2770  C  CD2 . LEU B  2  21  ? 102.464 101.741 14.190  1.00 47.12  ? 21   LEU L CD2 1 
ATOM   2771  N  N   . PHE B  2  22  ? 107.305 100.740 13.595  1.00 35.54  ? 22   PHE L N   1 
ATOM   2772  C  CA  . PHE B  2  22  ? 108.177 99.844  14.354  1.00 32.76  ? 22   PHE L CA  1 
ATOM   2773  C  C   . PHE B  2  22  ? 109.501 99.643  13.674  1.00 32.86  ? 22   PHE L C   1 
ATOM   2774  O  O   . PHE B  2  22  ? 110.242 98.732  14.033  1.00 33.74  ? 22   PHE L O   1 
ATOM   2775  C  CB  . PHE B  2  22  ? 107.541 98.477  14.537  1.00 30.36  ? 22   PHE L CB  1 
ATOM   2776  C  CG  . PHE B  2  22  ? 106.204 98.528  15.144  1.00 29.05  ? 22   PHE L CG  1 
ATOM   2777  C  CD1 . PHE B  2  22  ? 106.062 98.802  16.499  1.00 30.71  ? 22   PHE L CD1 1 
ATOM   2778  C  CD2 . PHE B  2  22  ? 105.079 98.367  14.359  1.00 28.34  ? 22   PHE L CD2 1 
ATOM   2779  C  CE1 . PHE B  2  22  ? 104.813 98.919  17.068  1.00 33.21  ? 22   PHE L CE1 1 
ATOM   2780  C  CE2 . PHE B  2  22  ? 103.819 98.480  14.903  1.00 27.48  ? 22   PHE L CE2 1 
ATOM   2781  C  CZ  . PHE B  2  22  ? 103.678 98.758  16.267  1.00 31.26  ? 22   PHE L CZ  1 
ATOM   2782  N  N   . ASP B  2  23  ? 109.761 100.426 12.635  1.00 33.39  ? 23   ASP L N   1 
ATOM   2783  C  CA  . ASP B  2  23  ? 111.036 100.366 11.938  1.00 33.35  ? 23   ASP L CA  1 
ATOM   2784  C  C   . ASP B  2  23  ? 112.192 100.879 12.809  1.00 33.79  ? 23   ASP L C   1 
ATOM   2785  O  O   . ASP B  2  23  ? 112.687 101.984 12.609  1.00 35.69  ? 23   ASP L O   1 
ATOM   2786  C  CB  . ASP B  2  23  ? 110.960 101.186 10.651  1.00 30.64  ? 23   ASP L CB  1 
ATOM   2787  C  CG  . ASP B  2  23  ? 112.146 100.944 9.739   1.00 29.89  ? 23   ASP L CG  1 
ATOM   2788  O  OD1 . ASP B  2  23  ? 113.131 100.312 10.168  1.00 26.61  ? 23   ASP L OD1 1 
ATOM   2789  O  OD2 . ASP B  2  23  ? 112.089 101.376 8.578   1.00 29.51  ? 23   ASP L OD2 1 
ATOM   2790  N  N   . PHE B  2  24  ? 112.672 100.044 13.721  1.00 33.44  ? 24   PHE L N   1 
ATOM   2791  C  CA  . PHE B  2  24  ? 113.788 100.418 14.574  1.00 31.69  ? 24   PHE L CA  1 
ATOM   2792  C  C   . PHE B  2  24  ? 114.392 99.226  15.323  1.00 32.14  ? 24   PHE L C   1 
ATOM   2793  O  O   . PHE B  2  24  ? 113.855 98.123  15.283  1.00 32.90  ? 24   PHE L O   1 
ATOM   2794  C  CB  . PHE B  2  24  ? 113.345 101.492 15.570  1.00 34.20  ? 24   PHE L CB  1 
ATOM   2795  C  CG  . PHE B  2  24  ? 112.273 101.041 16.518  1.00 30.89  ? 24   PHE L CG  1 
ATOM   2796  C  CD1 . PHE B  2  24  ? 112.604 100.396 17.699  1.00 29.08  ? 24   PHE L CD1 1 
ATOM   2797  C  CD2 . PHE B  2  24  ? 110.928 101.260 16.221  1.00 30.52  ? 24   PHE L CD2 1 
ATOM   2798  C  CE1 . PHE B  2  24  ? 111.612 99.971  18.568  1.00 30.48  ? 24   PHE L CE1 1 
ATOM   2799  C  CE2 . PHE B  2  24  ? 109.923 100.842 17.080  1.00 30.92  ? 24   PHE L CE2 1 
ATOM   2800  C  CZ  . PHE B  2  24  ? 110.261 100.194 18.259  1.00 31.37  ? 24   PHE L CZ  1 
ATOM   2801  N  N   . TRP B  2  25  ? 115.486 99.469  16.039  1.00 31.08  ? 25   TRP L N   1 
ATOM   2802  C  CA  . TRP B  2  25  ? 116.240 98.413  16.694  1.00 28.33  ? 25   TRP L CA  1 
ATOM   2803  C  C   . TRP B  2  25  ? 116.168 98.604  18.183  1.00 27.19  ? 25   TRP L C   1 
ATOM   2804  O  O   . TRP B  2  25  ? 116.083 99.730  18.667  1.00 31.59  ? 25   TRP L O   1 
ATOM   2805  C  CB  . TRP B  2  25  ? 117.712 98.433  16.264  1.00 25.49  ? 25   TRP L CB  1 
ATOM   2806  C  CG  . TRP B  2  25  ? 117.952 97.944  14.889  1.00 20.54  ? 25   TRP L CG  1 
ATOM   2807  C  CD1 . TRP B  2  25  ? 118.390 96.717  14.543  1.00 25.24  ? 25   TRP L CD1 1 
ATOM   2808  C  CD2 . TRP B  2  25  ? 117.871 98.700  13.666  1.00 24.61  ? 25   TRP L CD2 1 
ATOM   2809  N  NE1 . TRP B  2  25  ? 118.618 96.647  13.184  1.00 19.57  ? 25   TRP L NE1 1 
ATOM   2810  C  CE2 . TRP B  2  25  ? 118.308 97.851  12.620  1.00 21.76  ? 25   TRP L CE2 1 
ATOM   2811  C  CE3 . TRP B  2  25  ? 117.464 100.008 13.352  1.00 27.32  ? 25   TRP L CE3 1 
ATOM   2812  C  CZ2 . TRP B  2  25  ? 118.351 98.260  11.281  1.00 19.75  ? 25   TRP L CZ2 1 
ATOM   2813  C  CZ3 . TRP B  2  25  ? 117.497 100.420 12.011  1.00 25.80  ? 25   TRP L CZ3 1 
ATOM   2814  C  CH2 . TRP B  2  25  ? 117.938 99.542  10.995  1.00 28.78  ? 25   TRP L CH2 1 
ATOM   2815  N  N   . VAL B  2  26  ? 116.018 97.488  18.878  1.00 26.94  ? 26   VAL L N   1 
ATOM   2816  C  CA  . VAL B  2  26  ? 116.273 97.393  20.305  1.00 25.21  ? 26   VAL L CA  1 
ATOM   2817  C  C   . VAL B  2  26  ? 117.553 96.592  20.418  1.00 27.12  ? 26   VAL L C   1 
ATOM   2818  O  O   . VAL B  2  26  ? 117.585 95.421  20.075  1.00 32.68  ? 26   VAL L O   1 
ATOM   2819  C  CB  . VAL B  2  26  ? 115.142 96.628  21.041  1.00 24.21  ? 26   VAL L CB  1 
ATOM   2820  C  CG1 . VAL B  2  26  ? 115.499 96.415  22.483  1.00 19.09  ? 26   VAL L CG1 1 
ATOM   2821  C  CG2 . VAL B  2  26  ? 113.861 97.406  20.975  1.00 21.91  ? 26   VAL L CG2 1 
ATOM   2822  N  N   . GLY B  2  27  ? 118.644 97.254  20.768  1.00 31.04  ? 27   GLY L N   1 
ATOM   2823  C  CA  . GLY B  2  27  ? 119.918 96.572  20.776  1.00 29.85  ? 27   GLY L CA  1 
ATOM   2824  C  C   . GLY B  2  27  ? 120.264 96.141  19.365  1.00 31.65  ? 27   GLY L C   1 
ATOM   2825  O  O   . GLY B  2  27  ? 120.265 96.975  18.447  1.00 36.60  ? 27   GLY L O   1 
ATOM   2826  N  N   . PRO B  2  28  ? 120.558 94.847  19.156  1.00 28.78  ? 28   PRO L N   1 
ATOM   2827  C  CA  . PRO B  2  28  ? 120.846 94.307  17.827  1.00 27.69  ? 28   PRO L CA  1 
ATOM   2828  C  C   . PRO B  2  28  ? 119.588 93.856  17.108  1.00 24.39  ? 28   PRO L C   1 
ATOM   2829  O  O   . PRO B  2  28  ? 119.601 93.609  15.916  1.00 28.24  ? 28   PRO L O   1 
ATOM   2830  C  CB  . PRO B  2  28  ? 121.781 93.131  18.116  1.00 30.11  ? 28   PRO L CB  1 
ATOM   2831  C  CG  . PRO B  2  28  ? 121.406 92.666  19.504  1.00 26.10  ? 28   PRO L CG  1 
ATOM   2832  C  CD  . PRO B  2  28  ? 120.703 93.826  20.212  1.00 28.98  ? 28   PRO L CD  1 
ATOM   2833  N  N   . TYR B  2  29  ? 118.492 93.762  17.841  1.00 23.00  ? 29   TYR L N   1 
ATOM   2834  C  CA  . TYR B  2  29  ? 117.291 93.193  17.285  1.00 20.60  ? 29   TYR L CA  1 
ATOM   2835  C  C   . TYR B  2  29  ? 116.615 94.254  16.452  1.00 22.61  ? 29   TYR L C   1 
ATOM   2836  O  O   . TYR B  2  29  ? 116.311 95.345  16.929  1.00 22.36  ? 29   TYR L O   1 
ATOM   2837  C  CB  . TYR B  2  29  ? 116.354 92.719  18.402  1.00 20.72  ? 29   TYR L CB  1 
ATOM   2838  C  CG  . TYR B  2  29  ? 116.935 91.652  19.306  1.00 18.26  ? 29   TYR L CG  1 
ATOM   2839  C  CD1 . TYR B  2  29  ? 117.274 90.406  18.811  1.00 22.41  ? 29   TYR L CD1 1 
ATOM   2840  C  CD2 . TYR B  2  29  ? 117.222 91.923  20.637  1.00 26.19  ? 29   TYR L CD2 1 
ATOM   2841  C  CE1 . TYR B  2  29  ? 117.894 89.454  19.615  1.00 28.08  ? 29   TYR L CE1 1 
ATOM   2842  C  CE2 . TYR B  2  29  ? 117.862 90.984  21.455  1.00 28.13  ? 29   TYR L CE2 1 
ATOM   2843  C  CZ  . TYR B  2  29  ? 118.195 89.750  20.936  1.00 29.65  ? 29   TYR L CZ  1 
ATOM   2844  O  OH  . TYR B  2  29  ? 118.843 88.819  21.724  1.00 27.95  ? 29   TYR L OH  1 
ATOM   2845  N  N   . PHE B  2  30  ? 116.396 93.960  15.188  1.00 23.53  ? 30   PHE L N   1 
ATOM   2846  C  CA  . PHE B  2  30  ? 115.398 94.724  14.480  1.00 25.46  ? 30   PHE L CA  1 
ATOM   2847  C  C   . PHE B  2  30  ? 114.053 94.361  15.108  1.00 27.43  ? 30   PHE L C   1 
ATOM   2848  O  O   . PHE B  2  30  ? 113.847 93.227  15.533  1.00 29.48  ? 30   PHE L O   1 
ATOM   2849  C  CB  . PHE B  2  30  ? 115.404 94.378  12.993  1.00 28.12  ? 30   PHE L CB  1 
ATOM   2850  C  CG  . PHE B  2  30  ? 114.367 95.119  12.207  1.00 28.67  ? 30   PHE L CG  1 
ATOM   2851  C  CD1 . PHE B  2  30  ? 114.389 96.503  12.147  1.00 30.30  ? 30   PHE L CD1 1 
ATOM   2852  C  CD2 . PHE B  2  30  ? 113.316 94.443  11.615  1.00 29.11  ? 30   PHE L CD2 1 
ATOM   2853  C  CE1 . PHE B  2  30  ? 113.373 97.202  11.520  1.00 30.41  ? 30   PHE L CE1 1 
ATOM   2854  C  CE2 . PHE B  2  30  ? 112.304 95.124  10.989  1.00 29.75  ? 30   PHE L CE2 1 
ATOM   2855  C  CZ  . PHE B  2  30  ? 112.329 96.512  10.941  1.00 30.80  ? 30   PHE L CZ  1 
ATOM   2856  N  N   . VAL B  2  31  ? 113.179 95.340  15.268  1.00 26.71  ? 31   VAL L N   1 
ATOM   2857  C  CA  . VAL B  2  31  ? 111.831 95.060  15.716  1.00 25.94  ? 31   VAL L CA  1 
ATOM   2858  C  C   . VAL B  2  31  ? 110.880 94.895  14.527  1.00 29.61  ? 31   VAL L C   1 
ATOM   2859  O  O   . VAL B  2  31  ? 110.722 93.793  13.994  1.00 30.94  ? 31   VAL L O   1 
ATOM   2860  C  CB  . VAL B  2  31  ? 111.348 96.163  16.645  1.00 26.89  ? 31   VAL L CB  1 
ATOM   2861  C  CG1 . VAL B  2  31  ? 110.069 95.743  17.357  1.00 25.91  ? 31   VAL L CG1 1 
ATOM   2862  C  CG2 . VAL B  2  31  ? 112.440 96.470  17.650  1.00 27.69  ? 31   VAL L CG2 1 
ATOM   2863  N  N   . GLY B  2  32  ? 110.304 95.992  14.052  1.00 31.90  ? 32   GLY L N   1 
ATOM   2864  C  CA  . GLY B  2  32  ? 109.308 95.891  13.001  1.00 28.91  ? 32   GLY L CA  1 
ATOM   2865  C  C   . GLY B  2  32  ? 107.994 95.377  13.545  1.00 30.73  ? 32   GLY L C   1 
ATOM   2866  O  O   . GLY B  2  32  ? 107.888 94.985  14.710  1.00 30.79  ? 32   GLY L O   1 
ATOM   2867  N  N   . PHE B  2  33  ? 106.955 95.484  12.738  1.00 29.18  ? 33   PHE L N   1 
ATOM   2868  C  CA  . PHE B  2  33  ? 105.650 95.037  13.152  1.00 27.58  ? 33   PHE L CA  1 
ATOM   2869  C  C   . PHE B  2  33  ? 105.674 93.597  13.632  1.00 27.23  ? 33   PHE L C   1 
ATOM   2870  O  O   . PHE B  2  33  ? 104.981 93.236  14.584  1.00 32.78  ? 33   PHE L O   1 
ATOM   2871  C  CB  . PHE B  2  33  ? 104.675 95.173  11.999  1.00 28.78  ? 33   PHE L CB  1 
ATOM   2872  C  CG  . PHE B  2  33  ? 103.303 94.669  12.319  1.00 34.18  ? 33   PHE L CG  1 
ATOM   2873  C  CD1 . PHE B  2  33  ? 102.458 95.406  13.135  1.00 35.24  ? 33   PHE L CD1 1 
ATOM   2874  C  CD2 . PHE B  2  33  ? 102.895 93.404  11.896  1.00 37.37  ? 33   PHE L CD2 1 
ATOM   2875  C  CE1 . PHE B  2  33  ? 101.230 94.882  13.532  1.00 39.97  ? 33   PHE L CE1 1 
ATOM   2876  C  CE2 . PHE B  2  33  ? 101.674 92.874  12.282  1.00 34.90  ? 33   PHE L CE2 1 
ATOM   2877  C  CZ  . PHE B  2  33  ? 100.839 93.606  13.102  1.00 37.83  ? 33   PHE L CZ  1 
ATOM   2878  N  N   . PHE B  2  34  ? 106.431 92.757  12.944  1.00 27.82  ? 34   PHE L N   1 
ATOM   2879  C  CA  . PHE B  2  34  ? 106.418 91.325  13.230  1.00 27.61  ? 34   PHE L CA  1 
ATOM   2880  C  C   . PHE B  2  34  ? 107.289 90.956  14.413  1.00 29.47  ? 34   PHE L C   1 
ATOM   2881  O  O   . PHE B  2  34  ? 107.031 89.960  15.080  1.00 34.22  ? 34   PHE L O   1 
ATOM   2882  C  CB  . PHE B  2  34  ? 106.843 90.533  12.002  1.00 26.23  ? 34   PHE L CB  1 
ATOM   2883  C  CG  . PHE B  2  34  ? 105.892 90.664  10.858  1.00 28.76  ? 34   PHE L CG  1 
ATOM   2884  C  CD1 . PHE B  2  34  ? 104.634 90.084  10.922  1.00 30.28  ? 34   PHE L CD1 1 
ATOM   2885  C  CD2 . PHE B  2  34  ? 106.197 91.474  9.780   1.00 27.55  ? 34   PHE L CD2 1 
ATOM   2886  C  CE1 . PHE B  2  34  ? 103.686 90.316  9.943   1.00 31.54  ? 34   PHE L CE1 1 
ATOM   2887  C  CE2 . PHE B  2  34  ? 105.259 91.712  8.796   1.00 31.63  ? 34   PHE L CE2 1 
ATOM   2888  C  CZ  . PHE B  2  34  ? 103.993 91.132  8.881   1.00 32.19  ? 34   PHE L CZ  1 
ATOM   2889  N  N   . GLY B  2  35  ? 108.291 91.783  14.701  1.00 31.27  ? 35   GLY L N   1 
ATOM   2890  C  CA  . GLY B  2  35  ? 108.987 91.674  15.967  1.00 27.94  ? 35   GLY L CA  1 
ATOM   2891  C  C   . GLY B  2  35  ? 107.998 91.823  17.104  1.00 29.55  ? 35   GLY L C   1 
ATOM   2892  O  O   . GLY B  2  35  ? 107.978 91.022  18.047  1.00 32.48  ? 35   GLY L O   1 
ATOM   2893  N  N   . VAL B  2  36  ? 107.071 92.757  16.924  1.00 28.32  ? 36   VAL L N   1 
ATOM   2894  C  CA  . VAL B  2  36  ? 106.072 93.065  17.931  1.00 25.70  ? 36   VAL L CA  1 
ATOM   2895  C  C   . VAL B  2  36  ? 105.052 91.955  18.077  1.00 27.18  ? 36   VAL L C   1 
ATOM   2896  O  O   . VAL B  2  36  ? 104.781 91.530  19.192  1.00 25.15  ? 36   VAL L O   1 
ATOM   2897  C  CB  . VAL B  2  36  ? 105.365 94.381  17.614  1.00 24.24  ? 36   VAL L CB  1 
ATOM   2898  C  CG1 . VAL B  2  36  ? 104.156 94.562  18.491  1.00 22.77  ? 36   VAL L CG1 1 
ATOM   2899  C  CG2 . VAL B  2  36  ? 106.320 95.504  17.819  1.00 21.56  ? 36   VAL L CG2 1 
ATOM   2900  N  N   . SER B  2  37  ? 104.552 91.410  16.971  1.00 26.22  ? 37   SER L N   1 
ATOM   2901  C  CA  . SER B  2  37  ? 103.681 90.245  17.110  1.00 28.15  ? 37   SER L CA  1 
ATOM   2902  C  C   . SER B  2  37  ? 104.407 88.951  17.560  1.00 27.63  ? 37   SER L C   1 
ATOM   2903  O  O   . SER B  2  37  ? 103.885 88.217  18.403  1.00 32.25  ? 37   SER L O   1 
ATOM   2904  C  CB  . SER B  2  37  ? 102.865 90.004  15.834  1.00 26.65  ? 37   SER L CB  1 
ATOM   2905  O  OG  . SER B  2  37  ? 103.685 89.934  14.687  1.00 25.09  ? 37   SER L OG  1 
ATOM   2906  N  N   . ALA B  2  38  ? 105.628 88.712  17.080  1.00 23.31  ? 38   ALA L N   1 
ATOM   2907  C  CA  . ALA B  2  38  ? 106.416 87.580  17.557  1.00 19.93  ? 38   ALA L CA  1 
ATOM   2908  C  C   . ALA B  2  38  ? 106.493 87.612  19.076  1.00 23.74  ? 38   ALA L C   1 
ATOM   2909  O  O   . ALA B  2  38  ? 106.130 86.644  19.749  1.00 26.27  ? 38   ALA L O   1 
ATOM   2910  C  CB  . ALA B  2  38  ? 107.824 87.610  16.962  1.00 17.79  ? 38   ALA L CB  1 
ATOM   2911  N  N   . ILE B  2  39  ? 106.852 88.765  19.625  1.00 21.50  ? 39   ILE L N   1 
ATOM   2912  C  CA  . ILE B  2  39  ? 107.033 88.884  21.053  1.00 21.96  ? 39   ILE L CA  1 
ATOM   2913  C  C   . ILE B  2  39  ? 105.705 88.708  21.810  1.00 24.36  ? 39   ILE L C   1 
ATOM   2914  O  O   . ILE B  2  39  ? 105.637 88.101  22.885  1.00 23.54  ? 39   ILE L O   1 
ATOM   2915  C  CB  . ILE B  2  39  ? 107.654 90.233  21.390  1.00 24.40  ? 39   ILE L CB  1 
ATOM   2916  C  CG1 . ILE B  2  39  ? 109.064 90.310  20.807  1.00 26.97  ? 39   ILE L CG1 1 
ATOM   2917  C  CG2 . ILE B  2  39  ? 107.669 90.444  22.888  1.00 20.29  ? 39   ILE L CG2 1 
ATOM   2918  C  CD1 . ILE B  2  39  ? 110.066 89.413  21.482  1.00 30.88  ? 39   ILE L CD1 1 
ATOM   2919  N  N   . PHE B  2  40  ? 104.633 89.168  21.208  1.00 25.00  ? 40   PHE L N   1 
ATOM   2920  C  CA  . PHE B  2  40  ? 103.342 89.070  21.850  1.00 28.23  ? 40   PHE L CA  1 
ATOM   2921  C  C   . PHE B  2  40  ? 102.968 87.600  22.027  1.00 27.17  ? 40   PHE L C   1 
ATOM   2922  O  O   . PHE B  2  40  ? 102.551 87.174  23.105  1.00 28.29  ? 40   PHE L O   1 
ATOM   2923  C  CB  . PHE B  2  40  ? 102.314 89.821  20.992  1.00 34.79  ? 40   PHE L CB  1 
ATOM   2924  C  CG  . PHE B  2  40  ? 100.904 89.602  21.405  1.00 37.53  ? 40   PHE L CG  1 
ATOM   2925  C  CD1 . PHE B  2  40  ? 100.497 89.884  22.703  1.00 43.50  ? 40   PHE L CD1 1 
ATOM   2926  C  CD2 . PHE B  2  40  ? 100.003 89.009  20.528  1.00 39.58  ? 40   PHE L CD2 1 
ATOM   2927  C  CE1 . PHE B  2  40  ? 99.212  89.565  23.124  1.00 43.55  ? 40   PHE L CE1 1 
ATOM   2928  C  CE2 . PHE B  2  40  ? 98.715  88.686  20.938  1.00 40.33  ? 40   PHE L CE2 1 
ATOM   2929  C  CZ  . PHE B  2  40  ? 98.319  88.963  22.238  1.00 40.85  ? 40   PHE L CZ  1 
ATOM   2930  N  N   . PHE B  2  41  ? 103.146 86.820  20.965  1.00 28.92  ? 41   PHE L N   1 
ATOM   2931  C  CA  . PHE B  2  41  ? 102.770 85.405  20.964  1.00 28.47  ? 41   PHE L CA  1 
ATOM   2932  C  C   . PHE B  2  41  ? 103.684 84.587  21.861  1.00 29.97  ? 41   PHE L C   1 
ATOM   2933  O  O   . PHE B  2  41  ? 103.276 83.560  22.389  1.00 32.62  ? 41   PHE L O   1 
ATOM   2934  C  CB  . PHE B  2  41  ? 102.855 84.818  19.556  1.00 24.75  ? 41   PHE L CB  1 
ATOM   2935  C  CG  . PHE B  2  41  ? 101.702 85.156  18.696  1.00 25.52  ? 41   PHE L CG  1 
ATOM   2936  C  CD1 . PHE B  2  41  ? 100.459 84.612  18.946  1.00 24.47  ? 41   PHE L CD1 1 
ATOM   2937  C  CD2 . PHE B  2  41  ? 101.854 86.019  17.629  1.00 26.19  ? 41   PHE L CD2 1 
ATOM   2938  C  CE1 . PHE B  2  41  ? 99.381  84.931  18.145  1.00 24.92  ? 41   PHE L CE1 1 
ATOM   2939  C  CE2 . PHE B  2  41  ? 100.779 86.344  16.821  1.00 24.98  ? 41   PHE L CE2 1 
ATOM   2940  C  CZ  . PHE B  2  41  ? 99.542  85.802  17.082  1.00 24.32  ? 41   PHE L CZ  1 
ATOM   2941  N  N   . ILE B  2  42  ? 104.967 84.928  21.862  1.00 26.61  ? 42   ILE L N   1 
ATOM   2942  C  CA  . ILE B  2  42  ? 105.933 84.184  22.644  1.00 24.97  ? 42   ILE L CA  1 
ATOM   2943  C  C   . ILE B  2  42  ? 105.489 84.292  24.069  1.00 28.58  ? 42   ILE L C   1 
ATOM   2944  O  O   . ILE B  2  42  ? 105.185 83.293  24.710  1.00 33.17  ? 42   ILE L O   1 
ATOM   2945  C  CB  . ILE B  2  42  ? 107.331 84.786  22.521  1.00 21.97  ? 42   ILE L CB  1 
ATOM   2946  C  CG1 . ILE B  2  42  ? 107.896 84.487  21.135  1.00 25.47  ? 42   ILE L CG1 1 
ATOM   2947  C  CG2 . ILE B  2  42  ? 108.220 84.244  23.579  1.00 15.42  ? 42   ILE L CG2 1 
ATOM   2948  C  CD1 . ILE B  2  42  ? 109.060 85.356  20.762  1.00 23.41  ? 42   ILE L CD1 1 
ATOM   2949  N  N   . PHE B  2  43  ? 105.236 85.521  24.481  1.00 32.16  ? 43   PHE L N   1 
ATOM   2950  C  CA  . PHE B  2  43  ? 104.859 85.788  25.856  1.00 36.96  ? 43   PHE L CA  1 
ATOM   2951  C  C   . PHE B  2  43  ? 103.532 85.099  26.202  1.00 33.42  ? 43   PHE L C   1 
ATOM   2952  O  O   . PHE B  2  43  ? 103.450 84.364  27.188  1.00 32.06  ? 43   PHE L O   1 
ATOM   2953  C  CB  . PHE B  2  43  ? 104.830 87.305  26.074  1.00 43.73  ? 43   PHE L CB  1 
ATOM   2954  C  CG  . PHE B  2  43  ? 103.723 87.779  26.952  1.00 53.86  ? 43   PHE L CG  1 
ATOM   2955  C  CD1 . PHE B  2  43  ? 103.904 87.864  28.332  1.00 58.04  ? 43   PHE L CD1 1 
ATOM   2956  C  CD2 . PHE B  2  43  ? 102.501 88.180  26.395  1.00 59.59  ? 43   PHE L CD2 1 
ATOM   2957  C  CE1 . PHE B  2  43  ? 102.881 88.338  29.154  1.00 61.17  ? 43   PHE L CE1 1 
ATOM   2958  C  CE2 . PHE B  2  43  ? 101.467 88.660  27.200  1.00 61.95  ? 43   PHE L CE2 1 
ATOM   2959  C  CZ  . PHE B  2  43  ? 101.655 88.737  28.585  1.00 64.36  ? 43   PHE L CZ  1 
ATOM   2960  N  N   . LEU B  2  44  ? 102.568 85.179  25.294  1.00 31.84  ? 44   LEU L N   1 
ATOM   2961  C  CA  . LEU B  2  44  ? 101.368 84.356  25.382  1.00 30.48  ? 44   LEU L CA  1 
ATOM   2962  C  C   . LEU B  2  44  ? 101.703 82.881  25.584  1.00 30.29  ? 44   LEU L C   1 
ATOM   2963  O  O   . LEU B  2  44  ? 101.386 82.289  26.604  1.00 32.41  ? 44   LEU L O   1 
ATOM   2964  C  CB  . LEU B  2  44  ? 100.570 84.496  24.097  1.00 37.15  ? 44   LEU L CB  1 
ATOM   2965  C  CG  . LEU B  2  44  ? 99.403  85.451  24.174  1.00 35.52  ? 44   LEU L CG  1 
ATOM   2966  C  CD1 . LEU B  2  44  ? 98.240  84.758  24.848  1.00 39.26  ? 44   LEU L CD1 1 
ATOM   2967  C  CD2 . LEU B  2  44  ? 99.836  86.652  24.951  1.00 37.80  ? 44   LEU L CD2 1 
ATOM   2968  N  N   . GLY B  2  45  ? 102.391 82.294  24.620  1.00 28.79  ? 45   GLY L N   1 
ATOM   2969  C  CA  . GLY B  2  45  ? 102.517 80.856  24.596  1.00 25.82  ? 45   GLY L CA  1 
ATOM   2970  C  C   . GLY B  2  45  ? 103.283 80.386  25.800  1.00 26.19  ? 45   GLY L C   1 
ATOM   2971  O  O   . GLY B  2  45  ? 102.886 79.420  26.442  1.00 30.66  ? 45   GLY L O   1 
ATOM   2972  N  N   . VAL B  2  46  ? 104.284 81.163  26.193  1.00 23.38  ? 46   VAL L N   1 
ATOM   2973  C  CA  . VAL B  2  46  ? 105.130 80.806  27.319  1.00 21.19  ? 46   VAL L CA  1 
ATOM   2974  C  C   . VAL B  2  46  ? 104.402 80.983  28.639  1.00 24.30  ? 46   VAL L C   1 
ATOM   2975  O  O   . VAL B  2  46  ? 104.518 80.136  29.512  1.00 29.00  ? 46   VAL L O   1 
ATOM   2976  C  CB  . VAL B  2  46  ? 106.423 81.619  27.328  1.00 18.80  ? 46   VAL L CB  1 
ATOM   2977  C  CG1 . VAL B  2  46  ? 107.087 81.561  28.687  1.00 20.33  ? 46   VAL L CG1 1 
ATOM   2978  C  CG2 . VAL B  2  46  ? 107.357 81.067  26.313  1.00 16.06  ? 46   VAL L CG2 1 
ATOM   2979  N  N   . SER B  2  47  ? 103.506 81.960  28.712  1.00 29.11  ? 47   SER L N   1 
ATOM   2980  C  CA  . SER B  2  47  ? 102.627 82.086  29.871  1.00 28.89  ? 47   SER L CA  1 
ATOM   2981  C  C   . SER B  2  47  ? 101.698 80.891  30.020  1.00 30.78  ? 47   SER L C   1 
ATOM   2982  O  O   . SER B  2  47  ? 101.527 80.376  31.122  1.00 35.42  ? 47   SER L O   1 
ATOM   2983  C  CB  . SER B  2  47  ? 101.792 83.353  29.767  1.00 28.60  ? 47   SER L CB  1 
ATOM   2984  O  OG  . SER B  2  47  ? 102.631 84.479  29.850  1.00 30.45  ? 47   SER L OG  1 
ATOM   2985  N  N   . LEU B  2  48  ? 101.123 80.423  28.914  1.00 33.22  ? 48   LEU L N   1 
ATOM   2986  C  CA  . LEU B  2  48  ? 100.217 79.276  28.965  1.00 31.61  ? 48   LEU L CA  1 
ATOM   2987  C  C   . LEU B  2  48  ? 100.977 78.047  29.377  1.00 34.84  ? 48   LEU L C   1 
ATOM   2988  O  O   . LEU B  2  48  ? 100.541 77.326  30.272  1.00 38.63  ? 48   LEU L O   1 
ATOM   2989  C  CB  . LEU B  2  48  ? 99.561  79.043  27.621  1.00 27.18  ? 48   LEU L CB  1 
ATOM   2990  C  CG  . LEU B  2  48  ? 98.746  80.286  27.301  1.00 26.57  ? 48   LEU L CG  1 
ATOM   2991  C  CD1 . LEU B  2  48  ? 98.588  80.444  25.824  1.00 29.13  ? 48   LEU L CD1 1 
ATOM   2992  C  CD2 . LEU B  2  48  ? 97.409  80.210  27.992  1.00 27.11  ? 48   LEU L CD2 1 
ATOM   2993  N  N   . ILE B  2  49  ? 102.185 77.900  28.842  1.00 34.84  ? 49   ILE L N   1 
ATOM   2994  C  CA  . ILE B  2  49  ? 103.037 76.786  29.212  1.00 33.31  ? 49   ILE L CA  1 
ATOM   2995  C  C   . ILE B  2  49  ? 103.275 76.771  30.718  1.00 37.24  ? 49   ILE L C   1 
ATOM   2996  O  O   . ILE B  2  49  ? 103.161 75.726  31.356  1.00 37.70  ? 49   ILE L O   1 
ATOM   2997  C  CB  . ILE B  2  49  ? 104.376 76.832  28.462  1.00 29.40  ? 49   ILE L CB  1 
ATOM   2998  C  CG1 . ILE B  2  49  ? 104.136 76.597  26.967  1.00 26.50  ? 49   ILE L CG1 1 
ATOM   2999  C  CG2 . ILE B  2  49  ? 105.310 75.770  29.011  1.00 25.67  ? 49   ILE L CG2 1 
ATOM   3000  C  CD1 . ILE B  2  49  ? 105.351 76.787  26.111  1.00 25.78  ? 49   ILE L CD1 1 
ATOM   3001  N  N   . GLY B  2  50  ? 103.441 77.952  31.300  1.00 40.31  ? 50   GLY L N   1 
ATOM   3002  C  CA  . GLY B  2  50  ? 103.612 78.055  32.741  1.00 41.11  ? 50   GLY L CA  1 
ATOM   3003  C  C   . GLY B  2  50  ? 102.379 77.673  33.551  1.00 43.09  ? 50   GLY L C   1 
ATOM   3004  O  O   . GLY B  2  50  ? 102.457 76.882  34.493  1.00 42.69  ? 50   GLY L O   1 
ATOM   3005  N  N   . TYR B  2  51  ? 101.243 78.271  33.230  1.00 42.31  ? 51   TYR L N   1 
ATOM   3006  C  CA  . TYR B  2  51  ? 100.041 77.973  33.964  1.00 43.37  ? 51   TYR L CA  1 
ATOM   3007  C  C   . TYR B  2  51  ? 99.681  76.500  33.790  1.00 41.89  ? 51   TYR L C   1 
ATOM   3008  O  O   . TYR B  2  51  ? 99.477  75.782  34.773  1.00 41.38  ? 51   TYR L O   1 
ATOM   3009  C  CB  . TYR B  2  51  ? 98.917  78.864  33.480  1.00 53.33  ? 51   TYR L CB  1 
ATOM   3010  C  CG  . TYR B  2  51  ? 97.660  78.766  34.305  1.00 69.72  ? 51   TYR L CG  1 
ATOM   3011  C  CD1 . TYR B  2  51  ? 96.623  77.924  33.907  1.00 77.81  ? 51   TYR L CD1 1 
ATOM   3012  C  CD2 . TYR B  2  51  ? 97.395  79.695  35.314  1.00 76.55  ? 51   TYR L CD2 1 
ATOM   3013  C  CE1 . TYR B  2  51  ? 95.330  78.035  34.453  1.00 86.73  ? 51   TYR L CE1 1 
ATOM   3014  C  CE2 . TYR B  2  51  ? 96.103  79.823  35.870  1.00 85.91  ? 51   TYR L CE2 1 
ATOM   3015  C  CZ  . TYR B  2  51  ? 95.069  79.000  35.417  1.00 88.28  ? 51   TYR L CZ  1 
ATOM   3016  O  OH  . TYR B  2  51  ? 93.760  79.234  35.803  1.00 92.09  ? 51   TYR L OH  1 
ATOM   3017  N  N   . ALA B  2  52  ? 99.635  76.036  32.550  1.00 35.92  ? 52   ALA L N   1 
ATOM   3018  C  CA  . ALA B  2  52  ? 99.433  74.623  32.302  1.00 35.85  ? 52   ALA L CA  1 
ATOM   3019  C  C   . ALA B  2  52  ? 100.382 73.787  33.161  1.00 35.41  ? 52   ALA L C   1 
ATOM   3020  O  O   . ALA B  2  52  ? 99.946  72.976  33.971  1.00 36.89  ? 52   ALA L O   1 
ATOM   3021  C  CB  . ALA B  2  52  ? 99.647  74.315  30.846  1.00 35.79  ? 52   ALA L CB  1 
ATOM   3022  N  N   . ALA B  2  53  ? 101.676 74.047  33.053  1.00 34.52  ? 53   ALA L N   1 
ATOM   3023  C  CA  . ALA B  2  53  ? 102.666 73.231  33.747  1.00 35.59  ? 53   ALA L CA  1 
ATOM   3024  C  C   . ALA B  2  53  ? 102.444 73.239  35.246  1.00 37.19  ? 53   ALA L C   1 
ATOM   3025  O  O   . ALA B  2  53  ? 102.812 72.289  35.925  1.00 40.39  ? 53   ALA L O   1 
ATOM   3026  C  CB  . ALA B  2  53  ? 104.068 73.723  33.447  1.00 30.53  ? 53   ALA L CB  1 
ATOM   3027  N  N   . SER B  2  54  ? 101.925 74.349  35.764  1.00 39.60  ? 54   SER L N   1 
ATOM   3028  C  CA  . SER B  2  54  ? 101.810 74.556  37.206  1.00 38.63  ? 54   SER L CA  1 
ATOM   3029  C  C   . SER B  2  54  ? 100.617 73.791  37.725  1.00 39.38  ? 54   SER L C   1 
ATOM   3030  O  O   . SER B  2  54  ? 100.543 73.471  38.898  1.00 40.65  ? 54   SER L O   1 
ATOM   3031  C  CB  . SER B  2  54  ? 101.650 76.050  37.532  1.00 38.58  ? 54   SER L CB  1 
ATOM   3032  O  OG  . SER B  2  54  ? 100.338 76.527  37.249  1.00 37.04  ? 54   SER L OG  1 
ATOM   3033  N  N   . GLN B  2  55  ? 99.656  73.555  36.845  1.00 41.75  ? 55   GLN L N   1 
ATOM   3034  C  CA  . GLN B  2  55  ? 98.489  72.768  37.181  1.00 44.70  ? 55   GLN L CA  1 
ATOM   3035  C  C   . GLN B  2  55  ? 98.809  71.280  37.241  1.00 44.47  ? 55   GLN L C   1 
ATOM   3036  O  O   . GLN B  2  55  ? 97.950  70.470  37.582  1.00 45.64  ? 55   GLN L O   1 
ATOM   3037  C  CB  . GLN B  2  55  ? 97.391  73.012  36.150  1.00 48.93  ? 55   GLN L CB  1 
ATOM   3038  C  CG  . GLN B  2  55  ? 96.887  74.426  36.124  1.00 56.74  ? 55   GLN L CG  1 
ATOM   3039  C  CD  . GLN B  2  55  ? 96.340  74.851  37.466  1.00 65.36  ? 55   GLN L CD  1 
ATOM   3040  O  OE1 . GLN B  2  55  ? 95.180  74.584  37.787  1.00 70.58  ? 55   GLN L OE1 1 
ATOM   3041  N  NE2 . GLN B  2  55  ? 97.180  75.494  38.276  1.00 69.21  ? 55   GLN L NE2 1 
ATOM   3042  N  N   . GLY B  2  56  ? 100.011 70.913  36.817  1.00 45.61  ? 56   GLY L N   1 
ATOM   3043  C  CA  . GLY B  2  56  ? 100.376 69.510  36.777  1.00 48.89  ? 56   GLY L CA  1 
ATOM   3044  C  C   . GLY B  2  56  ? 101.367 69.111  37.859  1.00 53.53  ? 56   GLY L C   1 
ATOM   3045  O  O   . GLY B  2  56  ? 101.828 69.947  38.650  1.00 58.74  ? 56   GLY L O   1 
ATOM   3046  N  N   . PRO B  2  57  ? 101.806 67.845  37.848  1.00 53.58  ? 57   PRO L N   1 
ATOM   3047  C  CA  . PRO B  2  57  ? 102.328 67.123  39.010  1.00 54.57  ? 57   PRO L CA  1 
ATOM   3048  C  C   . PRO B  2  57  ? 103.839 67.191  39.115  1.00 52.01  ? 57   PRO L C   1 
ATOM   3049  O  O   . PRO B  2  57  ? 104.464 66.390  39.810  0.00 52.74  ? 57   PRO L O   1 
ATOM   3050  C  CB  . PRO B  2  57  ? 101.876 65.697  38.751  1.00 55.98  ? 57   PRO L CB  1 
ATOM   3051  C  CG  . PRO B  2  57  ? 101.990 65.583  37.276  1.00 56.50  ? 57   PRO L CG  1 
ATOM   3052  C  CD  . PRO B  2  57  ? 101.632 66.944  36.699  1.00 54.45  ? 57   PRO L CD  1 
ATOM   3053  N  N   . THR B  2  58  ? 104.425 68.139  38.400  1.00 51.07  ? 58   THR L N   1 
ATOM   3054  C  CA  . THR B  2  58  ? 105.846 68.106  38.180  1.00 50.33  ? 58   THR L CA  1 
ATOM   3055  C  C   . THR B  2  58  ? 106.378 69.463  37.782  1.00 51.05  ? 58   THR L C   1 
ATOM   3056  O  O   . THR B  2  58  ? 105.618 70.336  37.359  1.00 51.20  ? 58   THR L O   1 
ATOM   3057  C  CB  . THR B  2  58  ? 106.199 67.073  37.104  1.00 47.20  ? 58   THR L CB  1 
ATOM   3058  O  OG1 . THR B  2  58  ? 107.608 66.847  37.115  1.00 52.26  ? 58   THR L OG1 1 
ATOM   3059  C  CG2 . THR B  2  58  ? 105.777 67.546  35.737  1.00 49.15  ? 58   THR L CG2 1 
ATOM   3060  N  N   . TRP B  2  59  ? 107.634 69.697  38.144  1.00 51.71  ? 59   TRP L N   1 
ATOM   3061  C  CA  . TRP B  2  59  ? 108.399 70.792  37.577  1.00 51.99  ? 59   TRP L CA  1 
ATOM   3062  C  C   . TRP B  2  59  ? 109.778 70.320  37.103  1.00 52.24  ? 59   TRP L C   1 
ATOM   3063  O  O   . TRP B  2  59  ? 110.622 71.132  36.726  1.00 53.77  ? 59   TRP L O   1 
ATOM   3064  C  CB  . TRP B  2  59  ? 108.524 71.931  38.590  1.00 53.26  ? 59   TRP L CB  1 
ATOM   3065  C  CG  . TRP B  2  59  ? 107.311 72.821  38.641  1.00 57.87  ? 59   TRP L CG  1 
ATOM   3066  C  CD1 . TRP B  2  59  ? 106.406 72.919  39.663  1.00 60.64  ? 59   TRP L CD1 1 
ATOM   3067  C  CD2 . TRP B  2  59  ? 106.886 73.767  37.640  1.00 60.83  ? 59   TRP L CD2 1 
ATOM   3068  N  NE1 . TRP B  2  59  ? 105.452 73.874  39.367  1.00 61.92  ? 59   TRP L NE1 1 
ATOM   3069  C  CE2 . TRP B  2  59  ? 105.727 74.413  38.138  1.00 61.02  ? 59   TRP L CE2 1 
ATOM   3070  C  CE3 . TRP B  2  59  ? 107.370 74.129  36.373  1.00 61.73  ? 59   TRP L CE3 1 
ATOM   3071  C  CZ2 . TRP B  2  59  ? 105.048 75.403  37.414  1.00 60.63  ? 59   TRP L CZ2 1 
ATOM   3072  C  CZ3 . TRP B  2  59  ? 106.685 75.113  35.648  1.00 62.00  ? 59   TRP L CZ3 1 
ATOM   3073  C  CH2 . TRP B  2  59  ? 105.537 75.736  36.176  1.00 60.73  ? 59   TRP L CH2 1 
ATOM   3074  N  N   . ASP B  2  60  ? 109.990 69.006  37.059  1.00 50.07  ? 60   ASP L N   1 
ATOM   3075  C  CA  . ASP B  2  60  ? 111.138 68.472  36.349  1.00 46.34  ? 60   ASP L CA  1 
ATOM   3076  C  C   . ASP B  2  60  ? 110.930 68.772  34.872  1.00 47.96  ? 60   ASP L C   1 
ATOM   3077  O  O   . ASP B  2  60  ? 109.916 68.392  34.277  1.00 47.86  ? 60   ASP L O   1 
ATOM   3078  C  CB  . ASP B  2  60  ? 111.266 66.967  36.542  1.00 48.39  ? 60   ASP L CB  1 
ATOM   3079  C  CG  . ASP B  2  60  ? 112.547 66.402  35.923  1.00 52.80  ? 60   ASP L CG  1 
ATOM   3080  O  OD1 . ASP B  2  60  ? 112.577 66.104  34.706  1.00 56.77  ? 60   ASP L OD1 1 
ATOM   3081  O  OD2 . ASP B  2  60  ? 113.530 66.232  36.668  1.00 59.24  ? 60   ASP L OD2 1 
ATOM   3082  N  N   . PRO B  2  61  ? 111.919 69.410  34.247  1.00 46.71  ? 61   PRO L N   1 
ATOM   3083  C  CA  . PRO B  2  61  ? 111.797 69.935  32.886  1.00 44.87  ? 61   PRO L CA  1 
ATOM   3084  C  C   . PRO B  2  61  ? 111.657 68.825  31.860  1.00 42.99  ? 61   PRO L C   1 
ATOM   3085  O  O   . PRO B  2  61  ? 110.975 68.995  30.855  1.00 45.63  ? 61   PRO L O   1 
ATOM   3086  C  CB  . PRO B  2  61  ? 113.096 70.712  32.695  1.00 45.59  ? 61   PRO L CB  1 
ATOM   3087  C  CG  . PRO B  2  61  ? 113.598 70.954  34.081  1.00 43.14  ? 61   PRO L CG  1 
ATOM   3088  C  CD  . PRO B  2  61  ? 113.229 69.735  34.826  1.00 44.63  ? 61   PRO L CD  1 
ATOM   3089  N  N   . PHE B  2  62  ? 112.325 67.703  32.108  1.00 39.91  ? 62   PHE L N   1 
ATOM   3090  C  CA  . PHE B  2  62  ? 112.253 66.548  31.228  1.00 38.83  ? 62   PHE L CA  1 
ATOM   3091  C  C   . PHE B  2  62  ? 110.907 65.864  31.296  1.00 37.49  ? 62   PHE L C   1 
ATOM   3092  O  O   . PHE B  2  62  ? 110.537 65.138  30.380  1.00 37.99  ? 62   PHE L O   1 
ATOM   3093  C  CB  . PHE B  2  62  ? 113.313 65.542  31.612  1.00 40.10  ? 62   PHE L CB  1 
ATOM   3094  C  CG  . PHE B  2  62  ? 114.682 66.016  31.364  1.00 43.04  ? 62   PHE L CG  1 
ATOM   3095  C  CD1 . PHE B  2  62  ? 115.169 66.104  30.070  1.00 45.83  ? 62   PHE L CD1 1 
ATOM   3096  C  CD2 . PHE B  2  62  ? 115.473 66.443  32.410  1.00 47.03  ? 62   PHE L CD2 1 
ATOM   3097  C  CE1 . PHE B  2  62  ? 116.431 66.618  29.822  1.00 45.53  ? 62   PHE L CE1 1 
ATOM   3098  C  CE2 . PHE B  2  62  ? 116.737 66.964  32.175  1.00 49.49  ? 62   PHE L CE2 1 
ATOM   3099  C  CZ  . PHE B  2  62  ? 117.216 67.053  30.876  1.00 48.19  ? 62   PHE L CZ  1 
ATOM   3100  N  N   . ALA B  2  63  ? 110.187 66.088  32.391  1.00 32.96  ? 63   ALA L N   1 
ATOM   3101  C  CA  . ALA B  2  63  ? 108.990 65.317  32.684  1.00 31.42  ? 63   ALA L CA  1 
ATOM   3102  C  C   . ALA B  2  63  ? 107.709 66.126  32.539  1.00 30.18  ? 63   ALA L C   1 
ATOM   3103  O  O   . ALA B  2  63  ? 106.615 65.561  32.501  1.00 32.74  ? 63   ALA L O   1 
ATOM   3104  C  CB  . ALA B  2  63  ? 109.082 64.719  34.083  1.00 28.11  ? 63   ALA L CB  1 
ATOM   3105  N  N   . ILE B  2  64  ? 107.833 67.445  32.495  1.00 30.28  ? 64   ILE L N   1 
ATOM   3106  C  CA  . ILE B  2  64  ? 106.672 68.290  32.237  1.00 30.64  ? 64   ILE L CA  1 
ATOM   3107  C  C   . ILE B  2  64  ? 106.082 67.894  30.886  1.00 31.72  ? 64   ILE L C   1 
ATOM   3108  O  O   . ILE B  2  64  ? 106.827 67.539  29.961  1.00 33.32  ? 64   ILE L O   1 
ATOM   3109  C  CB  . ILE B  2  64  ? 107.068 69.771  32.189  1.00 30.38  ? 64   ILE L CB  1 
ATOM   3110  C  CG1 . ILE B  2  64  ? 107.641 70.198  33.542  1.00 30.48  ? 64   ILE L CG1 1 
ATOM   3111  C  CG2 . ILE B  2  64  ? 105.881 70.620  31.746  1.00 23.57  ? 64   ILE L CG2 1 
ATOM   3112  C  CD1 . ILE B  2  64  ? 106.759 71.150  34.295  1.00 39.80  ? 64   ILE L CD1 1 
ATOM   3113  N  N   . SER B  2  65  ? 104.756 67.898  30.784  1.00 29.22  ? 65   SER L N   1 
ATOM   3114  C  CA  . SER B  2  65  ? 104.099 67.563  29.529  1.00 25.97  ? 65   SER L CA  1 
ATOM   3115  C  C   . SER B  2  65  ? 102.694 68.154  29.437  1.00 25.45  ? 65   SER L C   1 
ATOM   3116  O  O   . SER B  2  65  ? 101.905 68.074  30.375  1.00 30.28  ? 65   SER L O   1 
ATOM   3117  C  CB  . SER B  2  65  ? 104.055 66.045  29.353  1.00 23.30  ? 65   SER L CB  1 
ATOM   3118  O  OG  . SER B  2  65  ? 103.616 65.694  28.059  1.00 22.02  ? 65   SER L OG  1 
ATOM   3119  N  N   . ILE B  2  66  ? 102.462 68.886  28.362  1.00 24.77  ? 66   ILE L N   1 
ATOM   3120  C  CA  . ILE B  2  66  ? 101.176 69.486  28.059  1.00 24.48  ? 66   ILE L CA  1 
ATOM   3121  C  C   . ILE B  2  66  ? 100.653 68.791  26.795  1.00 22.06  ? 66   ILE L C   1 
ATOM   3122  O  O   . ILE B  2  66  ? 101.295 68.856  25.752  1.00 24.17  ? 66   ILE L O   1 
ATOM   3123  C  CB  . ILE B  2  66  ? 101.371 70.999  27.816  1.00 27.17  ? 66   ILE L CB  1 
ATOM   3124  C  CG1 . ILE B  2  66  ? 102.013 71.621  29.052  1.00 28.00  ? 66   ILE L CG1 1 
ATOM   3125  C  CG2 . ILE B  2  66  ? 100.047 71.688  27.515  1.00 27.95  ? 66   ILE L CG2 1 
ATOM   3126  C  CD1 . ILE B  2  66  ? 102.855 72.821  28.750  1.00 30.12  ? 66   ILE L CD1 1 
ATOM   3127  N  N   . ASN B  2  67  ? 99.571  68.028  26.922  1.00 19.83  ? 67   ASN L N   1 
ATOM   3128  C  CA  . ASN B  2  67  ? 99.126  67.112  25.868  1.00 19.27  ? 67   ASN L CA  1 
ATOM   3129  C  C   . ASN B  2  67  ? 97.812  67.551  25.203  1.00 20.34  ? 67   ASN L C   1 
ATOM   3130  O  O   . ASN B  2  67  ? 97.011  68.273  25.800  1.00 24.92  ? 67   ASN L O   1 
ATOM   3131  C  CB  . ASN B  2  67  ? 98.946  65.698  26.434  1.00 21.13  ? 67   ASN L CB  1 
ATOM   3132  C  CG  . ASN B  2  67  ? 100.236 65.089  26.935  1.00 23.19  ? 67   ASN L CG  1 
ATOM   3133  O  OD1 . ASN B  2  67  ? 101.085 65.792  27.472  1.00 27.32  ? 67   ASN L OD1 1 
ATOM   3134  N  ND2 . ASN B  2  67  ? 100.375 63.771  26.793  1.00 23.47  ? 67   ASN L ND2 1 
ATOM   3135  N  N   . PRO B  2  68  ? 97.584  67.143  23.943  1.00 19.20  ? 68   PRO L N   1 
ATOM   3136  C  CA  . PRO B  2  68  ? 96.320  67.404  23.244  1.00 21.08  ? 68   PRO L CA  1 
ATOM   3137  C  C   . PRO B  2  68  ? 95.172  66.646  23.876  1.00 21.16  ? 68   PRO L C   1 
ATOM   3138  O  O   . PRO B  2  68  ? 95.352  65.977  24.881  1.00 23.98  ? 68   PRO L O   1 
ATOM   3139  C  CB  . PRO B  2  68  ? 96.598  66.910  21.831  1.00 22.67  ? 68   PRO L CB  1 
ATOM   3140  C  CG  . PRO B  2  68  ? 97.617  65.831  22.027  1.00 20.44  ? 68   PRO L CG  1 
ATOM   3141  C  CD  . PRO B  2  68  ? 98.517  66.390  23.087  1.00 20.72  ? 68   PRO L CD  1 
ATOM   3142  N  N   . PRO B  2  69  ? 93.956  66.824  23.359  1.00 22.73  ? 69   PRO L N   1 
ATOM   3143  C  CA  . PRO B  2  69  ? 92.813  66.213  24.044  1.00 24.31  ? 69   PRO L CA  1 
ATOM   3144  C  C   . PRO B  2  69  ? 92.610  64.774  23.639  1.00 25.31  ? 69   PRO L C   1 
ATOM   3145  O  O   . PRO B  2  69  ? 93.264  64.289  22.716  1.00 26.81  ? 69   PRO L O   1 
ATOM   3146  C  CB  . PRO B  2  69  ? 91.624  67.073  23.608  1.00 24.11  ? 69   PRO L CB  1 
ATOM   3147  C  CG  . PRO B  2  69  ? 92.050  67.673  22.325  1.00 25.50  ? 69   PRO L CG  1 
ATOM   3148  C  CD  . PRO B  2  69  ? 93.532  67.932  22.488  1.00 23.86  ? 69   PRO L CD  1 
ATOM   3149  N  N   . ASP B  2  70  ? 91.716  64.090  24.346  1.00 24.72  ? 70   ASP L N   1 
ATOM   3150  C  CA  . ASP B  2  70  ? 91.323  62.745  23.974  1.00 22.88  ? 70   ASP L CA  1 
ATOM   3151  C  C   . ASP B  2  70  ? 90.766  62.766  22.574  1.00 23.38  ? 70   ASP L C   1 
ATOM   3152  O  O   . ASP B  2  70  ? 90.267  63.791  22.118  1.00 25.76  ? 70   ASP L O   1 
ATOM   3153  C  CB  . ASP B  2  70  ? 90.280  62.214  24.951  1.00 22.64  ? 70   ASP L CB  1 
ATOM   3154  C  CG  . ASP B  2  70  ? 90.890  61.783  26.267  1.00 26.66  ? 70   ASP L CG  1 
ATOM   3155  O  OD1 . ASP B  2  70  ? 92.046  61.310  26.250  1.00 28.51  ? 70   ASP L OD1 1 
ATOM   3156  O  OD2 . ASP B  2  70  ? 90.240  61.938  27.325  1.00 29.70  ? 70   ASP L OD2 1 
ATOM   3157  N  N   . LEU B  2  71  ? 90.895  61.650  21.868  1.00 25.66  ? 71   LEU L N   1 
ATOM   3158  C  CA  . LEU B  2  71  ? 90.381  61.567  20.504  1.00 28.07  ? 71   LEU L CA  1 
ATOM   3159  C  C   . LEU B  2  71  ? 88.917  62.007  20.412  1.00 28.44  ? 71   LEU L C   1 
ATOM   3160  O  O   . LEU B  2  71  ? 88.499  62.611  19.422  1.00 31.24  ? 71   LEU L O   1 
ATOM   3161  C  CB  . LEU B  2  71  ? 90.520  60.144  19.973  1.00 24.41  ? 71   LEU L CB  1 
ATOM   3162  C  CG  . LEU B  2  71  ? 91.945  59.680  19.716  1.00 27.32  ? 71   LEU L CG  1 
ATOM   3163  C  CD1 . LEU B  2  71  ? 91.909  58.570  18.694  1.00 33.49  ? 71   LEU L CD1 1 
ATOM   3164  C  CD2 . LEU B  2  71  ? 92.786  60.823  19.198  1.00 25.66  ? 71   LEU L CD2 1 
ATOM   3165  N  N   . LYS B  2  72  ? 88.168  61.751  21.482  1.00 30.19  ? 72   LYS L N   1 
ATOM   3166  C  CA  . LYS B  2  72  ? 86.727  61.978  21.539  1.00 30.35  ? 72   LYS L CA  1 
ATOM   3167  C  C   . LYS B  2  72  ? 86.295  63.428  21.340  1.00 32.61  ? 72   LYS L C   1 
ATOM   3168  O  O   . LYS B  2  72  ? 85.199  63.674  20.849  1.00 37.24  ? 72   LYS L O   1 
ATOM   3169  C  CB  . LYS B  2  72  ? 86.165  61.467  22.868  1.00 29.64  ? 72   LYS L CB  1 
ATOM   3170  C  CG  . LYS B  2  72  ? 86.409  62.393  24.063  1.00 36.78  ? 72   LYS L CG  1 
ATOM   3171  C  CD  . LYS B  2  72  ? 85.945  61.759  25.373  1.00 37.71  ? 72   LYS L CD  1 
ATOM   3172  C  CE  . LYS B  2  72  ? 86.185  62.656  26.569  0.00 36.93  ? 72   LYS L CE  1 
ATOM   3173  N  NZ  . LYS B  2  72  ? 85.813  61.958  27.830  0.00 36.84  ? 72   LYS L NZ  1 
ATOM   3174  N  N   . TYR B  2  73  ? 87.124  64.388  21.741  1.00 30.58  ? 73   TYR L N   1 
ATOM   3175  C  CA  . TYR B  2  73  ? 86.790  65.792  21.521  1.00 29.80  ? 73   TYR L CA  1 
ATOM   3176  C  C   . TYR B  2  73  ? 86.910  66.153  20.051  1.00 29.65  ? 73   TYR L C   1 
ATOM   3177  O  O   . TYR B  2  73  ? 86.575  67.263  19.653  1.00 34.55  ? 73   TYR L O   1 
ATOM   3178  C  CB  . TYR B  2  73  ? 87.680  66.722  22.354  1.00 29.93  ? 73   TYR L CB  1 
ATOM   3179  C  CG  . TYR B  2  73  ? 87.417  66.631  23.835  1.00 33.52  ? 73   TYR L CG  1 
ATOM   3180  C  CD1 . TYR B  2  73  ? 86.399  67.362  24.426  1.00 35.07  ? 73   TYR L CD1 1 
ATOM   3181  C  CD2 . TYR B  2  73  ? 88.148  65.763  24.637  1.00 39.11  ? 73   TYR L CD2 1 
ATOM   3182  C  CE1 . TYR B  2  73  ? 86.105  67.223  25.781  1.00 37.19  ? 73   TYR L CE1 1 
ATOM   3183  C  CE2 . TYR B  2  73  ? 87.866  65.621  25.989  1.00 40.56  ? 73   TYR L CE2 1 
ATOM   3184  C  CZ  . TYR B  2  73  ? 86.841  66.353  26.553  1.00 37.80  ? 73   TYR L CZ  1 
ATOM   3185  O  OH  . TYR B  2  73  ? 86.562  66.210  27.892  1.00 42.81  ? 73   TYR L OH  1 
ATOM   3186  N  N   . GLY B  2  74  ? 87.341  65.205  19.236  1.00 24.91  ? 74   GLY L N   1 
ATOM   3187  C  CA  . GLY B  2  74  ? 87.434  65.459  17.820  1.00 26.69  ? 74   GLY L CA  1 
ATOM   3188  C  C   . GLY B  2  74  ? 88.215  66.720  17.515  1.00 28.74  ? 74   GLY L C   1 
ATOM   3189  O  O   . GLY B  2  74  ? 89.221  67.014  18.181  1.00 33.46  ? 74   GLY L O   1 
ATOM   3190  N  N   . LEU B  2  75  ? 87.728  67.480  16.537  1.00 26.78  ? 75   LEU L N   1 
ATOM   3191  C  CA  . LEU B  2  75  ? 88.347  68.740  16.151  1.00 27.74  ? 75   LEU L CA  1 
ATOM   3192  C  C   . LEU B  2  75  ? 87.739  69.891  16.912  1.00 28.62  ? 75   LEU L C   1 
ATOM   3193  O  O   . LEU B  2  75  ? 87.933  71.045  16.555  1.00 30.52  ? 75   LEU L O   1 
ATOM   3194  C  CB  . LEU B  2  75  ? 88.188  68.982  14.663  1.00 19.58  ? 75   LEU L CB  1 
ATOM   3195  C  CG  . LEU B  2  75  ? 88.930  67.934  13.866  1.00 17.11  ? 75   LEU L CG  1 
ATOM   3196  C  CD1 . LEU B  2  75  ? 88.663  68.136  12.433  1.00 15.09  ? 75   LEU L CD1 1 
ATOM   3197  C  CD2 . LEU B  2  75  ? 90.382  68.065  14.125  1.00 13.32  ? 75   LEU L CD2 1 
ATOM   3198  N  N   . GLY B  2  76  ? 87.093  69.578  18.026  1.00 34.51  ? 76   GLY L N   1 
ATOM   3199  C  CA  . GLY B  2  76  ? 86.438  70.602  18.817  1.00 32.60  ? 76   GLY L CA  1 
ATOM   3200  C  C   . GLY B  2  76  ? 87.341  71.167  19.890  1.00 35.63  ? 76   GLY L C   1 
ATOM   3201  O  O   . GLY B  2  76  ? 88.480  70.703  20.062  1.00 38.68  ? 76   GLY L O   1 
ATOM   3202  N  N   . ALA B  2  77  ? 86.844  72.194  20.581  1.00 36.70  ? 77   ALA L N   1 
ATOM   3203  C  CA  . ALA B  2  77  ? 87.569  72.821  21.675  1.00 36.65  ? 77   ALA L CA  1 
ATOM   3204  C  C   . ALA B  2  77  ? 87.439  71.936  22.877  1.00 39.57  ? 77   ALA L C   1 
ATOM   3205  O  O   . ALA B  2  77  ? 86.327  71.535  23.233  1.00 44.38  ? 77   ALA L O   1 
ATOM   3206  C  CB  . ALA B  2  77  ? 86.997  74.166  21.989  1.00 38.14  ? 77   ALA L CB  1 
ATOM   3207  N  N   . ALA B  2  78  ? 88.568  71.687  23.527  1.00 39.06  ? 78   ALA L N   1 
ATOM   3208  C  CA  . ALA B  2  78  ? 88.624  70.766  24.636  1.00 37.01  ? 78   ALA L CA  1 
ATOM   3209  C  C   . ALA B  2  78  ? 88.882  71.550  25.898  1.00 38.70  ? 78   ALA L C   1 
ATOM   3210  O  O   . ALA B  2  78  ? 89.369  72.674  25.853  1.00 39.27  ? 78   ALA L O   1 
ATOM   3211  C  CB  . ALA B  2  78  ? 89.719  69.762  24.410  1.00 40.29  ? 78   ALA L CB  1 
ATOM   3212  N  N   . PRO B  2  79  ? 88.466  71.005  27.045  1.00 39.44  ? 79   PRO L N   1 
ATOM   3213  C  CA  . PRO B  2  79  ? 88.631  71.693  28.327  1.00 38.98  ? 79   PRO L CA  1 
ATOM   3214  C  C   . PRO B  2  79  ? 90.072  72.106  28.578  1.00 38.12  ? 79   PRO L C   1 
ATOM   3215  O  O   . PRO B  2  79  ? 91.003  71.388  28.235  1.00 37.96  ? 79   PRO L O   1 
ATOM   3216  C  CB  . PRO B  2  79  ? 88.127  70.672  29.361  1.00 39.24  ? 79   PRO L CB  1 
ATOM   3217  C  CG  . PRO B  2  79  ? 87.903  69.383  28.591  1.00 41.70  ? 79   PRO L CG  1 
ATOM   3218  C  CD  . PRO B  2  79  ? 87.668  69.776  27.177  1.00 39.47  ? 79   PRO L CD  1 
ATOM   3219  N  N   . LEU B  2  80  ? 90.247  73.213  29.281  1.00 40.37  ? 80   LEU L N   1 
ATOM   3220  C  CA  . LEU B  2  80  ? 91.548  73.850  29.364  1.00 40.46  ? 80   LEU L CA  1 
ATOM   3221  C  C   . LEU B  2  80  ? 92.626  72.881  29.810  1.00 39.58  ? 80   LEU L C   1 
ATOM   3222  O  O   . LEU B  2  80  ? 93.614  72.657  29.117  1.00 41.73  ? 80   LEU L O   1 
ATOM   3223  C  CB  . LEU B  2  80  ? 91.484  75.034  30.318  1.00 39.15  ? 80   LEU L CB  1 
ATOM   3224  C  CG  . LEU B  2  80  ? 92.322  76.224  29.874  1.00 41.17  ? 80   LEU L CG  1 
ATOM   3225  C  CD1 . LEU B  2  80  ? 91.914  76.620  28.449  1.00 39.94  ? 80   LEU L CD1 1 
ATOM   3226  C  CD2 . LEU B  2  80  ? 92.121  77.375  30.849  1.00 40.29  ? 80   LEU L CD2 1 
ATOM   3227  N  N   . LEU B  2  81  ? 92.344  72.178  30.886  1.00 40.59  ? 81   LEU L N   1 
ATOM   3228  C  CA  . LEU B  2  81  ? 93.344  71.325  31.462  1.00 44.77  ? 81   LEU L CA  1 
ATOM   3229  C  C   . LEU B  2  81  ? 93.452  69.990  30.741  1.00 45.63  ? 81   LEU L C   1 
ATOM   3230  O  O   . LEU B  2  81  ? 94.382  69.217  30.996  1.00 48.69  ? 81   LEU L O   1 
ATOM   3231  C  CB  . LEU B  2  81  ? 93.043  71.107  32.936  1.00 49.20  ? 81   LEU L CB  1 
ATOM   3232  C  CG  . LEU B  2  81  ? 93.963  71.917  33.843  1.00 51.76  ? 81   LEU L CG  1 
ATOM   3233  C  CD1 . LEU B  2  81  ? 93.740  71.481  35.275  1.00 53.76  ? 81   LEU L CD1 1 
ATOM   3234  C  CD2 . LEU B  2  81  ? 95.427  71.694  33.432  1.00 53.47  ? 81   LEU L CD2 1 
ATOM   3235  N  N   . GLU B  2  82  ? 92.522  69.733  29.822  1.00 42.69  ? 82   GLU L N   1 
ATOM   3236  C  CA  . GLU B  2  82  ? 92.416  68.430  29.169  1.00 38.38  ? 82   GLU L CA  1 
ATOM   3237  C  C   . GLU B  2  82  ? 92.643  68.546  27.678  1.00 34.74  ? 82   GLU L C   1 
ATOM   3238  O  O   . GLU B  2  82  ? 91.875  67.983  26.900  1.00 34.67  ? 82   GLU L O   1 
ATOM   3239  C  CB  . GLU B  2  82  ? 91.034  67.834  29.406  1.00 44.27  ? 82   GLU L CB  1 
ATOM   3240  C  CG  . GLU B  2  82  ? 90.538  67.999  30.824  1.00 56.20  ? 82   GLU L CG  1 
ATOM   3241  C  CD  . GLU B  2  82  ? 90.174  66.685  31.451  1.00 63.58  ? 82   GLU L CD  1 
ATOM   3242  O  OE1 . GLU B  2  82  ? 89.054  66.204  31.174  1.00 71.36  ? 82   GLU L OE1 1 
ATOM   3243  O  OE2 . GLU B  2  82  ? 91.014  66.116  32.186  1.00 66.79  ? 82   GLU L OE2 1 
ATOM   3244  N  N   . GLY B  2  83  ? 93.621  69.359  27.284  1.00 30.16  ? 83   GLY L N   1 
ATOM   3245  C  CA  . GLY B  2  83  ? 93.883  69.575  25.878  1.00 27.65  ? 83   GLY L CA  1 
ATOM   3246  C  C   . GLY B  2  83  ? 93.623  71.008  25.464  1.00 27.37  ? 83   GLY L C   1 
ATOM   3247  O  O   . GLY B  2  83  ? 94.164  71.482  24.465  1.00 27.21  ? 83   GLY L O   1 
ATOM   3248  N  N   . GLY B  2  84  ? 92.854  71.728  26.267  1.00 25.73  ? 84   GLY L N   1 
ATOM   3249  C  CA  . GLY B  2  84  ? 92.594  73.123  25.972  1.00 23.43  ? 84   GLY L CA  1 
ATOM   3250  C  C   . GLY B  2  84  ? 93.862  73.947  25.913  1.00 21.84  ? 84   GLY L C   1 
ATOM   3251  O  O   . GLY B  2  84  ? 94.108  74.618  24.920  1.00 27.72  ? 84   GLY L O   1 
ATOM   3252  N  N   . PHE B  2  85  ? 94.714  73.815  26.919  1.00 17.63  ? 85   PHE L N   1 
ATOM   3253  C  CA  . PHE B  2  85  ? 95.972  74.534  26.949  1.00 21.44  ? 85   PHE L CA  1 
ATOM   3254  C  C   . PHE B  2  85  ? 96.757  74.206  25.699  1.00 24.49  ? 85   PHE L C   1 
ATOM   3255  O  O   . PHE B  2  85  ? 97.279  75.103  25.038  1.00 25.39  ? 85   PHE L O   1 
ATOM   3256  C  CB  . PHE B  2  85  ? 96.817  74.122  28.156  1.00 24.08  ? 85   PHE L CB  1 
ATOM   3257  C  CG  . PHE B  2  85  ? 96.464  74.833  29.412  1.00 30.03  ? 85   PHE L CG  1 
ATOM   3258  C  CD1 . PHE B  2  85  ? 96.420  76.223  29.451  1.00 33.48  ? 85   PHE L CD1 1 
ATOM   3259  C  CD2 . PHE B  2  85  ? 96.051  74.115  30.532  1.00 32.41  ? 85   PHE L CD2 1 
ATOM   3260  C  CE1 . PHE B  2  85  ? 95.951  76.877  30.572  1.00 30.47  ? 85   PHE L CE1 1 
ATOM   3261  C  CE2 . PHE B  2  85  ? 95.587  74.763  31.650  1.00 29.96  ? 85   PHE L CE2 1 
ATOM   3262  C  CZ  . PHE B  2  85  ? 95.532  76.143  31.665  1.00 30.68  ? 85   PHE L CZ  1 
ATOM   3263  N  N   . TRP B  2  86  ? 96.923  72.912  25.431  1.00 25.33  ? 86   TRP L N   1 
ATOM   3264  C  CA  . TRP B  2  86  ? 97.727  72.467  24.295  1.00 23.85  ? 86   TRP L CA  1 
ATOM   3265  C  C   . TRP B  2  86  ? 97.214  73.130  23.040  1.00 23.50  ? 86   TRP L C   1 
ATOM   3266  O  O   . TRP B  2  86  ? 97.987  73.504  22.164  1.00 27.06  ? 86   TRP L O   1 
ATOM   3267  C  CB  . TRP B  2  86  ? 97.664  70.940  24.134  1.00 22.28  ? 86   TRP L CB  1 
ATOM   3268  C  CG  . TRP B  2  86  ? 98.318  70.425  22.857  1.00 21.54  ? 86   TRP L CG  1 
ATOM   3269  C  CD1 . TRP B  2  86  ? 99.592  69.955  22.718  1.00 12.58  ? 86   TRP L CD1 1 
ATOM   3270  C  CD2 . TRP B  2  86  ? 97.729  70.380  21.546  1.00 16.72  ? 86   TRP L CD2 1 
ATOM   3271  N  NE1 . TRP B  2  86  ? 99.829  69.624  21.412  1.00 15.11  ? 86   TRP L NE1 1 
ATOM   3272  C  CE2 . TRP B  2  86  ? 98.709  69.890  20.669  1.00 13.87  ? 86   TRP L CE2 1 
ATOM   3273  C  CE3 . TRP B  2  86  ? 96.474  70.734  21.031  1.00 16.40  ? 86   TRP L CE3 1 
ATOM   3274  C  CZ2 . TRP B  2  86  ? 98.486  69.753  19.301  1.00 17.81  ? 86   TRP L CZ2 1 
ATOM   3275  C  CZ3 . TRP B  2  86  ? 96.248  70.599  19.670  1.00 19.27  ? 86   TRP L CZ3 1 
ATOM   3276  C  CH2 . TRP B  2  86  ? 97.255  70.114  18.818  1.00 19.39  ? 86   TRP L CH2 1 
ATOM   3277  N  N   . GLN B  2  87  ? 95.903  73.285  22.954  1.00 24.20  ? 87   GLN L N   1 
ATOM   3278  C  CA  . GLN B  2  87  ? 95.303  73.913  21.789  1.00 26.00  ? 87   GLN L CA  1 
ATOM   3279  C  C   . GLN B  2  87  ? 95.737  75.375  21.673  1.00 26.07  ? 87   GLN L C   1 
ATOM   3280  O  O   . GLN B  2  87  ? 96.189  75.827  20.619  1.00 26.41  ? 87   GLN L O   1 
ATOM   3281  C  CB  . GLN B  2  87  ? 93.778  73.808  21.870  1.00 24.95  ? 87   GLN L CB  1 
ATOM   3282  C  CG  . GLN B  2  87  ? 93.268  72.475  21.424  1.00 23.78  ? 87   GLN L CG  1 
ATOM   3283  C  CD  . GLN B  2  87  ? 91.772  72.327  21.579  1.00 27.97  ? 87   GLN L CD  1 
ATOM   3284  O  OE1 . GLN B  2  87  ? 91.193  72.730  22.589  1.00 31.81  ? 87   GLN L OE1 1 
ATOM   3285  N  NE2 . GLN B  2  87  ? 91.140  71.686  20.600  1.00 33.42  ? 87   GLN L NE2 1 
ATOM   3286  N  N   . ALA B  2  88  ? 95.706  76.082  22.791  1.00 26.25  ? 88   ALA L N   1 
ATOM   3287  C  CA  . ALA B  2  88  ? 96.078  77.478  22.794  1.00 25.59  ? 88   ALA L CA  1 
ATOM   3288  C  C   . ALA B  2  88  ? 97.557  77.661  22.499  1.00 26.43  ? 88   ALA L C   1 
ATOM   3289  O  O   . ALA B  2  88  ? 97.910  78.471  21.645  1.00 29.73  ? 88   ALA L O   1 
ATOM   3290  C  CB  . ALA B  2  88  ? 95.743  78.074  24.104  1.00 24.89  ? 88   ALA L CB  1 
ATOM   3291  N  N   . ILE B  2  89  ? 98.404  76.838  23.125  1.00 24.95  ? 89   ILE L N   1 
ATOM   3292  C  CA  . ILE B  2  89  ? 99.855  76.941  22.970  1.00 20.13  ? 89   ILE L CA  1 
ATOM   3293  C  C   . ILE B  2  89  ? 100.240 76.715  21.503  1.00 21.90  ? 89   ILE L C   1 
ATOM   3294  O  O   . ILE B  2  89  ? 101.101 77.418  20.970  1.00 23.94  ? 89   ILE L O   1 
ATOM   3295  C  CB  . ILE B  2  89  ? 100.599 75.925  23.900  1.00 17.42  ? 89   ILE L CB  1 
ATOM   3296  C  CG1 . ILE B  2  89  ? 100.342 76.279  25.367  1.00 14.21  ? 89   ILE L CG1 1 
ATOM   3297  C  CG2 . ILE B  2  89  ? 102.099 75.960  23.656  1.00 9.77   ? 89   ILE L CG2 1 
ATOM   3298  C  CD1 . ILE B  2  89  ? 100.604 75.132  26.334  1.00 10.28  ? 89   ILE L CD1 1 
ATOM   3299  N  N   . THR B  2  90  ? 99.482  75.865  20.815  1.00 19.20  ? 90   THR L N   1 
ATOM   3300  C  CA  . THR B  2  90  ? 99.725  75.569  19.406  1.00 22.34  ? 90   THR L CA  1 
ATOM   3301  C  C   . THR B  2  90  ? 99.491  76.774  18.507  1.00 26.22  ? 90   THR L C   1 
ATOM   3302  O  O   . THR B  2  90  ? 100.233 77.010  17.549  1.00 30.14  ? 90   THR L O   1 
ATOM   3303  C  CB  . THR B  2  90  ? 98.809  74.472  18.939  1.00 21.44  ? 90   THR L CB  1 
ATOM   3304  O  OG1 . THR B  2  90  ? 99.108  73.287  19.674  1.00 25.18  ? 90   THR L OG1 1 
ATOM   3305  C  CG2 . THR B  2  90  ? 98.981  74.218  17.464  1.00 23.68  ? 90   THR L CG2 1 
ATOM   3306  N  N   . VAL B  2  91  ? 98.399  77.475  18.772  1.00 25.82  ? 91   VAL L N   1 
ATOM   3307  C  CA  . VAL B  2  91  ? 98.076  78.719  18.087  1.00 25.65  ? 91   VAL L CA  1 
ATOM   3308  C  C   . VAL B  2  91  ? 99.150  79.786  18.314  1.00 24.72  ? 91   VAL L C   1 
ATOM   3309  O  O   . VAL B  2  91  ? 99.603  80.446  17.382  1.00 19.98  ? 91   VAL L O   1 
ATOM   3310  C  CB  . VAL B  2  91  ? 96.710  79.235  18.587  1.00 28.70  ? 91   VAL L CB  1 
ATOM   3311  C  CG1 . VAL B  2  91  ? 96.472  80.711  18.164  1.00 28.46  ? 91   VAL L CG1 1 
ATOM   3312  C  CG2 . VAL B  2  91  ? 95.615  78.307  18.062  1.00 24.09  ? 91   VAL L CG2 1 
ATOM   3313  N  N   . CYS B  2  92  ? 99.593  79.919  19.555  1.00 26.63  ? 92   CYS L N   1 
ATOM   3314  C  CA  . CYS B  2  92  ? 100.689 80.824  19.863  1.00 25.96  ? 92   CYS L CA  1 
ATOM   3315  C  C   . CYS B  2  92  ? 101.985 80.402  19.178  1.00 23.71  ? 92   CYS L C   1 
ATOM   3316  O  O   . CYS B  2  92  ? 102.688 81.244  18.624  1.00 24.67  ? 92   CYS L O   1 
ATOM   3317  C  CB  . CYS B  2  92  ? 100.889 80.911  21.369  1.00 25.88  ? 92   CYS L CB  1 
ATOM   3318  S  SG  . CYS B  2  92  ? 99.534  81.767  22.188  1.00 29.06  ? 92   CYS L SG  1 
ATOM   3319  N  N   . ALA B  2  93  ? 102.241 79.100  19.092  1.00 20.80  ? 93   ALA L N   1 
ATOM   3320  C  CA  . ALA B  2  93  ? 103.446 78.651  18.418  1.00 19.97  ? 93   ALA L CA  1 
ATOM   3321  C  C   . ALA B  2  93  ? 103.389 79.057  16.956  1.00 20.75  ? 93   ALA L C   1 
ATOM   3322  O  O   . ALA B  2  93  ? 104.295 79.734  16.462  1.00 25.40  ? 93   ALA L O   1 
ATOM   3323  C  CB  . ALA B  2  93  ? 103.623 77.148  18.553  1.00 18.46  ? 93   ALA L CB  1 
ATOM   3324  N  N   . LEU B  2  94  ? 102.268 78.798  16.299  1.00 17.17  ? 94   LEU L N   1 
ATOM   3325  C  CA  . LEU B  2  94  ? 102.175 79.141  14.893  1.00 20.26  ? 94   LEU L CA  1 
ATOM   3326  C  C   . LEU B  2  94  ? 102.331 80.642  14.672  1.00 19.42  ? 94   LEU L C   1 
ATOM   3327  O  O   . LEU B  2  94  ? 103.085 81.067  13.801  1.00 21.49  ? 94   LEU L O   1 
ATOM   3328  C  CB  . LEU B  2  94  ? 100.854 78.658  14.327  1.00 22.11  ? 94   LEU L CB  1 
ATOM   3329  C  CG  . LEU B  2  94  ? 100.904 77.178  14.011  1.00 28.75  ? 94   LEU L CG  1 
ATOM   3330  C  CD1 . LEU B  2  94  ? 99.493  76.647  13.780  1.00 28.33  ? 94   LEU L CD1 1 
ATOM   3331  C  CD2 . LEU B  2  94  ? 101.794 76.995  12.802  1.00 28.57  ? 94   LEU L CD2 1 
ATOM   3332  N  N   . GLY B  2  95  ? 101.725 81.433  15.550  1.00 22.15  ? 95   GLY L N   1 
ATOM   3333  C  CA  . GLY B  2  95  ? 101.830 82.884  15.463  1.00 23.63  ? 95   GLY L CA  1 
ATOM   3334  C  C   . GLY B  2  95  ? 103.251 83.368  15.652  1.00 25.11  ? 95   GLY L C   1 
ATOM   3335  O  O   . GLY B  2  95  ? 103.739 84.194  14.890  1.00 25.30  ? 95   GLY L O   1 
ATOM   3336  N  N   . ALA B  2  96  ? 103.960 82.748  16.589  1.00 25.36  ? 96   ALA L N   1 
ATOM   3337  C  CA  . ALA B  2  96  ? 105.353 83.073  16.838  1.00 22.26  ? 96   ALA L CA  1 
ATOM   3338  C  C   . ALA B  2  96  ? 106.187 82.768  15.606  1.00 20.10  ? 96   ALA L C   1 
ATOM   3339  O  O   . ALA B  2  96  ? 106.972 83.599  15.149  1.00 22.00  ? 96   ALA L O   1 
ATOM   3340  C  CB  . ALA B  2  96  ? 105.853 82.279  18.005  1.00 20.10  ? 96   ALA L CB  1 
ATOM   3341  N  N   . PHE B  2  97  ? 105.976 81.595  15.030  1.00 17.82  ? 97   PHE L N   1 
ATOM   3342  C  CA  . PHE B  2  97  ? 106.834 81.135  13.948  1.00 19.05  ? 97   PHE L CA  1 
ATOM   3343  C  C   . PHE B  2  97  ? 106.657 81.991  12.691  1.00 23.40  ? 97   PHE L C   1 
ATOM   3344  O  O   . PHE B  2  97  ? 107.624 82.442  12.074  1.00 25.95  ? 97   PHE L O   1 
ATOM   3345  C  CB  . PHE B  2  97  ? 106.529 79.675  13.622  1.00 21.78  ? 97   PHE L CB  1 
ATOM   3346  C  CG  . PHE B  2  97  ? 106.732 78.719  14.779  1.00 23.97  ? 97   PHE L CG  1 
ATOM   3347  C  CD1 . PHE B  2  97  ? 107.630 79.010  15.806  1.00 21.58  ? 97   PHE L CD1 1 
ATOM   3348  C  CD2 . PHE B  2  97  ? 106.039 77.510  14.818  1.00 21.89  ? 97   PHE L CD2 1 
ATOM   3349  C  CE1 . PHE B  2  97  ? 107.826 78.111  16.851  1.00 21.34  ? 97   PHE L CE1 1 
ATOM   3350  C  CE2 . PHE B  2  97  ? 106.230 76.609  15.851  1.00 23.81  ? 97   PHE L CE2 1 
ATOM   3351  C  CZ  . PHE B  2  97  ? 107.122 76.908  16.872  1.00 25.38  ? 97   PHE L CZ  1 
ATOM   3352  N  N   . ILE B  2  98  ? 105.414 82.215  12.297  1.00 24.61  ? 98   ILE L N   1 
ATOM   3353  C  CA  . ILE B  2  98  ? 105.162 83.014  11.113  1.00 26.18  ? 98   ILE L CA  1 
ATOM   3354  C  C   . ILE B  2  98  ? 105.608 84.481  11.280  1.00 26.33  ? 98   ILE L C   1 
ATOM   3355  O  O   . ILE B  2  98  ? 106.261 85.025  10.396  1.00 31.84  ? 98   ILE L O   1 
ATOM   3356  C  CB  . ILE B  2  98  ? 103.683 82.898  10.726  1.00 27.00  ? 98   ILE L CB  1 
ATOM   3357  C  CG1 . ILE B  2  98  ? 103.452 81.511  10.142  1.00 21.80  ? 98   ILE L CG1 1 
ATOM   3358  C  CG2 . ILE B  2  98  ? 103.273 83.995  9.748   1.00 24.22  ? 98   ILE L CG2 1 
ATOM   3359  C  CD1 . ILE B  2  98  ? 102.057 81.036  10.258  1.00 23.85  ? 98   ILE L CD1 1 
ATOM   3360  N  N   . SER B  2  99  ? 105.386 85.066  12.454  1.00 23.59  ? 99   SER L N   1 
ATOM   3361  C  CA  . SER B  2  99  ? 105.966 86.364  12.786  1.00 22.03  ? 99   SER L CA  1 
ATOM   3362  C  C   . SER B  2  99  ? 107.464 86.369  12.585  1.00 20.04  ? 99   SER L C   1 
ATOM   3363  O  O   . SER B  2  99  ? 108.015 87.330  12.054  1.00 23.96  ? 99   SER L O   1 
ATOM   3364  C  CB  . SER B  2  99  ? 105.698 86.723  14.240  1.00 22.72  ? 99   SER L CB  1 
ATOM   3365  O  OG  . SER B  2  99  ? 104.372 87.144  14.421  1.00 30.45  ? 99   SER L OG  1 
ATOM   3366  N  N   . TRP B  2  100 ? 108.125 85.311  13.041  1.00 19.77  ? 100  TRP L N   1 
ATOM   3367  C  CA  . TRP B  2  100 ? 109.573 85.214  12.955  1.00 17.26  ? 100  TRP L CA  1 
ATOM   3368  C  C   . TRP B  2  100 ? 109.983 85.163  11.504  1.00 19.52  ? 100  TRP L C   1 
ATOM   3369  O  O   . TRP B  2  100 ? 110.855 85.923  11.078  1.00 23.59  ? 100  TRP L O   1 
ATOM   3370  C  CB  . TRP B  2  100 ? 110.075 83.971  13.695  1.00 18.24  ? 100  TRP L CB  1 
ATOM   3371  C  CG  . TRP B  2  100 ? 111.540 84.011  14.030  1.00 15.79  ? 100  TRP L CG  1 
ATOM   3372  C  CD1 . TRP B  2  100 ? 112.559 83.404  13.344  1.00 16.26  ? 100  TRP L CD1 1 
ATOM   3373  C  CD2 . TRP B  2  100 ? 112.158 84.773  15.070  1.00 14.11  ? 100  TRP L CD2 1 
ATOM   3374  N  NE1 . TRP B  2  100 ? 113.773 83.753  13.892  1.00 17.96  ? 100  TRP L NE1 1 
ATOM   3375  C  CE2 . TRP B  2  100 ? 113.553 84.585  14.957  1.00 16.83  ? 100  TRP L CE2 1 
ATOM   3376  C  CE3 . TRP B  2  100 ? 111.670 85.622  16.064  1.00 16.12  ? 100  TRP L CE3 1 
ATOM   3377  C  CZ2 . TRP B  2  100 ? 114.461 85.202  15.809  1.00 19.39  ? 100  TRP L CZ2 1 
ATOM   3378  C  CZ3 . TRP B  2  100 ? 112.578 86.248  16.901  1.00 18.15  ? 100  TRP L CZ3 1 
ATOM   3379  C  CH2 . TRP B  2  100 ? 113.957 86.030  16.771  1.00 17.75  ? 100  TRP L CH2 1 
ATOM   3380  N  N   . MET B  2  101 ? 109.173 84.478  10.710  1.00 25.31  ? 101  MET L N   1 
ATOM   3381  C  CA  . MET B  2  101 ? 109.403 84.342  9.273   1.00 24.99  ? 101  MET L CA  1 
ATOM   3382  C  C   . MET B  2  101 ? 109.232 85.676  8.513   1.00 26.37  ? 101  MET L C   1 
ATOM   3383  O  O   . MET B  2  101 ? 110.140 86.146  7.807   1.00 23.58  ? 101  MET L O   1 
ATOM   3384  C  CB  . MET B  2  101 ? 108.450 83.280  8.737   1.00 27.16  ? 101  MET L CB  1 
ATOM   3385  C  CG  . MET B  2  101 ? 108.891 82.682  7.442   1.00 32.64  ? 101  MET L CG  1 
ATOM   3386  S  SD  . MET B  2  101 ? 108.302 83.746  6.155   1.00 46.55  ? 101  MET L SD  1 
ATOM   3387  C  CE  . MET B  2  101 ? 106.571 83.299  6.139   1.00 34.84  ? 101  MET L CE  1 
ATOM   3388  N  N   . LEU B  2  102 ? 108.095 86.328  8.721   1.00 25.36  ? 102  LEU L N   1 
ATOM   3389  C  CA  . LEU B  2  102 ? 107.849 87.614  8.088   1.00 24.40  ? 102  LEU L CA  1 
ATOM   3390  C  C   . LEU B  2  102 ? 108.831 88.688  8.551   1.00 25.69  ? 102  LEU L C   1 
ATOM   3391  O  O   . LEU B  2  102 ? 109.376 89.405  7.713   1.00 30.04  ? 102  LEU L O   1 
ATOM   3392  C  CB  . LEU B  2  102 ? 106.419 88.068  8.338   1.00 17.44  ? 102  LEU L CB  1 
ATOM   3393  C  CG  . LEU B  2  102 ? 105.410 87.098  7.738   1.00 16.30  ? 102  LEU L CG  1 
ATOM   3394  C  CD1 . LEU B  2  102 ? 104.012 87.519  8.132   1.00 13.13  ? 102  LEU L CD1 1 
ATOM   3395  C  CD2 . LEU B  2  102 ? 105.570 87.057  6.251   1.00 11.03  ? 102  LEU L CD2 1 
ATOM   3396  N  N   . ARG B  2  103 ? 109.161 88.720  9.843   1.00 22.14  ? 103  ARG L N   1 
ATOM   3397  C  CA  . ARG B  2  103 ? 110.234 89.600  10.315  1.00 22.78  ? 103  ARG L CA  1 
ATOM   3398  C  C   . ARG B  2  103 ? 111.535 89.374  9.562   1.00 22.50  ? 103  ARG L C   1 
ATOM   3399  O  O   . ARG B  2  103 ? 112.233 90.336  9.267   1.00 26.39  ? 103  ARG L O   1 
ATOM   3400  C  CB  . ARG B  2  103 ? 110.486 89.423  11.803  1.00 24.20  ? 103  ARG L CB  1 
ATOM   3401  C  CG  . ARG B  2  103 ? 111.683 90.194  12.364  1.00 22.77  ? 103  ARG L CG  1 
ATOM   3402  C  CD  . ARG B  2  103 ? 111.644 90.110  13.898  1.00 22.66  ? 103  ARG L CD  1 
ATOM   3403  N  NE  . ARG B  2  103 ? 112.802 90.692  14.575  1.00 21.39  ? 103  ARG L NE  1 
ATOM   3404  C  CZ  . ARG B  2  103 ? 113.835 89.993  15.034  1.00 18.04  ? 103  ARG L CZ  1 
ATOM   3405  N  NH1 . ARG B  2  103 ? 114.005 88.735  14.657  1.00 15.38  ? 103  ARG L NH1 1 
ATOM   3406  N  NH2 . ARG B  2  103 ? 114.767 90.587  15.775  1.00 20.62  ? 103  ARG L NH2 1 
ATOM   3407  N  N   . GLU B  2  104 ? 111.821 88.137  9.161   1.00 18.83  ? 104  GLU L N   1 
ATOM   3408  C  CA  . GLU B  2  104 ? 113.039 87.889  8.403   1.00 18.70  ? 104  GLU L CA  1 
ATOM   3409  C  C   . GLU B  2  104 ? 112.960 88.491  6.996   1.00 23.59  ? 104  GLU L C   1 
ATOM   3410  O  O   . GLU B  2  104 ? 113.968 88.908  6.423   1.00 24.27  ? 104  GLU L O   1 
ATOM   3411  C  CB  . GLU B  2  104 ? 113.316 86.393  8.306   1.00 20.76  ? 104  GLU L CB  1 
ATOM   3412  C  CG  . GLU B  2  104 ? 113.868 85.755  9.566   1.00 20.36  ? 104  GLU L CG  1 
ATOM   3413  C  CD  . GLU B  2  104 ? 114.266 84.304  9.374   1.00 22.32  ? 104  GLU L CD  1 
ATOM   3414  O  OE1 . GLU B  2  104 ? 113.719 83.639  8.473   1.00 28.21  ? 104  GLU L OE1 1 
ATOM   3415  O  OE2 . GLU B  2  104 ? 115.092 83.802  10.161  1.00 21.74  ? 104  GLU L OE2 1 
ATOM   3416  N  N   . VAL B  2  105 ? 111.765 88.525  6.421   1.00 24.61  ? 105  VAL L N   1 
ATOM   3417  C  CA  . VAL B  2  105 ? 111.594 89.175  5.127   1.00 23.08  ? 105  VAL L CA  1 
ATOM   3418  C  C   . VAL B  2  105 ? 111.899 90.672  5.191   1.00 21.79  ? 105  VAL L C   1 
ATOM   3419  O  O   . VAL B  2  105 ? 112.661 91.184  4.382   1.00 25.64  ? 105  VAL L O   1 
ATOM   3420  C  CB  . VAL B  2  105 ? 110.168 88.983  4.584   1.00 23.15  ? 105  VAL L CB  1 
ATOM   3421  C  CG1 . VAL B  2  105 ? 109.958 89.867  3.375   1.00 17.76  ? 105  VAL L CG1 1 
ATOM   3422  C  CG2 . VAL B  2  105 ? 109.942 87.524  4.220   1.00 20.06  ? 105  VAL L CG2 1 
ATOM   3423  N  N   . GLU B  2  106 ? 111.325 91.354  6.173   1.00 20.31  ? 106  GLU L N   1 
ATOM   3424  C  CA  . GLU B  2  106 ? 111.560 92.774  6.377   1.00 20.55  ? 106  GLU L CA  1 
ATOM   3425  C  C   . GLU B  2  106 ? 113.032 93.085  6.548   1.00 21.74  ? 106  GLU L C   1 
ATOM   3426  O  O   . GLU B  2  106 ? 113.547 93.983  5.904   1.00 30.58  ? 106  GLU L O   1 
ATOM   3427  C  CB  . GLU B  2  106 ? 110.786 93.275  7.592   1.00 19.82  ? 106  GLU L CB  1 
ATOM   3428  C  CG  . GLU B  2  106 ? 109.278 93.209  7.423   1.00 21.21  ? 106  GLU L CG  1 
ATOM   3429  C  CD  . GLU B  2  106 ? 108.527 94.045  8.451   1.00 23.12  ? 106  GLU L CD  1 
ATOM   3430  O  OE1 . GLU B  2  106 ? 109.036 94.245  9.573   1.00 28.66  ? 106  GLU L OE1 1 
ATOM   3431  O  OE2 . GLU B  2  106 ? 107.397 94.472  8.160   1.00 26.08  ? 106  GLU L OE2 1 
ATOM   3432  N  N   . ILE B  2  107 ? 113.742 92.273  7.321   1.00 23.21  ? 107  ILE L N   1 
ATOM   3433  C  CA  . ILE B  2  107 ? 115.188 92.437  7.482   1.00 19.40  ? 107  ILE L CA  1 
ATOM   3434  C  C   . ILE B  2  107 ? 115.894 92.253  6.136   1.00 19.43  ? 107  ILE L C   1 
ATOM   3435  O  O   . ILE B  2  107 ? 116.789 93.016  5.799   1.00 24.51  ? 107  ILE L O   1 
ATOM   3436  C  CB  . ILE B  2  107 ? 115.759 91.419  8.525   1.00 22.49  ? 107  ILE L CB  1 
ATOM   3437  C  CG1 . ILE B  2  107 ? 115.359 91.828  9.949   1.00 21.61  ? 107  ILE L CG1 1 
ATOM   3438  C  CG2 . ILE B  2  107 ? 117.272 91.350  8.434   1.00 22.75  ? 107  ILE L CG2 1 
ATOM   3439  C  CD1 . ILE B  2  107 ? 115.191 90.659  10.891  1.00 20.07  ? 107  ILE L CD1 1 
ATOM   3440  N  N   . SER B  2  108 ? 115.518 91.223  5.387   1.00 19.08  ? 108  SER L N   1 
ATOM   3441  C  CA  . SER B  2  108 ? 116.131 90.951  4.093   1.00 22.49  ? 108  SER L CA  1 
ATOM   3442  C  C   . SER B  2  108 ? 115.916 92.138  3.163   1.00 27.11  ? 108  SER L C   1 
ATOM   3443  O  O   . SER B  2  108 ? 116.866 92.609  2.528   1.00 28.54  ? 108  SER L O   1 
ATOM   3444  C  CB  . SER B  2  108 ? 115.516 89.705  3.467   1.00 20.06  ? 108  SER L CB  1 
ATOM   3445  O  OG  . SER B  2  108 ? 115.904 88.555  4.186   1.00 26.26  ? 108  SER L OG  1 
ATOM   3446  N  N   . ARG B  2  109 ? 114.679 92.645  3.140   1.00 26.93  ? 109  ARG L N   1 
ATOM   3447  C  CA  . ARG B  2  109 ? 114.287 93.790  2.319   1.00 23.96  ? 109  ARG L CA  1 
ATOM   3448  C  C   . ARG B  2  109 ? 115.169 94.987  2.632   1.00 23.70  ? 109  ARG L C   1 
ATOM   3449  O  O   . ARG B  2  109 ? 115.730 95.586  1.741   1.00 28.45  ? 109  ARG L O   1 
ATOM   3450  C  CB  . ARG B  2  109 ? 112.831 94.171  2.591   1.00 24.25  ? 109  ARG L CB  1 
ATOM   3451  C  CG  . ARG B  2  109 ? 111.791 93.331  1.884   1.00 33.26  ? 109  ARG L CG  1 
ATOM   3452  C  CD  . ARG B  2  109 ? 110.945 94.149  0.890   1.00 38.68  ? 109  ARG L CD  1 
ATOM   3453  N  NE  . ARG B  2  109 ? 110.091 95.159  1.524   1.00 41.80  ? 109  ARG L NE  1 
ATOM   3454  C  CZ  . ARG B  2  109 ? 109.759 96.322  0.957   1.00 47.81  ? 109  ARG L CZ  1 
ATOM   3455  N  NH1 . ARG B  2  109 ? 110.112 96.574  -0.297  1.00 45.63  ? 109  ARG L NH1 1 
ATOM   3456  N  NH2 . ARG B  2  109 ? 109.077 97.248  1.639   1.00 48.17  ? 109  ARG L NH2 1 
ATOM   3457  N  N   . LYS B  2  110 ? 115.328 95.314  3.906   1.00 23.54  ? 110  LYS L N   1 
ATOM   3458  C  CA  . LYS B  2  110 ? 116.111 96.479  4.295   1.00 23.10  ? 110  LYS L CA  1 
ATOM   3459  C  C   . LYS B  2  110 ? 117.588 96.347  3.889   1.00 25.19  ? 110  LYS L C   1 
ATOM   3460  O  O   . LYS B  2  110 ? 118.256 97.344  3.588   1.00 27.59  ? 110  LYS L O   1 
ATOM   3461  C  CB  . LYS B  2  110 ? 115.976 96.700  5.807   1.00 22.52  ? 110  LYS L CB  1 
ATOM   3462  C  CG  . LYS B  2  110 ? 116.728 97.905  6.329   1.00 22.77  ? 110  LYS L CG  1 
ATOM   3463  C  CD  . LYS B  2  110 ? 116.792 97.883  7.829   1.00 19.66  ? 110  LYS L CD  1 
ATOM   3464  C  CE  . LYS B  2  110 ? 115.392 97.873  8.436   1.00 26.89  ? 110  LYS L CE  1 
ATOM   3465  N  NZ  . LYS B  2  110 ? 114.639 99.168  8.276   1.00 20.05  ? 110  LYS L NZ  1 
ATOM   3466  N  N   . LEU B  2  111 ? 118.103 95.122  3.887   1.00 22.24  ? 111  LEU L N   1 
ATOM   3467  C  CA  . LEU B  2  111 ? 119.507 94.894  3.577   1.00 22.60  ? 111  LEU L CA  1 
ATOM   3468  C  C   . LEU B  2  111 ? 119.747 94.680  2.074   1.00 27.48  ? 111  LEU L C   1 
ATOM   3469  O  O   . LEU B  2  111 ? 120.892 94.457  1.632   1.00 25.26  ? 111  LEU L O   1 
ATOM   3470  C  CB  . LEU B  2  111 ? 120.015 93.683  4.349   1.00 21.29  ? 111  LEU L CB  1 
ATOM   3471  C  CG  . LEU B  2  111 ? 120.379 93.889  5.822   1.00 24.17  ? 111  LEU L CG  1 
ATOM   3472  C  CD1 . LEU B  2  111 ? 120.642 92.544  6.491   1.00 22.72  ? 111  LEU L CD1 1 
ATOM   3473  C  CD2 . LEU B  2  111 ? 121.629 94.751  5.921   1.00 26.98  ? 111  LEU L CD2 1 
ATOM   3474  N  N   . GLY B  2  112 ? 118.659 94.643  1.303   1.00 28.06  ? 112  GLY L N   1 
ATOM   3475  C  CA  . GLY B  2  112 ? 118.768 94.465  -0.141  1.00 26.83  ? 112  GLY L CA  1 
ATOM   3476  C  C   . GLY B  2  112 ? 119.271 93.100  -0.578  1.00 27.15  ? 112  GLY L C   1 
ATOM   3477  O  O   . GLY B  2  112 ? 119.832 92.954  -1.670  1.00 26.85  ? 112  GLY L O   1 
ATOM   3478  N  N   . ILE B  2  113 ? 119.009 92.081  0.235   1.00 25.63  ? 113  ILE L N   1 
ATOM   3479  C  CA  . ILE B  2  113 ? 119.459 90.736  -0.086  1.00 24.26  ? 113  ILE L CA  1 
ATOM   3480  C  C   . ILE B  2  113 ? 118.259 89.849  -0.409  1.00 25.50  ? 113  ILE L C   1 
ATOM   3481  O  O   . ILE B  2  113 ? 117.103 90.270  -0.255  1.00 26.65  ? 113  ILE L O   1 
ATOM   3482  C  CB  . ILE B  2  113 ? 120.281 90.136  1.069   1.00 20.66  ? 113  ILE L CB  1 
ATOM   3483  C  CG1 . ILE B  2  113 ? 119.414 89.929  2.302   1.00 19.73  ? 113  ILE L CG1 1 
ATOM   3484  C  CG2 . ILE B  2  113 ? 121.407 91.077  1.439   1.00 25.69  ? 113  ILE L CG2 1 
ATOM   3485  C  CD1 . ILE B  2  113 ? 120.079 89.022  3.329   1.00 15.48  ? 113  ILE L CD1 1 
ATOM   3486  N  N   . GLY B  2  114 ? 118.523 88.671  -0.959  1.00 24.80  ? 114  GLY L N   1 
ATOM   3487  C  CA  . GLY B  2  114 ? 117.436 87.760  -1.259  1.00 27.34  ? 114  GLY L CA  1 
ATOM   3488  C  C   . GLY B  2  114 ? 116.616 87.347  -0.046  1.00 28.55  ? 114  GLY L C   1 
ATOM   3489  O  O   . GLY B  2  114 ? 117.102 87.322  1.087   1.00 30.43  ? 114  GLY L O   1 
ATOM   3490  N  N   . TRP B  2  115 ? 115.389 86.922  -0.301  1.00 28.68  ? 115  TRP L N   1 
ATOM   3491  C  CA  . TRP B  2  115 ? 114.520 86.441  0.759   1.00 29.85  ? 115  TRP L CA  1 
ATOM   3492  C  C   . TRP B  2  115 ? 114.681 84.944  0.950   1.00 27.46  ? 115  TRP L C   1 
ATOM   3493  O  O   . TRP B  2  115 ? 113.764 84.292  1.426   1.00 29.11  ? 115  TRP L O   1 
ATOM   3494  C  CB  . TRP B  2  115 ? 113.061 86.712  0.409   1.00 35.51  ? 115  TRP L CB  1 
ATOM   3495  C  CG  . TRP B  2  115 ? 112.745 88.116  0.045   1.00 41.60  ? 115  TRP L CG  1 
ATOM   3496  C  CD1 . TRP B  2  115 ? 113.600 89.187  0.031   1.00 42.85  ? 115  TRP L CD1 1 
ATOM   3497  C  CD2 . TRP B  2  115 ? 111.452 88.633  -0.266  1.00 44.64  ? 115  TRP L CD2 1 
ATOM   3498  N  NE1 . TRP B  2  115 ? 112.911 90.340  -0.253  1.00 40.93  ? 115  TRP L NE1 1 
ATOM   3499  C  CE2 . TRP B  2  115 ? 111.592 90.030  -0.445  1.00 44.93  ? 115  TRP L CE2 1 
ATOM   3500  C  CE3 . TRP B  2  115 ? 110.184 88.051  -0.406  1.00 45.14  ? 115  TRP L CE3 1 
ATOM   3501  C  CZ2 . TRP B  2  115 ? 110.505 90.857  -0.761  1.00 44.77  ? 115  TRP L CZ2 1 
ATOM   3502  C  CZ3 . TRP B  2  115 ? 109.106 88.874  -0.718  1.00 42.88  ? 115  TRP L CZ3 1 
ATOM   3503  C  CH2 . TRP B  2  115 ? 109.276 90.261  -0.894  1.00 43.00  ? 115  TRP L CH2 1 
ATOM   3504  N  N   . HIS B  2  116 ? 115.833 84.391  0.584   1.00 27.08  ? 116  HIS L N   1 
ATOM   3505  C  CA  . HIS B  2  116 ? 115.987 82.934  0.574   1.00 24.17  ? 116  HIS L CA  1 
ATOM   3506  C  C   . HIS B  2  116 ? 115.867 82.330  1.963   1.00 25.55  ? 116  HIS L C   1 
ATOM   3507  O  O   . HIS B  2  116 ? 115.442 81.184  2.087   1.00 22.89  ? 116  HIS L O   1 
ATOM   3508  C  CB  . HIS B  2  116 ? 117.335 82.518  0.004   1.00 25.59  ? 116  HIS L CB  1 
ATOM   3509  C  CG  . HIS B  2  116 ? 117.549 82.919  -1.426  1.00 32.09  ? 116  HIS L CG  1 
ATOM   3510  N  ND1 . HIS B  2  116 ? 117.652 84.235  -1.825  1.00 31.02  ? 116  HIS L ND1 1 
ATOM   3511  C  CD2 . HIS B  2  116 ? 117.791 82.172  -2.530  1.00 33.22  ? 116  HIS L CD2 1 
ATOM   3512  C  CE1 . HIS B  2  116 ? 117.942 84.279  -3.111  1.00 33.87  ? 116  HIS L CE1 1 
ATOM   3513  N  NE2 . HIS B  2  116 ? 118.031 83.041  -3.560  1.00 34.07  ? 116  HIS L NE2 1 
ATOM   3514  N  N   . VAL B  2  117 ? 116.274 83.078  2.997   1.00 24.35  ? 117  VAL L N   1 
ATOM   3515  C  CA  . VAL B  2  117 ? 116.304 82.526  4.347   1.00 20.89  ? 117  VAL L CA  1 
ATOM   3516  C  C   . VAL B  2  117 ? 114.918 82.300  4.925   1.00 19.91  ? 117  VAL L C   1 
ATOM   3517  O  O   . VAL B  2  117 ? 114.552 81.164  5.186   1.00 26.01  ? 117  VAL L O   1 
ATOM   3518  C  CB  . VAL B  2  117 ? 117.148 83.361  5.332   1.00 16.38  ? 117  VAL L CB  1 
ATOM   3519  C  CG1 . VAL B  2  117 ? 117.043 82.745  6.733   1.00 16.01  ? 117  VAL L CG1 1 
ATOM   3520  C  CG2 . VAL B  2  117 ? 118.589 83.371  4.902   1.00 13.14  ? 117  VAL L CG2 1 
ATOM   3521  N  N   . PRO B  2  118 ? 114.075 83.343  4.994   1.00 21.21  ? 118  PRO L N   1 
ATOM   3522  C  CA  . PRO B  2  118 ? 112.691 83.125  5.442   1.00 23.67  ? 118  PRO L CA  1 
ATOM   3523  C  C   . PRO B  2  118 ? 111.971 82.047  4.656   1.00 26.93  ? 118  PRO L C   1 
ATOM   3524  O  O   . PRO B  2  118 ? 111.175 81.285  5.210   1.00 28.90  ? 118  PRO L O   1 
ATOM   3525  C  CB  . PRO B  2  118 ? 112.027 84.478  5.246   1.00 18.00  ? 118  PRO L CB  1 
ATOM   3526  C  CG  . PRO B  2  118 ? 112.939 85.214  4.346   1.00 20.74  ? 118  PRO L CG  1 
ATOM   3527  C  CD  . PRO B  2  118 ? 114.307 84.755  4.680   1.00 20.04  ? 118  PRO L CD  1 
ATOM   3528  N  N   . LEU B  2  119 ? 112.299 81.959  3.373   1.00 28.33  ? 119  LEU L N   1 
ATOM   3529  C  CA  . LEU B  2  119 ? 111.769 80.913  2.532   1.00 29.03  ? 119  LEU L CA  1 
ATOM   3530  C  C   . LEU B  2  119 ? 112.196 79.562  3.029   1.00 25.78  ? 119  LEU L C   1 
ATOM   3531  O  O   . LEU B  2  119 ? 111.369 78.696  3.219   1.00 25.08  ? 119  LEU L O   1 
ATOM   3532  C  CB  . LEU B  2  119 ? 112.258 81.086  1.115   1.00 37.42  ? 119  LEU L CB  1 
ATOM   3533  C  CG  . LEU B  2  119 ? 111.100 81.199  0.145   1.00 45.34  ? 119  LEU L CG  1 
ATOM   3534  C  CD1 . LEU B  2  119 ? 110.345 82.542  0.381   1.00 46.52  ? 119  LEU L CD1 1 
ATOM   3535  C  CD2 . LEU B  2  119 ? 111.669 81.083  -1.264  1.00 47.28  ? 119  LEU L CD2 1 
ATOM   3536  N  N   . ALA B  2  120 ? 113.494 79.369  3.204   1.00 22.85  ? 120  ALA L N   1 
ATOM   3537  C  CA  . ALA B  2  120 ? 113.991 78.130  3.768   1.00 24.98  ? 120  ALA L CA  1 
ATOM   3538  C  C   . ALA B  2  120 ? 113.311 77.870  5.112   1.00 23.84  ? 120  ALA L C   1 
ATOM   3539  O  O   . ALA B  2  120 ? 112.930 76.743  5.405   1.00 27.99  ? 120  ALA L O   1 
ATOM   3540  C  CB  . ALA B  2  120 ? 115.493 78.196  3.946   1.00 22.23  ? 120  ALA L CB  1 
ATOM   3541  N  N   . PHE B  2  121 ? 113.059 78.923  5.876   1.00 21.56  ? 121  PHE L N   1 
ATOM   3542  C  CA  . PHE B  2  121 ? 112.473 78.757  7.194   1.00 22.83  ? 121  PHE L CA  1 
ATOM   3543  C  C   . PHE B  2  121 ? 111.006 78.304  7.117   1.00 26.48  ? 121  PHE L C   1 
ATOM   3544  O  O   . PHE B  2  121 ? 110.499 77.713  8.076   1.00 29.96  ? 121  PHE L O   1 
ATOM   3545  C  CB  . PHE B  2  121 ? 112.617 80.057  8.006   1.00 21.92  ? 121  PHE L CB  1 
ATOM   3546  C  CG  . PHE B  2  121 ? 112.141 79.958  9.445   1.00 14.57  ? 121  PHE L CG  1 
ATOM   3547  C  CD1 . PHE B  2  121 ? 112.350 78.805  10.191  1.00 13.76  ? 121  PHE L CD1 1 
ATOM   3548  C  CD2 . PHE B  2  121 ? 111.376 80.986  10.002  1.00 17.07  ? 121  PHE L CD2 1 
ATOM   3549  C  CE1 . PHE B  2  121 ? 111.789 78.655  11.463  1.00 13.74  ? 121  PHE L CE1 1 
ATOM   3550  C  CE2 . PHE B  2  121 ? 110.809 80.855  11.276  1.00 20.39  ? 121  PHE L CE2 1 
ATOM   3551  C  CZ  . PHE B  2  121 ? 111.016 79.677  12.009  1.00 12.95  ? 121  PHE L CZ  1 
ATOM   3552  N  N   . CYS B  2  122 ? 110.379 78.407  5.940   1.00 27.69  ? 122  CYS L N   1 
ATOM   3553  C  CA  . CYS B  2  122 ? 109.001 77.923  5.775   1.00 23.39  ? 122  CYS L CA  1 
ATOM   3554  C  C   . CYS B  2  122 ? 108.884 76.417  5.836   1.00 20.43  ? 122  CYS L C   1 
ATOM   3555  O  O   . CYS B  2  122 ? 107.857 75.903  6.253   1.00 23.43  ? 122  CYS L O   1 
ATOM   3556  C  CB  . CYS B  2  122 ? 108.384 78.406  4.468   1.00 24.69  ? 122  CYS L CB  1 
ATOM   3557  S  SG  . CYS B  2  122 ? 107.829 80.124  4.533   1.00 47.13  ? 122  CYS L SG  1 
ATOM   3558  N  N   . VAL B  2  123 ? 109.932 75.700  5.443   1.00 19.85  ? 123  VAL L N   1 
ATOM   3559  C  CA  . VAL B  2  123 ? 109.908 74.243  5.495   1.00 18.01  ? 123  VAL L CA  1 
ATOM   3560  C  C   . VAL B  2  123 ? 109.610 73.698  6.906   1.00 19.34  ? 123  VAL L C   1 
ATOM   3561  O  O   . VAL B  2  123 ? 108.647 72.945  7.087   1.00 22.87  ? 123  VAL L O   1 
ATOM   3562  C  CB  . VAL B  2  123 ? 111.214 73.655  4.935   1.00 16.25  ? 123  VAL L CB  1 
ATOM   3563  C  CG1 . VAL B  2  123 ? 111.308 72.181  5.209   1.00 17.49  ? 123  VAL L CG1 1 
ATOM   3564  C  CG2 . VAL B  2  123 ? 111.258 73.878  3.447   1.00 12.63  ? 123  VAL L CG2 1 
ATOM   3565  N  N   . PRO B  2  124 ? 110.372 74.125  7.932   1.00 18.39  ? 124  PRO L N   1 
ATOM   3566  C  CA  . PRO B  2  124 ? 110.072 73.536  9.245   1.00 17.43  ? 124  PRO L CA  1 
ATOM   3567  C  C   . PRO B  2  124 ? 108.712 73.939  9.813   1.00 17.30  ? 124  PRO L C   1 
ATOM   3568  O  O   . PRO B  2  124 ? 108.051 73.122  10.455  1.00 21.67  ? 124  PRO L O   1 
ATOM   3569  C  CB  . PRO B  2  124 ? 111.235 73.995  10.126  1.00 14.79  ? 124  PRO L CB  1 
ATOM   3570  C  CG  . PRO B  2  124 ? 111.802 75.196  9.412   1.00 18.25  ? 124  PRO L CG  1 
ATOM   3571  C  CD  . PRO B  2  124 ? 111.641 74.877  7.958   1.00 18.49  ? 124  PRO L CD  1 
ATOM   3572  N  N   . ILE B  2  125 ? 108.254 75.147  9.501   1.00 14.83  ? 125  ILE L N   1 
ATOM   3573  C  CA  . ILE B  2  125 ? 106.910 75.580  9.885   1.00 18.79  ? 125  ILE L CA  1 
ATOM   3574  C  C   . ILE B  2  125 ? 105.846 74.687  9.223   1.00 23.63  ? 125  ILE L C   1 
ATOM   3575  O  O   . ILE B  2  125 ? 104.931 74.181  9.884   1.00 25.34  ? 125  ILE L O   1 
ATOM   3576  C  CB  . ILE B  2  125 ? 106.647 77.036  9.462   1.00 21.36  ? 125  ILE L CB  1 
ATOM   3577  C  CG1 . ILE B  2  125 ? 107.768 77.957  9.973   1.00 19.48  ? 125  ILE L CG1 1 
ATOM   3578  C  CG2 . ILE B  2  125 ? 105.284 77.468  9.984   1.00 19.62  ? 125  ILE L CG2 1 
ATOM   3579  C  CD1 . ILE B  2  125 ? 107.536 79.460  9.705   1.00 22.89  ? 125  ILE L CD1 1 
ATOM   3580  N  N   . PHE B  2  126 ? 105.980 74.509  7.909   1.00 23.78  ? 126  PHE L N   1 
ATOM   3581  C  CA  . PHE B  2  126 ? 105.223 73.517  7.153   1.00 21.08  ? 126  PHE L CA  1 
ATOM   3582  C  C   . PHE B  2  126 ? 105.192 72.155  7.843   1.00 22.34  ? 126  PHE L C   1 
ATOM   3583  O  O   . PHE B  2  126 ? 104.109 71.626  8.106   1.00 21.92  ? 126  PHE L O   1 
ATOM   3584  C  CB  . PHE B  2  126 ? 105.805 73.365  5.742   1.00 18.71  ? 126  PHE L CB  1 
ATOM   3585  C  CG  . PHE B  2  126 ? 105.182 72.254  4.940   1.00 20.12  ? 126  PHE L CG  1 
ATOM   3586  C  CD1 . PHE B  2  126 ? 103.828 72.281  4.619   1.00 21.97  ? 126  PHE L CD1 1 
ATOM   3587  C  CD2 . PHE B  2  126 ? 105.944 71.170  4.524   1.00 22.69  ? 126  PHE L CD2 1 
ATOM   3588  C  CE1 . PHE B  2  126 ? 103.248 71.251  3.897   1.00 20.57  ? 126  PHE L CE1 1 
ATOM   3589  C  CE2 . PHE B  2  126 ? 105.369 70.127  3.798   1.00 21.06  ? 126  PHE L CE2 1 
ATOM   3590  C  CZ  . PHE B  2  126 ? 104.028 70.171  3.481   1.00 18.79  ? 126  PHE L CZ  1 
ATOM   3591  N  N   . MET B  2  127 ? 106.354 71.579  8.150   1.00 20.14  ? 127  MET L N   1 
ATOM   3592  C  CA  . MET B  2  127 ? 106.353 70.262  8.798   1.00 19.97  ? 127  MET L CA  1 
ATOM   3593  C  C   . MET B  2  127 ? 105.650 70.334  10.148  1.00 21.43  ? 127  MET L C   1 
ATOM   3594  O  O   . MET B  2  127 ? 104.874 69.452  10.498  1.00 23.67  ? 127  MET L O   1 
ATOM   3595  C  CB  . MET B  2  127 ? 107.763 69.742  9.001   1.00 21.76  ? 127  MET L CB  1 
ATOM   3596  C  CG  . MET B  2  127 ? 107.810 68.333  9.483   1.00 19.49  ? 127  MET L CG  1 
ATOM   3597  S  SD  . MET B  2  127 ? 107.636 67.233  8.100   1.00 26.47  ? 127  MET L SD  1 
ATOM   3598  C  CE  . MET B  2  127 ? 107.083 65.744  8.911   1.00 18.06  ? 127  MET L CE  1 
ATOM   3599  N  N   . PHE B  2  128 ? 105.820 71.444  10.853  1.00 19.39  ? 128  PHE L N   1 
ATOM   3600  C  CA  . PHE B  2  128 ? 105.131 71.598  12.114  1.00 18.93  ? 128  PHE L CA  1 
ATOM   3601  C  C   . PHE B  2  128 ? 103.636 71.478  11.891  1.00 20.52  ? 128  PHE L C   1 
ATOM   3602  O  O   . PHE B  2  128 ? 102.930 70.881  12.698  1.00 22.26  ? 128  PHE L O   1 
ATOM   3603  C  CB  . PHE B  2  128 ? 105.443 72.943  12.743  1.00 15.40  ? 128  PHE L CB  1 
ATOM   3604  C  CG  . PHE B  2  128 ? 104.689 73.190  14.009  1.00 17.32  ? 128  PHE L CG  1 
ATOM   3605  C  CD1 . PHE B  2  128 ? 105.136 72.653  15.207  1.00 16.13  ? 128  PHE L CD1 1 
ATOM   3606  C  CD2 . PHE B  2  128 ? 103.573 74.027  14.017  1.00 19.44  ? 128  PHE L CD2 1 
ATOM   3607  C  CE1 . PHE B  2  128 ? 104.503 72.957  16.394  1.00 17.52  ? 128  PHE L CE1 1 
ATOM   3608  C  CE2 . PHE B  2  128 ? 102.928 74.338  15.200  1.00 19.02  ? 128  PHE L CE2 1 
ATOM   3609  C  CZ  . PHE B  2  128 ? 103.392 73.813  16.389  1.00 17.68  ? 128  PHE L CZ  1 
ATOM   3610  N  N   . CYS B  2  129 ? 103.155 72.049  10.793  1.00 22.37  ? 129  CYS L N   1 
ATOM   3611  C  CA  . CYS B  2  129 ? 101.736 72.031  10.486  1.00 18.17  ? 129  CYS L CA  1 
ATOM   3612  C  C   . CYS B  2  129 ? 101.285 70.641  10.063  1.00 20.57  ? 129  CYS L C   1 
ATOM   3613  O  O   . CYS B  2  129 ? 100.131 70.281  10.284  1.00 24.45  ? 129  CYS L O   1 
ATOM   3614  C  CB  . CYS B  2  129 ? 101.422 73.001  9.373   1.00 18.28  ? 129  CYS L CB  1 
ATOM   3615  S  SG  . CYS B  2  129 ? 101.360 74.712  9.896   1.00 24.73  ? 129  CYS L SG  1 
ATOM   3616  N  N   . VAL B  2  130 ? 102.139 69.902  9.358   1.00 15.12  ? 130  VAL L N   1 
ATOM   3617  C  CA  . VAL B  2  130 ? 101.748 68.579  8.892   1.00 16.42  ? 130  VAL L CA  1 
ATOM   3618  C  C   . VAL B  2  130 ? 101.430 67.721  10.109  1.00 19.42  ? 130  VAL L C   1 
ATOM   3619  O  O   . VAL B  2  130 ? 100.302 67.285  10.268  1.00 23.24  ? 130  VAL L O   1 
ATOM   3620  C  CB  . VAL B  2  130 ? 102.860 67.902  8.084   1.00 15.18  ? 130  VAL L CB  1 
ATOM   3621  C  CG1 . VAL B  2  130 ? 102.516 66.458  7.829   1.00 15.97  ? 130  VAL L CG1 1 
ATOM   3622  C  CG2 . VAL B  2  130 ? 103.034 68.591  6.766   1.00 15.53  ? 130  VAL L CG2 1 
ATOM   3623  N  N   . LEU B  2  131 ? 102.346 67.750  11.074  1.00 19.91  ? 131  LEU L N   1 
ATOM   3624  C  CA  . LEU B  2  131 ? 102.255 66.982  12.297  1.00 14.35  ? 131  LEU L CA  1 
ATOM   3625  C  C   . LEU B  2  131 ? 101.097 67.377  13.174  1.00 13.92  ? 131  LEU L C   1 
ATOM   3626  O  O   . LEU B  2  131 ? 100.392 66.513  13.652  1.00 20.40  ? 131  LEU L O   1 
ATOM   3627  C  CB  . LEU B  2  131 ? 103.563 67.110  13.086  1.00 15.82  ? 131  LEU L CB  1 
ATOM   3628  C  CG  . LEU B  2  131 ? 104.774 66.456  12.415  1.00 14.29  ? 131  LEU L CG  1 
ATOM   3629  C  CD1 . LEU B  2  131 ? 106.079 66.993  12.956  1.00 17.20  ? 131  LEU L CD1 1 
ATOM   3630  C  CD2 . LEU B  2  131 ? 104.693 65.005  12.648  1.00 17.30  ? 131  LEU L CD2 1 
ATOM   3631  N  N   . GLN B  2  132 ? 100.903 68.674  13.394  1.00 19.29  ? 132  GLN L N   1 
ATOM   3632  C  CA  . GLN B  2  132 ? 99.938  69.180  14.387  1.00 17.43  ? 132  GLN L CA  1 
ATOM   3633  C  C   . GLN B  2  132 ? 98.592  69.593  13.817  1.00 19.28  ? 132  GLN L C   1 
ATOM   3634  O  O   . GLN B  2  132 ? 97.612  69.692  14.551  1.00 24.07  ? 132  GLN L O   1 
ATOM   3635  C  CB  . GLN B  2  132 ? 100.495 70.400  15.121  1.00 16.67  ? 132  GLN L CB  1 
ATOM   3636  C  CG  . GLN B  2  132 ? 101.835 70.209  15.859  1.00 15.61  ? 132  GLN L CG  1 
ATOM   3637  C  CD  . GLN B  2  132 ? 101.763 69.190  16.989  1.00 15.06  ? 132  GLN L CD  1 
ATOM   3638  O  OE1 . GLN B  2  132 ? 101.752 67.989  16.744  1.00 15.98  ? 132  GLN L OE1 1 
ATOM   3639  N  NE2 . GLN B  2  132 ? 101.795 69.665  18.232  1.00 20.99  ? 132  GLN L NE2 1 
ATOM   3640  N  N   . VAL B  2  133 ? 98.567  70.000  12.561  1.00 19.80  ? 133  VAL L N   1 
ATOM   3641  C  CA  . VAL B  2  133 ? 97.337  70.523  11.995  1.00 19.87  ? 133  VAL L CA  1 
ATOM   3642  C  C   . VAL B  2  133 ? 96.716  69.660  10.900  1.00 20.05  ? 133  VAL L C   1 
ATOM   3643  O  O   . VAL B  2  133 ? 95.628  69.124  11.075  1.00 24.83  ? 133  VAL L O   1 
ATOM   3644  C  CB  . VAL B  2  133 ? 97.556  71.934  11.481  1.00 18.67  ? 133  VAL L CB  1 
ATOM   3645  C  CG1 . VAL B  2  133 ? 96.269  72.472  10.902  1.00 21.04  ? 133  VAL L CG1 1 
ATOM   3646  C  CG2 . VAL B  2  133 ? 98.015  72.817  12.618  1.00 16.95  ? 133  VAL L CG2 1 
ATOM   3647  N  N   . PHE B  2  134 ? 97.404  69.528  9.777   1.00 19.71  ? 134  PHE L N   1 
ATOM   3648  C  CA  . PHE B  2  134 ? 96.911  68.770  8.634   1.00 21.24  ? 134  PHE L CA  1 
ATOM   3649  C  C   . PHE B  2  134 ? 96.588  67.330  8.940   1.00 26.68  ? 134  PHE L C   1 
ATOM   3650  O  O   . PHE B  2  134 ? 95.502  66.854  8.585   1.00 29.40  ? 134  PHE L O   1 
ATOM   3651  C  CB  . PHE B  2  134 ? 97.927  68.785  7.505   1.00 17.60  ? 134  PHE L CB  1 
ATOM   3652  C  CG  . PHE B  2  134 ? 98.305  70.155  7.063   1.00 23.07  ? 134  PHE L CG  1 
ATOM   3653  C  CD1 . PHE B  2  134 ? 97.483  71.240  7.355   1.00 23.05  ? 134  PHE L CD1 1 
ATOM   3654  C  CD2 . PHE B  2  134 ? 99.528  70.380  6.429   1.00 26.33  ? 134  PHE L CD2 1 
ATOM   3655  C  CE1 . PHE B  2  134 ? 97.881  72.532  7.034   1.00 27.04  ? 134  PHE L CE1 1 
ATOM   3656  C  CE2 . PHE B  2  134 ? 99.945  71.670  6.099   1.00 21.87  ? 134  PHE L CE2 1 
ATOM   3657  C  CZ  . PHE B  2  134 ? 99.124  72.750  6.406   1.00 25.73  ? 134  PHE L CZ  1 
ATOM   3658  N  N   . ARG B  2  135 ? 97.575  66.587  9.438   1.00 24.19  ? 135  ARG L N   1 
ATOM   3659  C  CA  . ARG B  2  135 ? 97.351  65.170  9.703   1.00 24.38  ? 135  ARG L CA  1 
ATOM   3660  C  C   . ARG B  2  135 ? 96.224  64.907  10.749  1.00 22.93  ? 135  ARG L C   1 
ATOM   3661  O  O   . ARG B  2  135 ? 95.329  64.094  10.507  1.00 24.93  ? 135  ARG L O   1 
ATOM   3662  C  CB  . ARG B  2  135 ? 98.668  64.467  10.094  1.00 22.85  ? 135  ARG L CB  1 
ATOM   3663  C  CG  . ARG B  2  135 ? 98.483  62.943  10.237  1.00 23.92  ? 135  ARG L CG  1 
ATOM   3664  C  CD  . ARG B  2  135 ? 99.718  62.169  10.701  1.00 17.63  ? 135  ARG L CD  1 
ATOM   3665  N  NE  . ARG B  2  135 ? 99.414  60.744  10.852  1.00 17.42  ? 135  ARG L NE  1 
ATOM   3666  C  CZ  . ARG B  2  135 ? 99.194  60.144  12.018  1.00 15.56  ? 135  ARG L CZ  1 
ATOM   3667  N  NH1 . ARG B  2  135 ? 99.279  60.836  13.145  1.00 15.22  ? 135  ARG L NH1 1 
ATOM   3668  N  NH2 . ARG B  2  135 ? 98.893  58.855  12.060  1.00 14.89  ? 135  ARG L NH2 1 
ATOM   3669  N  N   . PRO B  2  136 ? 96.168  65.696  11.839  1.00 21.48  ? 136  PRO L N   1 
ATOM   3670  C  CA  . PRO B  2  136 ? 94.976  65.688  12.690  1.00 22.23  ? 136  PRO L CA  1 
ATOM   3671  C  C   . PRO B  2  136 ? 93.670  66.039  11.996  1.00 22.34  ? 136  PRO L C   1 
ATOM   3672  O  O   . PRO B  2  136 ? 92.625  65.513  12.364  1.00 28.85  ? 136  PRO L O   1 
ATOM   3673  C  CB  . PRO B  2  136 ? 95.317  66.697  13.784  1.00 22.87  ? 136  PRO L CB  1 
ATOM   3674  C  CG  . PRO B  2  136 ? 96.755  66.528  13.954  1.00 21.73  ? 136  PRO L CG  1 
ATOM   3675  C  CD  . PRO B  2  136 ? 97.318  66.265  12.566  1.00 22.96  ? 136  PRO L CD  1 
ATOM   3676  N  N   . LEU B  2  137 ? 93.691  66.966  11.048  1.00 23.27  ? 137  LEU L N   1 
ATOM   3677  C  CA  . LEU B  2  137 ? 92.470  67.250  10.301  1.00 24.13  ? 137  LEU L CA  1 
ATOM   3678  C  C   . LEU B  2  137 ? 92.078  66.047  9.451   1.00 25.76  ? 137  LEU L C   1 
ATOM   3679  O  O   . LEU B  2  137 ? 90.960  65.568  9.575   1.00 31.30  ? 137  LEU L O   1 
ATOM   3680  C  CB  . LEU B  2  137 ? 92.604  68.492  9.415   1.00 22.66  ? 137  LEU L CB  1 
ATOM   3681  C  CG  . LEU B  2  137 ? 92.670  69.888  10.040  1.00 20.24  ? 137  LEU L CG  1 
ATOM   3682  C  CD1 . LEU B  2  137 ? 92.639  70.893  8.924   1.00 22.37  ? 137  LEU L CD1 1 
ATOM   3683  C  CD2 . LEU B  2  137 ? 91.530  70.155  10.991  1.00 22.48  ? 137  LEU L CD2 1 
ATOM   3684  N  N   . LEU B  2  138 ? 93.018  65.480  8.700   1.00 21.04  ? 138  LEU L N   1 
ATOM   3685  C  CA  . LEU B  2  138 ? 92.719  64.300  7.908   1.00 24.71  ? 138  LEU L CA  1 
ATOM   3686  C  C   . LEU B  2  138 ? 92.138  63.182  8.762   1.00 28.39  ? 138  LEU L C   1 
ATOM   3687  O  O   . LEU B  2  138 ? 91.226  62.476  8.330   1.00 32.39  ? 138  LEU L O   1 
ATOM   3688  C  CB  . LEU B  2  138 ? 93.967  63.772  7.208   1.00 23.08  ? 138  LEU L CB  1 
ATOM   3689  C  CG  . LEU B  2  138 ? 94.480  64.662  6.085   1.00 27.34  ? 138  LEU L CG  1 
ATOM   3690  C  CD1 . LEU B  2  138 ? 95.623  63.991  5.343   1.00 23.04  ? 138  LEU L CD1 1 
ATOM   3691  C  CD2 . LEU B  2  138 ? 93.334  64.955  5.153   1.00 24.95  ? 138  LEU L CD2 1 
ATOM   3692  N  N   . LEU B  2  139 ? 92.755  62.936  9.916   1.00 30.84  ? 139  LEU L N   1 
ATOM   3693  C  CA  . LEU B  2  139 ? 92.365  61.815  10.769  1.00 27.08  ? 139  LEU L CA  1 
ATOM   3694  C  C   . LEU B  2  139 ? 91.182  62.144  11.695  1.00 28.26  ? 139  LEU L C   1 
ATOM   3695  O  O   . LEU B  2  139 ? 90.608  61.253  12.337  1.00 33.38  ? 139  LEU L O   1 
ATOM   3696  C  CB  . LEU B  2  139 ? 93.554  61.354  11.597  1.00 24.51  ? 139  LEU L CB  1 
ATOM   3697  C  CG  . LEU B  2  139 ? 94.550  60.460  10.874  1.00 29.40  ? 139  LEU L CG  1 
ATOM   3698  C  CD1 . LEU B  2  139 ? 95.446  59.876  11.908  1.00 32.09  ? 139  LEU L CD1 1 
ATOM   3699  C  CD2 . LEU B  2  139 ? 93.872  59.322  10.116  1.00 30.08  ? 139  LEU L CD2 1 
ATOM   3700  N  N   . GLY B  2  140 ? 90.845  63.419  11.815  1.00 24.35  ? 140  GLY L N   1 
ATOM   3701  C  CA  . GLY B  2  140 ? 89.590  63.752  12.445  1.00 22.15  ? 140  GLY L CA  1 
ATOM   3702  C  C   . GLY B  2  140 ? 89.653  64.240  13.868  1.00 23.34  ? 140  GLY L C   1 
ATOM   3703  O  O   . GLY B  2  140 ? 88.649  64.680  14.385  1.00 28.42  ? 140  GLY L O   1 
ATOM   3704  N  N   . SER B  2  141 ? 90.811  64.251  14.497  1.00 23.58  ? 141  SER L N   1 
ATOM   3705  C  CA  . SER B  2  141 ? 90.840  64.734  15.863  1.00 26.77  ? 141  SER L CA  1 
ATOM   3706  C  C   . SER B  2  141 ? 92.157  65.425  16.146  1.00 25.11  ? 141  SER L C   1 
ATOM   3707  O  O   . SER B  2  141 ? 93.180  65.043  15.588  1.00 29.89  ? 141  SER L O   1 
ATOM   3708  C  CB  . SER B  2  141 ? 90.607  63.579  16.845  1.00 24.25  ? 141  SER L CB  1 
ATOM   3709  O  OG  . SER B  2  141 ? 90.533  64.065  18.180  1.00 30.63  ? 141  SER L OG  1 
ATOM   3710  N  N   . TRP B  2  142 ? 92.127  66.472  16.967  1.00 23.87  ? 142  TRP L N   1 
ATOM   3711  C  CA  . TRP B  2  142 ? 93.359  67.104  17.438  1.00 24.87  ? 142  TRP L CA  1 
ATOM   3712  C  C   . TRP B  2  142 ? 94.121  66.131  18.331  1.00 25.96  ? 142  TRP L C   1 
ATOM   3713  O  O   . TRP B  2  142 ? 95.309  66.286  18.556  1.00 25.84  ? 142  TRP L O   1 
ATOM   3714  C  CB  . TRP B  2  142 ? 93.059  68.359  18.248  1.00 21.10  ? 142  TRP L CB  1 
ATOM   3715  C  CG  . TRP B  2  142 ? 92.384  69.439  17.480  1.00 28.40  ? 142  TRP L CG  1 
ATOM   3716  C  CD1 . TRP B  2  142 ? 91.125  69.955  17.703  1.00 29.78  ? 142  TRP L CD1 1 
ATOM   3717  C  CD2 . TRP B  2  142 ? 92.887  70.098  16.320  1.00 25.18  ? 142  TRP L CD2 1 
ATOM   3718  N  NE1 . TRP B  2  142 ? 90.812  70.862  16.725  1.00 26.07  ? 142  TRP L NE1 1 
ATOM   3719  C  CE2 . TRP B  2  142 ? 91.872  70.970  15.863  1.00 28.32  ? 142  TRP L CE2 1 
ATOM   3720  C  CE3 . TRP B  2  142 ? 94.094  70.038  15.620  1.00 27.70  ? 142  TRP L CE3 1 
ATOM   3721  C  CZ2 . TRP B  2  142 ? 92.027  71.764  14.731  1.00 28.37  ? 142  TRP L CZ2 1 
ATOM   3722  C  CZ3 . TRP B  2  142 ? 94.251  70.834  14.501  1.00 32.26  ? 142  TRP L CZ3 1 
ATOM   3723  C  CH2 . TRP B  2  142 ? 93.219  71.684  14.064  1.00 31.03  ? 142  TRP L CH2 1 
ATOM   3724  N  N   . GLY B  2  143 ? 93.436  65.110  18.823  1.00 27.49  ? 143  GLY L N   1 
ATOM   3725  C  CA  . GLY B  2  143 ? 94.077  64.159  19.710  1.00 25.75  ? 143  GLY L CA  1 
ATOM   3726  C  C   . GLY B  2  143 ? 95.214  63.359  19.117  1.00 23.05  ? 143  GLY L C   1 
ATOM   3727  O  O   . GLY B  2  143 ? 95.823  62.591  19.853  1.00 25.48  ? 143  GLY L O   1 
ATOM   3728  N  N   . HIS B  2  144 ? 95.513  63.552  17.827  1.00 20.93  ? 144  HIS L N   1 
ATOM   3729  C  CA  . HIS B  2  144 ? 96.569  62.810  17.114  1.00 19.02  ? 144  HIS L CA  1 
ATOM   3730  C  C   . HIS B  2  144 ? 97.909  63.547  17.046  1.00 19.49  ? 144  HIS L C   1 
ATOM   3731  O  O   . HIS B  2  144 ? 98.910  62.991  16.581  1.00 20.37  ? 144  HIS L O   1 
ATOM   3732  C  CB  . HIS B  2  144 ? 96.127  62.487  15.687  1.00 16.30  ? 144  HIS L CB  1 
ATOM   3733  C  CG  . HIS B  2  144 ? 94.975  61.537  15.612  1.00 17.73  ? 144  HIS L CG  1 
ATOM   3734  N  ND1 . HIS B  2  144 ? 95.053  60.237  16.061  1.00 20.99  ? 144  HIS L ND1 1 
ATOM   3735  C  CD2 . HIS B  2  144 ? 93.717  61.697  15.145  1.00 18.00  ? 144  HIS L CD2 1 
ATOM   3736  C  CE1 . HIS B  2  144 ? 93.891  59.640  15.876  1.00 23.20  ? 144  HIS L CE1 1 
ATOM   3737  N  NE2 . HIS B  2  144 ? 93.063  60.503  15.322  1.00 21.90  ? 144  HIS L NE2 1 
ATOM   3738  N  N   . ALA B  2  145 ? 97.911  64.806  17.476  1.00 18.30  ? 145  ALA L N   1 
ATOM   3739  C  CA  . ALA B  2  145 ? 99.099  65.659  17.441  1.00 16.86  ? 145  ALA L CA  1 
ATOM   3740  C  C   . ALA B  2  145 ? 100.065 65.290  18.575  1.00 18.96  ? 145  ALA L C   1 
ATOM   3741  O  O   . ALA B  2  145 ? 99.752  64.453  19.405  1.00 16.62  ? 145  ALA L O   1 
ATOM   3742  C  CB  . ALA B  2  145 ? 98.666  67.092  17.567  1.00 18.62  ? 145  ALA L CB  1 
ATOM   3743  N  N   . PHE B  2  146 ? 101.245 65.892  18.619  1.00 20.41  ? 146  PHE L N   1 
ATOM   3744  C  CA  . PHE B  2  146 ? 102.194 65.499  19.654  1.00 20.96  ? 146  PHE L CA  1 
ATOM   3745  C  C   . PHE B  2  146 ? 102.158 66.427  20.849  1.00 20.00  ? 146  PHE L C   1 
ATOM   3746  O  O   . PHE B  2  146 ? 101.689 67.565  20.748  1.00 21.03  ? 146  PHE L O   1 
ATOM   3747  C  CB  . PHE B  2  146 ? 103.611 65.385  19.092  1.00 17.70  ? 146  PHE L CB  1 
ATOM   3748  C  CG  . PHE B  2  146 ? 104.201 66.685  18.632  1.00 14.51  ? 146  PHE L CG  1 
ATOM   3749  C  CD1 . PHE B  2  146 ? 104.798 67.550  19.540  1.00 16.01  ? 146  PHE L CD1 1 
ATOM   3750  C  CD2 . PHE B  2  146 ? 104.254 66.991  17.278  1.00 13.97  ? 146  PHE L CD2 1 
ATOM   3751  C  CE1 . PHE B  2  146 ? 105.433 68.701  19.118  1.00 13.33  ? 146  PHE L CE1 1 
ATOM   3752  C  CE2 . PHE B  2  146 ? 104.892 68.148  16.829  1.00 8.74   ? 146  PHE L CE2 1 
ATOM   3753  C  CZ  . PHE B  2  146 ? 105.482 69.006  17.753  1.00 13.79  ? 146  PHE L CZ  1 
ATOM   3754  N  N   . PRO B  2  147 ? 102.513 65.896  22.031  1.00 17.84  ? 147  PRO L N   1 
ATOM   3755  C  CA  . PRO B  2  147 ? 102.514 66.614  23.305  1.00 15.40  ? 147  PRO L CA  1 
ATOM   3756  C  C   . PRO B  2  147 ? 103.714 67.539  23.417  1.00 17.93  ? 147  PRO L C   1 
ATOM   3757  O  O   . PRO B  2  147 ? 104.710 67.361  22.724  1.00 21.82  ? 147  PRO L O   1 
ATOM   3758  C  CB  . PRO B  2  147 ? 102.575 65.498  24.328  1.00 18.66  ? 147  PRO L CB  1 
ATOM   3759  C  CG  . PRO B  2  147 ? 103.372 64.440  23.637  1.00 18.62  ? 147  PRO L CG  1 
ATOM   3760  C  CD  . PRO B  2  147 ? 102.899 64.487  22.211  1.00 17.31  ? 147  PRO L CD  1 
ATOM   3761  N  N   . TYR B  2  148 ? 103.563 68.612  24.172  1.00 16.62  ? 148  TYR L N   1 
ATOM   3762  C  CA  . TYR B  2  148 ? 104.637 69.563  24.327  1.00 12.08  ? 148  TYR L CA  1 
ATOM   3763  C  C   . TYR B  2  148 ? 105.343 69.168  25.597  1.00 15.31  ? 148  TYR L C   1 
ATOM   3764  O  O   . TYR B  2  148 ? 104.820 69.400  26.677  1.00 19.20  ? 148  TYR L O   1 
ATOM   3765  C  CB  . TYR B  2  148 ? 104.081 70.985  24.430  1.00 10.07  ? 148  TYR L CB  1 
ATOM   3766  C  CG  . TYR B  2  148 ? 103.504 71.485  23.115  1.00 10.77  ? 148  TYR L CG  1 
ATOM   3767  C  CD1 . TYR B  2  148 ? 104.075 71.100  21.890  1.00 8.88   ? 148  TYR L CD1 1 
ATOM   3768  C  CD2 . TYR B  2  148 ? 102.316 72.222  23.089  1.00 8.99   ? 148  TYR L CD2 1 
ATOM   3769  C  CE1 . TYR B  2  148 ? 103.459 71.389  20.694  1.00 10.80  ? 148  TYR L CE1 1 
ATOM   3770  C  CE2 . TYR B  2  148 ? 101.705 72.555  21.883  1.00 10.75  ? 148  TYR L CE2 1 
ATOM   3771  C  CZ  . TYR B  2  148 ? 102.273 72.116  20.698  1.00 13.90  ? 148  TYR L CZ  1 
ATOM   3772  O  OH  . TYR B  2  148 ? 101.622 72.339  19.521  1.00 14.44  ? 148  TYR L OH  1 
ATOM   3773  N  N   . GLY B  2  149 ? 106.351 68.324  25.448  1.00 15.21  ? 149  GLY L N   1 
ATOM   3774  C  CA  . GLY B  2  149 ? 107.180 67.928  26.561  1.00 15.87  ? 149  GLY L CA  1 
ATOM   3775  C  C   . GLY B  2  149 ? 108.489 67.448  25.974  1.00 21.89  ? 149  GLY L C   1 
ATOM   3776  O  O   . GLY B  2  149 ? 108.509 66.805  24.921  1.00 23.67  ? 149  GLY L O   1 
ATOM   3777  N  N   . ILE B  2  150 ? 109.588 67.811  26.619  1.00 23.02  ? 150  ILE L N   1 
ATOM   3778  C  CA  . ILE B  2  150 ? 110.923 67.483  26.147  1.00 21.46  ? 150  ILE L CA  1 
ATOM   3779  C  C   . ILE B  2  150 ? 111.081 65.994  25.882  1.00 20.38  ? 150  ILE L C   1 
ATOM   3780  O  O   . ILE B  2  150 ? 111.591 65.618  24.842  1.00 24.18  ? 150  ILE L O   1 
ATOM   3781  C  CB  . ILE B  2  150 ? 111.945 67.944  27.183  1.00 21.69  ? 150  ILE L CB  1 
ATOM   3782  C  CG1 . ILE B  2  150 ? 111.900 69.461  27.257  1.00 20.49  ? 150  ILE L CG1 1 
ATOM   3783  C  CG2 . ILE B  2  150 ? 113.330 67.447  26.854  1.00 17.65  ? 150  ILE L CG2 1 
ATOM   3784  C  CD1 . ILE B  2  150 ? 112.663 70.001  28.420  1.00 35.73  ? 150  ILE L CD1 1 
ATOM   3785  N  N   . LEU B  2  151 ? 110.606 65.159  26.805  1.00 19.73  ? 151  LEU L N   1 
ATOM   3786  C  CA  . LEU B  2  151 ? 110.694 63.709  26.651  1.00 21.16  ? 151  LEU L CA  1 
ATOM   3787  C  C   . LEU B  2  151 ? 109.402 63.063  26.153  1.00 20.70  ? 151  LEU L C   1 
ATOM   3788  O  O   . LEU B  2  151 ? 109.437 62.092  25.402  1.00 22.56  ? 151  LEU L O   1 
ATOM   3789  C  CB  . LEU B  2  151 ? 111.116 63.057  27.970  1.00 20.98  ? 151  LEU L CB  1 
ATOM   3790  C  CG  . LEU B  2  151 ? 112.570 63.309  28.376  1.00 23.45  ? 151  LEU L CG  1 
ATOM   3791  C  CD1 . LEU B  2  151 ? 112.872 62.630  29.695  1.00 22.67  ? 151  LEU L CD1 1 
ATOM   3792  C  CD2 . LEU B  2  151 ? 113.498 62.790  27.291  1.00 23.33  ? 151  LEU L CD2 1 
ATOM   3793  N  N   . SER B  2  152 ? 108.265 63.611  26.563  1.00 17.03  ? 152  SER L N   1 
ATOM   3794  C  CA  . SER B  2  152 ? 106.988 63.054  26.211  1.00 14.79  ? 152  SER L CA  1 
ATOM   3795  C  C   . SER B  2  152 ? 106.768 63.121  24.715  1.00 14.54  ? 152  SER L C   1 
ATOM   3796  O  O   . SER B  2  152 ? 106.135 62.231  24.151  1.00 15.19  ? 152  SER L O   1 
ATOM   3797  C  CB  . SER B  2  152 ? 105.873 63.801  26.940  1.00 15.74  ? 152  SER L CB  1 
ATOM   3798  O  OG  . SER B  2  152 ? 105.711 65.104  26.411  1.00 20.65  ? 152  SER L OG  1 
ATOM   3799  N  N   . HIS B  2  153 ? 107.334 64.133  24.055  1.00 13.34  ? 153  HIS L N   1 
ATOM   3800  C  CA  . HIS B  2  153 ? 107.175 64.231  22.606  1.00 14.15  ? 153  HIS L CA  1 
ATOM   3801  C  C   . HIS B  2  153 ? 107.897 63.087  21.904  1.00 14.69  ? 153  HIS L C   1 
ATOM   3802  O  O   . HIS B  2  153 ? 107.392 62.580  20.899  1.00 16.48  ? 153  HIS L O   1 
ATOM   3803  C  CB  . HIS B  2  153 ? 107.523 65.663  22.041  1.00 11.76  ? 153  HIS L CB  1 
ATOM   3804  C  CG  . HIS B  2  153 ? 108.938 65.854  21.569  1.00 12.17  ? 153  HIS L CG  1 
ATOM   3805  N  ND1 . HIS B  2  153 ? 110.012 66.039  22.415  1.00 14.83  ? 153  HIS L ND1 1 
ATOM   3806  C  CD2 . HIS B  2  153 ? 109.405 66.165  20.334  1.00 12.83  ? 153  HIS L CD2 1 
ATOM   3807  C  CE1 . HIS B  2  153 ? 111.055 66.465  21.682  1.00 16.15  ? 153  HIS L CE1 1 
ATOM   3808  N  NE2 . HIS B  2  153 ? 110.733 66.560  20.409  1.00 15.88  ? 153  HIS L NE2 1 
ATOM   3809  N  N   . LEU B  2  154 ? 108.865 62.477  22.593  1.00 13.62  ? 154  LEU L N   1 
ATOM   3810  C  CA  . LEU B  2  154 ? 109.568 61.316  22.039  1.00 13.00  ? 154  LEU L CA  1 
ATOM   3811  C  C   . LEU B  2  154 ? 108.737 60.057  22.201  1.00 17.82  ? 154  LEU L C   1 
ATOM   3812  O  O   . LEU B  2  154 ? 108.690 59.220  21.297  1.00 19.03  ? 154  LEU L O   1 
ATOM   3813  C  CB  . LEU B  2  154 ? 110.910 61.115  22.719  1.00 9.94   ? 154  LEU L CB  1 
ATOM   3814  C  CG  . LEU B  2  154 ? 111.758 62.377  22.730  1.00 13.10  ? 154  LEU L CG  1 
ATOM   3815  C  CD1 . LEU B  2  154 ? 113.149 62.033  23.168  1.00 6.02   ? 154  LEU L CD1 1 
ATOM   3816  C  CD2 . LEU B  2  154 ? 111.751 63.014  21.357  1.00 6.64   ? 154  LEU L CD2 1 
ATOM   3817  N  N   . ASP B  2  155 ? 108.045 59.943  23.335  1.00 17.85  ? 155  ASP L N   1 
ATOM   3818  C  CA  . ASP B  2  155 ? 107.096 58.855  23.558  1.00 17.74  ? 155  ASP L CA  1 
ATOM   3819  C  C   . ASP B  2  155 ? 105.989 58.832  22.499  1.00 17.40  ? 155  ASP L C   1 
ATOM   3820  O  O   . ASP B  2  155 ? 105.598 57.761  22.050  1.00 15.65  ? 155  ASP L O   1 
ATOM   3821  C  CB  . ASP B  2  155 ? 106.480 58.978  24.943  1.00 13.97  ? 155  ASP L CB  1 
ATOM   3822  C  CG  . ASP B  2  155 ? 107.472 58.742  26.031  1.00 18.43  ? 155  ASP L CG  1 
ATOM   3823  O  OD1 . ASP B  2  155 ? 108.545 58.132  25.775  1.00 17.06  ? 155  ASP L OD1 1 
ATOM   3824  O  OD2 . ASP B  2  155 ? 107.156 59.130  27.164  1.00 15.81  ? 155  ASP L OD2 1 
ATOM   3825  N  N   . TRP B  2  156 ? 105.560 60.014  22.047  1.00 15.85  ? 156  TRP L N   1 
ATOM   3826  C  CA  . TRP B  2  156 ? 104.593 60.126  20.957  1.00 14.82  ? 156  TRP L CA  1 
ATOM   3827  C  C   . TRP B  2  156 ? 105.221 59.650  19.650  1.00 16.18  ? 156  TRP L C   1 
ATOM   3828  O  O   . TRP B  2  156 ? 104.658 58.779  18.993  1.00 21.28  ? 156  TRP L O   1 
ATOM   3829  C  CB  . TRP B  2  156 ? 104.087 61.570  20.807  1.00 15.58  ? 156  TRP L CB  1 
ATOM   3830  C  CG  . TRP B  2  156 ? 103.119 61.797  19.656  1.00 15.48  ? 156  TRP L CG  1 
ATOM   3831  C  CD1 . TRP B  2  156 ? 101.761 61.698  19.698  1.00 13.69  ? 156  TRP L CD1 1 
ATOM   3832  C  CD2 . TRP B  2  156 ? 103.442 62.227  18.324  1.00 20.06  ? 156  TRP L CD2 1 
ATOM   3833  N  NE1 . TRP B  2  156 ? 101.217 62.065  18.495  1.00 14.38  ? 156  TRP L NE1 1 
ATOM   3834  C  CE2 . TRP B  2  156 ? 102.224 62.393  17.632  1.00 17.31  ? 156  TRP L CE2 1 
ATOM   3835  C  CE3 . TRP B  2  156 ? 104.643 62.496  17.652  1.00 13.74  ? 156  TRP L CE3 1 
ATOM   3836  C  CZ2 . TRP B  2  156 ? 102.169 62.818  16.310  1.00 15.34  ? 156  TRP L CZ2 1 
ATOM   3837  C  CZ3 . TRP B  2  156 ? 104.586 62.922  16.343  1.00 11.11  ? 156  TRP L CZ3 1 
ATOM   3838  C  CH2 . TRP B  2  156 ? 103.360 63.079  15.683  1.00 12.66  ? 156  TRP L CH2 1 
ATOM   3839  N  N   . VAL B  2  157 ? 106.387 60.182  19.281  1.00 17.20  ? 157  VAL L N   1 
ATOM   3840  C  CA  . VAL B  2  157 ? 107.106 59.699  18.096  1.00 16.68  ? 157  VAL L CA  1 
ATOM   3841  C  C   . VAL B  2  157 ? 107.287 58.167  18.096  1.00 17.37  ? 157  VAL L C   1 
ATOM   3842  O  O   . VAL B  2  157 ? 106.843 57.479  17.166  1.00 19.36  ? 157  VAL L O   1 
ATOM   3843  C  CB  . VAL B  2  157 ? 108.474 60.379  17.962  1.00 16.82  ? 157  VAL L CB  1 
ATOM   3844  C  CG1 . VAL B  2  157 ? 109.218 59.818  16.784  1.00 12.16  ? 157  VAL L CG1 1 
ATOM   3845  C  CG2 . VAL B  2  157 ? 108.287 61.865  17.778  1.00 13.65  ? 157  VAL L CG2 1 
ATOM   3846  N  N   . ASN B  2  158 ? 107.705 57.636  19.236  1.00 14.86  ? 158  ASN L N   1 
ATOM   3847  C  CA  . ASN B  2  158 ? 107.848 56.200  19.433  1.00 12.62  ? 158  ASN L CA  1 
ATOM   3848  C  C   . ASN B  2  158 ? 106.565 55.442  19.106  1.00 15.37  ? 158  ASN L C   1 
ATOM   3849  O  O   . ASN B  2  158 ? 106.535 54.577  18.239  1.00 21.26  ? 158  ASN L O   1 
ATOM   3850  C  CB  . ASN B  2  158 ? 108.229 55.940  20.882  1.00 15.66  ? 158  ASN L CB  1 
ATOM   3851  C  CG  . ASN B  2  158 ? 108.866 54.598  21.092  1.00 12.56  ? 158  ASN L CG  1 
ATOM   3852  O  OD1 . ASN B  2  158 ? 109.136 53.870  20.157  1.00 17.31  ? 158  ASN L OD1 1 
ATOM   3853  N  ND2 . ASN B  2  158 ? 109.128 54.271  22.335  1.00 19.11  ? 158  ASN L ND2 1 
ATOM   3854  N  N   . ASN B  2  159 ? 105.488 55.772  19.787  1.00 16.98  ? 159  ASN L N   1 
ATOM   3855  C  CA  . ASN B  2  159 ? 104.248 55.022  19.615  1.00 19.40  ? 159  ASN L CA  1 
ATOM   3856  C  C   . ASN B  2  159 ? 103.648 55.178  18.219  1.00 21.91  ? 159  ASN L C   1 
ATOM   3857  O  O   . ASN B  2  159 ? 103.143 54.215  17.630  1.00 25.05  ? 159  ASN L O   1 
ATOM   3858  C  CB  . ASN B  2  159 ? 103.238 55.458  20.665  1.00 15.95  ? 159  ASN L CB  1 
ATOM   3859  C  CG  . ASN B  2  159 ? 103.475 54.795  21.999  1.00 17.42  ? 159  ASN L CG  1 
ATOM   3860  O  OD1 . ASN B  2  159 ? 103.602 53.574  22.072  1.00 18.04  ? 159  ASN L OD1 1 
ATOM   3861  N  ND2 . ASN B  2  159 ? 103.578 55.591  23.058  1.00 16.83  ? 159  ASN L ND2 1 
ATOM   3862  N  N   . PHE B  2  160 ? 103.750 56.386  17.672  1.00 21.06  ? 160  PHE L N   1 
ATOM   3863  C  CA  . PHE B  2  160 ? 103.278 56.679  16.322  1.00 17.08  ? 160  PHE L CA  1 
ATOM   3864  C  C   . PHE B  2  160 ? 104.023 55.762  15.359  1.00 17.55  ? 160  PHE L C   1 
ATOM   3865  O  O   . PHE B  2  160 ? 103.426 55.112  14.502  1.00 18.00  ? 160  PHE L O   1 
ATOM   3866  C  CB  . PHE B  2  160 ? 103.555 58.151  16.028  1.00 13.82  ? 160  PHE L CB  1 
ATOM   3867  C  CG  . PHE B  2  160 ? 103.054 58.642  14.700  1.00 15.20  ? 160  PHE L CG  1 
ATOM   3868  C  CD1 . PHE B  2  160 ? 102.501 57.783  13.758  1.00 17.80  ? 160  PHE L CD1 1 
ATOM   3869  C  CD2 . PHE B  2  160 ? 103.254 59.972  14.348  1.00 13.31  ? 160  PHE L CD2 1 
ATOM   3870  C  CE1 . PHE B  2  160 ? 102.178 58.234  12.476  1.00 19.80  ? 160  PHE L CE1 1 
ATOM   3871  C  CE2 . PHE B  2  160 ? 102.936 60.431  13.086  1.00 16.23  ? 160  PHE L CE2 1 
ATOM   3872  C  CZ  . PHE B  2  160 ? 102.400 59.561  12.137  1.00 15.42  ? 160  PHE L CZ  1 
ATOM   3873  N  N   . GLY B  2  161 ? 105.316 55.620  15.573  1.00 15.92  ? 161  GLY L N   1 
ATOM   3874  C  CA  . GLY B  2  161 ? 106.080 54.767  14.692  1.00 18.20  ? 161  GLY L CA  1 
ATOM   3875  C  C   . GLY B  2  161 ? 105.582 53.343  14.771  1.00 16.88  ? 161  GLY L C   1 
ATOM   3876  O  O   . GLY B  2  161 ? 105.189 52.779  13.771  1.00 17.51  ? 161  GLY L O   1 
ATOM   3877  N  N   . TYR B  2  162 ? 105.431 52.824  15.981  1.00 19.50  ? 162  TYR L N   1 
ATOM   3878  C  CA  . TYR B  2  162 ? 105.071 51.425  16.158  1.00 18.34  ? 162  TYR L CA  1 
ATOM   3879  C  C   . TYR B  2  162 ? 103.603 51.109  15.880  1.00 17.11  ? 162  TYR L C   1 
ATOM   3880  O  O   . TYR B  2  162 ? 103.248 49.949  15.674  1.00 18.38  ? 162  TYR L O   1 
ATOM   3881  C  CB  . TYR B  2  162 ? 105.462 50.954  17.554  1.00 20.14  ? 162  TYR L CB  1 
ATOM   3882  C  CG  . TYR B  2  162 ? 106.946 50.659  17.697  1.00 22.83  ? 162  TYR L CG  1 
ATOM   3883  C  CD1 . TYR B  2  162 ? 107.542 49.597  17.000  1.00 18.71  ? 162  TYR L CD1 1 
ATOM   3884  C  CD2 . TYR B  2  162 ? 107.735 51.379  18.597  1.00 19.01  ? 162  TYR L CD2 1 
ATOM   3885  C  CE1 . TYR B  2  162 ? 108.870 49.247  17.216  1.00 16.78  ? 162  TYR L CE1 1 
ATOM   3886  C  CE2 . TYR B  2  162 ? 109.070 51.041  18.806  1.00 19.61  ? 162  TYR L CE2 1 
ATOM   3887  C  CZ  . TYR B  2  162 ? 109.624 49.969  18.127  1.00 15.98  ? 162  TYR L CZ  1 
ATOM   3888  O  OH  . TYR B  2  162 ? 110.896 49.564  18.454  1.00 17.95  ? 162  TYR L OH  1 
ATOM   3889  N  N   . GLN B  2  163 ? 102.776 52.137  15.731  1.00 10.57  ? 163  GLN L N   1 
ATOM   3890  C  CA  . GLN B  2  163 ? 101.440 51.936  15.183  1.00 12.88  ? 163  GLN L CA  1 
ATOM   3891  C  C   . GLN B  2  163 ? 101.441 51.301  13.788  1.00 11.90  ? 163  GLN L C   1 
ATOM   3892  O  O   . GLN B  2  163 ? 100.524 50.571  13.421  1.00 15.66  ? 163  GLN L O   1 
ATOM   3893  C  CB  . GLN B  2  163 ? 100.666 53.253  15.163  1.00 7.02   ? 163  GLN L CB  1 
ATOM   3894  C  CG  . GLN B  2  163 ? 99.940  53.540  16.468  1.00 8.54   ? 163  GLN L CG  1 
ATOM   3895  C  CD  . GLN B  2  163 ? 99.226  54.849  16.421  1.00 15.74  ? 163  GLN L CD  1 
ATOM   3896  O  OE1 . GLN B  2  163 ? 99.787  55.842  15.988  1.00 18.04  ? 163  GLN L OE1 1 
ATOM   3897  N  NE2 . GLN B  2  163 ? 97.965  54.859  16.820  1.00 20.57  ? 163  GLN L NE2 1 
ATOM   3898  N  N   . TYR B  2  164 ? 102.526 51.479  13.065  1.00 9.61   ? 164  TYR L N   1 
ATOM   3899  C  CA  . TYR B  2  164 ? 102.634 50.912  11.750  1.00 10.78  ? 164  TYR L CA  1 
ATOM   3900  C  C   . TYR B  2  164 ? 103.720 49.869  11.760  1.00 12.83  ? 164  TYR L C   1 
ATOM   3901  O  O   . TYR B  2  164 ? 104.434 49.685  10.777  1.00 15.18  ? 164  TYR L O   1 
ATOM   3902  C  CB  . TYR B  2  164 ? 102.914 52.013  10.737  1.00 13.01  ? 164  TYR L CB  1 
ATOM   3903  C  CG  . TYR B  2  164 ? 101.847 53.069  10.783  1.00 12.86  ? 164  TYR L CG  1 
ATOM   3904  C  CD1 . TYR B  2  164 ? 101.872 54.059  11.758  1.00 18.21  ? 164  TYR L CD1 1 
ATOM   3905  C  CD2 . TYR B  2  164 ? 100.716 52.973  9.988   1.00 12.87  ? 164  TYR L CD2 1 
ATOM   3906  C  CE1 . TYR B  2  164 ? 100.782 54.921  11.956  1.00 16.86  ? 164  TYR L CE1 1 
ATOM   3907  C  CE2 . TYR B  2  164 ? 99.619  53.840  10.167  1.00 12.63  ? 164  TYR L CE2 1 
ATOM   3908  C  CZ  . TYR B  2  164 ? 99.661  54.797  11.156  1.00 15.87  ? 164  TYR L CZ  1 
ATOM   3909  O  OH  . TYR B  2  164 ? 98.576  55.606  11.395  1.00 21.31  ? 164  TYR L OH  1 
ATOM   3910  N  N   . LEU B  2  165 ? 103.794 49.165  12.886  1.00 15.98  ? 165  LEU L N   1 
ATOM   3911  C  CA  . LEU B  2  165 ? 104.629 47.985  13.087  1.00 15.72  ? 165  LEU L CA  1 
ATOM   3912  C  C   . LEU B  2  165 ? 106.125 48.220  12.962  1.00 16.64  ? 165  LEU L C   1 
ATOM   3913  O  O   . LEU B  2  165 ? 106.857 47.856  13.865  1.00 22.93  ? 165  LEU L O   1 
ATOM   3914  C  CB  . LEU B  2  165 ? 104.190 46.845  12.174  1.00 15.68  ? 165  LEU L CB  1 
ATOM   3915  C  CG  . LEU B  2  165 ? 102.694 46.531  12.221  1.00 16.33  ? 165  LEU L CG  1 
ATOM   3916  C  CD1 . LEU B  2  165 ? 102.396 45.309  11.355  1.00 11.98  ? 165  LEU L CD1 1 
ATOM   3917  C  CD2 . LEU B  2  165 ? 102.258 46.315  13.637  1.00 12.25  ? 165  LEU L CD2 1 
ATOM   3918  N  N   . ASN B  2  166 ? 106.598 48.685  11.808  1.00 18.39  ? 166  ASN L N   1 
ATOM   3919  C  CA  . ASN B  2  166 ? 107.987 49.150  11.667  1.00 18.04  ? 166  ASN L CA  1 
ATOM   3920  C  C   . ASN B  2  166 ? 108.090 50.384  10.773  1.00 18.14  ? 166  ASN L C   1 
ATOM   3921  O  O   . ASN B  2  166 ? 108.285 50.276  9.560   1.00 24.78  ? 166  ASN L O   1 
ATOM   3922  C  CB  . ASN B  2  166 ? 108.926 48.057  11.124  1.00 14.21  ? 166  ASN L CB  1 
ATOM   3923  C  CG  . ASN B  2  166 ? 110.403 48.369  11.400  1.00 15.63  ? 166  ASN L CG  1 
ATOM   3924  O  OD1 . ASN B  2  166 ? 110.832 49.517  11.309  1.00 19.91  ? 166  ASN L OD1 1 
ATOM   3925  N  ND2 . ASN B  2  166 ? 111.151 47.371  11.834  1.00 15.48  ? 166  ASN L ND2 1 
ATOM   3926  N  N   . TRP B  2  167 ? 108.164 51.543  11.413  1.00 17.64  ? 167  TRP L N   1 
ATOM   3927  C  CA  . TRP B  2  167 ? 108.175 52.808  10.720  1.00 12.89  ? 167  TRP L CA  1 
ATOM   3928  C  C   . TRP B  2  167 ? 109.375 52.939  9.780   1.00 15.51  ? 167  TRP L C   1 
ATOM   3929  O  O   . TRP B  2  167 ? 109.362 53.766  8.875   1.00 13.83  ? 167  TRP L O   1 
ATOM   3930  C  CB  . TRP B  2  167 ? 108.203 53.919  11.736  1.00 10.58  ? 167  TRP L CB  1 
ATOM   3931  C  CG  . TRP B  2  167 ? 108.012 55.258  11.148  1.00 14.68  ? 167  TRP L CG  1 
ATOM   3932  C  CD1 . TRP B  2  167 ? 108.981 56.187  10.880  1.00 16.00  ? 167  TRP L CD1 1 
ATOM   3933  C  CD2 . TRP B  2  167 ? 106.761 55.894  10.884  1.00 13.07  ? 167  TRP L CD2 1 
ATOM   3934  N  NE1 . TRP B  2  167 ? 108.400 57.372  10.480  1.00 19.63  ? 167  TRP L NE1 1 
ATOM   3935  C  CE2 . TRP B  2  167 ? 107.040 57.213  10.461  1.00 13.69  ? 167  TRP L CE2 1 
ATOM   3936  C  CE3 . TRP B  2  167 ? 105.433 55.487  10.991  1.00 10.88  ? 167  TRP L CE3 1 
ATOM   3937  C  CZ2 . TRP B  2  167 ? 106.048 58.116  10.137  1.00 12.64  ? 167  TRP L CZ2 1 
ATOM   3938  C  CZ3 . TRP B  2  167 ? 104.439 56.395  10.684  1.00 18.33  ? 167  TRP L CZ3 1 
ATOM   3939  C  CH2 . TRP B  2  167 ? 104.753 57.697  10.258  1.00 17.02  ? 167  TRP L CH2 1 
ATOM   3940  N  N   . HIS B  2  168 ? 110.402 52.111  9.976   1.00 17.22  ? 168  HIS L N   1 
ATOM   3941  C  CA  . HIS B  2  168 ? 111.627 52.228  9.178   1.00 19.77  ? 168  HIS L CA  1 
ATOM   3942  C  C   . HIS B  2  168 ? 111.376 51.876  7.734   1.00 20.82  ? 168  HIS L C   1 
ATOM   3943  O  O   . HIS B  2  168 ? 112.087 52.362  6.858   1.00 22.18  ? 168  HIS L O   1 
ATOM   3944  C  CB  . HIS B  2  168 ? 112.732 51.325  9.713   1.00 21.58  ? 168  HIS L CB  1 
ATOM   3945  C  CG  . HIS B  2  168 ? 113.524 51.925  10.833  1.00 24.25  ? 168  HIS L CG  1 
ATOM   3946  N  ND1 . HIS B  2  168 ? 113.681 51.300  12.053  1.00 24.35  ? 168  HIS L ND1 1 
ATOM   3947  C  CD2 . HIS B  2  168 ? 114.244 53.071  10.902  1.00 22.49  ? 168  HIS L CD2 1 
ATOM   3948  C  CE1 . HIS B  2  168 ? 114.468 52.029  12.823  1.00 22.85  ? 168  HIS L CE1 1 
ATOM   3949  N  NE2 . HIS B  2  168 ? 114.821 53.110  12.149  1.00 22.59  ? 168  HIS L NE2 1 
ATOM   3950  N  N   . TYR B  2  169 ? 110.352 51.058  7.487   1.00 19.14  ? 169  TYR L N   1 
ATOM   3951  C  CA  . TYR B  2  169 ? 110.028 50.644  6.138   1.00 16.18  ? 169  TYR L CA  1 
ATOM   3952  C  C   . TYR B  2  169 ? 109.135 51.647  5.431   1.00 18.46  ? 169  TYR L C   1 
ATOM   3953  O  O   . TYR B  2  169 ? 108.666 51.380  4.341   1.00 20.25  ? 169  TYR L O   1 
ATOM   3954  C  CB  . TYR B  2  169 ? 109.342 49.286  6.162   1.00 18.86  ? 169  TYR L CB  1 
ATOM   3955  C  CG  . TYR B  2  169 ? 110.230 48.122  6.548   1.00 17.19  ? 169  TYR L CG  1 
ATOM   3956  C  CD1 . TYR B  2  169 ? 110.889 48.095  7.768   1.00 18.12  ? 169  TYR L CD1 1 
ATOM   3957  C  CD2 . TYR B  2  169 ? 110.339 47.009  5.726   1.00 20.64  ? 169  TYR L CD2 1 
ATOM   3958  C  CE1 . TYR B  2  169 ? 111.629 46.984  8.157   1.00 15.18  ? 169  TYR L CE1 1 
ATOM   3959  C  CE2 . TYR B  2  169 ? 111.074 45.895  6.107   1.00 14.36  ? 169  TYR L CE2 1 
ATOM   3960  C  CZ  . TYR B  2  169 ? 111.712 45.888  7.329   1.00 15.32  ? 169  TYR L CZ  1 
ATOM   3961  O  OH  . TYR B  2  169 ? 112.388 44.750  7.742   1.00 16.94  ? 169  TYR L OH  1 
ATOM   3962  N  N   . ASN B  2  170 ? 108.826 52.767  6.080   1.00 21.47  ? 170  ASN L N   1 
ATOM   3963  C  CA  . ASN B  2  170 ? 107.965 53.799  5.487   1.00 19.40  ? 170  ASN L CA  1 
ATOM   3964  C  C   . ASN B  2  170 ? 108.772 54.510  4.403   1.00 21.92  ? 170  ASN L C   1 
ATOM   3965  O  O   . ASN B  2  170 ? 109.793 55.144  4.693   1.00 27.66  ? 170  ASN L O   1 
ATOM   3966  C  CB  . ASN B  2  170 ? 107.517 54.780  6.596   1.00 20.01  ? 170  ASN L CB  1 
ATOM   3967  C  CG  . ASN B  2  170 ? 106.725 55.981  6.078   1.00 19.13  ? 170  ASN L CG  1 
ATOM   3968  O  OD1 . ASN B  2  170 ? 106.883 56.429  4.939   1.00 23.18  ? 170  ASN L OD1 1 
ATOM   3969  N  ND2 . ASN B  2  170 ? 105.993 56.601  6.977   1.00 23.12  ? 170  ASN L ND2 1 
ATOM   3970  N  N   . PRO B  2  171 ? 108.378 54.356  3.125   1.00 22.92  ? 171  PRO L N   1 
ATOM   3971  C  CA  . PRO B  2  171 ? 109.136 54.944  2.019   1.00 22.77  ? 171  PRO L CA  1 
ATOM   3972  C  C   . PRO B  2  171 ? 109.365 56.458  2.137   1.00 22.67  ? 171  PRO L C   1 
ATOM   3973  O  O   . PRO B  2  171 ? 110.476 56.930  1.920   1.00 26.14  ? 171  PRO L O   1 
ATOM   3974  C  CB  . PRO B  2  171 ? 108.309 54.571  0.789   1.00 22.51  ? 171  PRO L CB  1 
ATOM   3975  C  CG  . PRO B  2  171 ? 106.950 54.245  1.341   1.00 22.75  ? 171  PRO L CG  1 
ATOM   3976  C  CD  . PRO B  2  171 ? 107.247 53.563  2.616   1.00 22.04  ? 171  PRO L CD  1 
ATOM   3977  N  N   . GLY B  2  172 ? 108.353 57.207  2.566   1.00 22.14  ? 172  GLY L N   1 
ATOM   3978  C  CA  . GLY B  2  172 ? 108.584 58.593  2.942   1.00 18.02  ? 172  GLY L CA  1 
ATOM   3979  C  C   . GLY B  2  172 ? 109.658 58.775  4.020   1.00 22.71  ? 172  GLY L C   1 
ATOM   3980  O  O   . GLY B  2  172 ? 110.486 59.688  3.943   1.00 23.01  ? 172  GLY L O   1 
ATOM   3981  N  N   . HIS B  2  173 ? 109.663 57.911  5.031   1.00 21.19  ? 173  HIS L N   1 
ATOM   3982  C  CA  . HIS B  2  173 ? 110.699 57.964  6.048   1.00 19.70  ? 173  HIS L CA  1 
ATOM   3983  C  C   . HIS B  2  173 ? 112.078 57.660  5.472   1.00 20.66  ? 173  HIS L C   1 
ATOM   3984  O  O   . HIS B  2  173 ? 113.030 58.397  5.710   1.00 22.29  ? 173  HIS L O   1 
ATOM   3985  C  CB  . HIS B  2  173 ? 110.406 56.990  7.169   1.00 21.43  ? 173  HIS L CB  1 
ATOM   3986  C  CG  . HIS B  2  173 ? 111.192 57.256  8.416   1.00 23.56  ? 173  HIS L CG  1 
ATOM   3987  N  ND1 . HIS B  2  173 ? 112.206 56.447  8.878   1.00 13.67  ? 173  HIS L ND1 1 
ATOM   3988  C  CD2 . HIS B  2  173 ? 111.022 58.211  9.368   1.00 19.91  ? 173  HIS L CD2 1 
ATOM   3989  C  CE1 . HIS B  2  173 ? 112.589 56.913  10.063  1.00 17.63  ? 173  HIS L CE1 1 
ATOM   3990  N  NE2 . HIS B  2  173 ? 111.893 57.984  10.411  1.00 18.23  ? 173  HIS L NE2 1 
ATOM   3991  N  N   . MET B  2  174 ? 112.181 56.632  4.647   1.00 17.68  ? 174  MET L N   1 
ATOM   3992  C  CA  . MET B  2  174 ? 113.473 56.288  4.068   1.00 16.94  ? 174  MET L CA  1 
ATOM   3993  C  C   . MET B  2  174 ? 114.090 57.449  3.290   1.00 18.44  ? 174  MET L C   1 
ATOM   3994  O  O   . MET B  2  174 ? 115.264 57.762  3.436   1.00 19.69  ? 174  MET L O   1 
ATOM   3995  C  CB  . MET B  2  174 ? 113.315 55.094  3.155   1.00 18.91  ? 174  MET L CB  1 
ATOM   3996  C  CG  . MET B  2  174 ? 112.934 53.823  3.869   1.00 18.97  ? 174  MET L CG  1 
ATOM   3997  S  SD  . MET B  2  174 ? 112.036 52.708  2.757   1.00 28.47  ? 174  MET L SD  1 
ATOM   3998  C  CE  . MET B  2  174 ? 113.318 52.247  1.604   1.00 18.35  ? 174  MET L CE  1 
ATOM   3999  N  N   . SER B  2  175 ? 113.258 58.169  2.556   1.00 21.08  ? 175  SER L N   1 
ATOM   4000  C  CA  . SER B  2  175 ? 113.726 59.319  1.815   1.00 19.28  ? 175  SER L CA  1 
ATOM   4001  C  C   . SER B  2  175 ? 114.177 60.389  2.789   1.00 21.51  ? 175  SER L C   1 
ATOM   4002  O  O   . SER B  2  175 ? 115.238 60.977  2.620   1.00 26.79  ? 175  SER L O   1 
ATOM   4003  C  CB  . SER B  2  175 ? 112.605 59.867  0.950   1.00 21.92  ? 175  SER L CB  1 
ATOM   4004  O  OG  . SER B  2  175 ? 113.025 61.070  0.336   1.00 31.56  ? 175  SER L OG  1 
ATOM   4005  N  N   . SER B  2  176 ? 113.382 60.609  3.830   1.00 19.17  ? 176  SER L N   1 
ATOM   4006  C  CA  . SER B  2  176 ? 113.694 61.590  4.853   1.00 17.73  ? 176  SER L CA  1 
ATOM   4007  C  C   . SER B  2  176 ? 115.048 61.356  5.537   1.00 18.34  ? 176  SER L C   1 
ATOM   4008  O  O   . SER B  2  176 ? 115.885 62.263  5.613   1.00 20.72  ? 176  SER L O   1 
ATOM   4009  C  CB  . SER B  2  176 ? 112.605 61.581  5.900   1.00 18.79  ? 176  SER L CB  1 
ATOM   4010  O  OG  . SER B  2  176 ? 112.635 62.800  6.584   1.00 28.23  ? 176  SER L OG  1 
ATOM   4011  N  N   . VAL B  2  177 ? 115.235 60.161  6.086   1.00 15.02  ? 177  VAL L N   1 
ATOM   4012  C  CA  . VAL B  2  177 ? 116.492 59.770  6.719   1.00 12.21  ? 177  VAL L CA  1 
ATOM   4013  C  C   . VAL B  2  177 ? 117.691 59.978  5.802   1.00 14.95  ? 177  VAL L C   1 
ATOM   4014  O  O   . VAL B  2  177 ? 118.736 60.461  6.223   1.00 19.01  ? 177  VAL L O   1 
ATOM   4015  C  CB  . VAL B  2  177 ? 116.436 58.311  7.117   1.00 7.16   ? 177  VAL L CB  1 
ATOM   4016  C  CG1 . VAL B  2  177 ? 117.809 57.820  7.487   1.00 3.00   ? 177  VAL L CG1 1 
ATOM   4017  C  CG2 . VAL B  2  177 ? 115.444 58.145  8.262   1.00 3.54   ? 177  VAL L CG2 1 
ATOM   4018  N  N   . SER B  2  178 ? 117.540 59.613  4.542   1.00 15.45  ? 178  SER L N   1 
ATOM   4019  C  CA  . SER B  2  178 ? 118.641 59.727  3.610   1.00 18.48  ? 178  SER L CA  1 
ATOM   4020  C  C   . SER B  2  178 ? 119.031 61.170  3.443   1.00 18.72  ? 178  SER L C   1 
ATOM   4021  O  O   . SER B  2  178 ? 120.204 61.511  3.517   1.00 21.33  ? 178  SER L O   1 
ATOM   4022  C  CB  . SER B  2  178 ? 118.249 59.139  2.266   1.00 20.95  ? 178  SER L CB  1 
ATOM   4023  O  OG  . SER B  2  178 ? 117.696 57.849  2.455   1.00 26.82  ? 178  SER L OG  1 
ATOM   4024  N  N   . PHE B  2  179 ? 118.054 62.042  3.269   1.00 19.42  ? 179  PHE L N   1 
ATOM   4025  C  CA  . PHE B  2  179 ? 118.375 63.458  3.226   1.00 21.76  ? 179  PHE L CA  1 
ATOM   4026  C  C   . PHE B  2  179 ? 119.016 63.939  4.524   1.00 22.64  ? 179  PHE L C   1 
ATOM   4027  O  O   . PHE B  2  179 ? 119.997 64.680  4.490   1.00 24.21  ? 179  PHE L O   1 
ATOM   4028  C  CB  . PHE B  2  179 ? 117.139 64.280  2.917   1.00 18.67  ? 179  PHE L CB  1 
ATOM   4029  C  CG  . PHE B  2  179 ? 116.815 64.313  1.480   1.00 21.43  ? 179  PHE L CG  1 
ATOM   4030  C  CD1 . PHE B  2  179 ? 117.662 64.953  0.590   1.00 24.33  ? 179  PHE L CD1 1 
ATOM   4031  C  CD2 . PHE B  2  179 ? 115.702 63.648  0.993   1.00 21.58  ? 179  PHE L CD2 1 
ATOM   4032  C  CE1 . PHE B  2  179 ? 117.402 64.934  -0.773  1.00 22.27  ? 179  PHE L CE1 1 
ATOM   4033  C  CE2 . PHE B  2  179 ? 115.437 63.622  -0.356  1.00 21.36  ? 179  PHE L CE2 1 
ATOM   4034  C  CZ  . PHE B  2  179 ? 116.290 64.269  -1.246  1.00 18.54  ? 179  PHE L CZ  1 
ATOM   4035  N  N   . LEU B  2  180 ? 118.521 63.464  5.662   1.00 22.31  ? 180  LEU L N   1 
ATOM   4036  C  CA  . LEU B  2  180 ? 119.090 63.873  6.940   1.00 21.85  ? 180  LEU L CA  1 
ATOM   4037  C  C   . LEU B  2  180 ? 120.575 63.505  7.002   1.00 22.98  ? 180  LEU L C   1 
ATOM   4038  O  O   . LEU B  2  180 ? 121.395 64.319  7.449   1.00 25.56  ? 180  LEU L O   1 
ATOM   4039  C  CB  . LEU B  2  180 ? 118.342 63.224  8.110   1.00 15.70  ? 180  LEU L CB  1 
ATOM   4040  C  CG  . LEU B  2  180 ? 118.930 63.571  9.474   1.00 11.39  ? 180  LEU L CG  1 
ATOM   4041  C  CD1 . LEU B  2  180 ? 118.429 64.947  9.904   1.00 7.62   ? 180  LEU L CD1 1 
ATOM   4042  C  CD2 . LEU B  2  180 ? 118.540 62.520  10.485  1.00 10.91  ? 180  LEU L CD2 1 
ATOM   4043  N  N   . PHE B  2  181 ? 120.925 62.317  6.497   1.00 22.33  ? 181  PHE L N   1 
ATOM   4044  C  CA  . PHE B  2  181 ? 122.313 61.812  6.551   1.00 21.94  ? 181  PHE L CA  1 
ATOM   4045  C  C   . PHE B  2  181 ? 123.222 62.459  5.471   1.00 22.74  ? 181  PHE L C   1 
ATOM   4046  O  O   . PHE B  2  181 ? 124.363 62.827  5.752   1.00 22.73  ? 181  PHE L O   1 
ATOM   4047  C  CB  . PHE B  2  181 ? 122.350 60.296  6.353   1.00 16.04  ? 181  PHE L CB  1 
ATOM   4048  C  CG  . PHE B  2  181 ? 121.751 59.473  7.487   1.00 16.58  ? 181  PHE L CG  1 
ATOM   4049  C  CD1 . PHE B  2  181 ? 121.405 60.034  8.698   1.00 21.00  ? 181  PHE L CD1 1 
ATOM   4050  C  CD2 . PHE B  2  181 ? 121.628 58.098  7.350   1.00 13.76  ? 181  PHE L CD2 1 
ATOM   4051  C  CE1 . PHE B  2  181 ? 120.953 59.232  9.757   1.00 18.86  ? 181  PHE L CE1 1 
ATOM   4052  C  CE2 . PHE B  2  181 ? 121.191 57.302  8.396   1.00 19.50  ? 181  PHE L CE2 1 
ATOM   4053  C  CZ  . PHE B  2  181 ? 120.855 57.869  9.599   1.00 18.33  ? 181  PHE L CZ  1 
ATOM   4054  N  N   . VAL B  2  182 ? 122.729 62.594  4.240   1.00 23.25  ? 182  VAL L N   1 
ATOM   4055  C  CA  . VAL B  2  182 ? 123.496 63.296  3.199   1.00 25.27  ? 182  VAL L CA  1 
ATOM   4056  C  C   . VAL B  2  182 ? 123.838 64.705  3.657   1.00 23.81  ? 182  VAL L C   1 
ATOM   4057  O  O   . VAL B  2  182 ? 124.959 65.179  3.461   1.00 22.29  ? 182  VAL L O   1 
ATOM   4058  C  CB  . VAL B  2  182 ? 122.734 63.465  1.869   1.00 24.88  ? 182  VAL L CB  1 
ATOM   4059  C  CG1 . VAL B  2  182 ? 123.691 63.971  0.796   1.00 27.12  ? 182  VAL L CG1 1 
ATOM   4060  C  CG2 . VAL B  2  182 ? 122.147 62.179  1.444   1.00 29.86  ? 182  VAL L CG2 1 
ATOM   4061  N  N   . ASN B  2  183 ? 122.836 65.404  4.178   1.00 19.66  ? 183  ASN L N   1 
ATOM   4062  C  CA  . ASN B  2  183 ? 122.992 66.804  4.483   1.00 17.78  ? 183  ASN L CA  1 
ATOM   4063  C  C   . ASN B  2  183 ? 123.984 67.010  5.591   1.00 19.93  ? 183  ASN L C   1 
ATOM   4064  O  O   . ASN B  2  183 ? 124.826 67.898  5.500   1.00 20.19  ? 183  ASN L O   1 
ATOM   4065  C  CB  . ASN B  2  183 ? 121.675 67.416  4.877   1.00 22.25  ? 183  ASN L CB  1 
ATOM   4066  C  CG  . ASN B  2  183 ? 121.827 68.841  5.286   1.00 22.16  ? 183  ASN L CG  1 
ATOM   4067  O  OD1 . ASN B  2  183 ? 121.919 69.138  6.472   1.00 32.65  ? 183  ASN L OD1 1 
ATOM   4068  N  ND2 . ASN B  2  183 ? 121.956 69.724  4.313   1.00 18.96  ? 183  ASN L ND2 1 
ATOM   4069  N  N   . ALA B  2  184 ? 123.942 66.119  6.580   1.00 23.00  ? 184  ALA L N   1 
ATOM   4070  C  CA  . ALA B  2  184 ? 124.895 66.118  7.691   1.00 21.02  ? 184  ALA L CA  1 
ATOM   4071  C  C   . ALA B  2  184 ? 126.302 65.930  7.165   1.00 19.46  ? 184  ALA L C   1 
ATOM   4072  O  O   . ALA B  2  184 ? 127.195 66.710  7.496   1.00 22.73  ? 184  ALA L O   1 
ATOM   4073  C  CB  . ALA B  2  184 ? 124.554 65.008  8.707   1.00 18.56  ? 184  ALA L CB  1 
ATOM   4074  N  N   . MET B  2  185 ? 126.481 64.943  6.292   1.00 19.27  ? 185  MET L N   1 
ATOM   4075  C  CA  . MET B  2  185 ? 127.771 64.716  5.644   1.00 16.76  ? 185  MET L CA  1 
ATOM   4076  C  C   . MET B  2  185 ? 128.227 65.909  4.798   1.00 15.62  ? 185  MET L C   1 
ATOM   4077  O  O   . MET B  2  185 ? 129.360 66.345  4.892   1.00 19.06  ? 185  MET L O   1 
ATOM   4078  C  CB  . MET B  2  185 ? 127.696 63.486  4.759   1.00 19.27  ? 185  MET L CB  1 
ATOM   4079  C  CG  . MET B  2  185 ? 128.828 63.414  3.771   1.00 28.34  ? 185  MET L CG  1 
ATOM   4080  S  SD  . MET B  2  185 ? 128.453 62.276  2.481   1.00 36.78  ? 185  MET L SD  1 
ATOM   4081  C  CE  . MET B  2  185 ? 129.804 62.583  1.352   1.00 39.95  ? 185  MET L CE  1 
ATOM   4082  N  N   . ALA B  2  186 ? 127.348 66.429  3.956   1.00 17.93  ? 186  ALA L N   1 
ATOM   4083  C  CA  . ALA B  2  186 ? 127.697 67.541  3.076   1.00 18.96  ? 186  ALA L CA  1 
ATOM   4084  C  C   . ALA B  2  186 ? 128.052 68.816  3.826   1.00 21.82  ? 186  ALA L C   1 
ATOM   4085  O  O   . ALA B  2  186 ? 128.857 69.608  3.342   1.00 27.21  ? 186  ALA L O   1 
ATOM   4086  C  CB  . ALA B  2  186 ? 126.568 67.821  2.118   1.00 17.26  ? 186  ALA L CB  1 
ATOM   4087  N  N   . LEU B  2  187 ? 127.347 69.090  4.920   1.00 21.80  ? 187  LEU L N   1 
ATOM   4088  C  CA  . LEU B  2  187 ? 127.689 70.217  5.781   1.00 20.60  ? 187  LEU L CA  1 
ATOM   4089  C  C   . LEU B  2  187 ? 129.084 70.008  6.351   1.00 19.46  ? 187  LEU L C   1 
ATOM   4090  O  O   . LEU B  2  187 ? 129.924 70.891  6.243   1.00 14.89  ? 187  LEU L O   1 
ATOM   4091  C  CB  . LEU B  2  187 ? 126.677 70.364  6.923   1.00 19.33  ? 187  LEU L CB  1 
ATOM   4092  C  CG  . LEU B  2  187 ? 126.932 71.550  7.847   1.00 16.46  ? 187  LEU L CG  1 
ATOM   4093  C  CD1 . LEU B  2  187 ? 127.078 72.808  7.010   1.00 13.31  ? 187  LEU L CD1 1 
ATOM   4094  C  CD2 . LEU B  2  187 ? 125.801 71.691  8.847   1.00 17.56  ? 187  LEU L CD2 1 
ATOM   4095  N  N   . GLY B  2  188 ? 129.377 68.781  6.770   1.00 18.25  ? 188  GLY L N   1 
ATOM   4096  C  CA  . GLY B  2  188 ? 130.731 68.443  7.167   1.00 16.96  ? 188  GLY L CA  1 
ATOM   4097  C  C   . GLY B  2  188 ? 131.737 68.711  6.067   1.00 17.75  ? 188  GLY L C   1 
ATOM   4098  O  O   . GLY B  2  188 ? 132.728 69.385  6.303   1.00 19.88  ? 188  GLY L O   1 
ATOM   4099  N  N   . LEU B  2  189 ? 131.469 68.234  4.855   1.00 17.11  ? 189  LEU L N   1 
ATOM   4100  C  CA  . LEU B  2  189 ? 132.409 68.392  3.757   1.00 16.03  ? 189  LEU L CA  1 
ATOM   4101  C  C   . LEU B  2  189 ? 132.569 69.852  3.380   1.00 19.55  ? 189  LEU L C   1 
ATOM   4102  O  O   . LEU B  2  189 ? 133.691 70.279  3.165   1.00 21.80  ? 189  LEU L O   1 
ATOM   4103  C  CB  . LEU B  2  189 ? 131.956 67.631  2.516   1.00 17.83  ? 189  LEU L CB  1 
ATOM   4104  C  CG  . LEU B  2  189 ? 131.993 66.111  2.463   1.00 22.32  ? 189  LEU L CG  1 
ATOM   4105  C  CD1 . LEU B  2  189 ? 131.389 65.669  1.150   1.00 14.99  ? 189  LEU L CD1 1 
ATOM   4106  C  CD2 . LEU B  2  189 ? 133.402 65.600  2.603   1.00 22.34  ? 189  LEU L CD2 1 
ATOM   4107  N  N   . HIS B  2  190 ? 131.461 70.586  3.177   1.00 20.94  ? 190  HIS L N   1 
ATOM   4108  C  CA  . HIS B  2  190 ? 131.539 72.018  2.811   1.00 22.00  ? 190  HIS L CA  1 
ATOM   4109  C  C   . HIS B  2  190 ? 132.269 72.872  3.858   1.00 27.92  ? 190  HIS L C   1 
ATOM   4110  O  O   . HIS B  2  190 ? 133.025 73.791  3.500   1.00 30.95  ? 190  HIS L O   1 
ATOM   4111  C  CB  . HIS B  2  190 ? 130.165 72.640  2.580   1.00 13.82  ? 190  HIS L CB  1 
ATOM   4112  C  CG  . HIS B  2  190 ? 130.227 74.107  2.271   1.00 19.71  ? 190  HIS L CG  1 
ATOM   4113  N  ND1 . HIS B  2  190 ? 131.040 74.647  1.300   1.00 15.90  ? 190  HIS L ND1 1 
ATOM   4114  C  CD2 . HIS B  2  190 ? 129.664 75.173  2.905   1.00 22.12  ? 190  HIS L CD2 1 
ATOM   4115  C  CE1 . HIS B  2  190 ? 130.950 75.986  1.371   1.00 19.31  ? 190  HIS L CE1 1 
ATOM   4116  N  NE2 . HIS B  2  190 ? 130.127 76.363  2.341   1.00 19.50  ? 190  HIS L NE2 1 
ATOM   4117  N  N   . GLY B  2  191 ? 131.981 72.622  5.141   1.00 27.77  ? 191  GLY L N   1 
ATOM   4118  C  CA  . GLY B  2  191 ? 132.720 73.265  6.217   1.00 22.89  ? 191  GLY L CA  1 
ATOM   4119  C  C   . GLY B  2  191 ? 134.197 72.886  6.245   1.00 22.30  ? 191  GLY L C   1 
ATOM   4120  O  O   . GLY B  2  191 ? 135.064 73.755  6.272   1.00 26.41  ? 191  GLY L O   1 
ATOM   4121  N  N   . GLY B  2  192 ? 134.492 71.594  6.214   1.00 20.65  ? 192  GLY L N   1 
ATOM   4122  C  CA  . GLY B  2  192 ? 135.870 71.147  6.238   1.00 22.36  ? 192  GLY L CA  1 
ATOM   4123  C  C   . GLY B  2  192 ? 136.686 71.697  5.084   1.00 26.00  ? 192  GLY L C   1 
ATOM   4124  O  O   . GLY B  2  192 ? 137.840 72.086  5.259   1.00 28.64  ? 192  GLY L O   1 
ATOM   4125  N  N   . LEU B  2  193 ? 136.063 71.825  3.923   1.00 27.05  ? 193  LEU L N   1 
ATOM   4126  C  CA  . LEU B  2  193 ? 136.781 72.286  2.756   1.00 28.50  ? 193  LEU L CA  1 
ATOM   4127  C  C   . LEU B  2  193 ? 137.114 73.755  2.876   1.00 28.04  ? 193  LEU L C   1 
ATOM   4128  O  O   . LEU B  2  193 ? 138.276 74.124  2.744   1.00 33.20  ? 193  LEU L O   1 
ATOM   4129  C  CB  . LEU B  2  193 ? 135.987 72.048  1.475   1.00 25.91  ? 193  LEU L CB  1 
ATOM   4130  C  CG  . LEU B  2  193 ? 136.678 72.629  0.240   1.00 24.38  ? 193  LEU L CG  1 
ATOM   4131  C  CD1 . LEU B  2  193 ? 137.703 71.647  -0.327  1.00 18.87  ? 193  LEU L CD1 1 
ATOM   4132  C  CD2 . LEU B  2  193 ? 135.619 72.980  -0.775  1.00 23.78  ? 193  LEU L CD2 1 
ATOM   4133  N  N   . ILE B  2  194 ? 136.111 74.596  3.109   1.00 24.45  ? 194  ILE L N   1 
ATOM   4134  C  CA  . ILE B  2  194 ? 136.369 76.019  3.228   1.00 22.25  ? 194  ILE L CA  1 
ATOM   4135  C  C   . ILE B  2  194 ? 137.400 76.292  4.315   1.00 21.07  ? 194  ILE L C   1 
ATOM   4136  O  O   . ILE B  2  194 ? 138.296 77.108  4.137   1.00 25.33  ? 194  ILE L O   1 
ATOM   4137  C  CB  . ILE B  2  194 ? 135.103 76.793  3.551   1.00 21.91  ? 194  ILE L CB  1 
ATOM   4138  C  CG1 . ILE B  2  194 ? 134.169 76.788  2.338   1.00 21.43  ? 194  ILE L CG1 1 
ATOM   4139  C  CG2 . ILE B  2  194 ? 135.459 78.216  4.002   1.00 18.34  ? 194  ILE L CG2 1 
ATOM   4140  C  CD1 . ILE B  2  194 ? 134.628 77.623  1.151   1.00 25.52  ? 194  ILE L CD1 1 
ATOM   4141  N  N   . LEU B  2  195 ? 137.308 75.577  5.426   1.00 22.50  ? 195  LEU L N   1 
ATOM   4142  C  CA  . LEU B  2  195 ? 138.303 75.716  6.474   1.00 21.37  ? 195  LEU L CA  1 
ATOM   4143  C  C   . LEU B  2  195 ? 139.674 75.247  6.028   1.00 20.20  ? 195  LEU L C   1 
ATOM   4144  O  O   . LEU B  2  195 ? 140.653 75.886  6.370   1.00 23.86  ? 195  LEU L O   1 
ATOM   4145  C  CB  . LEU B  2  195 ? 137.883 74.972  7.736   1.00 18.94  ? 195  LEU L CB  1 
ATOM   4146  C  CG  . LEU B  2  195 ? 136.639 75.515  8.437   1.00 20.54  ? 195  LEU L CG  1 
ATOM   4147  C  CD1 . LEU B  2  195 ? 136.397 74.696  9.682   1.00 19.92  ? 195  LEU L CD1 1 
ATOM   4148  C  CD2 . LEU B  2  195 ? 136.795 76.989  8.796   1.00 24.29  ? 195  LEU L CD2 1 
ATOM   4149  N  N   . SER B  2  196 ? 139.763 74.121  5.323   1.00 19.66  ? 196  SER L N   1 
ATOM   4150  C  CA  . SER B  2  196 ? 141.070 73.591  4.884   1.00 22.98  ? 196  SER L CA  1 
ATOM   4151  C  C   . SER B  2  196 ? 141.786 74.532  3.915   1.00 23.05  ? 196  SER L C   1 
ATOM   4152  O  O   . SER B  2  196 ? 143.006 74.516  3.816   1.00 23.10  ? 196  SER L O   1 
ATOM   4153  C  CB  . SER B  2  196 ? 140.920 72.229  4.202   1.00 19.74  ? 196  SER L CB  1 
ATOM   4154  O  OG  . SER B  2  196 ? 140.235 72.357  2.961   1.00 21.67  ? 196  SER L OG  1 
ATOM   4155  N  N   . VAL B  2  197 ? 141.015 75.238  3.099   1.00 24.47  ? 197  VAL L N   1 
ATOM   4156  C  CA  . VAL B  2  197 ? 141.590 76.182  2.145   1.00 27.45  ? 197  VAL L CA  1 
ATOM   4157  C  C   . VAL B  2  197 ? 142.065 77.440  2.881   1.00 28.60  ? 197  VAL L C   1 
ATOM   4158  O  O   . VAL B  2  197 ? 143.211 77.846  2.725   1.00 33.37  ? 197  VAL L O   1 
ATOM   4159  C  CB  . VAL B  2  197 ? 140.571 76.554  1.005   1.00 24.38  ? 197  VAL L CB  1 
ATOM   4160  C  CG1 . VAL B  2  197 ? 141.123 77.663  0.119   1.00 24.62  ? 197  VAL L CG1 1 
ATOM   4161  C  CG2 . VAL B  2  197 ? 140.277 75.348  0.159   1.00 21.95  ? 197  VAL L CG2 1 
ATOM   4162  N  N   . ALA B  2  198 ? 141.232 78.002  3.756   1.00 29.92  ? 198  ALA L N   1 
ATOM   4163  C  CA  . ALA B  2  198 ? 141.606 79.227  4.457   1.00 29.14  ? 198  ALA L CA  1 
ATOM   4164  C  C   . ALA B  2  198 ? 142.650 79.001  5.569   1.00 28.43  ? 198  ALA L C   1 
ATOM   4165  O  O   . ALA B  2  198 ? 143.344 79.941  5.971   1.00 30.73  ? 198  ALA L O   1 
ATOM   4166  C  CB  . ALA B  2  198 ? 140.365 79.924  5.014   1.00 24.99  ? 198  ALA L CB  1 
ATOM   4167  N  N   . ASN B  2  199 ? 142.803 77.760  6.024   1.00 25.68  ? 199  ASN L N   1 
ATOM   4168  C  CA  . ASN B  2  199 ? 143.697 77.461  7.149   1.00 26.25  ? 199  ASN L CA  1 
ATOM   4169  C  C   . ASN B  2  199 ? 144.540 76.250  6.821   1.00 25.74  ? 199  ASN L C   1 
ATOM   4170  O  O   . ASN B  2  199 ? 144.311 75.166  7.368   1.00 30.35  ? 199  ASN L O   1 
ATOM   4171  C  CB  . ASN B  2  199 ? 142.912 77.159  8.445   1.00 20.90  ? 199  ASN L CB  1 
ATOM   4172  C  CG  . ASN B  2  199 ? 141.917 78.241  8.799   1.00 26.06  ? 199  ASN L CG  1 
ATOM   4173  O  OD1 . ASN B  2  199 ? 142.200 79.146  9.588   1.00 26.81  ? 199  ASN L OD1 1 
ATOM   4174  N  ND2 . ASN B  2  199 ? 140.746 78.170  8.193   1.00 25.67  ? 199  ASN L ND2 1 
ATOM   4175  N  N   . PRO B  2  200 ? 145.513 76.402  5.914   1.00 24.83  ? 200  PRO L N   1 
ATOM   4176  C  CA  . PRO B  2  200 ? 146.304 75.269  5.425   1.00 27.00  ? 200  PRO L CA  1 
ATOM   4177  C  C   . PRO B  2  200 ? 147.251 74.645  6.455   1.00 29.82  ? 200  PRO L C   1 
ATOM   4178  O  O   . PRO B  2  200 ? 147.634 73.484  6.339   1.00 30.95  ? 200  PRO L O   1 
ATOM   4179  C  CB  . PRO B  2  200 ? 147.056 75.848  4.231   1.00 26.08  ? 200  PRO L CB  1 
ATOM   4180  C  CG  . PRO B  2  200 ? 147.099 77.297  4.485   1.00 23.80  ? 200  PRO L CG  1 
ATOM   4181  C  CD  . PRO B  2  200 ? 145.816 77.633  5.171   1.00 26.98  ? 200  PRO L CD  1 
ATOM   4182  N  N   . GLY B  2  201 ? 147.565 75.385  7.505   1.00 38.07  ? 201  GLY L N   1 
ATOM   4183  C  CA  . GLY B  2  201 ? 148.490 74.875  8.502   1.00 44.20  ? 201  GLY L CA  1 
ATOM   4184  C  C   . GLY B  2  201 ? 149.836 75.551  8.359   1.00 50.53  ? 201  GLY L C   1 
ATOM   4185  O  O   . GLY B  2  201 ? 150.109 76.170  7.324   1.00 54.78  ? 201  GLY L O   1 
ATOM   4186  N  N   . ASP B  2  202 ? 150.667 75.453  9.402   1.00 55.92  ? 202  ASP L N   1 
ATOM   4187  C  CA  . ASP B  2  202 ? 151.935 76.196  9.513   1.00 55.09  ? 202  ASP L CA  1 
ATOM   4188  C  C   . ASP B  2  202 ? 151.810 77.662  9.053   1.00 55.95  ? 202  ASP L C   1 
ATOM   4189  O  O   . ASP B  2  202 ? 150.928 78.406  9.532   1.00 57.97  ? 202  ASP L O   1 
ATOM   4190  C  CB  . ASP B  2  202 ? 153.049 75.465  8.746   1.00 54.92  ? 202  ASP L CB  1 
ATOM   4191  C  CG  . ASP B  2  202 ? 153.068 73.966  9.032   1.00 56.57  ? 202  ASP L CG  1 
ATOM   4192  O  OD1 . ASP B  2  202 ? 153.015 73.579  10.219  0.00 56.18  ? 202  ASP L OD1 1 
ATOM   4193  O  OD2 . ASP B  2  202 ? 153.139 73.179  8.064   0.00 56.18  ? 202  ASP L OD2 1 
ATOM   4194  N  N   . GLY B  2  203 ? 152.668 78.079  8.131   1.00 54.47  ? 203  GLY L N   1 
ATOM   4195  C  CA  . GLY B  2  203 ? 152.554 79.429  7.603   1.00 53.20  ? 203  GLY L CA  1 
ATOM   4196  C  C   . GLY B  2  203 ? 152.268 79.418  6.121   1.00 50.73  ? 203  GLY L C   1 
ATOM   4197  O  O   . GLY B  2  203 ? 152.637 80.354  5.399   1.00 52.71  ? 203  GLY L O   1 
ATOM   4198  N  N   . ASP B  2  204 ? 151.641 78.338  5.664   1.00 46.51  ? 204  ASP L N   1 
ATOM   4199  C  CA  . ASP B  2  204 ? 151.460 78.107  4.246   1.00 44.83  ? 204  ASP L CA  1 
ATOM   4200  C  C   . ASP B  2  204 ? 150.378 79.019  3.706   1.00 40.43  ? 204  ASP L C   1 
ATOM   4201  O  O   . ASP B  2  204 ? 149.654 79.650  4.472   1.00 41.88  ? 204  ASP L O   1 
ATOM   4202  C  CB  . ASP B  2  204 ? 151.137 76.635  4.004   1.00 53.47  ? 204  ASP L CB  1 
ATOM   4203  C  CG  . ASP B  2  204 ? 152.257 75.700  4.496   1.00 64.71  ? 204  ASP L CG  1 
ATOM   4204  O  OD1 . ASP B  2  204 ? 153.373 76.193  4.806   1.00 69.96  ? 204  ASP L OD1 1 
ATOM   4205  O  OD2 . ASP B  2  204 ? 152.023 74.466  4.579   1.00 71.25  ? 204  ASP L OD2 1 
ATOM   4206  N  N   . LYS B  2  205 ? 150.400 79.251  2.404   1.00 36.66  ? 205  LYS L N   1 
ATOM   4207  C  CA  . LYS B  2  205 ? 149.542 80.277  1.826   1.00 36.25  ? 205  LYS L CA  1 
ATOM   4208  C  C   . LYS B  2  205 ? 148.081 79.810  1.808   1.00 31.01  ? 205  LYS L C   1 
ATOM   4209  O  O   . LYS B  2  205 ? 147.778 78.675  1.439   1.00 28.52  ? 205  LYS L O   1 
ATOM   4210  C  CB  . LYS B  2  205 ? 149.994 80.644  0.388   1.00 42.43  ? 205  LYS L CB  1 
ATOM   4211  C  CG  . LYS B  2  205 ? 151.479 81.000  0.186   1.00 44.28  ? 205  LYS L CG  1 
ATOM   4212  C  CD  . LYS B  2  205 ? 151.777 82.466  0.452   0.00 45.13  ? 205  LYS L CD  1 
ATOM   4213  C  CE  . LYS B  2  205 ? 153.194 82.834  0.030   0.00 45.87  ? 205  LYS L CE  1 
ATOM   4214  N  NZ  . LYS B  2  205 ? 154.235 81.988  0.686   0.00 46.49  ? 205  LYS L NZ  1 
ATOM   4215  N  N   . VAL B  2  206 ? 147.189 80.679  2.251   1.00 26.68  ? 206  VAL L N   1 
ATOM   4216  C  CA  . VAL B  2  206 ? 145.778 80.536  1.943   1.00 25.67  ? 206  VAL L CA  1 
ATOM   4217  C  C   . VAL B  2  206 ? 145.616 80.164  0.459   1.00 26.56  ? 206  VAL L C   1 
ATOM   4218  O  O   . VAL B  2  206 ? 146.229 80.794  -0.411  1.00 31.87  ? 206  VAL L O   1 
ATOM   4219  C  CB  . VAL B  2  206 ? 145.060 81.860  2.240   1.00 23.97  ? 206  VAL L CB  1 
ATOM   4220  C  CG1 . VAL B  2  206 ? 143.675 81.871  1.619   1.00 18.16  ? 206  VAL L CG1 1 
ATOM   4221  C  CG2 . VAL B  2  206 ? 144.990 82.070  3.753   1.00 19.23  ? 206  VAL L CG2 1 
ATOM   4222  N  N   . LYS B  2  207 ? 144.865 79.099  0.178   1.00 23.09  ? 207  LYS L N   1 
ATOM   4223  C  CA  . LYS B  2  207 ? 144.670 78.639  -1.195  1.00 18.70  ? 207  LYS L CA  1 
ATOM   4224  C  C   . LYS B  2  207 ? 143.515 79.331  -1.917  1.00 21.27  ? 207  LYS L C   1 
ATOM   4225  O  O   . LYS B  2  207 ? 143.154 80.459  -1.589  1.00 19.53  ? 207  LYS L O   1 
ATOM   4226  C  CB  . LYS B  2  207 ? 144.493 77.133  -1.231  1.00 15.20  ? 207  LYS L CB  1 
ATOM   4227  C  CG  . LYS B  2  207 ? 145.713 76.379  -0.802  1.00 17.99  ? 207  LYS L CG  1 
ATOM   4228  C  CD  . LYS B  2  207 ? 146.972 77.148  -1.202  1.00 23.57  ? 207  LYS L CD  1 
ATOM   4229  C  CE  . LYS B  2  207 ? 148.205 76.292  -1.075  1.00 20.86  ? 207  LYS L CE  1 
ATOM   4230  N  NZ  . LYS B  2  207 ? 148.523 75.935  0.338   1.00 24.63  ? 207  LYS L NZ  1 
ATOM   4231  N  N   . THR B  2  208 ? 142.981 78.691  -2.952  1.00 24.71  ? 208  THR L N   1 
ATOM   4232  C  CA  . THR B  2  208 ? 142.166 79.411  -3.932  1.00 27.53  ? 208  THR L CA  1 
ATOM   4233  C  C   . THR B  2  208 ? 140.949 78.599  -4.360  1.00 27.56  ? 208  THR L C   1 
ATOM   4234  O  O   . THR B  2  208 ? 140.935 77.376  -4.199  1.00 28.80  ? 208  THR L O   1 
ATOM   4235  C  CB  . THR B  2  208 ? 142.976 79.722  -5.208  1.00 29.99  ? 208  THR L CB  1 
ATOM   4236  O  OG1 . THR B  2  208 ? 143.317 78.486  -5.863  1.00 31.25  ? 208  THR L OG1 1 
ATOM   4237  C  CG2 . THR B  2  208 ? 144.256 80.491  -4.869  1.00 32.80  ? 208  THR L CG2 1 
ATOM   4238  N  N   . ALA B  2  209 ? 140.072 79.249  -5.128  1.00 29.03  ? 209  ALA L N   1 
ATOM   4239  C  CA  . ALA B  2  209 ? 138.917 78.611  -5.769  1.00 30.80  ? 209  ALA L CA  1 
ATOM   4240  C  C   . ALA B  2  209 ? 139.304 77.378  -6.586  1.00 34.42  ? 209  ALA L C   1 
ATOM   4241  O  O   . ALA B  2  209 ? 138.616 76.360  -6.532  1.00 39.10  ? 209  ALA L O   1 
ATOM   4242  C  CB  . ALA B  2  209 ? 138.191 79.618  -6.661  1.00 27.59  ? 209  ALA L CB  1 
ATOM   4243  N  N   . GLU B  2  210 ? 140.429 77.450  -7.301  1.00 37.11  ? 210  GLU L N   1 
ATOM   4244  C  CA  . GLU B  2  210 ? 140.885 76.349  -8.167  1.00 35.66  ? 210  GLU L CA  1 
ATOM   4245  C  C   . GLU B  2  210 ? 141.290 75.116  -7.359  1.00 32.44  ? 210  GLU L C   1 
ATOM   4246  O  O   . GLU B  2  210 ? 141.220 73.998  -7.854  1.00 35.24  ? 210  GLU L O   1 
ATOM   4247  C  CB  . GLU B  2  210 ? 142.061 76.803  -9.060  1.00 33.91  ? 210  GLU L CB  1 
ATOM   4248  C  CG  . GLU B  2  210 ? 141.657 77.763  -10.192 1.00 33.78  ? 210  GLU L CG  1 
ATOM   4249  C  CD  . GLU B  2  210 ? 141.812 79.250  -9.841  1.00 36.91  ? 210  GLU L CD  1 
ATOM   4250  O  OE1 . GLU B  2  210 ? 141.542 79.664  -8.688  1.00 37.35  ? 210  GLU L OE1 1 
ATOM   4251  O  OE2 . GLU B  2  210 ? 142.145 80.032  -10.748 1.00 38.27  ? 210  GLU L OE2 1 
ATOM   4252  N  N   . HIS B  2  211 ? 141.709 75.320  -6.117  1.00 29.14  ? 211  HIS L N   1 
ATOM   4253  C  CA  . HIS B  2  211 ? 142.093 74.202  -5.256  1.00 31.95  ? 211  HIS L CA  1 
ATOM   4254  C  C   . HIS B  2  211 ? 140.885 73.408  -4.770  1.00 31.04  ? 211  HIS L C   1 
ATOM   4255  O  O   . HIS B  2  211 ? 140.986 72.206  -4.528  1.00 31.80  ? 211  HIS L O   1 
ATOM   4256  C  CB  . HIS B  2  211 ? 142.847 74.701  -4.035  1.00 29.97  ? 211  HIS L CB  1 
ATOM   4257  C  CG  . HIS B  2  211 ? 144.291 74.969  -4.283  1.00 33.69  ? 211  HIS L CG  1 
ATOM   4258  N  ND1 . HIS B  2  211 ? 144.740 76.152  -4.832  1.00 31.21  ? 211  HIS L ND1 1 
ATOM   4259  C  CD2 . HIS B  2  211 ? 145.397 74.254  -3.958  1.00 30.44  ? 211  HIS L CD2 1 
ATOM   4260  C  CE1 . HIS B  2  211 ? 146.061 76.157  -4.830  1.00 31.55  ? 211  HIS L CE1 1 
ATOM   4261  N  NE2 . HIS B  2  211 ? 146.485 75.018  -4.304  1.00 31.73  ? 211  HIS L NE2 1 
ATOM   4262  N  N   . GLU B  2  212 ? 139.822 74.136  -4.429  1.00 31.98  ? 212  GLU L N   1 
ATOM   4263  C  CA  . GLU B  2  212 ? 138.580 73.550  -3.928  1.00 29.00  ? 212  GLU L CA  1 
ATOM   4264  C  C   . GLU B  2  212 ? 138.060 72.565  -4.964  1.00 28.96  ? 212  GLU L C   1 
ATOM   4265  O  O   . GLU B  2  212 ? 137.821 71.390  -4.655  1.00 29.27  ? 212  GLU L O   1 
ATOM   4266  C  CB  . GLU B  2  212 ? 137.523 74.638  -3.704  1.00 26.84  ? 212  GLU L CB  1 
ATOM   4267  C  CG  . GLU B  2  212 ? 137.758 75.623  -2.540  1.00 21.09  ? 212  GLU L CG  1 
ATOM   4268  C  CD  . GLU B  2  212 ? 136.584 76.602  -2.377  1.00 24.53  ? 212  GLU L CD  1 
ATOM   4269  O  OE1 . GLU B  2  212 ? 135.415 76.157  -2.401  1.00 30.42  ? 212  GLU L OE1 1 
ATOM   4270  O  OE2 . GLU B  2  212 ? 136.811 77.821  -2.242  1.00 20.80  ? 212  GLU L OE2 1 
ATOM   4271  N  N   . ASN B  2  213 ? 137.984 73.041  -6.210  1.00 28.33  ? 213  ASN L N   1 
ATOM   4272  C  CA  . ASN B  2  213 ? 137.544 72.242  -7.355  1.00 27.51  ? 213  ASN L CA  1 
ATOM   4273  C  C   . ASN B  2  213 ? 138.469 71.054  -7.551  1.00 28.43  ? 213  ASN L C   1 
ATOM   4274  O  O   . ASN B  2  213 ? 138.014 69.914  -7.638  1.00 32.08  ? 213  ASN L O   1 
ATOM   4275  C  CB  . ASN B  2  213 ? 137.537 73.095  -8.625  1.00 29.34  ? 213  ASN L CB  1 
ATOM   4276  C  CG  . ASN B  2  213 ? 136.261 73.913  -8.785  1.00 32.77  ? 213  ASN L CG  1 
ATOM   4277  O  OD1 . ASN B  2  213 ? 135.217 73.590  -8.218  1.00 39.32  ? 213  ASN L OD1 1 
ATOM   4278  N  ND2 . ASN B  2  213 ? 136.326 74.943  -9.610  1.00 36.28  ? 213  ASN L ND2 1 
ATOM   4279  N  N   . GLN B  2  214 ? 139.768 71.300  -7.428  1.00 27.96  ? 214  GLN L N   1 
ATOM   4280  C  CA  . GLN B  2  214 ? 140.762 70.252  -7.617  1.00 29.38  ? 214  GLN L CA  1 
ATOM   4281  C  C   . GLN B  2  214 ? 140.663 69.165  -6.569  1.00 30.65  ? 214  GLN L C   1 
ATOM   4282  O  O   . GLN B  2  214 ? 140.756 67.981  -6.893  1.00 32.49  ? 214  GLN L O   1 
ATOM   4283  C  CB  . GLN B  2  214 ? 142.182 70.831  -7.617  1.00 29.75  ? 214  GLN L CB  1 
ATOM   4284  C  CG  . GLN B  2  214 ? 143.213 69.932  -8.310  1.00 31.55  ? 214  GLN L CG  1 
ATOM   4285  C  CD  . GLN B  2  214 ? 142.748 69.470  -9.687  1.00 34.61  ? 214  GLN L CD  1 
ATOM   4286  O  OE1 . GLN B  2  214 ? 142.620 68.269  -9.930  1.00 38.47  ? 214  GLN L OE1 1 
ATOM   4287  N  NE2 . GLN B  2  214 ? 142.363 70.420  -10.545 1.00 29.91  ? 214  GLN L NE2 1 
ATOM   4288  N  N   . TYR B  2  215 ? 140.459 69.554  -5.315  1.00 31.96  ? 215  TYR L N   1 
ATOM   4289  C  CA  . TYR B  2  215 ? 140.363 68.574  -4.233  1.00 30.89  ? 215  TYR L CA  1 
ATOM   4290  C  C   . TYR B  2  215 ? 139.300 67.496  -4.512  1.00 30.55  ? 215  TYR L C   1 
ATOM   4291  O  O   . TYR B  2  215 ? 139.596 66.293  -4.455  1.00 26.80  ? 215  TYR L O   1 
ATOM   4292  C  CB  . TYR B  2  215 ? 140.062 69.265  -2.901  1.00 28.33  ? 215  TYR L CB  1 
ATOM   4293  C  CG  . TYR B  2  215 ? 139.972 68.293  -1.740  1.00 26.14  ? 215  TYR L CG  1 
ATOM   4294  C  CD1 . TYR B  2  215 ? 141.113 67.671  -1.249  1.00 22.75  ? 215  TYR L CD1 1 
ATOM   4295  C  CD2 . TYR B  2  215 ? 138.730 67.871  -1.243  1.00 28.23  ? 215  TYR L CD2 1 
ATOM   4296  C  CE1 . TYR B  2  215 ? 141.029 66.649  -0.320  1.00 21.79  ? 215  TYR L CE1 1 
ATOM   4297  C  CE2 . TYR B  2  215 ? 138.641 66.835  -0.301  1.00 22.30  ? 215  TYR L CE2 1 
ATOM   4298  C  CZ  . TYR B  2  215 ? 139.796 66.232  0.151   1.00 20.74  ? 215  TYR L CZ  1 
ATOM   4299  O  OH  . TYR B  2  215 ? 139.740 65.216  1.086   1.00 23.84  ? 215  TYR L OH  1 
ATOM   4300  N  N   . PHE B  2  216 ? 138.081 67.924  -4.847  1.00 29.71  ? 216  PHE L N   1 
ATOM   4301  C  CA  . PHE B  2  216 ? 136.976 66.981  -5.032  1.00 31.59  ? 216  PHE L CA  1 
ATOM   4302  C  C   . PHE B  2  216 ? 136.979 66.244  -6.364  1.00 31.92  ? 216  PHE L C   1 
ATOM   4303  O  O   . PHE B  2  216 ? 136.603 65.071  -6.419  1.00 30.87  ? 216  PHE L O   1 
ATOM   4304  C  CB  . PHE B  2  216 ? 135.623 67.667  -4.805  1.00 31.44  ? 216  PHE L CB  1 
ATOM   4305  C  CG  . PHE B  2  216 ? 135.213 67.683  -3.366  1.00 32.52  ? 216  PHE L CG  1 
ATOM   4306  C  CD1 . PHE B  2  216 ? 135.225 66.502  -2.628  1.00 30.70  ? 216  PHE L CD1 1 
ATOM   4307  C  CD2 . PHE B  2  216 ? 134.998 68.885  -2.702  1.00 32.17  ? 216  PHE L CD2 1 
ATOM   4308  C  CE1 . PHE B  2  216 ? 135.043 66.515  -1.261  1.00 26.63  ? 216  PHE L CE1 1 
ATOM   4309  C  CE2 . PHE B  2  216 ? 134.804 68.906  -1.336  1.00 29.87  ? 216  PHE L CE2 1 
ATOM   4310  C  CZ  . PHE B  2  216 ? 134.828 67.714  -0.611  1.00 30.89  ? 216  PHE L CZ  1 
ATOM   4311  N  N   . ARG B  2  217 ? 137.490 66.895  -7.413  1.00 32.65  ? 217  ARG L N   1 
ATOM   4312  C  CA  . ARG B  2  217 ? 137.759 66.217  -8.681  1.00 27.87  ? 217  ARG L CA  1 
ATOM   4313  C  C   . ARG B  2  217 ? 138.730 65.083  -8.435  1.00 28.34  ? 217  ARG L C   1 
ATOM   4314  O  O   . ARG B  2  217 ? 138.523 63.966  -8.887  1.00 31.94  ? 217  ARG L O   1 
ATOM   4315  C  CB  . ARG B  2  217 ? 138.337 67.196  -9.701  1.00 24.43  ? 217  ARG L CB  1 
ATOM   4316  C  CG  . ARG B  2  217 ? 137.277 67.889  -10.531 1.00 21.57  ? 217  ARG L CG  1 
ATOM   4317  C  CD  . ARG B  2  217 ? 137.844 69.081  -11.239 1.00 21.32  ? 217  ARG L CD  1 
ATOM   4318  N  NE  . ARG B  2  217 ? 136.790 69.933  -11.774 1.00 21.60  ? 217  ARG L NE  1 
ATOM   4319  C  CZ  . ARG B  2  217 ? 136.985 71.197  -12.145 1.00 29.36  ? 217  ARG L CZ  1 
ATOM   4320  N  NH1 . ARG B  2  217 ? 138.210 71.729  -12.106 1.00 34.67  ? 217  ARG L NH1 1 
ATOM   4321  N  NH2 . ARG B  2  217 ? 135.964 71.934  -12.564 1.00 27.37  ? 217  ARG L NH2 1 
ATOM   4322  N  N   . ASP B  2  218 ? 139.691 65.332  -7.560  1.00 29.13  ? 218  ASP L N   1 
ATOM   4323  C  CA  . ASP B  2  218 ? 140.678 64.326  -7.250  1.00 29.75  ? 218  ASP L CA  1 
ATOM   4324  C  C   . ASP B  2  218 ? 140.028 63.210  -6.486  1.00 31.86  ? 218  ASP L C   1 
ATOM   4325  O  O   . ASP B  2  218 ? 140.176 62.048  -6.848  1.00 33.66  ? 218  ASP L O   1 
ATOM   4326  C  CB  . ASP B  2  218 ? 141.825 64.921  -6.441  1.00 29.22  ? 218  ASP L CB  1 
ATOM   4327  C  CG  . ASP B  2  218 ? 142.884 65.553  -7.312  1.00 29.53  ? 218  ASP L CG  1 
ATOM   4328  O  OD1 . ASP B  2  218 ? 142.694 65.624  -8.545  1.00 28.63  ? 218  ASP L OD1 1 
ATOM   4329  O  OD2 . ASP B  2  218 ? 143.902 66.010  -6.764  1.00 36.45  ? 218  ASP L OD2 1 
ATOM   4330  N  N   . VAL B  2  219 ? 139.238 63.565  -5.478  1.00 32.26  ? 219  VAL L N   1 
ATOM   4331  C  CA  . VAL B  2  219 ? 138.804 62.568  -4.519  1.00 31.01  ? 219  VAL L CA  1 
ATOM   4332  C  C   . VAL B  2  219 ? 137.672 61.718  -5.070  1.00 32.88  ? 219  VAL L C   1 
ATOM   4333  O  O   . VAL B  2  219 ? 137.716 60.497  -4.969  1.00 34.26  ? 219  VAL L O   1 
ATOM   4334  C  CB  . VAL B  2  219 ? 138.410 63.227  -3.181  1.00 31.83  ? 219  VAL L CB  1 
ATOM   4335  C  CG1 . VAL B  2  219 ? 137.943 62.170  -2.188  1.00 31.10  ? 219  VAL L CG1 1 
ATOM   4336  C  CG2 . VAL B  2  219 ? 139.609 63.949  -2.610  1.00 27.13  ? 219  VAL L CG2 1 
ATOM   4337  N  N   . VAL B  2  220 ? 136.697 62.367  -5.704  1.00 32.96  ? 220  VAL L N   1 
ATOM   4338  C  CA  . VAL B  2  220 ? 135.472 61.705  -6.155  1.00 33.76  ? 220  VAL L CA  1 
ATOM   4339  C  C   . VAL B  2  220 ? 135.195 61.901  -7.661  1.00 33.90  ? 220  VAL L C   1 
ATOM   4340  O  O   . VAL B  2  220 ? 134.347 61.231  -8.236  1.00 32.80  ? 220  VAL L O   1 
ATOM   4341  C  CB  . VAL B  2  220 ? 134.213 62.171  -5.306  1.00 33.21  ? 220  VAL L CB  1 
ATOM   4342  C  CG1 . VAL B  2  220 ? 134.504 62.044  -3.832  1.00 35.25  ? 220  VAL L CG1 1 
ATOM   4343  C  CG2 . VAL B  2  220 ? 133.807 63.608  -5.620  1.00 29.13  ? 220  VAL L CG2 1 
ATOM   4344  N  N   . GLY B  2  221 ? 135.957 62.767  -8.316  1.00 33.91  ? 221  GLY L N   1 
ATOM   4345  C  CA  . GLY B  2  221 ? 135.809 62.911  -9.747  1.00 28.31  ? 221  GLY L CA  1 
ATOM   4346  C  C   . GLY B  2  221 ? 134.824 63.991  -10.108 1.00 30.55  ? 221  GLY L C   1 
ATOM   4347  O  O   . GLY B  2  221 ? 134.600 64.253  -11.285 1.00 32.43  ? 221  GLY L O   1 
ATOM   4348  N  N   . TYR B  2  222 ? 134.284 64.679  -9.111  1.00 31.55  ? 222  TYR L N   1 
ATOM   4349  C  CA  . TYR B  2  222 ? 133.388 65.797  -9.396  1.00 30.36  ? 222  TYR L CA  1 
ATOM   4350  C  C   . TYR B  2  222 ? 133.392 66.866  -8.291  1.00 31.22  ? 222  TYR L C   1 
ATOM   4351  O  O   . TYR B  2  222 ? 133.507 66.556  -7.102  1.00 32.47  ? 222  TYR L O   1 
ATOM   4352  C  CB  . TYR B  2  222 ? 131.974 65.262  -9.628  1.00 26.35  ? 222  TYR L CB  1 
ATOM   4353  C  CG  . TYR B  2  222 ? 130.984 66.316  -10.060 1.00 25.00  ? 222  TYR L CG  1 
ATOM   4354  C  CD1 . TYR B  2  222 ? 131.199 67.091  -11.203 1.00 27.37  ? 222  TYR L CD1 1 
ATOM   4355  C  CD2 . TYR B  2  222 ? 129.899 66.629  -9.263  1.00 22.88  ? 222  TYR L CD2 1 
ATOM   4356  C  CE1 . TYR B  2  222 ? 130.358 68.169  -11.522 1.00 23.54  ? 222  TYR L CE1 1 
ATOM   4357  C  CE2 . TYR B  2  222 ? 129.066 67.699  -9.568  1.00 22.82  ? 222  TYR L CE2 1 
ATOM   4358  C  CZ  . TYR B  2  222 ? 129.299 68.468  -10.685 1.00 22.28  ? 222  TYR L CZ  1 
ATOM   4359  O  OH  . TYR B  2  222 ? 128.490 69.573  -10.904 1.00 27.86  ? 222  TYR L OH  1 
ATOM   4360  N  N   . SER B  2  223 ? 133.360 68.130  -8.694  1.00 28.52  ? 223  SER L N   1 
ATOM   4361  C  CA  . SER B  2  223 ? 133.182 69.214  -7.746  1.00 29.83  ? 223  SER L CA  1 
ATOM   4362  C  C   . SER B  2  223 ? 132.008 70.084  -8.180  1.00 33.18  ? 223  SER L C   1 
ATOM   4363  O  O   . SER B  2  223 ? 131.943 70.551  -9.324  1.00 32.41  ? 223  SER L O   1 
ATOM   4364  C  CB  . SER B  2  223 ? 134.453 70.054  -7.645  1.00 27.85  ? 223  SER L CB  1 
ATOM   4365  O  OG  . SER B  2  223 ? 134.141 71.367  -7.218  1.00 28.86  ? 223  SER L OG  1 
ATOM   4366  N  N   . ILE B  2  224 ? 131.066 70.275  -7.266  1.00 32.86  ? 224  ILE L N   1 
ATOM   4367  C  CA  . ILE B  2  224 ? 129.795 70.898  -7.604  1.00 32.90  ? 224  ILE L CA  1 
ATOM   4368  C  C   . ILE B  2  224 ? 129.969 72.410  -7.730  1.00 30.56  ? 224  ILE L C   1 
ATOM   4369  O  O   . ILE B  2  224 ? 129.163 73.096  -8.380  1.00 29.41  ? 224  ILE L O   1 
ATOM   4370  C  CB  . ILE B  2  224 ? 128.684 70.489  -6.554  1.00 36.12  ? 224  ILE L CB  1 
ATOM   4371  C  CG1 . ILE B  2  224 ? 127.435 71.358  -6.690  1.00 37.23  ? 224  ILE L CG1 1 
ATOM   4372  C  CG2 . ILE B  2  224 ? 129.222 70.559  -5.155  1.00 39.13  ? 224  ILE L CG2 1 
ATOM   4373  C  CD1 . ILE B  2  224 ? 126.310 70.689  -7.471  1.00 43.27  ? 224  ILE L CD1 1 
ATOM   4374  N  N   . GLY B  2  225 ? 131.133 72.886  -7.306  1.00 27.29  ? 225  GLY L N   1 
ATOM   4375  C  CA  . GLY B  2  225 ? 131.412 74.304  -7.412  1.00 26.38  ? 225  GLY L CA  1 
ATOM   4376  C  C   . GLY B  2  225 ? 130.812 75.125  -6.285  1.00 26.98  ? 225  GLY L C   1 
ATOM   4377  O  O   . GLY B  2  225 ? 129.791 74.753  -5.696  1.00 28.89  ? 225  GLY L O   1 
ATOM   4378  N  N   . ALA B  2  226 ? 131.339 76.331  -6.130  1.00 23.05  ? 226  ALA L N   1 
ATOM   4379  C  CA  . ALA B  2  226 ? 131.160 77.098  -4.930  1.00 19.32  ? 226  ALA L CA  1 
ATOM   4380  C  C   . ALA B  2  226 ? 129.745 77.601  -4.757  1.00 23.75  ? 226  ALA L C   1 
ATOM   4381  O  O   . ALA B  2  226 ? 129.173 77.387  -3.696  1.00 31.26  ? 226  ALA L O   1 
ATOM   4382  C  CB  . ALA B  2  226 ? 132.146 78.245  -4.888  1.00 18.73  ? 226  ALA L CB  1 
ATOM   4383  N  N   . LEU B  2  227 ? 129.148 78.270  -5.745  1.00 25.25  ? 227  LEU L N   1 
ATOM   4384  C  CA  . LEU B  2  227 ? 127.758 78.697  -5.532  1.00 23.33  ? 227  LEU L CA  1 
ATOM   4385  C  C   . LEU B  2  227 ? 126.891 77.465  -5.416  1.00 22.91  ? 227  LEU L C   1 
ATOM   4386  O  O   . LEU B  2  227 ? 126.066 77.386  -4.523  1.00 26.59  ? 227  LEU L O   1 
ATOM   4387  C  CB  . LEU B  2  227 ? 127.199 79.630  -6.629  1.00 17.70  ? 227  LEU L CB  1 
ATOM   4388  C  CG  . LEU B  2  227 ? 125.748 80.143  -6.400  1.00 18.12  ? 227  LEU L CG  1 
ATOM   4389  C  CD1 . LEU B  2  227 ? 125.663 81.206  -5.318  1.00 16.03  ? 227  LEU L CD1 1 
ATOM   4390  C  CD2 . LEU B  2  227 ? 125.178 80.716  -7.667  1.00 19.52  ? 227  LEU L CD2 1 
ATOM   4391  N  N   . SER B  2  228 ? 127.186 76.429  -6.181  1.00 23.58  ? 228  SER L N   1 
ATOM   4392  C  CA  . SER B  2  228 ? 126.238 75.332  -6.247  1.00 29.53  ? 228  SER L CA  1 
ATOM   4393  C  C   . SER B  2  228 ? 126.160 74.426  -5.029  1.00 30.48  ? 228  SER L C   1 
ATOM   4394  O  O   . SER B  2  228 ? 125.073 73.939  -4.717  1.00 35.43  ? 228  SER L O   1 
ATOM   4395  C  CB  . SER B  2  228 ? 126.454 74.518  -7.505  1.00 32.63  ? 228  SER L CB  1 
ATOM   4396  O  OG  . SER B  2  228 ? 126.099 75.318  -8.618  1.00 41.55  ? 228  SER L OG  1 
ATOM   4397  N  N   . ILE B  2  229 ? 127.241 74.312  -4.257  1.00 27.94  ? 229  ILE L N   1 
ATOM   4398  C  CA  . ILE B  2  229 ? 127.168 73.605  -2.986  1.00 20.59  ? 229  ILE L CA  1 
ATOM   4399  C  C   . ILE B  2  229 ? 126.257 74.292  -1.951  1.00 20.96  ? 229  ILE L C   1 
ATOM   4400  O  O   . ILE B  2  229 ? 125.598 73.627  -1.175  1.00 22.45  ? 229  ILE L O   1 
ATOM   4401  C  CB  . ILE B  2  229 ? 128.562 73.370  -2.379  1.00 19.13  ? 229  ILE L CB  1 
ATOM   4402  C  CG1 . ILE B  2  229 ? 128.460 72.307  -1.301  1.00 19.64  ? 229  ILE L CG1 1 
ATOM   4403  C  CG2 . ILE B  2  229 ? 129.111 74.649  -1.766  1.00 19.67  ? 229  ILE L CG2 1 
ATOM   4404  C  CD1 . ILE B  2  229 ? 127.680 71.101  -1.729  1.00 18.34  ? 229  ILE L CD1 1 
ATOM   4405  N  N   . HIS B  2  230 ? 126.115 75.606  -2.007  1.00 20.20  ? 230  HIS L N   1 
ATOM   4406  C  CA  . HIS B  2  230 ? 125.127 76.268  -1.155  1.00 23.54  ? 230  HIS L CA  1 
ATOM   4407  C  C   . HIS B  2  230 ? 123.691 75.973  -1.589  1.00 26.15  ? 230  HIS L C   1 
ATOM   4408  O  O   . HIS B  2  230 ? 122.833 75.672  -0.756  1.00 26.43  ? 230  HIS L O   1 
ATOM   4409  C  CB  . HIS B  2  230 ? 125.377 77.775  -1.117  1.00 20.44  ? 230  HIS L CB  1 
ATOM   4410  C  CG  . HIS B  2  230 ? 126.687 78.132  -0.505  1.00 21.02  ? 230  HIS L CG  1 
ATOM   4411  N  ND1 . HIS B  2  230 ? 127.879 77.975  -1.164  1.00 23.91  ? 230  HIS L ND1 1 
ATOM   4412  C  CD2 . HIS B  2  230 ? 127.023 78.268  0.802   1.00 25.45  ? 230  HIS L CD2 1 
ATOM   4413  C  CE1 . HIS B  2  230 ? 128.860 77.964  -0.255  1.00 26.44  ? 230  HIS L CE1 1 
ATOM   4414  N  NE2 . HIS B  2  230 ? 128.390 78.146  0.961   1.00 20.83  ? 230  HIS L NE2 1 
ATOM   4415  N  N   . ARG B  2  231 ? 123.425 76.065  -2.888  1.00 27.18  ? 231  ARG L N   1 
ATOM   4416  C  CA  . ARG B  2  231 ? 122.131 75.670  -3.437  1.00 24.35  ? 231  ARG L CA  1 
ATOM   4417  C  C   . ARG B  2  231 ? 121.831 74.187  -3.151  1.00 22.74  ? 231  ARG L C   1 
ATOM   4418  O  O   . ARG B  2  231 ? 120.723 73.846  -2.736  1.00 21.77  ? 231  ARG L O   1 
ATOM   4419  C  CB  . ARG B  2  231 ? 122.098 75.937  -4.940  1.00 26.95  ? 231  ARG L CB  1 
ATOM   4420  C  CG  . ARG B  2  231 ? 120.725 75.826  -5.592  1.00 33.29  ? 231  ARG L CG  1 
ATOM   4421  C  CD  . ARG B  2  231 ? 120.871 75.716  -7.117  1.00 38.94  ? 231  ARG L CD  1 
ATOM   4422  N  NE  . ARG B  2  231 ? 121.343 76.952  -7.760  1.00 35.91  ? 231  ARG L NE  1 
ATOM   4423  C  CZ  . ARG B  2  231 ? 122.504 77.087  -8.400  1.00 35.78  ? 231  ARG L CZ  1 
ATOM   4424  N  NH1 . ARG B  2  231 ? 123.330 76.050  -8.523  1.00 34.97  ? 231  ARG L NH1 1 
ATOM   4425  N  NH2 . ARG B  2  231 ? 122.828 78.260  -8.938  1.00 35.99  ? 231  ARG L NH2 1 
ATOM   4426  N  N   . LEU B  2  232 ? 122.835 73.322  -3.237  1.00 16.02  ? 232  LEU L N   1 
ATOM   4427  C  CA  . LEU B  2  232 ? 122.621 71.935  -2.851  1.00 16.16  ? 232  LEU L CA  1 
ATOM   4428  C  C   . LEU B  2  232 ? 122.253 71.799  -1.357  1.00 18.29  ? 232  LEU L C   1 
ATOM   4429  O  O   . LEU B  2  232 ? 121.260 71.169  -0.999  1.00 19.46  ? 232  LEU L O   1 
ATOM   4430  C  CB  . LEU B  2  232 ? 123.856 71.110  -3.162  1.00 11.84  ? 232  LEU L CB  1 
ATOM   4431  C  CG  . LEU B  2  232 ? 123.598 69.606  -3.063  1.00 23.01  ? 232  LEU L CG  1 
ATOM   4432  C  CD1 . LEU B  2  232 ? 122.726 69.129  -4.220  1.00 17.96  ? 232  LEU L CD1 1 
ATOM   4433  C  CD2 . LEU B  2  232 ? 124.914 68.856  -3.059  1.00 21.80  ? 232  LEU L CD2 1 
ATOM   4434  N  N   . GLY B  2  233 ? 123.032 72.428  -0.489  1.00 18.79  ? 233  GLY L N   1 
ATOM   4435  C  CA  . GLY B  2  233 ? 122.808 72.294  0.932   1.00 12.22  ? 233  GLY L CA  1 
ATOM   4436  C  C   . GLY B  2  233 ? 121.407 72.697  1.282   1.00 11.33  ? 233  GLY L C   1 
ATOM   4437  O  O   . GLY B  2  233 ? 120.735 71.966  1.993   1.00 17.59  ? 233  GLY L O   1 
ATOM   4438  N  N   . LEU B  2  234 ? 120.908 73.761  0.663   1.00 12.14  ? 234  LEU L N   1 
ATOM   4439  C  CA  . LEU B  2  234 ? 119.566 74.245  0.957   1.00 13.38  ? 234  LEU L CA  1 
ATOM   4440  C  C   . LEU B  2  234 ? 118.511 73.262  0.462   1.00 17.59  ? 234  LEU L C   1 
ATOM   4441  O  O   . LEU B  2  234 ? 117.500 73.019  1.140   1.00 18.59  ? 234  LEU L O   1 
ATOM   4442  C  CB  . LEU B  2  234 ? 119.345 75.611  0.325   1.00 7.55   ? 234  LEU L CB  1 
ATOM   4443  C  CG  . LEU B  2  234 ? 117.913 76.127  0.395   1.00 15.08  ? 234  LEU L CG  1 
ATOM   4444  C  CD1 . LEU B  2  234 ? 117.427 76.274  1.827   1.00 11.41  ? 234  LEU L CD1 1 
ATOM   4445  C  CD2 . LEU B  2  234 ? 117.858 77.458  -0.307  1.00 14.76  ? 234  LEU L CD2 1 
ATOM   4446  N  N   . PHE B  2  235 ? 118.830 72.576  -0.629  1.00 19.31  ? 235  PHE L N   1 
ATOM   4447  C  CA  . PHE B  2  235 ? 117.971 71.532  -1.187  1.00 15.85  ? 235  PHE L CA  1 
ATOM   4448  C  C   . PHE B  2  235 ? 117.985 70.257  -0.335  1.00 18.67  ? 235  PHE L C   1 
ATOM   4449  O  O   . PHE B  2  235 ? 116.909 69.739  0.009   1.00 19.61  ? 235  PHE L O   1 
ATOM   4450  C  CB  . PHE B  2  235 ? 118.414 71.245  -2.633  1.00 23.46  ? 235  PHE L CB  1 
ATOM   4451  C  CG  . PHE B  2  235 ? 117.833 69.970  -3.253  1.00 30.73  ? 235  PHE L CG  1 
ATOM   4452  C  CD1 . PHE B  2  235 ? 116.644 70.007  -3.996  1.00 31.90  ? 235  PHE L CD1 1 
ATOM   4453  C  CD2 . PHE B  2  235 ? 118.533 68.760  -3.191  1.00 32.12  ? 235  PHE L CD2 1 
ATOM   4454  C  CE1 . PHE B  2  235 ? 116.160 68.861  -4.658  1.00 29.65  ? 235  PHE L CE1 1 
ATOM   4455  C  CE2 . PHE B  2  235 ? 118.056 67.618  -3.848  1.00 34.48  ? 235  PHE L CE2 1 
ATOM   4456  C  CZ  . PHE B  2  235 ? 116.863 67.675  -4.581  1.00 32.65  ? 235  PHE L CZ  1 
ATOM   4457  N  N   . LEU B  2  236 ? 119.169 69.716  -0.028  1.00 15.74  ? 236  LEU L N   1 
ATOM   4458  C  CA  . LEU B  2  236 ? 119.256 68.465  0.745   1.00 17.03  ? 236  LEU L CA  1 
ATOM   4459  C  C   . LEU B  2  236 ? 118.564 68.665  2.088   1.00 19.03  ? 236  LEU L C   1 
ATOM   4460  O  O   . LEU B  2  236 ? 117.810 67.812  2.557   1.00 22.74  ? 236  LEU L O   1 
ATOM   4461  C  CB  . LEU B  2  236 ? 120.697 68.095  1.044   1.00 14.34  ? 236  LEU L CB  1 
ATOM   4462  C  CG  . LEU B  2  236 ? 121.568 67.621  -0.091  1.00 12.79  ? 236  LEU L CG  1 
ATOM   4463  C  CD1 . LEU B  2  236 ? 123.040 67.528  0.339   1.00 11.98  ? 236  LEU L CD1 1 
ATOM   4464  C  CD2 . LEU B  2  236 ? 121.054 66.284  -0.502  1.00 20.04  ? 236  LEU L CD2 1 
ATOM   4465  N  N   . ALA B  2  237 ? 118.862 69.787  2.724   1.00 15.03  ? 237  ALA L N   1 
ATOM   4466  C  CA  . ALA B  2  237 ? 118.310 70.068  4.030   1.00 16.12  ? 237  ALA L CA  1 
ATOM   4467  C  C   . ALA B  2  237 ? 116.804 70.122  3.935   1.00 19.29  ? 237  ALA L C   1 
ATOM   4468  O  O   . ALA B  2  237 ? 116.126 69.382  4.627   1.00 21.19  ? 237  ALA L O   1 
ATOM   4469  C  CB  . ALA B  2  237 ? 118.847 71.387  4.550   1.00 14.86  ? 237  ALA L CB  1 
ATOM   4470  N  N   . SER B  2  238 ? 116.288 70.926  3.002   1.00 22.73  ? 238  SER L N   1 
ATOM   4471  C  CA  . SER B  2  238 ? 114.845 71.211  2.924   1.00 21.97  ? 238  SER L CA  1 
ATOM   4472  C  C   . SER B  2  238 ? 114.042 69.970  2.614   1.00 18.54  ? 238  SER L C   1 
ATOM   4473  O  O   . SER B  2  238 ? 112.859 69.884  2.950   1.00 19.13  ? 238  SER L O   1 
ATOM   4474  C  CB  . SER B  2  238 ? 114.546 72.273  1.857   1.00 19.01  ? 238  SER L CB  1 
ATOM   4475  O  OG  . SER B  2  238 ? 115.008 73.560  2.244   1.00 20.41  ? 238  SER L OG  1 
ATOM   4476  N  N   . ASN B  2  239 ? 114.714 68.982  2.043   1.00 16.16  ? 239  ASN L N   1 
ATOM   4477  C  CA  . ASN B  2  239 ? 114.040 67.828  1.499   1.00 18.76  ? 239  ASN L CA  1 
ATOM   4478  C  C   . ASN B  2  239 ? 113.865 66.773  2.566   1.00 20.07  ? 239  ASN L C   1 
ATOM   4479  O  O   . ASN B  2  239 ? 113.092 65.824  2.395   1.00 18.74  ? 239  ASN L O   1 
ATOM   4480  C  CB  . ASN B  2  239 ? 114.834 67.268  0.331   1.00 23.84  ? 239  ASN L CB  1 
ATOM   4481  C  CG  . ASN B  2  239 ? 114.168 67.517  -1.005  1.00 26.38  ? 239  ASN L CG  1 
ATOM   4482  O  OD1 . ASN B  2  239 ? 114.700 67.134  -2.024  1.00 37.90  ? 239  ASN L OD1 1 
ATOM   4483  N  ND2 . ASN B  2  239 ? 112.996 68.128  -1.006  1.00 28.73  ? 239  ASN L ND2 1 
ATOM   4484  N  N   . ILE B  2  240 ? 114.582 66.948  3.667   1.00 18.35  ? 240  ILE L N   1 
ATOM   4485  C  CA  . ILE B  2  240 ? 114.357 66.146  4.852   1.00 21.76  ? 240  ILE L CA  1 
ATOM   4486  C  C   . ILE B  2  240 ? 112.883 66.230  5.245   1.00 23.28  ? 240  ILE L C   1 
ATOM   4487  O  O   . ILE B  2  240 ? 112.294 65.235  5.659   1.00 26.52  ? 240  ILE L O   1 
ATOM   4488  C  CB  . ILE B  2  240 ? 115.192 66.646  6.054   1.00 20.35  ? 240  ILE L CB  1 
ATOM   4489  C  CG1 . ILE B  2  240 ? 116.683 66.570  5.751   1.00 16.60  ? 240  ILE L CG1 1 
ATOM   4490  C  CG2 . ILE B  2  240 ? 114.882 65.817  7.277   1.00 20.92  ? 240  ILE L CG2 1 
ATOM   4491  C  CD1 . ILE B  2  240 ? 117.494 67.462  6.657   1.00 9.29   ? 240  ILE L CD1 1 
ATOM   4492  N  N   . PHE B  2  241 ? 112.300 67.424  5.155   1.00 23.16  ? 241  PHE L N   1 
ATOM   4493  C  CA  . PHE B  2  241 ? 110.910 67.610  5.550   1.00 19.61  ? 241  PHE L CA  1 
ATOM   4494  C  C   . PHE B  2  241 ? 109.960 67.527  4.375   1.00 22.66  ? 241  PHE L C   1 
ATOM   4495  O  O   . PHE B  2  241 ? 108.865 66.971  4.491   1.00 25.08  ? 241  PHE L O   1 
ATOM   4496  C  CB  . PHE B  2  241 ? 110.725 68.933  6.291   1.00 15.79  ? 241  PHE L CB  1 
ATOM   4497  C  CG  . PHE B  2  241 ? 111.317 68.932  7.681   1.00 20.33  ? 241  PHE L CG  1 
ATOM   4498  C  CD1 . PHE B  2  241 ? 112.009 67.817  8.165   1.00 19.86  ? 241  PHE L CD1 1 
ATOM   4499  C  CD2 . PHE B  2  241 ? 111.189 70.036  8.505   1.00 13.87  ? 241  PHE L CD2 1 
ATOM   4500  C  CE1 . PHE B  2  241 ? 112.560 67.811  9.452   1.00 20.92  ? 241  PHE L CE1 1 
ATOM   4501  C  CE2 . PHE B  2  241 ? 111.740 70.039  9.791   1.00 16.15  ? 241  PHE L CE2 1 
ATOM   4502  C  CZ  . PHE B  2  241 ? 112.423 68.929  10.265  1.00 17.99  ? 241  PHE L CZ  1 
ATOM   4503  N  N   . LEU B  2  242 ? 110.400 67.978  3.210   1.00 20.48  ? 242  LEU L N   1 
ATOM   4504  C  CA  . LEU B  2  242 ? 109.480 68.003  2.092   1.00 21.98  ? 242  LEU L CA  1 
ATOM   4505  C  C   . LEU B  2  242 ? 109.123 66.600  1.640   1.00 24.81  ? 242  LEU L C   1 
ATOM   4506  O  O   . LEU B  2  242 ? 107.951 66.326  1.371   1.00 27.22  ? 242  LEU L O   1 
ATOM   4507  C  CB  . LEU B  2  242 ? 110.041 68.811  0.936   1.00 22.07  ? 242  LEU L CB  1 
ATOM   4508  C  CG  . LEU B  2  242 ? 110.099 70.303  1.264   1.00 21.86  ? 242  LEU L CG  1 
ATOM   4509  C  CD1 . LEU B  2  242 ? 110.645 71.035  0.083   1.00 21.34  ? 242  LEU L CD1 1 
ATOM   4510  C  CD2 . LEU B  2  242 ? 108.738 70.833  1.645   1.00 18.57  ? 242  LEU L CD2 1 
ATOM   4511  N  N   . THR B  2  243 ? 110.079 65.675  1.692   1.00 19.53  ? 243  THR L N   1 
ATOM   4512  C  CA  . THR B  2  243 ? 109.751 64.296  1.348   1.00 20.68  ? 243  THR L CA  1 
ATOM   4513  C  C   . THR B  2  243 ? 109.180 63.521  2.546   1.00 23.55  ? 243  THR L C   1 
ATOM   4514  O  O   . THR B  2  243 ? 108.258 62.703  2.395   1.00 22.43  ? 243  THR L O   1 
ATOM   4515  C  CB  . THR B  2  243 ? 110.962 63.570  0.793   1.00 16.10  ? 243  THR L CB  1 
ATOM   4516  O  OG1 . THR B  2  243 ? 111.908 63.373  1.834   1.00 19.77  ? 243  THR L OG1 1 
ATOM   4517  C  CG2 . THR B  2  243 ? 111.609 64.400  -0.275  1.00 23.28  ? 243  THR L CG2 1 
ATOM   4518  N  N   . GLY B  2  244 ? 109.671 63.847  3.741   1.00 25.48  ? 244  GLY L N   1 
ATOM   4519  C  CA  . GLY B  2  244 ? 109.139 63.264  4.959   1.00 23.02  ? 244  GLY L CA  1 
ATOM   4520  C  C   . GLY B  2  244 ? 107.662 63.564  5.206   1.00 20.99  ? 244  GLY L C   1 
ATOM   4521  O  O   . GLY B  2  244 ? 106.919 62.708  5.706   1.00 20.40  ? 244  GLY L O   1 
ATOM   4522  N  N   . ALA B  2  245 ? 107.214 64.751  4.814   1.00 20.89  ? 245  ALA L N   1 
ATOM   4523  C  CA  . ALA B  2  245 ? 105.810 65.120  4.973   1.00 20.34  ? 245  ALA L CA  1 
ATOM   4524  C  C   . ALA B  2  245 ? 104.847 64.086  4.352   1.00 24.55  ? 245  ALA L C   1 
ATOM   4525  O  O   . ALA B  2  245 ? 103.755 63.844  4.883   1.00 25.63  ? 245  ALA L O   1 
ATOM   4526  C  CB  . ALA B  2  245 ? 105.563 66.489  4.388   1.00 18.43  ? 245  ALA L CB  1 
ATOM   4527  N  N   . PHE B  2  246 ? 105.290 63.396  3.308   1.00 21.38  ? 246  PHE L N   1 
ATOM   4528  C  CA  . PHE B  2  246 ? 104.433 62.434  2.635   1.00 25.18  ? 246  PHE L CA  1 
ATOM   4529  C  C   . PHE B  2  246 ? 104.328 61.149  3.430   1.00 25.23  ? 246  PHE L C   1 
ATOM   4530  O  O   . PHE B  2  246 ? 103.236 60.616  3.629   1.00 27.42  ? 246  PHE L O   1 
ATOM   4531  C  CB  . PHE B  2  246 ? 104.976 62.149  1.245   1.00 34.02  ? 246  PHE L CB  1 
ATOM   4532  C  CG  . PHE B  2  246 ? 104.943 63.335  0.350   1.00 45.71  ? 246  PHE L CG  1 
ATOM   4533  C  CD1 . PHE B  2  246 ? 105.791 64.419  0.584   1.00 53.59  ? 246  PHE L CD1 1 
ATOM   4534  C  CD2 . PHE B  2  246 ? 103.997 63.429  -0.660  1.00 50.24  ? 246  PHE L CD2 1 
ATOM   4535  C  CE1 . PHE B  2  246 ? 105.692 65.594  -0.175  1.00 56.43  ? 246  PHE L CE1 1 
ATOM   4536  C  CE2 . PHE B  2  246 ? 103.890 64.593  -1.424  1.00 55.10  ? 246  PHE L CE2 1 
ATOM   4537  C  CZ  . PHE B  2  246 ? 104.743 65.681  -1.176  1.00 56.79  ? 246  PHE L CZ  1 
ATOM   4538  N  N   . GLY B  2  247 ? 105.459 60.705  3.961   1.00 24.06  ? 247  GLY L N   1 
ATOM   4539  C  CA  . GLY B  2  247 ? 105.462 59.545  4.820   1.00 20.08  ? 247  GLY L CA  1 
ATOM   4540  C  C   . GLY B  2  247 ? 104.574 59.772  6.019   1.00 17.63  ? 247  GLY L C   1 
ATOM   4541  O  O   . GLY B  2  247 ? 103.914 58.839  6.487   1.00 20.20  ? 247  GLY L O   1 
ATOM   4542  N  N   . THR B  2  248 ? 104.635 60.972  6.586   1.00 17.84  ? 248  THR L N   1 
ATOM   4543  C  CA  . THR B  2  248 ? 103.846 61.275  7.769   1.00 15.65  ? 248  THR L CA  1 
ATOM   4544  C  C   . THR B  2  248 ? 102.385 61.347  7.405   1.00 18.52  ? 248  THR L C   1 
ATOM   4545  O  O   . THR B  2  248 ? 101.563 60.721  8.063   1.00 21.23  ? 248  THR L O   1 
ATOM   4546  C  CB  . THR B  2  248 ? 104.252 62.598  8.367   1.00 18.24  ? 248  THR L CB  1 
ATOM   4547  O  OG1 . THR B  2  248 ? 105.657 62.571  8.614   1.00 17.82  ? 248  THR L OG1 1 
ATOM   4548  C  CG2 . THR B  2  248 ? 103.485 62.877  9.648   1.00 13.15  ? 248  THR L CG2 1 
ATOM   4549  N  N   . ILE B  2  249 ? 102.064 62.037  6.307   1.00 19.04  ? 249  ILE L N   1 
ATOM   4550  C  CA  . ILE B  2  249 ? 100.667 62.300  5.973   1.00 17.07  ? 249  ILE L CA  1 
ATOM   4551  C  C   . ILE B  2  249 ? 99.990  61.019  5.545   1.00 16.77  ? 249  ILE L C   1 
ATOM   4552  O  O   . ILE B  2  249 ? 98.821  60.815  5.819   1.00 16.84  ? 249  ILE L O   1 
ATOM   4553  C  CB  . ILE B  2  249 ? 100.532 63.349  4.863   1.00 16.32  ? 249  ILE L CB  1 
ATOM   4554  C  CG1 . ILE B  2  249 ? 100.439 64.742  5.478   1.00 23.58  ? 249  ILE L CG1 1 
ATOM   4555  C  CG2 . ILE B  2  249 ? 99.271  63.147  4.078   1.00 20.07  ? 249  ILE L CG2 1 
ATOM   4556  C  CD1 . ILE B  2  249 ? 99.055  65.140  6.003   1.00 22.58  ? 249  ILE L CD1 1 
ATOM   4557  N  N   . ALA B  2  250 ? 100.768 60.104  4.990   1.00 15.12  ? 250  ALA L N   1 
ATOM   4558  C  CA  . ALA B  2  250 ? 100.210 58.899  4.439   1.00 15.72  ? 250  ALA L CA  1 
ATOM   4559  C  C   . ALA B  2  250 ? 99.767  57.964  5.543   1.00 18.88  ? 250  ALA L C   1 
ATOM   4560  O  O   . ALA B  2  250 ? 98.930  57.079  5.330   1.00 24.19  ? 250  ALA L O   1 
ATOM   4561  C  CB  . ALA B  2  250 ? 101.240 58.215  3.549   1.00 20.24  ? 250  ALA L CB  1 
ATOM   4562  N  N   . SER B  2  251 ? 100.383 58.099  6.707   1.00 20.60  ? 251  SER L N   1 
ATOM   4563  C  CA  . SER B  2  251 ? 100.212 57.112  7.770   1.00 18.50  ? 251  SER L CA  1 
ATOM   4564  C  C   . SER B  2  251 ? 98.911  57.346  8.534   1.00 19.12  ? 251  SER L C   1 
ATOM   4565  O  O   . SER B  2  251 ? 98.784  58.298  9.314   1.00 20.82  ? 251  SER L O   1 
ATOM   4566  C  CB  . SER B  2  251 ? 101.397 57.174  8.730   1.00 15.58  ? 251  SER L CB  1 
ATOM   4567  O  OG  . SER B  2  251 ? 102.606 56.919  8.044   1.00 16.56  ? 251  SER L OG  1 
ATOM   4568  N  N   . GLY B  2  252 ? 97.960  56.448  8.340   1.00 18.03  ? 252  GLY L N   1 
ATOM   4569  C  CA  . GLY B  2  252 ? 96.634  56.654  8.893   1.00 21.29  ? 252  GLY L CA  1 
ATOM   4570  C  C   . GLY B  2  252 ? 95.657  57.095  7.822   1.00 20.03  ? 252  GLY L C   1 
ATOM   4571  O  O   . GLY B  2  252 ? 94.749  56.342  7.465   1.00 21.81  ? 252  GLY L O   1 
ATOM   4572  N  N   . PRO B  2  253 ? 95.834  58.294  7.251   1.00 21.86  ? 253  PRO L N   1 
ATOM   4573  C  CA  . PRO B  2  253 ? 94.830  58.697  6.267   1.00 20.48  ? 253  PRO L CA  1 
ATOM   4574  C  C   . PRO B  2  253 ? 94.910  57.930  4.953   1.00 22.42  ? 253  PRO L C   1 
ATOM   4575  O  O   . PRO B  2  253 ? 93.955  57.938  4.216   1.00 26.13  ? 253  PRO L O   1 
ATOM   4576  C  CB  . PRO B  2  253 ? 95.101  60.182  6.069   1.00 22.96  ? 253  PRO L CB  1 
ATOM   4577  C  CG  . PRO B  2  253 ? 95.790  60.609  7.335   1.00 24.94  ? 253  PRO L CG  1 
ATOM   4578  C  CD  . PRO B  2  253 ? 96.633  59.441  7.720   1.00 21.04  ? 253  PRO L CD  1 
ATOM   4579  N  N   . PHE B  2  254 ? 96.063  57.341  4.625   1.00 22.97  ? 254  PHE L N   1 
ATOM   4580  C  CA  . PHE B  2  254 ? 96.258  56.633  3.346   1.00 22.53  ? 254  PHE L CA  1 
ATOM   4581  C  C   . PHE B  2  254 ? 96.889  55.236  3.462   1.00 24.57  ? 254  PHE L C   1 
ATOM   4582  O  O   . PHE B  2  254 ? 97.086  54.537  2.464   1.00 26.07  ? 254  PHE L O   1 
ATOM   4583  C  CB  . PHE B  2  254 ? 97.111  57.470  2.394   1.00 22.33  ? 254  PHE L CB  1 
ATOM   4584  C  CG  . PHE B  2  254 ? 96.461  58.749  1.982   1.00 28.84  ? 254  PHE L CG  1 
ATOM   4585  C  CD1 . PHE B  2  254 ? 96.561  59.878  2.788   1.00 32.44  ? 254  PHE L CD1 1 
ATOM   4586  C  CD2 . PHE B  2  254 ? 95.569  58.771  0.922   1.00 29.56  ? 254  PHE L CD2 1 
ATOM   4587  C  CE1 . PHE B  2  254 ? 95.770  61.012  2.562   1.00 34.84  ? 254  PHE L CE1 1 
ATOM   4588  C  CE2 . PHE B  2  254 ? 94.771  59.897  0.685   1.00 34.34  ? 254  PHE L CE2 1 
ATOM   4589  C  CZ  . PHE B  2  254 ? 94.872  61.021  1.513   1.00 33.38  ? 254  PHE L CZ  1 
ATOM   4590  N  N   . TRP B  2  255 ? 97.274  54.851  4.664   1.00 21.10  ? 255  TRP L N   1 
ATOM   4591  C  CA  . TRP B  2  255 ? 97.810  53.521  4.877   1.00 21.33  ? 255  TRP L CA  1 
ATOM   4592  C  C   . TRP B  2  255 ? 97.563  53.185  6.327   1.00 23.41  ? 255  TRP L C   1 
ATOM   4593  O  O   . TRP B  2  255 ? 97.852  53.997  7.213   1.00 27.58  ? 255  TRP L O   1 
ATOM   4594  C  CB  . TRP B  2  255 ? 99.297  53.500  4.595   1.00 20.89  ? 255  TRP L CB  1 
ATOM   4595  C  CG  . TRP B  2  255 ? 99.848  52.138  4.528   1.00 23.60  ? 255  TRP L CG  1 
ATOM   4596  C  CD1 . TRP B  2  255 ? 100.747 51.576  5.384   1.00 23.11  ? 255  TRP L CD1 1 
ATOM   4597  C  CD2 . TRP B  2  255 ? 99.538  51.139  3.553   1.00 22.36  ? 255  TRP L CD2 1 
ATOM   4598  N  NE1 . TRP B  2  255 ? 101.021 50.285  5.003   1.00 25.56  ? 255  TRP L NE1 1 
ATOM   4599  C  CE2 . TRP B  2  255 ? 100.293 49.984  3.883   1.00 23.58  ? 255  TRP L CE2 1 
ATOM   4600  C  CE3 . TRP B  2  255 ? 98.696  51.105  2.433   1.00 18.36  ? 255  TRP L CE3 1 
ATOM   4601  C  CZ2 . TRP B  2  255 ? 100.234 48.801  3.134   1.00 17.56  ? 255  TRP L CZ2 1 
ATOM   4602  C  CZ3 . TRP B  2  255 ? 98.642  49.925  1.683   1.00 19.97  ? 255  TRP L CZ3 1 
ATOM   4603  C  CH2 . TRP B  2  255 ? 99.407  48.792  2.041   1.00 17.52  ? 255  TRP L CH2 1 
ATOM   4604  N  N   . THR B  2  256 ? 96.897  52.065  6.565   1.00 20.48  ? 256  THR L N   1 
ATOM   4605  C  CA  . THR B  2  256 ? 96.541  51.693  7.920   1.00 21.88  ? 256  THR L CA  1 
ATOM   4606  C  C   . THR B  2  256 ? 97.243  50.427  8.388   1.00 23.74  ? 256  THR L C   1 
ATOM   4607  O  O   . THR B  2  256 ? 97.118  50.038  9.560   1.00 29.15  ? 256  THR L O   1 
ATOM   4608  C  CB  . THR B  2  256 ? 95.046  51.496  8.052   1.00 20.98  ? 256  THR L CB  1 
ATOM   4609  O  OG1 . THR B  2  256 ? 94.660  50.350  7.295   1.00 25.01  ? 256  THR L OG1 1 
ATOM   4610  C  CG2 . THR B  2  256 ? 94.291  52.726  7.528   1.00 23.59  ? 256  THR L CG2 1 
ATOM   4611  N  N   . ARG B  2  257 ? 98.003  49.804  7.490   1.00 23.87  ? 257  ARG L N   1 
ATOM   4612  C  CA  . ARG B  2  257 ? 98.712  48.576  7.820   1.00 27.64  ? 257  ARG L CA  1 
ATOM   4613  C  C   . ARG B  2  257 ? 100.146 48.861  8.263   1.00 25.67  ? 257  ARG L C   1 
ATOM   4614  O  O   . ARG B  2  257 ? 100.529 50.006  8.396   1.00 26.73  ? 257  ARG L O   1 
ATOM   4615  C  CB  . ARG B  2  257 ? 98.698  47.657  6.620   1.00 28.15  ? 257  ARG L CB  1 
ATOM   4616  C  CG  . ARG B  2  257 ? 97.326  47.523  6.031   1.00 38.45  ? 257  ARG L CG  1 
ATOM   4617  C  CD  . ARG B  2  257 ? 97.251  46.345  5.100   1.00 49.28  ? 257  ARG L CD  1 
ATOM   4618  N  NE  . ARG B  2  257 ? 96.690  46.716  3.807   1.00 60.45  ? 257  ARG L NE  1 
ATOM   4619  C  CZ  . ARG B  2  257 ? 95.698  46.063  3.210   1.00 66.80  ? 257  ARG L CZ  1 
ATOM   4620  N  NH1 . ARG B  2  257 ? 95.123  45.027  3.818   1.00 65.70  ? 257  ARG L NH1 1 
ATOM   4621  N  NH2 . ARG B  2  257 ? 95.237  46.493  2.032   1.00 71.69  ? 257  ARG L NH2 1 
ATOM   4622  N  N   . GLY B  2  258 ? 100.903 47.822  8.586   1.00 27.42  ? 258  GLY L N   1 
ATOM   4623  C  CA  . GLY B  2  258 ? 102.315 48.005  8.872   1.00 23.61  ? 258  GLY L CA  1 
ATOM   4624  C  C   . GLY B  2  258 ? 103.013 48.502  7.625   1.00 24.80  ? 258  GLY L C   1 
ATOM   4625  O  O   . GLY B  2  258 ? 102.517 48.315  6.515   1.00 26.25  ? 258  GLY L O   1 
ATOM   4626  N  N   . TRP B  2  259 ? 104.112 49.221  7.788   1.00 22.58  ? 259  TRP L N   1 
ATOM   4627  C  CA  . TRP B  2  259 ? 104.841 49.690  6.623   1.00 20.09  ? 259  TRP L CA  1 
ATOM   4628  C  C   . TRP B  2  259 ? 105.626 48.632  5.852   1.00 19.50  ? 259  TRP L C   1 
ATOM   4629  O  O   . TRP B  2  259 ? 105.681 48.694  4.633   1.00 19.59  ? 259  TRP L O   1 
ATOM   4630  C  CB  . TRP B  2  259 ? 105.751 50.847  6.995   1.00 21.05  ? 259  TRP L CB  1 
ATOM   4631  C  CG  . TRP B  2  259 ? 105.029 52.114  6.895   1.00 22.12  ? 259  TRP L CG  1 
ATOM   4632  C  CD1 . TRP B  2  259 ? 104.713 52.959  7.914   1.00 20.80  ? 259  TRP L CD1 1 
ATOM   4633  C  CD2 . TRP B  2  259 ? 104.405 52.638  5.724   1.00 18.41  ? 259  TRP L CD2 1 
ATOM   4634  N  NE1 . TRP B  2  259 ? 103.929 53.977  7.446   1.00 20.69  ? 259  TRP L NE1 1 
ATOM   4635  C  CE2 . TRP B  2  259 ? 103.725 53.800  6.101   1.00 17.82  ? 259  TRP L CE2 1 
ATOM   4636  C  CE3 . TRP B  2  259 ? 104.364 52.236  4.383   1.00 21.48  ? 259  TRP L CE3 1 
ATOM   4637  C  CZ2 . TRP B  2  259 ? 103.011 54.571  5.188   1.00 19.28  ? 259  TRP L CZ2 1 
ATOM   4638  C  CZ3 . TRP B  2  259 ? 103.663 53.004  3.480   1.00 20.15  ? 259  TRP L CZ3 1 
ATOM   4639  C  CH2 . TRP B  2  259 ? 102.996 54.159  3.886   1.00 17.97  ? 259  TRP L CH2 1 
ATOM   4640  N  N   . PRO B  2  260 ? 106.170 47.604  6.526   1.00 18.06  ? 260  PRO L N   1 
ATOM   4641  C  CA  . PRO B  2  260 ? 106.744 46.529  5.719   1.00 20.94  ? 260  PRO L CA  1 
ATOM   4642  C  C   . PRO B  2  260 ? 105.787 46.027  4.627   1.00 24.11  ? 260  PRO L C   1 
ATOM   4643  O  O   . PRO B  2  260 ? 106.143 46.048  3.453   1.00 28.19  ? 260  PRO L O   1 
ATOM   4644  C  CB  . PRO B  2  260 ? 107.064 45.453  6.750   1.00 16.84  ? 260  PRO L CB  1 
ATOM   4645  C  CG  . PRO B  2  260 ? 107.345 46.193  7.964   1.00 15.97  ? 260  PRO L CG  1 
ATOM   4646  C  CD  . PRO B  2  260 ? 106.362 47.344  7.958   1.00 16.35  ? 260  PRO L CD  1 
ATOM   4647  N  N   . GLU B  2  261 ? 104.527 45.770  4.989   1.00 28.11  ? 261  GLU L N   1 
ATOM   4648  C  CA  . GLU B  2  261 ? 103.538 45.230  4.045   1.00 26.18  ? 261  GLU L CA  1 
ATOM   4649  C  C   . GLU B  2  261 ? 103.297 46.114  2.820   1.00 25.19  ? 261  GLU L C   1 
ATOM   4650  O  O   . GLU B  2  261 ? 103.081 45.623  1.708   1.00 25.18  ? 261  GLU L O   1 
ATOM   4651  C  CB  . GLU B  2  261 ? 102.202 44.945  4.742   1.00 29.11  ? 261  GLU L CB  1 
ATOM   4652  C  CG  . GLU B  2  261 ? 101.281 44.070  3.896   1.00 34.00  ? 261  GLU L CG  1 
ATOM   4653  C  CD  . GLU B  2  261 ? 99.967  43.674  4.569   1.00 42.33  ? 261  GLU L CD  1 
ATOM   4654  O  OE1 . GLU B  2  261 ? 99.900  43.610  5.829   1.00 41.77  ? 261  GLU L OE1 1 
ATOM   4655  O  OE2 . GLU B  2  261 ? 99.006  43.376  3.809   1.00 45.45  ? 261  GLU L OE2 1 
ATOM   4656  N  N   . TRP B  2  262 ? 103.468 47.412  2.987   1.00 23.49  ? 262  TRP L N   1 
ATOM   4657  C  CA  . TRP B  2  262 ? 103.379 48.300  1.858   1.00 23.42  ? 262  TRP L CA  1 
ATOM   4658  C  C   . TRP B  2  262 ? 104.246 47.798  0.712   1.00 23.78  ? 262  TRP L C   1 
ATOM   4659  O  O   . TRP B  2  262 ? 103.774 47.675  -0.405  1.00 29.33  ? 262  TRP L O   1 
ATOM   4660  C  CB  . TRP B  2  262 ? 103.810 49.682  2.262   1.00 20.65  ? 262  TRP L CB  1 
ATOM   4661  C  CG  . TRP B  2  262 ? 103.601 50.595  1.205   1.00 20.19  ? 262  TRP L CG  1 
ATOM   4662  C  CD1 . TRP B  2  262 ? 102.429 51.200  0.859   1.00 17.75  ? 262  TRP L CD1 1 
ATOM   4663  C  CD2 . TRP B  2  262 ? 104.581 51.046  0.292   1.00 19.23  ? 262  TRP L CD2 1 
ATOM   4664  N  NE1 . TRP B  2  262 ? 102.631 52.019  -0.225  1.00 13.62  ? 262  TRP L NE1 1 
ATOM   4665  C  CE2 . TRP B  2  262 ? 103.947 51.940  -0.594  1.00 18.72  ? 262  TRP L CE2 1 
ATOM   4666  C  CE3 . TRP B  2  262 ? 105.947 50.795  0.140   1.00 23.44  ? 262  TRP L CE3 1 
ATOM   4667  C  CZ2 . TRP B  2  262 ? 104.637 52.585  -1.624  1.00 22.44  ? 262  TRP L CZ2 1 
ATOM   4668  C  CZ3 . TRP B  2  262 ? 106.640 51.439  -0.887  1.00 22.21  ? 262  TRP L CZ3 1 
ATOM   4669  C  CH2 . TRP B  2  262 ? 105.983 52.320  -1.754  1.00 22.86  ? 262  TRP L CH2 1 
ATOM   4670  N  N   . TRP B  2  263 ? 105.427 47.290  1.032   1.00 25.18  ? 263  TRP L N   1 
ATOM   4671  C  CA  . TRP B  2  263 ? 106.375 46.878  0.002   1.00 26.29  ? 263  TRP L CA  1 
ATOM   4672  C  C   . TRP B  2  263 ? 105.951 45.648  -0.764  1.00 28.29  ? 263  TRP L C   1 
ATOM   4673  O  O   . TRP B  2  263 ? 106.531 45.314  -1.798  1.00 27.05  ? 263  TRP L O   1 
ATOM   4674  C  CB  . TRP B  2  263 ? 107.744 46.660  0.622   1.00 27.27  ? 263  TRP L CB  1 
ATOM   4675  C  CG  . TRP B  2  263 ? 108.359 47.947  0.985   1.00 27.70  ? 263  TRP L CG  1 
ATOM   4676  C  CD1 . TRP B  2  263 ? 108.135 48.672  2.137   1.00 25.02  ? 263  TRP L CD1 1 
ATOM   4677  C  CD2 . TRP B  2  263 ? 109.091 48.806  0.107   1.00 27.15  ? 263  TRP L CD2 1 
ATOM   4678  N  NE1 . TRP B  2  263 ? 108.670 49.936  2.008   1.00 23.46  ? 263  TRP L NE1 1 
ATOM   4679  C  CE2 . TRP B  2  263 ? 109.263 50.046  0.779   1.00 27.42  ? 263  TRP L CE2 1 
ATOM   4680  C  CE3 . TRP B  2  263 ? 109.596 48.659  -1.192  1.00 27.02  ? 263  TRP L CE3 1 
ATOM   4681  C  CZ2 . TRP B  2  263 ? 109.918 51.128  0.193   1.00 26.90  ? 263  TRP L CZ2 1 
ATOM   4682  C  CZ3 . TRP B  2  263 ? 110.241 49.731  -1.777  1.00 28.77  ? 263  TRP L CZ3 1 
ATOM   4683  C  CH2 . TRP B  2  263 ? 110.397 50.956  -1.085  1.00 30.80  ? 263  TRP L CH2 1 
ATOM   4684  N  N   . GLY B  2  264 ? 104.865 45.043  -0.310  1.00 32.78  ? 264  GLY L N   1 
ATOM   4685  C  CA  . GLY B  2  264 ? 104.284 43.922  -1.014  1.00 35.10  ? 264  GLY L CA  1 
ATOM   4686  C  C   . GLY B  2  264 ? 103.896 44.265  -2.437  1.00 38.80  ? 264  GLY L C   1 
ATOM   4687  O  O   . GLY B  2  264 ? 103.948 43.400  -3.300  1.00 42.50  ? 264  GLY L O   1 
ATOM   4688  N  N   . TRP B  2  265 ? 103.591 45.530  -2.708  1.00 42.02  ? 265  TRP L N   1 
ATOM   4689  C  CA  . TRP B  2  265 ? 103.398 45.983  -4.085  1.00 45.37  ? 265  TRP L CA  1 
ATOM   4690  C  C   . TRP B  2  265 ? 104.560 45.547  -4.985  1.00 45.78  ? 265  TRP L C   1 
ATOM   4691  O  O   . TRP B  2  265 ? 104.394 45.425  -6.196  1.00 50.23  ? 265  TRP L O   1 
ATOM   4692  C  CB  . TRP B  2  265 ? 103.226 47.516  -4.155  1.00 50.24  ? 265  TRP L CB  1 
ATOM   4693  C  CG  . TRP B  2  265 ? 104.498 48.319  -3.999  1.00 55.64  ? 265  TRP L CG  1 
ATOM   4694  C  CD1 . TRP B  2  265 ? 104.984 48.856  -2.844  1.00 56.79  ? 265  TRP L CD1 1 
ATOM   4695  C  CD2 . TRP B  2  265 ? 105.488 48.580  -5.009  1.00 58.33  ? 265  TRP L CD2 1 
ATOM   4696  N  NE1 . TRP B  2  265 ? 106.225 49.401  -3.059  1.00 59.04  ? 265  TRP L NE1 1 
ATOM   4697  C  CE2 . TRP B  2  265 ? 106.558 49.252  -4.379  1.00 58.63  ? 265  TRP L CE2 1 
ATOM   4698  C  CE3 . TRP B  2  265 ? 105.583 48.290  -6.380  1.00 59.69  ? 265  TRP L CE3 1 
ATOM   4699  C  CZ2 . TRP B  2  265 ? 107.715 49.643  -5.071  1.00 57.93  ? 265  TRP L CZ2 1 
ATOM   4700  C  CZ3 . TRP B  2  265 ? 106.739 48.673  -7.068  1.00 59.40  ? 265  TRP L CZ3 1 
ATOM   4701  C  CH2 . TRP B  2  265 ? 107.788 49.343  -6.408  1.00 57.81  ? 265  TRP L CH2 1 
ATOM   4702  N  N   . TRP B  2  266 ? 105.749 45.409  -4.408  1.00 40.74  ? 266  TRP L N   1 
ATOM   4703  C  CA  . TRP B  2  266 ? 106.880 44.882  -5.142  1.00 35.70  ? 266  TRP L CA  1 
ATOM   4704  C  C   . TRP B  2  266 ? 106.958 43.374  -4.952  1.00 32.52  ? 266  TRP L C   1 
ATOM   4705  O  O   . TRP B  2  266 ? 106.941 42.614  -5.915  1.00 34.28  ? 266  TRP L O   1 
ATOM   4706  C  CB  . TRP B  2  266 ? 108.161 45.541  -4.655  1.00 35.98  ? 266  TRP L CB  1 
ATOM   4707  C  CG  . TRP B  2  266 ? 109.408 44.849  -5.098  1.00 37.89  ? 266  TRP L CG  1 
ATOM   4708  C  CD1 . TRP B  2  266 ? 110.010 43.759  -4.506  1.00 43.61  ? 266  TRP L CD1 1 
ATOM   4709  C  CD2 . TRP B  2  266 ? 110.289 45.267  -6.149  1.00 38.42  ? 266  TRP L CD2 1 
ATOM   4710  N  NE1 . TRP B  2  266 ? 111.218 43.495  -5.121  1.00 39.04  ? 266  TRP L NE1 1 
ATOM   4711  C  CE2 . TRP B  2  266 ? 111.412 44.404  -6.127  1.00 37.51  ? 266  TRP L CE2 1 
ATOM   4712  C  CE3 . TRP B  2  266 ? 110.238 46.285  -7.112  1.00 37.13  ? 266  TRP L CE3 1 
ATOM   4713  C  CZ2 . TRP B  2  266 ? 112.468 44.536  -7.027  1.00 39.52  ? 266  TRP L CZ2 1 
ATOM   4714  C  CZ3 . TRP B  2  266 ? 111.284 46.408  -8.011  1.00 35.59  ? 266  TRP L CZ3 1 
ATOM   4715  C  CH2 . TRP B  2  266 ? 112.385 45.540  -7.962  1.00 39.68  ? 266  TRP L CH2 1 
ATOM   4716  N  N   . LEU B  2  267 ? 107.067 42.948  -3.708  1.00 26.73  ? 267  LEU L N   1 
ATOM   4717  C  CA  . LEU B  2  267 ? 107.289 41.556  -3.419  1.00 28.00  ? 267  LEU L CA  1 
ATOM   4718  C  C   . LEU B  2  267 ? 106.307 40.666  -4.160  1.00 30.75  ? 267  LEU L C   1 
ATOM   4719  O  O   . LEU B  2  267 ? 106.698 39.668  -4.743  1.00 34.09  ? 267  LEU L O   1 
ATOM   4720  C  CB  . LEU B  2  267 ? 107.167 41.312  -1.925  1.00 24.69  ? 267  LEU L CB  1 
ATOM   4721  C  CG  . LEU B  2  267 ? 107.928 40.083  -1.464  1.00 25.31  ? 267  LEU L CG  1 
ATOM   4722  C  CD1 . LEU B  2  267 ? 109.366 40.186  -1.920  1.00 20.50  ? 267  LEU L CD1 1 
ATOM   4723  C  CD2 . LEU B  2  267 ? 107.851 39.985  0.025   1.00 20.39  ? 267  LEU L CD2 1 
ATOM   4724  N  N   . ASP B  2  268 ? 105.058 41.095  -4.252  1.00 34.33  ? 268  ASP L N   1 
ATOM   4725  C  CA  . ASP B  2  268 ? 103.993 40.220  -4.754  1.00 39.69  ? 268  ASP L CA  1 
ATOM   4726  C  C   . ASP B  2  268 ? 103.614 40.408  -6.230  1.00 42.53  ? 268  ASP L C   1 
ATOM   4727  O  O   . ASP B  2  268 ? 102.509 40.011  -6.626  1.00 44.59  ? 268  ASP L O   1 
ATOM   4728  C  CB  . ASP B  2  268 ? 102.701 40.373  -3.930  1.00 39.04  ? 268  ASP L CB  1 
ATOM   4729  C  CG  . ASP B  2  268 ? 102.875 40.035  -2.458  1.00 39.99  ? 268  ASP L CG  1 
ATOM   4730  O  OD1 . ASP B  2  268 ? 103.576 39.055  -2.114  1.00 32.72  ? 268  ASP L OD1 1 
ATOM   4731  O  OD2 . ASP B  2  268 ? 102.217 40.723  -1.648  1.00 42.93  ? 268  ASP L OD2 1 
ATOM   4732  N  N   . ILE B  2  269 ? 104.442 41.095  -7.017  1.00 42.38  ? 269  ILE L N   1 
ATOM   4733  C  CA  . ILE B  2  269 ? 104.224 41.109  -8.463  1.00 43.08  ? 269  ILE L CA  1 
ATOM   4734  C  C   . ILE B  2  269 ? 104.201 39.649  -8.897  1.00 44.62  ? 269  ILE L C   1 
ATOM   4735  O  O   . ILE B  2  269 ? 105.122 38.891  -8.594  1.00 45.54  ? 269  ILE L O   1 
ATOM   4736  C  CB  . ILE B  2  269 ? 105.350 41.833  -9.236  1.00 42.66  ? 269  ILE L CB  1 
ATOM   4737  C  CG1 . ILE B  2  269 ? 105.308 43.334  -8.957  1.00 37.52  ? 269  ILE L CG1 1 
ATOM   4738  C  CG2 . ILE B  2  269 ? 105.190 41.588  -10.739 1.00 42.66  ? 269  ILE L CG2 1 
ATOM   4739  C  CD1 . ILE B  2  269 ? 106.488 44.098  -9.518  0.00 39.74  ? 269  ILE L CD1 1 
ATOM   4740  N  N   . PRO B  2  270 ? 103.090 39.200  -9.504  1.00 46.22  ? 270  PRO L N   1 
ATOM   4741  C  CA  . PRO B  2  270 ? 102.838 37.758  -9.536  1.00 46.18  ? 270  PRO L CA  1 
ATOM   4742  C  C   . PRO B  2  270 ? 103.779 37.055  -10.519 1.00 44.73  ? 270  PRO L C   1 
ATOM   4743  O  O   . PRO B  2  270 ? 104.091 35.872  -10.359 1.00 44.43  ? 270  PRO L O   1 
ATOM   4744  C  CB  . PRO B  2  270 ? 101.367 37.661  -9.954  1.00 46.89  ? 270  PRO L CB  1 
ATOM   4745  C  CG  . PRO B  2  270 ? 100.903 39.124  -10.196 1.00 47.18  ? 270  PRO L CG  1 
ATOM   4746  C  CD  . PRO B  2  270 ? 102.140 39.932  -10.355 1.00 46.01  ? 270  PRO L CD  1 
ATOM   4747  N  N   . PHE B  2  271 ? 104.301 37.836  -11.467 1.00 41.69  ? 271  PHE L N   1 
ATOM   4748  C  CA  . PHE B  2  271 ? 105.426 37.445  -12.314 1.00 41.39  ? 271  PHE L CA  1 
ATOM   4749  C  C   . PHE B  2  271 ? 106.497 36.648  -11.585 1.00 42.88  ? 271  PHE L C   1 
ATOM   4750  O  O   . PHE B  2  271 ? 107.146 35.795  -12.180 1.00 46.20  ? 271  PHE L O   1 
ATOM   4751  C  CB  . PHE B  2  271 ? 106.067 38.690  -12.950 1.00 40.10  ? 271  PHE L CB  1 
ATOM   4752  C  CG  . PHE B  2  271 ? 107.446 38.449  -13.541 1.00 36.38  ? 271  PHE L CG  1 
ATOM   4753  C  CD1 . PHE B  2  271 ? 107.593 37.746  -14.733 0.00 35.16  ? 271  PHE L CD1 1 
ATOM   4754  C  CD2 . PHE B  2  271 ? 108.578 38.984  -12.935 0.00 35.16  ? 271  PHE L CD2 1 
ATOM   4755  C  CE1 . PHE B  2  271 ? 108.846 37.581  -15.314 0.00 33.96  ? 271  PHE L CE1 1 
ATOM   4756  C  CE2 . PHE B  2  271 ? 109.836 38.825  -13.508 0.00 33.96  ? 271  PHE L CE2 1 
ATOM   4757  C  CZ  . PHE B  2  271 ? 109.971 38.122  -14.701 0.00 33.69  ? 271  PHE L CZ  1 
ATOM   4758  N  N   . TRP B  2  272 ? 106.831 37.058  -10.373 1.00 46.70  ? 272  TRP L N   1 
ATOM   4759  C  CA  . TRP B  2  272 ? 107.895 36.368  -9.661  1.00 49.42  ? 272  TRP L CA  1 
ATOM   4760  C  C   . TRP B  2  272 ? 107.456 35.787  -8.331  1.00 51.66  ? 272  TRP L C   1 
ATOM   4761  O  O   . TRP B  2  272 ? 108.304 35.307  -7.564  1.00 51.93  ? 272  TRP L O   1 
ATOM   4762  C  CB  . TRP B  2  272 ? 109.119 37.281  -9.465  1.00 48.61  ? 272  TRP L CB  1 
ATOM   4763  C  CG  . TRP B  2  272 ? 108.845 38.660  -8.909  1.00 44.81  ? 272  TRP L CG  1 
ATOM   4764  C  CD1 . TRP B  2  272 ? 107.867 39.027  -8.029  1.00 42.01  ? 272  TRP L CD1 1 
ATOM   4765  C  CD2 . TRP B  2  272 ? 109.604 39.833  -9.170  1.00 42.13  ? 272  TRP L CD2 1 
ATOM   4766  N  NE1 . TRP B  2  272 ? 107.962 40.357  -7.742  1.00 40.17  ? 272  TRP L NE1 1 
ATOM   4767  C  CE2 . TRP B  2  272 ? 109.020 40.880  -8.431  1.00 40.84  ? 272  TRP L CE2 1 
ATOM   4768  C  CE3 . TRP B  2  272 ? 110.739 40.097  -9.950  1.00 44.54  ? 272  TRP L CE3 1 
ATOM   4769  C  CZ2 . TRP B  2  272 ? 109.522 42.176  -8.451  1.00 41.28  ? 272  TRP L CZ2 1 
ATOM   4770  C  CZ3 . TRP B  2  272 ? 111.245 41.383  -9.969  1.00 43.84  ? 272  TRP L CZ3 1 
ATOM   4771  C  CH2 . TRP B  2  272 ? 110.635 42.411  -9.222  1.00 43.89  ? 272  TRP L CH2 1 
ATOM   4772  N  N   . SER B  2  273 ? 106.140 35.764  -8.099  1.00 53.28  ? 273  SER L N   1 
ATOM   4773  C  CA  . SER B  2  273 ? 105.582 35.286  -6.836  1.00 54.87  ? 273  SER L CA  1 
ATOM   4774  C  C   . SER B  2  273 ? 105.534 33.757  -6.733  1.00 56.97  ? 273  SER L C   1 
ATOM   4775  O  O   . SER B  2  273 ? 105.551 33.268  -5.583  1.00 61.24  ? 273  SER L O   1 
ATOM   4776  C  CB  . SER B  2  273 ? 104.188 35.866  -6.615  1.00 53.17  ? 273  SER L CB  1 
ATOM   4777  O  OG  . SER B  2  273 ? 104.223 37.280  -6.655  1.00 54.87  ? 273  SER L OG  1 
ATOM   4778  O  OXT . SER B  2  273 ? 105.595 33.060  -7.777  1.00 60.02  ? 273  SER L OXT 1 
ATOM   4779  N  N   . ALA C  3  1   ? 113.951 88.951  -8.850  1.00 51.28  ? 1    ALA M N   1 
ATOM   4780  C  CA  . ALA C  3  1   ? 114.471 87.679  -8.270  1.00 51.64  ? 1    ALA M CA  1 
ATOM   4781  C  C   . ALA C  3  1   ? 115.847 87.438  -8.836  1.00 48.65  ? 1    ALA M C   1 
ATOM   4782  O  O   . ALA C  3  1   ? 116.196 87.962  -9.901  1.00 52.42  ? 1    ALA M O   1 
ATOM   4783  C  CB  . ALA C  3  1   ? 113.567 86.489  -8.595  1.00 52.31  ? 1    ALA M CB  1 
ATOM   4784  N  N   . ASP C  3  2   ? 116.577 86.543  -8.202  1.00 43.22  ? 2    ASP M N   1 
ATOM   4785  C  CA  . ASP C  3  2   ? 117.894 86.229  -8.674  1.00 38.54  ? 2    ASP M CA  1 
ATOM   4786  C  C   . ASP C  3  2   ? 117.856 84.846  -9.292  1.00 36.60  ? 2    ASP M C   1 
ATOM   4787  O  O   . ASP C  3  2   ? 117.968 83.865  -8.581  1.00 39.84  ? 2    ASP M O   1 
ATOM   4788  C  CB  . ASP C  3  2   ? 118.848 86.270  -7.498  1.00 37.04  ? 2    ASP M CB  1 
ATOM   4789  C  CG  . ASP C  3  2   ? 120.271 86.223  -7.921  1.00 39.32  ? 2    ASP M CG  1 
ATOM   4790  O  OD1 . ASP C  3  2   ? 120.548 85.726  -9.034  1.00 41.67  ? 2    ASP M OD1 1 
ATOM   4791  O  OD2 . ASP C  3  2   ? 121.121 86.677  -7.135  1.00 40.34  ? 2    ASP M OD2 1 
ATOM   4792  N  N   . TYR C  3  3   ? 117.810 84.759  -10.618 1.00 35.57  ? 3    TYR M N   1 
ATOM   4793  C  CA  . TYR C  3  3   ? 117.681 83.456  -11.282 1.00 33.12  ? 3    TYR M CA  1 
ATOM   4794  C  C   . TYR C  3  3   ? 118.937 82.643  -11.157 1.00 31.44  ? 3    TYR M C   1 
ATOM   4795  O  O   . TYR C  3  3   ? 118.920 81.421  -11.331 1.00 28.63  ? 3    TYR M O   1 
ATOM   4796  C  CB  . TYR C  3  3   ? 117.347 83.623  -12.759 1.00 34.59  ? 3    TYR M CB  1 
ATOM   4797  C  CG  . TYR C  3  3   ? 116.000 84.243  -12.951 1.00 38.01  ? 3    TYR M CG  1 
ATOM   4798  C  CD1 . TYR C  3  3   ? 114.843 83.509  -12.714 1.00 41.55  ? 3    TYR M CD1 1 
ATOM   4799  C  CD2 . TYR C  3  3   ? 115.876 85.602  -13.189 1.00 38.84  ? 3    TYR M CD2 1 
ATOM   4800  C  CE1 . TYR C  3  3   ? 113.596 84.120  -12.697 1.00 44.76  ? 3    TYR M CE1 1 
ATOM   4801  C  CE2 . TYR C  3  3   ? 114.638 86.221  -13.178 1.00 42.13  ? 3    TYR M CE2 1 
ATOM   4802  C  CZ  . TYR C  3  3   ? 113.503 85.478  -12.933 1.00 43.77  ? 3    TYR M CZ  1 
ATOM   4803  O  OH  . TYR C  3  3   ? 112.275 86.102  -12.947 1.00 52.80  ? 3    TYR M OH  1 
ATOM   4804  N  N   . GLN C  3  4   ? 120.040 83.346  -10.935 1.00 29.79  ? 4    GLN M N   1 
ATOM   4805  C  CA  . GLN C  3  4   ? 121.336 82.702  -10.807 1.00 32.97  ? 4    GLN M CA  1 
ATOM   4806  C  C   . GLN C  3  4   ? 121.330 81.741  -9.621  1.00 29.95  ? 4    GLN M C   1 
ATOM   4807  O  O   . GLN C  3  4   ? 122.000 80.703  -9.653  1.00 26.05  ? 4    GLN M O   1 
ATOM   4808  C  CB  . GLN C  3  4   ? 122.438 83.754  -10.625 1.00 38.94  ? 4    GLN M CB  1 
ATOM   4809  C  CG  . GLN C  3  4   ? 122.713 84.644  -11.845 1.00 46.93  ? 4    GLN M CG  1 
ATOM   4810  C  CD  . GLN C  3  4   ? 123.318 83.876  -13.014 1.00 49.63  ? 4    GLN M CD  1 
ATOM   4811  O  OE1 . GLN C  3  4   ? 122.645 83.617  -14.021 1.00 52.29  ? 4    GLN M OE1 1 
ATOM   4812  N  NE2 . GLN C  3  4   ? 124.597 83.535  -12.899 1.00 51.87  ? 4    GLN M NE2 1 
ATOM   4813  N  N   . THR C  3  5   ? 120.567 82.091  -8.584  1.00 26.86  ? 5    THR M N   1 
ATOM   4814  C  CA  . THR C  3  5   ? 120.576 81.312  -7.364  1.00 26.97  ? 5    THR M CA  1 
ATOM   4815  C  C   . THR C  3  5   ? 119.780 80.043  -7.598  1.00 31.05  ? 5    THR M C   1 
ATOM   4816  O  O   . THR C  3  5   ? 120.061 79.028  -6.963  1.00 33.68  ? 5    THR M O   1 
ATOM   4817  C  CB  . THR C  3  5   ? 119.983 82.078  -6.163  1.00 25.80  ? 5    THR M CB  1 
ATOM   4818  O  OG1 . THR C  3  5   ? 118.591 82.327  -6.382  1.00 25.17  ? 5    THR M OG1 1 
ATOM   4819  C  CG2 . THR C  3  5   ? 120.697 83.399  -5.948  1.00 23.08  ? 5    THR M CG2 1 
ATOM   4820  N  N   . ILE C  3  6   ? 118.873 80.076  -8.584  1.00 31.19  ? 6    ILE M N   1 
ATOM   4821  C  CA  . ILE C  3  6   ? 118.111 78.887  -9.028  1.00 27.50  ? 6    ILE M CA  1 
ATOM   4822  C  C   . ILE C  3  6   ? 118.857 78.007  -10.038 1.00 26.09  ? 6    ILE M C   1 
ATOM   4823  O  O   . ILE C  3  6   ? 118.746 76.779  -9.987  1.00 23.31  ? 6    ILE M O   1 
ATOM   4824  C  CB  . ILE C  3  6   ? 116.746 79.277  -9.654  1.00 28.84  ? 6    ILE M CB  1 
ATOM   4825  C  CG1 . ILE C  3  6   ? 115.857 79.955  -8.610  1.00 33.70  ? 6    ILE M CG1 1 
ATOM   4826  C  CG2 . ILE C  3  6   ? 116.026 78.036  -10.179 1.00 30.70  ? 6    ILE M CG2 1 
ATOM   4827  C  CD1 . ILE C  3  6   ? 114.836 80.929  -9.202  1.00 37.97  ? 6    ILE M CD1 1 
ATOM   4828  N  N   . TYR C  3  7   ? 119.480 78.636  -11.037 1.00 26.43  ? 7    TYR M N   1 
ATOM   4829  C  CA  . TYR C  3  7   ? 120.290 77.921  -12.020 1.00 27.17  ? 7    TYR M CA  1 
ATOM   4830  C  C   . TYR C  3  7   ? 121.092 78.919  -12.834 1.00 28.15  ? 7    TYR M C   1 
ATOM   4831  O  O   . TYR C  3  7   ? 120.715 80.087  -12.969 1.00 27.72  ? 7    TYR M O   1 
ATOM   4832  C  CB  . TYR C  3  7   ? 119.411 77.099  -12.968 1.00 29.90  ? 7    TYR M CB  1 
ATOM   4833  C  CG  . TYR C  3  7   ? 118.609 77.957  -13.916 1.00 32.19  ? 7    TYR M CG  1 
ATOM   4834  C  CD1 . TYR C  3  7   ? 117.711 78.913  -13.427 1.00 36.31  ? 7    TYR M CD1 1 
ATOM   4835  C  CD2 . TYR C  3  7   ? 118.841 77.916  -15.281 1.00 32.21  ? 7    TYR M CD2 1 
ATOM   4836  C  CE1 . TYR C  3  7   ? 117.071 79.806  -14.266 1.00 36.39  ? 7    TYR M CE1 1 
ATOM   4837  C  CE2 . TYR C  3  7   ? 118.214 78.814  -16.132 1.00 37.39  ? 7    TYR M CE2 1 
ATOM   4838  C  CZ  . TYR C  3  7   ? 117.333 79.759  -15.617 1.00 40.83  ? 7    TYR M CZ  1 
ATOM   4839  O  OH  . TYR C  3  7   ? 116.759 80.695  -16.456 1.00 53.29  ? 7    TYR M OH  1 
ATOM   4840  N  N   . THR C  3  8   ? 122.143 78.412  -13.457 1.00 28.45  ? 8    THR M N   1 
ATOM   4841  C  CA  . THR C  3  8   ? 123.038 79.196  -14.287 1.00 33.26  ? 8    THR M CA  1 
ATOM   4842  C  C   . THR C  3  8   ? 122.398 79.567  -15.648 1.00 35.30  ? 8    THR M C   1 
ATOM   4843  O  O   . THR C  3  8   ? 122.462 78.791  -16.620 1.00 34.05  ? 8    THR M O   1 
ATOM   4844  C  CB  . THR C  3  8   ? 124.332 78.387  -14.517 1.00 34.50  ? 8    THR M CB  1 
ATOM   4845  O  OG1 . THR C  3  8   ? 124.823 77.899  -13.258 1.00 36.80  ? 8    THR M OG1 1 
ATOM   4846  C  CG2 . THR C  3  8   ? 125.384 79.233  -15.201 1.00 39.28  ? 8    THR M CG2 1 
ATOM   4847  N  N   . GLN C  3  9   ? 121.839 80.772  -15.736 1.00 34.34  ? 9    GLN M N   1 
ATOM   4848  C  CA  . GLN C  3  9   ? 121.255 81.256  -16.990 1.00 34.83  ? 9    GLN M CA  1 
ATOM   4849  C  C   . GLN C  3  9   ? 122.132 81.118  -18.259 1.00 36.25  ? 9    GLN M C   1 
ATOM   4850  O  O   . GLN C  3  9   ? 121.622 80.728  -19.307 1.00 39.26  ? 9    GLN M O   1 
ATOM   4851  C  CB  . GLN C  3  9   ? 120.836 82.709  -16.848 1.00 34.48  ? 9    GLN M CB  1 
ATOM   4852  C  CG  . GLN C  3  9   ? 119.827 82.951  -15.792 1.00 35.85  ? 9    GLN M CG  1 
ATOM   4853  C  CD  . GLN C  3  9   ? 119.393 84.383  -15.795 1.00 39.22  ? 9    GLN M CD  1 
ATOM   4854  O  OE1 . GLN C  3  9   ? 118.568 84.781  -16.619 1.00 45.41  ? 9    GLN M OE1 1 
ATOM   4855  N  NE2 . GLN C  3  9   ? 120.039 85.201  -14.975 1.00 33.88  ? 9    GLN M NE2 1 
ATOM   4856  N  N   . ILE C  3  10  ? 123.394 81.555  -18.208 1.00 33.35  ? 10   ILE M N   1 
ATOM   4857  C  CA  . ILE C  3  10  ? 124.298 81.461  -19.360 1.00 28.01  ? 10   ILE M CA  1 
ATOM   4858  C  C   . ILE C  3  10  ? 125.572 80.775  -18.932 1.00 26.59  ? 10   ILE M C   1 
ATOM   4859  O  O   . ILE C  3  10  ? 126.330 81.326  -18.148 1.00 29.71  ? 10   ILE M O   1 
ATOM   4860  C  CB  . ILE C  3  10  ? 124.677 82.847  -19.921 1.00 26.24  ? 10   ILE M CB  1 
ATOM   4861  C  CG1 . ILE C  3  10  ? 123.421 83.611  -20.330 1.00 26.12  ? 10   ILE M CG1 1 
ATOM   4862  C  CG2 . ILE C  3  10  ? 125.595 82.691  -21.125 1.00 24.38  ? 10   ILE M CG2 1 
ATOM   4863  C  CD1 . ILE C  3  10  ? 123.662 85.089  -20.590 1.00 27.97  ? 10   ILE M CD1 1 
ATOM   4864  N  N   . GLN C  3  11  ? 125.769 79.546  -19.380 1.00 24.64  ? 11   GLN M N   1 
ATOM   4865  C  CA  . GLN C  3  11  ? 126.924 78.771  -18.965 1.00 26.41  ? 11   GLN M CA  1 
ATOM   4866  C  C   . GLN C  3  11  ? 128.109 79.231  -19.758 1.00 31.32  ? 11   GLN M C   1 
ATOM   4867  O  O   . GLN C  3  11  ? 127.948 79.844  -20.808 1.00 35.63  ? 11   GLN M O   1 
ATOM   4868  C  CB  . GLN C  3  11  ? 126.708 77.279  -19.202 1.00 26.64  ? 11   GLN M CB  1 
ATOM   4869  C  CG  . GLN C  3  11  ? 125.533 76.710  -18.418 1.00 31.55  ? 11   GLN M CG  1 
ATOM   4870  C  CD  . GLN C  3  11  ? 125.349 75.213  -18.607 1.00 33.65  ? 11   GLN M CD  1 
ATOM   4871  O  OE1 . GLN C  3  11  ? 126.323 74.450  -18.639 1.00 31.53  ? 11   GLN M OE1 1 
ATOM   4872  N  NE2 . GLN C  3  11  ? 124.091 74.778  -18.666 1.00 33.74  ? 11   GLN M NE2 1 
ATOM   4873  N  N   . ALA C  3  12  ? 129.291 79.032  -19.192 1.00 35.27  ? 12   ALA M N   1 
ATOM   4874  C  CA  . ALA C  3  12  ? 130.544 79.442  -19.803 1.00 35.67  ? 12   ALA M CA  1 
ATOM   4875  C  C   . ALA C  3  12  ? 131.405 78.204  -19.946 1.00 37.78  ? 12   ALA M C   1 
ATOM   4876  O  O   . ALA C  3  12  ? 131.440 77.332  -19.077 1.00 36.85  ? 12   ALA M O   1 
ATOM   4877  C  CB  . ALA C  3  12  ? 131.271 80.487  -18.932 1.00 31.21  ? 12   ALA M CB  1 
ATOM   4878  N  N   . ARG C  3  13  ? 132.125 78.151  -21.048 1.00 41.02  ? 13   ARG M N   1 
ATOM   4879  C  CA  . ARG C  3  13  ? 132.986 77.038  -21.334 1.00 43.64  ? 13   ARG M CA  1 
ATOM   4880  C  C   . ARG C  3  13  ? 134.370 77.611  -21.544 1.00 46.94  ? 13   ARG M C   1 
ATOM   4881  O  O   . ARG C  3  13  ? 134.527 78.772  -21.955 1.00 47.30  ? 13   ARG M O   1 
ATOM   4882  C  CB  . ARG C  3  13  ? 132.486 76.322  -22.581 1.00 41.95  ? 13   ARG M CB  1 
ATOM   4883  C  CG  . ARG C  3  13  ? 131.094 75.721  -22.403 1.00 46.24  ? 13   ARG M CG  1 
ATOM   4884  C  CD  . ARG C  3  13  ? 131.154 74.510  -21.462 1.00 48.37  ? 13   ARG M CD  1 
ATOM   4885  N  NE  . ARG C  3  13  ? 129.958 73.667  -21.518 1.00 49.84  ? 13   ARG M NE  1 
ATOM   4886  C  CZ  . ARG C  3  13  ? 128.930 73.754  -20.677 1.00 48.67  ? 13   ARG M CZ  1 
ATOM   4887  N  NH1 . ARG C  3  13  ? 128.851 74.749  -19.795 1.00 49.15  ? 13   ARG M NH1 1 
ATOM   4888  N  NH2 . ARG C  3  13  ? 127.931 72.896  -20.792 1.00 51.43  ? 13   ARG M NH2 1 
ATOM   4889  N  N   . GLY C  3  14  ? 135.367 76.847  -21.124 1.00 46.76  ? 14   GLY M N   1 
ATOM   4890  C  CA  . GLY C  3  14  ? 136.720 77.347  -21.141 1.00 45.64  ? 14   GLY M CA  1 
ATOM   4891  C  C   . GLY C  3  14  ? 137.652 76.183  -20.935 1.00 46.90  ? 14   GLY M C   1 
ATOM   4892  O  O   . GLY C  3  14  ? 137.203 75.069  -20.636 1.00 49.25  ? 14   GLY M O   1 
ATOM   4893  N  N   . PRO C  3  15  ? 138.954 76.394  -21.147 1.00 48.15  ? 15   PRO M N   1 
ATOM   4894  C  CA  . PRO C  3  15  ? 139.966 75.348  -21.002 1.00 49.10  ? 15   PRO M CA  1 
ATOM   4895  C  C   . PRO C  3  15  ? 139.959 74.734  -19.602 1.00 50.91  ? 15   PRO M C   1 
ATOM   4896  O  O   . PRO C  3  15  ? 139.715 75.426  -18.610 1.00 54.39  ? 15   PRO M O   1 
ATOM   4897  C  CB  . PRO C  3  15  ? 141.273 76.084  -21.314 1.00 50.84  ? 15   PRO M CB  1 
ATOM   4898  C  CG  . PRO C  3  15  ? 140.932 77.558  -21.160 1.00 48.62  ? 15   PRO M CG  1 
ATOM   4899  C  CD  . PRO C  3  15  ? 139.538 77.653  -21.640 1.00 47.07  ? 15   PRO M CD  1 
ATOM   4900  N  N   . HIS C  3  16  ? 140.113 73.418  -19.535 1.00 52.58  ? 16   HIS M N   1 
ATOM   4901  C  CA  . HIS C  3  16  ? 140.081 72.713  -18.261 1.00 55.03  ? 16   HIS M CA  1 
ATOM   4902  C  C   . HIS C  3  16  ? 141.310 73.065  -17.419 1.00 56.66  ? 16   HIS M C   1 
ATOM   4903  O  O   . HIS C  3  16  ? 142.436 73.013  -17.923 1.00 57.41  ? 16   HIS M O   1 
ATOM   4904  C  CB  . HIS C  3  16  ? 139.971 71.195  -18.507 1.00 53.38  ? 16   HIS M CB  1 
ATOM   4905  C  CG  . HIS C  3  16  ? 141.187 70.412  -18.122 0.50 50.51  ? 16   HIS M CG  1 
ATOM   4906  N  ND1 . HIS C  3  16  ? 142.377 70.497  -18.812 0.50 49.84  ? 16   HIS M ND1 1 
ATOM   4907  C  CD2 . HIS C  3  16  ? 141.370 69.463  -17.173 0.50 50.34  ? 16   HIS M CD2 1 
ATOM   4908  C  CE1 . HIS C  3  16  ? 143.233 69.620  -18.319 0.50 50.56  ? 16   HIS M CE1 1 
ATOM   4909  N  NE2 . HIS C  3  16  ? 142.646 68.979  -17.325 0.50 49.80  ? 16   HIS M NE2 1 
ATOM   4910  N  N   . ILE C  3  17  ? 141.073 73.456  -16.161 1.00 58.38  ? 17   ILE M N   1 
ATOM   4911  C  CA  . ILE C  3  17  ? 142.133 73.846  -15.210 1.00 58.35  ? 17   ILE M CA  1 
ATOM   4912  C  C   . ILE C  3  17  ? 142.687 72.625  -14.451 1.00 56.71  ? 17   ILE M C   1 
ATOM   4913  O  O   . ILE C  3  17  ? 141.951 71.663  -14.166 1.00 57.37  ? 17   ILE M O   1 
ATOM   4914  C  CB  . ILE C  3  17  ? 141.612 74.883  -14.132 1.00 60.86  ? 17   ILE M CB  1 
ATOM   4915  C  CG1 . ILE C  3  17  ? 141.007 76.132  -14.801 1.00 61.72  ? 17   ILE M CG1 1 
ATOM   4916  C  CG2 . ILE C  3  17  ? 142.757 75.283  -13.182 1.00 61.20  ? 17   ILE M CG2 1 
ATOM   4917  C  CD1 . ILE C  3  17  ? 140.477 77.194  -13.820 1.00 57.35  ? 17   ILE M CD1 1 
ATOM   4918  N  N   . THR C  3  18  ? 143.972 72.675  -14.105 1.00 53.97  ? 18   THR M N   1 
ATOM   4919  C  CA  . THR C  3  18  ? 144.560 71.666  -13.229 1.00 52.89  ? 18   THR M CA  1 
ATOM   4920  C  C   . THR C  3  18  ? 145.529 72.270  -12.205 1.00 50.82  ? 18   THR M C   1 
ATOM   4921  O  O   . THR C  3  18  ? 146.487 72.961  -12.570 1.00 55.47  ? 18   THR M O   1 
ATOM   4922  C  CB  . THR C  3  18  ? 145.257 70.550  -14.057 1.00 53.17  ? 18   THR M CB  1 
ATOM   4923  O  OG1 . THR C  3  18  ? 144.271 69.863  -14.847 1.00 55.78  ? 18   THR M OG1 1 
ATOM   4924  C  CG2 . THR C  3  18  ? 145.946 69.538  -13.145 1.00 52.80  ? 18   THR M CG2 1 
ATOM   4925  N  N   . VAL C  3  19  ? 145.170 72.148  -10.927 1.00 45.12  ? 19   VAL M N   1 
ATOM   4926  C  CA  . VAL C  3  19  ? 146.010 72.630  -9.843  1.00 39.55  ? 19   VAL M CA  1 
ATOM   4927  C  C   . VAL C  3  19  ? 146.888 71.462  -9.436  1.00 41.13  ? 19   VAL M C   1 
ATOM   4928  O  O   . VAL C  3  19  ? 146.395 70.363  -9.206  1.00 38.73  ? 19   VAL M O   1 
ATOM   4929  C  CB  . VAL C  3  19  ? 145.170 73.103  -8.637  1.00 34.80  ? 19   VAL M CB  1 
ATOM   4930  C  CG1 . VAL C  3  19  ? 146.035 73.193  -7.408  1.00 32.86  ? 19   VAL M CG1 1 
ATOM   4931  C  CG2 . VAL C  3  19  ? 144.545 74.462  -8.917  1.00 32.26  ? 19   VAL M CG2 1 
ATOM   4932  N  N   . SER C  3  20  ? 148.197 71.677  -9.450  1.00 46.73  ? 20   SER M N   1 
ATOM   4933  C  CA  . SER C  3  20  ? 149.130 70.571  -9.330  1.00 49.24  ? 20   SER M CA  1 
ATOM   4934  C  C   . SER C  3  20  ? 149.329 70.098  -7.905  1.00 51.33  ? 20   SER M C   1 
ATOM   4935  O  O   . SER C  3  20  ? 149.596 70.898  -7.001  1.00 50.82  ? 20   SER M O   1 
ATOM   4936  C  CB  . SER C  3  20  ? 150.481 70.931  -9.936  1.00 51.09  ? 20   SER M CB  1 
ATOM   4937  O  OG  . SER C  3  20  ? 151.257 69.758  -10.136 1.00 57.00  ? 20   SER M OG  1 
ATOM   4938  N  N   . GLY C  3  21  ? 149.203 68.784  -7.725  1.00 52.38  ? 21   GLY M N   1 
ATOM   4939  C  CA  . GLY C  3  21  ? 149.523 68.160  -6.457  1.00 53.85  ? 21   GLY M CA  1 
ATOM   4940  C  C   . GLY C  3  21  ? 151.012 68.135  -6.188  1.00 53.55  ? 21   GLY M C   1 
ATOM   4941  O  O   . GLY C  3  21  ? 151.812 68.335  -7.102  1.00 56.56  ? 21   GLY M O   1 
ATOM   4942  N  N   . GLU C  3  22  ? 151.373 67.946  -4.921  1.00 53.58  ? 22   GLU M N   1 
ATOM   4943  C  CA  . GLU C  3  22  ? 152.767 67.777  -4.503  1.00 53.99  ? 22   GLU M CA  1 
ATOM   4944  C  C   . GLU C  3  22  ? 153.214 66.354  -4.811  1.00 55.05  ? 22   GLU M C   1 
ATOM   4945  O  O   . GLU C  3  22  ? 154.375 66.000  -4.623  1.00 56.07  ? 22   GLU M O   1 
ATOM   4946  C  CB  . GLU C  3  22  ? 152.912 68.082  -3.000  1.00 54.67  ? 22   GLU M CB  1 
ATOM   4947  C  CG  . GLU C  3  22  ? 154.335 68.040  -2.436  1.00 51.87  ? 22   GLU M CG  1 
ATOM   4948  C  CD  . GLU C  3  22  ? 154.518 68.936  -1.225  0.00 52.61  ? 22   GLU M CD  1 
ATOM   4949  O  OE1 . GLU C  3  22  ? 153.712 68.837  -0.276  0.00 52.35  ? 22   GLU M OE1 1 
ATOM   4950  O  OE2 . GLU C  3  22  ? 155.477 69.737  -1.220  0.00 52.35  ? 22   GLU M OE2 1 
ATOM   4951  N  N   . TRP C  3  23  ? 152.258 65.522  -5.207  1.00 59.28  ? 23   TRP M N   1 
ATOM   4952  C  CA  . TRP C  3  23  ? 152.550 64.243  -5.847  1.00 63.13  ? 23   TRP M CA  1 
ATOM   4953  C  C   . TRP C  3  23  ? 151.334 63.706  -6.604  1.00 62.76  ? 23   TRP M C   1 
ATOM   4954  O  O   . TRP C  3  23  ? 150.265 64.341  -6.613  1.00 63.18  ? 23   TRP M O   1 
ATOM   4955  C  CB  . TRP C  3  23  ? 153.074 63.200  -4.832  1.00 64.45  ? 23   TRP M CB  1 
ATOM   4956  C  CG  . TRP C  3  23  ? 152.086 62.748  -3.808  1.00 69.10  ? 23   TRP M CG  1 
ATOM   4957  C  CD1 . TRP C  3  23  ? 151.193 61.721  -3.924  1.00 70.64  ? 23   TRP M CD1 1 
ATOM   4958  C  CD2 . TRP C  3  23  ? 151.853 63.337  -2.526  1.00 69.99  ? 23   TRP M CD2 1 
ATOM   4959  N  NE1 . TRP C  3  23  ? 150.401 61.649  -2.801  1.00 71.23  ? 23   TRP M NE1 1 
ATOM   4960  C  CE2 . TRP C  3  23  ? 150.786 62.629  -1.927  1.00 70.59  ? 23   TRP M CE2 1 
ATOM   4961  C  CE3 . TRP C  3  23  ? 152.437 64.400  -1.829  1.00 69.76  ? 23   TRP M CE3 1 
ATOM   4962  C  CZ2 . TRP C  3  23  ? 150.289 62.953  -0.669  1.00 71.64  ? 23   TRP M CZ2 1 
ATOM   4963  C  CZ3 . TRP C  3  23  ? 151.943 64.724  -0.576  1.00 71.83  ? 23   TRP M CZ3 1 
ATOM   4964  C  CH2 . TRP C  3  23  ? 150.876 64.002  -0.008  1.00 72.57  ? 23   TRP M CH2 1 
ATOM   4965  N  N   . GLY C  3  24  ? 151.610 62.722  -7.461  1.00 63.06  ? 24   GLY M N   1 
ATOM   4966  C  CA  . GLY C  3  24  ? 150.566 61.971  -8.130  1.00 63.73  ? 24   GLY M CA  1 
ATOM   4967  C  C   . GLY C  3  24  ? 149.791 62.711  -9.205  1.00 63.94  ? 24   GLY M C   1 
ATOM   4968  O  O   . GLY C  3  24  ? 148.793 62.189  -9.696  1.00 64.00  ? 24   GLY M O   1 
ATOM   4969  N  N   . ASP C  3  25  ? 150.277 63.870  -9.645  1.00 63.73  ? 25   ASP M N   1 
ATOM   4970  C  CA  . ASP C  3  25  ? 149.646 64.568  -10.771 1.00 63.62  ? 25   ASP M CA  1 
ATOM   4971  C  C   . ASP C  3  25  ? 149.547 63.653  -11.992 1.00 63.07  ? 25   ASP M C   1 
ATOM   4972  O  O   . ASP C  3  25  ? 148.754 63.889  -12.908 1.00 60.66  ? 25   ASP M O   1 
ATOM   4973  C  CB  . ASP C  3  25  ? 150.446 65.816  -11.138 1.00 63.53  ? 25   ASP M CB  1 
ATOM   4974  C  CG  . ASP C  3  25  ? 150.290 66.918  -10.133 1.00 61.25  ? 25   ASP M CG  1 
ATOM   4975  O  OD1 . ASP C  3  25  ? 149.325 67.691  -10.269 0.00 62.43  ? 25   ASP M OD1 1 
ATOM   4976  O  OD2 . ASP C  3  25  ? 151.139 67.014  -9.228  0.00 62.43  ? 25   ASP M OD2 1 
ATOM   4977  N  N   . ASN C  3  26  ? 150.350 62.591  -11.966 1.00 65.14  ? 26   ASN M N   1 
ATOM   4978  C  CA  . ASN C  3  26  ? 150.431 61.620  -13.049 1.00 66.87  ? 26   ASN M CA  1 
ATOM   4979  C  C   . ASN C  3  26  ? 149.443 60.459  -12.885 1.00 66.23  ? 26   ASN M C   1 
ATOM   4980  O  O   . ASN C  3  26  ? 149.413 59.543  -13.714 1.00 68.56  ? 26   ASN M O   1 
ATOM   4981  C  CB  . ASN C  3  26  ? 151.868 61.074  -13.147 1.00 68.75  ? 26   ASN M CB  1 
ATOM   4982  C  CG  . ASN C  3  26  ? 152.488 61.298  -14.520 1.00 67.65  ? 26   ASN M CG  1 
ATOM   4983  O  OD1 . ASN C  3  26  ? 153.143 62.311  -14.759 0.00 68.04  ? 26   ASN M OD1 1 
ATOM   4984  N  ND2 . ASN C  3  26  ? 152.300 60.341  -15.418 0.00 68.04  ? 26   ASN M ND2 1 
ATOM   4985  N  N   . ASP C  3  27  ? 148.662 60.475  -11.808 1.00 63.21  ? 27   ASP M N   1 
ATOM   4986  C  CA  . ASP C  3  27  ? 147.659 59.441  -11.583 1.00 58.63  ? 27   ASP M CA  1 
ATOM   4987  C  C   . ASP C  3  27  ? 146.270 59.955  -11.835 1.00 54.25  ? 27   ASP M C   1 
ATOM   4988  O  O   . ASP C  3  27  ? 145.299 59.245  -11.586 1.00 53.58  ? 27   ASP M O   1 
ATOM   4989  C  CB  . ASP C  3  27  ? 147.722 58.908  -10.161 1.00 62.49  ? 27   ASP M CB  1 
ATOM   4990  C  CG  . ASP C  3  27  ? 148.654 57.739  -10.027 1.00 66.29  ? 27   ASP M CG  1 
ATOM   4991  O  OD1 . ASP C  3  27  ? 149.861 57.986  -9.830  1.00 68.87  ? 27   ASP M OD1 1 
ATOM   4992  O  OD2 . ASP C  3  27  ? 148.180 56.580  -10.092 1.00 69.12  ? 27   ASP M OD2 1 
ATOM   4993  N  N   . ARG C  3  28  ? 146.162 61.223  -12.196 1.00 51.65  ? 28   ARG M N   1 
ATOM   4994  C  CA  . ARG C  3  28  ? 144.874 61.749  -12.597 1.00 56.61  ? 28   ARG M CA  1 
ATOM   4995  C  C   . ARG C  3  28  ? 144.536 61.233  -13.991 1.00 60.40  ? 28   ARG M C   1 
ATOM   4996  O  O   . ARG C  3  28  ? 145.178 61.611  -14.977 1.00 65.01  ? 28   ARG M O   1 
ATOM   4997  C  CB  . ARG C  3  28  ? 144.882 63.277  -12.564 1.00 54.94  ? 28   ARG M CB  1 
ATOM   4998  C  CG  . ARG C  3  28  ? 144.911 63.831  -11.159 1.00 55.41  ? 28   ARG M CG  1 
ATOM   4999  C  CD  . ARG C  3  28  ? 144.685 65.333  -11.118 1.00 55.38  ? 28   ARG M CD  1 
ATOM   5000  N  NE  . ARG C  3  28  ? 145.183 65.863  -9.852  1.00 58.82  ? 28   ARG M NE  1 
ATOM   5001  C  CZ  . ARG C  3  28  ? 146.221 66.682  -9.742  1.00 60.98  ? 28   ARG M CZ  1 
ATOM   5002  N  NH1 . ARG C  3  28  ? 146.637 67.357  -10.803 1.00 63.25  ? 28   ARG M NH1 1 
ATOM   5003  N  NH2 . ARG C  3  28  ? 146.791 66.887  -8.559  1.00 64.35  ? 28   ARG M NH2 1 
ATOM   5004  N  N   . VAL C  3  29  ? 143.651 60.239  -14.040 1.00 60.99  ? 29   VAL M N   1 
ATOM   5005  C  CA  . VAL C  3  29  ? 143.235 59.649  -15.305 1.00 60.75  ? 29   VAL M CA  1 
ATOM   5006  C  C   . VAL C  3  29  ? 141.931 60.246  -15.782 1.00 62.01  ? 29   VAL M C   1 
ATOM   5007  O  O   . VAL C  3  29  ? 141.156 60.790  -14.996 1.00 63.46  ? 29   VAL M O   1 
ATOM   5008  C  CB  . VAL C  3  29  ? 143.025 58.148  -15.193 1.00 59.29  ? 29   VAL M CB  1 
ATOM   5009  C  CG1 . VAL C  3  29  ? 143.169 57.517  -16.565 1.00 62.74  ? 29   VAL M CG1 1 
ATOM   5010  C  CG2 . VAL C  3  29  ? 144.020 57.557  -14.238 1.00 60.04  ? 29   VAL M CG2 1 
ATOM   5011  N  N   . GLY C  3  30  ? 141.660 60.087  -17.068 1.00 63.66  ? 30   GLY M N   1 
ATOM   5012  C  CA  . GLY C  3  30  ? 140.370 60.484  -17.588 1.00 64.94  ? 30   GLY M CA  1 
ATOM   5013  C  C   . GLY C  3  30  ? 140.433 61.808  -18.319 1.00 65.10  ? 30   GLY M C   1 
ATOM   5014  O  O   . GLY C  3  30  ? 141.374 62.598  -18.142 1.00 65.74  ? 30   GLY M O   1 
ATOM   5015  N  N   . LYS C  3  31  ? 139.486 61.981  -19.235 1.00 63.88  ? 31   LYS M N   1 
ATOM   5016  C  CA  . LYS C  3  31  ? 139.312 63.233  -19.953 1.00 60.25  ? 31   LYS M CA  1 
ATOM   5017  C  C   . LYS C  3  31  ? 138.118 63.928  -19.338 1.00 57.65  ? 31   LYS M C   1 
ATOM   5018  O  O   . LYS C  3  31  ? 137.046 63.328  -19.169 1.00 56.89  ? 31   LYS M O   1 
ATOM   5019  C  CB  . LYS C  3  31  ? 139.051 62.979  -21.443 1.00 62.51  ? 31   LYS M CB  1 
ATOM   5020  C  CG  . LYS C  3  31  ? 139.750 63.950  -22.381 0.00 61.79  ? 31   LYS M CG  1 
ATOM   5021  C  CD  . LYS C  3  31  ? 141.264 63.822  -22.281 0.00 62.06  ? 31   LYS M CD  1 
ATOM   5022  C  CE  . LYS C  3  31  ? 141.935 64.077  -23.624 0.00 62.00  ? 31   LYS M CE  1 
ATOM   5023  N  NZ  . LYS C  3  31  ? 141.693 65.457  -24.127 0.00 62.06  ? 31   LYS M NZ  1 
ATOM   5024  N  N   . PRO C  3  32  ? 138.331 65.157  -18.874 1.00 55.95  ? 32   PRO M N   1 
ATOM   5025  C  CA  . PRO C  3  32  ? 137.253 66.094  -18.556 1.00 58.05  ? 32   PRO M CA  1 
ATOM   5026  C  C   . PRO C  3  32  ? 136.210 66.073  -19.650 1.00 58.87  ? 32   PRO M C   1 
ATOM   5027  O  O   . PRO C  3  32  ? 136.533 66.234  -20.830 1.00 62.26  ? 32   PRO M O   1 
ATOM   5028  C  CB  . PRO C  3  32  ? 137.957 67.446  -18.501 1.00 58.86  ? 32   PRO M CB  1 
ATOM   5029  C  CG  . PRO C  3  32  ? 139.355 67.107  -18.156 1.00 60.25  ? 32   PRO M CG  1 
ATOM   5030  C  CD  . PRO C  3  32  ? 139.647 65.809  -18.838 1.00 56.93  ? 32   PRO M CD  1 
ATOM   5031  N  N   . PHE C  3  33  ? 134.973 65.795  -19.279 1.00 57.30  ? 33   PHE M N   1 
ATOM   5032  C  CA  . PHE C  3  33  ? 133.901 66.002  -20.210 1.00 55.85  ? 33   PHE M CA  1 
ATOM   5033  C  C   . PHE C  3  33  ? 132.797 66.781  -19.519 1.00 55.17  ? 33   PHE M C   1 
ATOM   5034  O  O   . PHE C  3  33  ? 132.796 66.938  -18.299 1.00 56.57  ? 33   PHE M O   1 
ATOM   5035  C  CB  . PHE C  3  33  ? 133.430 64.664  -20.766 1.00 58.54  ? 33   PHE M CB  1 
ATOM   5036  C  CG  . PHE C  3  33  ? 132.187 64.171  -20.154 1.00 61.56  ? 33   PHE M CG  1 
ATOM   5037  C  CD1 . PHE C  3  33  ? 130.950 64.627  -20.614 1.00 65.52  ? 33   PHE M CD1 1 
ATOM   5038  C  CD2 . PHE C  3  33  ? 132.238 63.315  -19.069 1.00 63.02  ? 33   PHE M CD2 1 
ATOM   5039  C  CE1 . PHE C  3  33  ? 129.773 64.248  -19.991 1.00 69.69  ? 33   PHE M CE1 1 
ATOM   5040  C  CE2 . PHE C  3  33  ? 131.070 62.919  -18.436 1.00 68.98  ? 33   PHE M CE2 1 
ATOM   5041  C  CZ  . PHE C  3  33  ? 129.829 63.390  -18.895 1.00 70.98  ? 33   PHE M CZ  1 
ATOM   5042  N  N   . TYR C  3  34  ? 131.976 67.435  -20.319 1.00 53.72  ? 34   TYR M N   1 
ATOM   5043  C  CA  . TYR C  3  34  ? 131.106 68.461  -19.799 1.00 53.30  ? 34   TYR M CA  1 
ATOM   5044  C  C   . TYR C  3  34  ? 129.664 68.045  -20.044 1.00 50.00  ? 34   TYR M C   1 
ATOM   5045  O  O   . TYR C  3  34  ? 129.393 67.326  -20.993 1.00 50.33  ? 34   TYR M O   1 
ATOM   5046  C  CB  . TYR C  3  34  ? 131.444 69.796  -20.473 1.00 56.77  ? 34   TYR M CB  1 
ATOM   5047  C  CG  . TYR C  3  34  ? 132.882 70.255  -20.237 1.00 65.04  ? 34   TYR M CG  1 
ATOM   5048  C  CD1 . TYR C  3  34  ? 133.969 69.470  -20.643 1.00 67.02  ? 34   TYR M CD1 1 
ATOM   5049  C  CD2 . TYR C  3  34  ? 133.158 71.462  -19.587 1.00 67.70  ? 34   TYR M CD2 1 
ATOM   5050  C  CE1 . TYR C  3  34  ? 135.297 69.863  -20.399 1.00 70.38  ? 34   TYR M CE1 1 
ATOM   5051  C  CE2 . TYR C  3  34  ? 134.486 71.879  -19.351 1.00 73.68  ? 34   TYR M CE2 1 
ATOM   5052  C  CZ  . TYR C  3  34  ? 135.552 71.068  -19.756 1.00 74.12  ? 34   TYR M CZ  1 
ATOM   5053  O  OH  . TYR C  3  34  ? 136.862 71.454  -19.516 1.00 74.57  ? 34   TYR M OH  1 
ATOM   5054  N  N   . SER C  3  35  ? 128.820 68.242  -19.040 1.00 47.01  ? 35   SER M N   1 
ATOM   5055  C  CA  . SER C  3  35  ? 127.402 67.983  -19.187 1.00 45.39  ? 35   SER M CA  1 
ATOM   5056  C  C   . SER C  3  35  ? 126.660 69.295  -19.173 1.00 44.20  ? 35   SER M C   1 
ATOM   5057  O  O   . SER C  3  35  ? 126.765 70.056  -18.204 1.00 47.58  ? 35   SER M O   1 
ATOM   5058  C  CB  . SER C  3  35  ? 126.887 67.107  -18.049 1.00 45.09  ? 35   SER M CB  1 
ATOM   5059  O  OG  . SER C  3  35  ? 125.466 67.195  -17.963 1.00 47.05  ? 35   SER M OG  1 
ATOM   5060  N  N   . TYR C  3  36  ? 125.806 69.498  -20.170 1.00 42.02  ? 36   TYR M N   1 
ATOM   5061  C  CA  . TYR C  3  36  ? 125.111 70.772  -20.302 1.00 40.23  ? 36   TYR M CA  1 
ATOM   5062  C  C   . TYR C  3  36  ? 124.038 70.949  -19.228 1.00 44.82  ? 36   TYR M C   1 
ATOM   5063  O  O   . TYR C  3  36  ? 123.841 72.051  -18.692 1.00 44.92  ? 36   TYR M O   1 
ATOM   5064  C  CB  . TYR C  3  36  ? 124.476 70.913  -21.682 1.00 33.45  ? 36   TYR M CB  1 
ATOM   5065  C  CG  . TYR C  3  36  ? 123.699 72.203  -21.831 1.00 26.78  ? 36   TYR M CG  1 
ATOM   5066  C  CD1 . TYR C  3  36  ? 124.355 73.410  -21.990 1.00 26.65  ? 36   TYR M CD1 1 
ATOM   5067  C  CD2 . TYR C  3  36  ? 122.321 72.221  -21.715 1.00 26.06  ? 36   TYR M CD2 1 
ATOM   5068  C  CE1 . TYR C  3  36  ? 123.667 74.597  -22.032 1.00 27.14  ? 36   TYR M CE1 1 
ATOM   5069  C  CE2 . TYR C  3  36  ? 121.618 73.407  -21.751 1.00 29.26  ? 36   TYR M CE2 1 
ATOM   5070  C  CZ  . TYR C  3  36  ? 122.298 74.591  -21.913 1.00 27.41  ? 36   TYR M CZ  1 
ATOM   5071  O  OH  . TYR C  3  36  ? 121.605 75.779  -21.962 1.00 37.02  ? 36   TYR M OH  1 
ATOM   5072  N  N   . TRP C  3  37  ? 123.310 69.876  -18.943 1.00 46.95  ? 37   TRP M N   1 
ATOM   5073  C  CA  . TRP C  3  37  ? 122.269 69.976  -17.945 1.00 47.10  ? 37   TRP M CA  1 
ATOM   5074  C  C   . TRP C  3  37  ? 122.841 69.995  -16.534 1.00 44.24  ? 37   TRP M C   1 
ATOM   5075  O  O   . TRP C  3  37  ? 122.449 70.837  -15.732 1.00 46.00  ? 37   TRP M O   1 
ATOM   5076  C  CB  . TRP C  3  37  ? 121.211 68.879  -18.125 1.00 51.03  ? 37   TRP M CB  1 
ATOM   5077  C  CG  . TRP C  3  37  ? 119.839 69.501  -18.258 1.00 55.54  ? 37   TRP M CG  1 
ATOM   5078  C  CD1 . TRP C  3  37  ? 118.986 69.806  -17.225 0.50 56.51  ? 37   TRP M CD1 1 
ATOM   5079  C  CD2 . TRP C  3  37  ? 119.325 70.200  -19.409 0.50 54.87  ? 37   TRP M CD2 1 
ATOM   5080  N  NE1 . TRP C  3  37  ? 118.016 70.685  -17.650 0.50 56.90  ? 37   TRP M NE1 1 
ATOM   5081  C  CE2 . TRP C  3  37  ? 118.199 70.945  -18.983 0.50 55.64  ? 37   TRP M CE2 1 
ATOM   5082  C  CE3 . TRP C  3  37  ? 119.721 70.285  -20.751 0.50 53.20  ? 37   TRP M CE3 1 
ATOM   5083  C  CZ2 . TRP C  3  37  ? 117.470 71.768  -19.851 0.50 54.38  ? 37   TRP M CZ2 1 
ATOM   5084  C  CZ3 . TRP C  3  37  ? 118.994 71.106  -21.614 0.50 53.75  ? 37   TRP M CZ3 1 
ATOM   5085  C  CH2 . TRP C  3  37  ? 117.883 71.837  -21.158 0.50 54.08  ? 37   TRP M CH2 1 
ATOM   5086  N  N   . LEU C  3  38  ? 123.911 69.240  -16.312 1.00 39.20  ? 38   LEU M N   1 
ATOM   5087  C  CA  . LEU C  3  38  ? 124.677 69.372  -15.082 1.00 37.43  ? 38   LEU M CA  1 
ATOM   5088  C  C   . LEU C  3  38  ? 125.122 70.820  -14.891 1.00 37.17  ? 38   LEU M C   1 
ATOM   5089  O  O   . LEU C  3  38  ? 124.853 71.426  -13.854 1.00 37.15  ? 38   LEU M O   1 
ATOM   5090  C  CB  . LEU C  3  38  ? 125.903 68.457  -15.110 1.00 35.96  ? 38   LEU M CB  1 
ATOM   5091  C  CG  . LEU C  3  38  ? 126.659 68.294  -13.795 1.00 32.81  ? 38   LEU M CG  1 
ATOM   5092  C  CD1 . LEU C  3  38  ? 125.650 68.292  -12.663 1.00 32.03  ? 38   LEU M CD1 1 
ATOM   5093  C  CD2 . LEU C  3  38  ? 127.487 66.996  -13.791 1.00 29.65  ? 38   LEU M CD2 1 
ATOM   5094  N  N   . GLY C  3  39  ? 125.666 71.416  -15.942 1.00 35.75  ? 39   GLY M N   1 
ATOM   5095  C  CA  . GLY C  3  39  ? 126.133 72.782  -15.840 1.00 35.19  ? 39   GLY M CA  1 
ATOM   5096  C  C   . GLY C  3  39  ? 125.061 73.779  -15.439 1.00 36.24  ? 39   GLY M C   1 
ATOM   5097  O  O   . GLY C  3  39  ? 125.361 74.936  -15.113 1.00 39.29  ? 39   GLY M O   1 
ATOM   5098  N  N   . LYS C  3  40  ? 123.804 73.370  -15.496 1.00 36.29  ? 40   LYS M N   1 
ATOM   5099  C  CA  . LYS C  3  40  ? 122.730 74.319  -15.239 1.00 41.47  ? 40   LYS M CA  1 
ATOM   5100  C  C   . LYS C  3  40  ? 122.583 74.603  -13.738 1.00 40.38  ? 40   LYS M C   1 
ATOM   5101  O  O   . LYS C  3  40  ? 122.242 75.727  -13.320 1.00 38.48  ? 40   LYS M O   1 
ATOM   5102  C  CB  . LYS C  3  40  ? 121.405 73.812  -15.843 1.00 46.27  ? 40   LYS M CB  1 
ATOM   5103  C  CG  . LYS C  3  40  ? 121.313 73.928  -17.383 1.00 49.00  ? 40   LYS M CG  1 
ATOM   5104  C  CD  . LYS C  3  40  ? 119.962 74.510  -17.835 1.00 52.36  ? 40   LYS M CD  1 
ATOM   5105  C  CE  . LYS C  3  40  ? 120.086 75.537  -18.983 1.00 55.76  ? 40   LYS M CE  1 
ATOM   5106  N  NZ  . LYS C  3  40  ? 121.351 76.379  -18.943 1.00 59.12  ? 40   LYS M NZ  1 
ATOM   5107  N  N   . ILE C  3  41  ? 122.888 73.596  -12.926 1.00 37.58  ? 41   ILE M N   1 
ATOM   5108  C  CA  . ILE C  3  41  ? 122.772 73.731  -11.474 1.00 39.66  ? 41   ILE M CA  1 
ATOM   5109  C  C   . ILE C  3  41  ? 124.049 73.314  -10.726 1.00 41.81  ? 41   ILE M C   1 
ATOM   5110  O  O   . ILE C  3  41  ? 124.076 73.315  -9.491  1.00 43.92  ? 41   ILE M O   1 
ATOM   5111  C  CB  . ILE C  3  41  ? 121.532 72.941  -10.904 1.00 38.40  ? 41   ILE M CB  1 
ATOM   5112  C  CG1 . ILE C  3  41  ? 121.410 71.554  -11.532 1.00 32.36  ? 41   ILE M CG1 1 
ATOM   5113  C  CG2 . ILE C  3  41  ? 120.237 73.708  -11.180 1.00 38.01  ? 41   ILE M CG2 1 
ATOM   5114  C  CD1 . ILE C  3  41  ? 122.419 70.551  -11.052 1.00 34.90  ? 41   ILE M CD1 1 
ATOM   5115  N  N   . GLY C  3  42  ? 125.107 73.017  -11.485 1.00 42.99  ? 42   GLY M N   1 
ATOM   5116  C  CA  . GLY C  3  42  ? 126.402 72.682  -10.921 1.00 40.97  ? 42   GLY M CA  1 
ATOM   5117  C  C   . GLY C  3  42  ? 127.523 73.089  -11.861 1.00 42.64  ? 42   GLY M C   1 
ATOM   5118  O  O   . GLY C  3  42  ? 127.297 73.775  -12.857 1.00 39.67  ? 42   GLY M O   1 
ATOM   5119  N  N   . ASP C  3  43  ? 128.747 72.701  -11.533 1.00 43.77  ? 43   ASP M N   1 
ATOM   5120  C  CA  . ASP C  3  43  ? 129.846 72.816  -12.479 1.00 45.41  ? 43   ASP M CA  1 
ATOM   5121  C  C   . ASP C  3  43  ? 129.601 71.754  -13.553 1.00 44.03  ? 43   ASP M C   1 
ATOM   5122  O  O   . ASP C  3  43  ? 129.181 70.641  -13.231 1.00 42.67  ? 43   ASP M O   1 
ATOM   5123  C  CB  . ASP C  3  43  ? 131.178 72.563  -11.759 1.00 48.72  ? 43   ASP M CB  1 
ATOM   5124  C  CG  . ASP C  3  43  ? 132.394 72.833  -12.641 1.00 53.86  ? 43   ASP M CG  1 
ATOM   5125  O  OD1 . ASP C  3  43  ? 132.725 74.014  -12.891 1.00 56.41  ? 43   ASP M OD1 1 
ATOM   5126  O  OD2 . ASP C  3  43  ? 133.054 71.855  -13.047 1.00 58.60  ? 43   ASP M OD2 1 
ATOM   5127  N  N   . ALA C  3  44  ? 129.823 72.102  -14.820 1.00 42.09  ? 44   ALA M N   1 
ATOM   5128  C  CA  . ALA C  3  44  ? 129.569 71.167  -15.924 1.00 39.57  ? 44   ALA M CA  1 
ATOM   5129  C  C   . ALA C  3  44  ? 130.611 70.054  -16.139 1.00 36.44  ? 44   ALA M C   1 
ATOM   5130  O  O   . ALA C  3  44  ? 130.267 68.973  -16.602 1.00 38.89  ? 44   ALA M O   1 
ATOM   5131  C  CB  . ALA C  3  44  ? 129.358 71.938  -17.209 1.00 38.25  ? 44   ALA M CB  1 
ATOM   5132  N  N   . GLN C  3  45  ? 131.864 70.291  -15.778 1.00 32.39  ? 45   GLN M N   1 
ATOM   5133  C  CA  . GLN C  3  45  ? 132.907 69.301  -16.020 1.00 33.42  ? 45   GLN M CA  1 
ATOM   5134  C  C   . GLN C  3  45  ? 132.694 68.110  -15.114 1.00 33.51  ? 45   GLN M C   1 
ATOM   5135  O  O   . GLN C  3  45  ? 132.543 68.260  -13.913 1.00 35.28  ? 45   GLN M O   1 
ATOM   5136  C  CB  . GLN C  3  45  ? 134.303 69.903  -15.758 1.00 35.29  ? 45   GLN M CB  1 
ATOM   5137  C  CG  . GLN C  3  45  ? 135.494 68.902  -15.730 1.00 36.99  ? 45   GLN M CG  1 
ATOM   5138  C  CD  . GLN C  3  45  ? 136.879 69.581  -15.520 1.00 39.53  ? 45   GLN M CD  1 
ATOM   5139  O  OE1 . GLN C  3  45  ? 137.054 70.779  -15.777 1.00 43.12  ? 45   GLN M OE1 1 
ATOM   5140  N  NE2 . GLN C  3  45  ? 137.860 68.803  -15.068 1.00 39.72  ? 45   GLN M NE2 1 
ATOM   5141  N  N   . ILE C  3  46  ? 132.624 66.932  -15.699 1.00 33.55  ? 46   ILE M N   1 
ATOM   5142  C  CA  . ILE C  3  46  ? 132.806 65.713  -14.935 1.00 37.12  ? 46   ILE M CA  1 
ATOM   5143  C  C   . ILE C  3  46  ? 134.206 65.155  -15.188 1.00 38.31  ? 46   ILE M C   1 
ATOM   5144  O  O   . ILE C  3  46  ? 134.702 65.241  -16.309 1.00 39.54  ? 46   ILE M O   1 
ATOM   5145  C  CB  . ILE C  3  46  ? 131.746 64.662  -15.322 1.00 35.39  ? 46   ILE M CB  1 
ATOM   5146  C  CG1 . ILE C  3  46  ? 130.384 65.069  -14.766 1.00 37.33  ? 46   ILE M CG1 1 
ATOM   5147  C  CG2 . ILE C  3  46  ? 132.119 63.308  -14.759 1.00 35.99  ? 46   ILE M CG2 1 
ATOM   5148  C  CD1 . ILE C  3  46  ? 129.391 65.391  -15.823 1.00 42.52  ? 46   ILE M CD1 1 
ATOM   5149  N  N   . GLY C  3  47  ? 134.809 64.535  -14.167 1.00 40.04  ? 47   GLY M N   1 
ATOM   5150  C  CA  . GLY C  3  47  ? 136.170 64.015  -14.274 1.00 38.47  ? 47   GLY M CA  1 
ATOM   5151  C  C   . GLY C  3  47  ? 137.197 65.129  -14.456 1.00 39.78  ? 47   GLY M C   1 
ATOM   5152  O  O   . GLY C  3  47  ? 136.822 66.303  -14.515 1.00 41.85  ? 47   GLY M O   1 
ATOM   5153  N  N   . PRO C  3  48  ? 138.489 64.813  -14.605 1.00 39.09  ? 48   PRO M N   1 
ATOM   5154  C  CA  . PRO C  3  48  ? 139.214 63.555  -14.411 1.00 41.25  ? 48   PRO M CA  1 
ATOM   5155  C  C   . PRO C  3  48  ? 139.150 63.128  -12.956 1.00 43.46  ? 48   PRO M C   1 
ATOM   5156  O  O   . PRO C  3  48  ? 138.771 63.911  -12.088 1.00 42.92  ? 48   PRO M O   1 
ATOM   5157  C  CB  . PRO C  3  48  ? 140.634 63.923  -14.798 1.00 42.11  ? 48   PRO M CB  1 
ATOM   5158  C  CG  . PRO C  3  48  ? 140.808 65.410  -14.669 1.00 45.18  ? 48   PRO M CG  1 
ATOM   5159  C  CD  . PRO C  3  48  ? 139.411 66.005  -14.621 1.00 42.10  ? 48   PRO M CD  1 
ATOM   5160  N  N   . ILE C  3  49  ? 139.680 61.946  -12.671 1.00 43.56  ? 49   ILE M N   1 
ATOM   5161  C  CA  . ILE C  3  49  ? 139.759 61.494  -11.301 1.00 44.30  ? 49   ILE M CA  1 
ATOM   5162  C  C   . ILE C  3  49  ? 141.156 60.977  -10.994 1.00 42.74  ? 49   ILE M C   1 
ATOM   5163  O  O   . ILE C  3  49  ? 141.857 60.473  -11.864 1.00 46.07  ? 49   ILE M O   1 
ATOM   5164  C  CB  . ILE C  3  49  ? 138.689 60.396  -11.004 1.00 48.15  ? 49   ILE M CB  1 
ATOM   5165  C  CG1 . ILE C  3  49  ? 138.387 60.367  -9.490  1.00 47.40  ? 49   ILE M CG1 1 
ATOM   5166  C  CG2 . ILE C  3  49  ? 139.144 59.034  -11.570 1.00 44.30  ? 49   ILE M CG2 1 
ATOM   5167  C  CD1 . ILE C  3  49  ? 137.256 59.434  -9.067  1.00 49.15  ? 49   ILE M CD1 1 
ATOM   5168  N  N   . TYR C  3  50  ? 141.551 61.100  -9.743  1.00 40.28  ? 50   TYR M N   1 
ATOM   5169  C  CA  . TYR C  3  50  ? 142.870 60.696  -9.318  1.00 38.40  ? 50   TYR M CA  1 
ATOM   5170  C  C   . TYR C  3  50  ? 142.846 59.233  -8.871  1.00 35.51  ? 50   TYR M C   1 
ATOM   5171  O  O   . TYR C  3  50  ? 142.038 58.832  -8.053  1.00 34.28  ? 50   TYR M O   1 
ATOM   5172  C  CB  . TYR C  3  50  ? 143.322 61.629  -8.189  1.00 37.52  ? 50   TYR M CB  1 
ATOM   5173  C  CG  . TYR C  3  50  ? 144.538 61.164  -7.454  1.00 38.37  ? 50   TYR M CG  1 
ATOM   5174  C  CD1 . TYR C  3  50  ? 145.805 61.495  -7.906  1.00 40.52  ? 50   TYR M CD1 1 
ATOM   5175  C  CD2 . TYR C  3  50  ? 144.425 60.388  -6.307  1.00 36.58  ? 50   TYR M CD2 1 
ATOM   5176  C  CE1 . TYR C  3  50  ? 146.937 61.062  -7.235  1.00 43.63  ? 50   TYR M CE1 1 
ATOM   5177  C  CE2 . TYR C  3  50  ? 145.548 59.949  -5.628  1.00 42.77  ? 50   TYR M CE2 1 
ATOM   5178  C  CZ  . TYR C  3  50  ? 146.807 60.288  -6.099  1.00 43.73  ? 50   TYR M CZ  1 
ATOM   5179  O  OH  . TYR C  3  50  ? 147.945 59.834  -5.470  1.00 49.20  ? 50   TYR M OH  1 
ATOM   5180  N  N   . LEU C  3  51  ? 143.708 58.424  -9.452  1.00 36.46  ? 51   LEU M N   1 
ATOM   5181  C  CA  . LEU C  3  51  ? 143.827 57.052  -9.014  1.00 40.10  ? 51   LEU M CA  1 
ATOM   5182  C  C   . LEU C  3  51  ? 144.504 56.973  -7.659  1.00 40.03  ? 51   LEU M C   1 
ATOM   5183  O  O   . LEU C  3  51  ? 143.916 57.343  -6.654  1.00 44.64  ? 51   LEU M O   1 
ATOM   5184  C  CB  . LEU C  3  51  ? 144.596 56.254  -10.048 1.00 43.08  ? 51   LEU M CB  1 
ATOM   5185  C  CG  . LEU C  3  51  ? 143.704 55.492  -11.026 1.00 48.16  ? 51   LEU M CG  1 
ATOM   5186  C  CD1 . LEU C  3  51  ? 142.520 56.340  -11.501 1.00 47.19  ? 51   LEU M CD1 1 
ATOM   5187  C  CD2 . LEU C  3  51  ? 144.572 55.067  -12.194 1.00 52.30  ? 51   LEU M CD2 1 
ATOM   5188  N  N   . GLY C  3  52  ? 145.722 56.451  -7.624  1.00 38.60  ? 52   GLY M N   1 
ATOM   5189  C  CA  . GLY C  3  52  ? 146.490 56.471  -6.398  1.00 39.29  ? 52   GLY M CA  1 
ATOM   5190  C  C   . GLY C  3  52  ? 146.458 55.131  -5.699  1.00 40.38  ? 52   GLY M C   1 
ATOM   5191  O  O   . GLY C  3  52  ? 145.599 54.300  -5.984  1.00 42.69  ? 52   GLY M O   1 
ATOM   5192  N  N   . ALA C  3  53  ? 147.364 54.934  -4.750  1.00 39.27  ? 53   ALA M N   1 
ATOM   5193  C  CA  . ALA C  3  53  ? 147.470 53.666  -4.035  1.00 39.11  ? 53   ALA M CA  1 
ATOM   5194  C  C   . ALA C  3  53  ? 146.357 53.495  -3.007  1.00 41.20  ? 53   ALA M C   1 
ATOM   5195  O  O   . ALA C  3  53  ? 145.777 52.415  -2.876  1.00 42.47  ? 53   ALA M O   1 
ATOM   5196  C  CB  . ALA C  3  53  ? 148.812 53.585  -3.339  1.00 42.39  ? 53   ALA M CB  1 
ATOM   5197  N  N   . SER C  3  54  ? 146.164 54.516  -2.181  1.00 40.37  ? 54   SER M N   1 
ATOM   5198  C  CA  . SER C  3  54  ? 145.143 54.465  -1.160  1.00 37.64  ? 54   SER M CA  1 
ATOM   5199  C  C   . SER C  3  54  ? 143.784 54.208  -1.830  1.00 38.48  ? 54   SER M C   1 
ATOM   5200  O  O   . SER C  3  54  ? 143.089 53.247  -1.484  1.00 35.30  ? 54   SER M O   1 
ATOM   5201  C  CB  . SER C  3  54  ? 145.135 55.781  -0.400  1.00 33.90  ? 54   SER M CB  1 
ATOM   5202  O  OG  . SER C  3  54  ? 144.890 56.841  -1.301  1.00 40.21  ? 54   SER M OG  1 
ATOM   5203  N  N   . GLY C  3  55  ? 143.482 54.984  -2.871  1.00 38.59  ? 55   GLY M N   1 
ATOM   5204  C  CA  . GLY C  3  55  ? 142.263 54.790  -3.646  1.00 42.21  ? 55   GLY M CA  1 
ATOM   5205  C  C   . GLY C  3  55  ? 142.059 53.387  -4.228  1.00 44.86  ? 55   GLY M C   1 
ATOM   5206  O  O   . GLY C  3  55  ? 141.014 52.758  -4.024  1.00 47.40  ? 55   GLY M O   1 
ATOM   5207  N  N   . ILE C  3  56  ? 143.048 52.889  -4.964  1.00 45.65  ? 56   ILE M N   1 
ATOM   5208  C  CA  . ILE C  3  56  ? 143.004 51.531  -5.500  1.00 42.92  ? 56   ILE M CA  1 
ATOM   5209  C  C   . ILE C  3  56  ? 142.829 50.513  -4.376  1.00 42.07  ? 56   ILE M C   1 
ATOM   5210  O  O   . ILE C  3  56  ? 141.982 49.620  -4.469  1.00 44.72  ? 56   ILE M O   1 
ATOM   5211  C  CB  . ILE C  3  56  ? 144.293 51.205  -6.292  1.00 42.83  ? 56   ILE M CB  1 
ATOM   5212  C  CG1 . ILE C  3  56  ? 144.126 51.603  -7.755  1.00 45.34  ? 56   ILE M CG1 1 
ATOM   5213  C  CG2 . ILE C  3  56  ? 144.593 49.721  -6.245  1.00 42.33  ? 56   ILE M CG2 1 
ATOM   5214  C  CD1 . ILE C  3  56  ? 143.938 53.080  -7.999  1.00 51.17  ? 56   ILE M CD1 1 
ATOM   5215  N  N   . ALA C  3  57  ? 143.599 50.677  -3.304  1.00 37.56  ? 57   ALA M N   1 
ATOM   5216  C  CA  . ALA C  3  57  ? 143.483 49.820  -2.131  1.00 36.94  ? 57   ALA M CA  1 
ATOM   5217  C  C   . ALA C  3  57  ? 142.034 49.810  -1.631  1.00 37.59  ? 57   ALA M C   1 
ATOM   5218  O  O   . ALA C  3  57  ? 141.395 48.742  -1.546  1.00 37.40  ? 57   ALA M O   1 
ATOM   5219  C  CB  . ALA C  3  57  ? 144.428 50.307  -1.030  1.00 31.64  ? 57   ALA M CB  1 
ATOM   5220  N  N   . ALA C  3  58  ? 141.492 51.013  -1.430  1.00 33.73  ? 58   ALA M N   1 
ATOM   5221  C  CA  . ALA C  3  58  ? 140.133 51.195  -0.962  1.00 30.21  ? 58   ALA M CA  1 
ATOM   5222  C  C   . ALA C  3  58  ? 139.187 50.418  -1.863  1.00 30.89  ? 58   ALA M C   1 
ATOM   5223  O  O   . ALA C  3  58  ? 138.444 49.566  -1.383  1.00 33.41  ? 58   ALA M O   1 
ATOM   5224  C  CB  . ALA C  3  58  ? 139.770 52.669  -0.957  1.00 30.72  ? 58   ALA M CB  1 
ATOM   5225  N  N   A PHE C  3  59  ? 139.284 50.640  -3.169  0.50 32.15  ? 59   PHE M N   1 
ATOM   5226  N  N   B PHE C  3  59  ? 139.345 50.589  -3.174  0.50 30.34  ? 59   PHE M N   1 
ATOM   5227  C  CA  A PHE C  3  59  ? 138.442 49.930  -4.127  0.50 33.06  ? 59   PHE M CA  1 
ATOM   5228  C  CA  B PHE C  3  59  ? 138.471 49.944  -4.153  0.50 29.54  ? 59   PHE M CA  1 
ATOM   5229  C  C   A PHE C  3  59  ? 138.586 48.415  -4.023  0.50 32.88  ? 59   PHE M C   1 
ATOM   5230  C  C   B PHE C  3  59  ? 138.657 48.438  -4.262  0.50 30.13  ? 59   PHE M C   1 
ATOM   5231  O  O   A PHE C  3  59  ? 137.608 47.677  -4.148  0.50 33.54  ? 59   PHE M O   1 
ATOM   5232  O  O   B PHE C  3  59  ? 137.748 47.725  -4.673  0.50 30.13  ? 59   PHE M O   1 
ATOM   5233  C  CB  A PHE C  3  59  ? 138.773 50.370  -5.547  0.50 35.44  ? 59   PHE M CB  1 
ATOM   5234  C  CB  B PHE C  3  59  ? 138.658 50.577  -5.525  0.50 28.10  ? 59   PHE M CB  1 
ATOM   5235  C  CG  A PHE C  3  59  ? 138.164 49.501  -6.602  0.50 38.94  ? 59   PHE M CG  1 
ATOM   5236  C  CG  B PHE C  3  59  ? 137.542 51.491  -5.917  0.50 27.97  ? 59   PHE M CG  1 
ATOM   5237  C  CD1 A PHE C  3  59  ? 138.849 48.389  -7.088  0.50 41.70  ? 59   PHE M CD1 1 
ATOM   5238  C  CD1 B PHE C  3  59  ? 137.542 52.819  -5.513  0.50 27.45  ? 59   PHE M CD1 1 
ATOM   5239  C  CD2 A PHE C  3  59  ? 136.916 49.801  -7.129  0.50 42.10  ? 59   PHE M CD2 1 
ATOM   5240  C  CD2 B PHE C  3  59  ? 136.464 51.014  -6.652  0.50 31.62  ? 59   PHE M CD2 1 
ATOM   5241  C  CE1 A PHE C  3  59  ? 138.297 47.589  -8.087  0.50 44.75  ? 59   PHE M CE1 1 
ATOM   5242  C  CE1 B PHE C  3  59  ? 136.478 53.666  -5.825  0.50 29.41  ? 59   PHE M CE1 1 
ATOM   5243  C  CE2 A PHE C  3  59  ? 136.355 49.013  -8.135  0.50 44.93  ? 59   PHE M CE2 1 
ATOM   5244  C  CE2 B PHE C  3  59  ? 135.393 51.852  -6.981  0.50 31.83  ? 59   PHE M CE2 1 
ATOM   5245  C  CZ  A PHE C  3  59  ? 137.048 47.904  -8.615  0.50 44.92  ? 59   PHE M CZ  1 
ATOM   5246  C  CZ  B PHE C  3  59  ? 135.401 53.184  -6.560  0.50 32.30  ? 59   PHE M CZ  1 
ATOM   5247  N  N   . ALA C  3  60  ? 139.811 47.948  -3.840  1.00 32.36  ? 60   ALA M N   1 
ATOM   5248  C  CA  . ALA C  3  60  ? 140.075 46.521  -3.846  1.00 32.22  ? 60   ALA M CA  1 
ATOM   5249  C  C   . ALA C  3  60  ? 139.372 45.865  -2.687  1.00 34.81  ? 60   ALA M C   1 
ATOM   5250  O  O   . ALA C  3  60  ? 138.615 44.917  -2.877  1.00 39.80  ? 60   ALA M O   1 
ATOM   5251  C  CB  . ALA C  3  60  ? 141.560 46.268  -3.763  1.00 33.44  ? 60   ALA M CB  1 
ATOM   5252  N  N   . PHE C  3  61  ? 139.597 46.397  -1.486  1.00 37.53  ? 61   PHE M N   1 
ATOM   5253  C  CA  . PHE C  3  61  ? 138.942 45.908  -0.273  1.00 34.21  ? 61   PHE M CA  1 
ATOM   5254  C  C   . PHE C  3  61  ? 137.414 45.960  -0.315  1.00 34.53  ? 61   PHE M C   1 
ATOM   5255  O  O   . PHE C  3  61  ? 136.752 44.962  0.008   1.00 34.18  ? 61   PHE M O   1 
ATOM   5256  C  CB  . PHE C  3  61  ? 139.433 46.699  0.922   1.00 35.60  ? 61   PHE M CB  1 
ATOM   5257  C  CG  . PHE C  3  61  ? 140.853 46.428  1.261   1.00 42.19  ? 61   PHE M CG  1 
ATOM   5258  C  CD1 . PHE C  3  61  ? 141.282 45.129  1.490   1.00 43.56  ? 61   PHE M CD1 1 
ATOM   5259  C  CD2 . PHE C  3  61  ? 141.773 47.461  1.337   1.00 42.31  ? 61   PHE M CD2 1 
ATOM   5260  C  CE1 . PHE C  3  61  ? 142.612 44.861  1.797   1.00 44.39  ? 61   PHE M CE1 1 
ATOM   5261  C  CE2 . PHE C  3  61  ? 143.105 47.206  1.643   1.00 41.70  ? 61   PHE M CE2 1 
ATOM   5262  C  CZ  . PHE C  3  61  ? 143.525 45.904  1.876   1.00 42.46  ? 61   PHE M CZ  1 
ATOM   5263  N  N   . GLY C  3  62  ? 136.868 47.106  -0.728  1.00 29.26  ? 62   GLY M N   1 
ATOM   5264  C  CA  . GLY C  3  62  ? 135.430 47.298  -0.751  1.00 31.33  ? 62   GLY M CA  1 
ATOM   5265  C  C   . GLY C  3  62  ? 134.760 46.334  -1.706  1.00 32.68  ? 62   GLY M C   1 
ATOM   5266  O  O   . GLY C  3  62  ? 133.752 45.716  -1.374  1.00 35.14  ? 62   GLY M O   1 
ATOM   5267  N  N   . SER C  3  63  ? 135.391 46.113  -2.850  1.00 34.13  ? 63   SER M N   1 
ATOM   5268  C  CA  . SER C  3  63  ? 134.909 45.142  -3.811  1.00 32.54  ? 63   SER M CA  1 
ATOM   5269  C  C   . SER C  3  63  ? 134.891 43.725  -3.254  1.00 32.77  ? 63   SER M C   1 
ATOM   5270  O  O   . SER C  3  63  ? 133.937 42.990  -3.486  1.00 35.46  ? 63   SER M O   1 
ATOM   5271  C  CB  . SER C  3  63  ? 135.759 45.200  -5.059  1.00 34.30  ? 63   SER M CB  1 
ATOM   5272  O  OG  . SER C  3  63  ? 135.644 46.484  -5.622  1.00 37.89  ? 63   SER M OG  1 
ATOM   5273  N  N   . THR C  3  64  ? 135.872 43.367  -2.433  1.00 33.35  ? 64   THR M N   1 
ATOM   5274  C  CA  . THR C  3  64  ? 135.848 42.050  -1.791  1.00 32.13  ? 64   THR M CA  1 
ATOM   5275  C  C   . THR C  3  64  ? 134.740 41.935  -0.762  1.00 34.33  ? 64   THR M C   1 
ATOM   5276  O  O   . THR C  3  64  ? 134.120 40.883  -0.629  1.00 37.62  ? 64   THR M O   1 
ATOM   5277  C  CB  . THR C  3  64  ? 137.155 41.740  -1.083  1.00 33.12  ? 64   THR M CB  1 
ATOM   5278  O  OG1 . THR C  3  64  ? 138.236 41.906  -2.009  1.00 28.44  ? 64   THR M OG1 1 
ATOM   5279  C  CG2 . THR C  3  64  ? 137.126 40.294  -0.497  1.00 28.31  ? 64   THR M CG2 1 
ATOM   5280  N  N   . ALA C  3  65  ? 134.580 42.982  0.042   1.00 34.38  ? 65   ALA M N   1 
ATOM   5281  C  CA  . ALA C  3  65  ? 133.511 43.037  1.028   1.00 33.54  ? 65   ALA M CA  1 
ATOM   5282  C  C   . ALA C  3  65  ? 132.241 42.722  0.296   1.00 31.72  ? 65   ALA M C   1 
ATOM   5283  O  O   . ALA C  3  65  ? 131.523 41.784  0.632   1.00 33.93  ? 65   ALA M O   1 
ATOM   5284  C  CB  . ALA C  3  65  ? 133.411 44.432  1.636   1.00 32.96  ? 65   ALA M CB  1 
ATOM   5285  N  N   . ILE C  3  66  ? 132.037 43.441  -0.791  1.00 28.88  ? 66   ILE M N   1 
ATOM   5286  C  CA  . ILE C  3  66  ? 130.803 43.318  -1.526  1.00 31.51  ? 66   ILE M CA  1 
ATOM   5287  C  C   . ILE C  3  66  ? 130.614 41.919  -2.112  1.00 31.93  ? 66   ILE M C   1 
ATOM   5288  O  O   . ILE C  3  66  ? 129.548 41.325  -1.944  1.00 34.14  ? 66   ILE M O   1 
ATOM   5289  C  CB  . ILE C  3  66  ? 130.730 44.388  -2.602  1.00 32.00  ? 66   ILE M CB  1 
ATOM   5290  C  CG1 . ILE C  3  66  ? 130.532 45.742  -1.930  1.00 35.11  ? 66   ILE M CG1 1 
ATOM   5291  C  CG2 . ILE C  3  66  ? 129.597 44.108  -3.565  1.00 35.35  ? 66   ILE M CG2 1 
ATOM   5292  C  CD1 . ILE C  3  66  ? 130.954 46.902  -2.789  1.00 36.84  ? 66   ILE M CD1 1 
ATOM   5293  N  N   . LEU C  3  67  ? 131.675 41.314  -2.636  1.00 32.92  ? 67   LEU M N   1 
ATOM   5294  C  CA  . LEU C  3  67  ? 131.523 39.971  -3.196  1.00 33.47  ? 67   LEU M CA  1 
ATOM   5295  C  C   . LEU C  3  67  ? 131.074 38.942  -2.166  1.00 32.85  ? 67   LEU M C   1 
ATOM   5296  O  O   . LEU C  3  67  ? 130.189 38.128  -2.446  1.00 33.64  ? 67   LEU M O   1 
ATOM   5297  C  CB  . LEU C  3  67  ? 132.804 39.505  -3.875  1.00 37.58  ? 67   LEU M CB  1 
ATOM   5298  C  CG  . LEU C  3  67  ? 133.302 40.331  -5.069  1.00 42.56  ? 67   LEU M CG  1 
ATOM   5299  C  CD1 . LEU C  3  67  ? 134.230 39.442  -5.866  1.00 47.65  ? 67   LEU M CD1 1 
ATOM   5300  C  CD2 . LEU C  3  67  ? 132.162 40.857  -5.959  1.00 43.20  ? 67   LEU M CD2 1 
ATOM   5301  N  N   . ILE C  3  68  ? 131.556 39.086  -0.935  1.00 31.15  ? 68   ILE M N   1 
ATOM   5302  C  CA  . ILE C  3  68  ? 131.168 38.176  0.136   1.00 31.30  ? 68   ILE M CA  1 
ATOM   5303  C  C   . ILE C  3  68  ? 129.690 38.358  0.524   1.00 34.91  ? 68   ILE M C   1 
ATOM   5304  O  O   . ILE C  3  68  ? 128.939 37.378  0.668   1.00 36.29  ? 68   ILE M O   1 
ATOM   5305  C  CB  . ILE C  3  68  ? 132.050 38.371  1.374   1.00 27.37  ? 68   ILE M CB  1 
ATOM   5306  C  CG1 . ILE C  3  68  ? 133.519 38.365  0.973   1.00 29.46  ? 68   ILE M CG1 1 
ATOM   5307  C  CG2 . ILE C  3  68  ? 131.811 37.258  2.348   1.00 25.62  ? 68   ILE M CG2 1 
ATOM   5308  C  CD1 . ILE C  3  68  ? 134.465 38.612  2.110   1.00 33.93  ? 68   ILE M CD1 1 
ATOM   5309  N  N   . ILE C  3  69  ? 129.254 39.610  0.635   1.00 35.10  ? 69   ILE M N   1 
ATOM   5310  C  CA  . ILE C  3  69  ? 127.862 39.892  0.975   1.00 34.21  ? 69   ILE M CA  1 
ATOM   5311  C  C   . ILE C  3  69  ? 126.937 39.389  -0.137  1.00 36.34  ? 69   ILE M C   1 
ATOM   5312  O  O   . ILE C  3  69  ? 126.028 38.599  0.116   1.00 37.38  ? 69   ILE M O   1 
ATOM   5313  C  CB  . ILE C  3  69  ? 127.628 41.398  1.201   1.00 30.09  ? 69   ILE M CB  1 
ATOM   5314  C  CG1 . ILE C  3  69  ? 128.461 41.891  2.377   1.00 26.26  ? 69   ILE M CG1 1 
ATOM   5315  C  CG2 . ILE C  3  69  ? 126.185 41.664  1.499   1.00 29.35  ? 69   ILE M CG2 1 
ATOM   5316  C  CD1 . ILE C  3  69  ? 128.764 43.345  2.266   1.00 23.42  ? 69   ILE M CD1 1 
ATOM   5317  N  N   . LEU C  3  70  ? 127.244 39.746  -1.378  1.00 36.23  ? 70   LEU M N   1 
ATOM   5318  C  CA  . LEU C  3  70  ? 126.407 39.363  -2.496  1.00 35.49  ? 70   LEU M CA  1 
ATOM   5319  C  C   . LEU C  3  70  ? 126.354 37.854  -2.684  1.00 39.75  ? 70   LEU M C   1 
ATOM   5320  O  O   . LEU C  3  70  ? 125.289 37.299  -2.908  1.00 40.19  ? 70   LEU M O   1 
ATOM   5321  C  CB  . LEU C  3  70  ? 126.901 40.029  -3.766  1.00 34.76  ? 70   LEU M CB  1 
ATOM   5322  C  CG  . LEU C  3  70  ? 126.582 41.515  -3.813  1.00 37.79  ? 70   LEU M CG  1 
ATOM   5323  C  CD1 . LEU C  3  70  ? 126.862 42.070  -5.197  1.00 39.15  ? 70   LEU M CD1 1 
ATOM   5324  C  CD2 . LEU C  3  70  ? 125.121 41.723  -3.435  1.00 40.52  ? 70   LEU M CD2 1 
ATOM   5325  N  N   . PHE C  3  71  ? 127.475 37.174  -2.490  1.00 41.95  ? 71   PHE M N   1 
ATOM   5326  C  CA  . PHE C  3  71  ? 127.494 35.730  -2.660  1.00 44.73  ? 71   PHE M CA  1 
ATOM   5327  C  C   . PHE C  3  71  ? 126.630 35.018  -1.629  1.00 41.73  ? 71   PHE M C   1 
ATOM   5328  O  O   . PHE C  3  71  ? 125.907 34.073  -1.954  1.00 39.46  ? 71   PHE M O   1 
ATOM   5329  C  CB  . PHE C  3  71  ? 128.920 35.207  -2.577  1.00 56.16  ? 71   PHE M CB  1 
ATOM   5330  C  CG  . PHE C  3  71  ? 129.358 34.447  -3.796  1.00 71.17  ? 71   PHE M CG  1 
ATOM   5331  C  CD1 . PHE C  3  71  ? 129.280 35.035  -5.063  1.00 76.51  ? 71   PHE M CD1 1 
ATOM   5332  C  CD2 . PHE C  3  71  ? 129.928 33.174  -3.674  1.00 76.08  ? 71   PHE M CD2 1 
ATOM   5333  C  CE1 . PHE C  3  71  ? 129.776 34.372  -6.191  1.00 79.56  ? 71   PHE M CE1 1 
ATOM   5334  C  CE2 . PHE C  3  71  ? 130.431 32.495  -4.794  1.00 79.51  ? 71   PHE M CE2 1 
ATOM   5335  C  CZ  . PHE C  3  71  ? 130.358 33.095  -6.055  1.00 81.46  ? 71   PHE M CZ  1 
ATOM   5336  N  N   . ASN C  3  72  ? 126.702 35.472  -0.385  1.00 37.95  ? 72   ASN M N   1 
ATOM   5337  C  CA  . ASN C  3  72  ? 125.877 34.896  0.667   1.00 35.63  ? 72   ASN M CA  1 
ATOM   5338  C  C   . ASN C  3  72  ? 124.417 35.260  0.449   1.00 35.46  ? 72   ASN M C   1 
ATOM   5339  O  O   . ASN C  3  72  ? 123.527 34.411  0.538   1.00 34.82  ? 72   ASN M O   1 
ATOM   5340  C  CB  . ASN C  3  72  ? 126.326 35.407  2.020   1.00 36.77  ? 72   ASN M CB  1 
ATOM   5341  C  CG  . ASN C  3  72  ? 127.508 34.649  2.555   1.00 38.89  ? 72   ASN M CG  1 
ATOM   5342  O  OD1 . ASN C  3  72  ? 127.366 33.784  3.426   1.00 40.95  ? 72   ASN M OD1 1 
ATOM   5343  N  ND2 . ASN C  3  72  ? 128.695 34.996  2.073   1.00 31.95  ? 72   ASN M ND2 1 
ATOM   5344  N  N   . MET C  3  73  ? 124.176 36.520  0.101   1.00 33.72  ? 73   MET M N   1 
ATOM   5345  C  CA  . MET C  3  73  ? 122.833 36.964  -0.204  1.00 30.75  ? 73   MET M CA  1 
ATOM   5346  C  C   . MET C  3  73  ? 122.291 36.060  -1.292  1.00 32.83  ? 73   MET M C   1 
ATOM   5347  O  O   . MET C  3  73  ? 121.265 35.437  -1.094  1.00 35.66  ? 73   MET M O   1 
ATOM   5348  C  CB  . MET C  3  73  ? 122.833 38.412  -0.672  1.00 28.04  ? 73   MET M CB  1 
ATOM   5349  C  CG  . MET C  3  73  ? 122.928 39.433  0.446   1.00 27.08  ? 73   MET M CG  1 
ATOM   5350  S  SD  . MET C  3  73  ? 123.006 41.102  -0.238  1.00 34.83  ? 73   MET M SD  1 
ATOM   5351  C  CE  . MET C  3  73  ? 121.450 41.164  -1.103  1.00 33.47  ? 73   MET M CE  1 
ATOM   5352  N  N   . ALA C  3  74  ? 123.119 35.789  -2.299  1.00 33.23  ? 74   ALA M N   1 
ATOM   5353  C  CA  . ALA C  3  74  ? 122.764 34.911  -3.407  1.00 31.50  ? 74   ALA M CA  1 
ATOM   5354  C  C   . ALA C  3  74  ? 122.502 33.494  -2.927  1.00 31.91  ? 74   ALA M C   1 
ATOM   5355  O  O   . ALA C  3  74  ? 121.608 32.821  -3.419  1.00 36.44  ? 74   ALA M O   1 
ATOM   5356  C  CB  . ALA C  3  74  ? 123.875 34.905  -4.442  1.00 34.67  ? 74   ALA M CB  1 
ATOM   5357  N  N   . ALA C  3  75  ? 123.252 33.045  -1.939  1.00 34.20  ? 75   ALA M N   1 
ATOM   5358  C  CA  . ALA C  3  75  ? 122.987 31.744  -1.352  1.00 36.49  ? 75   ALA M CA  1 
ATOM   5359  C  C   . ALA C  3  75  ? 121.596 31.696  -0.741  1.00 41.18  ? 75   ALA M C   1 
ATOM   5360  O  O   . ALA C  3  75  ? 120.928 30.664  -0.803  1.00 47.41  ? 75   ALA M O   1 
ATOM   5361  C  CB  . ALA C  3  75  ? 124.029 31.423  -0.298  1.00 37.78  ? 75   ALA M CB  1 
ATOM   5362  N  N   . GLU C  3  76  ? 121.150 32.821  -0.181  1.00 43.90  ? 76   GLU M N   1 
ATOM   5363  C  CA  . GLU C  3  76  ? 119.868 32.908  0.532   1.00 40.94  ? 76   GLU M CA  1 
ATOM   5364  C  C   . GLU C  3  76  ? 118.630 32.553  -0.320  1.00 41.96  ? 76   GLU M C   1 
ATOM   5365  O  O   . GLU C  3  76  ? 117.716 31.878  0.179   1.00 44.99  ? 76   GLU M O   1 
ATOM   5366  C  CB  . GLU C  3  76  ? 119.692 34.312  1.136   1.00 38.48  ? 76   GLU M CB  1 
ATOM   5367  C  CG  . GLU C  3  76  ? 119.928 34.410  2.633   1.00 34.87  ? 76   GLU M CG  1 
ATOM   5368  C  CD  . GLU C  3  76  ? 119.211 35.595  3.272   1.00 35.78  ? 76   GLU M CD  1 
ATOM   5369  O  OE1 . GLU C  3  76  ? 119.421 36.740  2.814   1.00 31.19  ? 76   GLU M OE1 1 
ATOM   5370  O  OE2 . GLU C  3  76  ? 118.434 35.375  4.235   1.00 31.60  ? 76   GLU M OE2 1 
ATOM   5371  N  N   . VAL C  3  77  ? 118.560 33.068  -1.556  1.00 38.68  ? 77   VAL M N   1 
ATOM   5372  C  CA  . VAL C  3  77  ? 117.529 32.653  -2.513  1.00 37.99  ? 77   VAL M CA  1 
ATOM   5373  C  C   . VAL C  3  77  ? 118.014 31.454  -3.310  1.00 41.37  ? 77   VAL M C   1 
ATOM   5374  O  O   . VAL C  3  77  ? 117.624 31.255  -4.465  1.00 40.81  ? 77   VAL M O   1 
ATOM   5375  C  CB  . VAL C  3  77  ? 117.144 33.752  -3.515  1.00 33.03  ? 77   VAL M CB  1 
ATOM   5376  C  CG1 . VAL C  3  77  ? 116.264 34.743  -2.865  1.00 36.65  ? 77   VAL M CG1 1 
ATOM   5377  C  CG2 . VAL C  3  77  ? 118.362 34.406  -4.071  1.00 36.10  ? 77   VAL M CG2 1 
ATOM   5378  N  N   . HIS C  3  78  ? 118.927 30.702  -2.708  1.00 45.80  ? 78   HIS M N   1 
ATOM   5379  C  CA  . HIS C  3  78  ? 119.448 29.484  -3.290  1.00 49.74  ? 78   HIS M CA  1 
ATOM   5380  C  C   . HIS C  3  78  ? 119.801 29.680  -4.759  1.00 49.26  ? 78   HIS M C   1 
ATOM   5381  O  O   . HIS C  3  78  ? 119.247 29.028  -5.645  1.00 48.31  ? 78   HIS M O   1 
ATOM   5382  C  CB  . HIS C  3  78  ? 118.432 28.370  -3.122  1.00 58.66  ? 78   HIS M CB  1 
ATOM   5383  C  CG  . HIS C  3  78  ? 118.931 27.045  -3.591  1.00 67.64  ? 78   HIS M CG  1 
ATOM   5384  N  ND1 . HIS C  3  78  ? 118.838 26.646  -4.906  1.00 70.52  ? 78   HIS M ND1 1 
ATOM   5385  C  CD2 . HIS C  3  78  ? 119.685 26.113  -2.963  1.00 71.03  ? 78   HIS M CD2 1 
ATOM   5386  C  CE1 . HIS C  3  78  ? 119.528 25.534  -5.073  1.00 74.27  ? 78   HIS M CE1 1 
ATOM   5387  N  NE2 . HIS C  3  78  ? 120.051 25.190  -3.910  1.00 73.86  ? 78   HIS M NE2 1 
ATOM   5388  N  N   . PHE C  3  79  ? 120.506 30.776  -5.003  1.00 48.00  ? 79   PHE M N   1 
ATOM   5389  C  CA  . PHE C  3  79  ? 121.091 31.072  -6.293  1.00 43.01  ? 79   PHE M CA  1 
ATOM   5390  C  C   . PHE C  3  79  ? 120.103 31.222  -7.432  1.00 42.99  ? 79   PHE M C   1 
ATOM   5391  O  O   . PHE C  3  79  ? 120.505 31.454  -8.572  1.00 44.40  ? 79   PHE M O   1 
ATOM   5392  C  CB  . PHE C  3  79  ? 122.150 30.031  -6.619  1.00 41.72  ? 79   PHE M CB  1 
ATOM   5393  C  CG  . PHE C  3  79  ? 123.242 29.961  -5.590  1.00 44.07  ? 79   PHE M CG  1 
ATOM   5394  C  CD1 . PHE C  3  79  ? 124.177 30.992  -5.480  1.00 43.25  ? 79   PHE M CD1 1 
ATOM   5395  C  CD2 . PHE C  3  79  ? 123.291 28.903  -4.674  1.00 45.46  ? 79   PHE M CD2 1 
ATOM   5396  C  CE1 . PHE C  3  79  ? 125.145 30.978  -4.473  1.00 43.51  ? 79   PHE M CE1 1 
ATOM   5397  C  CE2 . PHE C  3  79  ? 124.255 28.871  -3.661  1.00 45.17  ? 79   PHE M CE2 1 
ATOM   5398  C  CZ  . PHE C  3  79  ? 125.186 29.913  -3.560  1.00 45.87  ? 79   PHE M CZ  1 
ATOM   5399  N  N   . ASP C  3  80  ? 118.823 31.318  -7.104  1.00 41.85  ? 80   ASP M N   1 
ATOM   5400  C  CA  . ASP C  3  80  ? 117.871 31.710  -8.119  1.00 45.23  ? 80   ASP M CA  1 
ATOM   5401  C  C   . ASP C  3  80  ? 117.970 33.210  -8.368  1.00 45.82  ? 80   ASP M C   1 
ATOM   5402  O  O   . ASP C  3  80  ? 117.547 34.018  -7.555  1.00 50.40  ? 80   ASP M O   1 
ATOM   5403  C  CB  . ASP C  3  80  ? 116.453 31.329  -7.715  1.00 48.54  ? 80   ASP M CB  1 
ATOM   5404  C  CG  . ASP C  3  80  ? 115.434 31.544  -8.840  1.00 52.74  ? 80   ASP M CG  1 
ATOM   5405  O  OD1 . ASP C  3  80  ? 115.513 32.570  -9.572  1.00 53.72  ? 80   ASP M OD1 1 
ATOM   5406  O  OD2 . ASP C  3  80  ? 114.500 30.713  -8.938  1.00 56.71  ? 80   ASP M OD2 1 
ATOM   5407  N  N   . PRO C  3  81  ? 118.342 33.582  -9.584  1.00 47.83  ? 81   PRO M N   1 
ATOM   5408  C  CA  . PRO C  3  81  ? 118.438 34.953  -10.102 1.00 48.09  ? 81   PRO M CA  1 
ATOM   5409  C  C   . PRO C  3  81  ? 117.197 35.786  -9.910  1.00 44.68  ? 81   PRO M C   1 
ATOM   5410  O  O   . PRO C  3  81  ? 117.291 36.957  -9.574  1.00 47.70  ? 81   PRO M O   1 
ATOM   5411  C  CB  . PRO C  3  81  ? 118.694 34.758  -11.588 1.00 51.07  ? 81   PRO M CB  1 
ATOM   5412  C  CG  . PRO C  3  81  ? 119.375 33.420  -11.655 1.00 55.97  ? 81   PRO M CG  1 
ATOM   5413  C  CD  . PRO C  3  81  ? 118.749 32.585  -10.586 1.00 51.38  ? 81   PRO M CD  1 
ATOM   5414  N  N   . LEU C  3  82  ? 116.065 35.274  -10.362 1.00 40.14  ? 82   LEU M N   1 
ATOM   5415  C  CA  . LEU C  3  82  ? 114.890 36.109  -10.362 1.00 38.61  ? 82   LEU M CA  1 
ATOM   5416  C  C   . LEU C  3  82  ? 114.419 36.378  -8.942  1.00 35.50  ? 82   LEU M C   1 
ATOM   5417  O  O   . LEU C  3  82  ? 114.056 37.504  -8.619  1.00 34.29  ? 82   LEU M O   1 
ATOM   5418  C  CB  . LEU C  3  82  ? 113.770 35.487  -11.174 1.00 37.49  ? 82   LEU M CB  1 
ATOM   5419  C  CG  . LEU C  3  82  ? 112.624 36.494  -11.251 1.00 40.51  ? 82   LEU M CG  1 
ATOM   5420  C  CD1 . LEU C  3  82  ? 112.893 37.522  -12.352 1.00 34.63  ? 82   LEU M CD1 1 
ATOM   5421  C  CD2 . LEU C  3  82  ? 111.319 35.749  -11.471 1.00 42.83  ? 82   LEU M CD2 1 
ATOM   5422  N  N   . GLN C  3  83  ? 114.456 35.345  -8.099  1.00 34.69  ? 83   GLN M N   1 
ATOM   5423  C  CA  . GLN C  3  83  ? 114.116 35.467  -6.676  1.00 35.77  ? 83   GLN M CA  1 
ATOM   5424  C  C   . GLN C  3  83  ? 115.126 36.344  -5.932  1.00 36.38  ? 83   GLN M C   1 
ATOM   5425  O  O   . GLN C  3  83  ? 114.776 37.097  -5.020  1.00 37.05  ? 83   GLN M O   1 
ATOM   5426  C  CB  . GLN C  3  83  ? 114.048 34.085  -6.015  1.00 32.28  ? 83   GLN M CB  1 
ATOM   5427  C  CG  . GLN C  3  83  ? 112.769 33.333  -6.325  1.00 37.13  ? 83   GLN M CG  1 
ATOM   5428  C  CD  . GLN C  3  83  ? 111.545 34.249  -6.379  1.00 40.49  ? 83   GLN M CD  1 
ATOM   5429  O  OE1 . GLN C  3  83  ? 111.135 34.809  -5.363  1.00 41.00  ? 83   GLN M OE1 1 
ATOM   5430  N  NE2 . GLN C  3  83  ? 111.006 34.462  -7.581  1.00 38.17  ? 83   GLN M NE2 1 
ATOM   5431  N  N   . PHE C  3  84  ? 116.369 36.279  -6.382  1.00 34.58  ? 84   PHE M N   1 
ATOM   5432  C  CA  . PHE C  3  84  ? 117.408 37.156  -5.899  1.00 36.69  ? 84   PHE M CA  1 
ATOM   5433  C  C   . PHE C  3  84  ? 117.040 38.616  -6.152  1.00 38.00  ? 84   PHE M C   1 
ATOM   5434  O  O   . PHE C  3  84  ? 116.966 39.410  -5.221  1.00 39.62  ? 84   PHE M O   1 
ATOM   5435  C  CB  . PHE C  3  84  ? 118.718 36.820  -6.596  1.00 36.07  ? 84   PHE M CB  1 
ATOM   5436  C  CG  . PHE C  3  84  ? 119.872 37.603  -6.101  1.00 36.18  ? 84   PHE M CG  1 
ATOM   5437  C  CD1 . PHE C  3  84  ? 120.480 37.271  -4.900  1.00 39.03  ? 84   PHE M CD1 1 
ATOM   5438  C  CD2 . PHE C  3  84  ? 120.330 38.699  -6.810  1.00 38.33  ? 84   PHE M CD2 1 
ATOM   5439  C  CE1 . PHE C  3  84  ? 121.532 38.020  -4.407  1.00 40.10  ? 84   PHE M CE1 1 
ATOM   5440  C  CE2 . PHE C  3  84  ? 121.383 39.465  -6.323  1.00 43.53  ? 84   PHE M CE2 1 
ATOM   5441  C  CZ  . PHE C  3  84  ? 121.986 39.123  -5.118  1.00 40.77  ? 84   PHE M CZ  1 
ATOM   5442  N  N   A PHE C  3  85  ? 116.796 38.955  -7.413  0.50 37.91  ? 85   PHE M N   1 
ATOM   5443  N  N   B PHE C  3  85  ? 116.818 38.965  -7.416  0.50 37.79  ? 85   PHE M N   1 
ATOM   5444  C  CA  A PHE C  3  85  ? 116.486 40.325  -7.800  0.50 38.19  ? 85   PHE M CA  1 
ATOM   5445  C  CA  B PHE C  3  85  ? 116.479 40.336  -7.773  0.50 37.65  ? 85   PHE M CA  1 
ATOM   5446  C  C   A PHE C  3  85  ? 115.195 40.777  -7.126  0.50 40.35  ? 85   PHE M C   1 
ATOM   5447  C  C   B PHE C  3  85  ? 115.249 40.746  -6.984  0.50 40.06  ? 85   PHE M C   1 
ATOM   5448  O  O   A PHE C  3  85  ? 115.052 41.949  -6.772  0.50 42.97  ? 85   PHE M O   1 
ATOM   5449  O  O   B PHE C  3  85  ? 115.210 41.830  -6.402  0.50 43.04  ? 85   PHE M O   1 
ATOM   5450  C  CB  A PHE C  3  85  ? 116.363 40.415  -9.327  0.50 36.99  ? 85   PHE M CB  1 
ATOM   5451  C  CB  B PHE C  3  85  ? 116.173 40.463  -9.269  0.50 36.48  ? 85   PHE M CB  1 
ATOM   5452  C  CG  A PHE C  3  85  ? 115.911 41.760  -9.835  0.50 36.61  ? 85   PHE M CG  1 
ATOM   5453  C  CG  B PHE C  3  85  ? 117.378 40.349  -10.160 0.50 35.63  ? 85   PHE M CG  1 
ATOM   5454  C  CD1 A PHE C  3  85  ? 116.734 42.875  -9.730  0.50 37.20  ? 85   PHE M CD1 1 
ATOM   5455  C  CD1 B PHE C  3  85  ? 118.637 40.740  -9.716  0.50 35.89  ? 85   PHE M CD1 1 
ATOM   5456  C  CD2 A PHE C  3  85  ? 114.671 41.900  -10.464 0.50 35.62  ? 85   PHE M CD2 1 
ATOM   5457  C  CD2 B PHE C  3  85  ? 117.249 39.842  -11.452 0.50 37.40  ? 85   PHE M CD2 1 
ATOM   5458  C  CE1 A PHE C  3  85  ? 116.326 44.111  -10.251 0.50 37.26  ? 85   PHE M CE1 1 
ATOM   5459  C  CE1 B PHE C  3  85  ? 119.755 40.625  -10.542 0.50 34.83  ? 85   PHE M CE1 1 
ATOM   5460  C  CE2 A PHE C  3  85  ? 114.255 43.126  -10.985 0.50 33.39  ? 85   PHE M CE2 1 
ATOM   5461  C  CE2 B PHE C  3  85  ? 118.356 39.722  -12.287 0.50 36.48  ? 85   PHE M CE2 1 
ATOM   5462  C  CZ  A PHE C  3  85  ? 115.081 44.232  -10.881 0.50 33.78  ? 85   PHE M CZ  1 
ATOM   5463  C  CZ  B PHE C  3  85  ? 119.615 40.115  -11.829 0.50 35.27  ? 85   PHE M CZ  1 
ATOM   5464  N  N   . ARG C  3  86  ? 114.286 39.832  -6.897  1.00 41.22  ? 86   ARG M N   1 
ATOM   5465  C  CA  . ARG C  3  86  ? 112.995 40.114  -6.263  1.00 36.96  ? 86   ARG M CA  1 
ATOM   5466  C  C   . ARG C  3  86  ? 113.168 40.395  -4.780  1.00 36.87  ? 86   ARG M C   1 
ATOM   5467  O  O   . ARG C  3  86  ? 112.632 41.374  -4.253  1.00 36.79  ? 86   ARG M O   1 
ATOM   5468  C  CB  . ARG C  3  86  ? 112.052 38.922  -6.438  1.00 35.67  ? 86   ARG M CB  1 
ATOM   5469  C  CG  . ARG C  3  86  ? 110.653 39.108  -5.865  1.00 32.42  ? 86   ARG M CG  1 
ATOM   5470  C  CD  . ARG C  3  86  ? 110.102 37.770  -5.429  1.00 28.82  ? 86   ARG M CD  1 
ATOM   5471  N  NE  . ARG C  3  86  ? 108.694 37.832  -5.054  1.00 25.58  ? 86   ARG M NE  1 
ATOM   5472  C  CZ  . ARG C  3  86  ? 108.053 36.853  -4.417  1.00 26.24  ? 86   ARG M CZ  1 
ATOM   5473  N  NH1 . ARG C  3  86  ? 108.661 35.685  -4.202  1.00 21.31  ? 86   ARG M NH1 1 
ATOM   5474  N  NH2 . ARG C  3  86  ? 106.790 37.018  -4.034  1.00 24.76  ? 86   ARG M NH2 1 
ATOM   5475  N  N   . GLN C  3  87  ? 113.910 39.525  -4.107  1.00 33.91  ? 87   GLN M N   1 
ATOM   5476  C  CA  . GLN C  3  87  ? 113.998 39.577  -2.667  1.00 31.16  ? 87   GLN M CA  1 
ATOM   5477  C  C   . GLN C  3  87  ? 115.206 40.355  -2.157  1.00 33.02  ? 87   GLN M C   1 
ATOM   5478  O  O   . GLN C  3  87  ? 115.582 40.215  -0.994  1.00 36.95  ? 87   GLN M O   1 
ATOM   5479  C  CB  . GLN C  3  87  ? 114.039 38.164  -2.125  1.00 31.19  ? 87   GLN M CB  1 
ATOM   5480  C  CG  . GLN C  3  87  ? 112.892 37.318  -2.579  1.00 30.44  ? 87   GLN M CG  1 
ATOM   5481  C  CD  . GLN C  3  87  ? 113.092 35.865  -2.235  1.00 33.30  ? 87   GLN M CD  1 
ATOM   5482  O  OE1 . GLN C  3  87  ? 113.800 35.521  -1.286  1.00 34.06  ? 87   GLN M OE1 1 
ATOM   5483  N  NE2 . GLN C  3  87  ? 112.443 34.997  -2.982  1.00 39.58  ? 87   GLN M NE2 1 
ATOM   5484  N  N   . PHE C  3  88  ? 115.765 41.239  -2.977  1.00 31.47  ? 88   PHE M N   1 
ATOM   5485  C  CA  . PHE C  3  88  ? 117.075 41.790  -2.671  1.00 28.52  ? 88   PHE M CA  1 
ATOM   5486  C  C   . PHE C  3  88  ? 117.105 42.468  -1.306  1.00 29.75  ? 88   PHE M C   1 
ATOM   5487  O  O   . PHE C  3  88  ? 117.841 42.044  -0.416  1.00 28.32  ? 88   PHE M O   1 
ATOM   5488  C  CB  . PHE C  3  88  ? 117.511 42.771  -3.755  1.00 29.96  ? 88   PHE M CB  1 
ATOM   5489  C  CG  . PHE C  3  88  ? 118.941 43.190  -3.636  1.00 33.59  ? 88   PHE M CG  1 
ATOM   5490  C  CD1 . PHE C  3  88  ? 119.966 42.313  -3.974  1.00 36.02  ? 88   PHE M CD1 1 
ATOM   5491  C  CD2 . PHE C  3  88  ? 119.273 44.456  -3.160  1.00 34.97  ? 88   PHE M CD2 1 
ATOM   5492  C  CE1 . PHE C  3  88  ? 121.307 42.697  -3.844  1.00 38.59  ? 88   PHE M CE1 1 
ATOM   5493  C  CE2 . PHE C  3  88  ? 120.606 44.848  -3.021  1.00 35.16  ? 88   PHE M CE2 1 
ATOM   5494  C  CZ  . PHE C  3  88  ? 121.625 43.966  -3.365  1.00 35.63  ? 88   PHE M CZ  1 
ATOM   5495  N  N   . PHE C  3  89  ? 116.192 43.412  -1.102  1.00 27.41  ? 89   PHE M N   1 
ATOM   5496  C  CA  . PHE C  3  89  ? 116.098 44.141  0.146   1.00 22.90  ? 89   PHE M CA  1 
ATOM   5497  C  C   . PHE C  3  89  ? 116.074 43.264  1.365   1.00 26.04  ? 89   PHE M C   1 
ATOM   5498  O  O   . PHE C  3  89  ? 116.601 43.651  2.407   1.00 28.31  ? 89   PHE M O   1 
ATOM   5499  C  CB  . PHE C  3  89  ? 114.844 44.973  0.161   1.00 24.81  ? 89   PHE M CB  1 
ATOM   5500  C  CG  . PHE C  3  89  ? 114.963 46.227  -0.609  1.00 30.88  ? 89   PHE M CG  1 
ATOM   5501  C  CD1 . PHE C  3  89  ? 115.970 46.379  -1.557  1.00 32.94  ? 89   PHE M CD1 1 
ATOM   5502  C  CD2 . PHE C  3  89  ? 114.096 47.276  -0.377  1.00 35.37  ? 89   PHE M CD2 1 
ATOM   5503  C  CE1 . PHE C  3  89  ? 116.114 47.560  -2.262  1.00 34.28  ? 89   PHE M CE1 1 
ATOM   5504  C  CE2 . PHE C  3  89  ? 114.231 48.471  -1.077  1.00 41.17  ? 89   PHE M CE2 1 
ATOM   5505  C  CZ  . PHE C  3  89  ? 115.246 48.612  -2.022  1.00 39.25  ? 89   PHE M CZ  1 
ATOM   5506  N  N   . TRP C  3  90  ? 115.334 42.160  1.289   1.00 23.46  ? 90   TRP M N   1 
ATOM   5507  C  CA  . TRP C  3  90  ? 115.121 41.303  2.460   1.00 22.67  ? 90   TRP M CA  1 
ATOM   5508  C  C   . TRP C  3  90  ? 116.337 40.487  2.780   1.00 19.56  ? 90   TRP M C   1 
ATOM   5509  O  O   . TRP C  3  90  ? 116.410 39.861  3.839   1.00 20.00  ? 90   TRP M O   1 
ATOM   5510  C  CB  . TRP C  3  90  ? 113.936 40.356  2.247   1.00 19.09  ? 90   TRP M CB  1 
ATOM   5511  C  CG  . TRP C  3  90  ? 112.622 41.041  2.402   1.00 17.73  ? 90   TRP M CG  1 
ATOM   5512  C  CD1 . TRP C  3  90  ? 111.832 41.039  3.503   1.00 15.44  ? 90   TRP M CD1 1 
ATOM   5513  C  CD2 . TRP C  3  90  ? 111.994 41.916  1.454   1.00 17.72  ? 90   TRP M CD2 1 
ATOM   5514  N  NE1 . TRP C  3  90  ? 110.761 41.877  3.317   1.00 18.97  ? 90   TRP M NE1 1 
ATOM   5515  C  CE2 . TRP C  3  90  ? 110.834 42.428  2.066   1.00 19.16  ? 90   TRP M CE2 1 
ATOM   5516  C  CE3 . TRP C  3  90  ? 112.302 42.315  0.144   1.00 20.80  ? 90   TRP M CE3 1 
ATOM   5517  C  CZ2 . TRP C  3  90  ? 109.974 43.320  1.419   1.00 19.44  ? 90   TRP M CZ2 1 
ATOM   5518  C  CZ3 . TRP C  3  90  ? 111.451 43.195  -0.506  1.00 18.93  ? 90   TRP M CZ3 1 
ATOM   5519  C  CH2 . TRP C  3  90  ? 110.295 43.689  0.136   1.00 24.52  ? 90   TRP M CH2 1 
ATOM   5520  N  N   . LEU C  3  91  ? 117.201 40.363  1.782   1.00 23.92  ? 91   LEU M N   1 
ATOM   5521  C  CA  . LEU C  3  91  ? 118.362 39.495  1.855   1.00 26.75  ? 91   LEU M CA  1 
ATOM   5522  C  C   . LEU C  3  91  ? 119.433 40.140  2.709   1.00 27.78  ? 91   LEU M C   1 
ATOM   5523  O  O   . LEU C  3  91  ? 119.679 41.347  2.587   1.00 29.61  ? 91   LEU M O   1 
ATOM   5524  C  CB  . LEU C  3  91  ? 118.907 39.245  0.449   1.00 23.87  ? 91   LEU M CB  1 
ATOM   5525  C  CG  . LEU C  3  91  ? 117.951 38.514  -0.477  1.00 20.15  ? 91   LEU M CG  1 
ATOM   5526  C  CD1 . LEU C  3  91  ? 118.681 38.235  -1.758  1.00 20.18  ? 91   LEU M CD1 1 
ATOM   5527  C  CD2 . LEU C  3  91  ? 117.459 37.233  0.172   1.00 17.88  ? 91   LEU M CD2 1 
ATOM   5528  N  N   . GLY C  3  92  ? 120.156 39.324  3.470   1.00 25.30  ? 92   GLY M N   1 
ATOM   5529  C  CA  . GLY C  3  92  ? 121.232 39.869  4.264   1.00 26.42  ? 92   GLY M CA  1 
ATOM   5530  C  C   . GLY C  3  92  ? 122.278 38.851  4.630   1.00 27.35  ? 92   GLY M C   1 
ATOM   5531  O  O   . GLY C  3  92  ? 122.109 37.666  4.350   1.00 27.94  ? 92   GLY M O   1 
ATOM   5532  N  N   . LEU C  3  93  ? 123.375 39.346  5.203   1.00 28.09  ? 93   LEU M N   1 
ATOM   5533  C  CA  . LEU C  3  93  ? 124.488 38.547  5.716   1.00 28.39  ? 93   LEU M CA  1 
ATOM   5534  C  C   . LEU C  3  93  ? 124.583 38.834  7.221   1.00 28.68  ? 93   LEU M C   1 
ATOM   5535  O  O   . LEU C  3  93  ? 124.860 39.972  7.610   1.00 31.21  ? 93   LEU M O   1 
ATOM   5536  C  CB  . LEU C  3  93  ? 125.789 38.982  5.016   1.00 26.39  ? 93   LEU M CB  1 
ATOM   5537  C  CG  . LEU C  3  93  ? 127.123 38.482  5.580   1.00 23.81  ? 93   LEU M CG  1 
ATOM   5538  C  CD1 . LEU C  3  93  ? 127.094 36.981  5.728   1.00 21.19  ? 93   LEU M CD1 1 
ATOM   5539  C  CD2 . LEU C  3  93  ? 128.254 38.905  4.680   1.00 19.97  ? 93   LEU M CD2 1 
ATOM   5540  N  N   . TYR C  3  94  ? 124.239 37.854  8.056   1.00 28.88  ? 94   TYR M N   1 
ATOM   5541  C  CA  . TYR C  3  94  ? 124.067 38.103  9.491   1.00 31.84  ? 94   TYR M CA  1 
ATOM   5542  C  C   . TYR C  3  94  ? 125.272 37.729  10.351  1.00 32.14  ? 94   TYR M C   1 
ATOM   5543  O  O   . TYR C  3  94  ? 126.135 36.950  9.934   1.00 35.95  ? 94   TYR M O   1 
ATOM   5544  C  CB  . TYR C  3  94  ? 122.798 37.416  10.036  1.00 28.22  ? 94   TYR M CB  1 
ATOM   5545  C  CG  . TYR C  3  94  ? 121.533 37.884  9.360   1.00 26.74  ? 94   TYR M CG  1 
ATOM   5546  C  CD1 . TYR C  3  94  ? 121.081 37.270  8.202   1.00 29.83  ? 94   TYR M CD1 1 
ATOM   5547  C  CD2 . TYR C  3  94  ? 120.796 38.941  9.865   1.00 29.05  ? 94   TYR M CD2 1 
ATOM   5548  C  CE1 . TYR C  3  94  ? 119.925 37.682  7.568   1.00 27.62  ? 94   TYR M CE1 1 
ATOM   5549  C  CE2 . TYR C  3  94  ? 119.640 39.363  9.232   1.00 29.60  ? 94   TYR M CE2 1 
ATOM   5550  C  CZ  . TYR C  3  94  ? 119.214 38.720  8.084   1.00 27.11  ? 94   TYR M CZ  1 
ATOM   5551  O  OH  . TYR C  3  94  ? 118.086 39.126  7.431   1.00 30.55  ? 94   TYR M OH  1 
ATOM   5552  N  N   . PRO C  3  95  ? 125.443 38.443  11.475  1.00 33.34  ? 95   PRO M N   1 
ATOM   5553  C  CA  . PRO C  3  95  ? 126.390 38.073  12.534  1.00 32.65  ? 95   PRO M CA  1 
ATOM   5554  C  C   . PRO C  3  95  ? 125.936 36.810  13.263  1.00 32.70  ? 95   PRO M C   1 
ATOM   5555  O  O   . PRO C  3  95  ? 124.833 36.315  13.006  1.00 35.88  ? 95   PRO M O   1 
ATOM   5556  C  CB  . PRO C  3  95  ? 126.392 39.302  13.441  1.00 31.23  ? 95   PRO M CB  1 
ATOM   5557  C  CG  . PRO C  3  95  ? 125.069 39.972  13.165  1.00 32.31  ? 95   PRO M CG  1 
ATOM   5558  C  CD  . PRO C  3  95  ? 124.871 39.784  11.706  1.00 31.05  ? 95   PRO M CD  1 
ATOM   5559  N  N   . PRO C  3  96  ? 126.786 36.257  14.160  1.00 29.54  ? 96   PRO M N   1 
ATOM   5560  C  CA  . PRO C  3  96  ? 126.398 35.045  14.886  1.00 29.65  ? 96   PRO M CA  1 
ATOM   5561  C  C   . PRO C  3  96  ? 125.001 35.181  15.452  1.00 30.48  ? 96   PRO M C   1 
ATOM   5562  O  O   . PRO C  3  96  ? 124.678 36.187  16.082  1.00 34.53  ? 96   PRO M O   1 
ATOM   5563  C  CB  . PRO C  3  96  ? 127.435 34.940  15.998  1.00 23.91  ? 96   PRO M CB  1 
ATOM   5564  C  CG  . PRO C  3  96  ? 128.624 35.564  15.427  1.00 24.35  ? 96   PRO M CG  1 
ATOM   5565  C  CD  . PRO C  3  96  ? 128.154 36.673  14.513  1.00 28.46  ? 96   PRO M CD  1 
ATOM   5566  N  N   . LYS C  3  97  ? 124.131 34.254  15.079  1.00 30.91  ? 97   LYS M N   1 
ATOM   5567  C  CA  . LYS C  3  97  ? 122.888 34.074  15.807  1.00 31.11  ? 97   LYS M CA  1 
ATOM   5568  C  C   . LYS C  3  97  ? 123.119 33.418  17.167  1.00 32.71  ? 97   LYS M C   1 
ATOM   5569  O  O   . LYS C  3  97  ? 122.444 33.748  18.140  1.00 37.90  ? 97   LYS M O   1 
ATOM   5570  C  CB  . LYS C  3  97  ? 121.912 33.246  14.995  1.00 29.76  ? 97   LYS M CB  1 
ATOM   5571  C  CG  . LYS C  3  97  ? 121.387 33.946  13.739  1.00 34.78  ? 97   LYS M CG  1 
ATOM   5572  C  CD  . LYS C  3  97  ? 120.148 33.209  13.240  1.00 36.03  ? 97   LYS M CD  1 
ATOM   5573  C  CE  . LYS C  3  97  ? 119.687 33.622  11.849  1.00 37.83  ? 97   LYS M CE  1 
ATOM   5574  N  NZ  . LYS C  3  97  ? 118.463 32.824  11.494  1.00 42.37  ? 97   LYS M NZ  1 
ATOM   5575  N  N   . ALA C  3  98  ? 124.122 32.553  17.264  1.00 32.87  ? 98   ALA M N   1 
ATOM   5576  C  CA  . ALA C  3  98  ? 124.423 31.904  18.532  1.00 30.36  ? 98   ALA M CA  1 
ATOM   5577  C  C   . ALA C  3  98  ? 125.450 32.662  19.364  1.00 30.93  ? 98   ALA M C   1 
ATOM   5578  O  O   . ALA C  3  98  ? 126.248 33.473  18.853  1.00 31.40  ? 98   ALA M O   1 
ATOM   5579  C  CB  . ALA C  3  98  ? 124.896 30.492  18.289  1.00 34.27  ? 98   ALA M CB  1 
ATOM   5580  N  N   . GLN C  3  99  ? 125.409 32.406  20.662  1.00 32.01  ? 99   GLN M N   1 
ATOM   5581  C  CA  . GLN C  3  99  ? 126.358 33.007  21.581  1.00 35.40  ? 99   GLN M CA  1 
ATOM   5582  C  C   . GLN C  3  99  ? 127.648 32.242  21.473  1.00 38.66  ? 99   GLN M C   1 
ATOM   5583  O  O   . GLN C  3  99  ? 127.724 31.096  21.908  1.00 42.84  ? 99   GLN M O   1 
ATOM   5584  C  CB  . GLN C  3  99  ? 125.852 32.938  23.021  1.00 34.05  ? 99   GLN M CB  1 
ATOM   5585  C  CG  . GLN C  3  99  ? 126.616 33.827  23.964  1.00 26.11  ? 99   GLN M CG  1 
ATOM   5586  C  CD  . GLN C  3  99  ? 126.764 35.219  23.412  1.00 23.15  ? 99   GLN M CD  1 
ATOM   5587  O  OE1 . GLN C  3  99  ? 127.538 35.437  22.490  1.00 24.80  ? 99   GLN M OE1 1 
ATOM   5588  N  NE2 . GLN C  3  99  ? 125.939 36.147  23.888  1.00 28.28  ? 99   GLN M NE2 1 
ATOM   5589  N  N   . TYR C  3  100 ? 128.585 32.800  20.722  1.00 43.80  ? 100  TYR M N   1 
ATOM   5590  C  CA  . TYR C  3  100 ? 129.938 32.261  20.667  1.00 45.89  ? 100  TYR M CA  1 
ATOM   5591  C  C   . TYR C  3  100 ? 130.860 33.093  21.551  1.00 48.84  ? 100  TYR M C   1 
ATOM   5592  O  O   . TYR C  3  100 ? 132.052 32.813  21.640  1.00 51.44  ? 100  TYR M O   1 
ATOM   5593  C  CB  . TYR C  3  100 ? 130.457 32.255  19.223  1.00 43.95  ? 100  TYR M CB  1 
ATOM   5594  C  CG  . TYR C  3  100 ? 129.664 31.352  18.301  1.00 43.73  ? 100  TYR M CG  1 
ATOM   5595  C  CD1 . TYR C  3  100 ? 129.225 30.098  18.730  1.00 42.46  ? 100  TYR M CD1 1 
ATOM   5596  C  CD2 . TYR C  3  100 ? 129.259 31.792  17.036  1.00 47.21  ? 100  TYR M CD2 1 
ATOM   5597  C  CE1 . TYR C  3  100 ? 128.395 29.315  17.932  1.00 43.00  ? 100  TYR M CE1 1 
ATOM   5598  C  CE2 . TYR C  3  100 ? 128.420 31.013  16.229  1.00 45.82  ? 100  TYR M CE2 1 
ATOM   5599  C  CZ  . TYR C  3  100 ? 127.992 29.782  16.690  1.00 43.14  ? 100  TYR M CZ  1 
ATOM   5600  O  OH  . TYR C  3  100 ? 127.130 29.034  15.933  1.00 45.45  ? 100  TYR M OH  1 
ATOM   5601  N  N   . GLY C  3  101 ? 130.286 34.055  22.272  1.00 50.52  ? 101  GLY M N   1 
ATOM   5602  C  CA  . GLY C  3  101 ? 131.087 35.022  22.999  1.00 50.93  ? 101  GLY M CA  1 
ATOM   5603  C  C   . GLY C  3  101 ? 131.904 35.800  21.991  1.00 53.47  ? 101  GLY M C   1 
ATOM   5604  O  O   . GLY C  3  101 ? 131.415 36.114  20.892  1.00 53.97  ? 101  GLY M O   1 
ATOM   5605  N  N   . MET C  3  102 ? 133.189 35.958  22.281  1.00 53.79  ? 102  MET M N   1 
ATOM   5606  C  CA  . MET C  3  102 ? 134.087 36.611  21.338  1.00 55.17  ? 102  MET M CA  1 
ATOM   5607  C  C   . MET C  3  102 ? 134.791 35.595  20.439  1.00 55.65  ? 102  MET M C   1 
ATOM   5608  O  O   . MET C  3  102 ? 135.734 35.923  19.704  1.00 54.84  ? 102  MET M O   1 
ATOM   5609  C  CB  . MET C  3  102 ? 135.105 37.466  22.092  1.00 56.12  ? 102  MET M CB  1 
ATOM   5610  C  CG  . MET C  3  102 ? 134.585 38.840  22.472  1.00 52.81  ? 102  MET M CG  1 
ATOM   5611  S  SD  . MET C  3  102 ? 133.952 39.729  21.050  1.00 59.49  ? 102  MET M SD  1 
ATOM   5612  C  CE  . MET C  3  102 ? 135.448 40.411  20.338  1.00 51.07  ? 102  MET M CE  1 
ATOM   5613  N  N   . GLY C  3  103 ? 134.310 34.359  20.497  1.00 56.94  ? 103  GLY M N   1 
ATOM   5614  C  CA  . GLY C  3  103 ? 134.872 33.302  19.685  1.00 58.09  ? 103  GLY M CA  1 
ATOM   5615  C  C   . GLY C  3  103 ? 134.552 33.549  18.230  1.00 60.30  ? 103  GLY M C   1 
ATOM   5616  O  O   . GLY C  3  103 ? 133.507 34.136  17.906  1.00 61.13  ? 103  GLY M O   1 
ATOM   5617  N  N   . ILE C  3  104 ? 135.492 33.173  17.361  1.00 61.49  ? 104  ILE M N   1 
ATOM   5618  C  CA  . ILE C  3  104 ? 135.309 33.288  15.918  1.00 58.57  ? 104  ILE M CA  1 
ATOM   5619  C  C   . ILE C  3  104 ? 134.179 32.352  15.505  1.00 56.62  ? 104  ILE M C   1 
ATOM   5620  O  O   . ILE C  3  104 ? 134.202 31.161  15.835  1.00 58.53  ? 104  ILE M O   1 
ATOM   5621  C  CB  . ILE C  3  104 ? 136.603 32.923  15.145  1.00 57.42  ? 104  ILE M CB  1 
ATOM   5622  C  CG1 . ILE C  3  104 ? 137.694 33.959  15.434  1.00 54.79  ? 104  ILE M CG1 1 
ATOM   5623  C  CG2 . ILE C  3  104 ? 136.323 32.872  13.652  1.00 54.43  ? 104  ILE M CG2 1 
ATOM   5624  C  CD1 . ILE C  3  104 ? 139.016 33.674  14.754  0.00 55.74  ? 104  ILE M CD1 1 
ATOM   5625  N  N   . PRO C  3  105 ? 133.090 32.926  14.979  1.00 52.95  ? 105  PRO M N   1 
ATOM   5626  C  CA  . PRO C  3  105 ? 131.942 32.099  14.598  1.00 49.07  ? 105  PRO M CA  1 
ATOM   5627  C  C   . PRO C  3  105 ? 132.264 31.311  13.326  1.00 46.81  ? 105  PRO M C   1 
ATOM   5628  O  O   . PRO C  3  105 ? 133.046 31.757  12.487  1.00 46.99  ? 105  PRO M O   1 
ATOM   5629  C  CB  . PRO C  3  105 ? 130.836 33.126  14.387  1.00 50.00  ? 105  PRO M CB  1 
ATOM   5630  C  CG  . PRO C  3  105 ? 131.566 34.372  13.960  1.00 49.42  ? 105  PRO M CG  1 
ATOM   5631  C  CD  . PRO C  3  105 ? 132.874 34.357  14.683  1.00 50.45  ? 105  PRO M CD  1 
ATOM   5632  N  N   . PRO C  3  106 ? 131.664 30.133  13.166  1.00 43.19  ? 106  PRO M N   1 
ATOM   5633  C  CA  . PRO C  3  106 ? 131.730 29.406  11.887  1.00 43.25  ? 106  PRO M CA  1 
ATOM   5634  C  C   . PRO C  3  106 ? 131.214 30.256  10.730  1.00 45.33  ? 106  PRO M C   1 
ATOM   5635  O  O   . PRO C  3  106 ? 130.372 31.131  10.942  1.00 45.84  ? 106  PRO M O   1 
ATOM   5636  C  CB  . PRO C  3  106 ? 130.840 28.198  12.128  1.00 42.95  ? 106  PRO M CB  1 
ATOM   5637  C  CG  . PRO C  3  106 ? 129.919 28.638  13.228  1.00 43.32  ? 106  PRO M CG  1 
ATOM   5638  C  CD  . PRO C  3  106 ? 130.753 29.485  14.117  1.00 40.19  ? 106  PRO M CD  1 
ATOM   5639  N  N   . LEU C  3  107 ? 131.592 29.907  9.500   1.00 46.43  ? 107  LEU M N   1 
ATOM   5640  C  CA  . LEU C  3  107 ? 131.189 30.692  8.321   1.00 49.04  ? 107  LEU M CA  1 
ATOM   5641  C  C   . LEU C  3  107 ? 129.684 30.735  8.141   1.00 50.38  ? 107  LEU M C   1 
ATOM   5642  O  O   . LEU C  3  107 ? 129.127 31.676  7.555   1.00 51.82  ? 107  LEU M O   1 
ATOM   5643  C  CB  . LEU C  3  107 ? 131.799 30.116  7.053   1.00 45.90  ? 107  LEU M CB  1 
ATOM   5644  C  CG  . LEU C  3  107 ? 133.305 30.191  7.015   1.00 46.35  ? 107  LEU M CG  1 
ATOM   5645  C  CD1 . LEU C  3  107 ? 133.821 28.827  6.672   1.00 49.75  ? 107  LEU M CD1 1 
ATOM   5646  C  CD2 . LEU C  3  107 ? 133.761 31.234  6.026   1.00 44.87  ? 107  LEU M CD2 1 
ATOM   5647  N  N   . HIS C  3  108 ? 129.051 29.635  8.518   1.00 52.52  ? 108  HIS M N   1 
ATOM   5648  C  CA  . HIS C  3  108 ? 127.609 29.521  8.412   1.00 57.64  ? 108  HIS M CA  1 
ATOM   5649  C  C   . HIS C  3  108 ? 126.869 30.366  9.459   1.00 55.83  ? 108  HIS M C   1 
ATOM   5650  O  O   . HIS C  3  108 ? 125.757 30.826  9.202   1.00 58.83  ? 108  HIS M O   1 
ATOM   5651  C  CB  . HIS C  3  108 ? 127.186 28.043  8.485   1.00 63.88  ? 108  HIS M CB  1 
ATOM   5652  C  CG  . HIS C  3  108 ? 127.264 27.439  9.857   1.00 69.96  ? 108  HIS M CG  1 
ATOM   5653  N  ND1 . HIS C  3  108 ? 128.373 26.750  10.303  1.00 73.32  ? 108  HIS M ND1 1 
ATOM   5654  C  CD2 . HIS C  3  108 ? 126.317 27.283  10.815  1.00 73.99  ? 108  HIS M CD2 1 
ATOM   5655  C  CE1 . HIS C  3  108 ? 128.102 26.188  11.467  1.00 76.29  ? 108  HIS M CE1 1 
ATOM   5656  N  NE2 . HIS C  3  108 ? 126.862 26.497  11.801  1.00 77.17  ? 108  HIS M NE2 1 
ATOM   5657  N  N   . ASP C  3  109 ? 127.512 30.619  10.603  1.00 49.76  ? 109  ASP M N   1 
ATOM   5658  C  CA  . ASP C  3  109 ? 126.924 31.452  11.642  1.00 40.02  ? 109  ASP M CA  1 
ATOM   5659  C  C   . ASP C  3  109 ? 127.786 32.659  11.980  1.00 35.68  ? 109  ASP M C   1 
ATOM   5660  O  O   . ASP C  3  109 ? 128.212 32.829  13.118  1.00 32.35  ? 109  ASP M O   1 
ATOM   5661  C  CB  . ASP C  3  109 ? 126.667 30.641  12.905  1.00 36.86  ? 109  ASP M CB  1 
ATOM   5662  C  CG  . ASP C  3  109 ? 125.620 31.280  13.794  1.00 38.49  ? 109  ASP M CG  1 
ATOM   5663  O  OD1 . ASP C  3  109 ? 124.886 32.158  13.299  1.00 38.79  ? 109  ASP M OD1 1 
ATOM   5664  O  OD2 . ASP C  3  109 ? 125.503 30.895  14.975  1.00 35.67  ? 109  ASP M OD2 1 
ATOM   5665  N  N   . GLY C  3  110 ? 127.983 33.527  11.001  1.00 34.81  ? 110  GLY M N   1 
ATOM   5666  C  CA  . GLY C  3  110 ? 128.633 34.791  11.268  1.00 35.36  ? 110  GLY M CA  1 
ATOM   5667  C  C   . GLY C  3  110 ? 130.085 34.867  10.857  1.00 34.77  ? 110  GLY M C   1 
ATOM   5668  O  O   . GLY C  3  110 ? 130.654 35.961  10.821  1.00 36.76  ? 110  GLY M O   1 
ATOM   5669  N  N   . GLY C  3  111 ? 130.676 33.723  10.521  1.00 34.01  ? 111  GLY M N   1 
ATOM   5670  C  CA  . GLY C  3  111 ? 132.044 33.689  10.037  1.00 29.53  ? 111  GLY M CA  1 
ATOM   5671  C  C   . GLY C  3  111 ? 132.241 34.612  8.856   1.00 32.35  ? 111  GLY M C   1 
ATOM   5672  O  O   . GLY C  3  111 ? 133.040 35.542  8.912   1.00 36.26  ? 111  GLY M O   1 
ATOM   5673  N  N   . TRP C  3  112 ? 131.395 34.466  7.849   1.00 34.66  ? 112  TRP M N   1 
ATOM   5674  C  CA  . TRP C  3  112 ? 131.436 35.345  6.683   1.00 37.96  ? 112  TRP M CA  1 
ATOM   5675  C  C   . TRP C  3  112 ? 131.184 36.826  7.003   1.00 36.26  ? 112  TRP M C   1 
ATOM   5676  O  O   . TRP C  3  112 ? 131.680 37.717  6.304   1.00 34.09  ? 112  TRP M O   1 
ATOM   5677  C  CB  . TRP C  3  112 ? 130.420 34.864  5.641   1.00 42.82  ? 112  TRP M CB  1 
ATOM   5678  C  CG  . TRP C  3  112 ? 130.878 33.664  4.884   1.00 46.77  ? 112  TRP M CG  1 
ATOM   5679  C  CD1 . TRP C  3  112 ? 130.350 32.413  4.937   1.00 45.45  ? 112  TRP M CD1 1 
ATOM   5680  C  CD2 . TRP C  3  112 ? 131.981 33.602  3.973   1.00 48.09  ? 112  TRP M CD2 1 
ATOM   5681  N  NE1 . TRP C  3  112 ? 131.057 31.572  4.120   1.00 48.24  ? 112  TRP M NE1 1 
ATOM   5682  C  CE2 . TRP C  3  112 ? 132.057 32.277  3.506   1.00 47.37  ? 112  TRP M CE2 1 
ATOM   5683  C  CE3 . TRP C  3  112 ? 132.925 34.539  3.520   1.00 50.31  ? 112  TRP M CE3 1 
ATOM   5684  C  CZ2 . TRP C  3  112 ? 133.031 31.860  2.601   1.00 48.37  ? 112  TRP M CZ2 1 
ATOM   5685  C  CZ3 . TRP C  3  112 ? 133.896 34.130  2.629   1.00 50.85  ? 112  TRP M CZ3 1 
ATOM   5686  C  CH2 . TRP C  3  112 ? 133.942 32.796  2.175   1.00 50.98  ? 112  TRP M CH2 1 
ATOM   5687  N  N   . TRP C  3  113 ? 130.380 37.085  8.032   1.00 37.25  ? 113  TRP M N   1 
ATOM   5688  C  CA  . TRP C  3  113 ? 129.989 38.451  8.370   1.00 36.68  ? 113  TRP M CA  1 
ATOM   5689  C  C   . TRP C  3  113 ? 131.222 39.190  8.863   1.00 37.42  ? 113  TRP M C   1 
ATOM   5690  O  O   . TRP C  3  113 ? 131.546 40.271  8.362   1.00 36.16  ? 113  TRP M O   1 
ATOM   5691  C  CB  . TRP C  3  113 ? 128.890 38.450  9.443   1.00 35.81  ? 113  TRP M CB  1 
ATOM   5692  C  CG  . TRP C  3  113 ? 128.569 39.809  10.007  1.00 32.51  ? 113  TRP M CG  1 
ATOM   5693  C  CD1 . TRP C  3  113 ? 127.834 40.792  9.410   1.00 35.43  ? 113  TRP M CD1 1 
ATOM   5694  C  CD2 . TRP C  3  113 ? 129.108 40.381  11.198  1.00 34.41  ? 113  TRP M CD2 1 
ATOM   5695  N  NE1 . TRP C  3  113 ? 127.913 41.953  10.137  1.00 37.82  ? 113  TRP M NE1 1 
ATOM   5696  C  CE2 . TRP C  3  113 ? 128.697 41.731  11.237  1.00 35.10  ? 113  TRP M CE2 1 
ATOM   5697  C  CE3 . TRP C  3  113 ? 129.913 39.887  12.235  1.00 36.12  ? 113  TRP M CE3 1 
ATOM   5698  C  CZ2 . TRP C  3  113 ? 129.071 42.596  12.261  1.00 38.31  ? 113  TRP M CZ2 1 
ATOM   5699  C  CZ3 . TRP C  3  113 ? 130.278 40.747  13.262  1.00 38.09  ? 113  TRP M CZ3 1 
ATOM   5700  C  CH2 . TRP C  3  113 ? 129.860 42.089  13.264  1.00 37.94  ? 113  TRP M CH2 1 
ATOM   5701  N  N   . LEU C  3  114 ? 131.975 38.531  9.738   1.00 35.64  ? 114  LEU M N   1 
ATOM   5702  C  CA  . LEU C  3  114 ? 133.258 39.045  10.206  1.00 38.50  ? 114  LEU M CA  1 
ATOM   5703  C  C   . LEU C  3  114 ? 134.192 39.416  9.056   1.00 38.49  ? 114  LEU M C   1 
ATOM   5704  O  O   . LEU C  3  114 ? 134.867 40.449  9.085   1.00 38.71  ? 114  LEU M O   1 
ATOM   5705  C  CB  . LEU C  3  114 ? 133.929 37.988  11.062  1.00 39.86  ? 114  LEU M CB  1 
ATOM   5706  C  CG  . LEU C  3  114 ? 134.603 38.440  12.347  1.00 42.94  ? 114  LEU M CG  1 
ATOM   5707  C  CD1 . LEU C  3  114 ? 134.018 39.743  12.848  1.00 44.10  ? 114  LEU M CD1 1 
ATOM   5708  C  CD2 . LEU C  3  114 ? 134.404 37.341  13.379  1.00 47.01  ? 114  LEU M CD2 1 
ATOM   5709  N  N   . MET C  3  115 ? 134.271 38.516  8.085   1.00 39.23  ? 115  MET M N   1 
ATOM   5710  C  CA  . MET C  3  115 ? 135.136 38.657  6.924   1.00 40.18  ? 115  MET M CA  1 
ATOM   5711  C  C   . MET C  3  115 ? 134.867 39.971  6.255   1.00 38.12  ? 115  MET M C   1 
ATOM   5712  O  O   . MET C  3  115 ? 135.770 40.774  6.023   1.00 37.63  ? 115  MET M O   1 
ATOM   5713  C  CB  . MET C  3  115 ? 134.817 37.558  5.922   1.00 49.88  ? 115  MET M CB  1 
ATOM   5714  C  CG  . MET C  3  115 ? 135.352 36.219  6.278   1.00 58.19  ? 115  MET M CG  1 
ATOM   5715  S  SD  . MET C  3  115 ? 136.977 36.170  5.623   1.00 72.89  ? 115  MET M SD  1 
ATOM   5716  C  CE  . MET C  3  115 ? 137.917 36.818  7.013   1.00 71.25  ? 115  MET M CE  1 
ATOM   5717  N  N   . ALA C  3  116 ? 133.631 40.093  5.791   1.00 36.82  ? 116  ALA M N   1 
ATOM   5718  C  CA  . ALA C  3  116 ? 133.167 41.301  5.146   1.00 34.67  ? 116  ALA M CA  1 
ATOM   5719  C  C   . ALA C  3  116 ? 133.391 42.496  6.069   1.00 34.37  ? 116  ALA M C   1 
ATOM   5720  O  O   . ALA C  3  116 ? 133.810 43.556  5.613   1.00 40.64  ? 116  ALA M O   1 
ATOM   5721  C  CB  . ALA C  3  116 ? 131.704 41.162  4.804   1.00 31.14  ? 116  ALA M CB  1 
ATOM   5722  N  N   . GLY C  3  117 ? 133.198 42.299  7.369   1.00 29.66  ? 117  GLY M N   1 
ATOM   5723  C  CA  . GLY C  3  117 ? 133.433 43.362  8.319   1.00 29.53  ? 117  GLY M CA  1 
ATOM   5724  C  C   . GLY C  3  117 ? 134.862 43.847  8.233   1.00 32.04  ? 117  GLY M C   1 
ATOM   5725  O  O   . GLY C  3  117 ? 135.100 45.054  8.123   1.00 30.68  ? 117  GLY M O   1 
ATOM   5726  N  N   . LEU C  3  118 ? 135.796 42.897  8.138   1.00 33.72  ? 118  LEU M N   1 
ATOM   5727  C  CA  . LEU C  3  118 ? 137.226 43.183  8.000   1.00 33.75  ? 118  LEU M CA  1 
ATOM   5728  C  C   . LEU C  3  118 ? 137.554 43.984  6.760   1.00 34.15  ? 118  LEU M C   1 
ATOM   5729  O  O   . LEU C  3  118 ? 138.341 44.925  6.806   1.00 34.78  ? 118  LEU M O   1 
ATOM   5730  C  CB  . LEU C  3  118 ? 138.011 41.887  7.931   1.00 35.80  ? 118  LEU M CB  1 
ATOM   5731  C  CG  . LEU C  3  118 ? 139.513 41.930  8.200   1.00 41.84  ? 118  LEU M CG  1 
ATOM   5732  C  CD1 . LEU C  3  118 ? 140.055 43.341  8.493   1.00 43.31  ? 118  LEU M CD1 1 
ATOM   5733  C  CD2 . LEU C  3  118 ? 139.749 41.021  9.397   1.00 44.90  ? 118  LEU M CD2 1 
ATOM   5734  N  N   . PHE C  3  119 ? 137.080 43.506  5.624   1.00 35.42  ? 119  PHE M N   1 
ATOM   5735  C  CA  . PHE C  3  119 ? 137.449 44.114  4.367   1.00 37.90  ? 119  PHE M CA  1 
ATOM   5736  C  C   . PHE C  3  119 ? 136.849 45.498  4.232   1.00 38.62  ? 119  PHE M C   1 
ATOM   5737  O  O   . PHE C  3  119 ? 137.471 46.402  3.675   1.00 42.05  ? 119  PHE M O   1 
ATOM   5738  C  CB  . PHE C  3  119 ? 137.026 43.221  3.205   1.00 39.83  ? 119  PHE M CB  1 
ATOM   5739  C  CG  . PHE C  3  119 ? 137.953 42.084  2.973   1.00 41.39  ? 119  PHE M CG  1 
ATOM   5740  C  CD1 . PHE C  3  119 ? 139.249 42.324  2.523   1.00 42.35  ? 119  PHE M CD1 1 
ATOM   5741  C  CD2 . PHE C  3  119 ? 137.608 40.807  3.379   1.00 41.74  ? 119  PHE M CD2 1 
ATOM   5742  C  CE1 . PHE C  3  119 ? 140.189 41.315  2.504   1.00 39.09  ? 119  PHE M CE1 1 
ATOM   5743  C  CE2 . PHE C  3  119 ? 138.543 39.790  3.361   1.00 43.90  ? 119  PHE M CE2 1 
ATOM   5744  C  CZ  . PHE C  3  119 ? 139.836 40.045  2.929   1.00 41.35  ? 119  PHE M CZ  1 
ATOM   5745  N  N   . MET C  3  120 ? 135.671 45.682  4.811   1.00 40.68  ? 120  MET M N   1 
ATOM   5746  C  CA  . MET C  3  120 ? 135.027 46.987  4.820   1.00 41.05  ? 120  MET M CA  1 
ATOM   5747  C  C   . MET C  3  120 ? 135.868 47.957  5.642   1.00 40.03  ? 120  MET M C   1 
ATOM   5748  O  O   . MET C  3  120 ? 136.065 49.100  5.236   1.00 44.03  ? 120  MET M O   1 
ATOM   5749  C  CB  . MET C  3  120 ? 133.628 46.885  5.419   1.00 41.32  ? 120  MET M CB  1 
ATOM   5750  C  CG  . MET C  3  120 ? 132.876 48.185  5.404   1.00 43.90  ? 120  MET M CG  1 
ATOM   5751  S  SD  . MET C  3  120 ? 131.609 48.263  6.655   1.00 44.28  ? 120  MET M SD  1 
ATOM   5752  C  CE  . MET C  3  120 ? 130.376 49.111  5.688   1.00 42.39  ? 120  MET M CE  1 
ATOM   5753  N  N   . THR C  3  121 ? 136.412 47.478  6.759   1.00 37.01  ? 121  THR M N   1 
ATOM   5754  C  CA  . THR C  3  121 ? 137.246 48.302  7.634   1.00 35.66  ? 121  THR M CA  1 
ATOM   5755  C  C   . THR C  3  121 ? 138.490 48.817  6.870   1.00 37.51  ? 121  THR M C   1 
ATOM   5756  O  O   . THR C  3  121 ? 138.797 50.022  6.880   1.00 33.67  ? 121  THR M O   1 
ATOM   5757  C  CB  . THR C  3  121 ? 137.701 47.487  8.878   1.00 36.36  ? 121  THR M CB  1 
ATOM   5758  O  OG1 . THR C  3  121 ? 136.562 46.953  9.564   1.00 33.93  ? 121  THR M OG1 1 
ATOM   5759  C  CG2 . THR C  3  121 ? 138.464 48.365  9.830   1.00 36.61  ? 121  THR M CG2 1 
ATOM   5760  N  N   . LEU C  3  122 ? 139.141 47.906  6.139   1.00 33.91  ? 122  LEU M N   1 
ATOM   5761  C  CA  . LEU C  3  122 ? 140.343 48.219  5.388   1.00 28.67  ? 122  LEU M CA  1 
ATOM   5762  C  C   . LEU C  3  122 ? 139.988 49.118  4.221   1.00 29.26  ? 122  LEU M C   1 
ATOM   5763  O  O   . LEU C  3  122 ? 140.657 50.119  3.982   1.00 29.88  ? 122  LEU M O   1 
ATOM   5764  C  CB  . LEU C  3  122 ? 140.999 46.932  4.903   1.00 25.72  ? 122  LEU M CB  1 
ATOM   5765  C  CG  . LEU C  3  122 ? 141.321 45.919  6.015   1.00 29.59  ? 122  LEU M CG  1 
ATOM   5766  C  CD1 . LEU C  3  122 ? 141.916 44.660  5.441   1.00 28.40  ? 122  LEU M CD1 1 
ATOM   5767  C  CD2 . LEU C  3  122 ? 142.276 46.516  7.024   1.00 28.65  ? 122  LEU M CD2 1 
ATOM   5768  N  N   . SER C  3  123 ? 138.853 48.841  3.592   1.00 27.76  ? 123  SER M N   1 
ATOM   5769  C  CA  . SER C  3  123 ? 138.294 49.714  2.559   1.00 28.50  ? 123  SER M CA  1 
ATOM   5770  C  C   . SER C  3  123 ? 138.146 51.158  3.072   1.00 31.06  ? 123  SER M C   1 
ATOM   5771  O  O   . SER C  3  123 ? 138.809 52.067  2.562   1.00 34.58  ? 123  SER M O   1 
ATOM   5772  C  CB  . SER C  3  123 ? 136.942 49.165  2.115   1.00 25.59  ? 123  SER M CB  1 
ATOM   5773  O  OG  . SER C  3  123 ? 136.425 49.882  1.017   1.00 29.48  ? 123  SER M OG  1 
ATOM   5774  N  N   . LEU C  3  124 ? 137.432 51.324  4.188   1.00 32.39  ? 124  LEU M N   1 
ATOM   5775  C  CA  . LEU C  3  124 ? 137.269 52.627  4.844   1.00 30.96  ? 124  LEU M CA  1 
ATOM   5776  C  C   . LEU C  3  124 ? 138.602 53.228  5.226   1.00 30.26  ? 124  LEU M C   1 
ATOM   5777  O  O   . LEU C  3  124 ? 138.813 54.427  5.039   1.00 31.05  ? 124  LEU M O   1 
ATOM   5778  C  CB  . LEU C  3  124 ? 136.429 52.511  6.114   1.00 28.22  ? 124  LEU M CB  1 
ATOM   5779  C  CG  . LEU C  3  124 ? 134.946 52.191  5.988   1.00 30.03  ? 124  LEU M CG  1 
ATOM   5780  C  CD1 . LEU C  3  124 ? 134.264 52.578  7.276   1.00 32.45  ? 124  LEU M CD1 1 
ATOM   5781  C  CD2 . LEU C  3  124 ? 134.335 52.951  4.837   1.00 31.95  ? 124  LEU M CD2 1 
ATOM   5782  N  N   . GLY C  3  125 ? 139.481 52.403  5.793   1.00 31.08  ? 125  GLY M N   1 
ATOM   5783  C  CA  . GLY C  3  125 ? 140.841 52.829  6.098   1.00 35.38  ? 125  GLY M CA  1 
ATOM   5784  C  C   . GLY C  3  125 ? 141.624 53.438  4.930   1.00 37.45  ? 125  GLY M C   1 
ATOM   5785  O  O   . GLY C  3  125 ? 142.058 54.600  4.982   1.00 40.21  ? 125  GLY M O   1 
ATOM   5786  N  N   . SER C  3  126 ? 141.789 52.671  3.861   1.00 34.40  ? 126  SER M N   1 
ATOM   5787  C  CA  . SER C  3  126 ? 142.468 53.163  2.675   1.00 32.01  ? 126  SER M CA  1 
ATOM   5788  C  C   . SER C  3  126 ? 141.835 54.442  2.168   1.00 33.24  ? 126  SER M C   1 
ATOM   5789  O  O   . SER C  3  126 ? 142.529 55.385  1.794   1.00 36.68  ? 126  SER M O   1 
ATOM   5790  C  CB  . SER C  3  126 ? 142.411 52.115  1.589   1.00 29.85  ? 126  SER M CB  1 
ATOM   5791  O  OG  . SER C  3  126 ? 142.558 50.840  2.171   1.00 31.91  ? 126  SER M OG  1 
ATOM   5792  N  N   . TRP C  3  127 ? 140.512 54.500  2.174   1.00 32.05  ? 127  TRP M N   1 
ATOM   5793  C  CA  . TRP C  3  127 ? 139.864 55.706  1.693   1.00 31.31  ? 127  TRP M CA  1 
ATOM   5794  C  C   . TRP C  3  127 ? 140.151 56.914  2.595   1.00 30.98  ? 127  TRP M C   1 
ATOM   5795  O  O   . TRP C  3  127 ? 140.247 58.053  2.126   1.00 27.50  ? 127  TRP M O   1 
ATOM   5796  C  CB  . TRP C  3  127 ? 138.366 55.504  1.565   1.00 25.75  ? 127  TRP M CB  1 
ATOM   5797  C  CG  . TRP C  3  127 ? 137.775 56.576  0.742   1.00 30.82  ? 127  TRP M CG  1 
ATOM   5798  C  CD1 . TRP C  3  127 ? 137.127 57.691  1.186   1.00 33.11  ? 127  TRP M CD1 1 
ATOM   5799  C  CD2 . TRP C  3  127 ? 137.815 56.677  -0.685  1.00 30.32  ? 127  TRP M CD2 1 
ATOM   5800  N  NE1 . TRP C  3  127 ? 136.756 58.484  0.122   1.00 30.08  ? 127  TRP M NE1 1 
ATOM   5801  C  CE2 . TRP C  3  127 ? 137.142 57.874  -1.039  1.00 28.32  ? 127  TRP M CE2 1 
ATOM   5802  C  CE3 . TRP C  3  127 ? 138.357 55.879  -1.697  1.00 29.92  ? 127  TRP M CE3 1 
ATOM   5803  C  CZ2 . TRP C  3  127 ? 136.981 58.284  -2.364  1.00 27.49  ? 127  TRP M CZ2 1 
ATOM   5804  C  CZ3 . TRP C  3  127 ? 138.208 56.290  -3.014  1.00 33.95  ? 127  TRP M CZ3 1 
ATOM   5805  C  CH2 . TRP C  3  127 ? 137.517 57.485  -3.336  1.00 31.83  ? 127  TRP M CH2 1 
ATOM   5806  N  N   . TRP C  3  128 ? 140.295 56.671  3.891   1.00 29.74  ? 128  TRP M N   1 
ATOM   5807  C  CA  . TRP C  3  128 ? 140.604 57.757  4.792   1.00 28.56  ? 128  TRP M CA  1 
ATOM   5808  C  C   . TRP C  3  128 ? 141.937 58.333  4.358   1.00 30.25  ? 128  TRP M C   1 
ATOM   5809  O  O   . TRP C  3  128 ? 142.036 59.529  4.063   1.00 28.30  ? 128  TRP M O   1 
ATOM   5810  C  CB  . TRP C  3  128 ? 140.694 57.260  6.231   1.00 31.05  ? 128  TRP M CB  1 
ATOM   5811  C  CG  . TRP C  3  128 ? 140.879 58.357  7.204   1.00 26.87  ? 128  TRP M CG  1 
ATOM   5812  C  CD1 . TRP C  3  128 ? 139.936 59.241  7.608   1.00 24.87  ? 128  TRP M CD1 1 
ATOM   5813  C  CD2 . TRP C  3  128 ? 142.129 58.853  7.684   1.00 28.92  ? 128  TRP M CD2 1 
ATOM   5814  N  NE1 . TRP C  3  128 ? 140.518 60.288  8.272   1.00 28.40  ? 128  TRP M NE1 1 
ATOM   5815  C  CE2 . TRP C  3  128 ? 141.868 60.080  8.330   1.00 28.83  ? 128  TRP M CE2 1 
ATOM   5816  C  CE3 . TRP C  3  128 ? 143.451 58.400  7.591   1.00 26.53  ? 128  TRP M CE3 1 
ATOM   5817  C  CZ2 . TRP C  3  128 ? 142.878 60.868  8.879   1.00 30.14  ? 128  TRP M CZ2 1 
ATOM   5818  C  CZ3 . TRP C  3  128 ? 144.455 59.180  8.128   1.00 30.21  ? 128  TRP M CZ3 1 
ATOM   5819  C  CH2 . TRP C  3  128 ? 144.165 60.406  8.766   1.00 34.84  ? 128  TRP M CH2 1 
ATOM   5820  N  N   . ILE C  3  129 ? 142.911 57.441  4.169   1.00 30.89  ? 129  ILE M N   1 
ATOM   5821  C  CA  . ILE C  3  129 ? 144.251 57.841  3.745   1.00 29.21  ? 129  ILE M CA  1 
ATOM   5822  C  C   . ILE C  3  129 ? 144.192 58.720  2.500   1.00 28.32  ? 129  ILE M C   1 
ATOM   5823  O  O   . ILE C  3  129 ? 144.748 59.815  2.490   1.00 29.76  ? 129  ILE M O   1 
ATOM   5824  C  CB  . ILE C  3  129 ? 145.140 56.619  3.461   1.00 27.78  ? 129  ILE M CB  1 
ATOM   5825  C  CG1 . ILE C  3  129 ? 145.326 55.818  4.746   1.00 27.07  ? 129  ILE M CG1 1 
ATOM   5826  C  CG2 . ILE C  3  129 ? 146.487 57.067  2.899   1.00 25.10  ? 129  ILE M CG2 1 
ATOM   5827  C  CD1 . ILE C  3  129 ? 146.181 54.564  4.594   1.00 30.88  ? 129  ILE M CD1 1 
ATOM   5828  N  N   . ARG C  3  130 ? 143.409 58.301  1.510   1.00 26.86  ? 130  ARG M N   1 
ATOM   5829  C  CA  . ARG C  3  130 ? 143.290 59.055  0.275   1.00 27.62  ? 130  ARG M CA  1 
ATOM   5830  C  C   . ARG C  3  130 ? 142.729 60.451  0.530   1.00 31.08  ? 130  ARG M C   1 
ATOM   5831  O  O   . ARG C  3  130 ? 143.143 61.411  -0.131  1.00 37.28  ? 130  ARG M O   1 
ATOM   5832  C  CB  . ARG C  3  130 ? 142.398 58.310  -0.715  1.00 24.70  ? 130  ARG M CB  1 
ATOM   5833  C  CG  . ARG C  3  130 ? 141.897 59.163  -1.878  1.00 23.72  ? 130  ARG M CG  1 
ATOM   5834  C  CD  . ARG C  3  130 ? 140.640 58.540  -2.467  1.00 28.03  ? 130  ARG M CD  1 
ATOM   5835  N  NE  . ARG C  3  130 ? 140.175 59.179  -3.699  1.00 31.09  ? 130  ARG M NE  1 
ATOM   5836  C  CZ  . ARG C  3  130 ? 140.662 58.923  -4.912  1.00 32.51  ? 130  ARG M CZ  1 
ATOM   5837  N  NH1 . ARG C  3  130 ? 141.763 58.194  -5.064  1.00 30.08  ? 130  ARG M NH1 1 
ATOM   5838  N  NH2 . ARG C  3  130 ? 140.086 59.459  -5.973  1.00 29.05  ? 130  ARG M NH2 1 
ATOM   5839  N  N   . VAL C  3  131 ? 141.804 60.564  1.492   1.00 33.54  ? 131  VAL M N   1 
ATOM   5840  C  CA  . VAL C  3  131 ? 141.086 61.821  1.786   1.00 30.74  ? 131  VAL M CA  1 
ATOM   5841  C  C   . VAL C  3  131 ? 142.023 62.778  2.504   1.00 28.24  ? 131  VAL M C   1 
ATOM   5842  O  O   . VAL C  3  131 ? 141.931 64.005  2.371   1.00 29.62  ? 131  VAL M O   1 
ATOM   5843  C  CB  . VAL C  3  131 ? 139.829 61.558  2.685   1.00 31.36  ? 131  VAL M CB  1 
ATOM   5844  C  CG1 . VAL C  3  131 ? 139.267 62.862  3.219   1.00 25.84  ? 131  VAL M CG1 1 
ATOM   5845  C  CG2 . VAL C  3  131 ? 138.757 60.830  1.886   1.00 31.37  ? 131  VAL M CG2 1 
ATOM   5846  N  N   . TYR C  3  132 ? 142.934 62.187  3.255   1.00 25.02  ? 132  TYR M N   1 
ATOM   5847  C  CA  . TYR C  3  132 ? 143.901 62.912  4.031   1.00 27.72  ? 132  TYR M CA  1 
ATOM   5848  C  C   . TYR C  3  132 ? 145.036 63.452  3.137   1.00 31.28  ? 132  TYR M C   1 
ATOM   5849  O  O   . TYR C  3  132 ? 145.317 64.674  3.110   1.00 29.87  ? 132  TYR M O   1 
ATOM   5850  C  CB  . TYR C  3  132 ? 144.438 61.952  5.054   1.00 27.42  ? 132  TYR M CB  1 
ATOM   5851  C  CG  . TYR C  3  132 ? 145.390 62.601  5.969   1.00 40.34  ? 132  TYR M CG  1 
ATOM   5852  C  CD1 . TYR C  3  132 ? 144.941 63.416  6.998   1.00 41.50  ? 132  TYR M CD1 1 
ATOM   5853  C  CD2 . TYR C  3  132 ? 146.750 62.432  5.799   1.00 42.20  ? 132  TYR M CD2 1 
ATOM   5854  C  CE1 . TYR C  3  132 ? 145.833 64.041  7.841   1.00 46.27  ? 132  TYR M CE1 1 
ATOM   5855  C  CE2 . TYR C  3  132 ? 147.652 63.057  6.630   1.00 47.64  ? 132  TYR M CE2 1 
ATOM   5856  C  CZ  . TYR C  3  132 ? 147.192 63.858  7.650   1.00 49.64  ? 132  TYR M CZ  1 
ATOM   5857  O  OH  . TYR C  3  132 ? 148.106 64.465  8.483   1.00 61.12  ? 132  TYR M OH  1 
ATOM   5858  N  N   . SER C  3  133 ? 145.594 62.550  2.323   1.00 33.04  ? 133  SER M N   1 
ATOM   5859  C  CA  . SER C  3  133 ? 146.623 62.863  1.327   1.00 32.10  ? 133  SER M CA  1 
ATOM   5860  C  C   . SER C  3  133 ? 146.258 63.937  0.329   1.00 32.35  ? 133  SER M C   1 
ATOM   5861  O  O   . SER C  3  133 ? 147.007 64.890  0.175   1.00 33.36  ? 133  SER M O   1 
ATOM   5862  C  CB  . SER C  3  133 ? 147.000 61.620  0.555   1.00 28.36  ? 133  SER M CB  1 
ATOM   5863  O  OG  . SER C  3  133 ? 147.105 60.554  1.460   1.00 37.10  ? 133  SER M OG  1 
ATOM   5864  N  N   . ARG C  3  134 ? 145.172 63.756  -0.415  1.00 31.32  ? 134  ARG M N   1 
ATOM   5865  C  CA  . ARG C  3  134 ? 144.825 64.747  -1.438  1.00 34.37  ? 134  ARG M CA  1 
ATOM   5866  C  C   . ARG C  3  134 ? 144.859 66.155  -0.855  1.00 33.00  ? 134  ARG M C   1 
ATOM   5867  O  O   . ARG C  3  134 ? 145.414 67.066  -1.456  1.00 36.06  ? 134  ARG M O   1 
ATOM   5868  C  CB  . ARG C  3  134 ? 143.451 64.462  -2.051  1.00 35.92  ? 134  ARG M CB  1 
ATOM   5869  C  CG  . ARG C  3  134 ? 143.453 63.384  -3.139  1.00 35.89  ? 134  ARG M CG  1 
ATOM   5870  C  CD  . ARG C  3  134 ? 144.224 63.830  -4.368  1.00 39.98  ? 134  ARG M CD  1 
ATOM   5871  N  NE  . ARG C  3  134 ? 145.597 63.337  -4.356  1.00 41.99  ? 134  ARG M NE  1 
ATOM   5872  C  CZ  . ARG C  3  134 ? 146.636 63.970  -4.898  1.00 37.12  ? 134  ARG M CZ  1 
ATOM   5873  N  NH1 . ARG C  3  134 ? 146.449 64.990  -5.721  1.00 33.86  ? 134  ARG M NH1 1 
ATOM   5874  N  NH2 . ARG C  3  134 ? 147.860 63.497  -4.713  1.00 34.74  ? 134  ARG M NH2 1 
ATOM   5875  N  N   . ALA C  3  135 ? 144.458 66.272  0.402   1.00 32.95  ? 135  ALA M N   1 
ATOM   5876  C  CA  . ALA C  3  135 ? 144.469 67.550  1.092   1.00 32.04  ? 135  ALA M CA  1 
ATOM   5877  C  C   . ALA C  3  135 ? 145.903 67.986  1.264   1.00 31.62  ? 135  ALA M C   1 
ATOM   5878  O  O   . ALA C  3  135 ? 146.279 69.077  0.849   1.00 32.90  ? 135  ALA M O   1 
ATOM   5879  C  CB  . ALA C  3  135 ? 143.800 67.421  2.452   1.00 30.84  ? 135  ALA M CB  1 
ATOM   5880  N  N   . ARG C  3  136 ? 146.711 67.099  1.827   1.00 31.32  ? 136  ARG M N   1 
ATOM   5881  C  CA  . ARG C  3  136 ? 148.127 67.367  2.007   1.00 35.60  ? 136  ARG M CA  1 
ATOM   5882  C  C   . ARG C  3  136 ? 148.812 67.723  0.685   1.00 34.47  ? 136  ARG M C   1 
ATOM   5883  O  O   . ARG C  3  136 ? 149.351 68.815  0.532   1.00 37.82  ? 136  ARG M O   1 
ATOM   5884  C  CB  . ARG C  3  136 ? 148.800 66.157  2.651   1.00 36.94  ? 136  ARG M CB  1 
ATOM   5885  C  CG  . ARG C  3  136 ? 148.490 66.026  4.136   1.00 44.94  ? 136  ARG M CG  1 
ATOM   5886  C  CD  . ARG C  3  136 ? 149.304 67.017  4.988   1.00 54.29  ? 136  ARG M CD  1 
ATOM   5887  N  NE  . ARG C  3  136 ? 148.788 68.393  4.938   1.00 61.34  ? 136  ARG M NE  1 
ATOM   5888  C  CZ  . ARG C  3  136 ? 149.529 69.492  5.100   1.00 62.30  ? 136  ARG M CZ  1 
ATOM   5889  N  NH1 . ARG C  3  136 ? 150.828 69.394  5.354   0.00 61.76  ? 136  ARG M NH1 1 
ATOM   5890  N  NH2 . ARG C  3  136 ? 148.964 70.689  5.025   0.00 61.76  ? 136  ARG M NH2 1 
ATOM   5891  N  N   . ALA C  3  137 ? 148.628 66.868  -0.311  1.00 33.89  ? 137  ALA M N   1 
ATOM   5892  C  CA  . ALA C  3  137 ? 149.180 67.059  -1.641  1.00 31.96  ? 137  ALA M CA  1 
ATOM   5893  C  C   . ALA C  3  137 ? 148.849 68.407  -2.227  1.00 32.07  ? 137  ALA M C   1 
ATOM   5894  O  O   . ALA C  3  137 ? 149.626 68.945  -2.996  1.00 34.02  ? 137  ALA M O   1 
ATOM   5895  C  CB  . ALA C  3  137 ? 148.683 65.978  -2.566  1.00 32.21  ? 137  ALA M CB  1 
ATOM   5896  N  N   . LEU C  3  138 ? 147.659 68.909  -1.952  1.00 32.41  ? 138  LEU M N   1 
ATOM   5897  C  CA  . LEU C  3  138 ? 147.225 70.147  -2.573  1.00 32.12  ? 138  LEU M CA  1 
ATOM   5898  C  C   . LEU C  3  138 ? 147.512 71.320  -1.666  1.00 33.17  ? 138  LEU M C   1 
ATOM   5899  O  O   . LEU C  3  138 ? 147.139 72.451  -1.969  1.00 35.81  ? 138  LEU M O   1 
ATOM   5900  C  CB  . LEU C  3  138 ? 145.736 70.078  -2.916  1.00 32.06  ? 138  LEU M CB  1 
ATOM   5901  C  CG  . LEU C  3  138 ? 145.417 69.220  -4.152  1.00 35.68  ? 138  LEU M CG  1 
ATOM   5902  C  CD1 . LEU C  3  138 ? 143.947 68.840  -4.158  1.00 36.39  ? 138  LEU M CD1 1 
ATOM   5903  C  CD2 . LEU C  3  138 ? 145.780 69.974  -5.433  1.00 30.12  ? 138  LEU M CD2 1 
ATOM   5904  N  N   . GLY C  3  139 ? 148.209 71.054  -0.569  1.00 33.30  ? 139  GLY M N   1 
ATOM   5905  C  CA  . GLY C  3  139 ? 148.586 72.118  0.351   1.00 37.55  ? 139  GLY M CA  1 
ATOM   5906  C  C   . GLY C  3  139 ? 147.437 72.660  1.183   1.00 39.53  ? 139  GLY M C   1 
ATOM   5907  O  O   . GLY C  3  139 ? 147.455 73.826  1.599   1.00 41.40  ? 139  GLY M O   1 
ATOM   5908  N  N   . LEU C  3  140 ? 146.503 71.770  1.516   1.00 36.89  ? 140  LEU M N   1 
ATOM   5909  C  CA  . LEU C  3  140 ? 145.257 72.123  2.184   1.00 30.24  ? 140  LEU M CA  1 
ATOM   5910  C  C   . LEU C  3  140 ? 145.266 71.576  3.619   1.00 29.01  ? 140  LEU M C   1 
ATOM   5911  O  O   . LEU C  3  140 ? 145.973 70.607  3.918   1.00 31.28  ? 140  LEU M O   1 
ATOM   5912  C  CB  . LEU C  3  140 ? 144.084 71.514  1.409   1.00 27.30  ? 140  LEU M CB  1 
ATOM   5913  C  CG  . LEU C  3  140 ? 143.824 71.871  -0.049  1.00 21.12  ? 140  LEU M CG  1 
ATOM   5914  C  CD1 . LEU C  3  140 ? 142.678 71.050  -0.557  1.00 21.31  ? 140  LEU M CD1 1 
ATOM   5915  C  CD2 . LEU C  3  140 ? 143.492 73.336  -0.175  1.00 22.53  ? 140  LEU M CD2 1 
ATOM   5916  N  N   . GLY C  3  141 ? 144.465 72.170  4.499   1.00 29.50  ? 141  GLY M N   1 
ATOM   5917  C  CA  . GLY C  3  141 ? 144.250 71.568  5.807   1.00 29.27  ? 141  GLY M CA  1 
ATOM   5918  C  C   . GLY C  3  141 ? 143.484 70.246  5.727   1.00 33.09  ? 141  GLY M C   1 
ATOM   5919  O  O   . GLY C  3  141 ? 142.735 70.010  4.777   1.00 34.57  ? 141  GLY M O   1 
ATOM   5920  N  N   . THR C  3  142 ? 143.517 69.472  6.811   1.00 33.25  ? 142  THR M N   1 
ATOM   5921  C  CA  . THR C  3  142 ? 142.943 68.124  6.846   1.00 30.82  ? 142  THR M CA  1 
ATOM   5922  C  C   . THR C  3  142 ? 141.598 68.021  7.602   1.00 29.19  ? 142  THR M C   1 
ATOM   5923  O  O   . THR C  3  142 ? 141.218 66.951  8.114   1.00 26.97  ? 142  THR M O   1 
ATOM   5924  C  CB  . THR C  3  142 ? 143.956 67.149  7.480   1.00 30.74  ? 142  THR M CB  1 
ATOM   5925  O  OG1 . THR C  3  142 ? 144.366 67.653  8.754   1.00 33.92  ? 142  THR M OG1 1 
ATOM   5926  C  CG2 . THR C  3  142 ? 145.180 67.024  6.609   1.00 30.23  ? 142  THR M CG2 1 
ATOM   5927  N  N   . HIS C  3  143 ? 140.865 69.127  7.626   1.00 27.63  ? 143  HIS M N   1 
ATOM   5928  C  CA  . HIS C  3  143 ? 139.628 69.214  8.392   1.00 27.68  ? 143  HIS M CA  1 
ATOM   5929  C  C   . HIS C  3  143 ? 138.633 68.141  7.933   1.00 31.43  ? 143  HIS M C   1 
ATOM   5930  O  O   . HIS C  3  143 ? 137.972 67.501  8.761   1.00 34.65  ? 143  HIS M O   1 
ATOM   5931  C  CB  . HIS C  3  143 ? 139.008 70.597  8.219   1.00 23.43  ? 143  HIS M CB  1 
ATOM   5932  C  CG  . HIS C  3  143 ? 139.906 71.710  8.648   1.00 26.82  ? 143  HIS M CG  1 
ATOM   5933  N  ND1 . HIS C  3  143 ? 140.906 72.211  7.840   1.00 30.03  ? 143  HIS M ND1 1 
ATOM   5934  C  CD2 . HIS C  3  143 ? 139.933 72.447  9.780   1.00 26.82  ? 143  HIS M CD2 1 
ATOM   5935  C  CE1 . HIS C  3  143 ? 141.505 73.214  8.455   1.00 28.39  ? 143  HIS M CE1 1 
ATOM   5936  N  NE2 . HIS C  3  143 ? 140.935 73.373  9.634   1.00 28.88  ? 143  HIS M NE2 1 
ATOM   5937  N  N   . ILE C  3  144 ? 138.569 67.915  6.618   1.00 29.40  ? 144  ILE M N   1 
ATOM   5938  C  CA  . ILE C  3  144 ? 137.738 66.859  6.064   1.00 24.85  ? 144  ILE M CA  1 
ATOM   5939  C  C   . ILE C  3  144 ? 138.179 65.487  6.595   1.00 21.86  ? 144  ILE M C   1 
ATOM   5940  O  O   . ILE C  3  144 ? 137.398 64.810  7.269   1.00 20.09  ? 144  ILE M O   1 
ATOM   5941  C  CB  . ILE C  3  144 ? 137.745 66.894  4.511   1.00 23.03  ? 144  ILE M CB  1 
ATOM   5942  C  CG1 . ILE C  3  144 ? 137.226 68.249  4.027   1.00 24.26  ? 144  ILE M CG1 1 
ATOM   5943  C  CG2 . ILE C  3  144 ? 136.852 65.826  3.959   1.00 20.28  ? 144  ILE M CG2 1 
ATOM   5944  C  CD1 . ILE C  3  144 ? 136.911 68.298  2.572   1.00 24.60  ? 144  ILE M CD1 1 
ATOM   5945  N  N   . ALA C  3  145 ? 139.465 65.174  6.502   1.00 16.08  ? 145  ALA M N   1 
ATOM   5946  C  CA  . ALA C  3  145 ? 139.907 63.862  6.966   1.00 16.76  ? 145  ALA M CA  1 
ATOM   5947  C  C   . ALA C  3  145 ? 139.527 63.679  8.425   1.00 19.61  ? 145  ALA M C   1 
ATOM   5948  O  O   . ALA C  3  145 ? 139.010 62.639  8.804   1.00 21.33  ? 145  ALA M O   1 
ATOM   5949  C  CB  . ALA C  3  145 ? 141.402 63.695  6.776   1.00 16.99  ? 145  ALA M CB  1 
ATOM   5950  N  N   . TRP C  3  146 ? 139.569 64.753  9.195   1.00 20.73  ? 146  TRP M N   1 
ATOM   5951  C  CA  . TRP C  3  146 ? 139.235 64.627  10.597  1.00 25.50  ? 146  TRP M CA  1 
ATOM   5952  C  C   . TRP C  3  146 ? 137.778 64.400  10.882  1.00 24.29  ? 146  TRP M C   1 
ATOM   5953  O  O   . TRP C  3  146 ? 137.444 63.522  11.671  1.00 27.26  ? 146  TRP M O   1 
ATOM   5954  C  CB  . TRP C  3  146 ? 139.753 65.823  11.378  1.00 34.47  ? 146  TRP M CB  1 
ATOM   5955  C  CG  . TRP C  3  146 ? 141.177 65.622  11.631  1.00 43.75  ? 146  TRP M CG  1 
ATOM   5956  C  CD1 . TRP C  3  146 ? 142.187 66.357  11.102  1.00 45.09  ? 146  TRP M CD1 1 
ATOM   5957  C  CD2 . TRP C  3  146 ? 141.775 64.387  12.076  1.00 49.28  ? 146  TRP M CD2 1 
ATOM   5958  N  NE1 . TRP C  3  146 ? 143.358 65.637  11.116  1.00 49.65  ? 146  TRP M NE1 1 
ATOM   5959  C  CE2 . TRP C  3  146 ? 143.137 64.427  11.716  1.00 49.29  ? 146  TRP M CE2 1 
ATOM   5960  C  CE3 . TRP C  3  146 ? 141.280 63.238  12.714  1.00 49.66  ? 146  TRP M CE3 1 
ATOM   5961  C  CZ2 . TRP C  3  146 ? 144.021 63.359  11.975  1.00 49.19  ? 146  TRP M CZ2 1 
ATOM   5962  C  CZ3 . TRP C  3  146 ? 142.163 62.172  12.968  1.00 48.31  ? 146  TRP M CZ3 1 
ATOM   5963  C  CH2 . TRP C  3  146 ? 143.514 62.246  12.598  1.00 44.35  ? 146  TRP M CH2 1 
ATOM   5964  N  N   . ASN C  3  147 ? 136.919 65.064  10.119  1.00 24.62  ? 147  ASN M N   1 
ATOM   5965  C  CA  . ASN C  3  147 ? 135.473 64.863  10.198  1.00 22.16  ? 147  ASN M CA  1 
ATOM   5966  C  C   . ASN C  3  147 ? 135.089 63.440  9.781   1.00 24.57  ? 147  ASN M C   1 
ATOM   5967  O  O   . ASN C  3  147 ? 134.256 62.804  10.429  1.00 26.69  ? 147  ASN M O   1 
ATOM   5968  C  CB  . ASN C  3  147 ? 134.767 65.889  9.307   1.00 26.36  ? 147  ASN M CB  1 
ATOM   5969  C  CG  . ASN C  3  147 ? 133.260 65.959  9.555   1.00 30.39  ? 147  ASN M CG  1 
ATOM   5970  O  OD1 . ASN C  3  147 ? 132.771 66.913  10.164  1.00 33.42  ? 147  ASN M OD1 1 
ATOM   5971  N  ND2 . ASN C  3  147 ? 132.514 64.987  9.032   1.00 20.00  ? 147  ASN M ND2 1 
ATOM   5972  N  N   . PHE C  3  148 ? 135.808 62.899  8.796   1.00 27.70  ? 148  PHE M N   1 
ATOM   5973  C  CA  . PHE C  3  148 ? 135.610 61.531  8.293   1.00 24.47  ? 148  PHE M CA  1 
ATOM   5974  C  C   . PHE C  3  148 ? 136.022 60.496  9.328   1.00 22.83  ? 148  PHE M C   1 
ATOM   5975  O  O   . PHE C  3  148 ? 135.364 59.475  9.483   1.00 23.56  ? 148  PHE M O   1 
ATOM   5976  C  CB  . PHE C  3  148 ? 136.423 61.335  7.000   1.00 27.66  ? 148  PHE M CB  1 
ATOM   5977  C  CG  . PHE C  3  148 ? 136.085 60.083  6.221   1.00 26.69  ? 148  PHE M CG  1 
ATOM   5978  C  CD1 . PHE C  3  148 ? 134.821 59.509  6.282   1.00 25.48  ? 148  PHE M CD1 1 
ATOM   5979  C  CD2 . PHE C  3  148 ? 137.023 59.525  5.360   1.00 25.97  ? 148  PHE M CD2 1 
ATOM   5980  C  CE1 . PHE C  3  148 ? 134.501 58.402  5.498   1.00 24.53  ? 148  PHE M CE1 1 
ATOM   5981  C  CE2 . PHE C  3  148 ? 136.707 58.421  4.581   1.00 27.24  ? 148  PHE M CE2 1 
ATOM   5982  C  CZ  . PHE C  3  148 ? 135.447 57.857  4.649   1.00 27.05  ? 148  PHE M CZ  1 
ATOM   5983  N  N   . ALA C  3  149 ? 137.095 60.774  10.061  1.00 21.65  ? 149  ALA M N   1 
ATOM   5984  C  CA  . ALA C  3  149 ? 137.576 59.856  11.087  1.00 17.81  ? 149  ALA M CA  1 
ATOM   5985  C  C   . ALA C  3  149 ? 136.457 59.532  12.076  1.00 21.53  ? 149  ALA M C   1 
ATOM   5986  O  O   . ALA C  3  149 ? 136.269 58.380  12.484  1.00 22.75  ? 149  ALA M O   1 
ATOM   5987  C  CB  . ALA C  3  149 ? 138.729 60.482  11.811  1.00 17.10  ? 149  ALA M CB  1 
ATOM   5988  N  N   . ALA C  3  150 ? 135.711 60.564  12.459  1.00 21.39  ? 150  ALA M N   1 
ATOM   5989  C  CA  . ALA C  3  150 ? 134.667 60.421  13.467  1.00 20.18  ? 150  ALA M CA  1 
ATOM   5990  C  C   . ALA C  3  150 ? 133.567 59.528  12.928  1.00 21.89  ? 150  ALA M C   1 
ATOM   5991  O  O   . ALA C  3  150 ? 133.073 58.633  13.621  1.00 25.84  ? 150  ALA M O   1 
ATOM   5992  C  CB  . ALA C  3  150 ? 134.108 61.776  13.816  1.00 18.43  ? 150  ALA M CB  1 
ATOM   5993  N  N   . ALA C  3  151 ? 133.221 59.751  11.664  1.00 22.40  ? 151  ALA M N   1 
ATOM   5994  C  CA  . ALA C  3  151 ? 132.242 58.925  10.973  1.00 18.46  ? 151  ALA M CA  1 
ATOM   5995  C  C   . ALA C  3  151 ? 132.730 57.483  10.925  1.00 18.73  ? 151  ALA M C   1 
ATOM   5996  O  O   . ALA C  3  151 ? 132.047 56.578  11.394  1.00 22.05  ? 151  ALA M O   1 
ATOM   5997  C  CB  . ALA C  3  151 ? 132.009 59.454  9.575   1.00 13.85  ? 151  ALA M CB  1 
ATOM   5998  N  N   . ILE C  3  152 ? 133.969 57.279  10.504  1.00 18.82  ? 152  ILE M N   1 
ATOM   5999  C  CA  . ILE C  3  152 ? 134.495 55.930  10.469  1.00 20.03  ? 152  ILE M CA  1 
ATOM   6000  C  C   . ILE C  3  152 ? 134.501 55.325  11.858  1.00 18.68  ? 152  ILE M C   1 
ATOM   6001  O  O   . ILE C  3  152 ? 134.191 54.153  12.033  1.00 24.27  ? 152  ILE M O   1 
ATOM   6002  C  CB  . ILE C  3  152 ? 135.911 55.882  9.898   1.00 21.52  ? 152  ILE M CB  1 
ATOM   6003  C  CG1 . ILE C  3  152 ? 135.867 56.253  8.413   1.00 20.08  ? 152  ILE M CG1 1 
ATOM   6004  C  CG2 . ILE C  3  152 ? 136.505 54.477  10.103  1.00 16.12  ? 152  ILE M CG2 1 
ATOM   6005  C  CD1 . ILE C  3  152 ? 137.222 56.484  7.801   1.00 21.47  ? 152  ILE M CD1 1 
ATOM   6006  N  N   . PHE C  3  153 ? 134.767 56.134  12.866  1.00 19.64  ? 153  PHE M N   1 
ATOM   6007  C  CA  . PHE C  3  153 ? 134.876 55.577  14.204  1.00 21.21  ? 153  PHE M CA  1 
ATOM   6008  C  C   . PHE C  3  153 ? 133.524 55.097  14.686  1.00 21.98  ? 153  PHE M C   1 
ATOM   6009  O  O   . PHE C  3  153 ? 133.434 54.128  15.436  1.00 24.19  ? 153  PHE M O   1 
ATOM   6010  C  CB  . PHE C  3  153 ? 135.435 56.610  15.174  1.00 24.90  ? 153  PHE M CB  1 
ATOM   6011  C  CG  . PHE C  3  153 ? 135.621 56.084  16.569  1.00 27.14  ? 153  PHE M CG  1 
ATOM   6012  C  CD1 . PHE C  3  153 ? 136.445 54.997  16.807  1.00 28.43  ? 153  PHE M CD1 1 
ATOM   6013  C  CD2 . PHE C  3  153 ? 134.906 56.625  17.629  1.00 25.74  ? 153  PHE M CD2 1 
ATOM   6014  C  CE1 . PHE C  3  153 ? 136.545 54.451  18.080  1.00 31.43  ? 153  PHE M CE1 1 
ATOM   6015  C  CE2 . PHE C  3  153 ? 134.992 56.085  18.903  1.00 27.57  ? 153  PHE M CE2 1 
ATOM   6016  C  CZ  . PHE C  3  153 ? 135.809 54.996  19.132  1.00 30.00  ? 153  PHE M CZ  1 
ATOM   6017  N  N   . PHE C  3  154 ? 132.473 55.811  14.292  1.00 22.44  ? 154  PHE M N   1 
ATOM   6018  C  CA  . PHE C  3  154 ? 131.124 55.434  14.677  1.00 21.45  ? 154  PHE M CA  1 
ATOM   6019  C  C   . PHE C  3  154 ? 130.819 54.020  14.197  1.00 23.11  ? 154  PHE M C   1 
ATOM   6020  O  O   . PHE C  3  154 ? 130.464 53.150  14.990  1.00 26.49  ? 154  PHE M O   1 
ATOM   6021  C  CB  . PHE C  3  154 ? 130.106 56.418  14.101  1.00 18.43  ? 154  PHE M CB  1 
ATOM   6022  C  CG  . PHE C  3  154 ? 128.700 56.052  14.415  1.00 16.31  ? 154  PHE M CG  1 
ATOM   6023  C  CD1 . PHE C  3  154 ? 128.370 55.612  15.685  1.00 14.10  ? 154  PHE M CD1 1 
ATOM   6024  C  CD2 . PHE C  3  154 ? 127.764 55.937  13.408  1.00 16.45  ? 154  PHE M CD2 1 
ATOM   6025  C  CE1 . PHE C  3  154 ? 127.154 55.041  15.948  1.00 17.42  ? 154  PHE M CE1 1 
ATOM   6026  C  CE2 . PHE C  3  154 ? 126.530 55.364  13.657  1.00 19.46  ? 154  PHE M CE2 1 
ATOM   6027  C  CZ  . PHE C  3  154 ? 126.226 54.904  14.935  1.00 19.79  ? 154  PHE M CZ  1 
ATOM   6028  N  N   . VAL C  3  155 ? 131.105 53.779  12.924  1.00 25.56  ? 155  VAL M N   1 
ATOM   6029  C  CA  . VAL C  3  155 ? 130.913 52.489  12.261  1.00 22.91  ? 155  VAL M CA  1 
ATOM   6030  C  C   . VAL C  3  155 ? 131.684 51.432  13.037  1.00 24.77  ? 155  VAL M C   1 
ATOM   6031  O  O   . VAL C  3  155 ? 131.232 50.304  13.205  1.00 27.07  ? 155  VAL M O   1 
ATOM   6032  C  CB  . VAL C  3  155 ? 131.473 52.536  10.797  1.00 25.63  ? 155  VAL M CB  1 
ATOM   6033  C  CG1 . VAL C  3  155 ? 131.496 51.152  10.178  1.00 29.90  ? 155  VAL M CG1 1 
ATOM   6034  C  CG2 . VAL C  3  155 ? 130.664 53.496  9.923   1.00 21.32  ? 155  VAL M CG2 1 
ATOM   6035  N  N   . LEU C  3  156 ? 132.917 51.759  13.378  1.00 24.32  ? 156  LEU M N   1 
ATOM   6036  C  CA  . LEU C  3  156 ? 133.746 50.865  14.157  1.00 20.95  ? 156  LEU M CA  1 
ATOM   6037  C  C   . LEU C  3  156 ? 133.006 50.538  15.441  1.00 24.82  ? 156  LEU M C   1 
ATOM   6038  O  O   . LEU C  3  156 ? 133.053 49.405  15.906  1.00 27.78  ? 156  LEU M O   1 
ATOM   6039  C  CB  . LEU C  3  156 ? 135.057 51.558  14.494  1.00 25.90  ? 156  LEU M CB  1 
ATOM   6040  C  CG  . LEU C  3  156 ? 136.281 51.375  13.607  1.00 27.49  ? 156  LEU M CG  1 
ATOM   6041  C  CD1 . LEU C  3  156 ? 137.048 50.226  14.184  1.00 31.31  ? 156  LEU M CD1 1 
ATOM   6042  C  CD2 . LEU C  3  156 ? 135.930 51.116  12.160  1.00 24.68  ? 156  LEU M CD2 1 
ATOM   6043  N  N   . CYS C  3  157 ? 132.369 51.539  16.050  1.00 22.13  ? 157  CYS M N   1 
ATOM   6044  C  CA  . CYS C  3  157 ? 131.739 51.348  17.351  1.00 22.47  ? 157  CYS M CA  1 
ATOM   6045  C  C   . CYS C  3  157 ? 130.607 50.349  17.282  1.00 23.68  ? 157  CYS M C   1 
ATOM   6046  O  O   . CYS C  3  157 ? 130.580 49.398  18.055  1.00 25.66  ? 157  CYS M O   1 
ATOM   6047  C  CB  . CYS C  3  157 ? 131.206 52.660  17.888  1.00 21.12  ? 157  CYS M CB  1 
ATOM   6048  S  SG  . CYS C  3  157 ? 132.504 53.729  18.508  1.00 26.71  ? 157  CYS M SG  1 
ATOM   6049  N  N   . ILE C  3  158 ? 129.687 50.551  16.339  1.00 24.75  ? 158  ILE M N   1 
ATOM   6050  C  CA  . ILE C  3  158 ? 128.533 49.663  16.183  1.00 25.34  ? 158  ILE M CA  1 
ATOM   6051  C  C   . ILE C  3  158 ? 128.867 48.330  15.499  1.00 25.84  ? 158  ILE M C   1 
ATOM   6052  O  O   . ILE C  3  158 ? 128.191 47.332  15.743  1.00 23.41  ? 158  ILE M O   1 
ATOM   6053  C  CB  . ILE C  3  158 ? 127.344 50.343  15.408  1.00 25.25  ? 158  ILE M CB  1 
ATOM   6054  C  CG1 . ILE C  3  158 ? 127.756 50.685  13.972  1.00 22.15  ? 158  ILE M CG1 1 
ATOM   6055  C  CG2 . ILE C  3  158 ? 126.841 51.570  16.173  1.00 24.82  ? 158  ILE M CG2 1 
ATOM   6056  C  CD1 . ILE C  3  158 ? 126.660 51.322  13.165  1.00 20.74  ? 158  ILE M CD1 1 
ATOM   6057  N  N   . GLY C  3  159 ? 129.924 48.307  14.687  1.00 25.75  ? 159  GLY M N   1 
ATOM   6058  C  CA  . GLY C  3  159 ? 130.323 47.085  14.003  1.00 28.34  ? 159  GLY M CA  1 
ATOM   6059  C  C   . GLY C  3  159 ? 131.246 46.172  14.801  1.00 28.90  ? 159  GLY M C   1 
ATOM   6060  O  O   . GLY C  3  159 ? 131.070 44.961  14.784  1.00 28.27  ? 159  GLY M O   1 
ATOM   6061  N  N   . CYS C  3  160 ? 132.191 46.755  15.536  1.00 31.41  ? 160  CYS M N   1 
ATOM   6062  C  CA  . CYS C  3  160 ? 133.246 46.005  16.221  1.00 33.44  ? 160  CYS M CA  1 
ATOM   6063  C  C   . CYS C  3  160 ? 133.251 46.260  17.698  1.00 28.53  ? 160  CYS M C   1 
ATOM   6064  O  O   . CYS C  3  160 ? 133.263 45.336  18.501  1.00 35.12  ? 160  CYS M O   1 
ATOM   6065  C  CB  . CYS C  3  160 ? 134.630 46.411  15.712  1.00 42.15  ? 160  CYS M CB  1 
ATOM   6066  S  SG  . CYS C  3  160 ? 135.224 45.512  14.272  1.00 63.31  ? 160  CYS M SG  1 
ATOM   6067  N  N   . ILE C  3  161 ? 133.441 47.513  18.055  1.00 25.68  ? 161  ILE M N   1 
ATOM   6068  C  CA  . ILE C  3  161 ? 133.919 47.812  19.383  1.00 25.75  ? 161  ILE M CA  1 
ATOM   6069  C  C   . ILE C  3  161 ? 132.876 47.503  20.448  1.00 27.22  ? 161  ILE M C   1 
ATOM   6070  O  O   . ILE C  3  161 ? 133.149 46.752  21.389  1.00 30.98  ? 161  ILE M O   1 
ATOM   6071  C  CB  . ILE C  3  161 ? 134.388 49.260  19.462  1.00 22.60  ? 161  ILE M CB  1 
ATOM   6072  C  CG1 . ILE C  3  161 ? 135.405 49.514  18.344  1.00 21.97  ? 161  ILE M CG1 1 
ATOM   6073  C  CG2 . ILE C  3  161 ? 135.023 49.516  20.794  1.00 14.82  ? 161  ILE M CG2 1 
ATOM   6074  C  CD1 . ILE C  3  161 ? 135.798 50.963  18.148  1.00 20.93  ? 161  ILE M CD1 1 
ATOM   6075  N  N   . HIS C  3  162 ? 131.637 47.899  20.201  1.00 22.45  ? 162  HIS M N   1 
ATOM   6076  C  CA  . HIS C  3  162 ? 130.589 47.557  21.142  1.00 24.12  ? 162  HIS M CA  1 
ATOM   6077  C  C   . HIS C  3  162 ? 130.416 46.043  21.289  1.00 23.96  ? 162  HIS M C   1 
ATOM   6078  O  O   . HIS C  3  162 ? 130.171 45.573  22.393  1.00 27.75  ? 162  HIS M O   1 
ATOM   6079  C  CB  . HIS C  3  162 ? 129.258 48.225  20.772  1.00 19.93  ? 162  HIS M CB  1 
ATOM   6080  C  CG  . HIS C  3  162 ? 128.068 47.556  21.376  1.00 17.65  ? 162  HIS M CG  1 
ATOM   6081  N  ND1 . HIS C  3  162 ? 127.820 47.577  22.729  1.00 15.36  ? 162  HIS M ND1 1 
ATOM   6082  C  CD2 . HIS C  3  162 ? 127.208 46.648  20.855  1.00 18.06  ? 162  HIS M CD2 1 
ATOM   6083  C  CE1 . HIS C  3  162 ? 126.884 46.692  23.021  1.00 13.45  ? 162  HIS M CE1 1 
ATOM   6084  N  NE2 . HIS C  3  162 ? 126.494 46.115  21.900  1.00 12.43  ? 162  HIS M NE2 1 
ATOM   6085  N  N   . PRO C  3  163 ? 130.544 45.262  20.196  1.00 26.01  ? 163  PRO M N   1 
ATOM   6086  C  CA  . PRO C  3  163 ? 130.433 43.806  20.389  1.00 28.97  ? 163  PRO M CA  1 
ATOM   6087  C  C   . PRO C  3  163 ? 131.597 43.233  21.169  1.00 29.68  ? 163  PRO M C   1 
ATOM   6088  O  O   . PRO C  3  163 ? 131.419 42.355  22.005  1.00 31.72  ? 163  PRO M O   1 
ATOM   6089  C  CB  . PRO C  3  163 ? 130.392 43.263  18.971  1.00 27.00  ? 163  PRO M CB  1 
ATOM   6090  C  CG  . PRO C  3  163 ? 129.700 44.320  18.242  1.00 23.88  ? 163  PRO M CG  1 
ATOM   6091  C  CD  . PRO C  3  163 ? 130.254 45.606  18.796  1.00 25.73  ? 163  PRO M CD  1 
ATOM   6092  N  N   . THR C  3  164 ? 132.769 43.809  20.966  1.00 27.08  ? 164  THR M N   1 
ATOM   6093  C  CA  . THR C  3  164 ? 133.942 43.400  21.706  1.00 26.69  ? 164  THR M CA  1 
ATOM   6094  C  C   . THR C  3  164 ? 133.809 43.722  23.177  1.00 29.78  ? 164  THR M C   1 
ATOM   6095  O  O   . THR C  3  164 ? 134.119 42.889  24.034  1.00 33.08  ? 164  THR M O   1 
ATOM   6096  C  CB  . THR C  3  164 ? 135.165 44.101  21.175  1.00 27.40  ? 164  THR M CB  1 
ATOM   6097  O  OG1 . THR C  3  164 ? 135.314 43.782  19.792  1.00 26.33  ? 164  THR M OG1 1 
ATOM   6098  C  CG2 . THR C  3  164 ? 136.375 43.644  21.908  1.00 28.20  ? 164  THR M CG2 1 
ATOM   6099  N  N   . LEU C  3  165 ? 133.313 44.921  23.461  1.00 30.69  ? 165  LEU M N   1 
ATOM   6100  C  CA  . LEU C  3  165 ? 133.199 45.405  24.825  1.00 31.22  ? 165  LEU M CA  1 
ATOM   6101  C  C   . LEU C  3  165 ? 132.295 44.511  25.651  1.00 32.52  ? 165  LEU M C   1 
ATOM   6102  O  O   . LEU C  3  165 ? 132.706 44.046  26.708  1.00 36.97  ? 165  LEU M O   1 
ATOM   6103  C  CB  . LEU C  3  165 ? 132.675 46.848  24.843  1.00 34.16  ? 165  LEU M CB  1 
ATOM   6104  C  CG  . LEU C  3  165 ? 133.699 47.959  24.574  1.00 31.62  ? 165  LEU M CG  1 
ATOM   6105  C  CD1 . LEU C  3  165 ? 133.051 49.346  24.520  1.00 27.77  ? 165  LEU M CD1 1 
ATOM   6106  C  CD2 . LEU C  3  165 ? 134.706 47.915  25.683  1.00 31.40  ? 165  LEU M CD2 1 
ATOM   6107  N  N   . VAL C  3  166 ? 131.102 44.207  25.135  1.00 33.03  ? 166  VAL M N   1 
ATOM   6108  C  CA  . VAL C  3  166 ? 130.167 43.303  25.829  1.00 30.52  ? 166  VAL M CA  1 
ATOM   6109  C  C   . VAL C  3  166 ? 130.566 41.819  25.655  1.00 31.85  ? 166  VAL M C   1 
ATOM   6110  O  O   . VAL C  3  166 ? 130.123 40.929  26.408  1.00 30.61  ? 166  VAL M O   1 
ATOM   6111  C  CB  . VAL C  3  166 ? 128.680 43.498  25.347  1.00 28.59  ? 166  VAL M CB  1 
ATOM   6112  C  CG1 . VAL C  3  166 ? 128.157 44.867  25.752  1.00 29.24  ? 166  VAL M CG1 1 
ATOM   6113  C  CG2 . VAL C  3  166 ? 128.570 43.317  23.861  1.00 24.90  ? 166  VAL M CG2 1 
ATOM   6114  N  N   . GLY C  3  167 ? 131.372 41.557  24.633  1.00 29.13  ? 167  GLY M N   1 
ATOM   6115  C  CA  . GLY C  3  167 ? 131.945 40.242  24.471  1.00 28.50  ? 167  GLY M CA  1 
ATOM   6116  C  C   . GLY C  3  167 ? 131.073 39.331  23.646  1.00 27.20  ? 167  GLY M C   1 
ATOM   6117  O  O   . GLY C  3  167 ? 131.143 38.121  23.826  1.00 26.65  ? 167  GLY M O   1 
ATOM   6118  N  N   . SER C  3  168 ? 130.255 39.889  22.752  1.00 24.16  ? 168  SER M N   1 
ATOM   6119  C  CA  . SER C  3  168 ? 129.507 39.069  21.808  1.00 22.51  ? 168  SER M CA  1 
ATOM   6120  C  C   . SER C  3  168 ? 129.424 39.629  20.404  1.00 25.61  ? 168  SER M C   1 
ATOM   6121  O  O   . SER C  3  168 ? 128.873 40.706  20.172  1.00 29.30  ? 168  SER M O   1 
ATOM   6122  C  CB  . SER C  3  168 ? 128.097 38.795  22.304  1.00 25.36  ? 168  SER M CB  1 
ATOM   6123  O  OG  . SER C  3  168 ? 127.416 37.984  21.355  1.00 30.59  ? 168  SER M OG  1 
ATOM   6124  N  N   . TRP C  3  169 ? 129.839 38.813  19.444  1.00 28.71  ? 169  TRP M N   1 
ATOM   6125  C  CA  . TRP C  3  169 ? 129.770 39.187  18.047  1.00 28.53  ? 169  TRP M CA  1 
ATOM   6126  C  C   . TRP C  3  169 ? 128.348 39.238  17.572  1.00 26.24  ? 169  TRP M C   1 
ATOM   6127  O  O   . TRP C  3  169 ? 128.077 39.839  16.545  1.00 27.13  ? 169  TRP M O   1 
ATOM   6128  C  CB  . TRP C  3  169 ? 130.536 38.193  17.198  1.00 30.36  ? 169  TRP M CB  1 
ATOM   6129  C  CG  . TRP C  3  169 ? 131.973 38.376  17.308  1.00 33.45  ? 169  TRP M CG  1 
ATOM   6130  C  CD1 . TRP C  3  169 ? 132.874 37.467  17.744  1.00 33.73  ? 169  TRP M CD1 1 
ATOM   6131  C  CD2 . TRP C  3  169 ? 132.713 39.542  16.928  1.00 34.15  ? 169  TRP M CD2 1 
ATOM   6132  N  NE1 . TRP C  3  169 ? 134.140 37.985  17.650  1.00 36.71  ? 169  TRP M NE1 1 
ATOM   6133  C  CE2 . TRP C  3  169 ? 134.071 39.258  17.148  1.00 34.23  ? 169  TRP M CE2 1 
ATOM   6134  C  CE3 . TRP C  3  169 ? 132.359 40.792  16.404  1.00 34.26  ? 169  TRP M CE3 1 
ATOM   6135  C  CZ2 . TRP C  3  169 ? 135.087 40.178  16.860  1.00 35.94  ? 169  TRP M CZ2 1 
ATOM   6136  C  CZ3 . TRP C  3  169 ? 133.372 41.708  16.111  1.00 34.83  ? 169  TRP M CZ3 1 
ATOM   6137  C  CH2 . TRP C  3  169 ? 134.719 41.393  16.338  1.00 34.20  ? 169  TRP M CH2 1 
ATOM   6138  N  N   . SER C  3  170 ? 127.437 38.623  18.328  1.00 28.63  ? 170  SER M N   1 
ATOM   6139  C  CA  . SER C  3  170 ? 126.031 38.525  17.926  1.00 27.86  ? 170  SER M CA  1 
ATOM   6140  C  C   . SER C  3  170 ? 125.366 39.897  17.836  1.00 27.70  ? 170  SER M C   1 
ATOM   6141  O  O   . SER C  3  170 ? 124.326 40.042  17.185  1.00 28.61  ? 170  SER M O   1 
ATOM   6142  C  CB  . SER C  3  170 ? 125.243 37.637  18.898  1.00 24.81  ? 170  SER M CB  1 
ATOM   6143  O  OG  . SER C  3  170 ? 124.929 38.333  20.087  1.00 25.18  ? 170  SER M OG  1 
ATOM   6144  N  N   . GLU C  3  171 ? 126.040 40.914  18.373  1.00 25.48  ? 171  GLU M N   1 
ATOM   6145  C  CA  . GLU C  3  171 ? 125.461 42.245  18.509  1.00 23.67  ? 171  GLU M CA  1 
ATOM   6146  C  C   . GLU C  3  171 ? 125.688 43.160  17.299  1.00 22.52  ? 171  GLU M C   1 
ATOM   6147  O  O   . GLU C  3  171 ? 125.144 44.276  17.254  1.00 21.52  ? 171  GLU M O   1 
ATOM   6148  C  CB  . GLU C  3  171 ? 126.000 42.922  19.778  1.00 23.25  ? 171  GLU M CB  1 
ATOM   6149  C  CG  . GLU C  3  171 ? 125.856 42.092  21.038  1.00 20.18  ? 171  GLU M CG  1 
ATOM   6150  C  CD  . GLU C  3  171 ? 124.894 42.691  22.049  1.00 26.39  ? 171  GLU M CD  1 
ATOM   6151  O  OE1 . GLU C  3  171 ? 124.765 43.931  22.131  1.00 19.91  ? 171  GLU M OE1 1 
ATOM   6152  O  OE2 . GLU C  3  171 ? 124.273 41.909  22.791  1.00 31.78  ? 171  GLU M OE2 1 
ATOM   6153  N  N   . GLY C  3  172 ? 126.506 42.712  16.349  1.00 18.08  ? 172  GLY M N   1 
ATOM   6154  C  CA  . GLY C  3  172 ? 126.915 43.579  15.252  1.00 14.28  ? 172  GLY M CA  1 
ATOM   6155  C  C   . GLY C  3  172 ? 125.817 43.866  14.252  1.00 18.83  ? 172  GLY M C   1 
ATOM   6156  O  O   . GLY C  3  172 ? 124.738 43.284  14.326  1.00 23.95  ? 172  GLY M O   1 
ATOM   6157  N  N   . VAL C  3  173 ? 126.108 44.705  13.270  1.00 16.33  ? 173  VAL M N   1 
ATOM   6158  C  CA  . VAL C  3  173 ? 125.110 45.159  12.325  1.00 16.03  ? 173  VAL M CA  1 
ATOM   6159  C  C   . VAL C  3  173 ? 125.198 44.263  11.097  1.00 19.92  ? 173  VAL M C   1 
ATOM   6160  O  O   . VAL C  3  173 ? 126.246 44.171  10.475  1.00 21.69  ? 173  VAL M O   1 
ATOM   6161  C  CB  . VAL C  3  173 ? 125.383 46.619  11.902  1.00 14.24  ? 173  VAL M CB  1 
ATOM   6162  C  CG1 . VAL C  3  173 ? 124.253 47.141  11.075  1.00 16.74  ? 173  VAL M CG1 1 
ATOM   6163  C  CG2 . VAL C  3  173 ? 125.561 47.493  13.113  1.00 6.13   ? 173  VAL M CG2 1 
ATOM   6164  N  N   . PRO C  3  174 ? 124.106 43.573  10.754  1.00 22.60  ? 174  PRO M N   1 
ATOM   6165  C  CA  . PRO C  3  174 ? 124.031 42.730  9.551   1.00 23.14  ? 174  PRO M CA  1 
ATOM   6166  C  C   . PRO C  3  174 ? 124.270 43.569  8.314   1.00 25.42  ? 174  PRO M C   1 
ATOM   6167  O  O   . PRO C  3  174 ? 124.058 44.774  8.361   1.00 28.32  ? 174  PRO M O   1 
ATOM   6168  C  CB  . PRO C  3  174 ? 122.592 42.195  9.565   1.00 25.33  ? 174  PRO M CB  1 
ATOM   6169  C  CG  . PRO C  3  174 ? 122.043 42.523  10.915  1.00 23.40  ? 174  PRO M CG  1 
ATOM   6170  C  CD  . PRO C  3  174 ? 122.781 43.752  11.364  1.00 24.76  ? 174  PRO M CD  1 
ATOM   6171  N  N   . PHE C  3  175 ? 124.716 42.950  7.219   1.00 26.26  ? 175  PHE M N   1 
ATOM   6172  C  CA  . PHE C  3  175 ? 124.743 43.632  5.915   1.00 28.79  ? 175  PHE M CA  1 
ATOM   6173  C  C   . PHE C  3  175 ? 123.474 43.289  5.157   1.00 27.75  ? 175  PHE M C   1 
ATOM   6174  O  O   . PHE C  3  175 ? 123.094 42.125  5.094   1.00 32.62  ? 175  PHE M O   1 
ATOM   6175  C  CB  . PHE C  3  175 ? 125.930 43.176  5.063   1.00 29.65  ? 175  PHE M CB  1 
ATOM   6176  C  CG  . PHE C  3  175 ? 127.274 43.520  5.639   1.00 27.14  ? 175  PHE M CG  1 
ATOM   6177  C  CD1 . PHE C  3  175 ? 127.888 42.678  6.562   1.00 25.06  ? 175  PHE M CD1 1 
ATOM   6178  C  CD2 . PHE C  3  175 ? 127.918 44.696  5.273   1.00 24.39  ? 175  PHE M CD2 1 
ATOM   6179  C  CE1 . PHE C  3  175 ? 129.118 43.013  7.126   1.00 22.55  ? 175  PHE M CE1 1 
ATOM   6180  C  CE2 . PHE C  3  175 ? 129.142 45.029  5.827   1.00 21.94  ? 175  PHE M CE2 1 
ATOM   6181  C  CZ  . PHE C  3  175 ? 129.743 44.186  6.761   1.00 22.53  ? 175  PHE M CZ  1 
ATOM   6182  N  N   . GLY C  3  176 ? 122.837 44.289  4.565   1.00 27.69  ? 176  GLY M N   1 
ATOM   6183  C  CA  . GLY C  3  176 ? 121.639 44.047  3.781   1.00 23.91  ? 176  GLY M CA  1 
ATOM   6184  C  C   . GLY C  3  176 ? 120.698 45.198  4.025   1.00 24.89  ? 176  GLY M C   1 
ATOM   6185  O  O   . GLY C  3  176 ? 120.711 45.772  5.108   1.00 25.82  ? 176  GLY M O   1 
ATOM   6186  N  N   . ILE C  3  177 ? 119.853 45.513  3.051   1.00 23.73  ? 177  ILE M N   1 
ATOM   6187  C  CA  . ILE C  3  177 ? 119.031 46.704  3.124   1.00 20.91  ? 177  ILE M CA  1 
ATOM   6188  C  C   . ILE C  3  177 ? 118.023 46.716  4.277   1.00 23.30  ? 177  ILE M C   1 
ATOM   6189  O  O   . ILE C  3  177 ? 118.143 47.553  5.160   1.00 27.90  ? 177  ILE M O   1 
ATOM   6190  C  CB  . ILE C  3  177 ? 118.325 46.951  1.812   1.00 21.10  ? 177  ILE M CB  1 
ATOM   6191  C  CG1 . ILE C  3  177 ? 119.327 46.809  0.668   1.00 23.51  ? 177  ILE M CG1 1 
ATOM   6192  C  CG2 . ILE C  3  177 ? 117.710 48.342  1.805   1.00 22.20  ? 177  ILE M CG2 1 
ATOM   6193  C  CD1 . ILE C  3  177 ? 120.125 48.046  0.399   1.00 17.81  ? 177  ILE M CD1 1 
ATOM   6194  N  N   . TRP C  3  178 ? 117.034 45.821  4.279   1.00 21.66  ? 178  TRP M N   1 
ATOM   6195  C  CA  . TRP C  3  178 ? 116.148 45.707  5.429   1.00 19.36  ? 178  TRP M CA  1 
ATOM   6196  C  C   . TRP C  3  178 ? 116.874 45.181  6.658   1.00 23.36  ? 178  TRP M C   1 
ATOM   6197  O  O   . TRP C  3  178 ? 116.533 45.582  7.775   1.00 26.42  ? 178  TRP M O   1 
ATOM   6198  C  CB  . TRP C  3  178 ? 114.949 44.803  5.155   1.00 15.75  ? 178  TRP M CB  1 
ATOM   6199  C  CG  . TRP C  3  178 ? 113.973 45.340  4.190   1.00 17.71  ? 178  TRP M CG  1 
ATOM   6200  C  CD1 . TRP C  3  178 ? 113.219 44.618  3.332   1.00 19.09  ? 178  TRP M CD1 1 
ATOM   6201  C  CD2 . TRP C  3  178 ? 113.573 46.711  4.023   1.00 20.07  ? 178  TRP M CD2 1 
ATOM   6202  N  NE1 . TRP C  3  178 ? 112.361 45.443  2.642   1.00 21.96  ? 178  TRP M NE1 1 
ATOM   6203  C  CE2 . TRP C  3  178 ? 112.557 46.732  3.047   1.00 19.65  ? 178  TRP M CE2 1 
ATOM   6204  C  CE3 . TRP C  3  178 ? 113.969 47.918  4.609   1.00 21.26  ? 178  TRP M CE3 1 
ATOM   6205  C  CZ2 . TRP C  3  178 ? 111.930 47.910  2.639   1.00 21.11  ? 178  TRP M CZ2 1 
ATOM   6206  C  CZ3 . TRP C  3  178 ? 113.343 49.100  4.202   1.00 22.64  ? 178  TRP M CZ3 1 
ATOM   6207  C  CH2 . TRP C  3  178 ? 112.337 49.082  3.229   1.00 23.34  ? 178  TRP M CH2 1 
ATOM   6208  N  N   . PRO C  3  179 ? 117.809 44.208  6.498   1.00 22.25  ? 179  PRO M N   1 
ATOM   6209  C  CA  . PRO C  3  179 ? 118.450 43.650  7.702   1.00 22.83  ? 179  PRO M CA  1 
ATOM   6210  C  C   . PRO C  3  179 ? 119.220 44.652  8.585   1.00 23.53  ? 179  PRO M C   1 
ATOM   6211  O  O   . PRO C  3  179 ? 118.995 44.705  9.787   1.00 30.86  ? 179  PRO M O   1 
ATOM   6212  C  CB  . PRO C  3  179 ? 119.341 42.533  7.144   1.00 20.67  ? 179  PRO M CB  1 
ATOM   6213  C  CG  . PRO C  3  179 ? 118.588 42.074  5.950   1.00 16.93  ? 179  PRO M CG  1 
ATOM   6214  C  CD  . PRO C  3  179 ? 118.074 43.350  5.327   1.00 19.58  ? 179  PRO M CD  1 
ATOM   6215  N  N   . HIS C  3  180 ? 119.987 45.558  7.988   1.00 25.63  ? 180  HIS M N   1 
ATOM   6216  C  CA  . HIS C  3  180 ? 120.667 46.592  8.769   1.00 21.81  ? 180  HIS M CA  1 
ATOM   6217  C  C   . HIS C  3  180 ? 119.665 47.508  9.488   1.00 23.40  ? 180  HIS M C   1 
ATOM   6218  O  O   . HIS C  3  180 ? 119.921 47.924  10.621  1.00 23.78  ? 180  HIS M O   1 
ATOM   6219  C  CB  . HIS C  3  180 ? 121.685 47.357  7.872   1.00 18.53  ? 180  HIS M CB  1 
ATOM   6220  C  CG  . HIS C  3  180 ? 121.244 48.715  7.391   1.00 21.86  ? 180  HIS M CG  1 
ATOM   6221  N  ND1 . HIS C  3  180 ? 120.361 48.919  6.347   1.00 21.38  ? 180  HIS M ND1 1 
ATOM   6222  C  CD2 . HIS C  3  180 ? 121.809 49.931  7.618   1.00 20.16  ? 180  HIS M CD2 1 
ATOM   6223  C  CE1 . HIS C  3  180 ? 120.434 50.216  5.988   1.00 23.33  ? 180  HIS M CE1 1 
ATOM   6224  N  NE2 . HIS C  3  180 ? 121.312 50.870  6.732   1.00 22.52  ? 180  HIS M NE2 1 
ATOM   6225  N  N   . ILE C  3  181 ? 118.438 47.571  8.954   1.00 22.30  ? 181  ILE M N   1 
ATOM   6226  C  CA  . ILE C  3  181 ? 117.366 48.404  9.497   1.00 18.50  ? 181  ILE M CA  1 
ATOM   6227  C  C   . ILE C  3  181 ? 116.699 47.691  10.679  1.00 21.70  ? 181  ILE M C   1 
ATOM   6228  O  O   . ILE C  3  181 ? 116.403 48.307  11.698  1.00 27.13  ? 181  ILE M O   1 
ATOM   6229  C  CB  . ILE C  3  181 ? 116.297 48.722  8.403   1.00 21.48  ? 181  ILE M CB  1 
ATOM   6230  C  CG1 . ILE C  3  181 ? 116.835 49.731  7.398   1.00 18.08  ? 181  ILE M CG1 1 
ATOM   6231  C  CG2 . ILE C  3  181 ? 115.039 49.272  9.021   1.00 16.93  ? 181  ILE M CG2 1 
ATOM   6232  C  CD1 . ILE C  3  181 ? 117.251 51.011  8.028   1.00 24.92  ? 181  ILE M CD1 1 
ATOM   6233  N  N   . ASP C  3  182 ? 116.489 46.388  10.566  1.00 22.20  ? 182  ASP M N   1 
ATOM   6234  C  CA  . ASP C  3  182 ? 115.833 45.628  11.632  1.00 21.31  ? 182  ASP M CA  1 
ATOM   6235  C  C   . ASP C  3  182 ? 116.690 45.608  12.894  1.00 20.15  ? 182  ASP M C   1 
ATOM   6236  O  O   . ASP C  3  182 ? 116.166 45.567  14.006  1.00 18.50  ? 182  ASP M O   1 
ATOM   6237  C  CB  . ASP C  3  182 ? 115.553 44.182  11.180  1.00 24.86  ? 182  ASP M CB  1 
ATOM   6238  C  CG  . ASP C  3  182 ? 114.491 44.086  10.076  1.00 22.66  ? 182  ASP M CG  1 
ATOM   6239  O  OD1 . ASP C  3  182 ? 113.600 44.944  9.967   1.00 27.00  ? 182  ASP M OD1 1 
ATOM   6240  O  OD2 . ASP C  3  182 ? 114.512 43.100  9.341   1.00 25.02  ? 182  ASP M OD2 1 
ATOM   6241  N  N   . TRP C  3  183 ? 118.006 45.650  12.699  1.00 18.83  ? 183  TRP M N   1 
ATOM   6242  C  CA  . TRP C  3  183 ? 118.978 45.701  13.782  1.00 18.74  ? 183  TRP M CA  1 
ATOM   6243  C  C   . TRP C  3  183 ? 118.701 46.889  14.704  1.00 19.27  ? 183  TRP M C   1 
ATOM   6244  O  O   . TRP C  3  183 ? 118.723 46.759  15.927  1.00 19.82  ? 183  TRP M O   1 
ATOM   6245  C  CB  . TRP C  3  183 ? 120.386 45.832  13.198  1.00 19.84  ? 183  TRP M CB  1 
ATOM   6246  C  CG  . TRP C  3  183 ? 121.445 46.060  14.235  1.00 21.14  ? 183  TRP M CG  1 
ATOM   6247  C  CD1 . TRP C  3  183 ? 121.999 45.121  15.064  1.00 18.35  ? 183  TRP M CD1 1 
ATOM   6248  C  CD2 . TRP C  3  183 ? 122.044 47.316  14.596  1.00 24.19  ? 183  TRP M CD2 1 
ATOM   6249  N  NE1 . TRP C  3  183 ? 122.905 45.715  15.911  1.00 19.78  ? 183  TRP M NE1 1 
ATOM   6250  C  CE2 . TRP C  3  183 ? 122.944 47.062  15.652  1.00 21.51  ? 183  TRP M CE2 1 
ATOM   6251  C  CE3 . TRP C  3  183 ? 121.889 48.637  14.146  1.00 26.28  ? 183  TRP M CE3 1 
ATOM   6252  C  CZ2 . TRP C  3  183 ? 123.675 48.083  16.272  1.00 21.40  ? 183  TRP M CZ2 1 
ATOM   6253  C  CZ3 . TRP C  3  183 ? 122.616 49.649  14.765  1.00 17.82  ? 183  TRP M CZ3 1 
ATOM   6254  C  CH2 . TRP C  3  183 ? 123.489 49.365  15.818  1.00 19.83  ? 183  TRP M CH2 1 
ATOM   6255  N  N   . LEU C  3  184 ? 118.314 48.008  14.103  1.00 17.32  ? 184  LEU M N   1 
ATOM   6256  C  CA  . LEU C  3  184 ? 118.063 49.244  14.822  1.00 9.93   ? 184  LEU M CA  1 
ATOM   6257  C  C   . LEU C  3  184 ? 117.014 49.031  15.902  1.00 12.47  ? 184  LEU M C   1 
ATOM   6258  O  O   . LEU C  3  184 ? 117.139 49.550  17.013  1.00 16.05  ? 184  LEU M O   1 
ATOM   6259  C  CB  . LEU C  3  184 ? 117.606 50.318  13.838  1.00 6.13   ? 184  LEU M CB  1 
ATOM   6260  C  CG  . LEU C  3  184 ? 118.644 50.691  12.781  1.00 8.27   ? 184  LEU M CG  1 
ATOM   6261  C  CD1 . LEU C  3  184 ? 118.148 51.756  11.770  1.00 2.00   ? 184  LEU M CD1 1 
ATOM   6262  C  CD2 . LEU C  3  184 ? 119.841 51.205  13.549  1.00 9.72   ? 184  LEU M CD2 1 
ATOM   6263  N  N   . THR C  3  185 ? 115.990 48.247  15.600  1.00 12.40  ? 185  THR M N   1 
ATOM   6264  C  CA  . THR C  3  185 ? 114.959 47.990  16.603  1.00 13.40  ? 185  THR M CA  1 
ATOM   6265  C  C   . THR C  3  185 ? 115.390 46.876  17.522  1.00 15.48  ? 185  THR M C   1 
ATOM   6266  O  O   . THR C  3  185 ? 114.978 46.842  18.677  1.00 17.30  ? 185  THR M O   1 
ATOM   6267  C  CB  . THR C  3  185 ? 113.619 47.576  15.989  1.00 13.02  ? 185  THR M CB  1 
ATOM   6268  O  OG1 . THR C  3  185 ? 113.183 48.590  15.076  1.00 16.35  ? 185  THR M OG1 1 
ATOM   6269  C  CG2 . THR C  3  185 ? 112.571 47.393  17.080  1.00 10.08  ? 185  THR M CG2 1 
ATOM   6270  N  N   . ALA C  3  186 ? 116.100 45.888  16.986  1.00 14.52  ? 186  ALA M N   1 
ATOM   6271  C  CA  . ALA C  3  186 ? 116.606 44.832  17.846  1.00 14.72  ? 186  ALA M CA  1 
ATOM   6272  C  C   . ALA C  3  186 ? 117.477 45.462  18.951  1.00 18.25  ? 186  ALA M C   1 
ATOM   6273  O  O   . ALA C  3  186 ? 117.219 45.262  20.142  1.00 19.47  ? 186  ALA M O   1 
ATOM   6274  C  CB  . ALA C  3  186 ? 117.399 43.854  17.043  1.00 12.54  ? 186  ALA M CB  1 
ATOM   6275  N  N   . PHE C  3  187 ? 118.338 46.399  18.557  1.00 19.56  ? 187  PHE M N   1 
ATOM   6276  C  CA  . PHE C  3  187 ? 119.330 46.981  19.454  1.00 18.97  ? 187  PHE M CA  1 
ATOM   6277  C  C   . PHE C  3  187 ? 118.667 47.894  20.478  1.00 19.54  ? 187  PHE M C   1 
ATOM   6278  O  O   . PHE C  3  187 ? 118.901 47.782  21.681  1.00 20.43  ? 187  PHE M O   1 
ATOM   6279  C  CB  . PHE C  3  187 ? 120.352 47.766  18.638  1.00 14.21  ? 187  PHE M CB  1 
ATOM   6280  C  CG  . PHE C  3  187 ? 121.633 48.039  19.368  1.00 22.29  ? 187  PHE M CG  1 
ATOM   6281  C  CD1 . PHE C  3  187 ? 122.613 47.051  19.475  1.00 21.54  ? 187  PHE M CD1 1 
ATOM   6282  C  CD2 . PHE C  3  187 ? 121.890 49.298  19.907  1.00 23.13  ? 187  PHE M CD2 1 
ATOM   6283  C  CE1 . PHE C  3  187 ? 123.816 47.309  20.094  1.00 16.20  ? 187  PHE M CE1 1 
ATOM   6284  C  CE2 . PHE C  3  187 ? 123.104 49.568  20.536  1.00 21.78  ? 187  PHE M CE2 1 
ATOM   6285  C  CZ  . PHE C  3  187 ? 124.061 48.575  20.625  1.00 22.86  ? 187  PHE M CZ  1 
ATOM   6286  N  N   . SER C  3  188 ? 117.773 48.747  20.006  1.00 20.30  ? 188  SER M N   1 
ATOM   6287  C  CA  . SER C  3  188 ? 117.092 49.678  20.886  1.00 18.65  ? 188  SER M CA  1 
ATOM   6288  C  C   . SER C  3  188 ? 116.211 48.941  21.909  1.00 17.88  ? 188  SER M C   1 
ATOM   6289  O  O   . SER C  3  188 ? 116.201 49.274  23.090  1.00 21.46  ? 188  SER M O   1 
ATOM   6290  C  CB  . SER C  3  188 ? 116.293 50.646  20.023  1.00 16.34  ? 188  SER M CB  1 
ATOM   6291  O  OG  . SER C  3  188 ? 115.136 51.144  20.668  1.00 22.39  ? 188  SER M OG  1 
ATOM   6292  N  N   . ILE C  3  189 ? 115.548 47.880  21.467  1.00 18.89  ? 189  ILE M N   1 
ATOM   6293  C  CA  . ILE C  3  189 ? 114.691 47.066  22.328  1.00 19.22  ? 189  ILE M CA  1 
ATOM   6294  C  C   . ILE C  3  189 ? 115.487 46.435  23.463  1.00 22.03  ? 189  ILE M C   1 
ATOM   6295  O  O   . ILE C  3  189 ? 115.115 46.545  24.622  1.00 25.48  ? 189  ILE M O   1 
ATOM   6296  C  CB  . ILE C  3  189 ? 114.012 45.956  21.511  1.00 16.82  ? 189  ILE M CB  1 
ATOM   6297  C  CG1 . ILE C  3  189 ? 112.821 46.536  20.751  1.00 18.12  ? 189  ILE M CG1 1 
ATOM   6298  C  CG2 . ILE C  3  189 ? 113.591 44.811  22.403  1.00 18.73  ? 189  ILE M CG2 1 
ATOM   6299  C  CD1 . ILE C  3  189 ? 112.037 45.509  19.995  1.00 22.71  ? 189  ILE M CD1 1 
ATOM   6300  N  N   . ARG C  3  190 ? 116.592 45.783  23.121  1.00 20.44  ? 190  ARG M N   1 
ATOM   6301  C  CA  . ARG C  3  190 ? 117.405 45.069  24.105  1.00 17.79  ? 190  ARG M CA  1 
ATOM   6302  C  C   . ARG C  3  190 ? 118.008 46.037  25.120  1.00 17.90  ? 190  ARG M C   1 
ATOM   6303  O  O   . ARG C  3  190 ? 118.120 45.714  26.301  1.00 17.01  ? 190  ARG M O   1 
ATOM   6304  C  CB  . ARG C  3  190 ? 118.498 44.290  23.373  1.00 17.10  ? 190  ARG M CB  1 
ATOM   6305  C  CG  . ARG C  3  190 ? 119.729 43.947  24.171  1.00 22.82  ? 190  ARG M CG  1 
ATOM   6306  C  CD  . ARG C  3  190 ? 119.402 42.999  25.299  1.00 26.82  ? 190  ARG M CD  1 
ATOM   6307  N  NE  . ARG C  3  190 ? 120.601 42.637  26.049  1.00 29.74  ? 190  ARG M NE  1 
ATOM   6308  C  CZ  . ARG C  3  190 ? 121.100 43.371  27.037  1.00 26.09  ? 190  ARG M CZ  1 
ATOM   6309  N  NH1 . ARG C  3  190 ? 120.559 44.547  27.334  1.00 24.78  ? 190  ARG M NH1 1 
ATOM   6310  N  NH2 . ARG C  3  190 ? 122.169 42.955  27.693  1.00 30.47  ? 190  ARG M NH2 1 
ATOM   6311  N  N   . TYR C  3  191 ? 118.289 47.256  24.673  1.00 16.40  ? 191  TYR M N   1 
ATOM   6312  C  CA  . TYR C  3  191 ? 118.897 48.255  25.523  1.00 15.70  ? 191  TYR M CA  1 
ATOM   6313  C  C   . TYR C  3  191 ? 117.901 49.268  26.032  1.00 17.74  ? 191  TYR M C   1 
ATOM   6314  O  O   . TYR C  3  191 ? 118.272 50.359  26.489  1.00 21.06  ? 191  TYR M O   1 
ATOM   6315  C  CB  . TYR C  3  191 ? 120.051 48.912  24.786  1.00 15.35  ? 191  TYR M CB  1 
ATOM   6316  C  CG  . TYR C  3  191 ? 121.208 47.952  24.671  1.00 16.90  ? 191  TYR M CG  1 
ATOM   6317  C  CD1 . TYR C  3  191 ? 121.782 47.387  25.819  1.00 20.67  ? 191  TYR M CD1 1 
ATOM   6318  C  CD2 . TYR C  3  191 ? 121.650 47.499  23.433  1.00 19.91  ? 191  TYR M CD2 1 
ATOM   6319  C  CE1 . TYR C  3  191 ? 122.769 46.392  25.737  1.00 15.73  ? 191  TYR M CE1 1 
ATOM   6320  C  CE2 . TYR C  3  191 ? 122.644 46.487  23.336  1.00 17.17  ? 191  TYR M CE2 1 
ATOM   6321  C  CZ  . TYR C  3  191 ? 123.197 45.947  24.494  1.00 18.62  ? 191  TYR M CZ  1 
ATOM   6322  O  OH  . TYR C  3  191 ? 124.189 44.981  24.416  1.00 18.79  ? 191  TYR M OH  1 
ATOM   6323  N  N   . GLY C  3  192 ? 116.636 48.861  26.029  1.00 18.12  ? 192  GLY M N   1 
ATOM   6324  C  CA  . GLY C  3  192 ? 115.606 49.577  26.760  1.00 15.13  ? 192  GLY M CA  1 
ATOM   6325  C  C   . GLY C  3  192 ? 115.220 50.942  26.233  1.00 15.19  ? 192  GLY M C   1 
ATOM   6326  O  O   . GLY C  3  192 ? 114.979 51.845  27.037  1.00 15.26  ? 192  GLY M O   1 
ATOM   6327  N  N   . ASN C  3  193 ? 115.097 51.071  24.909  1.00 12.88  ? 193  ASN M N   1 
ATOM   6328  C  CA  . ASN C  3  193 ? 114.539 52.262  24.238  1.00 12.43  ? 193  ASN M CA  1 
ATOM   6329  C  C   . ASN C  3  193 ? 115.570 53.367  24.089  1.00 14.25  ? 193  ASN M C   1 
ATOM   6330  O  O   . ASN C  3  193 ? 115.738 54.181  24.971  1.00 18.43  ? 193  ASN M O   1 
ATOM   6331  C  CB  . ASN C  3  193 ? 113.286 52.793  24.965  1.00 9.47   ? 193  ASN M CB  1 
ATOM   6332  C  CG  . ASN C  3  193 ? 112.567 53.909  24.198  1.00 13.24  ? 193  ASN M CG  1 
ATOM   6333  O  OD1 . ASN C  3  193 ? 113.024 54.343  23.155  1.00 14.18  ? 193  ASN M OD1 1 
ATOM   6334  N  ND2 . ASN C  3  193 ? 111.481 54.436  24.772  1.00 9.99   ? 193  ASN M ND2 1 
ATOM   6335  N  N   . PHE C  3  194 ? 116.212 53.437  22.925  1.00 16.39  ? 194  PHE M N   1 
ATOM   6336  C  CA  . PHE C  3  194 ? 117.236 54.452  22.660  1.00 15.00  ? 194  PHE M CA  1 
ATOM   6337  C  C   . PHE C  3  194 ? 116.709 55.899  22.729  1.00 16.54  ? 194  PHE M C   1 
ATOM   6338  O  O   . PHE C  3  194 ? 117.502 56.833  22.769  1.00 18.80  ? 194  PHE M O   1 
ATOM   6339  C  CB  . PHE C  3  194 ? 117.892 54.205  21.284  1.00 14.49  ? 194  PHE M CB  1 
ATOM   6340  C  CG  . PHE C  3  194 ? 119.290 53.613  21.339  1.00 10.36  ? 194  PHE M CG  1 
ATOM   6341  C  CD1 . PHE C  3  194 ? 119.634 52.650  22.276  1.00 11.81  ? 194  PHE M CD1 1 
ATOM   6342  C  CD2 . PHE C  3  194 ? 120.260 54.042  20.455  1.00 10.99  ? 194  PHE M CD2 1 
ATOM   6343  C  CE1 . PHE C  3  194 ? 120.925 52.137  22.337  1.00 15.05  ? 194  PHE M CE1 1 
ATOM   6344  C  CE2 . PHE C  3  194 ? 121.563 53.530  20.513  1.00 16.64  ? 194  PHE M CE2 1 
ATOM   6345  C  CZ  . PHE C  3  194 ? 121.893 52.580  21.456  1.00 10.83  ? 194  PHE M CZ  1 
ATOM   6346  N  N   . TYR C  3  195 ? 115.397 56.111  22.786  1.00 13.06  ? 195  TYR M N   1 
ATOM   6347  C  CA  . TYR C  3  195 ? 114.920 57.479  22.952  1.00 13.29  ? 195  TYR M CA  1 
ATOM   6348  C  C   . TYR C  3  195 ? 115.384 58.049  24.284  1.00 17.32  ? 195  TYR M C   1 
ATOM   6349  O  O   . TYR C  3  195 ? 115.587 59.253  24.433  1.00 16.37  ? 195  TYR M O   1 
ATOM   6350  C  CB  . TYR C  3  195 ? 113.419 57.523  22.889  1.00 11.82  ? 195  TYR M CB  1 
ATOM   6351  C  CG  . TYR C  3  195 ? 112.896 57.466  21.482  1.00 8.86   ? 195  TYR M CG  1 
ATOM   6352  C  CD1 . TYR C  3  195 ? 113.251 58.434  20.561  1.00 11.12  ? 195  TYR M CD1 1 
ATOM   6353  C  CD2 . TYR C  3  195 ? 111.996 56.477  21.092  1.00 11.34  ? 195  TYR M CD2 1 
ATOM   6354  C  CE1 . TYR C  3  195 ? 112.713 58.442  19.294  1.00 12.64  ? 195  TYR M CE1 1 
ATOM   6355  C  CE2 . TYR C  3  195 ? 111.448 56.469  19.827  1.00 11.08  ? 195  TYR M CE2 1 
ATOM   6356  C  CZ  . TYR C  3  195 ? 111.812 57.458  18.925  1.00 15.99  ? 195  TYR M CZ  1 
ATOM   6357  O  OH  . TYR C  3  195 ? 111.297 57.446  17.644  1.00 15.65  ? 195  TYR M OH  1 
ATOM   6358  N  N   . TYR C  3  196 ? 115.648 57.154  25.224  1.00 20.74  ? 196  TYR M N   1 
ATOM   6359  C  CA  . TYR C  3  196 ? 116.031 57.540  26.573  1.00 17.00  ? 196  TYR M CA  1 
ATOM   6360  C  C   . TYR C  3  196 ? 117.550 57.462  26.771  1.00 18.59  ? 196  TYR M C   1 
ATOM   6361  O  O   . TYR C  3  196 ? 118.040 57.546  27.900  1.00 18.55  ? 196  TYR M O   1 
ATOM   6362  C  CB  . TYR C  3  196 ? 115.290 56.655  27.585  1.00 16.21  ? 196  TYR M CB  1 
ATOM   6363  C  CG  . TYR C  3  196 ? 113.845 57.082  27.803  1.00 11.44  ? 196  TYR M CG  1 
ATOM   6364  C  CD1 . TYR C  3  196 ? 113.523 58.072  28.732  1.00 11.10  ? 196  TYR M CD1 1 
ATOM   6365  C  CD2 . TYR C  3  196 ? 112.835 56.631  26.970  1.00 14.17  ? 196  TYR M CD2 1 
ATOM   6366  C  CE1 . TYR C  3  196 ? 112.226 58.625  28.806  1.00 13.11  ? 196  TYR M CE1 1 
ATOM   6367  C  CE2 . TYR C  3  196 ? 111.537 57.176  27.039  1.00 14.12  ? 196  TYR M CE2 1 
ATOM   6368  C  CZ  . TYR C  3  196 ? 111.249 58.166  27.956  1.00 12.64  ? 196  TYR M CZ  1 
ATOM   6369  O  OH  . TYR C  3  196 ? 109.979 58.666  28.045  1.00 17.66  ? 196  TYR M OH  1 
ATOM   6370  N  N   . CYS C  3  197 ? 118.294 57.328  25.669  1.00 18.52  ? 197  CYS M N   1 
ATOM   6371  C  CA  . CYS C  3  197 ? 119.749 57.449  25.693  1.00 14.21  ? 197  CYS M CA  1 
ATOM   6372  C  C   . CYS C  3  197 ? 120.090 58.910  25.490  1.00 17.75  ? 197  CYS M C   1 
ATOM   6373  O  O   . CYS C  3  197 ? 119.712 59.514  24.483  1.00 25.50  ? 197  CYS M O   1 
ATOM   6374  C  CB  . CYS C  3  197 ? 120.388 56.610  24.590  1.00 13.05  ? 197  CYS M CB  1 
ATOM   6375  S  SG  . CYS C  3  197 ? 122.199 56.687  24.503  1.00 13.69  ? 197  CYS M SG  1 
ATOM   6376  N  N   . PRO C  3  198 ? 120.716 59.533  26.489  1.00 17.91  ? 198  PRO M N   1 
ATOM   6377  C  CA  . PRO C  3  198 ? 121.060 60.945  26.340  1.00 18.03  ? 198  PRO M CA  1 
ATOM   6378  C  C   . PRO C  3  198 ? 121.876 61.254  25.076  1.00 20.07  ? 198  PRO M C   1 
ATOM   6379  O  O   . PRO C  3  198 ? 121.658 62.277  24.430  1.00 20.52  ? 198  PRO M O   1 
ATOM   6380  C  CB  . PRO C  3  198 ? 121.833 61.235  27.623  1.00 18.48  ? 198  PRO M CB  1 
ATOM   6381  C  CG  . PRO C  3  198 ? 121.197 60.340  28.609  1.00 17.81  ? 198  PRO M CG  1 
ATOM   6382  C  CD  . PRO C  3  198 ? 120.969 59.061  27.861  1.00 14.46  ? 198  PRO M CD  1 
ATOM   6383  N  N   . TRP C  3  199 ? 122.802 60.365  24.715  1.00 20.93  ? 199  TRP M N   1 
ATOM   6384  C  CA  . TRP C  3  199 ? 123.687 60.576  23.557  1.00 19.03  ? 199  TRP M CA  1 
ATOM   6385  C  C   . TRP C  3  199 ? 122.990 60.359  22.210  1.00 18.74  ? 199  TRP M C   1 
ATOM   6386  O  O   . TRP C  3  199 ? 123.292 61.050  21.242  1.00 22.01  ? 199  TRP M O   1 
ATOM   6387  C  CB  . TRP C  3  199 ? 124.926 59.687  23.676  1.00 13.94  ? 199  TRP M CB  1 
ATOM   6388  C  CG  . TRP C  3  199 ? 125.833 60.175  24.761  1.00 16.34  ? 199  TRP M CG  1 
ATOM   6389  C  CD1 . TRP C  3  199 ? 126.722 61.221  24.674  1.00 17.40  ? 199  TRP M CD1 1 
ATOM   6390  C  CD2 . TRP C  3  199 ? 125.705 59.890  26.158  1.00 19.36  ? 199  TRP M CD2 1 
ATOM   6391  N  NE1 . TRP C  3  199 ? 127.109 61.635  25.929  1.00 17.26  ? 199  TRP M NE1 1 
ATOM   6392  C  CE2 . TRP C  3  199 ? 126.497 60.837  26.858  1.00 19.36  ? 199  TRP M CE2 1 
ATOM   6393  C  CE3 . TRP C  3  199 ? 124.955 58.957  26.891  1.00 16.82  ? 199  TRP M CE3 1 
ATOM   6394  C  CZ2 . TRP C  3  199 ? 126.561 60.871  28.248  1.00 18.37  ? 199  TRP M CZ2 1 
ATOM   6395  C  CZ3 . TRP C  3  199 ? 125.012 58.998  28.273  1.00 17.65  ? 199  TRP M CZ3 1 
ATOM   6396  C  CH2 . TRP C  3  199 ? 125.812 59.947  28.940  1.00 18.02  ? 199  TRP M CH2 1 
ATOM   6397  N  N   . HIS C  3  200 ? 121.984 59.487  22.182  1.00 17.65  ? 200  HIS M N   1 
ATOM   6398  C  CA  . HIS C  3  200 ? 121.059 59.441  21.066  1.00 17.32  ? 200  HIS M CA  1 
ATOM   6399  C  C   . HIS C  3  200 ? 120.410 60.821  20.885  1.00 17.61  ? 200  HIS M C   1 
ATOM   6400  O  O   . HIS C  3  200 ? 120.440 61.390  19.794  1.00 16.23  ? 200  HIS M O   1 
ATOM   6401  C  CB  . HIS C  3  200 ? 119.992 58.405  21.330  1.00 12.73  ? 200  HIS M CB  1 
ATOM   6402  C  CG  . HIS C  3  200 ? 119.122 58.142  20.153  1.00 13.03  ? 200  HIS M CG  1 
ATOM   6403  N  ND1 . HIS C  3  200 ? 117.813 58.551  20.052  1.00 13.04  ? 200  HIS M ND1 1 
ATOM   6404  C  CD2 . HIS C  3  200 ? 119.389 57.481  19.004  1.00 17.63  ? 200  HIS M CD2 1 
ATOM   6405  C  CE1 . HIS C  3  200 ? 117.344 58.116  18.888  1.00 14.25  ? 200  HIS M CE1 1 
ATOM   6406  N  NE2 . HIS C  3  200 ? 118.266 57.461  18.211  1.00 16.24  ? 200  HIS M NE2 1 
ATOM   6407  N  N   . GLY C  3  201 ? 119.972 61.409  21.996  1.00 17.82  ? 201  GLY M N   1 
ATOM   6408  C  CA  . GLY C  3  201 ? 119.481 62.777  21.988  1.00 13.00  ? 201  GLY M CA  1 
ATOM   6409  C  C   . GLY C  3  201 ? 120.471 63.826  21.498  1.00 15.82  ? 201  GLY M C   1 
ATOM   6410  O  O   . GLY C  3  201 ? 120.122 64.671  20.688  1.00 17.81  ? 201  GLY M O   1 
ATOM   6411  N  N   . PHE C  3  202 ? 121.697 63.828  22.001  1.00 17.98  ? 202  PHE M N   1 
ATOM   6412  C  CA  . PHE C  3  202 ? 122.665 64.827  21.543  1.00 18.56  ? 202  PHE M CA  1 
ATOM   6413  C  C   . PHE C  3  202 ? 122.847 64.657  20.031  1.00 20.95  ? 202  PHE M C   1 
ATOM   6414  O  O   . PHE C  3  202 ? 122.862 65.633  19.265  1.00 21.30  ? 202  PHE M O   1 
ATOM   6415  C  CB  . PHE C  3  202 ? 124.025 64.620  22.211  1.00 18.36  ? 202  PHE M CB  1 
ATOM   6416  C  CG  . PHE C  3  202 ? 124.114 65.128  23.601  1.00 15.19  ? 202  PHE M CG  1 
ATOM   6417  C  CD1 . PHE C  3  202 ? 124.120 66.483  23.863  1.00 18.33  ? 202  PHE M CD1 1 
ATOM   6418  C  CD2 . PHE C  3  202 ? 124.294 64.236  24.662  1.00 24.19  ? 202  PHE M CD2 1 
ATOM   6419  C  CE1 . PHE C  3  202 ? 124.300 66.958  25.169  1.00 18.58  ? 202  PHE M CE1 1 
ATOM   6420  C  CE2 . PHE C  3  202 ? 124.474 64.695  25.972  1.00 22.36  ? 202  PHE M CE2 1 
ATOM   6421  C  CZ  . PHE C  3  202 ? 124.475 66.059  26.224  1.00 21.27  ? 202  PHE M CZ  1 
ATOM   6422  N  N   . SER C  3  203 ? 123.080 63.416  19.620  1.00 19.01  ? 203  SER M N   1 
ATOM   6423  C  CA  . SER C  3  203 ? 123.296 63.121  18.215  1.00 19.20  ? 203  SER M CA  1 
ATOM   6424  C  C   . SER C  3  203 ? 122.160 63.684  17.336  1.00 16.09  ? 203  SER M C   1 
ATOM   6425  O  O   . SER C  3  203 ? 122.396 64.474  16.428  1.00 17.02  ? 203  SER M O   1 
ATOM   6426  C  CB  . SER C  3  203 ? 123.428 61.623  18.035  1.00 16.90  ? 203  SER M CB  1 
ATOM   6427  O  OG  . SER C  3  203 ? 124.142 61.349  16.856  1.00 25.46  ? 203  SER M OG  1 
ATOM   6428  N  N   . ILE C  3  204 ? 120.919 63.393  17.692  1.00 16.39  ? 204  ILE M N   1 
ATOM   6429  C  CA  . ILE C  3  204 ? 119.786 63.914  16.923  1.00 19.70  ? 204  ILE M CA  1 
ATOM   6430  C  C   . ILE C  3  204 ? 119.777 65.433  16.936  1.00 14.57  ? 204  ILE M C   1 
ATOM   6431  O  O   . ILE C  3  204 ? 119.524 66.065  15.928  1.00 18.56  ? 204  ILE M O   1 
ATOM   6432  C  CB  . ILE C  3  204 ? 118.466 63.390  17.488  1.00 17.40  ? 204  ILE M CB  1 
ATOM   6433  C  CG1 . ILE C  3  204 ? 118.427 61.874  17.288  1.00 18.68  ? 204  ILE M CG1 1 
ATOM   6434  C  CG2 . ILE C  3  204 ? 117.288 64.099  16.833  1.00 15.92  ? 204  ILE M CG2 1 
ATOM   6435  C  CD1 . ILE C  3  204 ? 117.501 61.141  18.215  1.00 18.75  ? 204  ILE M CD1 1 
ATOM   6436  N  N   . GLY C  3  205 ? 120.193 65.991  18.058  1.00 16.92  ? 205  GLY M N   1 
ATOM   6437  C  CA  . GLY C  3  205 ? 120.242 67.425  18.217  1.00 14.60  ? 205  GLY M CA  1 
ATOM   6438  C  C   . GLY C  3  205 ? 121.200 68.014  17.225  1.00 16.33  ? 205  GLY M C   1 
ATOM   6439  O  O   . GLY C  3  205 ? 120.842 68.911  16.459  1.00 23.90  ? 205  GLY M O   1 
ATOM   6440  N  N   . PHE C  3  206 ? 122.357 67.394  17.104  1.00 14.73  ? 206  PHE M N   1 
ATOM   6441  C  CA  . PHE C  3  206 ? 123.317 67.823  16.105  1.00 15.48  ? 206  PHE M CA  1 
ATOM   6442  C  C   . PHE C  3  206 ? 122.889 67.523  14.670  1.00 16.70  ? 206  PHE M C   1 
ATOM   6443  O  O   . PHE C  3  206 ? 123.055 68.367  13.791  1.00 19.12  ? 206  PHE M O   1 
ATOM   6444  C  CB  . PHE C  3  206 ? 124.660 67.199  16.430  1.00 17.81  ? 206  PHE M CB  1 
ATOM   6445  C  CG  . PHE C  3  206 ? 125.293 67.775  17.666  1.00 20.05  ? 206  PHE M CG  1 
ATOM   6446  C  CD1 . PHE C  3  206 ? 125.755 69.075  17.678  1.00 13.84  ? 206  PHE M CD1 1 
ATOM   6447  C  CD2 . PHE C  3  206 ? 125.388 67.036  18.823  1.00 22.49  ? 206  PHE M CD2 1 
ATOM   6448  C  CE1 . PHE C  3  206 ? 126.303 69.623  18.811  1.00 18.46  ? 206  PHE M CE1 1 
ATOM   6449  C  CE2 . PHE C  3  206 ? 125.937 67.592  19.965  1.00 24.20  ? 206  PHE M CE2 1 
ATOM   6450  C  CZ  . PHE C  3  206 ? 126.395 68.883  19.954  1.00 19.17  ? 206  PHE M CZ  1 
ATOM   6451  N  N   . ALA C  3  207 ? 122.177 66.417  14.458  1.00 15.34  ? 207  ALA M N   1 
ATOM   6452  C  CA  . ALA C  3  207 ? 121.717 66.079  13.116  1.00 12.17  ? 207  ALA M CA  1 
ATOM   6453  C  C   . ALA C  3  207 ? 120.656 67.070  12.631  1.00 12.93  ? 207  ALA M C   1 
ATOM   6454  O  O   . ALA C  3  207 ? 120.769 67.648  11.558  1.00 15.94  ? 207  ALA M O   1 
ATOM   6455  C  CB  . ALA C  3  207 ? 121.178 64.689  13.105  1.00 8.07   ? 207  ALA M CB  1 
ATOM   6456  N  N   . TYR C  3  208 ? 119.683 67.362  13.480  1.00 12.59  ? 208  TYR M N   1 
ATOM   6457  C  CA  . TYR C  3  208 ? 118.702 68.385  13.167  1.00 12.42  ? 208  TYR M CA  1 
ATOM   6458  C  C   . TYR C  3  208 ? 119.416 69.721  12.991  1.00 17.34  ? 208  TYR M C   1 
ATOM   6459  O  O   . TYR C  3  208 ? 119.031 70.541  12.156  1.00 16.71  ? 208  TYR M O   1 
ATOM   6460  C  CB  . TYR C  3  208 ? 117.702 68.501  14.299  1.00 10.87  ? 208  TYR M CB  1 
ATOM   6461  C  CG  . TYR C  3  208 ? 116.764 67.337  14.442  1.00 15.00  ? 208  TYR M CG  1 
ATOM   6462  C  CD1 . TYR C  3  208 ? 116.705 66.338  13.479  1.00 15.63  ? 208  TYR M CD1 1 
ATOM   6463  C  CD2 . TYR C  3  208 ? 115.807 67.330  15.452  1.00 17.78  ? 208  TYR M CD2 1 
ATOM   6464  C  CE1 . TYR C  3  208 ? 115.709 65.376  13.516  1.00 15.00  ? 208  TYR M CE1 1 
ATOM   6465  C  CE2 . TYR C  3  208 ? 114.814 66.385  15.495  1.00 13.95  ? 208  TYR M CE2 1 
ATOM   6466  C  CZ  . TYR C  3  208 ? 114.766 65.415  14.527  1.00 15.58  ? 208  TYR M CZ  1 
ATOM   6467  O  OH  . TYR C  3  208 ? 113.745 64.505  14.553  1.00 12.90  ? 208  TYR M OH  1 
ATOM   6468  N  N   . GLY C  3  209 ? 120.432 69.952  13.824  1.00 20.01  ? 209  GLY M N   1 
ATOM   6469  C  CA  . GLY C  3  209 ? 121.197 71.189  13.767  1.00 18.52  ? 209  GLY M CA  1 
ATOM   6470  C  C   . GLY C  3  209 ? 121.941 71.353  12.458  1.00 19.65  ? 209  GLY M C   1 
ATOM   6471  O  O   . GLY C  3  209 ? 122.051 72.467  11.931  1.00 16.20  ? 209  GLY M O   1 
ATOM   6472  N  N   . CYS C  3  210 ? 122.387 70.238  11.885  1.00 17.80  ? 210  CYS M N   1 
ATOM   6473  C  CA  . CYS C  3  210 ? 123.010 70.290  10.572  1.00 16.79  ? 210  CYS M CA  1 
ATOM   6474  C  C   . CYS C  3  210 ? 122.027 70.688  9.502   1.00 17.63  ? 210  CYS M C   1 
ATOM   6475  O  O   . CYS C  3  210 ? 122.304 71.567  8.692   1.00 15.11  ? 210  CYS M O   1 
ATOM   6476  C  CB  . CYS C  3  210 ? 123.608 68.966  10.235  1.00 12.54  ? 210  CYS M CB  1 
ATOM   6477  S  SG  . CYS C  3  210 ? 125.067 68.681  11.240  1.00 23.37  ? 210  CYS M SG  1 
ATOM   6478  N  N   . GLY C  3  211 ? 120.833 70.124  9.593   1.00 18.59  ? 211  GLY M N   1 
ATOM   6479  C  CA  . GLY C  3  211 ? 119.747 70.576  8.757   1.00 14.61  ? 211  GLY M CA  1 
ATOM   6480  C  C   . GLY C  3  211 ? 119.462 72.042  8.971   1.00 15.24  ? 211  GLY M C   1 
ATOM   6481  O  O   . GLY C  3  211 ? 119.325 72.794  8.004   1.00 17.07  ? 211  GLY M O   1 
ATOM   6482  N  N   . LEU C  3  212 ? 119.397 72.479  10.221  1.00 15.77  ? 212  LEU M N   1 
ATOM   6483  C  CA  . LEU C  3  212 ? 119.115 73.892  10.458  1.00 15.16  ? 212  LEU M CA  1 
ATOM   6484  C  C   . LEU C  3  212 ? 120.225 74.753  9.849   1.00 17.17  ? 212  LEU M C   1 
ATOM   6485  O  O   . LEU C  3  212 ? 119.956 75.661  9.048   1.00 14.97  ? 212  LEU M O   1 
ATOM   6486  C  CB  . LEU C  3  212 ? 118.978 74.176  11.949  1.00 13.00  ? 212  LEU M CB  1 
ATOM   6487  C  CG  . LEU C  3  212 ? 118.299 75.498  12.309  1.00 12.80  ? 212  LEU M CG  1 
ATOM   6488  C  CD1 . LEU C  3  212 ? 117.912 75.435  13.756  1.00 8.55   ? 212  LEU M CD1 1 
ATOM   6489  C  CD2 . LEU C  3  212 ? 119.198 76.683  12.076  1.00 12.68  ? 212  LEU M CD2 1 
ATOM   6490  N  N   . LEU C  3  213 ? 121.471 74.385  10.135  1.00 15.03  ? 213  LEU M N   1 
ATOM   6491  C  CA  . LEU C  3  213 ? 122.611 75.186  9.728   1.00 18.15  ? 213  LEU M CA  1 
ATOM   6492  C  C   . LEU C  3  213 ? 122.825 75.190  8.215   1.00 23.34  ? 213  LEU M C   1 
ATOM   6493  O  O   . LEU C  3  213 ? 123.092 76.269  7.639   1.00 20.68  ? 213  LEU M O   1 
ATOM   6494  C  CB  . LEU C  3  213 ? 123.883 74.717  10.433  1.00 17.32  ? 213  LEU M CB  1 
ATOM   6495  C  CG  . LEU C  3  213 ? 124.201 75.412  11.746  1.00 12.77  ? 213  LEU M CG  1 
ATOM   6496  C  CD1 . LEU C  3  213 ? 125.465 74.828  12.318  1.00 12.41  ? 213  LEU M CD1 1 
ATOM   6497  C  CD2 . LEU C  3  213 ? 124.378 76.887  11.510  1.00 19.50  ? 213  LEU M CD2 1 
ATOM   6498  N  N   . PHE C  3  214 ? 122.671 74.032  7.554   1.00 19.80  ? 214  PHE M N   1 
ATOM   6499  C  CA  . PHE C  3  214 ? 122.926 73.986  6.115   1.00 16.59  ? 214  PHE M CA  1 
ATOM   6500  C  C   . PHE C  3  214 ? 121.789 74.600  5.295   1.00 18.88  ? 214  PHE M C   1 
ATOM   6501  O  O   . PHE C  3  214 ? 122.050 75.322  4.320   1.00 19.87  ? 214  PHE M O   1 
ATOM   6502  C  CB  . PHE C  3  214 ? 123.252 72.575  5.628   1.00 14.19  ? 214  PHE M CB  1 
ATOM   6503  C  CG  . PHE C  3  214 ? 124.171 72.554  4.427   1.00 13.37  ? 214  PHE M CG  1 
ATOM   6504  C  CD1 . PHE C  3  214 ? 124.628 73.743  3.866   1.00 16.75  ? 214  PHE M CD1 1 
ATOM   6505  C  CD2 . PHE C  3  214 ? 124.719 71.367  3.968   1.00 15.22  ? 214  PHE M CD2 1 
ATOM   6506  C  CE1 . PHE C  3  214 ? 125.640 73.748  2.880   1.00 16.47  ? 214  PHE M CE1 1 
ATOM   6507  C  CE2 . PHE C  3  214 ? 125.740 71.367  2.974   1.00 12.70  ? 214  PHE M CE2 1 
ATOM   6508  C  CZ  . PHE C  3  214 ? 126.194 72.557  2.445   1.00 9.71   ? 214  PHE M CZ  1 
ATOM   6509  N  N   . ALA C  3  215 ? 120.556 74.509  5.791   1.00 17.08  ? 215  ALA M N   1 
ATOM   6510  C  CA  . ALA C  3  215 ? 119.485 75.347  5.223   1.00 16.38  ? 215  ALA M CA  1 
ATOM   6511  C  C   . ALA C  3  215 ? 119.773 76.843  5.406   1.00 16.44  ? 215  ALA M C   1 
ATOM   6512  O  O   . ALA C  3  215 ? 119.644 77.598  4.465   1.00 19.49  ? 215  ALA M O   1 
ATOM   6513  C  CB  . ALA C  3  215 ? 118.112 74.998  5.838   1.00 13.93  ? 215  ALA M CB  1 
ATOM   6514  N  N   . ALA C  3  216 ? 120.231 77.249  6.593   1.00 20.86  ? 216  ALA M N   1 
ATOM   6515  C  CA  . ALA C  3  216 ? 120.452 78.659  6.934   1.00 16.60  ? 216  ALA M CA  1 
ATOM   6516  C  C   . ALA C  3  216 ? 121.636 79.232  6.183   1.00 17.88  ? 216  ALA M C   1 
ATOM   6517  O  O   . ALA C  3  216 ? 121.566 80.347  5.679   1.00 16.98  ? 216  ALA M O   1 
ATOM   6518  C  CB  . ALA C  3  216 ? 120.687 78.811  8.424   1.00 20.47  ? 216  ALA M CB  1 
ATOM   6519  N  N   . HIS C  3  217 ? 122.721 78.468  6.134   1.00 16.18  ? 217  HIS M N   1 
ATOM   6520  C  CA  . HIS C  3  217 ? 123.945 78.889  5.468   1.00 18.98  ? 217  HIS M CA  1 
ATOM   6521  C  C   . HIS C  3  217 ? 123.742 78.902  3.950   1.00 22.01  ? 217  HIS M C   1 
ATOM   6522  O  O   . HIS C  3  217 ? 124.049 79.905  3.286   1.00 27.03  ? 217  HIS M O   1 
ATOM   6523  C  CB  . HIS C  3  217 ? 125.099 77.944  5.850   1.00 17.16  ? 217  HIS M CB  1 
ATOM   6524  C  CG  . HIS C  3  217 ? 126.404 78.305  5.215   1.00 16.76  ? 217  HIS M CG  1 
ATOM   6525  N  ND1 . HIS C  3  217 ? 126.897 79.587  5.149   1.00 10.65  ? 217  HIS M ND1 1 
ATOM   6526  C  CD2 . HIS C  3  217 ? 127.281 77.533  4.516   1.00 16.99  ? 217  HIS M CD2 1 
ATOM   6527  C  CE1 . HIS C  3  217 ? 128.014 79.563  4.418   1.00 9.79   ? 217  HIS M CE1 1 
ATOM   6528  N  NE2 . HIS C  3  217 ? 128.297 78.335  4.007   1.00 18.49  ? 217  HIS M NE2 1 
ATOM   6529  N  N   . GLY C  3  218 ? 123.209 77.812  3.399   1.00 16.66  ? 218  GLY M N   1 
ATOM   6530  C  CA  . GLY C  3  218 ? 122.990 77.772  1.966   1.00 13.72  ? 218  GLY M CA  1 
ATOM   6531  C  C   . GLY C  3  218 ? 122.119 78.939  1.526   1.00 16.12  ? 218  GLY M C   1 
ATOM   6532  O  O   . GLY C  3  218 ? 122.512 79.735  0.673   1.00 19.72  ? 218  GLY M O   1 
ATOM   6533  N  N   . ALA C  3  219 ? 121.012 79.148  2.225   1.00 14.77  ? 219  ALA M N   1 
ATOM   6534  C  CA  . ALA C  3  219 ? 120.106 80.229  1.868   1.00 16.30  ? 219  ALA M CA  1 
ATOM   6535  C  C   . ALA C  3  219 ? 120.774 81.578  2.027   1.00 20.17  ? 219  ALA M C   1 
ATOM   6536  O  O   . ALA C  3  219 ? 120.603 82.447  1.171   1.00 23.67  ? 219  ALA M O   1 
ATOM   6537  C  CB  . ALA C  3  219 ? 118.822 80.171  2.691   1.00 14.27  ? 219  ALA M CB  1 
ATOM   6538  N  N   . THR C  3  220 ? 121.621 81.719  3.047   1.00 22.34  ? 220  THR M N   1 
ATOM   6539  C  CA  . THR C  3  220 ? 122.255 83.005  3.321   1.00 19.69  ? 220  THR M CA  1 
ATOM   6540  C  C   . THR C  3  220 ? 123.141 83.346  2.135   1.00 20.13  ? 220  THR M C   1 
ATOM   6541  O  O   . THR C  3  220 ? 122.980 84.412  1.522   1.00 20.14  ? 220  THR M O   1 
ATOM   6542  C  CB  . THR C  3  220 ? 123.090 82.980  4.634   1.00 19.55  ? 220  THR M CB  1 
ATOM   6543  O  OG1 . THR C  3  220 ? 122.209 82.818  5.749   1.00 21.93  ? 220  THR M OG1 1 
ATOM   6544  C  CG2 . THR C  3  220 ? 123.831 84.295  4.836   1.00 14.83  ? 220  THR M CG2 1 
ATOM   6545  N  N   . ILE C  3  221 ? 123.903 82.360  1.672   1.00 16.84  ? 221  ILE M N   1 
ATOM   6546  C  CA  . ILE C  3  221 ? 124.782 82.612  0.551   1.00 16.70  ? 221  ILE M CA  1 
ATOM   6547  C  C   . ILE C  3  221 ? 124.047 82.923  -0.747  1.00 20.88  ? 221  ILE M C   1 
ATOM   6548  O  O   . ILE C  3  221 ? 124.327 83.944  -1.384  1.00 22.27  ? 221  ILE M O   1 
ATOM   6549  C  CB  . ILE C  3  221 ? 125.718 81.470  0.317   1.00 15.97  ? 221  ILE M CB  1 
ATOM   6550  C  CG1 . ILE C  3  221 ? 126.600 81.294  1.538   1.00 12.83  ? 221  ILE M CG1 1 
ATOM   6551  C  CG2 . ILE C  3  221 ? 126.579 81.773  -0.895  1.00 19.06  ? 221  ILE M CG2 1 
ATOM   6552  C  CD1 . ILE C  3  221 ? 127.274 82.593  1.970   1.00 8.86   ? 221  ILE M CD1 1 
ATOM   6553  N  N   . LEU C  3  222 ? 123.087 82.082  -1.123  1.00 21.10  ? 222  LEU M N   1 
ATOM   6554  C  CA  . LEU C  3  222 ? 122.305 82.368  -2.311  1.00 20.20  ? 222  LEU M CA  1 
ATOM   6555  C  C   . LEU C  3  222 ? 121.722 83.776  -2.184  1.00 20.93  ? 222  LEU M C   1 
ATOM   6556  O  O   . LEU C  3  222 ? 121.619 84.487  -3.175  1.00 22.90  ? 222  LEU M O   1 
ATOM   6557  C  CB  . LEU C  3  222 ? 121.162 81.362  -2.500  1.00 16.16  ? 222  LEU M CB  1 
ATOM   6558  C  CG  . LEU C  3  222 ? 121.413 79.864  -2.656  1.00 13.83  ? 222  LEU M CG  1 
ATOM   6559  C  CD1 . LEU C  3  222 ? 120.104 79.245  -3.001  1.00 19.50  ? 222  LEU M CD1 1 
ATOM   6560  C  CD2 . LEU C  3  222 ? 122.414 79.528  -3.703  1.00 17.03  ? 222  LEU M CD2 1 
ATOM   6561  N  N   . ALA C  3  223 ? 121.350 84.187  -0.974  1.00 23.08  ? 223  ALA M N   1 
ATOM   6562  C  CA  . ALA C  3  223 ? 120.676 85.478  -0.794  1.00 22.48  ? 223  ALA M CA  1 
ATOM   6563  C  C   . ALA C  3  223 ? 121.626 86.641  -0.981  1.00 23.42  ? 223  ALA M C   1 
ATOM   6564  O  O   . ALA C  3  223 ? 121.176 87.756  -1.263  1.00 24.19  ? 223  ALA M O   1 
ATOM   6565  C  CB  . ALA C  3  223 ? 120.036 85.568  0.562   1.00 20.82  ? 223  ALA M CB  1 
ATOM   6566  N  N   . VAL C  3  224 ? 122.923 86.397  -0.779  1.00 23.46  ? 224  VAL M N   1 
ATOM   6567  C  CA  . VAL C  3  224 ? 123.951 87.388  -1.110  1.00 23.57  ? 224  VAL M CA  1 
ATOM   6568  C  C   . VAL C  3  224 ? 124.850 86.975  -2.285  1.00 26.22  ? 224  VAL M C   1 
ATOM   6569  O  O   . VAL C  3  224 ? 125.957 87.495  -2.448  1.00 31.00  ? 224  VAL M O   1 
ATOM   6570  C  CB  . VAL C  3  224 ? 124.847 87.771  0.130   1.00 21.05  ? 224  VAL M CB  1 
ATOM   6571  C  CG1 . VAL C  3  224 ? 124.021 88.517  1.167   1.00 16.60  ? 224  VAL M CG1 1 
ATOM   6572  C  CG2 . VAL C  3  224 ? 125.516 86.549  0.725   1.00 15.83  ? 224  VAL M CG2 1 
ATOM   6573  N  N   . ALA C  3  225 ? 124.332 86.119  -3.157  1.00 27.40  ? 225  ALA M N   1 
ATOM   6574  C  CA  . ALA C  3  225 ? 125.015 85.775  -4.398  1.00 26.55  ? 225  ALA M CA  1 
ATOM   6575  C  C   . ALA C  3  225 ? 125.250 87.030  -5.278  1.00 26.53  ? 225  ALA M C   1 
ATOM   6576  O  O   . ALA C  3  225 ? 126.301 87.181  -5.904  1.00 21.27  ? 225  ALA M O   1 
ATOM   6577  C  CB  . ALA C  3  225 ? 124.201 84.720  -5.159  1.00 20.72  ? 225  ALA M CB  1 
ATOM   6578  N  N   . ARG C  3  226 ? 124.341 87.995  -5.214  1.00 24.39  ? 226  ARG M N   1 
ATOM   6579  C  CA  . ARG C  3  226 ? 124.508 89.206  -6.006  1.00 25.31  ? 226  ARG M CA  1 
ATOM   6580  C  C   . ARG C  3  226 ? 125.773 89.996  -5.665  1.00 27.26  ? 226  ARG M C   1 
ATOM   6581  O  O   . ARG C  3  226 ? 126.281 90.758  -6.486  1.00 29.36  ? 226  ARG M O   1 
ATOM   6582  C  CB  . ARG C  3  226 ? 123.270 90.087  -5.870  1.00 26.54  ? 226  ARG M CB  1 
ATOM   6583  C  CG  . ARG C  3  226 ? 122.137 89.581  -6.714  1.00 28.87  ? 226  ARG M CG  1 
ATOM   6584  C  CD  . ARG C  3  226 ? 120.826 90.235  -6.392  1.00 34.19  ? 226  ARG M CD  1 
ATOM   6585  N  NE  . ARG C  3  226 ? 119.861 89.933  -7.447  1.00 37.17  ? 226  ARG M NE  1 
ATOM   6586  C  CZ  . ARG C  3  226 ? 118.631 90.432  -7.522  1.00 36.99  ? 226  ARG M CZ  1 
ATOM   6587  N  NH1 . ARG C  3  226 ? 118.114 91.114  -6.509  1.00 30.88  ? 226  ARG M NH1 1 
ATOM   6588  N  NH2 . ARG C  3  226 ? 117.895 90.194  -8.600  1.00 40.17  ? 226  ARG M NH2 1 
ATOM   6589  N  N   . PHE C  3  227 ? 126.302 89.787  -4.465  1.00 28.55  ? 227  PHE M N   1 
ATOM   6590  C  CA  . PHE C  3  227 ? 127.477 90.518  -4.013  1.00 22.26  ? 227  PHE M CA  1 
ATOM   6591  C  C   . PHE C  3  227 ? 128.642 89.561  -3.949  1.00 21.33  ? 227  PHE M C   1 
ATOM   6592  O  O   . PHE C  3  227 ? 129.581 89.788  -3.214  1.00 27.80  ? 227  PHE M O   1 
ATOM   6593  C  CB  . PHE C  3  227 ? 127.216 91.123  -2.641  1.00 21.92  ? 227  PHE M CB  1 
ATOM   6594  C  CG  . PHE C  3  227 ? 125.889 91.821  -2.530  1.00 20.10  ? 227  PHE M CG  1 
ATOM   6595  C  CD1 . PHE C  3  227 ? 125.750 93.139  -2.934  1.00 22.73  ? 227  PHE M CD1 1 
ATOM   6596  C  CD2 . PHE C  3  227 ? 124.782 91.152  -2.047  1.00 18.33  ? 227  PHE M CD2 1 
ATOM   6597  C  CE1 . PHE C  3  227 ? 124.534 93.790  -2.856  1.00 23.98  ? 227  PHE M CE1 1 
ATOM   6598  C  CE2 . PHE C  3  227 ? 123.540 91.789  -1.967  1.00 24.99  ? 227  PHE M CE2 1 
ATOM   6599  C  CZ  . PHE C  3  227 ? 123.419 93.114  -2.369  1.00 27.09  ? 227  PHE M CZ  1 
ATOM   6600  N  N   . GLY C  3  228 ? 128.559 88.461  -4.688  1.00 21.05  ? 228  GLY M N   1 
ATOM   6601  C  CA  . GLY C  3  228 ? 129.694 87.565  -4.815  1.00 19.54  ? 228  GLY M CA  1 
ATOM   6602  C  C   . GLY C  3  228 ? 129.972 86.777  -3.555  1.00 24.25  ? 228  GLY M C   1 
ATOM   6603  O  O   . GLY C  3  228 ? 131.093 86.269  -3.371  1.00 23.66  ? 228  GLY M O   1 
ATOM   6604  N  N   . GLY C  3  229 ? 128.921 86.571  -2.753  1.00 24.46  ? 229  GLY M N   1 
ATOM   6605  C  CA  . GLY C  3  229 ? 129.037 85.846  -1.492  1.00 22.20  ? 229  GLY M CA  1 
ATOM   6606  C  C   . GLY C  3  229 ? 129.564 84.419  -1.604  1.00 21.46  ? 229  GLY M C   1 
ATOM   6607  O  O   . GLY C  3  229 ? 130.140 83.888  -0.658  1.00 25.65  ? 229  GLY M O   1 
ATOM   6608  N  N   . ASP C  3  230 ? 129.374 83.793  -2.761  1.00 22.82  ? 230  ASP M N   1 
ATOM   6609  C  CA  . ASP C  3  230 ? 129.836 82.415  -3.008  1.00 20.79  ? 230  ASP M CA  1 
ATOM   6610  C  C   . ASP C  3  230 ? 131.351 82.246  -2.952  1.00 18.50  ? 230  ASP M C   1 
ATOM   6611  O  O   . ASP C  3  230 ? 131.861 81.141  -2.711  1.00 13.83  ? 230  ASP M O   1 
ATOM   6612  C  CB  . ASP C  3  230 ? 129.297 81.887  -4.359  1.00 23.49  ? 230  ASP M CB  1 
ATOM   6613  C  CG  . ASP C  3  230 ? 129.482 82.876  -5.529  1.00 23.14  ? 230  ASP M CG  1 
ATOM   6614  O  OD1 . ASP C  3  230 ? 128.967 84.008  -5.462  1.00 24.23  ? 230  ASP M OD1 1 
ATOM   6615  O  OD2 . ASP C  3  230 ? 130.022 82.471  -6.581  1.00 25.96  ? 230  ASP M OD2 1 
ATOM   6616  N  N   . ARG C  3  231 ? 132.066 83.342  -3.204  1.00 21.94  ? 231  ARG M N   1 
ATOM   6617  C  CA  . ARG C  3  231 ? 133.528 83.322  -3.215  1.00 28.16  ? 231  ARG M CA  1 
ATOM   6618  C  C   . ARG C  3  231 ? 134.040 83.470  -1.783  1.00 28.34  ? 231  ARG M C   1 
ATOM   6619  O  O   . ARG C  3  231 ? 134.576 84.526  -1.401  1.00 26.25  ? 231  ARG M O   1 
ATOM   6620  C  CB  . ARG C  3  231 ? 134.052 84.461  -4.075  1.00 32.91  ? 231  ARG M CB  1 
ATOM   6621  C  CG  . ARG C  3  231 ? 133.437 84.496  -5.443  1.00 35.85  ? 231  ARG M CG  1 
ATOM   6622  C  CD  . ARG C  3  231 ? 134.339 85.213  -6.394  1.00 37.58  ? 231  ARG M CD  1 
ATOM   6623  N  NE  . ARG C  3  231 ? 133.687 86.416  -6.865  1.00 37.32  ? 231  ARG M NE  1 
ATOM   6624  C  CZ  . ARG C  3  231 ? 134.318 87.524  -7.219  1.00 33.51  ? 231  ARG M CZ  1 
ATOM   6625  N  NH1 . ARG C  3  231 ? 135.634 87.611  -7.165  1.00 30.81  ? 231  ARG M NH1 1 
ATOM   6626  N  NH2 . ARG C  3  231 ? 133.613 88.534  -7.677  1.00 37.99  ? 231  ARG M NH2 1 
ATOM   6627  N  N   . GLU C  3  232 ? 133.884 82.394  -1.011  1.00 23.64  ? 232  GLU M N   1 
ATOM   6628  C  CA  . GLU C  3  232 ? 133.900 82.483  0.434   1.00 19.98  ? 232  GLU M CA  1 
ATOM   6629  C  C   . GLU C  3  232 ? 135.307 82.695  0.954   1.00 23.87  ? 232  GLU M C   1 
ATOM   6630  O  O   . GLU C  3  232 ? 135.515 83.578  1.793   1.00 26.43  ? 232  GLU M O   1 
ATOM   6631  C  CB  . GLU C  3  232 ? 133.261 81.243  1.048   1.00 17.09  ? 232  GLU M CB  1 
ATOM   6632  C  CG  . GLU C  3  232 ? 131.738 81.290  1.037   1.00 13.03  ? 232  GLU M CG  1 
ATOM   6633  C  CD  . GLU C  3  232 ? 131.122 80.010  1.574   1.00 18.14  ? 232  GLU M CD  1 
ATOM   6634  O  OE1 . GLU C  3  232 ? 131.763 78.948  1.456   1.00 24.85  ? 232  GLU M OE1 1 
ATOM   6635  O  OE2 . GLU C  3  232 ? 130.019 80.051  2.157   1.00 16.46  ? 232  GLU M OE2 1 
ATOM   6636  N  N   . ILE C  3  233 ? 136.284 82.074  0.285   1.00 22.04  ? 233  ILE M N   1 
ATOM   6637  C  CA  . ILE C  3  233 ? 137.690 82.240  0.642   1.00 22.81  ? 233  ILE M CA  1 
ATOM   6638  C  C   . ILE C  3  233 ? 138.102 83.697  0.670   1.00 25.01  ? 233  ILE M C   1 
ATOM   6639  O  O   . ILE C  3  233 ? 138.626 84.158  1.660   1.00 32.62  ? 233  ILE M O   1 
ATOM   6640  C  CB  . ILE C  3  233 ? 138.622 81.534  -0.327  1.00 20.49  ? 233  ILE M CB  1 
ATOM   6641  C  CG1 . ILE C  3  233 ? 138.187 80.089  -0.491  1.00 16.37  ? 233  ILE M CG1 1 
ATOM   6642  C  CG2 . ILE C  3  233 ? 140.036 81.611  0.196   1.00 19.93  ? 233  ILE M CG2 1 
ATOM   6643  C  CD1 . ILE C  3  233 ? 138.136 79.341  0.806   1.00 19.64  ? 233  ILE M CD1 1 
ATOM   6644  N  N   . GLU C  3  234 ? 137.761 84.447  -0.368  1.00 26.84  ? 234  GLU M N   1 
ATOM   6645  C  CA  . GLU C  3  234 ? 138.135 85.856  -0.445  1.00 23.75  ? 234  GLU M CA  1 
ATOM   6646  C  C   . GLU C  3  234 ? 137.216 86.780  0.350   1.00 27.01  ? 234  GLU M C   1 
ATOM   6647  O  O   . GLU C  3  234 ? 137.586 87.923  0.630   1.00 27.17  ? 234  GLU M O   1 
ATOM   6648  C  CB  . GLU C  3  234 ? 138.199 86.319  -1.905  1.00 21.46  ? 234  GLU M CB  1 
ATOM   6649  C  CG  . GLU C  3  234 ? 139.439 85.811  -2.654  1.00 21.44  ? 234  GLU M CG  1 
ATOM   6650  C  CD  . GLU C  3  234 ? 139.315 84.374  -3.161  1.00 21.76  ? 234  GLU M CD  1 
ATOM   6651  O  OE1 . GLU C  3  234 ? 138.298 84.076  -3.831  1.00 18.60  ? 234  GLU M OE1 1 
ATOM   6652  O  OE2 . GLU C  3  234 ? 140.253 83.564  -2.934  1.00 20.27  ? 234  GLU M OE2 1 
ATOM   6653  N  N   . GLN C  3  235 ? 136.044 86.286  0.749   1.00 26.39  ? 235  GLN M N   1 
ATOM   6654  C  CA  . GLN C  3  235 ? 135.209 87.019  1.696   1.00 23.62  ? 235  GLN M CA  1 
ATOM   6655  C  C   . GLN C  3  235 ? 135.789 86.840  3.114   1.00 24.68  ? 235  GLN M C   1 
ATOM   6656  O  O   . GLN C  3  235 ? 135.653 87.726  3.968   1.00 22.76  ? 235  GLN M O   1 
ATOM   6657  C  CB  . GLN C  3  235 ? 133.770 86.512  1.621   1.00 22.72  ? 235  GLN M CB  1 
ATOM   6658  C  CG  . GLN C  3  235 ? 133.067 86.849  0.326   1.00 16.30  ? 235  GLN M CG  1 
ATOM   6659  C  CD  . GLN C  3  235 ? 132.694 88.292  0.259   1.00 21.07  ? 235  GLN M CD  1 
ATOM   6660  O  OE1 . GLN C  3  235 ? 132.632 88.960  1.281   1.00 25.34  ? 235  GLN M OE1 1 
ATOM   6661  N  NE2 . GLN C  3  235 ? 132.392 88.785  -0.937  1.00 24.83  ? 235  GLN M NE2 1 
ATOM   6662  N  N   . ILE C  3  236 ? 136.587 85.780  3.282   1.00 21.96  ? 236  ILE M N   1 
ATOM   6663  C  CA  . ILE C  3  236 ? 137.345 85.532  4.505   1.00 21.55  ? 236  ILE M CA  1 
ATOM   6664  C  C   . ILE C  3  236 ? 138.525 86.501  4.652   1.00 25.50  ? 236  ILE M C   1 
ATOM   6665  O  O   . ILE C  3  236 ? 138.597 87.259  5.634   1.00 26.17  ? 236  ILE M O   1 
ATOM   6666  C  CB  . ILE C  3  236 ? 137.855 84.060  4.549   1.00 21.44  ? 236  ILE M CB  1 
ATOM   6667  C  CG1 . ILE C  3  236 ? 136.681 83.112  4.832   1.00 20.43  ? 236  ILE M CG1 1 
ATOM   6668  C  CG2 . ILE C  3  236 ? 138.987 83.877  5.592   1.00 19.36  ? 236  ILE M CG2 1 
ATOM   6669  C  CD1 . ILE C  3  236 ? 137.059 81.618  4.801   1.00 14.20  ? 236  ILE M CD1 1 
ATOM   6670  N  N   . THR C  3  237 ? 139.462 86.462  3.702   1.00 25.91  ? 237  THR M N   1 
ATOM   6671  C  CA  . THR C  3  237 ? 140.670 87.276  3.795   1.00 22.62  ? 237  THR M CA  1 
ATOM   6672  C  C   . THR C  3  237 ? 140.376 88.715  3.475   1.00 22.51  ? 237  THR M C   1 
ATOM   6673  O  O   . THR C  3  237 ? 141.221 89.567  3.674   1.00 30.95  ? 237  THR M O   1 
ATOM   6674  C  CB  . THR C  3  237 ? 141.770 86.834  2.838   1.00 22.65  ? 237  THR M CB  1 
ATOM   6675  O  OG1 . THR C  3  237 ? 141.280 86.939  1.497   1.00 25.32  ? 237  THR M OG1 1 
ATOM   6676  C  CG2 . THR C  3  237 ? 142.223 85.413  3.141   1.00 16.16  ? 237  THR M CG2 1 
ATOM   6677  N  N   . ASP C  3  238 ? 139.203 89.011  2.950   1.00 22.67  ? 238  ASP M N   1 
ATOM   6678  C  CA  . ASP C  3  238 ? 138.885 90.400  2.719   1.00 23.30  ? 238  ASP M CA  1 
ATOM   6679  C  C   . ASP C  3  238 ? 137.392 90.625  2.755   1.00 22.08  ? 238  ASP M C   1 
ATOM   6680  O  O   . ASP C  3  238 ? 136.762 90.770  1.730   1.00 26.05  ? 238  ASP M O   1 
ATOM   6681  C  CB  . ASP C  3  238 ? 139.493 90.845  1.381   1.00 28.24  ? 238  ASP M CB  1 
ATOM   6682  C  CG  . ASP C  3  238 ? 139.377 92.352  1.138   1.00 33.90  ? 238  ASP M CG  1 
ATOM   6683  O  OD1 . ASP C  3  238 ? 139.454 93.151  2.112   1.00 34.01  ? 238  ASP M OD1 1 
ATOM   6684  O  OD2 . ASP C  3  238 ? 139.226 92.732  -0.045  1.00 34.43  ? 238  ASP M OD2 1 
ATOM   6685  N  N   . ARG C  3  239 ? 136.845 90.692  3.956   1.00 23.89  ? 239  ARG M N   1 
ATOM   6686  C  CA  . ARG C  3  239 ? 135.427 90.924  4.172   1.00 22.27  ? 239  ARG M CA  1 
ATOM   6687  C  C   . ARG C  3  239 ? 134.836 91.881  3.138   1.00 23.85  ? 239  ARG M C   1 
ATOM   6688  O  O   . ARG C  3  239 ? 135.346 92.985  2.976   1.00 23.85  ? 239  ARG M O   1 
ATOM   6689  C  CB  . ARG C  3  239 ? 135.222 91.511  5.573   1.00 23.56  ? 239  ARG M CB  1 
ATOM   6690  C  CG  . ARG C  3  239 ? 133.772 91.858  5.891   1.00 25.01  ? 239  ARG M CG  1 
ATOM   6691  C  CD  . ARG C  3  239 ? 133.612 92.512  7.235   1.00 22.76  ? 239  ARG M CD  1 
ATOM   6692  N  NE  . ARG C  3  239 ? 133.928 93.928  7.170   1.00 27.71  ? 239  ARG M NE  1 
ATOM   6693  C  CZ  . ARG C  3  239 ? 134.735 94.549  8.018   1.00 29.15  ? 239  ARG M CZ  1 
ATOM   6694  N  NH1 . ARG C  3  239 ? 135.443 93.846  8.896   1.00 25.24  ? 239  ARG M NH1 1 
ATOM   6695  N  NH2 . ARG C  3  239 ? 134.883 95.864  7.938   1.00 28.49  ? 239  ARG M NH2 1 
ATOM   6696  N  N   . GLY C  3  240 ? 133.772 91.452  2.454   1.00 22.48  ? 240  GLY M N   1 
ATOM   6697  C  CA  . GLY C  3  240 ? 133.019 92.326  1.559   1.00 24.05  ? 240  GLY M CA  1 
ATOM   6698  C  C   . GLY C  3  240 ? 131.540 92.505  1.913   1.00 23.45  ? 240  GLY M C   1 
ATOM   6699  O  O   . GLY C  3  240 ? 131.050 91.880  2.857   1.00 27.32  ? 240  GLY M O   1 
ATOM   6700  N  N   . THR C  3  241 ? 130.802 93.300  1.137   1.00 20.26  ? 241  THR M N   1 
ATOM   6701  C  CA  . THR C  3  241 ? 129.443 93.679  1.532   1.00 20.18  ? 241  THR M CA  1 
ATOM   6702  C  C   . THR C  3  241 ? 128.540 92.454  1.662   1.00 23.61  ? 241  THR M C   1 
ATOM   6703  O  O   . THR C  3  241 ? 127.570 92.464  2.420   1.00 26.08  ? 241  THR M O   1 
ATOM   6704  C  CB  . THR C  3  241 ? 128.820 94.682  0.529   1.00 18.75  ? 241  THR M CB  1 
ATOM   6705  O  OG1 . THR C  3  241 ? 127.629 95.239  1.079   1.00 24.98  ? 241  THR M OG1 1 
ATOM   6706  C  CG2 . THR C  3  241 ? 128.459 94.012  -0.766  1.00 24.76  ? 241  THR M CG2 1 
ATOM   6707  N  N   . ALA C  3  242 ? 128.893 91.386  0.953   1.00 22.15  ? 242  ALA M N   1 
ATOM   6708  C  CA  . ALA C  3  242 ? 128.158 90.135  0.993   1.00 22.83  ? 242  ALA M CA  1 
ATOM   6709  C  C   . ALA C  3  242 ? 128.061 89.609  2.427   1.00 25.00  ? 242  ALA M C   1 
ATOM   6710  O  O   . ALA C  3  242 ? 126.986 89.610  3.040   1.00 27.31  ? 242  ALA M O   1 
ATOM   6711  C  CB  . ALA C  3  242 ? 128.851 89.111  0.098   1.00 24.70  ? 242  ALA M CB  1 
ATOM   6712  N  N   . VAL C  3  243 ? 129.213 89.283  3.000   1.00 22.66  ? 243  VAL M N   1 
ATOM   6713  C  CA  . VAL C  3  243 ? 129.262 88.747  4.352   1.00 20.26  ? 243  VAL M CA  1 
ATOM   6714  C  C   . VAL C  3  243 ? 129.042 89.831  5.423   1.00 19.79  ? 243  VAL M C   1 
ATOM   6715  O  O   . VAL C  3  243 ? 128.790 89.514  6.572   1.00 27.14  ? 243  VAL M O   1 
ATOM   6716  C  CB  . VAL C  3  243 ? 130.592 88.019  4.603   1.00 12.22  ? 243  VAL M CB  1 
ATOM   6717  C  CG1 . VAL C  3  243 ? 130.798 86.954  3.549   1.00 13.56  ? 243  VAL M CG1 1 
ATOM   6718  C  CG2 . VAL C  3  243 ? 131.736 89.000  4.533   1.00 13.49  ? 243  VAL M CG2 1 
ATOM   6719  N  N   . GLU C  3  244 ? 129.023 91.099  5.052   1.00 14.85  ? 244  GLU M N   1 
ATOM   6720  C  CA  . GLU C  3  244 ? 128.628 92.099  6.032   1.00 18.34  ? 244  GLU M CA  1 
ATOM   6721  C  C   . GLU C  3  244 ? 127.139 92.007  6.160   1.00 20.45  ? 244  GLU M C   1 
ATOM   6722  O  O   . GLU C  3  244 ? 126.602 92.064  7.258   1.00 24.33  ? 244  GLU M O   1 
ATOM   6723  C  CB  . GLU C  3  244 ? 128.998 93.515  5.597   1.00 19.58  ? 244  GLU M CB  1 
ATOM   6724  C  CG  . GLU C  3  244 ? 130.486 93.728  5.409   1.00 25.13  ? 244  GLU M CG  1 
ATOM   6725  C  CD  . GLU C  3  244 ? 130.909 95.204  5.374   1.00 27.07  ? 244  GLU M CD  1 
ATOM   6726  O  OE1 . GLU C  3  244 ? 130.090 96.097  5.039   1.00 30.45  ? 244  GLU M OE1 1 
ATOM   6727  O  OE2 . GLU C  3  244 ? 132.089 95.459  5.678   1.00 23.53  ? 244  GLU M OE2 1 
ATOM   6728  N  N   . ARG C  3  245 ? 126.470 91.887  5.017   1.00 24.86  ? 245  ARG M N   1 
ATOM   6729  C  CA  . ARG C  3  245 ? 125.018 91.858  4.970   1.00 22.54  ? 245  ARG M CA  1 
ATOM   6730  C  C   . ARG C  3  245 ? 124.536 90.523  5.514   1.00 23.87  ? 245  ARG M C   1 
ATOM   6731  O  O   . ARG C  3  245 ? 123.560 90.490  6.251   1.00 26.95  ? 245  ARG M O   1 
ATOM   6732  C  CB  . ARG C  3  245 ? 124.517 92.059  3.540   1.00 21.94  ? 245  ARG M CB  1 
ATOM   6733  C  CG  . ARG C  3  245 ? 124.873 93.415  2.938   1.00 26.61  ? 245  ARG M CG  1 
ATOM   6734  C  CD  . ARG C  3  245 ? 124.287 93.584  1.525   1.00 33.46  ? 245  ARG M CD  1 
ATOM   6735  N  NE  . ARG C  3  245 ? 124.962 94.604  0.702   1.00 34.49  ? 245  ARG M NE  1 
ATOM   6736  C  CZ  . ARG C  3  245 ? 124.333 95.573  0.034   1.00 30.17  ? 245  ARG M CZ  1 
ATOM   6737  N  NH1 . ARG C  3  245 ? 123.013 95.625  0.020   1.00 25.22  ? 245  ARG M NH1 1 
ATOM   6738  N  NH2 . ARG C  3  245 ? 125.021 96.443  -0.686  1.00 32.12  ? 245  ARG M NH2 1 
ATOM   6739  N  N   . ALA C  3  246 ? 125.301 89.455  5.289   1.00 24.06  ? 246  ALA M N   1 
ATOM   6740  C  CA  . ALA C  3  246 ? 124.946 88.141  5.834   1.00 23.90  ? 246  ALA M CA  1 
ATOM   6741  C  C   . ALA C  3  246 ? 124.965 88.206  7.360   1.00 23.53  ? 246  ALA M C   1 
ATOM   6742  O  O   . ALA C  3  246 ? 123.995 87.829  8.029   1.00 27.13  ? 246  ALA M O   1 
ATOM   6743  C  CB  . ALA C  3  246 ? 125.915 87.070  5.338   1.00 15.86  ? 246  ALA M CB  1 
ATOM   6744  N  N   . ALA C  3  247 ? 125.997 88.851  7.887   1.00 21.36  ? 247  ALA M N   1 
ATOM   6745  C  CA  . ALA C  3  247 ? 126.157 88.968  9.318   1.00 20.19  ? 247  ALA M CA  1 
ATOM   6746  C  C   . ALA C  3  247 ? 125.070 89.839  9.924   1.00 18.28  ? 247  ALA M C   1 
ATOM   6747  O  O   . ALA C  3  247 ? 124.449 89.454  10.906  1.00 18.58  ? 247  ALA M O   1 
ATOM   6748  C  CB  . ALA C  3  247 ? 127.533 89.518  9.651   1.00 22.69  ? 247  ALA M CB  1 
ATOM   6749  N  N   . LEU C  3  248 ? 124.781 90.979  9.316   1.00 17.44  ? 248  LEU M N   1 
ATOM   6750  C  CA  . LEU C  3  248 ? 123.782 91.857  9.893   1.00 18.00  ? 248  LEU M CA  1 
ATOM   6751  C  C   . LEU C  3  248 ? 122.376 91.279  9.812   1.00 21.62  ? 248  LEU M C   1 
ATOM   6752  O  O   . LEU C  3  248 ? 121.555 91.501  10.722  1.00 24.61  ? 248  LEU M O   1 
ATOM   6753  C  CB  . LEU C  3  248 ? 123.837 93.227  9.242   1.00 20.14  ? 248  LEU M CB  1 
ATOM   6754  C  CG  . LEU C  3  248 ? 125.140 93.965  9.536   1.00 24.15  ? 248  LEU M CG  1 
ATOM   6755  C  CD1 . LEU C  3  248 ? 125.157 95.250  8.733   1.00 18.20  ? 248  LEU M CD1 1 
ATOM   6756  C  CD2 . LEU C  3  248 ? 125.284 94.218  11.050  1.00 16.19  ? 248  LEU M CD2 1 
ATOM   6757  N  N   . PHE C  3  249 ? 122.120 90.460  8.792   1.00 18.69  ? 249  PHE M N   1 
ATOM   6758  C  CA  . PHE C  3  249 ? 120.853 89.739  8.718   1.00 18.80  ? 249  PHE M CA  1 
ATOM   6759  C  C   . PHE C  3  249 ? 120.701 88.920  9.986   1.00 20.30  ? 249  PHE M C   1 
ATOM   6760  O  O   . PHE C  3  249 ? 119.733 89.078  10.737  1.00 27.04  ? 249  PHE M O   1 
ATOM   6761  C  CB  . PHE C  3  249 ? 120.799 88.798  7.504   1.00 18.19  ? 249  PHE M CB  1 
ATOM   6762  C  CG  . PHE C  3  249 ? 119.582 87.899  7.487   1.00 17.66  ? 249  PHE M CG  1 
ATOM   6763  C  CD1 . PHE C  3  249 ? 118.388 88.334  6.950   1.00 19.84  ? 249  PHE M CD1 1 
ATOM   6764  C  CD2 . PHE C  3  249 ? 119.613 86.653  8.087   1.00 16.81  ? 249  PHE M CD2 1 
ATOM   6765  C  CE1 . PHE C  3  249 ? 117.244 87.542  7.026   1.00 15.03  ? 249  PHE M CE1 1 
ATOM   6766  C  CE2 . PHE C  3  249 ? 118.481 85.871  8.174   1.00 12.28  ? 249  PHE M CE2 1 
ATOM   6767  C  CZ  . PHE C  3  249 ? 117.300 86.312  7.650   1.00 10.38  ? 249  PHE M CZ  1 
ATOM   6768  N  N   . TRP C  3  250 ? 121.720 88.128  10.283  1.00 17.74  ? 250  TRP M N   1 
ATOM   6769  C  CA  . TRP C  3  250 ? 121.653 87.246  11.424  1.00 15.89  ? 250  TRP M CA  1 
ATOM   6770  C  C   . TRP C  3  250 ? 121.738 87.938  12.769  1.00 15.01  ? 250  TRP M C   1 
ATOM   6771  O  O   . TRP C  3  250 ? 120.920 87.664  13.645  1.00 21.59  ? 250  TRP M O   1 
ATOM   6772  C  CB  . TRP C  3  250 ? 122.686 86.145  11.270  1.00 12.54  ? 250  TRP M CB  1 
ATOM   6773  C  CG  . TRP C  3  250 ? 122.244 85.187  10.194  1.00 17.16  ? 250  TRP M CG  1 
ATOM   6774  C  CD1 . TRP C  3  250 ? 122.745 85.089  8.927   1.00 20.08  ? 250  TRP M CD1 1 
ATOM   6775  C  CD2 . TRP C  3  250 ? 121.170 84.222  10.273  1.00 14.84  ? 250  TRP M CD2 1 
ATOM   6776  N  NE1 . TRP C  3  250 ? 122.073 84.105  8.225   1.00 18.86  ? 250  TRP M NE1 1 
ATOM   6777  C  CE2 . TRP C  3  250 ? 121.106 83.561  9.026   1.00 16.03  ? 250  TRP M CE2 1 
ATOM   6778  C  CE3 . TRP C  3  250 ? 120.265 83.851  11.283  1.00 13.72  ? 250  TRP M CE3 1 
ATOM   6779  C  CZ2 . TRP C  3  250 ? 120.177 82.542  8.759   1.00 20.09  ? 250  TRP M CZ2 1 
ATOM   6780  C  CZ3 . TRP C  3  250 ? 119.338 82.836  11.017  1.00 16.91  ? 250  TRP M CZ3 1 
ATOM   6781  C  CH2 . TRP C  3  250 ? 119.305 82.195  9.764   1.00 20.18  ? 250  TRP M CH2 1 
ATOM   6782  N  N   . ARG C  3  251 ? 122.483 89.031  12.831  1.00 18.94  ? 251  ARG M N   1 
ATOM   6783  C  CA  . ARG C  3  251 ? 122.556 89.810  14.054  1.00 17.42  ? 251  ARG M CA  1 
ATOM   6784  C  C   . ARG C  3  251 ? 121.200 90.410  14.366  1.00 22.13  ? 251  ARG M C   1 
ATOM   6785  O  O   . ARG C  3  251 ? 120.750 90.376  15.512  1.00 25.79  ? 251  ARG M O   1 
ATOM   6786  C  CB  . ARG C  3  251 ? 123.590 90.920  13.917  1.00 21.52  ? 251  ARG M CB  1 
ATOM   6787  C  CG  . ARG C  3  251 ? 123.899 91.671  15.207  1.00 19.29  ? 251  ARG M CG  1 
ATOM   6788  C  CD  . ARG C  3  251 ? 125.115 92.594  15.054  1.00 20.74  ? 251  ARG M CD  1 
ATOM   6789  N  NE  . ARG C  3  251 ? 125.494 93.225  16.323  1.00 22.84  ? 251  ARG M NE  1 
ATOM   6790  C  CZ  . ARG C  3  251 ? 126.236 92.633  17.257  1.00 30.14  ? 251  ARG M CZ  1 
ATOM   6791  N  NH1 . ARG C  3  251 ? 126.901 91.514  16.978  1.00 28.69  ? 251  ARG M NH1 1 
ATOM   6792  N  NH2 . ARG C  3  251 ? 126.404 93.213  18.438  1.00 34.83  ? 251  ARG M NH2 1 
ATOM   6793  N  N   . TRP C  3  252 ? 120.499 90.871  13.337  1.00 23.02  ? 252  TRP M N   1 
ATOM   6794  C  CA  . TRP C  3  252 ? 119.262 91.620  13.555  1.00 22.20  ? 252  TRP M CA  1 
ATOM   6795  C  C   . TRP C  3  252 ? 118.106 90.713  13.839  1.00 22.23  ? 252  TRP M C   1 
ATOM   6796  O  O   . TRP C  3  252 ? 117.091 91.143  14.394  1.00 20.73  ? 252  TRP M O   1 
ATOM   6797  C  CB  . TRP C  3  252 ? 118.939 92.470  12.344  1.00 23.10  ? 252  TRP M CB  1 
ATOM   6798  C  CG  . TRP C  3  252 ? 119.916 93.574  12.133  1.00 23.38  ? 252  TRP M CG  1 
ATOM   6799  C  CD1 . TRP C  3  252 ? 120.916 93.975  12.980  1.00 22.16  ? 252  TRP M CD1 1 
ATOM   6800  C  CD2 . TRP C  3  252 ? 119.954 94.455  11.026  1.00 23.75  ? 252  TRP M CD2 1 
ATOM   6801  N  NE1 . TRP C  3  252 ? 121.582 95.053  12.455  1.00 18.71  ? 252  TRP M NE1 1 
ATOM   6802  C  CE2 . TRP C  3  252 ? 121.010 95.373  11.256  1.00 24.70  ? 252  TRP M CE2 1 
ATOM   6803  C  CE3 . TRP C  3  252 ? 119.179 94.585  9.867   1.00 29.91  ? 252  TRP M CE3 1 
ATOM   6804  C  CZ2 . TRP C  3  252 ? 121.314 96.397  10.368  1.00 27.00  ? 252  TRP M CZ2 1 
ATOM   6805  C  CZ3 . TRP C  3  252 ? 119.474 95.613  8.978   1.00 31.59  ? 252  TRP M CZ3 1 
ATOM   6806  C  CH2 . TRP C  3  252 ? 120.539 96.507  9.236   1.00 31.63  ? 252  TRP M CH2 1 
ATOM   6807  N  N   . THR C  3  253 ? 118.225 89.483  13.358  1.00 21.52  ? 253  THR M N   1 
ATOM   6808  C  CA  . THR C  3  253 ? 117.216 88.473  13.599  1.00 20.55  ? 253  THR M CA  1 
ATOM   6809  C  C   . THR C  3  253 ? 117.401 87.823  14.965  1.00 21.59  ? 253  THR M C   1 
ATOM   6810  O  O   . THR C  3  253 ? 116.498 87.883  15.783  1.00 22.40  ? 253  THR M O   1 
ATOM   6811  C  CB  . THR C  3  253 ? 117.244 87.393  12.499  1.00 19.24  ? 253  THR M CB  1 
ATOM   6812  O  OG1 . THR C  3  253 ? 117.208 88.031  11.221  1.00 18.47  ? 253  THR M OG1 1 
ATOM   6813  C  CG2 . THR C  3  253 ? 116.031 86.469  12.614  1.00 17.13  ? 253  THR M CG2 1 
ATOM   6814  N  N   . ILE C  3  254 ? 118.563 87.212  15.213  1.00 19.52  ? 254  ILE M N   1 
ATOM   6815  C  CA  . ILE C  3  254 ? 118.753 86.434  16.426  1.00 16.45  ? 254  ILE M CA  1 
ATOM   6816  C  C   . ILE C  3  254 ? 119.627 87.067  17.480  1.00 20.37  ? 254  ILE M C   1 
ATOM   6817  O  O   . ILE C  3  254 ? 119.742 86.537  18.579  1.00 25.27  ? 254  ILE M O   1 
ATOM   6818  C  CB  . ILE C  3  254 ? 119.301 85.047  16.145  1.00 12.99  ? 254  ILE M CB  1 
ATOM   6819  C  CG1 . ILE C  3  254 ? 120.725 85.106  15.604  1.00 11.07  ? 254  ILE M CG1 1 
ATOM   6820  C  CG2 . ILE C  3  254 ? 118.392 84.351  15.197  1.00 15.48  ? 254  ILE M CG2 1 
ATOM   6821  C  CD1 . ILE C  3  254 ? 121.279 83.713  15.263  1.00 6.40   ? 254  ILE M CD1 1 
ATOM   6822  N  N   . GLY C  3  255 ? 120.295 88.158  17.133  1.00 21.66  ? 255  GLY M N   1 
ATOM   6823  C  CA  . GLY C  3  255 ? 120.944 88.969  18.142  1.00 17.49  ? 255  GLY M CA  1 
ATOM   6824  C  C   . GLY C  3  255 ? 122.451 88.866  18.211  1.00 20.47  ? 255  GLY M C   1 
ATOM   6825  O  O   . GLY C  3  255 ? 123.067 89.673  18.910  1.00 23.07  ? 255  GLY M O   1 
ATOM   6826  N  N   . PHE C  3  256 ? 123.002 87.762  17.704  1.00 16.94  ? 256  PHE M N   1 
ATOM   6827  C  CA  . PHE C  3  256 ? 124.446 87.579  17.600  1.00 14.82  ? 256  PHE M CA  1 
ATOM   6828  C  C   . PHE C  3  256 ? 124.706 87.067  16.195  1.00 17.01  ? 256  PHE M C   1 
ATOM   6829  O  O   . PHE C  3  256 ? 123.763 86.889  15.438  1.00 21.88  ? 256  PHE M O   1 
ATOM   6830  C  CB  . PHE C  3  256 ? 124.950 86.567  18.639  1.00 16.32  ? 256  PHE M CB  1 
ATOM   6831  C  CG  . PHE C  3  256 ? 124.362 85.173  18.493  1.00 12.31  ? 256  PHE M CG  1 
ATOM   6832  C  CD1 . PHE C  3  256 ? 123.049 84.903  18.877  1.00 14.28  ? 256  PHE M CD1 1 
ATOM   6833  C  CD2 . PHE C  3  256 ? 125.145 84.119  18.044  1.00 6.86   ? 256  PHE M CD2 1 
ATOM   6834  C  CE1 . PHE C  3  256 ? 122.525 83.604  18.808  1.00 12.81  ? 256  PHE M CE1 1 
ATOM   6835  C  CE2 . PHE C  3  256 ? 124.630 82.812  17.977  1.00 13.71  ? 256  PHE M CE2 1 
ATOM   6836  C  CZ  . PHE C  3  256 ? 123.316 82.552  18.352  1.00 6.16   ? 256  PHE M CZ  1 
ATOM   6837  N  N   . ASN C  3  257 ? 125.965 86.906  15.807  1.00 19.67  ? 257  ASN M N   1 
ATOM   6838  C  CA  . ASN C  3  257 ? 126.275 86.535  14.433  1.00 19.87  ? 257  ASN M CA  1 
ATOM   6839  C  C   . ASN C  3  257 ? 127.632 85.891  14.324  1.00 18.65  ? 257  ASN M C   1 
ATOM   6840  O  O   . ASN C  3  257 ? 128.452 86.039  15.206  1.00 23.80  ? 257  ASN M O   1 
ATOM   6841  C  CB  . ASN C  3  257 ? 126.220 87.763  13.518  1.00 24.46  ? 257  ASN M CB  1 
ATOM   6842  C  CG  . ASN C  3  257 ? 127.223 88.837  13.917  1.00 26.39  ? 257  ASN M CG  1 
ATOM   6843  O  OD1 . ASN C  3  257 ? 126.863 89.824  14.566  1.00 23.93  ? 257  ASN M OD1 1 
ATOM   6844  N  ND2 . ASN C  3  257 ? 128.487 88.633  13.563  1.00 21.44  ? 257  ASN M ND2 1 
ATOM   6845  N  N   . ALA C  3  258 ? 127.782 85.019  13.339  1.00 20.21  ? 258  ALA M N   1 
ATOM   6846  C  CA  . ALA C  3  258 ? 129.067 84.418  13.023  1.00 19.20  ? 258  ALA M CA  1 
ATOM   6847  C  C   . ALA C  3  258 ? 129.826 85.345  12.076  1.00 19.54  ? 258  ALA M C   1 
ATOM   6848  O  O   . ALA C  3  258 ? 129.413 86.485  11.847  1.00 19.24  ? 258  ALA M O   1 
ATOM   6849  C  CB  . ALA C  3  258 ? 128.849 83.063  12.360  1.00 19.37  ? 258  ALA M CB  1 
ATOM   6850  N  N   . THR C  3  259 ? 130.942 84.852  11.552  1.00 19.10  ? 259  THR M N   1 
ATOM   6851  C  CA  . THR C  3  259 ? 131.599 85.422  10.373  1.00 20.28  ? 259  THR M CA  1 
ATOM   6852  C  C   . THR C  3  259 ? 131.516 84.382  9.228   1.00 22.49  ? 259  THR M C   1 
ATOM   6853  O  O   . THR C  3  259 ? 130.996 83.261  9.409   1.00 23.47  ? 259  THR M O   1 
ATOM   6854  C  CB  . THR C  3  259 ? 133.098 85.740  10.646  1.00 18.69  ? 259  THR M CB  1 
ATOM   6855  O  OG1 . THR C  3  259 ? 133.784 84.535  11.022  1.00 24.67  ? 259  THR M OG1 1 
ATOM   6856  C  CG2 . THR C  3  259 ? 133.243 86.772  11.750  1.00 16.09  ? 259  THR M CG2 1 
ATOM   6857  N  N   . ILE C  3  260 ? 132.057 84.726  8.068   1.00 18.64  ? 260  ILE M N   1 
ATOM   6858  C  CA  . ILE C  3  260 ? 132.002 83.802  6.964   1.00 21.52  ? 260  ILE M CA  1 
ATOM   6859  C  C   . ILE C  3  260 ? 132.928 82.601  7.170   1.00 22.08  ? 260  ILE M C   1 
ATOM   6860  O  O   . ILE C  3  260 ? 132.609 81.501  6.713   1.00 25.96  ? 260  ILE M O   1 
ATOM   6861  C  CB  . ILE C  3  260 ? 132.236 84.523  5.573   1.00 24.27  ? 260  ILE M CB  1 
ATOM   6862  C  CG1 . ILE C  3  260 ? 131.978 83.550  4.423   1.00 22.21  ? 260  ILE M CG1 1 
ATOM   6863  C  CG2 . ILE C  3  260 ? 133.633 85.076  5.457   1.00 22.70  ? 260  ILE M CG2 1 
ATOM   6864  C  CD1 . ILE C  3  260 ? 130.526 83.140  4.296   1.00 23.52  ? 260  ILE M CD1 1 
ATOM   6865  N  N   . GLU C  3  261 ? 134.008 82.754  7.935   1.00 20.20  ? 261  GLU M N   1 
ATOM   6866  C  CA  . GLU C  3  261 ? 134.815 81.578  8.239   1.00 22.48  ? 261  GLU M CA  1 
ATOM   6867  C  C   . GLU C  3  261 ? 134.194 80.788  9.370   1.00 24.50  ? 261  GLU M C   1 
ATOM   6868  O  O   . GLU C  3  261 ? 134.123 79.556  9.305   1.00 25.34  ? 261  GLU M O   1 
ATOM   6869  C  CB  . GLU C  3  261 ? 136.263 81.919  8.617   1.00 21.20  ? 261  GLU M CB  1 
ATOM   6870  C  CG  . GLU C  3  261 ? 137.075 80.648  8.949   1.00 19.47  ? 261  GLU M CG  1 
ATOM   6871  C  CD  . GLU C  3  261 ? 138.534 80.891  9.367   1.00 23.65  ? 261  GLU M CD  1 
ATOM   6872  O  OE1 . GLU C  3  261 ? 138.946 82.066  9.573   1.00 16.24  ? 261  GLU M OE1 1 
ATOM   6873  O  OE2 . GLU C  3  261 ? 139.266 79.879  9.505   1.00 21.61  ? 261  GLU M OE2 1 
ATOM   6874  N  N   . SER C  3  262 ? 133.756 81.489  10.415  1.00 24.97  ? 262  SER M N   1 
ATOM   6875  C  CA  . SER C  3  262 ? 133.411 80.792  11.643  1.00 22.40  ? 262  SER M CA  1 
ATOM   6876  C  C   . SER C  3  262 ? 132.158 79.960  11.446  1.00 23.05  ? 262  SER M C   1 
ATOM   6877  O  O   . SER C  3  262 ? 132.113 78.817  11.919  1.00 24.20  ? 262  SER M O   1 
ATOM   6878  C  CB  . SER C  3  262 ? 133.242 81.760  12.804  1.00 19.06  ? 262  SER M CB  1 
ATOM   6879  O  OG  . SER C  3  262 ? 132.047 82.499  12.687  1.00 17.54  ? 262  SER M OG  1 
ATOM   6880  N  N   . VAL C  3  263 ? 131.241 80.431  10.591  1.00 18.94  ? 263  VAL M N   1 
ATOM   6881  C  CA  . VAL C  3  263 ? 130.027 79.661  10.314  1.00 17.59  ? 263  VAL M CA  1 
ATOM   6882  C  C   . VAL C  3  263 ? 130.321 78.296  9.686   1.00 15.13  ? 263  VAL M C   1 
ATOM   6883  O  O   . VAL C  3  263 ? 129.655 77.320  10.010  1.00 17.32  ? 263  VAL M O   1 
ATOM   6884  C  CB  . VAL C  3  263 ? 128.966 80.467  9.476   1.00 18.72  ? 263  VAL M CB  1 
ATOM   6885  C  CG1 . VAL C  3  263 ? 129.312 80.497  8.013   1.00 15.95  ? 263  VAL M CG1 1 
ATOM   6886  C  CG2 . VAL C  3  263 ? 127.576 79.877  9.675   1.00 12.91  ? 263  VAL M CG2 1 
ATOM   6887  N  N   . HIS C  3  264 ? 131.460 78.161  9.027   1.00 13.84  ? 264  HIS M N   1 
ATOM   6888  C  CA  . HIS C  3  264 ? 131.865 76.840  8.562   1.00 15.79  ? 264  HIS M CA  1 
ATOM   6889  C  C   . HIS C  3  264 ? 132.447 76.033  9.693   1.00 18.15  ? 264  HIS M C   1 
ATOM   6890  O  O   . HIS C  3  264 ? 132.449 74.798  9.650   1.00 19.08  ? 264  HIS M O   1 
ATOM   6891  C  CB  . HIS C  3  264 ? 132.880 76.957  7.436   1.00 17.10  ? 264  HIS M CB  1 
ATOM   6892  C  CG  . HIS C  3  264 ? 132.314 77.559  6.194   1.00 15.30  ? 264  HIS M CG  1 
ATOM   6893  N  ND1 . HIS C  3  264 ? 132.405 78.897  5.886   1.00 13.68  ? 264  HIS M ND1 1 
ATOM   6894  C  CD2 . HIS C  3  264 ? 131.463 77.029  5.277   1.00 15.13  ? 264  HIS M CD2 1 
ATOM   6895  C  CE1 . HIS C  3  264 ? 131.617 79.139  4.840   1.00 15.34  ? 264  HIS M CE1 1 
ATOM   6896  N  NE2 . HIS C  3  264 ? 131.019 78.029  4.420   1.00 20.75  ? 264  HIS M NE2 1 
ATOM   6897  N  N   . ARG C  3  265 ? 132.976 76.728  10.697  1.00 19.91  ? 265  ARG M N   1 
ATOM   6898  C  CA  . ARG C  3  265 ? 133.427 76.073  11.920  1.00 20.03  ? 265  ARG M CA  1 
ATOM   6899  C  C   . ARG C  3  265 ? 132.235 75.526  12.687  1.00 18.19  ? 265  ARG M C   1 
ATOM   6900  O  O   . ARG C  3  265 ? 132.223 74.360  13.052  1.00 20.76  ? 265  ARG M O   1 
ATOM   6901  C  CB  . ARG C  3  265 ? 134.203 77.042  12.814  1.00 19.75  ? 265  ARG M CB  1 
ATOM   6902  C  CG  . ARG C  3  265 ? 135.401 77.661  12.145  1.00 26.28  ? 265  ARG M CG  1 
ATOM   6903  C  CD  . ARG C  3  265 ? 136.478 78.044  13.158  1.00 26.77  ? 265  ARG M CD  1 
ATOM   6904  N  NE  . ARG C  3  265 ? 137.715 78.442  12.488  1.00 24.26  ? 265  ARG M NE  1 
ATOM   6905  C  CZ  . ARG C  3  265 ? 138.677 77.592  12.160  1.00 21.09  ? 265  ARG M CZ  1 
ATOM   6906  N  NH1 . ARG C  3  265 ? 138.680 76.374  12.677  1.00 13.34  ? 265  ARG M NH1 1 
ATOM   6907  N  NH2 . ARG C  3  265 ? 139.636 77.968  11.326  1.00 22.11  ? 265  ARG M NH2 1 
ATOM   6908  N  N   . TRP C  3  266 ? 131.231 76.361  12.935  1.00 16.99  ? 266  TRP M N   1 
ATOM   6909  C  CA  . TRP C  3  266 ? 129.988 75.888  13.548  1.00 16.25  ? 266  TRP M CA  1 
ATOM   6910  C  C   . TRP C  3  266 ? 129.433 74.704  12.763  1.00 14.81  ? 266  TRP M C   1 
ATOM   6911  O  O   . TRP C  3  266 ? 128.949 73.725  13.326  1.00 16.69  ? 266  TRP M O   1 
ATOM   6912  C  CB  . TRP C  3  266 ? 128.955 76.998  13.544  1.00 15.74  ? 266  TRP M CB  1 
ATOM   6913  C  CG  . TRP C  3  266 ? 129.120 78.003  14.610  1.00 16.70  ? 266  TRP M CG  1 
ATOM   6914  C  CD1 . TRP C  3  266 ? 129.743 79.215  14.508  1.00 17.89  ? 266  TRP M CD1 1 
ATOM   6915  C  CD2 . TRP C  3  266 ? 128.479 77.987  15.888  1.00 22.06  ? 266  TRP M CD2 1 
ATOM   6916  N  NE1 . TRP C  3  266 ? 129.492 79.974  15.629  1.00 19.39  ? 266  TRP M NE1 1 
ATOM   6917  C  CE2 . TRP C  3  266 ? 128.717 79.242  16.494  1.00 21.64  ? 266  TRP M CE2 1 
ATOM   6918  C  CE3 . TRP C  3  266 ? 127.714 77.030  16.579  1.00 24.11  ? 266  TRP M CE3 1 
ATOM   6919  C  CZ2 . TRP C  3  266 ? 128.211 79.571  17.763  1.00 17.29  ? 266  TRP M CZ2 1 
ATOM   6920  C  CZ3 . TRP C  3  266 ? 127.207 77.359  17.832  1.00 22.50  ? 266  TRP M CZ3 1 
ATOM   6921  C  CH2 . TRP C  3  266 ? 127.457 78.621  18.408  1.00 22.54  ? 266  TRP M CH2 1 
ATOM   6922  N  N   . GLY C  3  267 ? 129.509 74.808  11.447  1.00 13.72  ? 267  GLY M N   1 
ATOM   6923  C  CA  . GLY C  3  267 ? 129.036 73.744  10.590  1.00 13.61  ? 267  GLY M CA  1 
ATOM   6924  C  C   . GLY C  3  267 ? 129.822 72.471  10.754  1.00 15.93  ? 267  GLY M C   1 
ATOM   6925  O  O   . GLY C  3  267 ? 129.246 71.403  10.915  1.00 18.53  ? 267  GLY M O   1 
ATOM   6926  N  N   . TRP C  3  268 ? 131.141 72.574  10.724  1.00 17.22  ? 268  TRP M N   1 
ATOM   6927  C  CA  . TRP C  3  268 ? 131.992 71.393  10.797  1.00 17.99  ? 268  TRP M CA  1 
ATOM   6928  C  C   . TRP C  3  268 ? 131.791 70.715  12.151  1.00 19.94  ? 268  TRP M C   1 
ATOM   6929  O  O   . TRP C  3  268 ? 131.797 69.487  12.280  1.00 20.91  ? 268  TRP M O   1 
ATOM   6930  C  CB  . TRP C  3  268 ? 133.456 71.830  10.625  1.00 16.51  ? 268  TRP M CB  1 
ATOM   6931  C  CG  . TRP C  3  268 ? 134.468 70.695  10.571  1.00 17.64  ? 268  TRP M CG  1 
ATOM   6932  C  CD1 . TRP C  3  268 ? 134.874 70.001  9.466   1.00 22.46  ? 268  TRP M CD1 1 
ATOM   6933  C  CD2 . TRP C  3  268 ? 135.238 70.188  11.658  1.00 19.34  ? 268  TRP M CD2 1 
ATOM   6934  N  NE1 . TRP C  3  268 ? 135.848 69.095  9.802   1.00 21.38  ? 268  TRP M NE1 1 
ATOM   6935  C  CE2 . TRP C  3  268 ? 136.095 69.198  11.141  1.00 20.32  ? 268  TRP M CE2 1 
ATOM   6936  C  CE3 . TRP C  3  268 ? 135.282 70.471  13.026  1.00 23.34  ? 268  TRP M CE3 1 
ATOM   6937  C  CZ2 . TRP C  3  268 ? 136.986 68.499  11.937  1.00 23.22  ? 268  TRP M CZ2 1 
ATOM   6938  C  CZ3 . TRP C  3  268 ? 136.169 69.771  13.818  1.00 23.00  ? 268  TRP M CZ3 1 
ATOM   6939  C  CH2 . TRP C  3  268 ? 137.011 68.799  13.272  1.00 25.12  ? 268  TRP M CH2 1 
ATOM   6940  N  N   . PHE C  3  269 ? 131.671 71.547  13.173  1.00 20.34  ? 269  PHE M N   1 
ATOM   6941  C  CA  . PHE C  3  269 ? 131.597 71.087  14.547  1.00 18.06  ? 269  PHE M CA  1 
ATOM   6942  C  C   . PHE C  3  269 ? 130.312 70.315  14.728  1.00 16.98  ? 269  PHE M C   1 
ATOM   6943  O  O   . PHE C  3  269 ? 130.332 69.181  15.192  1.00 19.66  ? 269  PHE M O   1 
ATOM   6944  C  CB  . PHE C  3  269 ? 131.639 72.301  15.482  1.00 18.41  ? 269  PHE M CB  1 
ATOM   6945  C  CG  . PHE C  3  269 ? 131.398 71.979  16.923  1.00 16.37  ? 269  PHE M CG  1 
ATOM   6946  C  CD1 . PHE C  3  269 ? 132.233 71.085  17.601  1.00 13.32  ? 269  PHE M CD1 1 
ATOM   6947  C  CD2 . PHE C  3  269 ? 130.338 72.576  17.604  1.00 15.59  ? 269  PHE M CD2 1 
ATOM   6948  C  CE1 . PHE C  3  269 ? 132.027 70.783  18.936  1.00 15.75  ? 269  PHE M CE1 1 
ATOM   6949  C  CE2 . PHE C  3  269 ? 130.111 72.287  18.943  1.00 20.30  ? 269  PHE M CE2 1 
ATOM   6950  C  CZ  . PHE C  3  269 ? 130.966 71.383  19.616  1.00 20.25  ? 269  PHE M CZ  1 
ATOM   6951  N  N   . PHE C  3  270 ? 129.195 70.909  14.319  1.00 18.80  ? 270  PHE M N   1 
ATOM   6952  C  CA  . PHE C  3  270 ? 127.909 70.225  14.405  1.00 18.40  ? 270  PHE M CA  1 
ATOM   6953  C  C   . PHE C  3  270 ? 127.943 68.880  13.674  1.00 20.12  ? 270  PHE M C   1 
ATOM   6954  O  O   . PHE C  3  270 ? 127.600 67.854  14.257  1.00 26.62  ? 270  PHE M O   1 
ATOM   6955  C  CB  . PHE C  3  270 ? 126.797 71.109  13.854  1.00 18.56  ? 270  PHE M CB  1 
ATOM   6956  C  CG  . PHE C  3  270 ? 126.132 71.986  14.895  1.00 23.84  ? 270  PHE M CG  1 
ATOM   6957  C  CD1 . PHE C  3  270 ? 126.889 72.795  15.742  1.00 19.17  ? 270  PHE M CD1 1 
ATOM   6958  C  CD2 . PHE C  3  270 ? 124.738 72.024  15.006  1.00 20.62  ? 270  PHE M CD2 1 
ATOM   6959  C  CE1 . PHE C  3  270 ? 126.269 73.630  16.684  1.00 24.04  ? 270  PHE M CE1 1 
ATOM   6960  C  CE2 . PHE C  3  270 ? 124.111 72.861  15.947  1.00 21.02  ? 270  PHE M CE2 1 
ATOM   6961  C  CZ  . PHE C  3  270 ? 124.884 73.664  16.784  1.00 17.47  ? 270  PHE M CZ  1 
ATOM   6962  N  N   . SER C  3  271 ? 128.587 68.839  12.514  1.00 19.76  ? 271  SER M N   1 
ATOM   6963  C  CA  . SER C  3  271 ? 128.633 67.606  11.720  1.00 17.20  ? 271  SER M CA  1 
ATOM   6964  C  C   . SER C  3  271 ? 129.413 66.581  12.481  1.00 13.39  ? 271  SER M C   1 
ATOM   6965  O  O   . SER C  3  271 ? 128.920 65.520  12.793  1.00 16.48  ? 271  SER M O   1 
ATOM   6966  C  CB  . SER C  3  271 ? 129.314 67.854  10.379  1.00 15.36  ? 271  SER M CB  1 
ATOM   6967  O  OG  . SER C  3  271 ? 129.564 66.636  9.713   1.00 32.42  ? 271  SER M OG  1 
ATOM   6968  N  N   . LEU C  3  272 ? 130.581 66.993  12.928  1.00 13.50  ? 272  LEU M N   1 
ATOM   6969  C  CA  . LEU C  3  272 ? 131.443 66.140  13.714  1.00 16.58  ? 272  LEU M CA  1 
ATOM   6970  C  C   . LEU C  3  272 ? 130.714 65.538  14.925  1.00 14.83  ? 272  LEU M C   1 
ATOM   6971  O  O   . LEU C  3  272 ? 130.798 64.350  15.197  1.00 15.74  ? 272  LEU M O   1 
ATOM   6972  C  CB  . LEU C  3  272 ? 132.643 66.965  14.157  1.00 12.30  ? 272  LEU M CB  1 
ATOM   6973  C  CG  . LEU C  3  272 ? 133.624 66.122  14.933  1.00 20.85  ? 272  LEU M CG  1 
ATOM   6974  C  CD1 . LEU C  3  272 ? 134.533 65.451  13.967  1.00 21.67  ? 272  LEU M CD1 1 
ATOM   6975  C  CD2 . LEU C  3  272 ? 134.394 66.963  15.891  1.00 17.78  ? 272  LEU M CD2 1 
ATOM   6976  N  N   . MET C  3  273 ? 129.952 66.356  15.632  1.00 17.64  ? 273  MET M N   1 
ATOM   6977  C  CA  . MET C  3  273 ? 129.377 65.924  16.900  1.00 18.66  ? 273  MET M CA  1 
ATOM   6978  C  C   . MET C  3  273 ? 128.266 64.897  16.743  1.00 20.06  ? 273  MET M C   1 
ATOM   6979  O  O   . MET C  3  273 ? 127.932 64.195  17.693  1.00 21.81  ? 273  MET M O   1 
ATOM   6980  C  CB  . MET C  3  273 ? 128.847 67.125  17.691  1.00 22.50  ? 273  MET M CB  1 
ATOM   6981  C  CG  . MET C  3  273 ? 129.904 67.983  18.383  1.00 14.17  ? 273  MET M CG  1 
ATOM   6982  S  SD  . MET C  3  273 ? 131.009 67.050  19.427  1.00 23.16  ? 273  MET M SD  1 
ATOM   6983  C  CE  . MET C  3  273 ? 129.984 66.790  20.870  1.00 15.47  ? 273  MET M CE  1 
ATOM   6984  N  N   . VAL C  3  274 ? 127.600 64.900  15.595  1.00 18.98  ? 274  VAL M N   1 
ATOM   6985  C  CA  . VAL C  3  274 ? 126.621 63.862  15.291  1.00 16.77  ? 274  VAL M CA  1 
ATOM   6986  C  C   . VAL C  3  274 ? 127.274 62.498  15.453  1.00 17.10  ? 274  VAL M C   1 
ATOM   6987  O  O   . VAL C  3  274 ? 126.790 61.649  16.190  1.00 18.84  ? 274  VAL M O   1 
ATOM   6988  C  CB  . VAL C  3  274 ? 126.118 63.985  13.845  1.00 17.79  ? 274  VAL M CB  1 
ATOM   6989  C  CG1 . VAL C  3  274 ? 125.099 62.916  13.561  1.00 20.14  ? 274  VAL M CG1 1 
ATOM   6990  C  CG2 . VAL C  3  274 ? 125.503 65.357  13.613  1.00 23.09  ? 274  VAL M CG2 1 
ATOM   6991  N  N   . MET C  3  275 ? 128.499 62.393  14.963  1.00 16.72  ? 275  MET M N   1 
ATOM   6992  C  CA  . MET C  3  275 ? 129.199 61.131  14.949  1.00 16.94  ? 275  MET M CA  1 
ATOM   6993  C  C   . MET C  3  275 ? 129.877 60.865  16.283  1.00 20.60  ? 275  MET M C   1 
ATOM   6994  O  O   . MET C  3  275 ? 129.707 59.802  16.868  1.00 21.49  ? 275  MET M O   1 
ATOM   6995  C  CB  . MET C  3  275 ? 130.197 61.152  13.812  1.00 13.04  ? 275  MET M CB  1 
ATOM   6996  C  CG  . MET C  3  275 ? 129.532 61.036  12.437  1.00 17.10  ? 275  MET M CG  1 
ATOM   6997  S  SD  . MET C  3  275 ? 128.870 59.398  12.129  1.00 22.86  ? 275  MET M SD  1 
ATOM   6998  C  CE  . MET C  3  275 ? 127.231 59.500  12.832  1.00 18.26  ? 275  MET M CE  1 
ATOM   6999  N  N   . VAL C  3  276 ? 130.378 61.938  16.881  1.00 20.67  ? 276  VAL M N   1 
ATOM   7000  C  CA  . VAL C  3  276 ? 131.022 61.876  18.187  1.00 18.52  ? 276  VAL M CA  1 
ATOM   7001  C  C   . VAL C  3  276 ? 130.015 61.507  19.300  1.00 18.96  ? 276  VAL M C   1 
ATOM   7002  O  O   . VAL C  3  276 ? 130.206 60.514  20.007  1.00 21.79  ? 276  VAL M O   1 
ATOM   7003  C  CB  . VAL C  3  276 ? 131.730 63.241  18.469  1.00 18.75  ? 276  VAL M CB  1 
ATOM   7004  C  CG1 . VAL C  3  276 ? 132.091 63.400  19.936  1.00 22.79  ? 276  VAL M CG1 1 
ATOM   7005  C  CG2 . VAL C  3  276 ? 132.958 63.342  17.626  1.00 15.92  ? 276  VAL M CG2 1 
ATOM   7006  N  N   . SER C  3  277 ? 128.887 62.212  19.365  1.00 13.49  ? 277  SER M N   1 
ATOM   7007  C  CA  . SER C  3  277 ? 127.903 61.968  20.405  1.00 15.03  ? 277  SER M CA  1 
ATOM   7008  C  C   . SER C  3  277 ? 127.417 60.551  20.278  1.00 17.32  ? 277  SER M C   1 
ATOM   7009  O  O   . SER C  3  277 ? 127.188 59.877  21.277  1.00 27.17  ? 277  SER M O   1 
ATOM   7010  C  CB  . SER C  3  277 ? 126.709 62.900  20.257  1.00 11.90  ? 277  SER M CB  1 
ATOM   7011  O  OG  . SER C  3  277 ? 127.086 64.257  20.365  1.00 13.19  ? 277  SER M OG  1 
ATOM   7012  N  N   . ALA C  3  278 ? 127.264 60.095  19.041  1.00 20.67  ? 278  ALA M N   1 
ATOM   7013  C  CA  . ALA C  3  278 ? 126.712 58.773  18.767  1.00 18.31  ? 278  ALA M CA  1 
ATOM   7014  C  C   . ALA C  3  278 ? 127.650 57.650  19.212  1.00 18.39  ? 278  ALA M C   1 
ATOM   7015  O  O   . ALA C  3  278 ? 127.201 56.660  19.796  1.00 21.26  ? 278  ALA M O   1 
ATOM   7016  C  CB  . ALA C  3  278 ? 126.396 58.641  17.283  1.00 15.86  ? 278  ALA M CB  1 
ATOM   7017  N  N   . SER C  3  279 ? 128.949 57.789  18.932  1.00 18.82  ? 279  SER M N   1 
ATOM   7018  C  CA  . SER C  3  279 ? 129.936 56.805  19.389  1.00 17.11  ? 279  SER M CA  1 
ATOM   7019  C  C   . SER C  3  279 ? 129.946 56.676  20.898  1.00 19.59  ? 279  SER M C   1 
ATOM   7020  O  O   . SER C  3  279 ? 129.995 55.564  21.418  1.00 22.44  ? 279  SER M O   1 
ATOM   7021  C  CB  . SER C  3  279 ? 131.324 57.200  18.936  1.00 21.24  ? 279  SER M CB  1 
ATOM   7022  O  OG  . SER C  3  279 ? 131.285 57.642  17.602  1.00 22.02  ? 279  SER M OG  1 
ATOM   7023  N  N   . VAL C  3  280 ? 129.888 57.808  21.604  1.00 16.76  ? 280  VAL M N   1 
ATOM   7024  C  CA  . VAL C  3  280 ? 129.883 57.792  23.059  1.00 14.99  ? 280  VAL M CA  1 
ATOM   7025  C  C   . VAL C  3  280 ? 128.688 56.985  23.556  1.00 16.83  ? 280  VAL M C   1 
ATOM   7026  O  O   . VAL C  3  280 ? 128.835 56.066  24.373  1.00 17.54  ? 280  VAL M O   1 
ATOM   7027  C  CB  . VAL C  3  280 ? 129.810 59.212  23.641  1.00 15.81  ? 280  VAL M CB  1 
ATOM   7028  C  CG1 . VAL C  3  280 ? 129.578 59.154  25.144  1.00 14.69  ? 280  VAL M CG1 1 
ATOM   7029  C  CG2 . VAL C  3  280 ? 131.092 59.944  23.351  1.00 15.92  ? 280  VAL M CG2 1 
ATOM   7030  N  N   . GLY C  3  281 ? 127.514 57.291  23.017  1.00 14.63  ? 281  GLY M N   1 
ATOM   7031  C  CA  . GLY C  3  281 ? 126.324 56.560  23.406  1.00 11.47  ? 281  GLY M CA  1 
ATOM   7032  C  C   . GLY C  3  281 ? 126.455 55.084  23.134  1.00 14.75  ? 281  GLY M C   1 
ATOM   7033  O  O   . GLY C  3  281 ? 125.982 54.275  23.921  1.00 13.69  ? 281  GLY M O   1 
ATOM   7034  N  N   . ILE C  3  282 ? 127.124 54.704  22.047  1.00 15.09  ? 282  ILE M N   1 
ATOM   7035  C  CA  . ILE C  3  282 ? 127.281 53.272  21.782  1.00 20.25  ? 282  ILE M CA  1 
ATOM   7036  C  C   . ILE C  3  282 ? 128.290 52.641  22.742  1.00 16.75  ? 282  ILE M C   1 
ATOM   7037  O  O   . ILE C  3  282 ? 128.090 51.530  23.204  1.00 21.96  ? 282  ILE M O   1 
ATOM   7038  C  CB  . ILE C  3  282 ? 127.681 52.964  20.291  1.00 23.06  ? 282  ILE M CB  1 
ATOM   7039  C  CG1 . ILE C  3  282 ? 126.497 53.253  19.370  1.00 19.59  ? 282  ILE M CG1 1 
ATOM   7040  C  CG2 . ILE C  3  282 ? 128.072 51.461  20.123  1.00 16.40  ? 282  ILE M CG2 1 
ATOM   7041  C  CD1 . ILE C  3  282 ? 125.275 52.389  19.669  1.00 23.25  ? 282  ILE M CD1 1 
ATOM   7042  N  N   . LEU C  3  283 ? 129.323 53.386  23.103  1.00 18.23  ? 283  LEU M N   1 
ATOM   7043  C  CA  . LEU C  3  283 ? 130.373 52.864  23.950  1.00 12.23  ? 283  LEU M CA  1 
ATOM   7044  C  C   . LEU C  3  283 ? 129.817 52.629  25.323  1.00 11.51  ? 283  LEU M C   1 
ATOM   7045  O  O   . LEU C  3  283 ? 130.148 51.659  25.964  1.00 17.66  ? 283  LEU M O   1 
ATOM   7046  C  CB  . LEU C  3  283 ? 131.501 53.860  24.025  1.00 11.24  ? 283  LEU M CB  1 
ATOM   7047  C  CG  . LEU C  3  283 ? 132.357 53.854  22.782  1.00 15.59  ? 283  LEU M CG  1 
ATOM   7048  C  CD1 . LEU C  3  283 ? 133.368 54.981  22.850  1.00 18.11  ? 283  LEU M CD1 1 
ATOM   7049  C  CD2 . LEU C  3  283 ? 133.039 52.506  22.681  1.00 17.78  ? 283  LEU M CD2 1 
ATOM   7050  N  N   . LEU C  3  284 ? 128.934 53.501  25.772  1.00 13.70  ? 284  LEU M N   1 
ATOM   7051  C  CA  . LEU C  3  284 ? 128.326 53.324  27.080  1.00 18.08  ? 284  LEU M CA  1 
ATOM   7052  C  C   . LEU C  3  284 ? 127.296 52.180  27.143  1.00 22.37  ? 284  LEU M C   1 
ATOM   7053  O  O   . LEU C  3  284 ? 127.043 51.626  28.218  1.00 26.60  ? 284  LEU M O   1 
ATOM   7054  C  CB  . LEU C  3  284 ? 127.658 54.622  27.504  1.00 15.48  ? 284  LEU M CB  1 
ATOM   7055  C  CG  . LEU C  3  284 ? 128.575 55.752  27.917  1.00 15.39  ? 284  LEU M CG  1 
ATOM   7056  C  CD1 . LEU C  3  284 ? 127.752 56.990  28.162  1.00 15.71  ? 284  LEU M CD1 1 
ATOM   7057  C  CD2 . LEU C  3  284 ? 129.288 55.339  29.169  1.00 16.37  ? 284  LEU M CD2 1 
ATOM   7058  N  N   . THR C  3  285 ? 126.664 51.876  26.009  1.00 23.28  ? 285  THR M N   1 
ATOM   7059  C  CA  . THR C  3  285 ? 125.512 50.967  25.959  1.00 19.98  ? 285  THR M CA  1 
ATOM   7060  C  C   . THR C  3  285 ? 125.980 49.530  26.098  1.00 19.70  ? 285  THR M C   1 
ATOM   7061  O  O   . THR C  3  285 ? 126.910 49.110  25.396  1.00 20.11  ? 285  THR M O   1 
ATOM   7062  C  CB  . THR C  3  285 ? 124.750 51.152  24.627  1.00 19.10  ? 285  THR M CB  1 
ATOM   7063  O  OG1 . THR C  3  285 ? 124.118 52.429  24.640  1.00 16.58  ? 285  THR M OG1 1 
ATOM   7064  C  CG2 . THR C  3  285 ? 123.694 50.103  24.440  1.00 14.04  ? 285  THR M CG2 1 
ATOM   7065  N  N   . GLY C  3  286 ? 125.404 48.812  27.061  1.00 17.49  ? 286  GLY M N   1 
ATOM   7066  C  CA  . GLY C  3  286 ? 125.783 47.420  27.303  1.00 19.35  ? 286  GLY M CA  1 
ATOM   7067  C  C   . GLY C  3  286 ? 126.974 47.261  28.243  1.00 20.97  ? 286  GLY M C   1 
ATOM   7068  O  O   . GLY C  3  286 ? 126.945 46.479  29.201  1.00 21.21  ? 286  GLY M O   1 
ATOM   7069  N  N   . THR C  3  287 ? 127.989 48.078  28.025  1.00 17.78  ? 287  THR M N   1 
ATOM   7070  C  CA  . THR C  3  287 ? 129.062 48.208  28.974  1.00 20.40  ? 287  THR M CA  1 
ATOM   7071  C  C   . THR C  3  287 ? 128.576 48.687  30.339  1.00 22.09  ? 287  THR M C   1 
ATOM   7072  O  O   . THR C  3  287 ? 128.833 48.037  31.349  1.00 23.77  ? 287  THR M O   1 
ATOM   7073  C  CB  . THR C  3  287 ? 130.076 49.180  28.452  1.00 19.88  ? 287  THR M CB  1 
ATOM   7074  O  OG1 . THR C  3  287 ? 130.127 49.075  27.032  1.00 22.03  ? 287  THR M OG1 1 
ATOM   7075  C  CG2 . THR C  3  287 ? 131.422 48.844  28.983  1.00 27.72  ? 287  THR M CG2 1 
ATOM   7076  N  N   . PHE C  3  288 ? 127.887 49.826  30.376  1.00 23.66  ? 288  PHE M N   1 
ATOM   7077  C  CA  . PHE C  3  288 ? 127.548 50.471  31.647  1.00 22.32  ? 288  PHE M CA  1 
ATOM   7078  C  C   . PHE C  3  288 ? 126.094 50.812  31.861  1.00 23.69  ? 288  PHE M C   1 
ATOM   7079  O  O   . PHE C  3  288 ? 125.761 51.407  32.883  1.00 22.81  ? 288  PHE M O   1 
ATOM   7080  C  CB  . PHE C  3  288 ? 128.330 51.756  31.812  1.00 25.03  ? 288  PHE M CB  1 
ATOM   7081  C  CG  . PHE C  3  288 ? 129.792 51.561  31.758  1.00 27.79  ? 288  PHE M CG  1 
ATOM   7082  C  CD1 . PHE C  3  288 ? 130.400 50.613  32.582  1.00 28.38  ? 288  PHE M CD1 1 
ATOM   7083  C  CD2 . PHE C  3  288 ? 130.552 52.236  30.816  1.00 26.54  ? 288  PHE M CD2 1 
ATOM   7084  C  CE1 . PHE C  3  288 ? 131.740 50.328  32.462  1.00 22.45  ? 288  PHE M CE1 1 
ATOM   7085  C  CE2 . PHE C  3  288 ? 131.899 51.978  30.685  1.00 24.23  ? 288  PHE M CE2 1 
ATOM   7086  C  CZ  . PHE C  3  288 ? 132.499 51.015  31.509  1.00 28.07  ? 288  PHE M CZ  1 
ATOM   7087  N  N   . VAL C  3  289 ? 125.296 50.715  30.806  1.00 19.36  ? 289  VAL M N   1 
ATOM   7088  C  CA  . VAL C  3  289 ? 123.860 50.902  30.945  1.00 19.16  ? 289  VAL M CA  1 
ATOM   7089  C  C   . VAL C  3  289 ? 123.186 49.753  30.211  1.00 22.43  ? 289  VAL M C   1 
ATOM   7090  O  O   . VAL C  3  289 ? 123.617 49.390  29.117  1.00 25.42  ? 289  VAL M O   1 
ATOM   7091  C  CB  . VAL C  3  289 ? 123.401 52.240  30.325  1.00 16.45  ? 289  VAL M CB  1 
ATOM   7092  C  CG1 . VAL C  3  289 ? 121.960 52.431  30.580  1.00 18.24  ? 289  VAL M CG1 1 
ATOM   7093  C  CG2 . VAL C  3  289 ? 124.178 53.401  30.905  1.00 10.70  ? 289  VAL M CG2 1 
ATOM   7094  N  N   . ASP C  3  290 ? 122.267 49.070  30.885  1.00 22.23  ? 290  ASP M N   1 
ATOM   7095  C  CA  . ASP C  3  290 ? 121.525 47.956  30.293  1.00 21.59  ? 290  ASP M CA  1 
ATOM   7096  C  C   . ASP C  3  290 ? 120.175 48.429  29.734  1.00 24.02  ? 290  ASP M C   1 
ATOM   7097  O  O   . ASP C  3  290 ? 119.723 47.956  28.706  1.00 24.75  ? 290  ASP M O   1 
ATOM   7098  C  CB  . ASP C  3  290 ? 121.283 46.876  31.350  1.00 23.22  ? 290  ASP M CB  1 
ATOM   7099  C  CG  . ASP C  3  290 ? 121.775 45.492  30.924  1.00 28.65  ? 290  ASP M CG  1 
ATOM   7100  O  OD1 . ASP C  3  290 ? 122.278 45.323  29.787  1.00 25.45  ? 290  ASP M OD1 1 
ATOM   7101  O  OD2 . ASP C  3  290 ? 121.667 44.564  31.754  1.00 26.01  ? 290  ASP M OD2 1 
ATOM   7102  N  N   . ASN C  3  291 ? 119.535 49.371  30.415  1.00 20.34  ? 291  ASN M N   1 
ATOM   7103  C  CA  . ASN C  3  291 ? 118.197 49.766  30.049  1.00 18.59  ? 291  ASN M CA  1 
ATOM   7104  C  C   . ASN C  3  291 ? 118.080 51.266  30.220  1.00 19.58  ? 291  ASN M C   1 
ATOM   7105  O  O   . ASN C  3  291 ? 118.018 51.761  31.340  1.00 19.97  ? 291  ASN M O   1 
ATOM   7106  C  CB  . ASN C  3  291 ? 117.184 49.064  30.939  1.00 18.83  ? 291  ASN M CB  1 
ATOM   7107  C  CG  . ASN C  3  291 ? 115.762 49.371  30.543  1.00 20.15  ? 291  ASN M CG  1 
ATOM   7108  O  OD1 . ASN C  3  291 ? 115.427 50.510  30.246  1.00 26.04  ? 291  ASN M OD1 1 
ATOM   7109  N  ND2 . ASN C  3  291 ? 114.911 48.363  30.553  1.00 16.06  ? 291  ASN M ND2 1 
ATOM   7110  N  N   . TRP C  3  292 ? 118.058 51.995  29.111  1.00 16.73  ? 292  TRP M N   1 
ATOM   7111  C  CA  . TRP C  3  292 ? 118.149 53.436  29.195  1.00 17.13  ? 292  TRP M CA  1 
ATOM   7112  C  C   . TRP C  3  292 ? 116.909 54.066  29.803  1.00 20.39  ? 292  TRP M C   1 
ATOM   7113  O  O   . TRP C  3  292 ? 117.026 54.991  30.607  1.00 22.59  ? 292  TRP M O   1 
ATOM   7114  C  CB  . TRP C  3  292 ? 118.427 54.039  27.825  1.00 15.58  ? 292  TRP M CB  1 
ATOM   7115  C  CG  . TRP C  3  292 ? 119.831 53.862  27.384  1.00 14.42  ? 292  TRP M CG  1 
ATOM   7116  C  CD1 . TRP C  3  292 ? 120.279 53.069  26.357  1.00 12.97  ? 292  TRP M CD1 1 
ATOM   7117  C  CD2 . TRP C  3  292 ? 120.973 54.583  27.862  1.00 9.51   ? 292  TRP M CD2 1 
ATOM   7118  N  NE1 . TRP C  3  292 ? 121.625 53.274  26.164  1.00 12.60  ? 292  TRP M NE1 1 
ATOM   7119  C  CE2 . TRP C  3  292 ? 122.073 54.196  27.074  1.00 10.89  ? 292  TRP M CE2 1 
ATOM   7120  C  CE3 . TRP C  3  292 ? 121.170 55.517  28.881  1.00 11.17  ? 292  TRP M CE3 1 
ATOM   7121  C  CZ2 . TRP C  3  292 ? 123.351 54.712  27.278  1.00 12.97  ? 292  TRP M CZ2 1 
ATOM   7122  C  CZ3 . TRP C  3  292 ? 122.435 56.021  29.086  1.00 11.54  ? 292  TRP M CZ3 1 
ATOM   7123  C  CH2 . TRP C  3  292 ? 123.509 55.620  28.294  1.00 9.08   ? 292  TRP M CH2 1 
ATOM   7124  N  N   . TYR C  3  293 ? 115.726 53.528  29.507  1.00 21.35  ? 293  TYR M N   1 
ATOM   7125  C  CA  . TYR C  3  293 ? 114.527 54.062  30.150  1.00 20.74  ? 293  TYR M CA  1 
ATOM   7126  C  C   . TYR C  3  293 ? 114.688 53.978  31.673  1.00 19.65  ? 293  TYR M C   1 
ATOM   7127  O  O   . TYR C  3  293 ? 114.558 54.991  32.361  1.00 20.34  ? 293  TYR M O   1 
ATOM   7128  C  CB  . TYR C  3  293 ? 113.261 53.322  29.692  1.00 18.40  ? 293  TYR M CB  1 
ATOM   7129  C  CG  . TYR C  3  293 ? 112.011 53.688  30.484  1.00 12.07  ? 293  TYR M CG  1 
ATOM   7130  C  CD1 . TYR C  3  293 ? 111.387 54.925  30.342  1.00 11.63  ? 293  TYR M CD1 1 
ATOM   7131  C  CD2 . TYR C  3  293 ? 111.483 52.799  31.402  1.00 18.48  ? 293  TYR M CD2 1 
ATOM   7132  C  CE1 . TYR C  3  293 ? 110.269 55.268  31.106  1.00 14.84  ? 293  TYR M CE1 1 
ATOM   7133  C  CE2 . TYR C  3  293 ? 110.377 53.121  32.177  1.00 19.03  ? 293  TYR M CE2 1 
ATOM   7134  C  CZ  . TYR C  3  293 ? 109.769 54.352  32.037  1.00 23.76  ? 293  TYR M CZ  1 
ATOM   7135  O  OH  . TYR C  3  293 ? 108.683 54.633  32.869  1.00 29.88  ? 293  TYR M OH  1 
ATOM   7136  N  N   . LEU C  3  294 ? 115.168 52.837  32.163  1.00 17.16  ? 294  LEU M N   1 
ATOM   7137  C  CA  . LEU C  3  294 ? 115.287 52.605  33.606  1.00 14.46  ? 294  LEU M CA  1 
ATOM   7138  C  C   . LEU C  3  294 ? 116.415 53.426  34.194  1.00 17.77  ? 294  LEU M C   1 
ATOM   7139  O  O   . LEU C  3  294 ? 116.303 53.913  35.304  1.00 21.60  ? 294  LEU M O   1 
ATOM   7140  C  CB  . LEU C  3  294 ? 115.526 51.126  33.901  1.00 17.97  ? 294  LEU M CB  1 
ATOM   7141  C  CG  . LEU C  3  294 ? 114.255 50.282  33.795  1.00 17.11  ? 294  LEU M CG  1 
ATOM   7142  C  CD1 . LEU C  3  294 ? 114.511 48.848  34.114  1.00 18.92  ? 294  LEU M CD1 1 
ATOM   7143  C  CD2 . LEU C  3  294 ? 113.248 50.838  34.759  1.00 19.37  ? 294  LEU M CD2 1 
ATOM   7144  N  N   . TRP C  3  295 ? 117.485 53.621  33.434  1.00 16.04  ? 295  TRP M N   1 
ATOM   7145  C  CA  . TRP C  3  295 ? 118.527 54.542  33.840  1.00 16.05  ? 295  TRP M CA  1 
ATOM   7146  C  C   . TRP C  3  295 ? 117.921 55.921  34.029  1.00 19.83  ? 295  TRP M C   1 
ATOM   7147  O  O   . TRP C  3  295 ? 118.221 56.597  35.005  1.00 23.03  ? 295  TRP M O   1 
ATOM   7148  C  CB  . TRP C  3  295 ? 119.620 54.602  32.777  1.00 16.79  ? 295  TRP M CB  1 
ATOM   7149  C  CG  . TRP C  3  295 ? 120.781 55.524  33.111  1.00 20.54  ? 295  TRP M CG  1 
ATOM   7150  C  CD1 . TRP C  3  295 ? 121.871 55.217  33.876  1.00 18.56  ? 295  TRP M CD1 1 
ATOM   7151  C  CD2 . TRP C  3  295 ? 120.990 56.872  32.643  1.00 21.57  ? 295  TRP M CD2 1 
ATOM   7152  N  NE1 . TRP C  3  295 ? 122.742 56.280  33.911  1.00 23.36  ? 295  TRP M NE1 1 
ATOM   7153  C  CE2 . TRP C  3  295 ? 122.232 57.307  33.162  1.00 20.59  ? 295  TRP M CE2 1 
ATOM   7154  C  CE3 . TRP C  3  295 ? 120.249 57.752  31.851  1.00 22.15  ? 295  TRP M CE3 1 
ATOM   7155  C  CZ2 . TRP C  3  295 ? 122.746 58.579  32.908  1.00 22.87  ? 295  TRP M CZ2 1 
ATOM   7156  C  CZ3 . TRP C  3  295 ? 120.765 59.023  31.600  1.00 18.76  ? 295  TRP M CZ3 1 
ATOM   7157  C  CH2 . TRP C  3  295 ? 121.997 59.422  32.125  1.00 19.06  ? 295  TRP M CH2 1 
ATOM   7158  N  N   . CYS C  3  296 ? 117.109 56.366  33.076  1.00 19.45  ? 296  CYS M N   1 
ATOM   7159  C  CA  . CYS C  3  296 ? 116.479 57.675  33.178  1.00 20.74  ? 296  CYS M CA  1 
ATOM   7160  C  C   . CYS C  3  296 ? 115.531 57.769  34.358  1.00 21.58  ? 296  CYS M C   1 
ATOM   7161  O  O   . CYS C  3  296 ? 115.471 58.807  35.020  1.00 24.12  ? 296  CYS M O   1 
ATOM   7162  C  CB  . CYS C  3  296 ? 115.711 58.012  31.907  1.00 20.55  ? 296  CYS M CB  1 
ATOM   7163  S  SG  . CYS C  3  296 ? 116.784 58.746  30.677  1.00 29.80  ? 296  CYS M SG  1 
ATOM   7164  N  N   . VAL C  3  297 ? 114.653 56.778  34.470  1.00 20.41  ? 297  VAL M N   1 
ATOM   7165  C  CA  . VAL C  3  297 ? 113.801 56.599  35.640  1.00 18.61  ? 297  VAL M CA  1 
ATOM   7166  C  C   . VAL C  3  297 ? 114.630 56.636  36.919  1.00 20.76  ? 297  VAL M C   1 
ATOM   7167  O  O   . VAL C  3  297 ? 114.258 57.295  37.887  1.00 23.63  ? 297  VAL M O   1 
ATOM   7168  C  CB  . VAL C  3  297 ? 113.085 55.254  35.586  1.00 14.15  ? 297  VAL M CB  1 
ATOM   7169  C  CG1 . VAL C  3  297 ? 112.312 54.998  36.873  1.00 11.46  ? 297  VAL M CG1 1 
ATOM   7170  C  CG2 . VAL C  3  297 ? 112.183 55.216  34.403  1.00 15.91  ? 297  VAL M CG2 1 
ATOM   7171  N  N   . LYS C  3  298 ? 115.779 55.974  36.904  1.00 24.53  ? 298  LYS M N   1 
ATOM   7172  C  CA  . LYS C  3  298 ? 116.661 55.966  38.065  1.00 27.20  ? 298  LYS M CA  1 
ATOM   7173  C  C   . LYS C  3  298 ? 117.047 57.400  38.421  1.00 31.18  ? 298  LYS M C   1 
ATOM   7174  O  O   . LYS C  3  298 ? 117.045 57.779  39.593  1.00 39.18  ? 298  LYS M O   1 
ATOM   7175  C  CB  . LYS C  3  298 ? 117.911 55.113  37.788  1.00 22.87  ? 298  LYS M CB  1 
ATOM   7176  C  CG  . LYS C  3  298 ? 118.982 55.183  38.876  1.00 27.16  ? 298  LYS M CG  1 
ATOM   7177  C  CD  . LYS C  3  298 ? 120.032 54.074  38.741  1.00 32.41  ? 298  LYS M CD  1 
ATOM   7178  C  CE  . LYS C  3  298 ? 121.385 54.523  39.323  1.00 36.02  ? 298  LYS M CE  1 
ATOM   7179  N  NZ  . LYS C  3  298 ? 122.479 53.558  39.021  0.00 35.10  ? 298  LYS M NZ  1 
ATOM   7180  N  N   . HIS C  3  299 ? 117.285 58.230  37.413  1.00 32.97  ? 299  HIS M N   1 
ATOM   7181  C  CA  . HIS C  3  299 ? 117.873 59.534  37.670  1.00 32.63  ? 299  HIS M CA  1 
ATOM   7182  C  C   . HIS C  3  299 ? 116.866 60.673  37.638  1.00 33.28  ? 299  HIS M C   1 
ATOM   7183  O  O   . HIS C  3  299 ? 117.253 61.826  37.736  1.00 36.95  ? 299  HIS M O   1 
ATOM   7184  C  CB  . HIS C  3  299 ? 119.027 59.791  36.694  1.00 31.51  ? 299  HIS M CB  1 
ATOM   7185  C  CG  . HIS C  3  299 ? 120.250 58.974  36.980  1.00 30.85  ? 299  HIS M CG  1 
ATOM   7186  N  ND1 . HIS C  3  299 ? 121.027 59.157  38.107  1.00 37.83  ? 299  HIS M ND1 1 
ATOM   7187  C  CD2 . HIS C  3  299 ? 120.847 57.985  36.276  1.00 30.05  ? 299  HIS M CD2 1 
ATOM   7188  C  CE1 . HIS C  3  299 ? 122.058 58.328  38.075  1.00 32.34  ? 299  HIS M CE1 1 
ATOM   7189  N  NE2 . HIS C  3  299 ? 121.970 57.605  36.975  1.00 32.36  ? 299  HIS M NE2 1 
ATOM   7190  N  N   . GLY C  3  300 ? 115.577 60.350  37.565  1.00 35.35  ? 300  GLY M N   1 
ATOM   7191  C  CA  . GLY C  3  300 ? 114.542 61.367  37.710  1.00 35.27  ? 300  GLY M CA  1 
ATOM   7192  C  C   . GLY C  3  300 ? 114.020 62.057  36.454  1.00 38.31  ? 300  GLY M C   1 
ATOM   7193  O  O   . GLY C  3  300 ? 113.069 62.838  36.518  1.00 41.22  ? 300  GLY M O   1 
ATOM   7194  N  N   . ALA C  3  301 ? 114.558 61.712  35.293  1.00 38.11  ? 301  ALA M N   1 
ATOM   7195  C  CA  . ALA C  3  301 ? 114.196 62.431  34.087  1.00 36.91  ? 301  ALA M CA  1 
ATOM   7196  C  C   . ALA C  3  301 ? 112.873 61.968  33.448  1.00 38.27  ? 301  ALA M C   1 
ATOM   7197  O  O   . ALA C  3  301 ? 112.117 62.806  32.943  1.00 43.88  ? 301  ALA M O   1 
ATOM   7198  C  CB  . ALA C  3  301 ? 115.333 62.352  33.090  1.00 38.61  ? 301  ALA M CB  1 
ATOM   7199  N  N   . ALA C  3  302 ? 112.559 60.670  33.527  1.00 30.44  ? 302  ALA M N   1 
ATOM   7200  C  CA  . ALA C  3  302 ? 111.468 60.079  32.726  1.00 27.65  ? 302  ALA M CA  1 
ATOM   7201  C  C   . ALA C  3  302 ? 110.077 60.663  32.974  1.00 25.25  ? 302  ALA M C   1 
ATOM   7202  O  O   . ALA C  3  302 ? 109.623 60.739  34.113  1.00 27.41  ? 302  ALA M O   1 
ATOM   7203  C  CB  . ALA C  3  302 ? 111.419 58.579  32.920  1.00 19.82  ? 302  ALA M CB  1 
ATOM   7204  N  N   . PRO C  3  303 ? 109.320 60.933  31.896  1.00 26.75  ? 303  PRO M N   1 
ATOM   7205  C  CA  . PRO C  3  303 ? 107.916 61.321  32.056  1.00 24.96  ? 303  PRO M CA  1 
ATOM   7206  C  C   . PRO C  3  303 ? 107.043 60.140  32.458  1.00 28.08  ? 303  PRO M C   1 
ATOM   7207  O  O   . PRO C  3  303 ? 107.447 58.979  32.288  1.00 31.11  ? 303  PRO M O   1 
ATOM   7208  C  CB  . PRO C  3  303 ? 107.547 61.869  30.688  1.00 25.41  ? 303  PRO M CB  1 
ATOM   7209  C  CG  . PRO C  3  303 ? 108.464 61.161  29.754  1.00 28.12  ? 303  PRO M CG  1 
ATOM   7210  C  CD  . PRO C  3  303 ? 109.741 60.986  30.485  1.00 26.98  ? 303  PRO M CD  1 
ATOM   7211  N  N   . ASP C  3  304 ? 105.889 60.435  33.063  1.00 28.79  ? 304  ASP M N   1 
ATOM   7212  C  CA  . ASP C  3  304 ? 104.931 59.403  33.453  1.00 28.83  ? 304  ASP M CA  1 
ATOM   7213  C  C   . ASP C  3  304 ? 103.518 59.901  33.237  1.00 29.16  ? 304  ASP M C   1 
ATOM   7214  O  O   . ASP C  3  304 ? 103.287 61.108  33.210  1.00 32.87  ? 304  ASP M O   1 
ATOM   7215  C  CB  . ASP C  3  304 ? 105.123 59.004  34.919  1.00 34.47  ? 304  ASP M CB  1 
ATOM   7216  C  CG  . ASP C  3  304 ? 104.319 57.752  35.314  1.00 37.71  ? 304  ASP M CG  1 
ATOM   7217  O  OD1 . ASP C  3  304 ? 104.195 56.796  34.519  1.00 42.40  ? 304  ASP M OD1 1 
ATOM   7218  O  OD2 . ASP C  3  304 ? 103.864 57.698  36.468  1.00 41.10  ? 304  ASP M OD2 1 
ATOM   7219  N  N   . TYR C  3  305 ? 102.604 58.963  32.992  1.00 26.44  ? 305  TYR M N   1 
ATOM   7220  C  CA  . TYR C  3  305 ? 101.261 59.270  32.519  1.00 24.75  ? 305  TYR M CA  1 
ATOM   7221  C  C   . TYR C  3  305 ? 100.249 58.453  33.310  1.00 25.16  ? 305  TYR M C   1 
ATOM   7222  O  O   . TYR C  3  305 ? 100.481 57.281  33.612  1.00 26.85  ? 305  TYR M O   1 
ATOM   7223  C  CB  . TYR C  3  305 ? 101.113 58.928  31.024  1.00 25.53  ? 305  TYR M CB  1 
ATOM   7224  C  CG  . TYR C  3  305 ? 102.253 59.389  30.147  1.00 16.11  ? 305  TYR M CG  1 
ATOM   7225  C  CD1 . TYR C  3  305 ? 102.383 60.726  29.799  1.00 14.41  ? 305  TYR M CD1 1 
ATOM   7226  C  CD2 . TYR C  3  305 ? 103.260 58.511  29.769  1.00 14.67  ? 305  TYR M CD2 1 
ATOM   7227  C  CE1 . TYR C  3  305 ? 103.480 61.174  29.103  1.00 13.56  ? 305  TYR M CE1 1 
ATOM   7228  C  CE2 . TYR C  3  305 ? 104.369 58.955  29.080  1.00 14.99  ? 305  TYR M CE2 1 
ATOM   7229  C  CZ  . TYR C  3  305 ? 104.463 60.289  28.743  1.00 13.32  ? 305  TYR M CZ  1 
ATOM   7230  O  OH  . TYR C  3  305 ? 105.494 60.739  27.974  1.00 14.60  ? 305  TYR M OH  1 
ATOM   7231  N  N   . PRO C  3  306 ? 99.071  59.029  33.556  1.00 23.23  ? 306  PRO M N   1 
ATOM   7232  C  CA  . PRO C  3  306 ? 97.876  58.311  34.014  1.00 20.72  ? 306  PRO M CA  1 
ATOM   7233  C  C   . PRO C  3  306 ? 97.584  57.054  33.224  1.00 21.91  ? 306  PRO M C   1 
ATOM   7234  O  O   . PRO C  3  306 ? 97.826  56.972  32.021  1.00 23.63  ? 306  PRO M O   1 
ATOM   7235  C  CB  . PRO C  3  306 ? 96.759  59.316  33.815  1.00 22.90  ? 306  PRO M CB  1 
ATOM   7236  C  CG  . PRO C  3  306 ? 97.441  60.635  33.764  1.00 21.60  ? 306  PRO M CG  1 
ATOM   7237  C  CD  . PRO C  3  306 ? 98.729  60.371  33.069  1.00 24.56  ? 306  PRO M CD  1 
ATOM   7238  N  N   . ALA C  3  307 ? 97.011  56.080  33.903  1.00 27.39  ? 307  ALA M N   1 
ATOM   7239  C  CA  . ALA C  3  307 ? 96.455  54.945  33.210  1.00 31.75  ? 307  ALA M CA  1 
ATOM   7240  C  C   . ALA C  3  307 ? 95.331  55.520  32.380  1.00 33.15  ? 307  ALA M C   1 
ATOM   7241  O  O   . ALA C  3  307 ? 94.755  56.552  32.746  1.00 38.78  ? 307  ALA M O   1 
ATOM   7242  C  CB  . ALA C  3  307 ? 95.918  53.956  34.204  1.00 36.47  ? 307  ALA M CB  1 
ATOM   7243  N  N   . TYR C  3  308 ? 95.119  54.965  31.200  1.00 31.76  ? 308  TYR M N   1 
ATOM   7244  C  CA  . TYR C  3  308 ? 93.951  55.335  30.433  1.00 30.96  ? 308  TYR M CA  1 
ATOM   7245  C  C   . TYR C  3  308 ? 93.028  54.135  30.328  1.00 34.22  ? 308  TYR M C   1 
ATOM   7246  O  O   . TYR C  3  308 ? 91.908  54.175  30.818  1.00 36.97  ? 308  TYR M O   1 
ATOM   7247  C  CB  . TYR C  3  308 ? 94.348  55.829  29.054  1.00 31.00  ? 308  TYR M CB  1 
ATOM   7248  C  CG  . TYR C  3  308 ? 93.159  56.128  28.185  1.00 29.31  ? 308  TYR M CG  1 
ATOM   7249  C  CD1 . TYR C  3  308 ? 92.573  57.383  28.186  1.00 25.35  ? 308  TYR M CD1 1 
ATOM   7250  C  CD2 . TYR C  3  308 ? 92.613  55.150  27.363  1.00 28.97  ? 308  TYR M CD2 1 
ATOM   7251  C  CE1 . TYR C  3  308 ? 91.468  57.663  27.382  1.00 25.99  ? 308  TYR M CE1 1 
ATOM   7252  C  CE2 . TYR C  3  308 ? 91.507  55.421  26.559  1.00 30.99  ? 308  TYR M CE2 1 
ATOM   7253  C  CZ  . TYR C  3  308 ? 90.938  56.681  26.574  1.00 27.60  ? 308  TYR M CZ  1 
ATOM   7254  O  OH  . TYR C  3  308 ? 89.848  56.949  25.772  1.00 32.02  ? 308  TYR M OH  1 
ATOM   7255  N  N   . LEU C  3  309 ? 93.472  53.070  29.670  1.00 36.20  ? 309  LEU M N   1 
ATOM   7256  C  CA  . LEU C  3  309 ? 92.914  51.757  29.977  1.00 32.07  ? 309  LEU M CA  1 
ATOM   7257  C  C   . LEU C  3  309 ? 93.473  51.369  31.340  1.00 33.67  ? 309  LEU M C   1 
ATOM   7258  O  O   . LEU C  3  309 ? 94.562  51.825  31.740  1.00 36.60  ? 309  LEU M O   1 
ATOM   7259  C  CB  . LEU C  3  309 ? 93.331  50.715  28.944  1.00 26.73  ? 309  LEU M CB  1 
ATOM   7260  C  CG  . LEU C  3  309 ? 92.784  50.934  27.543  1.00 24.44  ? 309  LEU M CG  1 
ATOM   7261  C  CD1 . LEU C  3  309 ? 92.936  49.652  26.694  1.00 14.83  ? 309  LEU M CD1 1 
ATOM   7262  C  CD2 . LEU C  3  309 ? 91.345  51.363  27.655  1.00 17.41  ? 309  LEU M CD2 1 
ATOM   7263  N  N   . PRO C  3  310 ? 92.743  50.518  32.076  1.00 32.30  ? 310  PRO M N   1 
ATOM   7264  C  CA  . PRO C  3  310 ? 93.145  50.055  33.407  1.00 31.31  ? 310  PRO M CA  1 
ATOM   7265  C  C   . PRO C  3  310 ? 94.560  49.487  33.463  1.00 32.44  ? 310  PRO M C   1 
ATOM   7266  O  O   . PRO C  3  310 ? 95.014  48.779  32.546  1.00 35.26  ? 310  PRO M O   1 
ATOM   7267  C  CB  . PRO C  3  310 ? 92.106  48.993  33.744  1.00 29.20  ? 310  PRO M CB  1 
ATOM   7268  C  CG  . PRO C  3  310 ? 90.925  49.347  32.894  1.00 31.71  ? 310  PRO M CG  1 
ATOM   7269  C  CD  . PRO C  3  310 ? 91.497  49.876  31.630  1.00 32.05  ? 310  PRO M CD  1 
ATOM   7270  N  N   . ALA C  3  311 ? 95.247  49.806  34.549  1.00 30.62  ? 311  ALA M N   1 
ATOM   7271  C  CA  . ALA C  3  311 ? 96.595  49.329  34.757  1.00 29.89  ? 311  ALA M CA  1 
ATOM   7272  C  C   . ALA C  3  311 ? 96.602  47.809  34.799  1.00 27.64  ? 311  ALA M C   1 
ATOM   7273  O  O   . ALA C  3  311 ? 95.707  47.193  35.359  1.00 30.30  ? 311  ALA M O   1 
ATOM   7274  C  CB  . ALA C  3  311 ? 97.143  49.897  36.029  1.00 28.71  ? 311  ALA M CB  1 
ATOM   7275  N  N   . THR C  3  312 ? 97.580  47.214  34.137  1.00 25.09  ? 312  THR M N   1 
ATOM   7276  C  CA  . THR C  3  312 ? 97.591  45.790  33.928  1.00 20.46  ? 312  THR M CA  1 
ATOM   7277  C  C   . THR C  3  312 ? 98.808  45.162  34.589  1.00 21.58  ? 312  THR M C   1 
ATOM   7278  O  O   . THR C  3  312 ? 99.929  45.229  34.094  1.00 22.28  ? 312  THR M O   1 
ATOM   7279  C  CB  . THR C  3  312 ? 97.557  45.500  32.436  1.00 16.93  ? 312  THR M CB  1 
ATOM   7280  O  OG1 . THR C  3  312 ? 96.301  45.950  31.918  1.00 21.71  ? 312  THR M OG1 1 
ATOM   7281  C  CG2 . THR C  3  312 ? 97.753  44.027  32.151  1.00 12.67  ? 312  THR M CG2 1 
ATOM   7282  N  N   . PRO C  3  313 ? 98.594  44.539  35.739  1.00 20.44  ? 313  PRO M N   1 
ATOM   7283  C  CA  . PRO C  3  313 ? 99.596  43.724  36.418  1.00 21.29  ? 313  PRO M CA  1 
ATOM   7284  C  C   . PRO C  3  313 ? 100.160 42.711  35.478  1.00 22.89  ? 313  PRO M C   1 
ATOM   7285  O  O   . PRO C  3  313 ? 99.435  42.141  34.660  1.00 26.63  ? 313  PRO M O   1 
ATOM   7286  C  CB  . PRO C  3  313 ? 98.800  43.033  37.511  1.00 24.47  ? 313  PRO M CB  1 
ATOM   7287  C  CG  . PRO C  3  313 ? 97.624  43.931  37.729  1.00 22.28  ? 313  PRO M CG  1 
ATOM   7288  C  CD  . PRO C  3  313 ? 97.278  44.422  36.378  1.00 22.26  ? 313  PRO M CD  1 
ATOM   7289  N  N   . ASP C  3  314 ? 101.433 42.417  35.677  1.00 24.87  ? 314  ASP M N   1 
ATOM   7290  C  CA  . ASP C  3  314 ? 102.102 41.303  35.014  1.00 28.25  ? 314  ASP M CA  1 
ATOM   7291  C  C   . ASP C  3  314 ? 101.434 39.975  35.426  1.00 31.63  ? 314  ASP M C   1 
ATOM   7292  O  O   . ASP C  3  314 ? 101.393 39.621  36.607  1.00 32.28  ? 314  ASP M O   1 
ATOM   7293  C  CB  . ASP C  3  314 ? 103.579 41.321  35.422  1.00 27.80  ? 314  ASP M CB  1 
ATOM   7294  C  CG  . ASP C  3  314 ? 104.444 40.363  34.620  1.00 30.25  ? 314  ASP M CG  1 
ATOM   7295  O  OD1 . ASP C  3  314 ? 103.910 39.485  33.924  1.00 32.07  ? 314  ASP M OD1 1 
ATOM   7296  O  OD2 . ASP C  3  314 ? 105.687 40.440  34.764  1.00 33.41  ? 314  ASP M OD2 1 
ATOM   7297  N  N   . PRO C  3  315 ? 100.903 39.217  34.452  1.00 31.89  ? 315  PRO M N   1 
ATOM   7298  C  CA  . PRO C  3  315 ? 100.200 37.993  34.831  1.00 28.85  ? 315  PRO M CA  1 
ATOM   7299  C  C   . PRO C  3  315 ? 101.190 37.036  35.431  1.00 31.75  ? 315  PRO M C   1 
ATOM   7300  O  O   . PRO C  3  315 ? 100.886 36.308  36.363  1.00 31.43  ? 315  PRO M O   1 
ATOM   7301  C  CB  . PRO C  3  315 ? 99.680  37.453  33.508  1.00 32.75  ? 315  PRO M CB  1 
ATOM   7302  C  CG  . PRO C  3  315 ? 99.863  38.557  32.521  1.00 34.63  ? 315  PRO M CG  1 
ATOM   7303  C  CD  . PRO C  3  315 ? 101.017 39.346  32.992  1.00 30.13  ? 315  PRO M CD  1 
ATOM   7304  N  N   . ALA C  3  316 ? 102.401 37.077  34.899  1.00 33.69  ? 316  ALA M N   1 
ATOM   7305  C  CA  . ALA C  3  316 ? 103.416 36.109  35.237  1.00 37.34  ? 316  ALA M CA  1 
ATOM   7306  C  C   . ALA C  3  316 ? 103.727 36.126  36.723  1.00 40.69  ? 316  ALA M C   1 
ATOM   7307  O  O   . ALA C  3  316 ? 104.254 35.151  37.248  1.00 42.56  ? 316  ALA M O   1 
ATOM   7308  C  CB  . ALA C  3  316 ? 104.671 36.382  34.429  1.00 39.48  ? 316  ALA M CB  1 
ATOM   7309  N  N   . SER C  3  317 ? 103.385 37.222  37.398  1.00 44.51  ? 317  SER M N   1 
ATOM   7310  C  CA  . SER C  3  317 ? 103.725 37.401  38.810  1.00 48.89  ? 317  SER M CA  1 
ATOM   7311  C  C   . SER C  3  317 ? 102.557 37.112  39.747  1.00 51.49  ? 317  SER M C   1 
ATOM   7312  O  O   . SER C  3  317 ? 102.724 37.080  40.967  1.00 54.97  ? 317  SER M O   1 
ATOM   7313  C  CB  . SER C  3  317 ? 104.242 38.822  39.064  1.00 48.60  ? 317  SER M CB  1 
ATOM   7314  O  OG  . SER C  3  317 ? 103.174 39.748  39.247  1.00 52.27  ? 317  SER M OG  1 
ATOM   7315  N  N   . LEU C  3  318 ? 101.361 36.982  39.190  1.00 53.78  ? 318  LEU M N   1 
ATOM   7316  C  CA  . LEU C  3  318 ? 100.238 36.500  39.965  1.00 55.18  ? 318  LEU M CA  1 
ATOM   7317  C  C   . LEU C  3  318 ? 100.465 35.173  40.616  1.00 60.80  ? 318  LEU M C   1 
ATOM   7318  O  O   . LEU C  3  318 ? 101.398 34.439  40.235  1.00 60.82  ? 318  LEU M O   1 
ATOM   7319  C  CB  . LEU C  3  318 ? 99.009  36.370  39.082  1.00 53.42  ? 318  LEU M CB  1 
ATOM   7320  C  CG  . LEU C  3  318 ? 98.559  37.656  38.387  1.00 53.76  ? 318  LEU M CG  1 
ATOM   7321  C  CD1 . LEU C  3  318 ? 97.221  37.457  37.696  1.00 51.85  ? 318  LEU M CD1 1 
ATOM   7322  C  CD2 . LEU C  3  318 ? 98.484  38.805  39.383  1.00 52.28  ? 318  LEU M CD2 1 
ATOM   7323  N  N   . PRO C  3  319 ? 99.565  35.046  41.542  1.00 66.65  ? 319  PRO M N   1 
ATOM   7324  C  CA  . PRO C  3  319 ? 99.325  33.848  42.307  1.00 69.08  ? 319  PRO M CA  1 
ATOM   7325  C  C   . PRO C  3  319 ? 99.078  32.702  41.317  1.00 70.76  ? 319  PRO M C   1 
ATOM   7326  O  O   . PRO C  3  319 ? 97.986  32.568  40.747  1.00 70.21  ? 319  PRO M O   1 
ATOM   7327  C  CB  . PRO C  3  319 ? 98.117  34.261  43.161  1.00 71.50  ? 319  PRO M CB  1 
ATOM   7328  C  CG  . PRO C  3  319 ? 98.199  35.760  43.220  1.00 72.13  ? 319  PRO M CG  1 
ATOM   7329  C  CD  . PRO C  3  319 ? 98.705  36.161  41.900  1.00 70.24  ? 319  PRO M CD  1 
ATOM   7330  N  N   . GLY C  3  320 ? 100.072 31.825  41.200  1.00 70.96  ? 320  GLY M N   1 
ATOM   7331  C  CA  . GLY C  3  320 ? 99.896  30.602  40.442  1.00 70.54  ? 320  GLY M CA  1 
ATOM   7332  C  C   . GLY C  3  320 ? 99.608  30.855  38.977  1.00 71.42  ? 320  GLY M C   1 
ATOM   7333  O  O   . GLY C  3  320 ? 98.640  30.315  38.425  1.00 75.28  ? 320  GLY M O   1 
ATOM   7334  N  N   . ALA C  3  321 ? 100.350 31.794  38.395  1.00 68.05  ? 321  ALA M N   1 
ATOM   7335  C  CA  . ALA C  3  321 ? 100.429 31.910  36.947  1.00 62.31  ? 321  ALA M CA  1 
ATOM   7336  C  C   . ALA C  3  321 ? 101.392 30.820  36.534  1.00 58.25  ? 321  ALA M C   1 
ATOM   7337  O  O   . ALA C  3  321 ? 102.269 30.443  37.305  1.00 59.25  ? 321  ALA M O   1 
ATOM   7338  C  CB  . ALA C  3  321 ? 100.972 33.274  36.550  1.00 61.11  ? 321  ALA M CB  1 
ATOM   7339  N  N   . PRO C  3  322 ? 101.177 30.217  35.363  1.00 54.45  ? 322  PRO M N   1 
ATOM   7340  C  CA  . PRO C  3  322 ? 102.240 29.435  34.739  1.00 54.64  ? 322  PRO M CA  1 
ATOM   7341  C  C   . PRO C  3  322 ? 103.504 30.258  34.539  1.00 54.99  ? 322  PRO M C   1 
ATOM   7342  O  O   . PRO C  3  322 ? 103.584 31.416  34.963  1.00 53.30  ? 322  PRO M O   1 
ATOM   7343  C  CB  . PRO C  3  322 ? 101.626 29.006  33.408  1.00 54.54  ? 322  PRO M CB  1 
ATOM   7344  C  CG  . PRO C  3  322 ? 100.184 28.939  33.689  1.00 55.06  ? 322  PRO M CG  1 
ATOM   7345  C  CD  . PRO C  3  322 ? 99.902  30.065  34.651  1.00 55.11  ? 322  PRO M CD  1 
ATOM   7346  N  N   . LYS C  3  323 ? 104.452 29.677  33.819  1.00 58.17  ? 323  LYS M N   1 
ATOM   7347  C  CA  . LYS C  3  323 ? 105.741 30.309  33.600  1.00 62.58  ? 323  LYS M CA  1 
ATOM   7348  C  C   . LYS C  3  323 ? 105.849 30.818  32.162  1.00 64.92  ? 323  LYS M C   1 
ATOM   7349  O  O   . LYS C  3  323 ? 105.032 30.363  31.324  1.00 67.80  ? 323  LYS M O   1 
ATOM   7350  C  CB  . LYS C  3  323 ? 106.865 29.305  33.892  1.00 62.28  ? 323  LYS M CB  1 
ATOM   7351  C  CG  . LYS C  3  323 ? 108.184 29.950  34.300  0.00 62.46  ? 323  LYS M CG  1 
ATOM   7352  C  CD  . LYS C  3  323 ? 108.058 30.691  35.626  0.00 62.51  ? 323  LYS M CD  1 
ATOM   7353  C  CE  . LYS C  3  323 ? 108.495 32.145  35.503  0.00 62.58  ? 323  LYS M CE  1 
ATOM   7354  N  NZ  . LYS C  3  323 ? 107.539 32.956  34.695  0.00 62.61  ? 323  LYS M NZ  1 
ATOM   7355  O  OXT . LYS C  3  323 ? 106.773 31.623  31.881  1.00 67.31  ? 323  LYS M OXT 1 
HETATM 7356  N  N   . FME D  4  1   ? 126.246 42.813  41.746  1.00 38.27  ? 1    FME H N   1 
HETATM 7357  C  CN  . FME D  4  1   ? 124.983 42.922  42.265  1.00 41.15  ? 1    FME H CN  1 
HETATM 7358  O  O1  . FME D  4  1   ? 124.929 43.593  43.300  1.00 38.26  ? 1    FME H O1  1 
HETATM 7359  C  CA  . FME D  4  1   ? 126.910 44.096  41.575  1.00 36.74  ? 1    FME H CA  1 
HETATM 7360  C  CB  . FME D  4  1   ? 128.396 43.920  41.874  1.00 40.80  ? 1    FME H CB  1 
HETATM 7361  C  CG  . FME D  4  1   ? 128.678 43.748  43.373  1.00 46.57  ? 1    FME H CG  1 
HETATM 7362  S  SD  . FME D  4  1   ? 129.780 42.395  43.891  1.00 54.23  ? 1    FME H SD  1 
HETATM 7363  C  CE  . FME D  4  1   ? 131.055 42.633  42.666  1.00 45.59  ? 1    FME H CE  1 
HETATM 7364  C  C   . FME D  4  1   ? 126.687 44.598  40.155  1.00 34.43  ? 1    FME H C   1 
HETATM 7365  O  O   . FME D  4  1   ? 126.270 43.823  39.300  1.00 36.17  ? 1    FME H O   1 
ATOM   7366  N  N   . TYR D  4  2   ? 126.917 45.885  39.901  1.00 30.72  ? 2    TYR H N   1 
ATOM   7367  C  CA  . TYR D  4  2   ? 126.648 46.439  38.574  1.00 30.03  ? 2    TYR H CA  1 
ATOM   7368  C  C   . TYR D  4  2   ? 127.841 47.039  37.889  1.00 30.77  ? 2    TYR H C   1 
ATOM   7369  O  O   . TYR D  4  2   ? 128.506 47.896  38.456  1.00 33.21  ? 2    TYR H O   1 
ATOM   7370  C  CB  . TYR D  4  2   ? 125.580 47.513  38.629  1.00 30.11  ? 2    TYR H CB  1 
ATOM   7371  C  CG  . TYR D  4  2   ? 124.248 46.968  38.977  1.00 30.53  ? 2    TYR H CG  1 
ATOM   7372  C  CD1 . TYR D  4  2   ? 123.613 46.056  38.146  1.00 33.77  ? 2    TYR H CD1 1 
ATOM   7373  C  CD2 . TYR D  4  2   ? 123.681 47.247  40.209  1.00 33.44  ? 2    TYR H CD2 1 
ATOM   7374  C  CE1 . TYR D  4  2   ? 122.439 45.423  38.549  1.00 33.49  ? 2    TYR H CE1 1 
ATOM   7375  C  CE2 . TYR D  4  2   ? 122.525 46.622  40.624  1.00 33.65  ? 2    TYR H CE2 1 
ATOM   7376  C  CZ  . TYR D  4  2   ? 121.909 45.712  39.798  1.00 34.38  ? 2    TYR H CZ  1 
ATOM   7377  O  OH  . TYR D  4  2   ? 120.764 45.101  40.246  1.00 39.37  ? 2    TYR H OH  1 
ATOM   7378  N  N   . HIS D  4  3   ? 127.935 46.789  36.589  1.00 29.98  ? 3    HIS H N   1 
ATOM   7379  C  CA  . HIS D  4  3   ? 128.904 47.470  35.756  1.00 31.25  ? 3    HIS H CA  1 
ATOM   7380  C  C   . HIS D  4  3   ? 128.497 48.921  35.695  1.00 33.66  ? 3    HIS H C   1 
ATOM   7381  O  O   . HIS D  4  3   ? 127.323 49.229  35.526  1.00 37.69  ? 3    HIS H O   1 
ATOM   7382  C  CB  . HIS D  4  3   ? 128.896 46.900  34.347  1.00 33.88  ? 3    HIS H CB  1 
ATOM   7383  C  CG  . HIS D  4  3   ? 129.123 45.423  34.290  1.00 35.87  ? 3    HIS H CG  1 
ATOM   7384  N  ND1 . HIS D  4  3   ? 130.377 44.864  34.371  1.00 29.55  ? 3    HIS H ND1 1 
ATOM   7385  C  CD2 . HIS D  4  3   ? 128.264 44.393  34.082  1.00 39.90  ? 3    HIS H CD2 1 
ATOM   7386  C  CE1 . HIS D  4  3   ? 130.286 43.557  34.201  1.00 35.13  ? 3    HIS H CE1 1 
ATOM   7387  N  NE2 . HIS D  4  3   ? 129.015 43.244  34.027  1.00 37.70  ? 3    HIS H NE2 1 
ATOM   7388  N  N   . GLY D  4  4   ? 129.445 49.803  35.971  1.00 39.67  ? 4    GLY H N   1 
ATOM   7389  C  CA  . GLY D  4  4   ? 129.199 51.224  35.833  1.00 41.42  ? 4    GLY H CA  1 
ATOM   7390  C  C   . GLY D  4  4   ? 128.888 51.925  37.136  1.00 41.21  ? 4    GLY H C   1 
ATOM   7391  O  O   . GLY D  4  4   ? 129.037 53.152  37.225  1.00 43.97  ? 4    GLY H O   1 
ATOM   7392  N  N   . ALA D  4  5   ? 128.410 51.168  38.123  1.00 40.99  ? 5    ALA H N   1 
ATOM   7393  C  CA  . ALA D  4  5   ? 128.022 51.730  39.417  1.00 39.97  ? 5    ALA H CA  1 
ATOM   7394  C  C   . ALA D  4  5   ? 129.260 52.270  40.139  1.00 41.59  ? 5    ALA H C   1 
ATOM   7395  O  O   . ALA D  4  5   ? 130.293 51.608  40.155  1.00 44.96  ? 5    ALA H O   1 
ATOM   7396  C  CB  . ALA D  4  5   ? 127.337 50.665  40.247  1.00 33.00  ? 5    ALA H CB  1 
ATOM   7397  N  N   . LEU D  4  6   ? 129.189 53.505  40.634  1.00 43.44  ? 6    LEU H N   1 
ATOM   7398  C  CA  . LEU D  4  6   ? 130.345 54.157  41.246  1.00 47.34  ? 6    LEU H CA  1 
ATOM   7399  C  C   . LEU D  4  6   ? 130.209 54.367  42.746  1.00 55.18  ? 6    LEU H C   1 
ATOM   7400  O  O   . LEU D  4  6   ? 131.207 54.483  43.457  1.00 60.14  ? 6    LEU H O   1 
ATOM   7401  C  CB  . LEU D  4  6   ? 130.621 55.508  40.596  1.00 40.69  ? 6    LEU H CB  1 
ATOM   7402  C  CG  . LEU D  4  6   ? 131.180 55.474  39.186  1.00 40.32  ? 6    LEU H CG  1 
ATOM   7403  C  CD1 . LEU D  4  6   ? 131.856 56.778  38.902  1.00 35.94  ? 6    LEU H CD1 1 
ATOM   7404  C  CD2 . LEU D  4  6   ? 132.153 54.335  39.043  1.00 36.87  ? 6    LEU H CD2 1 
ATOM   7405  N  N   . ALA D  4  7   ? 128.992 54.572  43.216  1.00 59.78  ? 7    ALA H N   1 
ATOM   7406  C  CA  . ALA D  4  7   ? 128.801 54.851  44.627  1.00 68.41  ? 7    ALA H CA  1 
ATOM   7407  C  C   . ALA D  4  7   ? 127.370 54.504  44.986  1.00 75.58  ? 7    ALA H C   1 
ATOM   7408  O  O   . ALA D  4  7   ? 126.636 53.938  44.164  1.00 77.96  ? 7    ALA H O   1 
ATOM   7409  C  CB  . ALA D  4  7   ? 129.096 56.332  44.933  1.00 65.72  ? 7    ALA H CB  1 
ATOM   7410  N  N   . GLN D  4  8   ? 126.976 54.855  46.208  1.00 81.54  ? 8    GLN H N   1 
ATOM   7411  C  CA  . GLN D  4  8   ? 125.601 54.683  46.670  1.00 83.29  ? 8    GLN H CA  1 
ATOM   7412  C  C   . GLN D  4  8   ? 124.604 55.202  45.635  1.00 83.47  ? 8    GLN H C   1 
ATOM   7413  O  O   . GLN D  4  8   ? 123.483 54.688  45.537  1.00 86.25  ? 8    GLN H O   1 
ATOM   7414  C  CB  . GLN D  4  8   ? 125.394 55.424  47.993  0.00 83.32  ? 8    GLN H CB  1 
ATOM   7415  C  CG  . GLN D  4  8   ? 125.353 54.522  49.215  0.00 83.60  ? 8    GLN H CG  1 
ATOM   7416  C  CD  . GLN D  4  8   ? 124.031 54.605  49.959  0.00 83.63  ? 8    GLN H CD  1 
ATOM   7417  O  OE1 . GLN D  4  8   ? 123.343 55.623  49.919  0.00 83.66  ? 8    GLN H OE1 1 
ATOM   7418  N  NE2 . GLN D  4  8   ? 123.680 53.536  50.657  0.00 83.66  ? 8    GLN H NE2 1 
ATOM   7419  N  N   . HIS D  4  9   ? 124.999 56.233  44.884  1.00 79.22  ? 9    HIS H N   1 
ATOM   7420  C  CA  . HIS D  4  9   ? 124.116 56.772  43.859  1.00 74.08  ? 9    HIS H CA  1 
ATOM   7421  C  C   . HIS D  4  9   ? 124.797 57.432  42.656  1.00 65.62  ? 9    HIS H C   1 
ATOM   7422  O  O   . HIS D  4  9   ? 124.208 58.289  42.004  1.00 66.04  ? 9    HIS H O   1 
ATOM   7423  C  CB  . HIS D  4  9   ? 123.117 57.740  44.504  1.00 79.41  ? 9    HIS H CB  1 
ATOM   7424  C  CG  . HIS D  4  9   ? 121.687 57.413  44.204  0.00 82.33  ? 9    HIS H CG  1 
ATOM   7425  N  ND1 . HIS D  4  9   ? 121.239 57.140  42.929  0.00 84.01  ? 9    HIS H ND1 1 
ATOM   7426  C  CD2 . HIS D  4  9   ? 120.612 57.275  45.017  0.00 84.01  ? 9    HIS H CD2 1 
ATOM   7427  C  CE1 . HIS D  4  9   ? 119.952 56.847  42.968  0.00 84.96  ? 9    HIS H CE1 1 
ATOM   7428  N  NE2 . HIS D  4  9   ? 119.546 56.922  44.223  0.00 84.96  ? 9    HIS H NE2 1 
ATOM   7429  N  N   . LEU D  4  10  ? 125.926 56.881  42.240  1.00 55.23  ? 10   LEU H N   1 
ATOM   7430  C  CA  . LEU D  4  10  ? 126.681 57.449  41.140  1.00 43.11  ? 10   LEU H CA  1 
ATOM   7431  C  C   . LEU D  4  10  ? 126.900 56.373  40.130  1.00 37.91  ? 10   LEU H C   1 
ATOM   7432  O  O   . LEU D  4  10  ? 127.112 55.227  40.498  1.00 40.26  ? 10   LEU H O   1 
ATOM   7433  C  CB  . LEU D  4  10  ? 128.038 57.911  41.618  1.00 43.24  ? 10   LEU H CB  1 
ATOM   7434  C  CG  . LEU D  4  10  ? 128.441 59.266  41.077  1.00 44.50  ? 10   LEU H CG  1 
ATOM   7435  C  CD1 . LEU D  4  10  ? 127.586 60.306  41.782  1.00 42.62  ? 10   LEU H CD1 1 
ATOM   7436  C  CD2 . LEU D  4  10  ? 129.918 59.506  41.311  1.00 42.29  ? 10   LEU H CD2 1 
ATOM   7437  N  N   . ASP D  4  11  ? 126.953 56.741  38.864  1.00 33.53  ? 11   ASP H N   1 
ATOM   7438  C  CA  . ASP D  4  11  ? 127.402 55.796  37.864  1.00 29.23  ? 11   ASP H CA  1 
ATOM   7439  C  C   . ASP D  4  11  ? 128.061 56.508  36.709  1.00 27.16  ? 11   ASP H C   1 
ATOM   7440  O  O   . ASP D  4  11  ? 127.930 57.725  36.563  1.00 26.17  ? 11   ASP H O   1 
ATOM   7441  C  CB  . ASP D  4  11  ? 126.252 54.886  37.389  1.00 30.15  ? 11   ASP H CB  1 
ATOM   7442  C  CG  . ASP D  4  11  ? 125.111 55.645  36.721  1.00 32.92  ? 11   ASP H CG  1 
ATOM   7443  O  OD1 . ASP D  4  11  ? 125.288 56.127  35.582  1.00 34.79  ? 11   ASP H OD1 1 
ATOM   7444  O  OD2 . ASP D  4  11  ? 124.001 55.667  37.296  1.00 36.09  ? 11   ASP H OD2 1 
ATOM   7445  N  N   . ILE D  4  12  ? 128.806 55.734  35.926  1.00 25.20  ? 12   ILE H N   1 
ATOM   7446  C  CA  . ILE D  4  12  ? 129.606 56.232  34.822  1.00 24.89  ? 12   ILE H CA  1 
ATOM   7447  C  C   . ILE D  4  12  ? 128.822 57.108  33.841  1.00 28.12  ? 12   ILE H C   1 
ATOM   7448  O  O   . ILE D  4  12  ? 129.144 58.274  33.657  1.00 29.26  ? 12   ILE H O   1 
ATOM   7449  C  CB  . ILE D  4  12  ? 130.224 55.068  34.041  1.00 25.58  ? 12   ILE H CB  1 
ATOM   7450  C  CG1 . ILE D  4  12  ? 131.157 54.264  34.930  1.00 24.27  ? 12   ILE H CG1 1 
ATOM   7451  C  CG2 . ILE D  4  12  ? 131.057 55.603  32.910  1.00 32.67  ? 12   ILE H CG2 1 
ATOM   7452  C  CD1 . ILE D  4  12  ? 132.377 55.036  35.318  1.00 26.04  ? 12   ILE H CD1 1 
ATOM   7453  N  N   . ALA D  4  13  ? 127.811 56.546  33.188  1.00 27.27  ? 13   ALA H N   1 
ATOM   7454  C  CA  . ALA D  4  13  ? 127.073 57.289  32.174  1.00 25.84  ? 13   ALA H CA  1 
ATOM   7455  C  C   . ALA D  4  13  ? 126.644 58.642  32.723  1.00 25.63  ? 13   ALA H C   1 
ATOM   7456  O  O   . ALA D  4  13  ? 126.781 59.672  32.064  1.00 29.94  ? 13   ALA H O   1 
ATOM   7457  C  CB  . ALA D  4  13  ? 125.854 56.493  31.716  1.00 20.28  ? 13   ALA H CB  1 
ATOM   7458  N  N   . GLN D  4  14  ? 126.278 58.665  33.993  1.00 27.29  ? 14   GLN H N   1 
ATOM   7459  C  CA  . GLN D  4  14  ? 125.734 59.879  34.565  1.00 26.69  ? 14   GLN H CA  1 
ATOM   7460  C  C   . GLN D  4  14  ? 126.792 60.957  34.674  1.00 26.12  ? 14   GLN H C   1 
ATOM   7461  O  O   . GLN D  4  14  ? 126.516 62.133  34.505  1.00 31.44  ? 14   GLN H O   1 
ATOM   7462  C  CB  . GLN D  4  14  ? 125.152 59.591  35.926  1.00 25.02  ? 14   GLN H CB  1 
ATOM   7463  C  CG  . GLN D  4  14  ? 125.090 60.805  36.795  1.00 35.21  ? 14   GLN H CG  1 
ATOM   7464  C  CD  . GLN D  4  14  ? 124.944 60.444  38.243  1.00 42.21  ? 14   GLN H CD  1 
ATOM   7465  O  OE1 . GLN D  4  14  ? 125.320 59.337  38.654  1.00 44.31  ? 14   GLN H OE1 1 
ATOM   7466  N  NE2 . GLN D  4  14  ? 124.323 61.332  39.020  1.00 41.25  ? 14   GLN H NE2 1 
ATOM   7467  N  N   . LEU D  4  15  ? 128.008 60.560  34.970  1.00 22.91  ? 15   LEU H N   1 
ATOM   7468  C  CA  . LEU D  4  15  ? 129.088 61.517  35.040  1.00 24.72  ? 15   LEU H CA  1 
ATOM   7469  C  C   . LEU D  4  15  ? 129.445 61.987  33.658  1.00 27.05  ? 15   LEU H C   1 
ATOM   7470  O  O   . LEU D  4  15  ? 129.761 63.163  33.443  1.00 29.57  ? 15   LEU H O   1 
ATOM   7471  C  CB  . LEU D  4  15  ? 130.310 60.875  35.664  1.00 29.45  ? 15   LEU H CB  1 
ATOM   7472  C  CG  . LEU D  4  15  ? 130.118 60.460  37.116  1.00 35.42  ? 15   LEU H CG  1 
ATOM   7473  C  CD1 . LEU D  4  15  ? 131.315 59.643  37.558  1.00 34.80  ? 15   LEU H CD1 1 
ATOM   7474  C  CD2 . LEU D  4  15  ? 129.937 61.700  37.972  1.00 35.40  ? 15   LEU H CD2 1 
ATOM   7475  N  N   . VAL D  4  16  ? 129.423 61.058  32.714  1.00 28.28  ? 16   VAL H N   1 
ATOM   7476  C  CA  . VAL D  4  16  ? 129.726 61.382  31.334  1.00 26.04  ? 16   VAL H CA  1 
ATOM   7477  C  C   . VAL D  4  16  ? 128.667 62.296  30.710  1.00 25.05  ? 16   VAL H C   1 
ATOM   7478  O  O   . VAL D  4  16  ? 128.986 63.156  29.888  1.00 28.59  ? 16   VAL H O   1 
ATOM   7479  C  CB  . VAL D  4  16  ? 129.884 60.118  30.517  1.00 24.48  ? 16   VAL H CB  1 
ATOM   7480  C  CG1 . VAL D  4  16  ? 130.212 60.458  29.092  1.00 26.23  ? 16   VAL H CG1 1 
ATOM   7481  C  CG2 . VAL D  4  16  ? 130.983 59.283  31.099  1.00 24.52  ? 16   VAL H CG2 1 
ATOM   7482  N  N   . TRP D  4  17  ? 127.448 62.253  31.225  1.00 25.70  ? 17   TRP H N   1 
ATOM   7483  C  CA  . TRP D  4  17  ? 126.476 63.263  30.829  1.00 27.44  ? 17   TRP H CA  1 
ATOM   7484  C  C   . TRP D  4  17  ? 126.988 64.677  31.141  1.00 26.86  ? 17   TRP H C   1 
ATOM   7485  O  O   . TRP D  4  17  ? 126.958 65.568  30.294  1.00 31.12  ? 17   TRP H O   1 
ATOM   7486  C  CB  . TRP D  4  17  ? 125.149 63.016  31.529  1.00 26.63  ? 17   TRP H CB  1 
ATOM   7487  C  CG  . TRP D  4  17  ? 124.036 63.776  30.908  1.00 36.85  ? 17   TRP H CG  1 
ATOM   7488  C  CD1 . TRP D  4  17  ? 123.507 63.619  29.638  1.00 40.03  ? 17   TRP H CD1 1 
ATOM   7489  C  CD2 . TRP D  4  17  ? 123.287 64.806  31.523  1.00 36.30  ? 17   TRP H CD2 1 
ATOM   7490  N  NE1 . TRP D  4  17  ? 122.455 64.490  29.447  1.00 37.03  ? 17   TRP H NE1 1 
ATOM   7491  C  CE2 . TRP D  4  17  ? 122.299 65.229  30.588  1.00 40.29  ? 17   TRP H CE2 1 
ATOM   7492  C  CE3 . TRP D  4  17  ? 123.351 65.420  32.771  1.00 35.41  ? 17   TRP H CE3 1 
ATOM   7493  C  CZ2 . TRP D  4  17  ? 121.391 66.236  30.874  1.00 43.64  ? 17   TRP H CZ2 1 
ATOM   7494  C  CZ3 . TRP D  4  17  ? 122.451 66.422  33.059  1.00 45.56  ? 17   TRP H CZ3 1 
ATOM   7495  C  CH2 . TRP D  4  17  ? 121.481 66.825  32.115  1.00 48.24  ? 17   TRP H CH2 1 
ATOM   7496  N  N   . TYR D  4  18  ? 127.568 64.835  32.321  1.00 26.72  ? 18   TYR H N   1 
ATOM   7497  C  CA  . TYR D  4  18  ? 128.088 66.115  32.770  1.00 24.87  ? 18   TYR H CA  1 
ATOM   7498  C  C   . TYR D  4  18  ? 129.252 66.583  31.950  1.00 21.02  ? 18   TYR H C   1 
ATOM   7499  O  O   . TYR D  4  18  ? 129.316 67.739  31.570  1.00 21.73  ? 18   TYR H O   1 
ATOM   7500  C  CB  . TYR D  4  18  ? 128.516 66.020  34.220  1.00 29.64  ? 18   TYR H CB  1 
ATOM   7501  C  CG  . TYR D  4  18  ? 127.335 66.022  35.134  1.00 34.26  ? 18   TYR H CG  1 
ATOM   7502  C  CD1 . TYR D  4  18  ? 126.476 67.120  35.155  1.00 39.46  ? 18   TYR H CD1 1 
ATOM   7503  C  CD2 . TYR D  4  18  ? 126.949 64.863  35.810  1.00 38.72  ? 18   TYR H CD2 1 
ATOM   7504  C  CE1 . TYR D  4  18  ? 125.238 67.068  35.805  1.00 45.04  ? 18   TYR H CE1 1 
ATOM   7505  C  CE2 . TYR D  4  18  ? 125.705 64.789  36.468  1.00 45.35  ? 18   TYR H CE2 1 
ATOM   7506  C  CZ  . TYR D  4  18  ? 124.844 65.898  36.447  1.00 48.24  ? 18   TYR H CZ  1 
ATOM   7507  O  OH  . TYR D  4  18  ? 123.548 65.818  36.944  1.00 53.53  ? 18   TYR H OH  1 
ATOM   7508  N  N   . ALA D  4  19  ? 130.203 65.695  31.729  1.00 19.32  ? 19   ALA H N   1 
ATOM   7509  C  CA  . ALA D  4  19  ? 131.349 66.023  30.913  1.00 21.46  ? 19   ALA H CA  1 
ATOM   7510  C  C   . ALA D  4  19  ? 130.952 66.405  29.483  1.00 26.67  ? 19   ALA H C   1 
ATOM   7511  O  O   . ALA D  4  19  ? 131.495 67.356  28.911  1.00 29.50  ? 19   ALA H O   1 
ATOM   7512  C  CB  . ALA D  4  19  ? 132.275 64.879  30.890  1.00 18.50  ? 19   ALA H CB  1 
ATOM   7513  N  N   . GLN D  4  20  ? 129.973 65.695  28.928  1.00 26.39  ? 20   GLN H N   1 
ATOM   7514  C  CA  . GLN D  4  20  ? 129.509 65.948  27.581  1.00 22.67  ? 20   GLN H CA  1 
ATOM   7515  C  C   . GLN D  4  20  ? 129.071 67.402  27.453  1.00 24.19  ? 20   GLN H C   1 
ATOM   7516  O  O   . GLN D  4  20  ? 129.514 68.122  26.567  1.00 24.82  ? 20   GLN H O   1 
ATOM   7517  C  CB  . GLN D  4  20  ? 128.345 65.029  27.282  1.00 24.14  ? 20   GLN H CB  1 
ATOM   7518  C  CG  . GLN D  4  20  ? 127.665 65.386  26.003  1.00 31.70  ? 20   GLN H CG  1 
ATOM   7519  C  CD  . GLN D  4  20  ? 128.316 64.737  24.811  1.00 33.05  ? 20   GLN H CD  1 
ATOM   7520  O  OE1 . GLN D  4  20  ? 128.906 63.665  24.930  1.00 27.51  ? 20   GLN H OE1 1 
ATOM   7521  N  NE2 . GLN D  4  20  ? 128.170 65.354  23.638  1.00 32.83  ? 20   GLN H NE2 1 
ATOM   7522  N  N   . TRP D  4  21  ? 128.182 67.825  28.339  1.00 24.90  ? 21   TRP H N   1 
ATOM   7523  C  CA  . TRP D  4  21  ? 127.726 69.206  28.372  1.00 28.02  ? 21   TRP H CA  1 
ATOM   7524  C  C   . TRP D  4  21  ? 128.832 70.223  28.535  1.00 30.72  ? 21   TRP H C   1 
ATOM   7525  O  O   . TRP D  4  21  ? 128.670 71.391  28.184  1.00 35.48  ? 21   TRP H O   1 
ATOM   7526  C  CB  . TRP D  4  21  ? 126.737 69.402  29.509  1.00 30.38  ? 21   TRP H CB  1 
ATOM   7527  C  CG  . TRP D  4  21  ? 125.367 69.103  29.094  1.00 31.28  ? 21   TRP H CG  1 
ATOM   7528  C  CD1 . TRP D  4  21  ? 124.560 68.115  29.576  1.00 29.57  ? 21   TRP H CD1 1 
ATOM   7529  C  CD2 . TRP D  4  21  ? 124.648 69.734  28.032  1.00 29.33  ? 21   TRP H CD2 1 
ATOM   7530  N  NE1 . TRP D  4  21  ? 123.378 68.094  28.881  1.00 30.76  ? 21   TRP H NE1 1 
ATOM   7531  C  CE2 . TRP D  4  21  ? 123.401 69.082  27.930  1.00 31.01  ? 21   TRP H CE2 1 
ATOM   7532  C  CE3 . TRP D  4  21  ? 124.937 70.794  27.157  1.00 32.93  ? 21   TRP H CE3 1 
ATOM   7533  C  CZ2 . TRP D  4  21  ? 122.431 69.460  26.989  1.00 30.67  ? 21   TRP H CZ2 1 
ATOM   7534  C  CZ3 . TRP D  4  21  ? 123.972 71.173  26.215  1.00 27.45  ? 21   TRP H CZ3 1 
ATOM   7535  C  CH2 . TRP D  4  21  ? 122.737 70.505  26.143  1.00 30.68  ? 21   TRP H CH2 1 
ATOM   7536  N  N   . LEU D  4  22  ? 129.872 69.842  29.250  1.00 28.36  ? 22   LEU H N   1 
ATOM   7537  C  CA  . LEU D  4  22  ? 130.934 70.780  29.515  1.00 28.75  ? 22   LEU H CA  1 
ATOM   7538  C  C   . LEU D  4  22  ? 131.763 70.975  28.274  1.00 25.79  ? 22   LEU H C   1 
ATOM   7539  O  O   . LEU D  4  22  ? 132.266 72.058  27.993  1.00 22.11  ? 22   LEU H O   1 
ATOM   7540  C  CB  . LEU D  4  22  ? 131.814 70.270  30.642  1.00 36.65  ? 22   LEU H CB  1 
ATOM   7541  C  CG  . LEU D  4  22  ? 131.684 71.185  31.844  1.00 40.77  ? 22   LEU H CG  1 
ATOM   7542  C  CD1 . LEU D  4  22  ? 130.826 70.527  32.914  1.00 44.91  ? 22   LEU H CD1 1 
ATOM   7543  C  CD2 . LEU D  4  22  ? 133.073 71.506  32.335  1.00 47.18  ? 22   LEU H CD2 1 
ATOM   7544  N  N   . VAL D  4  23  ? 131.953 69.897  27.545  1.00 22.95  ? 23   VAL H N   1 
ATOM   7545  C  CA  . VAL D  4  23  ? 132.748 69.983  26.360  1.00 22.09  ? 23   VAL H CA  1 
ATOM   7546  C  C   . VAL D  4  23  ? 132.043 70.890  25.370  1.00 24.04  ? 23   VAL H C   1 
ATOM   7547  O  O   . VAL D  4  23  ? 132.646 71.838  24.855  1.00 28.56  ? 23   VAL H O   1 
ATOM   7548  C  CB  . VAL D  4  23  ? 132.941 68.615  25.807  1.00 22.46  ? 23   VAL H CB  1 
ATOM   7549  C  CG1 . VAL D  4  23  ? 133.438 68.686  24.394  1.00 21.65  ? 23   VAL H CG1 1 
ATOM   7550  C  CG2 . VAL D  4  23  ? 133.902 67.858  26.717  1.00 23.63  ? 23   VAL H CG2 1 
ATOM   7551  N  N   . ILE D  4  24  ? 130.722 70.785  25.349  1.00 20.85  ? 24   ILE H N   1 
ATOM   7552  C  CA  . ILE D  4  24  ? 129.930 71.531  24.404  1.00 16.99  ? 24   ILE H CA  1 
ATOM   7553  C  C   . ILE D  4  24  ? 129.930 73.012  24.712  1.00 20.56  ? 24   ILE H C   1 
ATOM   7554  O  O   . ILE D  4  24  ? 130.371 73.804  23.879  1.00 22.66  ? 24   ILE H O   1 
ATOM   7555  C  CB  . ILE D  4  24  ? 128.519 70.991  24.361  1.00 16.93  ? 24   ILE H CB  1 
ATOM   7556  C  CG1 . ILE D  4  24  ? 128.545 69.607  23.720  1.00 14.52  ? 24   ILE H CG1 1 
ATOM   7557  C  CG2 . ILE D  4  24  ? 127.626 71.906  23.549  1.00 21.08  ? 24   ILE H CG2 1 
ATOM   7558  C  CD1 . ILE D  4  24  ? 127.254 68.866  23.838  1.00 22.85  ? 24   ILE H CD1 1 
ATOM   7559  N  N   . TRP D  4  25  ? 129.566 73.394  25.934  1.00 21.18  ? 25   TRP H N   1 
ATOM   7560  C  CA  . TRP D  4  25  ? 129.552 74.819  26.272  1.00 22.08  ? 25   TRP H CA  1 
ATOM   7561  C  C   . TRP D  4  25  ? 130.941 75.461  26.244  1.00 19.28  ? 25   TRP H C   1 
ATOM   7562  O  O   . TRP D  4  25  ? 131.105 76.602  25.814  1.00 16.60  ? 25   TRP H O   1 
ATOM   7563  C  CB  . TRP D  4  25  ? 128.877 75.044  27.615  1.00 28.08  ? 25   TRP H CB  1 
ATOM   7564  C  CG  . TRP D  4  25  ? 127.405 74.935  27.492  1.00 45.06  ? 25   TRP H CG  1 
ATOM   7565  C  CD1 . TRP D  4  25  ? 126.612 73.956  28.029  1.00 49.45  ? 25   TRP H CD1 1 
ATOM   7566  C  CD2 . TRP D  4  25  ? 126.559 75.680  26.588  1.00 49.92  ? 25   TRP H CD2 1 
ATOM   7567  N  NE1 . TRP D  4  25  ? 125.342 74.028  27.497  1.00 53.66  ? 25   TRP H NE1 1 
ATOM   7568  C  CE2 . TRP D  4  25  ? 125.284 75.073  26.610  1.00 52.79  ? 25   TRP H CE2 1 
ATOM   7569  C  CE3 . TRP D  4  25  ? 126.760 76.790  25.755  1.00 51.43  ? 25   TRP H CE3 1 
ATOM   7570  C  CZ2 . TRP D  4  25  ? 124.215 75.544  25.827  1.00 52.95  ? 25   TRP H CZ2 1 
ATOM   7571  C  CZ3 . TRP D  4  25  ? 125.696 77.255  24.983  1.00 50.46  ? 25   TRP H CZ3 1 
ATOM   7572  C  CH2 . TRP D  4  25  ? 124.443 76.632  25.027  1.00 49.48  ? 25   TRP H CH2 1 
ATOM   7573  N  N   . THR D  4  26  ? 131.957 74.664  26.532  1.00 17.98  ? 26   THR H N   1 
ATOM   7574  C  CA  . THR D  4  26  ? 133.330 75.107  26.369  1.00 18.00  ? 26   THR H CA  1 
ATOM   7575  C  C   . THR D  4  26  ? 133.642 75.477  24.919  1.00 20.63  ? 26   THR H C   1 
ATOM   7576  O  O   . THR D  4  26  ? 133.919 76.646  24.623  1.00 21.06  ? 26   THR H O   1 
ATOM   7577  C  CB  . THR D  4  26  ? 134.309 74.027  26.849  1.00 18.71  ? 26   THR H CB  1 
ATOM   7578  O  OG1 . THR D  4  26  ? 134.114 73.801  28.245  1.00 16.47  ? 26   THR H OG1 1 
ATOM   7579  C  CG2 . THR D  4  26  ? 135.708 74.479  26.669  1.00 20.07  ? 26   THR H CG2 1 
ATOM   7580  N  N   . VAL D  4  27  ? 133.475 74.521  24.006  1.00 18.52  ? 27   VAL H N   1 
ATOM   7581  C  CA  . VAL D  4  27  ? 133.751 74.769  22.604  1.00 16.31  ? 27   VAL H CA  1 
ATOM   7582  C  C   . VAL D  4  27  ? 132.874 75.885  22.056  1.00 16.20  ? 27   VAL H C   1 
ATOM   7583  O  O   . VAL D  4  27  ? 133.360 76.792  21.377  1.00 20.83  ? 27   VAL H O   1 
ATOM   7584  C  CB  . VAL D  4  27  ? 133.536 73.512  21.767  1.00 18.36  ? 27   VAL H CB  1 
ATOM   7585  C  CG1 . VAL D  4  27  ? 133.709 73.832  20.291  1.00 17.68  ? 27   VAL H CG1 1 
ATOM   7586  C  CG2 . VAL D  4  27  ? 134.523 72.440  22.198  1.00 17.51  ? 27   VAL H CG2 1 
ATOM   7587  N  N   . VAL D  4  28  ? 131.603 75.882  22.415  1.00 14.36  ? 28   VAL H N   1 
ATOM   7588  C  CA  . VAL D  4  28  ? 130.701 76.880  21.871  1.00 15.30  ? 28   VAL H CA  1 
ATOM   7589  C  C   . VAL D  4  28  ? 131.035 78.293  22.380  1.00 18.13  ? 28   VAL H C   1 
ATOM   7590  O  O   . VAL D  4  28  ? 131.228 79.215  21.574  1.00 20.54  ? 28   VAL H O   1 
ATOM   7591  C  CB  . VAL D  4  28  ? 129.238 76.496  22.174  1.00 17.01  ? 28   VAL H CB  1 
ATOM   7592  C  CG1 . VAL D  4  28  ? 128.307 77.651  21.913  1.00 17.59  ? 28   VAL H CG1 1 
ATOM   7593  C  CG2 . VAL D  4  28  ? 128.843 75.310  21.328  1.00 13.15  ? 28   VAL H CG2 1 
ATOM   7594  N  N   . LEU D  4  29  ? 131.240 78.446  23.690  1.00 22.82  ? 29   LEU H N   1 
ATOM   7595  C  CA  . LEU D  4  29  ? 131.422 79.786  24.286  1.00 21.91  ? 29   LEU H CA  1 
ATOM   7596  C  C   . LEU D  4  29  ? 132.844 80.297  24.210  1.00 21.34  ? 29   LEU H C   1 
ATOM   7597  O  O   . LEU D  4  29  ? 133.089 81.475  23.973  1.00 20.58  ? 29   LEU H O   1 
ATOM   7598  C  CB  . LEU D  4  29  ? 130.990 79.796  25.743  1.00 22.11  ? 29   LEU H CB  1 
ATOM   7599  C  CG  . LEU D  4  29  ? 129.483 79.863  25.959  1.00 25.71  ? 29   LEU H CG  1 
ATOM   7600  C  CD1 . LEU D  4  29  ? 129.178 79.566  27.408  1.00 26.27  ? 29   LEU H CD1 1 
ATOM   7601  C  CD2 . LEU D  4  29  ? 128.974 81.233  25.582  1.00 22.09  ? 29   LEU H CD2 1 
ATOM   7602  N  N   . LEU D  4  30  ? 133.788 79.435  24.524  1.00 20.61  ? 30   LEU H N   1 
ATOM   7603  C  CA  . LEU D  4  30  ? 135.154 79.888  24.600  1.00 20.95  ? 30   LEU H CA  1 
ATOM   7604  C  C   . LEU D  4  30  ? 135.875 79.804  23.254  1.00 21.36  ? 30   LEU H C   1 
ATOM   7605  O  O   . LEU D  4  30  ? 136.762 80.602  22.975  1.00 21.68  ? 30   LEU H O   1 
ATOM   7606  C  CB  . LEU D  4  30  ? 135.887 79.120  25.702  1.00 18.65  ? 30   LEU H CB  1 
ATOM   7607  C  CG  . LEU D  4  30  ? 135.860 79.705  27.138  1.00 16.91  ? 30   LEU H CG  1 
ATOM   7608  C  CD1 . LEU D  4  30  ? 134.599 80.432  27.485  1.00 11.38  ? 30   LEU H CD1 1 
ATOM   7609  C  CD2 . LEU D  4  30  ? 136.036 78.591  28.111  1.00 15.32  ? 30   LEU H CD2 1 
ATOM   7610  N  N   . TYR D  4  31  ? 135.415 78.924  22.370  1.00 24.62  ? 31   TYR H N   1 
ATOM   7611  C  CA  . TYR D  4  31  ? 135.966 78.864  21.015  1.00 22.05  ? 31   TYR H CA  1 
ATOM   7612  C  C   . TYR D  4  31  ? 135.099 79.579  19.967  1.00 21.53  ? 31   TYR H C   1 
ATOM   7613  O  O   . TYR D  4  31  ? 135.405 80.703  19.553  1.00 26.48  ? 31   TYR H O   1 
ATOM   7614  C  CB  . TYR D  4  31  ? 136.209 77.409  20.595  1.00 20.96  ? 31   TYR H CB  1 
ATOM   7615  C  CG  . TYR D  4  31  ? 136.949 77.262  19.277  1.00 23.50  ? 31   TYR H CG  1 
ATOM   7616  C  CD1 . TYR D  4  31  ? 138.177 77.892  19.058  1.00 27.03  ? 31   TYR H CD1 1 
ATOM   7617  C  CD2 . TYR D  4  31  ? 136.396 76.541  18.224  1.00 29.33  ? 31   TYR H CD2 1 
ATOM   7618  C  CE1 . TYR D  4  31  ? 138.832 77.815  17.809  1.00 28.97  ? 31   TYR H CE1 1 
ATOM   7619  C  CE2 . TYR D  4  31  ? 137.047 76.450  16.982  1.00 31.80  ? 31   TYR H CE2 1 
ATOM   7620  C  CZ  . TYR D  4  31  ? 138.257 77.094  16.779  1.00 29.01  ? 31   TYR H CZ  1 
ATOM   7621  O  OH  . TYR D  4  31  ? 138.835 77.062  15.527  1.00 28.66  ? 31   TYR H OH  1 
ATOM   7622  N  N   . LEU D  4  32  ? 133.997 78.956  19.572  1.00 19.39  ? 32   LEU H N   1 
ATOM   7623  C  CA  . LEU D  4  32  ? 133.276 79.393  18.383  1.00 16.64  ? 32   LEU H CA  1 
ATOM   7624  C  C   . LEU D  4  32  ? 132.749 80.797  18.541  1.00 20.21  ? 32   LEU H C   1 
ATOM   7625  O  O   . LEU D  4  32  ? 132.943 81.632  17.653  1.00 20.52  ? 32   LEU H O   1 
ATOM   7626  C  CB  . LEU D  4  32  ? 132.126 78.437  18.094  1.00 17.03  ? 32   LEU H CB  1 
ATOM   7627  C  CG  . LEU D  4  32  ? 132.477 77.015  17.694  1.00 10.61  ? 32   LEU H CG  1 
ATOM   7628  C  CD1 . LEU D  4  32  ? 131.258 76.117  17.804  1.00 15.89  ? 32   LEU H CD1 1 
ATOM   7629  C  CD2 . LEU D  4  32  ? 132.976 77.043  16.282  1.00 8.23   ? 32   LEU H CD2 1 
ATOM   7630  N  N   . ARG D  4  33  ? 132.190 81.103  19.712  1.00 17.97  ? 33   ARG H N   1 
ATOM   7631  C  CA  . ARG D  4  33  ? 131.670 82.443  19.940  1.00 18.85  ? 33   ARG H CA  1 
ATOM   7632  C  C   . ARG D  4  33  ? 132.768 83.499  19.889  1.00 21.01  ? 33   ARG H C   1 
ATOM   7633  O  O   . ARG D  4  33  ? 132.487 84.692  19.790  1.00 22.14  ? 33   ARG H O   1 
ATOM   7634  C  CB  . ARG D  4  33  ? 130.940 82.531  21.275  1.00 18.67  ? 33   ARG H CB  1 
ATOM   7635  C  CG  . ARG D  4  33  ? 129.525 82.046  21.228  1.00 12.91  ? 33   ARG H CG  1 
ATOM   7636  C  CD  . ARG D  4  33  ? 128.774 82.758  20.149  1.00 15.10  ? 33   ARG H CD  1 
ATOM   7637  N  NE  . ARG D  4  33  ? 128.328 84.096  20.525  1.00 15.90  ? 33   ARG H NE  1 
ATOM   7638  C  CZ  . ARG D  4  33  ? 128.307 85.142  19.693  1.00 15.53  ? 33   ARG H CZ  1 
ATOM   7639  N  NH1 . ARG D  4  33  ? 128.721 85.001  18.445  1.00 15.83  ? 33   ARG H NH1 1 
ATOM   7640  N  NH2 . ARG D  4  33  ? 127.929 86.344  20.121  1.00 19.32  ? 33   ARG H NH2 1 
ATOM   7641  N  N   . ARG D  4  34  ? 134.022 83.079  19.940  1.00 19.08  ? 34   ARG H N   1 
ATOM   7642  C  CA  . ARG D  4  34  ? 135.088 84.061  19.846  1.00 21.64  ? 34   ARG H CA  1 
ATOM   7643  C  C   . ARG D  4  34  ? 135.599 84.167  18.420  1.00 22.63  ? 34   ARG H C   1 
ATOM   7644  O  O   . ARG D  4  34  ? 135.885 85.266  17.923  1.00 21.69  ? 34   ARG H O   1 
ATOM   7645  C  CB  . ARG D  4  34  ? 136.225 83.713  20.806  1.00 24.86  ? 34   ARG H CB  1 
ATOM   7646  C  CG  . ARG D  4  34  ? 135.883 83.919  22.287  1.00 25.77  ? 34   ARG H CG  1 
ATOM   7647  C  CD  . ARG D  4  34  ? 137.074 84.486  23.001  1.00 27.76  ? 34   ARG H CD  1 
ATOM   7648  N  NE  . ARG D  4  34  ? 136.989 84.459  24.465  1.00 35.62  ? 34   ARG H NE  1 
ATOM   7649  C  CZ  . ARG D  4  34  ? 137.707 83.649  25.251  1.00 37.45  ? 34   ARG H CZ  1 
ATOM   7650  N  NH1 . ARG D  4  34  ? 138.310 82.563  24.761  1.00 31.47  ? 34   ARG H NH1 1 
ATOM   7651  N  NH2 . ARG D  4  34  ? 137.789 83.901  26.550  1.00 40.23  ? 34   ARG H NH2 1 
ATOM   7652  N  N   . GLU D  4  35  ? 135.679 83.021  17.752  1.00 21.00  ? 35   GLU H N   1 
ATOM   7653  C  CA  . GLU D  4  35  ? 135.852 82.981  16.312  1.00 19.03  ? 35   GLU H CA  1 
ATOM   7654  C  C   . GLU D  4  35  ? 134.849 83.878  15.576  1.00 18.90  ? 35   GLU H C   1 
ATOM   7655  O  O   . GLU D  4  35  ? 135.205 84.538  14.613  1.00 19.79  ? 35   GLU H O   1 
ATOM   7656  C  CB  . GLU D  4  35  ? 135.729 81.538  15.823  1.00 19.59  ? 35   GLU H CB  1 
ATOM   7657  C  CG  . GLU D  4  35  ? 136.918 80.676  16.180  1.00 16.87  ? 35   GLU H CG  1 
ATOM   7658  C  CD  . GLU D  4  35  ? 138.232 81.330  15.816  1.00 24.01  ? 35   GLU H CD  1 
ATOM   7659  O  OE1 . GLU D  4  35  ? 138.397 81.727  14.647  1.00 28.65  ? 35   GLU H OE1 1 
ATOM   7660  O  OE2 . GLU D  4  35  ? 139.117 81.437  16.685  1.00 27.19  ? 35   GLU H OE2 1 
ATOM   7661  N  N   . ASP D  4  36  ? 133.643 84.020  16.116  1.00 21.10  ? 36   ASP H N   1 
ATOM   7662  C  CA  . ASP D  4  36  ? 132.610 84.851  15.492  1.00 18.93  ? 36   ASP H CA  1 
ATOM   7663  C  C   . ASP D  4  36  ? 132.939 86.330  15.540  1.00 21.38  ? 36   ASP H C   1 
ATOM   7664  O  O   . ASP D  4  36  ? 132.173 87.151  15.028  1.00 22.54  ? 36   ASP H O   1 
ATOM   7665  C  CB  . ASP D  4  36  ? 131.258 84.653  16.190  1.00 21.37  ? 36   ASP H CB  1 
ATOM   7666  C  CG  . ASP D  4  36  ? 130.727 83.231  16.077  1.00 23.30  ? 36   ASP H CG  1 
ATOM   7667  O  OD1 . ASP D  4  36  ? 131.035 82.506  15.115  1.00 27.52  ? 36   ASP H OD1 1 
ATOM   7668  O  OD2 . ASP D  4  36  ? 129.979 82.826  16.973  1.00 30.13  ? 36   ASP H OD2 1 
ATOM   7669  N  N   . ARG D  4  37  ? 133.963 86.688  16.315  1.00 22.46  ? 37   ARG H N   1 
ATOM   7670  C  CA  . ARG D  4  37  ? 134.243 88.089  16.624  1.00 19.92  ? 37   ARG H CA  1 
ATOM   7671  C  C   . ARG D  4  37  ? 135.482 88.641  15.912  1.00 21.43  ? 37   ARG H C   1 
ATOM   7672  O  O   . ARG D  4  37  ? 135.963 89.720  16.246  1.00 24.45  ? 37   ARG H O   1 
ATOM   7673  C  CB  . ARG D  4  37  ? 134.398 88.260  18.127  1.00 17.71  ? 37   ARG H CB  1 
ATOM   7674  C  CG  . ARG D  4  37  ? 133.145 88.676  18.823  1.00 19.65  ? 37   ARG H CG  1 
ATOM   7675  C  CD  . ARG D  4  37  ? 133.189 88.250  20.275  1.00 18.51  ? 37   ARG H CD  1 
ATOM   7676  N  NE  . ARG D  4  37  ? 131.895 88.425  20.927  1.00 15.78  ? 37   ARG H NE  1 
ATOM   7677  C  CZ  . ARG D  4  37  ? 131.279 87.489  21.657  1.00 15.12  ? 37   ARG H CZ  1 
ATOM   7678  N  NH1 . ARG D  4  37  ? 131.860 86.314  21.912  1.00 8.69   ? 37   ARG H NH1 1 
ATOM   7679  N  NH2 . ARG D  4  37  ? 130.102 87.769  22.208  1.00 16.78  ? 37   ARG H NH2 1 
ATOM   7680  N  N   . ARG D  4  38  ? 135.932 87.953  14.868  1.00 20.18  ? 38   ARG H N   1 
ATOM   7681  C  CA  . ARG D  4  38  ? 137.104 88.370  14.110  1.00 18.77  ? 38   ARG H CA  1 
ATOM   7682  C  C   . ARG D  4  38  ? 136.843 89.459  13.064  1.00 21.57  ? 38   ARG H C   1 
ATOM   7683  O  O   . ARG D  4  38  ? 137.750 89.816  12.297  1.00 22.85  ? 38   ARG H O   1 
ATOM   7684  C  CB  . ARG D  4  38  ? 137.714 87.171  13.427  1.00 9.22   ? 38   ARG H CB  1 
ATOM   7685  C  CG  . ARG D  4  38  ? 138.206 86.135  14.398  1.00 12.57  ? 38   ARG H CG  1 
ATOM   7686  C  CD  . ARG D  4  38  ? 139.332 85.334  13.756  1.00 12.01  ? 38   ARG H CD  1 
ATOM   7687  N  NE  . ARG D  4  38  ? 139.853 84.297  14.630  1.00 14.05  ? 38   ARG H NE  1 
ATOM   7688  C  CZ  . ARG D  4  38  ? 140.973 84.398  15.339  1.00 18.67  ? 38   ARG H CZ  1 
ATOM   7689  N  NH1 . ARG D  4  38  ? 141.776 85.448  15.185  1.00 18.54  ? 38   ARG H NH1 1 
ATOM   7690  N  NH2 . ARG D  4  38  ? 141.321 83.404  16.146  1.00 14.18  ? 38   ARG H NH2 1 
ATOM   7691  N  N   . GLU D  4  39  ? 135.594 89.903  12.966  1.00 19.96  ? 39   GLU H N   1 
ATOM   7692  C  CA  . GLU D  4  39  ? 135.210 90.943  12.016  1.00 21.97  ? 39   GLU H CA  1 
ATOM   7693  C  C   . GLU D  4  39  ? 134.230 91.863  12.700  1.00 21.20  ? 39   GLU H C   1 
ATOM   7694  O  O   . GLU D  4  39  ? 133.241 91.408  13.257  1.00 22.72  ? 39   GLU H O   1 
ATOM   7695  C  CB  . GLU D  4  39  ? 134.530 90.346  10.772  1.00 21.07  ? 39   GLU H CB  1 
ATOM   7696  C  CG  . GLU D  4  39  ? 135.395 89.390  9.953   1.00 21.93  ? 39   GLU H CG  1 
ATOM   7697  C  CD  . GLU D  4  39  ? 136.431 90.089  9.085   1.00 17.98  ? 39   GLU H CD  1 
ATOM   7698  O  OE1 . GLU D  4  39  ? 136.349 91.310  8.873   1.00 24.43  ? 39   GLU H OE1 1 
ATOM   7699  O  OE2 . GLU D  4  39  ? 137.344 89.407  8.609   1.00 22.47  ? 39   GLU H OE2 1 
ATOM   7700  N  N   . GLY D  4  40  ? 134.557 93.144  12.750  1.00 24.83  ? 40   GLY H N   1 
ATOM   7701  C  CA  . GLY D  4  40  ? 133.568 94.119  13.163  1.00 28.21  ? 40   GLY H CA  1 
ATOM   7702  C  C   . GLY D  4  40  ? 133.686 94.505  14.613  1.00 31.17  ? 40   GLY H C   1 
ATOM   7703  O  O   . GLY D  4  40  ? 132.871 95.286  15.109  1.00 30.23  ? 40   GLY H O   1 
ATOM   7704  N  N   . TYR D  4  41  ? 134.662 93.908  15.301  1.00 36.41  ? 41   TYR H N   1 
ATOM   7705  C  CA  . TYR D  4  41  ? 134.947 94.209  16.703  1.00 36.34  ? 41   TYR H CA  1 
ATOM   7706  C  C   . TYR D  4  41  ? 136.254 94.964  16.812  1.00 39.42  ? 41   TYR H C   1 
ATOM   7707  O  O   . TYR D  4  41  ? 137.165 94.782  15.995  1.00 41.43  ? 41   TYR H O   1 
ATOM   7708  C  CB  . TYR D  4  41  ? 135.026 92.937  17.545  1.00 32.54  ? 41   TYR H CB  1 
ATOM   7709  C  CG  . TYR D  4  41  ? 133.687 92.298  17.772  1.00 30.65  ? 41   TYR H CG  1 
ATOM   7710  C  CD1 . TYR D  4  41  ? 133.038 91.666  16.737  1.00 33.08  ? 41   TYR H CD1 1 
ATOM   7711  C  CD2 . TYR D  4  41  ? 133.033 92.395  18.985  1.00 28.12  ? 41   TYR H CD2 1 
ATOM   7712  C  CE1 . TYR D  4  41  ? 131.772 91.162  16.881  1.00 31.88  ? 41   TYR H CE1 1 
ATOM   7713  C  CE2 . TYR D  4  41  ? 131.764 91.871  19.147  1.00 30.15  ? 41   TYR H CE2 1 
ATOM   7714  C  CZ  . TYR D  4  41  ? 131.140 91.255  18.074  1.00 33.21  ? 41   TYR H CZ  1 
ATOM   7715  O  OH  . TYR D  4  41  ? 129.887 90.692  18.146  1.00 39.60  ? 41   TYR H OH  1 
ATOM   7716  N  N   . PRO D  4  42  ? 136.335 95.882  17.780  1.00 42.30  ? 42   PRO H N   1 
ATOM   7717  C  CA  . PRO D  4  42  ? 135.272 95.993  18.787  1.00 41.72  ? 42   PRO H CA  1 
ATOM   7718  C  C   . PRO D  4  42  ? 134.118 96.890  18.368  1.00 38.76  ? 42   PRO H C   1 
ATOM   7719  O  O   . PRO D  4  42  ? 134.264 97.788  17.522  1.00 36.30  ? 42   PRO H O   1 
ATOM   7720  C  CB  . PRO D  4  42  ? 136.004 96.534  20.000  1.00 44.16  ? 42   PRO H CB  1 
ATOM   7721  C  CG  . PRO D  4  42  ? 137.428 96.765  19.633  1.00 46.67  ? 42   PRO H CG  1 
ATOM   7722  C  CD  . PRO D  4  42  ? 137.496 96.724  18.113  1.00 46.51  ? 42   PRO H CD  1 
ATOM   7723  N  N   . LEU D  4  43  ? 132.962 96.573  18.932  1.00 38.53  ? 43   LEU H N   1 
ATOM   7724  C  CA  . LEU D  4  43  ? 131.730 97.266  18.647  1.00 43.02  ? 43   LEU H CA  1 
ATOM   7725  C  C   . LEU D  4  43  ? 131.967 98.745  18.738  1.00 46.82  ? 43   LEU H C   1 
ATOM   7726  O  O   . LEU D  4  43  ? 132.416 99.225  19.763  1.00 51.57  ? 43   LEU H O   1 
ATOM   7727  C  CB  . LEU D  4  43  ? 130.658 96.865  19.660  1.00 40.75  ? 43   LEU H CB  1 
ATOM   7728  C  CG  . LEU D  4  43  ? 130.211 95.401  19.691  1.00 40.23  ? 43   LEU H CG  1 
ATOM   7729  C  CD1 . LEU D  4  43  ? 128.797 95.312  20.247  1.00 37.86  ? 43   LEU H CD1 1 
ATOM   7730  C  CD2 . LEU D  4  43  ? 130.260 94.804  18.285  1.00 42.90  ? 43   LEU H CD2 1 
ATOM   7731  N  N   . VAL D  4  44  ? 131.663 99.465  17.667  1.00 53.59  ? 44   VAL H N   1 
ATOM   7732  C  CA  . VAL D  4  44  ? 131.722 100.918 17.692  1.00 59.71  ? 44   VAL H CA  1 
ATOM   7733  C  C   . VAL D  4  44  ? 130.464 101.504 18.353  1.00 67.07  ? 44   VAL H C   1 
ATOM   7734  O  O   . VAL D  4  44  ? 129.443 100.810 18.505  1.00 68.37  ? 44   VAL H O   1 
ATOM   7735  C  CB  . VAL D  4  44  ? 131.916 101.501 16.269  1.00 58.33  ? 44   VAL H CB  1 
ATOM   7736  C  CG1 . VAL D  4  44  ? 133.209 100.945 15.647  1.00 59.69  ? 44   VAL H CG1 1 
ATOM   7737  C  CG2 . VAL D  4  44  ? 130.709 101.198 15.393  1.00 59.90  ? 44   VAL H CG2 1 
ATOM   7738  N  N   . GLU D  4  45  ? 130.606 102.706 18.911  1.00 75.09  ? 45   GLU H N   1 
ATOM   7739  C  CA  . GLU D  4  45  ? 129.571 103.324 19.748  1.00 80.57  ? 45   GLU H CA  1 
ATOM   7740  C  C   . GLU D  4  45  ? 129.708 104.817 19.699  0.00 83.26  ? 45   GLU H C   1 
ATOM   7741  O  O   . GLU D  4  45  ? 130.554 105.349 18.980  0.00 83.50  ? 45   GLU H O   1 
ATOM   7742  C  CB  . GLU D  4  45  ? 129.870 103.080 21.237  1.00 80.77  ? 45   GLU H CB  1 
ATOM   7743  C  CG  . GLU D  4  45  ? 129.729 101.630 21.670  0.00 81.19  ? 45   GLU H CG  1 
ATOM   7744  C  CD  . GLU D  4  45  ? 129.878 101.453 23.169  0.00 81.33  ? 45   GLU H CD  1 
ATOM   7745  O  OE1 . GLU D  4  45  ? 131.002 101.640 23.680  0.00 81.45  ? 45   GLU H OE1 1 
ATOM   7746  O  OE2 . GLU D  4  45  ? 128.871 101.129 23.832  0.00 81.44  ? 45   GLU H OE2 1 
ATOM   7747  N  N   . PRO D  4  46  ? 128.880 105.523 20.452  0.00 86.25  ? 46   PRO H N   1 
ATOM   7748  C  CA  . PRO D  4  46  ? 129.115 106.926 20.692  0.00 88.79  ? 46   PRO H CA  1 
ATOM   7749  C  C   . PRO D  4  46  ? 130.407 106.969 21.512  0.00 91.26  ? 46   PRO H C   1 
ATOM   7750  O  O   . PRO D  4  46  ? 131.050 105.941 21.732  0.00 91.48  ? 46   PRO H O   1 
ATOM   7751  C  CB  . PRO D  4  46  ? 127.925 107.340 21.560  0.00 88.38  ? 46   PRO H CB  1 
ATOM   7752  C  CG  . PRO D  4  46  ? 126.903 106.293 21.304  0.00 87.73  ? 46   PRO H CG  1 
ATOM   7753  C  CD  . PRO D  4  46  ? 127.671 105.024 21.095  0.00 86.91  ? 46   PRO H CD  1 
ATOM   7754  N  N   . LEU D  4  47  ? 130.772 108.161 21.969  0.00 93.99  ? 47   LEU H N   1 
ATOM   7755  C  CA  . LEU D  4  47  ? 131.991 108.348 22.746  0.00 96.90  ? 47   LEU H CA  1 
ATOM   7756  C  C   . LEU D  4  47  ? 131.652 108.954 24.103  0.00 98.93  ? 47   LEU H C   1 
ATOM   7757  O  O   . LEU D  4  47  ? 130.580 109.536 24.280  0.00 99.15  ? 47   LEU H O   1 
ATOM   7758  C  CB  . LEU D  4  47  ? 132.963 109.267 22.000  0.00 96.84  ? 47   LEU H CB  1 
ATOM   7759  C  CG  . LEU D  4  47  ? 133.487 108.790 20.642  0.00 96.94  ? 47   LEU H CG  1 
ATOM   7760  C  CD1 . LEU D  4  47  ? 134.247 109.917 19.964  0.00 96.92  ? 47   LEU H CD1 1 
ATOM   7761  C  CD2 . LEU D  4  47  ? 134.381 107.573 20.826  0.00 96.92  ? 47   LEU H CD2 1 
ATOM   7762  N  N   . GLY D  4  48  ? 132.564 108.803 25.058  0.00 101.05 ? 48   GLY H N   1 
ATOM   7763  C  CA  . GLY D  4  48  ? 132.374 109.396 26.368  0.00 103.70 ? 48   GLY H CA  1 
ATOM   7764  C  C   . GLY D  4  48  ? 133.279 110.597 26.548  0.00 105.42 ? 48   GLY H C   1 
ATOM   7765  O  O   . GLY D  4  48  ? 134.384 110.628 26.005  0.00 105.71 ? 48   GLY H O   1 
ATOM   7766  N  N   . LEU D  4  49  ? 132.811 111.584 27.305  0.00 106.90 ? 49   LEU H N   1 
ATOM   7767  C  CA  . LEU D  4  49  ? 133.574 112.808 27.539  0.00 108.23 ? 49   LEU H CA  1 
ATOM   7768  C  C   . LEU D  4  49  ? 134.866 112.511 28.297  0.00 108.59 ? 49   LEU H C   1 
ATOM   7769  O  O   . LEU D  4  49  ? 135.907 113.108 28.025  0.00 108.88 ? 49   LEU H O   1 
ATOM   7770  C  CB  . LEU D  4  49  ? 132.732 113.818 28.325  0.00 109.06 ? 49   LEU H CB  1 
ATOM   7771  C  CG  . LEU D  4  49  ? 131.356 114.176 27.754  0.00 109.72 ? 49   LEU H CG  1 
ATOM   7772  C  CD1 . LEU D  4  49  ? 130.675 115.185 28.664  0.00 110.07 ? 49   LEU H CD1 1 
ATOM   7773  C  CD2 . LEU D  4  49  ? 131.500 114.738 26.346  0.00 110.08 ? 49   LEU H CD2 1 
ATOM   7774  N  N   . VAL D  4  50  ? 134.772 111.635 29.292  0.00 108.67 ? 50   VAL H N   1 
ATOM   7775  C  CA  . VAL D  4  50  ? 135.941 111.170 30.030  0.00 108.46 ? 50   VAL H CA  1 
ATOM   7776  C  C   . VAL D  4  50  ? 135.885 109.646 30.102  0.00 107.64 ? 50   VAL H C   1 
ATOM   7777  O  O   . VAL D  4  50  ? 134.869 109.078 30.508  0.00 107.80 ? 50   VAL H O   1 
ATOM   7778  C  CB  . VAL D  4  50  ? 135.975 111.743 31.472  0.00 109.13 ? 50   VAL H CB  1 
ATOM   7779  C  CG1 . VAL D  4  50  ? 137.222 111.257 32.199  0.00 109.66 ? 50   VAL H CG1 1 
ATOM   7780  C  CG2 . VAL D  4  50  ? 135.948 113.264 31.439  0.00 109.66 ? 50   VAL H CG2 1 
ATOM   7781  N  N   . LYS D  4  51  ? 136.935 108.995 29.613  0.00 106.32 ? 51   LYS H N   1 
ATOM   7782  C  CA  . LYS D  4  51  ? 137.042 107.541 29.649  0.00 104.81 ? 51   LYS H CA  1 
ATOM   7783  C  C   . LYS D  4  51  ? 138.515 107.171 29.532  0.00 103.38 ? 51   LYS H C   1 
ATOM   7784  O  O   . LYS D  4  51  ? 139.267 107.838 28.822  0.00 103.39 ? 51   LYS H O   1 
ATOM   7785  C  CB  . LYS D  4  51  ? 136.254 106.919 28.494  0.00 105.10 ? 51   LYS H CB  1 
ATOM   7786  C  CG  . LYS D  4  51  ? 135.664 105.549 28.806  0.00 105.24 ? 51   LYS H CG  1 
ATOM   7787  C  CD  . LYS D  4  51  ? 134.523 105.654 29.808  0.00 105.35 ? 51   LYS H CD  1 
ATOM   7788  C  CE  . LYS D  4  51  ? 134.866 104.960 31.117  0.00 105.39 ? 51   LYS H CE  1 
ATOM   7789  N  NZ  . LYS D  4  51  ? 133.843 105.223 32.166  0.00 105.40 ? 51   LYS H NZ  1 
ATOM   7790  N  N   . LEU D  4  52  ? 138.935 106.144 30.264  0.00 101.57 ? 52   LEU H N   1 
ATOM   7791  C  CA  . LEU D  4  52  ? 140.358 105.839 30.389  0.00 99.67  ? 52   LEU H CA  1 
ATOM   7792  C  C   . LEU D  4  52  ? 140.674 104.343 30.395  0.00 98.46  ? 52   LEU H C   1 
ATOM   7793  O  O   . LEU D  4  52  ? 141.840 103.951 30.438  0.00 98.36  ? 52   LEU H O   1 
ATOM   7794  C  CB  . LEU D  4  52  ? 140.918 106.483 31.662  0.00 99.27  ? 52   LEU H CB  1 
ATOM   7795  C  CG  . LEU D  4  52  ? 140.944 108.013 31.713  0.00 98.83  ? 52   LEU H CG  1 
ATOM   7796  C  CD1 . LEU D  4  52  ? 140.418 108.495 33.054  0.00 98.57  ? 52   LEU H CD1 1 
ATOM   7797  C  CD2 . LEU D  4  52  ? 142.359 108.514 31.472  0.00 98.57  ? 52   LEU H CD2 1 
ATOM   7798  N  N   . ALA D  4  53  ? 139.641 103.508 30.370  0.00 96.93  ? 53   ALA H N   1 
ATOM   7799  C  CA  . ALA D  4  53  ? 139.829 102.066 30.481  0.00 95.40  ? 53   ALA H CA  1 
ATOM   7800  C  C   . ALA D  4  53  ? 140.075 101.234 29.284  0.00 93.93  ? 53   ALA H C   1 
ATOM   7801  O  O   . ALA D  4  53  ? 139.371 101.337 28.287  0.00 94.19  ? 53   ALA H O   1 
ATOM   7802  C  CB  . ALA D  4  53  ? 138.514 101.396 30.812  0.00 95.45  ? 53   ALA H CB  1 
ATOM   7803  N  N   . PRO D  4  54  ? 141.067 100.379 29.357  1.00 93.21  ? 54   PRO H N   1 
ATOM   7804  C  CA  . PRO D  4  54  ? 141.142 99.307  28.427  1.00 90.63  ? 54   PRO H CA  1 
ATOM   7805  C  C   . PRO D  4  54  ? 139.905 98.397  28.725  1.00 86.09  ? 54   PRO H C   1 
ATOM   7806  O  O   . PRO D  4  54  ? 140.087 97.281  29.225  1.00 88.81  ? 54   PRO H O   1 
ATOM   7807  C  CB  . PRO D  4  54  ? 142.444 98.596  28.802  1.00 90.61  ? 54   PRO H CB  1 
ATOM   7808  C  CG  . PRO D  4  54  ? 143.212 99.625  29.548  1.00 89.46  ? 54   PRO H CG  1 
ATOM   7809  C  CD  . PRO D  4  54  ? 142.184 100.425 30.291  1.00 90.18  ? 54   PRO H CD  1 
ATOM   7810  N  N   . GLU D  4  55  ? 138.678 98.844  28.392  1.00 75.83  ? 55   GLU H N   1 
ATOM   7811  C  CA  . GLU D  4  55  ? 137.422 98.202  28.878  1.00 61.95  ? 55   GLU H CA  1 
ATOM   7812  C  C   . GLU D  4  55  ? 137.432 96.660  28.810  1.00 53.16  ? 55   GLU H C   1 
ATOM   7813  O  O   . GLU D  4  55  ? 137.382 96.092  27.725  1.00 50.49  ? 55   GLU H O   1 
ATOM   7814  C  CB  . GLU D  4  55  ? 136.212 98.747  28.106  1.00 56.30  ? 55   GLU H CB  1 
ATOM   7815  C  CG  . GLU D  4  55  ? 134.860 98.242  28.597  1.00 48.21  ? 55   GLU H CG  1 
ATOM   7816  C  CD  . GLU D  4  55  ? 133.692 98.964  27.951  0.00 49.38  ? 55   GLU H CD  1 
ATOM   7817  O  OE1 . GLU D  4  55  ? 133.472 98.781  26.735  0.00 48.25  ? 55   GLU H OE1 1 
ATOM   7818  O  OE2 . GLU D  4  55  ? 132.983 99.705  28.665  0.00 48.25  ? 55   GLU H OE2 1 
ATOM   7819  N  N   . ASP D  4  56  ? 137.460 95.996  29.968  1.00 45.30  ? 56   ASP H N   1 
ATOM   7820  C  CA  . ASP D  4  56  ? 137.954 94.610  30.065  1.00 42.07  ? 56   ASP H CA  1 
ATOM   7821  C  C   . ASP D  4  56  ? 137.255 93.632  29.121  1.00 40.97  ? 56   ASP H C   1 
ATOM   7822  O  O   . ASP D  4  56  ? 137.873 92.679  28.623  1.00 34.48  ? 56   ASP H O   1 
ATOM   7823  C  CB  . ASP D  4  56  ? 137.783 94.057  31.479  1.00 42.17  ? 56   ASP H CB  1 
ATOM   7824  C  CG  . ASP D  4  56  ? 138.578 94.800  32.522  1.00 38.39  ? 56   ASP H CG  1 
ATOM   7825  O  OD1 . ASP D  4  56  ? 139.304 95.762  32.212  1.00 40.47  ? 56   ASP H OD1 1 
ATOM   7826  O  OD2 . ASP D  4  56  ? 138.453 94.404  33.691  1.00 38.99  ? 56   ASP H OD2 1 
ATOM   7827  N  N   . GLY D  4  57  ? 135.930 93.785  29.038  1.00 40.80  ? 57   GLY H N   1 
ATOM   7828  C  CA  . GLY D  4  57  ? 135.074 92.886  28.276  1.00 40.99  ? 57   GLY H CA  1 
ATOM   7829  C  C   . GLY D  4  57  ? 135.395 92.788  26.800  1.00 40.37  ? 57   GLY H C   1 
ATOM   7830  O  O   . GLY D  4  57  ? 135.335 91.696  26.216  1.00 44.30  ? 57   GLY H O   1 
ATOM   7831  N  N   . GLN D  4  58  ? 135.905 93.892  26.258  1.00 36.54  ? 58   GLN H N   1 
ATOM   7832  C  CA  . GLN D  4  58  ? 136.337 93.988  24.875  1.00 33.85  ? 58   GLN H CA  1 
ATOM   7833  C  C   . GLN D  4  58  ? 137.618 93.204  24.607  1.00 32.18  ? 58   GLN H C   1 
ATOM   7834  O  O   . GLN D  4  58  ? 137.900 92.842  23.472  1.00 38.73  ? 58   GLN H O   1 
ATOM   7835  C  CB  . GLN D  4  58  ? 136.532 95.456  24.516  1.00 33.67  ? 58   GLN H CB  1 
ATOM   7836  C  CG  . GLN D  4  58  ? 135.370 96.314  24.962  1.00 43.13  ? 58   GLN H CG  1 
ATOM   7837  C  CD  . GLN D  4  58  ? 135.234 97.591  24.158  1.00 52.75  ? 58   GLN H CD  1 
ATOM   7838  O  OE1 . GLN D  4  58  ? 134.272 97.763  23.394  1.00 56.77  ? 58   GLN H OE1 1 
ATOM   7839  N  NE2 . GLN D  4  58  ? 136.171 98.516  24.355  1.00 53.83  ? 58   GLN H NE2 1 
ATOM   7840  N  N   . VAL D  4  59  ? 138.368 92.903  25.653  1.00 25.64  ? 59   VAL H N   1 
ATOM   7841  C  CA  . VAL D  4  59  ? 139.552 92.091  25.520  1.00 22.66  ? 59   VAL H CA  1 
ATOM   7842  C  C   . VAL D  4  59  ? 139.165 90.635  25.626  1.00 24.54  ? 59   VAL H C   1 
ATOM   7843  O  O   . VAL D  4  59  ? 139.718 89.781  24.928  1.00 25.26  ? 59   VAL H O   1 
ATOM   7844  C  CB  . VAL D  4  59  ? 140.530 92.409  26.639  1.00 24.63  ? 59   VAL H CB  1 
ATOM   7845  C  CG1 . VAL D  4  59  ? 141.667 91.388  26.661  1.00 27.49  ? 59   VAL H CG1 1 
ATOM   7846  C  CG2 . VAL D  4  59  ? 141.066 93.808  26.448  1.00 22.42  ? 59   VAL H CG2 1 
ATOM   7847  N  N   . TYR D  4  60  ? 138.308 90.347  26.602  1.00 20.71  ? 60   TYR H N   1 
ATOM   7848  C  CA  . TYR D  4  60  ? 137.973 88.973  26.949  1.00 21.57  ? 60   TYR H CA  1 
ATOM   7849  C  C   . TYR D  4  60  ? 137.236 88.296  25.828  1.00 20.23  ? 60   TYR H C   1 
ATOM   7850  O  O   . TYR D  4  60  ? 137.447 87.127  25.561  1.00 22.19  ? 60   TYR H O   1 
ATOM   7851  C  CB  . TYR D  4  60  ? 137.110 88.915  28.211  1.00 23.53  ? 60   TYR H CB  1 
ATOM   7852  C  CG  . TYR D  4  60  ? 137.757 89.489  29.456  1.00 21.26  ? 60   TYR H CG  1 
ATOM   7853  C  CD1 . TYR D  4  60  ? 139.133 89.395  29.674  1.00 21.27  ? 60   TYR H CD1 1 
ATOM   7854  C  CD2 . TYR D  4  60  ? 136.984 90.093  30.432  1.00 22.30  ? 60   TYR H CD2 1 
ATOM   7855  C  CE1 . TYR D  4  60  ? 139.710 89.889  30.850  1.00 25.39  ? 60   TYR H CE1 1 
ATOM   7856  C  CE2 . TYR D  4  60  ? 137.551 90.595  31.597  1.00 26.47  ? 60   TYR H CE2 1 
ATOM   7857  C  CZ  . TYR D  4  60  ? 138.907 90.487  31.799  1.00 23.08  ? 60   TYR H CZ  1 
ATOM   7858  O  OH  . TYR D  4  60  ? 139.426 90.960  32.964  1.00 25.18  ? 60   TYR H OH  1 
ATOM   7859  N  N   . GLU D  4  61  ? 136.365 89.031  25.161  1.00 20.04  ? 61   GLU H N   1 
ATOM   7860  C  CA  . GLU D  4  61  ? 135.590 88.417  24.109  1.00 20.23  ? 61   GLU H CA  1 
ATOM   7861  C  C   . GLU D  4  61  ? 136.356 88.138  22.822  1.00 22.35  ? 61   GLU H C   1 
ATOM   7862  O  O   . GLU D  4  61  ? 135.897 87.351  21.997  1.00 26.89  ? 61   GLU H O   1 
ATOM   7863  C  CB  . GLU D  4  61  ? 134.376 89.265  23.806  1.00 18.68  ? 61   GLU H CB  1 
ATOM   7864  C  CG  . GLU D  4  61  ? 134.667 90.556  23.107  1.00 17.89  ? 61   GLU H CG  1 
ATOM   7865  C  CD  . GLU D  4  61  ? 133.432 91.428  23.016  1.00 23.26  ? 61   GLU H CD  1 
ATOM   7866  O  OE1 . GLU D  4  61  ? 132.358 91.014  23.520  1.00 25.84  ? 61   GLU H OE1 1 
ATOM   7867  O  OE2 . GLU D  4  61  ? 133.524 92.523  22.435  1.00 22.77  ? 61   GLU H OE2 1 
ATOM   7868  N  N   . LEU D  4  62  ? 137.479 88.818  22.618  1.00 23.18  ? 62   LEU H N   1 
ATOM   7869  C  CA  . LEU D  4  62  ? 138.217 88.691  21.373  1.00 18.72  ? 62   LEU H CA  1 
ATOM   7870  C  C   . LEU D  4  62  ? 139.063 87.471  21.436  1.00 19.45  ? 62   LEU H C   1 
ATOM   7871  O  O   . LEU D  4  62  ? 139.633 87.181  22.464  1.00 22.03  ? 62   LEU H O   1 
ATOM   7872  C  CB  . LEU D  4  62  ? 139.128 89.870  21.169  1.00 20.60  ? 62   LEU H CB  1 
ATOM   7873  C  CG  . LEU D  4  62  ? 138.376 91.094  20.695  1.00 26.28  ? 62   LEU H CG  1 
ATOM   7874  C  CD1 . LEU D  4  62  ? 139.404 92.016  20.101  1.00 29.09  ? 62   LEU H CD1 1 
ATOM   7875  C  CD2 . LEU D  4  62  ? 137.321 90.719  19.651  1.00 22.30  ? 62   LEU H CD2 1 
ATOM   7876  N  N   . PRO D  4  63  ? 139.260 86.809  20.305  1.00 21.33  ? 63   PRO H N   1 
ATOM   7877  C  CA  . PRO D  4  63  ? 140.326 85.804  20.235  1.00 22.28  ? 63   PRO H CA  1 
ATOM   7878  C  C   . PRO D  4  63  ? 141.674 86.458  20.043  1.00 23.93  ? 63   PRO H C   1 
ATOM   7879  O  O   . PRO D  4  63  ? 141.773 87.655  19.750  1.00 26.41  ? 63   PRO H O   1 
ATOM   7880  C  CB  . PRO D  4  63  ? 139.945 84.957  19.016  1.00 22.97  ? 63   PRO H CB  1 
ATOM   7881  C  CG  . PRO D  4  63  ? 139.143 85.903  18.125  1.00 23.86  ? 63   PRO H CG  1 
ATOM   7882  C  CD  . PRO D  4  63  ? 138.585 87.011  19.007  1.00 21.37  ? 63   PRO H CD  1 
ATOM   7883  N  N   . TYR D  4  64  ? 142.700 85.630  20.023  1.00 24.75  ? 64   TYR H N   1 
ATOM   7884  C  CA  . TYR D  4  64  ? 144.006 86.114  19.671  1.00 30.91  ? 64   TYR H CA  1 
ATOM   7885  C  C   . TYR D  4  64  ? 144.001 86.360  18.185  1.00 30.95  ? 64   TYR H C   1 
ATOM   7886  O  O   . TYR D  4  64  ? 143.301 85.670  17.462  1.00 36.29  ? 64   TYR H O   1 
ATOM   7887  C  CB  . TYR D  4  64  ? 145.046 85.075  20.059  1.00 38.81  ? 64   TYR H CB  1 
ATOM   7888  C  CG  . TYR D  4  64  ? 145.414 85.156  21.528  1.00 55.61  ? 64   TYR H CG  1 
ATOM   7889  C  CD1 . TYR D  4  64  ? 145.915 86.345  22.081  1.00 62.09  ? 64   TYR H CD1 1 
ATOM   7890  C  CD2 . TYR D  4  64  ? 145.321 84.038  22.357  1.00 60.84  ? 64   TYR H CD2 1 
ATOM   7891  C  CE1 . TYR D  4  64  ? 146.335 86.407  23.414  1.00 66.79  ? 64   TYR H CE1 1 
ATOM   7892  C  CE2 . TYR D  4  64  ? 145.739 84.092  23.689  1.00 65.88  ? 64   TYR H CE2 1 
ATOM   7893  C  CZ  . TYR D  4  64  ? 146.262 85.270  24.203  1.00 68.09  ? 64   TYR H CZ  1 
ATOM   7894  O  OH  . TYR D  4  64  ? 146.874 85.251  25.435  1.00 74.39  ? 64   TYR H OH  1 
ATOM   7895  N  N   . PRO D  4  65  ? 144.699 87.400  17.714  1.00 31.75  ? 65   PRO H N   1 
ATOM   7896  C  CA  . PRO D  4  65  ? 144.787 87.614  16.269  1.00 31.86  ? 65   PRO H CA  1 
ATOM   7897  C  C   . PRO D  4  65  ? 145.329 86.405  15.531  1.00 34.93  ? 65   PRO H C   1 
ATOM   7898  O  O   . PRO D  4  65  ? 146.071 85.609  16.119  1.00 34.75  ? 65   PRO H O   1 
ATOM   7899  C  CB  . PRO D  4  65  ? 145.717 88.809  16.152  1.00 31.03  ? 65   PRO H CB  1 
ATOM   7900  C  CG  . PRO D  4  65  ? 145.378 89.607  17.345  1.00 30.82  ? 65   PRO H CG  1 
ATOM   7901  C  CD  . PRO D  4  65  ? 145.215 88.563  18.449  1.00 31.76  ? 65   PRO H CD  1 
ATOM   7902  N  N   . LYS D  4  66  ? 144.741 86.141  14.358  1.00 36.32  ? 66   LYS H N   1 
ATOM   7903  C  CA  . LYS D  4  66  ? 145.276 85.178  13.379  1.00 34.26  ? 66   LYS H CA  1 
ATOM   7904  C  C   . LYS D  4  66  ? 145.700 85.908  12.083  1.00 32.93  ? 66   LYS H C   1 
ATOM   7905  O  O   . LYS D  4  66  ? 145.196 87.014  11.786  1.00 32.72  ? 66   LYS H O   1 
ATOM   7906  C  CB  . LYS D  4  66  ? 144.241 84.066  13.078  1.00 30.83  ? 66   LYS H CB  1 
ATOM   7907  C  CG  . LYS D  4  66  ? 143.198 84.413  12.013  1.00 28.86  ? 66   LYS H CG  1 
ATOM   7908  C  CD  . LYS D  4  66  ? 142.116 83.374  11.898  1.00 22.19  ? 66   LYS H CD  1 
ATOM   7909  C  CE  . LYS D  4  66  ? 142.618 82.085  11.317  1.00 17.96  ? 66   LYS H CE  1 
ATOM   7910  N  NZ  . LYS D  4  66  ? 141.453 81.385  10.758  1.00 15.01  ? 66   LYS H NZ  1 
ATOM   7911  N  N   . THR D  4  67  ? 146.726 85.371  11.413  1.00 31.75  ? 67   THR H N   1 
ATOM   7912  C  CA  . THR D  4  67  ? 147.196 85.919  10.133  1.00 34.38  ? 67   THR H CA  1 
ATOM   7913  C  C   . THR D  4  67  ? 147.187 84.899  8.981   1.00 34.66  ? 67   THR H C   1 
ATOM   7914  O  O   . THR D  4  67  ? 147.703 83.771  9.094   1.00 34.82  ? 67   THR H O   1 
ATOM   7915  C  CB  . THR D  4  67  ? 148.611 86.530  10.258  1.00 32.49  ? 67   THR H CB  1 
ATOM   7916  O  OG1 . THR D  4  67  ? 148.629 87.473  11.335  1.00 36.77  ? 67   THR H OG1 1 
ATOM   7917  C  CG2 . THR D  4  67  ? 148.996 87.246  8.988   1.00 32.54  ? 67   THR H CG2 1 
ATOM   7918  N  N   . PHE D  4  68  ? 146.481 85.259  7.921   1.00 31.01  ? 68   PHE H N   1 
ATOM   7919  C  CA  . PHE D  4  68  ? 146.499 84.465  6.717   1.00 31.96  ? 68   PHE H CA  1 
ATOM   7920  C  C   . PHE D  4  68  ? 147.669 84.979  5.895   1.00 32.07  ? 68   PHE H C   1 
ATOM   7921  O  O   . PHE D  4  68  ? 147.881 86.201  5.805   1.00 31.73  ? 68   PHE H O   1 
ATOM   7922  C  CB  . PHE D  4  68  ? 145.205 84.671  5.944   1.00 29.67  ? 68   PHE H CB  1 
ATOM   7923  C  CG  . PHE D  4  68  ? 143.973 84.467  6.761   1.00 25.24  ? 68   PHE H CG  1 
ATOM   7924  C  CD1 . PHE D  4  68  ? 143.559 83.185  7.096   1.00 19.70  ? 68   PHE H CD1 1 
ATOM   7925  C  CD2 . PHE D  4  68  ? 143.189 85.556  7.135   1.00 23.76  ? 68   PHE H CD2 1 
ATOM   7926  C  CE1 . PHE D  4  68  ? 142.389 82.990  7.769   1.00 18.92  ? 68   PHE H CE1 1 
ATOM   7927  C  CE2 . PHE D  4  68  ? 142.010 85.374  7.821   1.00 19.42  ? 68   PHE H CE2 1 
ATOM   7928  C  CZ  . PHE D  4  68  ? 141.604 84.086  8.135   1.00 20.88  ? 68   PHE H CZ  1 
ATOM   7929  N  N   . VAL D  4  69  ? 148.460 84.069  5.344   1.00 28.11  ? 69   VAL H N   1 
ATOM   7930  C  CA  . VAL D  4  69  ? 149.448 84.483  4.379   1.00 29.78  ? 69   VAL H CA  1 
ATOM   7931  C  C   . VAL D  4  69  ? 148.864 84.248  2.995   1.00 30.84  ? 69   VAL H C   1 
ATOM   7932  O  O   . VAL D  4  69  ? 148.359 83.167  2.689   1.00 34.18  ? 69   VAL H O   1 
ATOM   7933  C  CB  . VAL D  4  69  ? 150.814 83.777  4.591   1.00 30.45  ? 69   VAL H CB  1 
ATOM   7934  C  CG1 . VAL D  4  69  ? 150.979 83.397  6.051   1.00 32.44  ? 69   VAL H CG1 1 
ATOM   7935  C  CG2 . VAL D  4  69  ? 150.950 82.567  3.728   1.00 34.06  ? 69   VAL H CG2 1 
ATOM   7936  N  N   . LEU D  4  70  ? 148.662 85.366  2.312   1.00 29.53  ? 70   LEU H N   1 
ATOM   7937  C  CA  . LEU D  4  70  ? 147.855 85.458  1.120   1.00 29.51  ? 70   LEU H CA  1 
ATOM   7938  C  C   . LEU D  4  70  ? 148.542 84.784  -0.057  1.00 35.20  ? 70   LEU H C   1 
ATOM   7939  O  O   . LEU D  4  70  ? 149.773 84.770  -0.133  1.00 37.56  ? 70   LEU H O   1 
ATOM   7940  C  CB  . LEU D  4  70  ? 147.627 86.923  0.809   1.00 28.80  ? 70   LEU H CB  1 
ATOM   7941  C  CG  . LEU D  4  70  ? 146.825 87.643  1.886   1.00 27.62  ? 70   LEU H CG  1 
ATOM   7942  C  CD1 . LEU D  4  70  ? 146.608 89.101  1.524   1.00 28.38  ? 70   LEU H CD1 1 
ATOM   7943  C  CD2 . LEU D  4  70  ? 145.514 86.928  2.029   1.00 26.75  ? 70   LEU H CD2 1 
ATOM   7944  N  N   . PRO D  4  71  ? 147.762 84.193  -0.983  1.00 35.89  ? 71   PRO H N   1 
ATOM   7945  C  CA  . PRO D  4  71  ? 148.378 83.313  -1.965  1.00 38.42  ? 71   PRO H CA  1 
ATOM   7946  C  C   . PRO D  4  71  ? 149.316 84.093  -2.877  1.00 42.23  ? 71   PRO H C   1 
ATOM   7947  O  O   . PRO D  4  71  ? 150.380 83.602  -3.251  1.00 46.28  ? 71   PRO H O   1 
ATOM   7948  C  CB  . PRO D  4  71  ? 147.181 82.733  -2.719  1.00 37.14  ? 71   PRO H CB  1 
ATOM   7949  C  CG  . PRO D  4  71  ? 146.128 83.748  -2.557  1.00 36.25  ? 71   PRO H CG  1 
ATOM   7950  C  CD  . PRO D  4  71  ? 146.302 84.237  -1.156  1.00 36.74  ? 71   PRO H CD  1 
ATOM   7951  N  N   . HIS D  4  72  ? 148.950 85.318  -3.226  1.00 44.83  ? 72   HIS H N   1 
ATOM   7952  C  CA  . HIS D  4  72  ? 149.803 86.077  -4.141  1.00 50.72  ? 72   HIS H CA  1 
ATOM   7953  C  C   . HIS D  4  72  ? 150.546 87.199  -3.434  1.00 52.22  ? 72   HIS H C   1 
ATOM   7954  O  O   . HIS D  4  72  ? 150.841 88.235  -4.042  1.00 55.23  ? 72   HIS H O   1 
ATOM   7955  C  CB  . HIS D  4  72  ? 148.996 86.622  -5.334  1.00 49.80  ? 72   HIS H CB  1 
ATOM   7956  C  CG  . HIS D  4  72  ? 148.319 85.552  -6.135  1.00 49.76  ? 72   HIS H CG  1 
ATOM   7957  N  ND1 . HIS D  4  72  ? 149.018 84.587  -6.830  1.00 51.67  ? 72   HIS H ND1 1 
ATOM   7958  C  CD2 . HIS D  4  72  ? 147.012 85.218  -6.242  1.00 49.42  ? 72   HIS H CD2 1 
ATOM   7959  C  CE1 . HIS D  4  72  ? 148.168 83.706  -7.330  1.00 50.59  ? 72   HIS H CE1 1 
ATOM   7960  N  NE2 . HIS D  4  72  ? 146.945 84.067  -6.987  1.00 49.00  ? 72   HIS H NE2 1 
ATOM   7961  N  N   . GLY D  4  73  ? 150.838 86.983  -2.151  1.00 52.11  ? 73   GLY H N   1 
ATOM   7962  C  CA  . GLY D  4  73  ? 151.694 87.891  -1.409  1.00 49.93  ? 73   GLY H CA  1 
ATOM   7963  C  C   . GLY D  4  73  ? 150.987 88.836  -0.460  1.00 46.70  ? 73   GLY H C   1 
ATOM   7964  O  O   . GLY D  4  73  ? 149.977 89.458  -0.797  1.00 46.21  ? 73   GLY H O   1 
ATOM   7965  N  N   . GLY D  4  74  ? 151.601 89.037  0.696   1.00 45.82  ? 74   GLY H N   1 
ATOM   7966  C  CA  . GLY D  4  74  ? 150.968 89.825  1.737   1.00 47.06  ? 74   GLY H CA  1 
ATOM   7967  C  C   . GLY D  4  74  ? 150.387 88.954  2.840   1.00 45.20  ? 74   GLY H C   1 
ATOM   7968  O  O   . GLY D  4  74  ? 150.546 87.724  2.831   1.00 47.79  ? 74   GLY H O   1 
ATOM   7969  N  N   . THR D  4  75  ? 149.791 89.597  3.836   1.00 40.31  ? 75   THR H N   1 
ATOM   7970  C  CA  . THR D  4  75  ? 149.142 88.888  4.918   1.00 36.76  ? 75   THR H CA  1 
ATOM   7971  C  C   . THR D  4  75  ? 147.950 89.686  5.346   1.00 35.80  ? 75   THR H C   1 
ATOM   7972  O  O   . THR D  4  75  ? 147.874 90.888  5.103   1.00 32.86  ? 75   THR H O   1 
ATOM   7973  C  CB  . THR D  4  75  ? 150.036 88.766  6.128   1.00 36.55  ? 75   THR H CB  1 
ATOM   7974  O  OG1 . THR D  4  75  ? 150.669 90.029  6.377   1.00 42.31  ? 75   THR H OG1 1 
ATOM   7975  C  CG2 . THR D  4  75  ? 151.060 87.678  5.916   1.00 30.71  ? 75   THR H CG2 1 
ATOM   7976  N  N   . VAL D  4  76  ? 147.021 89.019  6.007   1.00 35.88  ? 76   VAL H N   1 
ATOM   7977  C  CA  . VAL D  4  76  ? 145.913 89.722  6.596   1.00 33.78  ? 76   VAL H CA  1 
ATOM   7978  C  C   . VAL D  4  76  ? 145.769 89.177  7.989   1.00 30.95  ? 76   VAL H C   1 
ATOM   7979  O  O   . VAL D  4  76  ? 145.983 87.985  8.223   1.00 26.68  ? 76   VAL H O   1 
ATOM   7980  C  CB  . VAL D  4  76  ? 144.626 89.502  5.792   1.00 36.17  ? 76   VAL H CB  1 
ATOM   7981  C  CG1 . VAL D  4  76  ? 143.472 90.224  6.448   1.00 39.50  ? 76   VAL H CG1 1 
ATOM   7982  C  CG2 . VAL D  4  76  ? 144.801 90.044  4.390   1.00 41.55  ? 76   VAL H CG2 1 
ATOM   7983  N  N   . THR D  4  77  ? 145.555 90.084  8.928   1.00 28.38  ? 77   THR H N   1 
ATOM   7984  C  CA  . THR D  4  77  ? 145.426 89.715  10.317  1.00 28.99  ? 77   THR H CA  1 
ATOM   7985  C  C   . THR D  4  77  ? 144.052 90.098  10.814  1.00 28.36  ? 77   THR H C   1 
ATOM   7986  O  O   . THR D  4  77  ? 143.575 91.213  10.561  1.00 26.03  ? 77   THR H O   1 
ATOM   7987  C  CB  . THR D  4  77  ? 146.502 90.407  11.181  1.00 30.51  ? 77   THR H CB  1 
ATOM   7988  O  OG1 . THR D  4  77  ? 147.802 90.007  10.722  1.00 34.34  ? 77   THR H OG1 1 
ATOM   7989  C  CG2 . THR D  4  77  ? 146.350 90.011  12.647  1.00 34.70  ? 77   THR H CG2 1 
ATOM   7990  N  N   . VAL D  4  78  ? 143.388 89.147  11.460  1.00 25.04  ? 78   VAL H N   1 
ATOM   7991  C  CA  . VAL D  4  78  ? 142.081 89.414  12.018  1.00 25.40  ? 78   VAL H CA  1 
ATOM   7992  C  C   . VAL D  4  78  ? 142.085 88.827  13.407  1.00 28.24  ? 78   VAL H C   1 
ATOM   7993  O  O   . VAL D  4  78  ? 142.674 87.765  13.626  1.00 30.02  ? 78   VAL H O   1 
ATOM   7994  C  CB  . VAL D  4  78  ? 140.953 88.783  11.153  1.00 22.34  ? 78   VAL H CB  1 
ATOM   7995  C  CG1 . VAL D  4  78  ? 140.648 89.683  9.969   1.00 14.05  ? 78   VAL H CG1 1 
ATOM   7996  C  CG2 . VAL D  4  78  ? 141.377 87.416  10.667  1.00 21.29  ? 78   VAL H CG2 1 
ATOM   7997  N  N   . PRO D  4  79  ? 141.440 89.509  14.373  1.00 27.65  ? 79   PRO H N   1 
ATOM   7998  C  CA  . PRO D  4  79  ? 140.699 90.763  14.173  1.00 27.51  ? 79   PRO H CA  1 
ATOM   7999  C  C   . PRO D  4  79  ? 141.660 91.928  14.039  1.00 30.56  ? 79   PRO H C   1 
ATOM   8000  O  O   . PRO D  4  79  ? 142.860 91.788  14.300  1.00 32.22  ? 79   PRO H O   1 
ATOM   8001  C  CB  . PRO D  4  79  ? 139.873 90.887  15.440  1.00 25.71  ? 79   PRO H CB  1 
ATOM   8002  C  CG  . PRO D  4  79  ? 140.407 89.955  16.486  1.00 24.16  ? 79   PRO H CG  1 
ATOM   8003  C  CD  . PRO D  4  79  ? 141.306 88.980  15.772  1.00 23.35  ? 79   PRO H CD  1 
ATOM   8004  N  N   . ARG D  4  80  ? 141.135 93.063  13.602  1.00 29.23  ? 80   ARG H N   1 
ATOM   8005  C  CA  . ARG D  4  80  ? 141.882 94.293  13.655  1.00 37.19  ? 80   ARG H CA  1 
ATOM   8006  C  C   . ARG D  4  80  ? 140.940 95.477  13.643  1.00 40.96  ? 80   ARG H C   1 
ATOM   8007  O  O   . ARG D  4  80  ? 139.744 95.325  13.388  1.00 41.19  ? 80   ARG H O   1 
ATOM   8008  C  CB  . ARG D  4  80  ? 142.866 94.375  12.490  1.00 39.87  ? 80   ARG H CB  1 
ATOM   8009  C  CG  . ARG D  4  80  ? 142.237 94.614  11.131  1.00 44.80  ? 80   ARG H CG  1 
ATOM   8010  C  CD  . ARG D  4  80  ? 143.294 94.657  10.025  1.00 42.66  ? 80   ARG H CD  1 
ATOM   8011  N  NE  . ARG D  4  80  ? 142.692 94.721  8.690   1.00 40.73  ? 80   ARG H NE  1 
ATOM   8012  C  CZ  . ARG D  4  80  ? 142.364 93.654  7.967   1.00 41.16  ? 80   ARG H CZ  1 
ATOM   8013  N  NH1 . ARG D  4  80  ? 142.692 92.437  8.389   1.00 41.84  ? 80   ARG H NH1 1 
ATOM   8014  N  NH2 . ARG D  4  80  ? 141.768 93.807  6.792   1.00 39.12  ? 80   ARG H NH2 1 
ATOM   8015  N  N   . ARG D  4  81  ? 141.452 96.618  14.084  1.00 48.02  ? 81   ARG H N   1 
ATOM   8016  C  CA  . ARG D  4  81  ? 140.660 97.833  14.161  1.00 57.55  ? 81   ARG H CA  1 
ATOM   8017  C  C   . ARG D  4  81  ? 140.554 98.385  12.751  1.00 61.84  ? 81   ARG H C   1 
ATOM   8018  O  O   . ARG D  4  81  ? 141.572 98.611  12.079  1.00 63.46  ? 81   ARG H O   1 
ATOM   8019  C  CB  . ARG D  4  81  ? 141.335 98.861  15.084  1.00 62.86  ? 81   ARG H CB  1 
ATOM   8020  C  CG  . ARG D  4  81  ? 140.367 99.780  15.831  1.00 64.98  ? 81   ARG H CG  1 
ATOM   8021  C  CD  . ARG D  4  81  ? 141.098 100.918 16.525  0.00 64.81  ? 81   ARG H CD  1 
ATOM   8022  N  NE  . ARG D  4  81  ? 140.188 101.746 17.312  0.00 65.34  ? 81   ARG H NE  1 
ATOM   8023  C  CZ  . ARG D  4  81  ? 139.953 103.036 17.087  0.00 65.46  ? 81   ARG H CZ  1 
ATOM   8024  N  NH1 . ARG D  4  81  ? 140.629 103.691 16.151  0.00 65.61  ? 81   ARG H NH1 1 
ATOM   8025  N  NH2 . ARG D  4  81  ? 139.069 103.685 17.832  0.00 65.61  ? 81   ARG H NH2 1 
ATOM   8026  N  N   . ARG D  4  82  ? 139.322 98.461  12.264  1.00 65.35  ? 82   ARG H N   1 
ATOM   8027  C  CA  . ARG D  4  82  ? 139.047 98.861  10.889  1.00 66.99  ? 82   ARG H CA  1 
ATOM   8028  C  C   . ARG D  4  82  ? 137.905 99.862  10.936  1.00 71.79  ? 82   ARG H C   1 
ATOM   8029  O  O   . ARG D  4  82  ? 136.742 99.496  10.733  1.00 74.58  ? 82   ARG H O   1 
ATOM   8030  C  CB  . ARG D  4  82  ? 138.604 97.650  10.044  1.00 64.67  ? 82   ARG H CB  1 
ATOM   8031  C  CG  . ARG D  4  82  ? 139.639 96.563  9.807   1.00 57.22  ? 82   ARG H CG  1 
ATOM   8032  C  CD  . ARG D  4  82  ? 139.186 95.607  8.718   1.00 53.53  ? 82   ARG H CD  1 
ATOM   8033  N  NE  . ARG D  4  82  ? 138.845 96.313  7.484   1.00 53.74  ? 82   ARG H NE  1 
ATOM   8034  C  CZ  . ARG D  4  82  ? 138.371 95.728  6.390   1.00 50.82  ? 82   ARG H CZ  1 
ATOM   8035  N  NH1 . ARG D  4  82  ? 138.301 94.406  6.331   1.00 53.32  ? 82   ARG H NH1 1 
ATOM   8036  N  NH2 . ARG D  4  82  ? 138.002 96.462  5.347   1.00 47.44  ? 82   ARG H NH2 1 
ATOM   8037  N  N   . PRO D  4  83  ? 138.193 101.108 11.329  1.00 75.48  ? 83   PRO H N   1 
ATOM   8038  C  CA  . PRO D  4  83  ? 137.090 102.072 11.360  1.00 76.48  ? 83   PRO H CA  1 
ATOM   8039  C  C   . PRO D  4  83  ? 136.667 102.490 9.948   1.00 75.51  ? 83   PRO H C   1 
ATOM   8040  O  O   . PRO D  4  83  ? 137.429 102.336 8.977   1.00 76.11  ? 83   PRO H O   1 
ATOM   8041  C  CB  . PRO D  4  83  ? 137.656 103.241 12.177  1.00 77.41  ? 83   PRO H CB  1 
ATOM   8042  C  CG  . PRO D  4  83  ? 139.182 103.032 12.191  1.00 78.27  ? 83   PRO H CG  1 
ATOM   8043  C  CD  . PRO D  4  83  ? 139.498 101.784 11.386  1.00 77.62  ? 83   PRO H CD  1 
ATOM   8044  N  N   . GLU D  4  84  ? 135.417 102.913 9.820   1.00 73.16  ? 84   GLU H N   1 
ATOM   8045  C  CA  . GLU D  4  84  ? 134.921 103.360 8.533   1.00 73.65  ? 84   GLU H CA  1 
ATOM   8046  C  C   . GLU D  4  84  ? 135.131 104.866 8.468   1.00 74.65  ? 84   GLU H C   1 
ATOM   8047  O  O   . GLU D  4  84  ? 134.538 105.617 9.255   1.00 75.33  ? 84   GLU H O   1 
ATOM   8048  C  CB  . GLU D  4  84  ? 133.438 102.991 8.360   1.00 72.63  ? 84   GLU H CB  1 
ATOM   8049  C  CG  . GLU D  4  84  ? 133.098 101.536 8.739   1.00 67.09  ? 84   GLU H CG  1 
ATOM   8050  C  CD  . GLU D  4  84  ? 133.128 100.560 7.568   1.00 62.34  ? 84   GLU H CD  1 
ATOM   8051  O  OE1 . GLU D  4  84  ? 132.258 100.700 6.681   1.00 60.22  ? 84   GLU H OE1 1 
ATOM   8052  O  OE2 . GLU D  4  84  ? 133.961 99.613  7.584   1.00 56.62  ? 84   GLU H OE2 1 
ATOM   8053  N  N   . THR D  4  85  ? 136.136 105.259 7.683   1.00 74.83  ? 85   THR H N   1 
ATOM   8054  C  CA  . THR D  4  85  ? 136.525 106.656 7.527   1.00 72.64  ? 85   THR H CA  1 
ATOM   8055  C  C   . THR D  4  85  ? 135.508 107.442 6.690   1.00 71.93  ? 85   THR H C   1 
ATOM   8056  O  O   . THR D  4  85  ? 135.174 108.589 7.015   1.00 71.64  ? 85   THR H O   1 
ATOM   8057  C  CB  . THR D  4  85  ? 137.909 106.764 6.860   0.00 72.51  ? 85   THR H CB  1 
ATOM   8058  O  OG1 . THR D  4  85  ? 137.975 105.859 5.750   0.00 72.08  ? 85   THR H OG1 1 
ATOM   8059  C  CG2 . THR D  4  85  ? 139.007 106.419 7.854   0.00 72.08  ? 85   THR H CG2 1 
ATOM   8060  N  N   . ARG D  4  86  ? 135.034 106.822 5.609   1.00 70.17  ? 86   ARG H N   1 
ATOM   8061  C  CA  . ARG D  4  86  ? 134.146 107.480 4.653   1.00 67.52  ? 86   ARG H CA  1 
ATOM   8062  C  C   . ARG D  4  86  ? 132.947 108.155 5.304   1.00 66.56  ? 86   ARG H C   1 
ATOM   8063  O  O   . ARG D  4  86  ? 132.274 107.564 6.149   1.00 68.44  ? 86   ARG H O   1 
ATOM   8064  C  CB  . ARG D  4  86  ? 133.643 106.479 3.615   1.00 66.28  ? 86   ARG H CB  1 
ATOM   8065  C  CG  . ARG D  4  86  ? 132.519 107.023 2.738   1.00 63.87  ? 86   ARG H CG  1 
ATOM   8066  C  CD  . ARG D  4  86  ? 132.307 106.163 1.510   1.00 64.74  ? 86   ARG H CD  1 
ATOM   8067  N  NE  . ARG D  4  86  ? 131.555 104.953 1.822   1.00 61.54  ? 86   ARG H NE  1 
ATOM   8068  C  CZ  . ARG D  4  86  ? 130.243 104.843 1.668   1.00 61.09  ? 86   ARG H CZ  1 
ATOM   8069  N  NH1 . ARG D  4  86  ? 129.555 105.850 1.138   1.00 60.57  ? 86   ARG H NH1 1 
ATOM   8070  N  NH2 . ARG D  4  86  ? 129.629 103.716 2.004   1.00 60.04  ? 86   ARG H NH2 1 
ATOM   8071  N  N   . GLU D  4  87  ? 132.614 109.341 4.802   1.00 65.54  ? 87   GLU H N   1 
ATOM   8072  C  CA  . GLU D  4  87  ? 131.441 110.077 5.267   1.00 64.70  ? 87   GLU H CA  1 
ATOM   8073  C  C   . GLU D  4  87  ? 130.172 109.406 4.759   1.00 62.35  ? 87   GLU H C   1 
ATOM   8074  O  O   . GLU D  4  87  ? 130.099 108.972 3.605   1.00 65.71  ? 87   GLU H O   1 
ATOM   8075  C  CB  . GLU D  4  87  ? 131.483 111.534 4.777   1.00 66.95  ? 87   GLU H CB  1 
ATOM   8076  C  CG  . GLU D  4  87  ? 132.812 112.246 5.004   0.00 65.62  ? 87   GLU H CG  1 
ATOM   8077  C  CD  . GLU D  4  87  ? 133.292 112.167 6.442   0.00 65.61  ? 87   GLU H CD  1 
ATOM   8078  O  OE1 . GLU D  4  87  ? 132.623 112.738 7.330   0.00 65.39  ? 87   GLU H OE1 1 
ATOM   8079  O  OE2 . GLU D  4  87  ? 134.342 111.535 6.683   0.00 65.39  ? 87   GLU H OE2 1 
ATOM   8080  N  N   . LEU D  4  88  ? 129.159 109.360 5.611   1.00 57.10  ? 88   LEU H N   1 
ATOM   8081  C  CA  . LEU D  4  88  ? 127.910 108.734 5.246   1.00 51.49  ? 88   LEU H CA  1 
ATOM   8082  C  C   . LEU D  4  88  ? 126.831 109.790 5.180   1.00 51.22  ? 88   LEU H C   1 
ATOM   8083  O  O   . LEU D  4  88  ? 126.555 110.472 6.171   1.00 46.63  ? 88   LEU H O   1 
ATOM   8084  C  CB  . LEU D  4  88  ? 127.547 107.665 6.269   1.00 48.62  ? 88   LEU H CB  1 
ATOM   8085  C  CG  . LEU D  4  88  ? 128.610 106.578 6.338   1.00 45.42  ? 88   LEU H CG  1 
ATOM   8086  C  CD1 . LEU D  4  88  ? 128.327 105.678 7.506   1.00 48.56  ? 88   LEU H CD1 1 
ATOM   8087  C  CD2 . LEU D  4  88  ? 128.633 105.796 5.043   1.00 45.00  ? 88   LEU H CD2 1 
ATOM   8088  N  N   . LYS D  4  89  ? 126.284 109.990 3.987   1.00 51.76  ? 89   LYS H N   1 
ATOM   8089  C  CA  . LYS D  4  89  ? 125.176 110.917 3.842   1.00 52.27  ? 89   LYS H CA  1 
ATOM   8090  C  C   . LYS D  4  89  ? 123.862 110.351 4.393   1.00 49.63  ? 89   LYS H C   1 
ATOM   8091  O  O   . LYS D  4  89  ? 122.930 110.029 3.639   1.00 51.31  ? 89   LYS H O   1 
ATOM   8092  C  CB  . LYS D  4  89  ? 125.030 111.348 2.386   1.00 54.84  ? 89   LYS H CB  1 
ATOM   8093  C  CG  . LYS D  4  89  ? 125.682 112.695 2.095   1.00 55.64  ? 89   LYS H CG  1 
ATOM   8094  C  CD  . LYS D  4  89  ? 127.054 112.546 1.440   0.00 57.44  ? 89   LYS H CD  1 
ATOM   8095  C  CE  . LYS D  4  89  ? 128.112 112.061 2.425   0.00 58.31  ? 89   LYS H CE  1 
ATOM   8096  N  NZ  . LYS D  4  89  ? 128.047 112.789 3.724   0.00 59.12  ? 89   LYS H NZ  1 
ATOM   8097  N  N   . LEU D  4  90  ? 123.803 110.280 5.723   1.00 45.40  ? 90   LEU H N   1 
ATOM   8098  C  CA  . LEU D  4  90  ? 122.657 109.775 6.463   1.00 44.82  ? 90   LEU H CA  1 
ATOM   8099  C  C   . LEU D  4  90  ? 122.420 110.683 7.663   1.00 44.78  ? 90   LEU H C   1 
ATOM   8100  O  O   . LEU D  4  90  ? 123.323 111.381 8.110   1.00 47.02  ? 90   LEU H O   1 
ATOM   8101  C  CB  . LEU D  4  90  ? 122.924 108.346 6.948   1.00 41.83  ? 90   LEU H CB  1 
ATOM   8102  C  CG  . LEU D  4  90  ? 123.126 107.307 5.849   1.00 39.36  ? 90   LEU H CG  1 
ATOM   8103  C  CD1 . LEU D  4  90  ? 123.899 106.116 6.389   1.00 34.91  ? 90   LEU H CD1 1 
ATOM   8104  C  CD2 . LEU D  4  90  ? 121.771 106.908 5.279   1.00 36.98  ? 90   LEU H CD2 1 
ATOM   8105  N  N   . ALA D  4  91  ? 121.205 110.665 8.187   1.00 49.00  ? 91   ALA H N   1 
ATOM   8106  C  CA  . ALA D  4  91  ? 120.836 111.514 9.313   1.00 54.04  ? 91   ALA H CA  1 
ATOM   8107  C  C   . ALA D  4  91  ? 119.851 110.768 10.192  1.00 57.63  ? 91   ALA H C   1 
ATOM   8108  O  O   . ALA D  4  91  ? 118.974 110.067 9.687   1.00 59.82  ? 91   ALA H O   1 
ATOM   8109  C  CB  . ALA D  4  91  ? 120.200 112.797 8.808   1.00 53.11  ? 91   ALA H CB  1 
ATOM   8110  N  N   . GLN D  4  92  ? 119.985 110.913 11.503  1.00 62.71  ? 92   GLN H N   1 
ATOM   8111  C  CA  . GLN D  4  92  ? 119.111 110.179 12.411  1.00 68.65  ? 92   GLN H CA  1 
ATOM   8112  C  C   . GLN D  4  92  ? 117.696 110.740 12.299  1.00 69.16  ? 92   GLN H C   1 
ATOM   8113  O  O   . GLN D  4  92  ? 117.525 111.953 12.113  1.00 68.21  ? 92   GLN H O   1 
ATOM   8114  C  CB  . GLN D  4  92  ? 119.629 110.234 13.863  1.00 73.66  ? 92   GLN H CB  1 
ATOM   8115  C  CG  . GLN D  4  92  ? 120.471 111.466 14.223  1.00 76.60  ? 92   GLN H CG  1 
ATOM   8116  C  CD  . GLN D  4  92  ? 121.916 111.360 13.764  0.00 76.50  ? 92   GLN H CD  1 
ATOM   8117  O  OE1 . GLN D  4  92  ? 122.334 110.344 13.214  0.00 77.02  ? 92   GLN H OE1 1 
ATOM   8118  N  NE2 . GLN D  4  92  ? 122.671 112.434 13.942  0.00 77.02  ? 92   GLN H NE2 1 
ATOM   8119  N  N   . THR D  4  93  ? 116.730 109.828 12.160  1.00 69.20  ? 93   THR H N   1 
ATOM   8120  C  CA  . THR D  4  93  ? 115.338 110.193 11.926  1.00 69.94  ? 93   THR H CA  1 
ATOM   8121  C  C   . THR D  4  93  ? 114.634 110.571 13.226  1.00 73.99  ? 93   THR H C   1 
ATOM   8122  O  O   . THR D  4  93  ? 113.717 111.390 13.220  1.00 76.86  ? 93   THR H O   1 
ATOM   8123  C  CB  . THR D  4  93  ? 114.549 109.050 11.253  1.00 67.06  ? 93   THR H CB  1 
ATOM   8124  O  OG1 . THR D  4  93  ? 114.499 107.917 12.128  1.00 64.93  ? 93   THR H OG1 1 
ATOM   8125  C  CG2 . THR D  4  93  ? 115.194 108.656 9.939   1.00 66.59  ? 93   THR H CG2 1 
ATOM   8126  N  N   . ASP D  4  94  ? 114.998 109.908 14.319  1.00 76.55  ? 94   ASP H N   1 
ATOM   8127  C  CA  . ASP D  4  94  ? 114.529 110.297 15.648  1.00 78.35  ? 94   ASP H CA  1 
ATOM   8128  C  C   . ASP D  4  94  ? 115.755 110.538 16.527  1.00 79.89  ? 94   ASP H C   1 
ATOM   8129  O  O   . ASP D  4  94  ? 116.781 111.008 16.041  1.00 81.31  ? 94   ASP H O   1 
ATOM   8130  C  CB  . ASP D  4  94  ? 113.634 109.201 16.234  0.00 78.51  ? 94   ASP H CB  1 
ATOM   8131  C  CG  . ASP D  4  94  ? 112.574 109.754 17.171  0.00 78.65  ? 94   ASP H CG  1 
ATOM   8132  O  OD1 . ASP D  4  94  ? 111.620 110.397 16.681  0.00 78.72  ? 94   ASP H OD1 1 
ATOM   8133  O  OD2 . ASP D  4  94  ? 112.697 109.552 18.398  0.00 78.72  ? 94   ASP H OD2 1 
ATOM   8134  N  N   . GLY D  4  95  ? 115.675 110.189 17.807  1.00 81.78  ? 95   GLY H N   1 
ATOM   8135  C  CA  . GLY D  4  95  ? 116.799 110.441 18.692  1.00 83.07  ? 95   GLY H CA  1 
ATOM   8136  C  C   . GLY D  4  95  ? 117.560 109.207 19.149  1.00 84.07  ? 95   GLY H C   1 
ATOM   8137  O  O   . GLY D  4  95  ? 118.797 109.200 19.170  1.00 85.05  ? 95   GLY H O   1 
ATOM   8138  N  N   . PHE D  4  96  ? 116.816 108.184 19.574  1.00 83.16  ? 96   PHE H N   1 
ATOM   8139  C  CA  . PHE D  4  96  ? 117.388 106.999 20.226  1.00 79.84  ? 96   PHE H CA  1 
ATOM   8140  C  C   . PHE D  4  96  ? 118.306 106.174 19.326  1.00 74.38  ? 96   PHE H C   1 
ATOM   8141  O  O   . PHE D  4  96  ? 118.164 106.198 18.104  1.00 74.61  ? 96   PHE H O   1 
ATOM   8142  C  CB  . PHE D  4  96  ? 116.267 106.112 20.809  1.00 83.82  ? 96   PHE H CB  1 
ATOM   8143  C  CG  . PHE D  4  96  ? 115.247 105.654 19.802  1.00 84.83  ? 96   PHE H CG  1 
ATOM   8144  C  CD1 . PHE D  4  96  ? 114.413 106.573 19.155  1.00 85.71  ? 96   PHE H CD1 1 
ATOM   8145  C  CD2 . PHE D  4  96  ? 115.101 104.298 19.522  1.00 86.03  ? 96   PHE H CD2 1 
ATOM   8146  C  CE1 . PHE D  4  96  ? 113.450 106.151 18.235  1.00 87.48  ? 96   PHE H CE1 1 
ATOM   8147  C  CE2 . PHE D  4  96  ? 114.142 103.862 18.608  1.00 89.51  ? 96   PHE H CE2 1 
ATOM   8148  C  CZ  . PHE D  4  96  ? 113.312 104.796 17.958  1.00 89.33  ? 96   PHE H CZ  1 
ATOM   8149  N  N   . GLU D  4  97  ? 119.219 105.413 19.925  1.00 67.97  ? 97   GLU H N   1 
ATOM   8150  C  CA  . GLU D  4  97  ? 120.142 104.633 19.122  1.00 62.78  ? 97   GLU H CA  1 
ATOM   8151  C  C   . GLU D  4  97  ? 119.388 103.618 18.278  1.00 56.77  ? 97   GLU H C   1 
ATOM   8152  O  O   . GLU D  4  97  ? 119.847 103.241 17.203  1.00 57.94  ? 97   GLU H O   1 
ATOM   8153  C  CB  . GLU D  4  97  ? 121.188 103.914 19.981  1.00 68.48  ? 97   GLU H CB  1 
ATOM   8154  C  CG  . GLU D  4  97  ? 122.410 103.406 19.142  1.00 73.76  ? 97   GLU H CG  1 
ATOM   8155  C  CD  . GLU D  4  97  ? 123.179 102.253 19.790  1.00 71.59  ? 97   GLU H CD  1 
ATOM   8156  O  OE1 . GLU D  4  97  ? 124.124 102.524 20.560  0.00 71.96  ? 97   GLU H OE1 1 
ATOM   8157  O  OE2 . GLU D  4  97  ? 122.840 101.082 19.514  0.00 71.96  ? 97   GLU H OE2 1 
ATOM   8158  N  N   . GLY D  4  98  ? 118.201 103.226 18.726  1.00 50.71  ? 98   GLY H N   1 
ATOM   8159  C  CA  . GLY D  4  98  ? 117.404 102.301 17.939  1.00 45.45  ? 98   GLY H CA  1 
ATOM   8160  C  C   . GLY D  4  98  ? 116.961 102.858 16.596  1.00 39.71  ? 98   GLY H C   1 
ATOM   8161  O  O   . GLY D  4  98  ? 116.676 102.104 15.677  1.00 36.82  ? 98   GLY H O   1 
ATOM   8162  N  N   . ALA D  4  99  ? 116.929 104.182 16.477  1.00 38.63  ? 99   ALA H N   1 
ATOM   8163  C  CA  . ALA D  4  99  ? 116.290 104.858 15.351  1.00 37.49  ? 99   ALA H CA  1 
ATOM   8164  C  C   . ALA D  4  99  ? 117.010 104.564 14.047  1.00 37.33  ? 99   ALA H C   1 
ATOM   8165  O  O   . ALA D  4  99  ? 118.241 104.485 14.005  1.00 39.07  ? 99   ALA H O   1 
ATOM   8166  C  CB  . ALA D  4  99  ? 116.267 106.351 15.591  1.00 37.41  ? 99   ALA H CB  1 
ATOM   8167  N  N   . PRO D  4  100 ? 116.256 104.413 12.959  1.00 34.04  ? 100  PRO H N   1 
ATOM   8168  C  CA  . PRO D  4  100 ? 116.903 104.235 11.661  1.00 36.02  ? 100  PRO H CA  1 
ATOM   8169  C  C   . PRO D  4  100 ? 117.482 105.559 11.138  1.00 39.44  ? 100  PRO H C   1 
ATOM   8170  O  O   . PRO D  4  100 ? 117.031 106.634 11.532  1.00 40.92  ? 100  PRO H O   1 
ATOM   8171  C  CB  . PRO D  4  100 ? 115.773 103.711 10.791  1.00 32.39  ? 100  PRO H CB  1 
ATOM   8172  C  CG  . PRO D  4  100 ? 114.542 104.256 11.429  1.00 30.62  ? 100  PRO H CG  1 
ATOM   8173  C  CD  . PRO D  4  100 ? 114.810 104.163 12.889  1.00 31.21  ? 100  PRO H CD  1 
ATOM   8174  N  N   . LEU D  4  101 ? 118.557 105.478 10.357  1.00 42.11  ? 101  LEU H N   1 
ATOM   8175  C  CA  . LEU D  4  101 ? 119.109 106.636 9.635   1.00 44.04  ? 101  LEU H CA  1 
ATOM   8176  C  C   . LEU D  4  101 ? 118.365 106.843 8.305   1.00 45.42  ? 101  LEU H C   1 
ATOM   8177  O  O   . LEU D  4  101 ? 117.826 105.891 7.745   1.00 49.98  ? 101  LEU H O   1 
ATOM   8178  C  CB  . LEU D  4  101 ? 120.601 106.413 9.339   1.00 39.73  ? 101  LEU H CB  1 
ATOM   8179  C  CG  . LEU D  4  101 ? 121.523 106.000 10.480  1.00 36.43  ? 101  LEU H CG  1 
ATOM   8180  C  CD1 . LEU D  4  101 ? 122.889 105.668 9.916   1.00 35.41  ? 101  LEU H CD1 1 
ATOM   8181  C  CD2 . LEU D  4  101 ? 121.627 107.122 11.500  1.00 37.99  ? 101  LEU H CD2 1 
ATOM   8182  N  N   . GLN D  4  102 ? 118.412 108.054 7.761   1.00 45.97  ? 102  GLN H N   1 
ATOM   8183  C  CA  . GLN D  4  102 ? 117.820 108.352 6.451   1.00 50.35  ? 102  GLN H CA  1 
ATOM   8184  C  C   . GLN D  4  102 ? 118.868 108.975 5.528   1.00 49.05  ? 102  GLN H C   1 
ATOM   8185  O  O   . GLN D  4  102 ? 119.639 109.820 5.965   1.00 48.26  ? 102  GLN H O   1 
ATOM   8186  C  CB  . GLN D  4  102 ? 116.658 109.329 6.625   1.00 57.03  ? 102  GLN H CB  1 
ATOM   8187  C  CG  . GLN D  4  102 ? 116.118 109.887 5.325   1.00 68.13  ? 102  GLN H CG  1 
ATOM   8188  C  CD  . GLN D  4  102 ? 114.661 109.541 5.117   1.00 74.40  ? 102  GLN H CD  1 
ATOM   8189  O  OE1 . GLN D  4  102 ? 113.806 109.875 5.949   1.00 79.32  ? 102  GLN H OE1 1 
ATOM   8190  N  NE2 . GLN D  4  102 ? 114.363 108.868 4.010   1.00 75.29  ? 102  GLN H NE2 1 
ATOM   8191  N  N   . PRO D  4  103 ? 118.895 108.595 4.238   1.00 49.85  ? 103  PRO H N   1 
ATOM   8192  C  CA  . PRO D  4  103 ? 119.800 109.310 3.328   1.00 52.15  ? 103  PRO H CA  1 
ATOM   8193  C  C   . PRO D  4  103 ? 119.437 110.792 3.153   1.00 55.19  ? 103  PRO H C   1 
ATOM   8194  O  O   . PRO D  4  103 ? 118.276 111.189 3.316   1.00 57.11  ? 103  PRO H O   1 
ATOM   8195  C  CB  . PRO D  4  103 ? 119.691 108.527 2.021   1.00 48.73  ? 103  PRO H CB  1 
ATOM   8196  C  CG  . PRO D  4  103 ? 118.385 107.826 2.117   1.00 48.02  ? 103  PRO H CG  1 
ATOM   8197  C  CD  . PRO D  4  103 ? 118.217 107.482 3.558   1.00 48.60  ? 103  PRO H CD  1 
ATOM   8198  N  N   . THR D  4  104 ? 120.462 111.625 3.008   1.00 57.21  ? 104  THR H N   1 
ATOM   8199  C  CA  . THR D  4  104 ? 120.253 113.052 2.770   1.00 57.40  ? 104  THR H CA  1 
ATOM   8200  C  C   . THR D  4  104 ? 120.577 113.453 1.319   1.00 57.54  ? 104  THR H C   1 
ATOM   8201  O  O   . THR D  4  104 ? 120.198 114.540 0.861   1.00 60.62  ? 104  THR H O   1 
ATOM   8202  C  CB  . THR D  4  104 ? 121.080 113.922 3.768   1.00 55.72  ? 104  THR H CB  1 
ATOM   8203  O  OG1 . THR D  4  104 ? 122.425 113.433 3.855   1.00 49.75  ? 104  THR H OG1 1 
ATOM   8204  C  CG2 . THR D  4  104 ? 120.443 113.891 5.150   1.00 54.93  ? 104  THR H CG2 1 
ATOM   8205  N  N   . GLY D  4  105 ? 121.209 112.541 0.583   1.00 54.71  ? 105  GLY H N   1 
ATOM   8206  C  CA  . GLY D  4  105 ? 121.448 112.764 -0.829  1.00 50.86  ? 105  GLY H CA  1 
ATOM   8207  C  C   . GLY D  4  105 ? 120.826 111.688 -1.704  1.00 49.53  ? 105  GLY H C   1 
ATOM   8208  O  O   . GLY D  4  105 ? 119.698 111.243 -1.469  1.00 49.21  ? 105  GLY H O   1 
ATOM   8209  N  N   . ASN D  4  106 ? 121.536 111.311 -2.759  1.00 44.13  ? 106  ASN H N   1 
ATOM   8210  C  CA  . ASN D  4  106 ? 121.121 110.191 -3.570  1.00 43.13  ? 106  ASN H CA  1 
ATOM   8211  C  C   . ASN D  4  106 ? 121.815 108.966 -2.998  1.00 41.14  ? 106  ASN H C   1 
ATOM   8212  O  O   . ASN D  4  106 ? 123.013 108.789 -3.181  1.00 37.40  ? 106  ASN H O   1 
ATOM   8213  C  CB  . ASN D  4  106 ? 121.533 110.404 -5.032  1.00 47.31  ? 106  ASN H CB  1 
ATOM   8214  C  CG  . ASN D  4  106 ? 121.258 109.187 -5.910  1.00 47.59  ? 106  ASN H CG  1 
ATOM   8215  O  OD1 . ASN D  4  106 ? 120.768 108.161 -5.442  1.00 51.85  ? 106  ASN H OD1 1 
ATOM   8216  N  ND2 . ASN D  4  106 ? 121.617 109.283 -7.177  1.00 50.92  ? 106  ASN H ND2 1 
ATOM   8217  N  N   . PRO D  4  107 ? 121.060 108.090 -2.318  1.00 40.19  ? 107  PRO H N   1 
ATOM   8218  C  CA  . PRO D  4  107 ? 121.632 106.906 -1.675  1.00 36.93  ? 107  PRO H CA  1 
ATOM   8219  C  C   . PRO D  4  107 ? 122.292 105.974 -2.673  1.00 34.35  ? 107  PRO H C   1 
ATOM   8220  O  O   . PRO D  4  107 ? 123.219 105.258 -2.319  1.00 35.89  ? 107  PRO H O   1 
ATOM   8221  C  CB  . PRO D  4  107 ? 120.429 106.253 -1.000  1.00 38.32  ? 107  PRO H CB  1 
ATOM   8222  C  CG  . PRO D  4  107 ? 119.280 106.659 -1.843  1.00 37.36  ? 107  PRO H CG  1 
ATOM   8223  C  CD  . PRO D  4  107 ? 119.587 108.080 -2.241  1.00 41.77  ? 107  PRO H CD  1 
ATOM   8224  N  N   . LEU D  4  108 ? 121.864 106.029 -3.930  1.00 33.63  ? 108  LEU H N   1 
ATOM   8225  C  CA  . LEU D  4  108 ? 122.442 105.164 -4.957  1.00 36.00  ? 108  LEU H CA  1 
ATOM   8226  C  C   . LEU D  4  108 ? 123.873 105.571 -5.212  1.00 37.63  ? 108  LEU H C   1 
ATOM   8227  O  O   . LEU D  4  108 ? 124.804 104.763 -5.192  1.00 38.19  ? 108  LEU H O   1 
ATOM   8228  C  CB  . LEU D  4  108 ? 121.645 105.255 -6.263  1.00 33.97  ? 108  LEU H CB  1 
ATOM   8229  C  CG  . LEU D  4  108 ? 120.267 104.579 -6.258  1.00 33.99  ? 108  LEU H CG  1 
ATOM   8230  C  CD1 . LEU D  4  108 ? 119.879 104.119 -7.673  1.00 30.37  ? 108  LEU H CD1 1 
ATOM   8231  C  CD2 . LEU D  4  108 ? 120.301 103.395 -5.297  1.00 28.07  ? 108  LEU H CD2 1 
ATOM   8232  N  N   . VAL D  4  109 ? 124.044 106.872 -5.307  1.00 40.32  ? 109  VAL H N   1 
ATOM   8233  C  CA  . VAL D  4  109 ? 125.337 107.445 -5.581  1.00 46.26  ? 109  VAL H CA  1 
ATOM   8234  C  C   . VAL D  4  109 ? 126.127 107.584 -4.280  1.00 46.10  ? 109  VAL H C   1 
ATOM   8235  O  O   . VAL D  4  109 ? 127.318 107.247 -4.225  1.00 46.67  ? 109  VAL H O   1 
ATOM   8236  C  CB  . VAL D  4  109 ? 125.153 108.819 -6.253  1.00 50.35  ? 109  VAL H CB  1 
ATOM   8237  C  CG1 . VAL D  4  109 ? 126.488 109.493 -6.472  1.00 50.99  ? 109  VAL H CG1 1 
ATOM   8238  C  CG2 . VAL D  4  109 ? 124.424 108.636 -7.578  1.00 51.50  ? 109  VAL H CG2 1 
ATOM   8239  N  N   . ASP D  4  110 ? 125.434 107.983 -3.216  1.00 42.05  ? 110  ASP H N   1 
ATOM   8240  C  CA  . ASP D  4  110 ? 126.069 108.152 -1.918  1.00 42.32  ? 110  ASP H CA  1 
ATOM   8241  C  C   . ASP D  4  110 ? 126.546 106.800 -1.366  1.00 41.61  ? 110  ASP H C   1 
ATOM   8242  O  O   . ASP D  4  110 ? 127.486 106.757 -0.577  1.00 42.10  ? 110  ASP H O   1 
ATOM   8243  C  CB  . ASP D  4  110 ? 125.100 108.791 -0.919  1.00 45.25  ? 110  ASP H CB  1 
ATOM   8244  C  CG  . ASP D  4  110 ? 124.713 110.213 -1.285  1.00 45.03  ? 110  ASP H CG  1 
ATOM   8245  O  OD1 . ASP D  4  110 ? 125.471 110.880 -2.018  1.00 45.31  ? 110  ASP H OD1 1 
ATOM   8246  O  OD2 . ASP D  4  110 ? 123.664 110.677 -0.787  1.00 44.56  ? 110  ASP H OD2 1 
ATOM   8247  N  N   . ALA D  4  111 ? 125.882 105.717 -1.774  1.00 35.63  ? 111  ALA H N   1 
ATOM   8248  C  CA  . ALA D  4  111 ? 126.181 104.362 -1.311  1.00 37.25  ? 111  ALA H CA  1 
ATOM   8249  C  C   . ALA D  4  111 ? 125.952 104.206 0.182   1.00 37.39  ? 111  ALA H C   1 
ATOM   8250  O  O   . ALA D  4  111 ? 126.871 103.879 0.930   1.00 37.87  ? 111  ALA H O   1 
ATOM   8251  C  CB  . ALA D  4  111 ? 127.619 103.959 -1.671  1.00 34.29  ? 111  ALA H CB  1 
ATOM   8252  N  N   . VAL D  4  112 ? 124.722 104.448 0.614   1.00 35.64  ? 112  VAL H N   1 
ATOM   8253  C  CA  . VAL D  4  112 ? 124.324 104.141 1.978   1.00 35.48  ? 112  VAL H CA  1 
ATOM   8254  C  C   . VAL D  4  112 ? 123.150 103.160 1.935   1.00 37.03  ? 112  VAL H C   1 
ATOM   8255  O  O   . VAL D  4  112 ? 122.620 102.891 0.852   1.00 40.34  ? 112  VAL H O   1 
ATOM   8256  C  CB  . VAL D  4  112 ? 123.928 105.413 2.715   1.00 36.72  ? 112  VAL H CB  1 
ATOM   8257  C  CG1 . VAL D  4  112 ? 125.162 106.285 2.907   1.00 35.34  ? 112  VAL H CG1 1 
ATOM   8258  C  CG2 . VAL D  4  112 ? 122.831 106.161 1.938   1.00 36.47  ? 112  VAL H CG2 1 
ATOM   8259  N  N   . GLY D  4  113 ? 122.785 102.579 3.082   1.00 36.17  ? 113  GLY H N   1 
ATOM   8260  C  CA  . GLY D  4  113 ? 121.684 101.620 3.135   1.00 29.65  ? 113  GLY H CA  1 
ATOM   8261  C  C   . GLY D  4  113 ? 121.996 100.389 2.306   1.00 28.30  ? 113  GLY H C   1 
ATOM   8262  O  O   . GLY D  4  113 ? 123.157 99.998  2.235   1.00 27.72  ? 113  GLY H O   1 
ATOM   8263  N  N   . PRO D  4  114 ? 121.030 99.845  1.550   1.00 27.08  ? 114  PRO H N   1 
ATOM   8264  C  CA  . PRO D  4  114 ? 121.334 98.689  0.690   1.00 26.80  ? 114  PRO H CA  1 
ATOM   8265  C  C   . PRO D  4  114 ? 122.356 98.920  -0.436  1.00 29.94  ? 114  PRO H C   1 
ATOM   8266  O  O   . PRO D  4  114 ? 122.763 97.959  -1.104  1.00 30.82  ? 114  PRO H O   1 
ATOM   8267  C  CB  . PRO D  4  114 ? 119.959 98.275  0.149   1.00 25.25  ? 114  PRO H CB  1 
ATOM   8268  C  CG  . PRO D  4  114 ? 119.015 99.400  0.516   1.00 23.33  ? 114  PRO H CG  1 
ATOM   8269  C  CD  . PRO D  4  114 ? 119.579 99.992  1.759   1.00 24.95  ? 114  PRO H CD  1 
ATOM   8270  N  N   . ALA D  4  115 ? 122.802 100.176 -0.602  1.00 34.77  ? 115  ALA H N   1 
ATOM   8271  C  CA  . ALA D  4  115 ? 123.734 100.606 -1.675  1.00 36.66  ? 115  ALA H CA  1 
ATOM   8272  C  C   . ALA D  4  115 ? 125.206 100.610 -1.236  1.00 37.87  ? 115  ALA H C   1 
ATOM   8273  O  O   . ALA D  4  115 ? 126.095 100.977 -2.005  1.00 38.99  ? 115  ALA H O   1 
ATOM   8274  C  CB  . ALA D  4  115 ? 123.361 102.007 -2.155  1.00 32.50  ? 115  ALA H CB  1 
ATOM   8275  N  N   . SER D  4  116 ? 125.431 100.322 0.042   1.00 39.53  ? 116  SER H N   1 
ATOM   8276  C  CA  . SER D  4  116 ? 126.746 100.393 0.661   1.00 33.88  ? 116  SER H CA  1 
ATOM   8277  C  C   . SER D  4  116 ? 127.673 99.332  0.138   1.00 31.78  ? 116  SER H C   1 
ATOM   8278  O  O   . SER D  4  116 ? 127.248 98.235  -0.199  1.00 35.54  ? 116  SER H O   1 
ATOM   8279  C  CB  . SER D  4  116 ? 126.596 100.224 2.165   1.00 32.15  ? 116  SER H CB  1 
ATOM   8280  O  OG  . SER D  4  116 ? 125.549 101.051 2.663   1.00 32.16  ? 116  SER H OG  1 
ATOM   8281  N  N   . TYR D  4  117 ? 128.957 99.621  0.142   1.00 30.76  ? 117  TYR H N   1 
ATOM   8282  C  CA  . TYR D  4  117 ? 129.916 98.573  -0.136  1.00 31.42  ? 117  TYR H CA  1 
ATOM   8283  C  C   . TYR D  4  117 ? 130.909 98.489  0.999   1.00 30.42  ? 117  TYR H C   1 
ATOM   8284  O  O   . TYR D  4  117 ? 131.000 99.390  1.836   1.00 32.73  ? 117  TYR H O   1 
ATOM   8285  C  CB  . TYR D  4  117 ? 130.644 98.832  -1.454  1.00 35.13  ? 117  TYR H CB  1 
ATOM   8286  C  CG  . TYR D  4  117 ? 131.301 100.179 -1.522  1.00 35.46  ? 117  TYR H CG  1 
ATOM   8287  C  CD1 . TYR D  4  117 ? 130.550 101.315 -1.806  1.00 37.26  ? 117  TYR H CD1 1 
ATOM   8288  C  CD2 . TYR D  4  117 ? 132.648 100.335 -1.181  1.00 39.14  ? 117  TYR H CD2 1 
ATOM   8289  C  CE1 . TYR D  4  117 ? 131.114 102.580 -1.736  1.00 40.71  ? 117  TYR H CE1 1 
ATOM   8290  C  CE2 . TYR D  4  117 ? 133.226 101.589 -1.100  1.00 39.99  ? 117  TYR H CE2 1 
ATOM   8291  C  CZ  . TYR D  4  117 ? 132.451 102.711 -1.377  1.00 43.88  ? 117  TYR H CZ  1 
ATOM   8292  O  OH  . TYR D  4  117 ? 133.007 103.969 -1.305  1.00 53.71  ? 117  TYR H OH  1 
ATOM   8293  N  N   . ALA D  4  118 ? 131.651 97.394  1.021   1.00 28.29  ? 118  ALA H N   1 
ATOM   8294  C  CA  . ALA D  4  118 ? 132.672 97.192  2.015   1.00 28.07  ? 118  ALA H CA  1 
ATOM   8295  C  C   . ALA D  4  118 ? 133.853 97.954  1.510   1.00 27.20  ? 118  ALA H C   1 
ATOM   8296  O  O   . ALA D  4  118 ? 134.066 98.026  0.312   1.00 28.64  ? 118  ALA H O   1 
ATOM   8297  C  CB  . ALA D  4  118 ? 133.018 95.737  2.105   1.00 26.89  ? 118  ALA H CB  1 
ATOM   8298  N  N   . GLU D  4  119 ? 134.734 98.328  2.420   1.00 31.90  ? 119  GLU H N   1 
ATOM   8299  C  CA  . GLU D  4  119 ? 136.040 98.836  2.031   1.00 32.69  ? 119  GLU H CA  1 
ATOM   8300  C  C   . GLU D  4  119 ? 136.932 97.665  1.648   1.00 28.36  ? 119  GLU H C   1 
ATOM   8301  O  O   . GLU D  4  119 ? 138.000 97.483  2.232   1.00 31.13  ? 119  GLU H O   1 
ATOM   8302  C  CB  . GLU D  4  119 ? 136.699 99.601  3.180   1.00 38.90  ? 119  GLU H CB  1 
ATOM   8303  C  CG  . GLU D  4  119 ? 135.789 100.516 3.964   1.00 52.28  ? 119  GLU H CG  1 
ATOM   8304  C  CD  . GLU D  4  119 ? 135.891 101.960 3.532   1.00 63.23  ? 119  GLU H CD  1 
ATOM   8305  O  OE1 . GLU D  4  119 ? 135.834 102.210 2.306   1.00 68.19  ? 119  GLU H OE1 1 
ATOM   8306  O  OE2 . GLU D  4  119 ? 135.997 102.845 4.422   1.00 70.17  ? 119  GLU H OE2 1 
ATOM   8307  N  N   . ARG D  4  120 ? 136.520 96.882  0.656   1.00 21.96  ? 120  ARG H N   1 
ATOM   8308  C  CA  . ARG D  4  120 ? 137.390 95.823  0.170   1.00 23.14  ? 120  ARG H CA  1 
ATOM   8309  C  C   . ARG D  4  120 ? 138.704 96.385  -0.403  1.00 26.39  ? 120  ARG H C   1 
ATOM   8310  O  O   . ARG D  4  120 ? 138.836 97.591  -0.670  1.00 25.71  ? 120  ARG H O   1 
ATOM   8311  C  CB  . ARG D  4  120 ? 136.681 94.984  -0.890  1.00 22.40  ? 120  ARG H CB  1 
ATOM   8312  C  CG  . ARG D  4  120 ? 135.515 94.181  -0.371  1.00 20.56  ? 120  ARG H CG  1 
ATOM   8313  C  CD  . ARG D  4  120 ? 135.207 93.028  -1.303  1.00 18.83  ? 120  ARG H CD  1 
ATOM   8314  N  NE  . ARG D  4  120 ? 136.020 91.847  -1.036  1.00 18.49  ? 120  ARG H NE  1 
ATOM   8315  C  CZ  . ARG D  4  120 ? 135.767 90.642  -1.543  1.00 24.03  ? 120  ARG H CZ  1 
ATOM   8316  N  NH1 . ARG D  4  120 ? 134.813 90.482  -2.462  1.00 24.79  ? 120  ARG H NH1 1 
ATOM   8317  N  NH2 . ARG D  4  120 ? 136.516 89.607  -1.196  1.00 21.52  ? 120  ARG H NH2 1 
ATOM   8318  N  N   . ALA D  4  121 ? 139.680 95.507  -0.592  1.00 24.63  ? 121  ALA H N   1 
ATOM   8319  C  CA  . ALA D  4  121 ? 140.956 95.903  -1.181  1.00 26.35  ? 121  ALA H CA  1 
ATOM   8320  C  C   . ALA D  4  121 ? 140.794 96.487  -2.592  1.00 30.74  ? 121  ALA H C   1 
ATOM   8321  O  O   . ALA D  4  121 ? 140.076 95.930  -3.431  1.00 35.64  ? 121  ALA H O   1 
ATOM   8322  C  CB  . ALA D  4  121 ? 141.886 94.711  -1.213  1.00 21.87  ? 121  ALA H CB  1 
ATOM   8323  N  N   . GLU D  4  122 ? 141.455 97.604  -2.874  1.00 33.56  ? 122  GLU H N   1 
ATOM   8324  C  CA  . GLU D  4  122 ? 141.512 98.057  -4.254  1.00 33.33  ? 122  GLU H CA  1 
ATOM   8325  C  C   . GLU D  4  122 ? 142.526 97.252  -5.039  1.00 30.83  ? 122  GLU H C   1 
ATOM   8326  O  O   . GLU D  4  122 ? 143.408 97.801  -5.671  1.00 31.37  ? 122  GLU H O   1 
ATOM   8327  C  CB  . GLU D  4  122 ? 141.822 99.549  -4.340  1.00 37.50  ? 122  GLU H CB  1 
ATOM   8328  C  CG  . GLU D  4  122 ? 140.590 100.479 -4.178  1.00 48.06  ? 122  GLU H CG  1 
ATOM   8329  C  CD  . GLU D  4  122 ? 139.603 100.465 -5.377  1.00 51.95  ? 122  GLU H CD  1 
ATOM   8330  O  OE1 . GLU D  4  122 ? 139.690 99.555  -6.239  1.00 51.38  ? 122  GLU H OE1 1 
ATOM   8331  O  OE2 . GLU D  4  122 ? 138.722 101.367 -5.441  1.00 50.77  ? 122  GLU H OE2 1 
ATOM   8332  N  N   . VAL D  4  123 ? 142.386 95.935  -5.011  1.00 33.36  ? 123  VAL H N   1 
ATOM   8333  C  CA  . VAL D  4  123 ? 143.185 95.089  -5.881  1.00 36.35  ? 123  VAL H CA  1 
ATOM   8334  C  C   . VAL D  4  123 ? 142.348 94.131  -6.708  1.00 38.27  ? 123  VAL H C   1 
ATOM   8335  O  O   . VAL D  4  123 ? 141.158 93.931  -6.443  1.00 38.75  ? 123  VAL H O   1 
ATOM   8336  C  CB  . VAL D  4  123 ? 144.242 94.277  -5.111  1.00 37.24  ? 123  VAL H CB  1 
ATOM   8337  C  CG1 . VAL D  4  123 ? 145.312 95.207  -4.587  1.00 39.83  ? 123  VAL H CG1 1 
ATOM   8338  C  CG2 . VAL D  4  123 ? 143.601 93.490  -3.993  1.00 39.19  ? 123  VAL H CG2 1 
ATOM   8339  N  N   . VAL D  4  124 ? 142.962 93.618  -7.769  1.00 38.37  ? 124  VAL H N   1 
ATOM   8340  C  CA  . VAL D  4  124 ? 142.260 92.812  -8.739  1.00 38.33  ? 124  VAL H CA  1 
ATOM   8341  C  C   . VAL D  4  124 ? 142.328 91.369  -8.299  1.00 39.95  ? 124  VAL H C   1 
ATOM   8342  O  O   . VAL D  4  124 ? 143.415 90.839  -8.037  1.00 41.17  ? 124  VAL H O   1 
ATOM   8343  C  CB  . VAL D  4  124 ? 142.875 92.972  -10.141 1.00 38.24  ? 124  VAL H CB  1 
ATOM   8344  C  CG1 . VAL D  4  124 ? 142.510 91.799  -11.040 1.00 38.29  ? 124  VAL H CG1 1 
ATOM   8345  C  CG2 . VAL D  4  124 ? 142.370 94.255  -10.752 1.00 37.11  ? 124  VAL H CG2 1 
ATOM   8346  N  N   . ASP D  4  125 ? 141.154 90.759  -8.167  1.00 38.23  ? 125  ASP H N   1 
ATOM   8347  C  CA  . ASP D  4  125 ? 141.070 89.373  -7.760  1.00 35.57  ? 125  ASP H CA  1 
ATOM   8348  C  C   . ASP D  4  125 ? 141.832 88.570  -8.799  1.00 32.76  ? 125  ASP H C   1 
ATOM   8349  O  O   . ASP D  4  125 ? 141.713 88.825  -10.001 1.00 33.56  ? 125  ASP H O   1 
ATOM   8350  C  CB  . ASP D  4  125 ? 139.601 88.928  -7.682  1.00 37.72  ? 125  ASP H CB  1 
ATOM   8351  C  CG  . ASP D  4  125 ? 139.408 87.646  -6.858  1.00 40.72  ? 125  ASP H CG  1 
ATOM   8352  O  OD1 . ASP D  4  125 ? 140.356 87.216  -6.151  1.00 38.83  ? 125  ASP H OD1 1 
ATOM   8353  O  OD2 . ASP D  4  125 ? 138.306 87.051  -6.942  1.00 39.14  ? 125  ASP H OD2 1 
ATOM   8354  N  N   . ALA D  4  126 ? 142.685 87.674  -8.328  1.00 28.08  ? 126  ALA H N   1 
ATOM   8355  C  CA  . ALA D  4  126 ? 143.534 86.919  -9.218  1.00 26.91  ? 126  ALA H CA  1 
ATOM   8356  C  C   . ALA D  4  126 ? 143.097 85.491  -9.323  1.00 29.31  ? 126  ALA H C   1 
ATOM   8357  O  O   . ALA D  4  126 ? 142.661 84.891  -8.346  1.00 33.99  ? 126  ALA H O   1 
ATOM   8358  C  CB  . ALA D  4  126 ? 144.939 86.962  -8.728  1.00 27.57  ? 126  ALA H CB  1 
ATOM   8359  N  N   . THR D  4  127 ? 143.448 84.881  -10.436 1.00 27.51  ? 127  THR H N   1 
ATOM   8360  C  CA  . THR D  4  127 ? 143.360 83.447  -10.553 1.00 27.81  ? 127  THR H CA  1 
ATOM   8361  C  C   . THR D  4  127 ? 144.554 82.868  -9.811  1.00 25.27  ? 127  THR H C   1 
ATOM   8362  O  O   . THR D  4  127 ? 145.449 83.606  -9.409  1.00 21.37  ? 127  THR H O   1 
ATOM   8363  C  CB  . THR D  4  127 ? 143.442 83.057  -11.995 1.00 29.62  ? 127  THR H CB  1 
ATOM   8364  O  OG1 . THR D  4  127 ? 144.691 83.544  -12.521 1.00 34.95  ? 127  THR H OG1 1 
ATOM   8365  C  CG2 . THR D  4  127 ? 142.271 83.682  -12.763 1.00 28.53  ? 127  THR H CG2 1 
ATOM   8366  N  N   . VAL D  4  128 ? 144.672 81.547  -9.836  1.00 26.40  ? 128  VAL H N   1 
ATOM   8367  C  CA  . VAL D  4  128 ? 145.694 80.865  -9.056  1.00 30.83  ? 128  VAL H CA  1 
ATOM   8368  C  C   . VAL D  4  128 ? 147.084 81.043  -9.646  1.00 36.82  ? 128  VAL H C   1 
ATOM   8369  O  O   . VAL D  4  128 ? 148.085 80.861  -8.959  1.00 39.59  ? 128  VAL H O   1 
ATOM   8370  C  CB  . VAL D  4  128 ? 145.382 79.342  -8.913  1.00 31.32  ? 128  VAL H CB  1 
ATOM   8371  C  CG1 . VAL D  4  128 ? 145.424 78.657  -10.257 1.00 31.31  ? 128  VAL H CG1 1 
ATOM   8372  C  CG2 . VAL D  4  128 ? 146.358 78.674  -7.934  1.00 30.45  ? 128  VAL H CG2 1 
ATOM   8373  N  N   . ASP D  4  129 ? 147.149 81.441  -10.907 1.00 41.77  ? 129  ASP H N   1 
ATOM   8374  C  CA  . ASP D  4  129 ? 148.428 81.546  -11.593 1.00 45.40  ? 129  ASP H CA  1 
ATOM   8375  C  C   . ASP D  4  129 ? 148.766 83.014  -11.812 1.00 44.48  ? 129  ASP H C   1 
ATOM   8376  O  O   . ASP D  4  129 ? 149.646 83.347  -12.606 1.00 45.74  ? 129  ASP H O   1 
ATOM   8377  C  CB  . ASP D  4  129 ? 148.353 80.812  -12.923 1.00 53.16  ? 129  ASP H CB  1 
ATOM   8378  C  CG  . ASP D  4  129 ? 147.267 81.372  -13.835 1.00 62.83  ? 129  ASP H CG  1 
ATOM   8379  O  OD1 . ASP D  4  129 ? 146.068 81.314  -13.469 1.00 64.41  ? 129  ASP H OD1 1 
ATOM   8380  O  OD2 . ASP D  4  129 ? 147.621 81.900  -14.913 1.00 71.54  ? 129  ASP H OD2 1 
ATOM   8381  N  N   . GLY D  4  130 ? 147.984 83.887  -11.185 1.00 41.06  ? 130  GLY H N   1 
ATOM   8382  C  CA  . GLY D  4  130 ? 148.370 85.275  -11.071 1.00 37.58  ? 130  GLY H CA  1 
ATOM   8383  C  C   . GLY D  4  130 ? 147.585 86.185  -11.983 1.00 37.97  ? 130  GLY H C   1 
ATOM   8384  O  O   . GLY D  4  130 ? 147.614 87.410  -11.833 1.00 40.55  ? 130  GLY H O   1 
ATOM   8385  N  N   . LYS D  4  131 ? 146.830 85.600  -12.896 1.00 35.93  ? 131  LYS H N   1 
ATOM   8386  C  CA  . LYS D  4  131 ? 146.091 86.414  -13.846 1.00 38.32  ? 131  LYS H CA  1 
ATOM   8387  C  C   . LYS D  4  131 ? 144.886 87.104  -13.210 1.00 36.58  ? 131  LYS H C   1 
ATOM   8388  O  O   . LYS D  4  131 ? 144.289 86.573  -12.278 1.00 39.77  ? 131  LYS H O   1 
ATOM   8389  C  CB  . LYS D  4  131 ? 145.625 85.549  -15.012 1.00 42.56  ? 131  LYS H CB  1 
ATOM   8390  C  CG  . LYS D  4  131 ? 146.734 84.948  -15.846 1.00 44.81  ? 131  LYS H CG  1 
ATOM   8391  C  CD  . LYS D  4  131 ? 146.142 84.157  -17.015 1.00 49.33  ? 131  LYS H CD  1 
ATOM   8392  C  CE  . LYS D  4  131 ? 147.234 83.541  -17.877 0.00 47.74  ? 131  LYS H CE  1 
ATOM   8393  N  NZ  . LYS D  4  131 ? 146.687 82.556  -18.852 0.00 48.18  ? 131  LYS H NZ  1 
ATOM   8394  N  N   . ALA D  4  132 ? 144.461 88.222  -13.793 1.00 34.44  ? 132  ALA H N   1 
ATOM   8395  C  CA  . ALA D  4  132 ? 143.218 88.868  -13.399 1.00 34.78  ? 132  ALA H CA  1 
ATOM   8396  C  C   . ALA D  4  132 ? 142.080 87.873  -13.570 1.00 38.26  ? 132  ALA H C   1 
ATOM   8397  O  O   . ALA D  4  132 ? 141.981 87.225  -14.597 1.00 40.65  ? 132  ALA H O   1 
ATOM   8398  C  CB  . ALA D  4  132 ? 142.974 90.077  -14.258 1.00 34.57  ? 132  ALA H CB  1 
ATOM   8399  N  N   . LYS D  4  133 ? 141.227 87.738  -12.566 1.00 40.39  ? 133  LYS H N   1 
ATOM   8400  C  CA  . LYS D  4  133 ? 140.272 86.635  -12.534 1.00 36.54  ? 133  LYS H CA  1 
ATOM   8401  C  C   . LYS D  4  133 ? 138.979 86.968  -13.282 1.00 35.65  ? 133  LYS H C   1 
ATOM   8402  O  O   . LYS D  4  133 ? 138.449 86.133  -14.009 1.00 35.92  ? 133  LYS H O   1 
ATOM   8403  C  CB  . LYS D  4  133 ? 139.972 86.261  -11.074 1.00 39.36  ? 133  LYS H CB  1 
ATOM   8404  C  CG  . LYS D  4  133 ? 139.072 85.047  -10.855 1.00 36.17  ? 133  LYS H CG  1 
ATOM   8405  C  CD  . LYS D  4  133 ? 138.411 85.104  -9.484  1.00 33.91  ? 133  LYS H CD  1 
ATOM   8406  C  CE  . LYS D  4  133 ? 139.159 84.243  -8.474  1.00 34.75  ? 133  LYS H CE  1 
ATOM   8407  N  NZ  . LYS D  4  133 ? 138.447 84.241  -7.162  1.00 35.69  ? 133  LYS H NZ  1 
ATOM   8408  N  N   . ILE D  4  134 ? 138.420 88.146  -13.047 1.00 34.33  ? 134  ILE H N   1 
ATOM   8409  C  CA  . ILE D  4  134 ? 137.155 88.500  -13.672 1.00 34.26  ? 134  ILE H CA  1 
ATOM   8410  C  C   . ILE D  4  134 ? 137.415 89.533  -14.782 1.00 37.27  ? 134  ILE H C   1 
ATOM   8411  O  O   . ILE D  4  134 ? 137.892 90.652  -14.528 1.00 36.84  ? 134  ILE H O   1 
ATOM   8412  C  CB  . ILE D  4  134 ? 136.139 88.998  -12.591 1.00 36.23  ? 134  ILE H CB  1 
ATOM   8413  C  CG1 . ILE D  4  134 ? 135.667 87.806  -11.742 1.00 33.87  ? 134  ILE H CG1 1 
ATOM   8414  C  CG2 . ILE D  4  134 ? 134.918 89.668  -13.225 1.00 36.44  ? 134  ILE H CG2 1 
ATOM   8415  C  CD1 . ILE D  4  134 ? 136.302 87.724  -10.386 1.00 33.57  ? 134  ILE H CD1 1 
ATOM   8416  N  N   . VAL D  4  135 ? 137.301 89.057  -16.021 1.00 37.86  ? 135  VAL H N   1 
ATOM   8417  C  CA  . VAL D  4  135 ? 137.662 89.824  -17.219 1.00 36.91  ? 135  VAL H CA  1 
ATOM   8418  C  C   . VAL D  4  135 ? 136.668 89.613  -18.346 1.00 37.08  ? 135  VAL H C   1 
ATOM   8419  O  O   . VAL D  4  135 ? 136.173 88.500  -18.556 1.00 36.09  ? 135  VAL H O   1 
ATOM   8420  C  CB  . VAL D  4  135 ? 139.006 89.399  -17.770 1.00 34.95  ? 135  VAL H CB  1 
ATOM   8421  C  CG1 . VAL D  4  135 ? 140.120 89.948  -16.894 1.00 36.10  ? 135  VAL H CG1 1 
ATOM   8422  C  CG2 . VAL D  4  135 ? 139.050 87.886  -17.878 1.00 24.34  ? 135  VAL H CG2 1 
ATOM   8423  N  N   . PRO D  4  136 ? 136.476 90.646  -19.172 1.00 37.26  ? 136  PRO H N   1 
ATOM   8424  C  CA  . PRO D  4  136 ? 135.476 90.583  -20.237 1.00 34.78  ? 136  PRO H CA  1 
ATOM   8425  C  C   . PRO D  4  136 ? 135.925 89.526  -21.254 1.00 36.80  ? 136  PRO H C   1 
ATOM   8426  O  O   . PRO D  4  136 ? 137.123 89.223  -21.336 1.00 34.68  ? 136  PRO H O   1 
ATOM   8427  C  CB  . PRO D  4  136 ? 135.519 91.989  -20.813 1.00 34.15  ? 136  PRO H CB  1 
ATOM   8428  C  CG  . PRO D  4  136 ? 136.978 92.332  -20.713 1.00 37.87  ? 136  PRO H CG  1 
ATOM   8429  C  CD  . PRO D  4  136 ? 137.441 91.737  -19.405 1.00 35.93  ? 136  PRO H CD  1 
ATOM   8430  N  N   . LEU D  4  137 ? 134.979 88.990  -22.033 1.00 36.57  ? 137  LEU H N   1 
ATOM   8431  C  CA  . LEU D  4  137 ? 135.270 87.939  -23.001 1.00 35.16  ? 137  LEU H CA  1 
ATOM   8432  C  C   . LEU D  4  137 ? 136.084 88.434  -24.185 1.00 36.61  ? 137  LEU H C   1 
ATOM   8433  O  O   . LEU D  4  137 ? 136.764 87.645  -24.834 1.00 36.33  ? 137  LEU H O   1 
ATOM   8434  C  CB  . LEU D  4  137 ? 133.983 87.283  -23.502 1.00 36.71  ? 137  LEU H CB  1 
ATOM   8435  C  CG  . LEU D  4  137 ? 133.418 86.064  -22.745 1.00 37.29  ? 137  LEU H CG  1 
ATOM   8436  C  CD1 . LEU D  4  137 ? 131.978 85.860  -23.172 1.00 40.21  ? 137  LEU H CD1 1 
ATOM   8437  C  CD2 . LEU D  4  137 ? 134.218 84.800  -23.014 1.00 36.72  ? 137  LEU H CD2 1 
ATOM   8438  N  N   . ARG D  4  138 ? 136.061 89.741  -24.436 1.00 36.83  ? 138  ARG H N   1 
ATOM   8439  C  CA  . ARG D  4  138 ? 137.040 90.363  -25.335 1.00 39.73  ? 138  ARG H CA  1 
ATOM   8440  C  C   . ARG D  4  138 ? 138.469 89.942  -24.948 1.00 42.78  ? 138  ARG H C   1 
ATOM   8441  O  O   . ARG D  4  138 ? 139.214 89.424  -25.774 1.00 45.45  ? 138  ARG H O   1 
ATOM   8442  C  CB  . ARG D  4  138 ? 136.924 91.890  -25.296 1.00 35.90  ? 138  ARG H CB  1 
ATOM   8443  C  CG  . ARG D  4  138 ? 137.597 92.522  -24.093 1.00 41.64  ? 138  ARG H CG  1 
ATOM   8444  C  CD  . ARG D  4  138 ? 137.389 93.997  -24.054 1.00 42.90  ? 138  ARG H CD  1 
ATOM   8445  N  NE  . ARG D  4  138 ? 135.980 94.311  -23.947 1.00 44.39  ? 138  ARG H NE  1 
ATOM   8446  C  CZ  . ARG D  4  138 ? 135.424 94.915  -22.902 1.00 49.59  ? 138  ARG H CZ  1 
ATOM   8447  N  NH1 . ARG D  4  138 ? 136.153 95.292  -21.859 1.00 45.22  ? 138  ARG H NH1 1 
ATOM   8448  N  NH2 . ARG D  4  138 ? 134.121 95.144  -22.907 1.00 55.46  ? 138  ARG H NH2 1 
ATOM   8449  N  N   . VAL D  4  139 ? 138.787 90.038  -23.660 1.00 45.18  ? 139  VAL H N   1 
ATOM   8450  C  CA  . VAL D  4  139 ? 140.073 89.584  -23.139 1.00 45.95  ? 139  VAL H CA  1 
ATOM   8451  C  C   . VAL D  4  139 ? 140.087 88.060  -22.987 1.00 50.34  ? 139  VAL H C   1 
ATOM   8452  O  O   . VAL D  4  139 ? 141.053 87.392  -23.366 1.00 50.38  ? 139  VAL H O   1 
ATOM   8453  C  CB  . VAL D  4  139 ? 140.335 90.203  -21.769 1.00 43.00  ? 139  VAL H CB  1 
ATOM   8454  C  CG1 . VAL D  4  139 ? 141.668 89.762  -21.263 1.00 38.99  ? 139  VAL H CG1 1 
ATOM   8455  C  CG2 . VAL D  4  139 ? 140.248 91.709  -21.859 1.00 39.80  ? 139  VAL H CG2 1 
ATOM   8456  N  N   . ALA D  4  140 ? 139.028 87.534  -22.374 1.00 54.33  ? 140  ALA H N   1 
ATOM   8457  C  CA  . ALA D  4  140 ? 138.870 86.103  -22.127 1.00 55.85  ? 140  ALA H CA  1 
ATOM   8458  C  C   . ALA D  4  140 ? 138.485 85.388  -23.419 1.00 56.08  ? 140  ALA H C   1 
ATOM   8459  O  O   . ALA D  4  140 ? 137.315 85.071  -23.646 1.00 56.20  ? 140  ALA H O   1 
ATOM   8460  C  CB  . ALA D  4  140 ? 137.803 85.873  -21.053 1.00 56.14  ? 140  ALA H CB  1 
ATOM   8461  N  N   . THR D  4  141 ? 139.507 85.001  -24.173 1.00 56.82  ? 141  THR H N   1 
ATOM   8462  C  CA  . THR D  4  141 ? 139.353 84.569  -25.559 1.00 58.42  ? 141  THR H CA  1 
ATOM   8463  C  C   . THR D  4  141 ? 139.090 83.060  -25.704 1.00 57.20  ? 141  THR H C   1 
ATOM   8464  O  O   . THR D  4  141 ? 138.207 82.639  -26.453 1.00 58.70  ? 141  THR H O   1 
ATOM   8465  C  CB  . THR D  4  141 ? 140.605 85.019  -26.370 1.00 60.92  ? 141  THR H CB  1 
ATOM   8466  O  OG1 . THR D  4  141 ? 140.238 86.100  -27.234 1.00 64.43  ? 141  THR H OG1 1 
ATOM   8467  C  CG2 . THR D  4  141 ? 141.223 83.870  -27.173 1.00 61.97  ? 141  THR H CG2 1 
ATOM   8468  N  N   . ASP D  4  142 ? 139.806 82.260  -24.924 1.00 54.58  ? 142  ASP H N   1 
ATOM   8469  C  CA  . ASP D  4  142 ? 139.558 80.822  -24.836 1.00 53.23  ? 142  ASP H CA  1 
ATOM   8470  C  C   . ASP D  4  142 ? 138.228 80.469  -24.146 1.00 50.46  ? 142  ASP H C   1 
ATOM   8471  O  O   . ASP D  4  142 ? 137.921 79.294  -23.937 1.00 49.73  ? 142  ASP H O   1 
ATOM   8472  C  CB  . ASP D  4  142 ? 140.728 80.124  -24.126 1.00 56.60  ? 142  ASP H CB  1 
ATOM   8473  C  CG  . ASP D  4  142 ? 141.360 80.979  -23.004 1.00 63.12  ? 142  ASP H CG  1 
ATOM   8474  O  OD1 . ASP D  4  142 ? 140.858 82.077  -22.663 1.00 65.86  ? 142  ASP H OD1 1 
ATOM   8475  O  OD2 . ASP D  4  142 ? 142.385 80.537  -22.441 1.00 69.07  ? 142  ASP H OD2 1 
ATOM   8476  N  N   . PHE D  4  143 ? 137.450 81.493  -23.806 1.00 48.45  ? 143  PHE H N   1 
ATOM   8477  C  CA  . PHE D  4  143 ? 136.145 81.329  -23.178 1.00 49.16  ? 143  PHE H CA  1 
ATOM   8478  C  C   . PHE D  4  143 ? 135.000 81.661  -24.142 1.00 49.29  ? 143  PHE H C   1 
ATOM   8479  O  O   . PHE D  4  143 ? 135.146 82.484  -25.056 1.00 51.46  ? 143  PHE H O   1 
ATOM   8480  C  CB  . PHE D  4  143 ? 136.049 82.215  -21.937 1.00 46.81  ? 143  PHE H CB  1 
ATOM   8481  C  CG  . PHE D  4  143 ? 136.708 81.626  -20.734 1.00 44.39  ? 143  PHE H CG  1 
ATOM   8482  C  CD1 . PHE D  4  143 ? 138.082 81.729  -20.562 1.00 42.03  ? 143  PHE H CD1 1 
ATOM   8483  C  CD2 . PHE D  4  143 ? 135.974 80.891  -19.818 1.00 43.51  ? 143  PHE H CD2 1 
ATOM   8484  C  CE1 . PHE D  4  143 ? 138.720 81.100  -19.504 1.00 39.00  ? 143  PHE H CE1 1 
ATOM   8485  C  CE2 . PHE D  4  143 ? 136.604 80.263  -18.757 1.00 42.02  ? 143  PHE H CE2 1 
ATOM   8486  C  CZ  . PHE D  4  143 ? 137.983 80.366  -18.603 1.00 40.38  ? 143  PHE H CZ  1 
ATOM   8487  N  N   . SER D  4  144 ? 133.832 81.095  -23.867 1.00 46.47  ? 144  SER H N   1 
ATOM   8488  C  CA  . SER D  4  144 ? 132.754 81.029  -24.847 1.00 45.33  ? 144  SER H CA  1 
ATOM   8489  C  C   . SER D  4  144 ? 131.447 80.787  -24.136 1.00 42.90  ? 144  SER H C   1 
ATOM   8490  O  O   . SER D  4  144 ? 131.429 80.173  -23.082 1.00 47.40  ? 144  SER H O   1 
ATOM   8491  C  CB  . SER D  4  144 ? 133.001 79.866  -25.805 1.00 46.62  ? 144  SER H CB  1 
ATOM   8492  O  OG  . SER D  4  144 ? 133.442 78.714  -25.102 1.00 48.58  ? 144  SER H OG  1 
ATOM   8493  N  N   . ILE D  4  145 ? 130.345 81.164  -24.756 1.00 41.84  ? 145  ILE H N   1 
ATOM   8494  C  CA  . ILE D  4  145 ? 129.045 80.802  -24.229 1.00 39.06  ? 145  ILE H CA  1 
ATOM   8495  C  C   . ILE D  4  145 ? 128.757 79.379  -24.641 1.00 40.28  ? 145  ILE H C   1 
ATOM   8496  O  O   . ILE D  4  145 ? 129.112 78.969  -25.742 1.00 45.48  ? 145  ILE H O   1 
ATOM   8497  C  CB  . ILE D  4  145 ? 127.960 81.732  -24.767 1.00 39.74  ? 145  ILE H CB  1 
ATOM   8498  C  CG1 . ILE D  4  145 ? 128.205 83.137  -24.216 1.00 37.24  ? 145  ILE H CG1 1 
ATOM   8499  C  CG2 . ILE D  4  145 ? 126.575 81.202  -24.402 1.00 41.79  ? 145  ILE H CG2 1 
ATOM   8500  C  CD1 . ILE D  4  145 ? 127.100 84.100  -24.467 1.00 41.70  ? 145  ILE H CD1 1 
ATOM   8501  N  N   . ALA D  4  146 ? 128.261 78.584  -23.702 1.00 43.83  ? 146  ALA H N   1 
ATOM   8502  C  CA  . ALA D  4  146 ? 127.911 77.196  -23.989 1.00 45.67  ? 146  ALA H CA  1 
ATOM   8503  C  C   . ALA D  4  146 ? 126.836 77.116  -25.064 1.00 47.68  ? 146  ALA H C   1 
ATOM   8504  O  O   . ALA D  4  146 ? 125.895 77.926  -25.109 1.00 50.08  ? 146  ALA H O   1 
ATOM   8505  C  CB  . ALA D  4  146 ? 127.436 76.496  -22.733 1.00 43.88  ? 146  ALA H CB  1 
ATOM   8506  N  N   . GLU D  4  147 ? 126.998 76.146  -25.953 1.00 50.29  ? 147  GLU H N   1 
ATOM   8507  C  CA  . GLU D  4  147 ? 126.018 75.928  -27.000 1.00 50.26  ? 147  GLU H CA  1 
ATOM   8508  C  C   . GLU D  4  147 ? 124.700 75.654  -26.317 1.00 48.65  ? 147  GLU H C   1 
ATOM   8509  O  O   . GLU D  4  147 ? 124.596 74.745  -25.482 1.00 47.91  ? 147  GLU H O   1 
ATOM   8510  C  CB  . GLU D  4  147 ? 126.401 74.732  -27.880 1.00 55.36  ? 147  GLU H CB  1 
ATOM   8511  C  CG  . GLU D  4  147 ? 125.619 74.659  -29.186 0.00 54.44  ? 147  GLU H CG  1 
ATOM   8512  C  CD  . GLU D  4  147 ? 125.448 73.240  -29.691 0.00 55.20  ? 147  GLU H CD  1 
ATOM   8513  O  OE1 . GLU D  4  147 ? 126.355 72.741  -30.390 0.00 55.20  ? 147  GLU H OE1 1 
ATOM   8514  O  OE2 . GLU D  4  147 ? 124.399 72.627  -29.400 0.00 55.20  ? 147  GLU H OE2 1 
ATOM   8515  N  N   . GLY D  4  148 ? 123.758 76.552  -26.552 1.00 46.34  ? 148  GLY H N   1 
ATOM   8516  C  CA  . GLY D  4  148 ? 122.427 76.365  -26.038 1.00 45.51  ? 148  GLY H CA  1 
ATOM   8517  C  C   . GLY D  4  148 ? 121.979 77.629  -25.356 1.00 47.58  ? 148  GLY H C   1 
ATOM   8518  O  O   . GLY D  4  148 ? 120.780 77.870  -25.244 1.00 50.52  ? 148  GLY H O   1 
ATOM   8519  N  N   . ASP D  4  149 ? 122.918 78.452  -24.903 1.00 46.11  ? 149  ASP H N   1 
ATOM   8520  C  CA  . ASP D  4  149 ? 122.520 79.608  -24.120 1.00 47.05  ? 149  ASP H CA  1 
ATOM   8521  C  C   . ASP D  4  149 ? 122.530 80.896  -24.905 1.00 45.61  ? 149  ASP H C   1 
ATOM   8522  O  O   . ASP D  4  149 ? 123.224 81.010  -25.919 1.00 46.23  ? 149  ASP H O   1 
ATOM   8523  C  CB  . ASP D  4  149 ? 123.376 79.723  -22.857 1.00 50.19  ? 149  ASP H CB  1 
ATOM   8524  C  CG  . ASP D  4  149 ? 122.964 78.719  -21.798 1.00 51.66  ? 149  ASP H CG  1 
ATOM   8525  O  OD1 . ASP D  4  149 ? 121.744 78.559  -21.595 1.00 51.77  ? 149  ASP H OD1 1 
ATOM   8526  O  OD2 . ASP D  4  149 ? 123.838 78.021  -21.240 1.00 54.33  ? 149  ASP H OD2 1 
ATOM   8527  N  N   . VAL D  4  150 ? 121.561 81.740  -24.573 1.00 43.03  ? 150  VAL H N   1 
ATOM   8528  C  CA  . VAL D  4  150 ? 121.492 83.109  -25.056 1.00 45.61  ? 150  VAL H CA  1 
ATOM   8529  C  C   . VAL D  4  150 ? 122.873 83.759  -24.916 1.00 50.17  ? 150  VAL H C   1 
ATOM   8530  O  O   . VAL D  4  150 ? 123.547 83.586  -23.892 1.00 53.99  ? 150  VAL H O   1 
ATOM   8531  C  CB  . VAL D  4  150 ? 120.437 83.919  -24.238 1.00 44.58  ? 150  VAL H CB  1 
ATOM   8532  C  CG1 . VAL D  4  150 ? 120.460 85.386  -24.613 1.00 42.90  ? 150  VAL H CG1 1 
ATOM   8533  C  CG2 . VAL D  4  150 ? 119.039 83.353  -24.470 1.00 46.55  ? 150  VAL H CG2 1 
ATOM   8534  N  N   . ASP D  4  151 ? 123.376 84.275  -26.039 1.00 50.58  ? 151  ASP H N   1 
ATOM   8535  C  CA  . ASP D  4  151 ? 124.543 85.164  -26.076 1.00 48.41  ? 151  ASP H CA  1 
ATOM   8536  C  C   . ASP D  4  151 ? 123.994 86.600  -26.017 1.00 50.09  ? 151  ASP H C   1 
ATOM   8537  O  O   . ASP D  4  151 ? 123.251 87.020  -26.907 1.00 52.41  ? 151  ASP H O   1 
ATOM   8538  C  CB  . ASP D  4  151 ? 125.322 84.895  -27.381 1.00 43.27  ? 151  ASP H CB  1 
ATOM   8539  C  CG  . ASP D  4  151 ? 126.487 85.865  -27.628 1.00 46.20  ? 151  ASP H CG  1 
ATOM   8540  O  OD1 . ASP D  4  151 ? 126.613 86.902  -26.947 1.00 45.63  ? 151  ASP H OD1 1 
ATOM   8541  O  OD2 . ASP D  4  151 ? 127.260 85.608  -28.582 1.00 45.62  ? 151  ASP H OD2 1 
ATOM   8542  N  N   . PRO D  4  152 ? 124.221 87.312  -24.896 1.00 49.38  ? 152  PRO H N   1 
ATOM   8543  C  CA  . PRO D  4  152 ? 123.449 88.545  -24.719 1.00 49.35  ? 152  PRO H CA  1 
ATOM   8544  C  C   . PRO D  4  152 ? 124.029 89.675  -25.560 1.00 49.26  ? 152  PRO H C   1 
ATOM   8545  O  O   . PRO D  4  152 ? 123.388 90.719  -25.712 1.00 51.26  ? 152  PRO H O   1 
ATOM   8546  C  CB  . PRO D  4  152 ? 123.571 88.823  -23.227 1.00 47.41  ? 152  PRO H CB  1 
ATOM   8547  C  CG  . PRO D  4  152 ? 124.934 88.319  -22.913 1.00 46.66  ? 152  PRO H CG  1 
ATOM   8548  C  CD  . PRO D  4  152 ? 125.106 87.062  -23.746 1.00 47.86  ? 152  PRO H CD  1 
ATOM   8549  N  N   . ARG D  4  153 ? 125.227 89.448  -26.112 1.00 45.68  ? 153  ARG H N   1 
ATOM   8550  C  CA  . ARG D  4  153 ? 125.930 90.431  -26.952 1.00 45.60  ? 153  ARG H CA  1 
ATOM   8551  C  C   . ARG D  4  153 ? 125.095 90.875  -28.159 1.00 46.15  ? 153  ARG H C   1 
ATOM   8552  O  O   . ARG D  4  153 ? 124.874 90.106  -29.099 1.00 47.39  ? 153  ARG H O   1 
ATOM   8553  C  CB  . ARG D  4  153 ? 127.262 89.857  -27.443 1.00 40.64  ? 153  ARG H CB  1 
ATOM   8554  C  CG  . ARG D  4  153 ? 128.251 89.553  -26.339 1.00 36.75  ? 153  ARG H CG  1 
ATOM   8555  C  CD  . ARG D  4  153 ? 129.532 88.899  -26.859 1.00 29.60  ? 153  ARG H CD  1 
ATOM   8556  N  NE  . ARG D  4  153 ? 129.343 87.514  -27.280 1.00 27.75  ? 153  ARG H NE  1 
ATOM   8557  C  CZ  . ARG D  4  153 ? 130.332 86.633  -27.438 1.00 28.64  ? 153  ARG H CZ  1 
ATOM   8558  N  NH1 . ARG D  4  153 ? 131.592 87.000  -27.263 1.00 28.48  ? 153  ARG H NH1 1 
ATOM   8559  N  NH2 . ARG D  4  153 ? 130.065 85.375  -27.789 1.00 34.88  ? 153  ARG H NH2 1 
ATOM   8560  N  N   . GLY D  4  154 ? 124.671 92.131  -28.147 1.00 44.79  ? 154  GLY H N   1 
ATOM   8561  C  CA  . GLY D  4  154 ? 123.709 92.586  -29.124 1.00 45.59  ? 154  GLY H CA  1 
ATOM   8562  C  C   . GLY D  4  154 ? 122.366 92.937  -28.502 1.00 48.48  ? 154  GLY H C   1 
ATOM   8563  O  O   . GLY D  4  154 ? 121.732 93.922  -28.913 1.00 52.80  ? 154  GLY H O   1 
ATOM   8564  N  N   . LEU D  4  155 ? 121.935 92.159  -27.509 1.00 44.47  ? 155  LEU H N   1 
ATOM   8565  C  CA  . LEU D  4  155 ? 120.627 92.340  -26.900 1.00 39.35  ? 155  LEU H CA  1 
ATOM   8566  C  C   . LEU D  4  155 ? 120.495 93.690  -26.210 1.00 38.72  ? 155  LEU H C   1 
ATOM   8567  O  O   . LEU D  4  155 ? 121.457 94.219  -25.654 1.00 37.91  ? 155  LEU H O   1 
ATOM   8568  C  CB  . LEU D  4  155 ? 120.376 91.239  -25.889 1.00 42.52  ? 155  LEU H CB  1 
ATOM   8569  C  CG  . LEU D  4  155 ? 120.178 89.830  -26.431 1.00 43.23  ? 155  LEU H CG  1 
ATOM   8570  C  CD1 . LEU D  4  155 ? 119.730 88.894  -25.305 1.00 43.30  ? 155  LEU H CD1 1 
ATOM   8571  C  CD2 . LEU D  4  155 ? 119.140 89.874  -27.509 1.00 40.56  ? 155  LEU H CD2 1 
ATOM   8572  N  N   . PRO D  4  156 ? 119.282 94.247  -26.195 1.00 38.49  ? 156  PRO H N   1 
ATOM   8573  C  CA  . PRO D  4  156 ? 118.998 95.454  -25.407 1.00 42.18  ? 156  PRO H CA  1 
ATOM   8574  C  C   . PRO D  4  156 ? 118.768 95.182  -23.910 1.00 45.35  ? 156  PRO H C   1 
ATOM   8575  O  O   . PRO D  4  156 ? 118.127 94.187  -23.530 1.00 47.24  ? 156  PRO H O   1 
ATOM   8576  C  CB  . PRO D  4  156 ? 117.740 96.019  -26.064 1.00 39.22  ? 156  PRO H CB  1 
ATOM   8577  C  CG  . PRO D  4  156 ? 117.028 94.796  -26.575 1.00 37.59  ? 156  PRO H CG  1 
ATOM   8578  C  CD  . PRO D  4  156 ? 118.125 93.831  -27.007 1.00 36.66  ? 156  PRO H CD  1 
ATOM   8579  N  N   . VAL D  4  157 ? 119.238 96.103  -23.072 1.00 44.74  ? 157  VAL H N   1 
ATOM   8580  C  CA  . VAL D  4  157 ? 118.956 96.053  -21.648 1.00 41.51  ? 157  VAL H CA  1 
ATOM   8581  C  C   . VAL D  4  157 ? 117.770 96.942  -21.366 1.00 40.94  ? 157  VAL H C   1 
ATOM   8582  O  O   . VAL D  4  157 ? 117.730 98.086  -21.818 1.00 40.16  ? 157  VAL H O   1 
ATOM   8583  C  CB  . VAL D  4  157 ? 120.147 96.540  -20.824 1.00 39.65  ? 157  VAL H CB  1 
ATOM   8584  C  CG1 . VAL D  4  157 ? 119.810 96.493  -19.338 1.00 38.34  ? 157  VAL H CG1 1 
ATOM   8585  C  CG2 . VAL D  4  157 ? 121.362 95.670  -21.125 1.00 41.49  ? 157  VAL H CG2 1 
ATOM   8586  N  N   . VAL D  4  158 ? 116.821 96.421  -20.596 1.00 40.83  ? 158  VAL H N   1 
ATOM   8587  C  CA  . VAL D  4  158 ? 115.573 97.124  -20.331 1.00 39.63  ? 158  VAL H CA  1 
ATOM   8588  C  C   . VAL D  4  158 ? 115.366 97.340  -18.835 1.00 38.63  ? 158  VAL H C   1 
ATOM   8589  O  O   . VAL D  4  158 ? 115.377 96.396  -18.051 1.00 37.47  ? 158  VAL H O   1 
ATOM   8590  C  CB  . VAL D  4  158 ? 114.382 96.340  -20.878 1.00 40.49  ? 158  VAL H CB  1 
ATOM   8591  C  CG1 . VAL D  4  158 ? 113.157 97.246  -20.956 1.00 33.77  ? 158  VAL H CG1 1 
ATOM   8592  C  CG2 . VAL D  4  158 ? 114.739 95.721  -22.236 1.00 37.96  ? 158  VAL H CG2 1 
ATOM   8593  N  N   . ALA D  4  159 ? 115.087 98.581  -18.473 1.00 37.33  ? 159  ALA H N   1 
ATOM   8594  C  CA  . ALA D  4  159 ? 115.120 99.014  -17.091 1.00 37.76  ? 159  ALA H CA  1 
ATOM   8595  C  C   . ALA D  4  159 ? 113.782 98.767  -16.404 1.00 36.74  ? 159  ALA H C   1 
ATOM   8596  O  O   . ALA D  4  159 ? 112.827 98.361  -17.033 1.00 32.91  ? 159  ALA H O   1 
ATOM   8597  C  CB  . ALA D  4  159 ? 115.478 100.487 -17.037 1.00 34.71  ? 159  ALA H CB  1 
ATOM   8598  N  N   . ALA D  4  160 ? 113.688 99.152  -15.140 1.00 39.12  ? 160  ALA H N   1 
ATOM   8599  C  CA  . ALA D  4  160 ? 112.473 98.963  -14.359 1.00 42.36  ? 160  ALA H CA  1 
ATOM   8600  C  C   . ALA D  4  160 ? 111.310 99.775  -14.908 1.00 44.30  ? 160  ALA H C   1 
ATOM   8601  O  O   . ALA D  4  160 ? 110.145 99.446  -14.672 1.00 44.08  ? 160  ALA H O   1 
ATOM   8602  C  CB  . ALA D  4  160 ? 112.731 99.346  -12.909 1.00 41.16  ? 160  ALA H CB  1 
ATOM   8603  N  N   . ASP D  4  161 ? 111.634 100.902 -15.538 1.00 47.00  ? 161  ASP H N   1 
ATOM   8604  C  CA  . ASP D  4  161 ? 110.613 101.799 -16.078 1.00 47.37  ? 161  ASP H CA  1 
ATOM   8605  C  C   . ASP D  4  161 ? 110.146 101.353 -17.444 1.00 47.71  ? 161  ASP H C   1 
ATOM   8606  O  O   . ASP D  4  161 ? 109.333 102.017 -18.076 1.00 48.78  ? 161  ASP H O   1 
ATOM   8607  C  CB  . ASP D  4  161 ? 111.113 103.248 -16.164 1.00 47.15  ? 161  ASP H CB  1 
ATOM   8608  C  CG  . ASP D  4  161 ? 112.518 103.372 -16.748 1.00 49.57  ? 161  ASP H CG  1 
ATOM   8609  O  OD1 . ASP D  4  161 ? 113.121 102.351 -17.179 1.00 47.17  ? 161  ASP H OD1 1 
ATOM   8610  O  OD2 . ASP D  4  161 ? 113.027 104.521 -16.740 1.00 47.96  ? 161  ASP H OD2 1 
ATOM   8611  N  N   . GLY D  4  162 ? 110.701 100.247 -17.914 1.00 48.68  ? 162  GLY H N   1 
ATOM   8612  C  CA  . GLY D  4  162 ? 110.245 99.675  -19.163 1.00 51.01  ? 162  GLY H CA  1 
ATOM   8613  C  C   . GLY D  4  162 ? 111.060 100.154 -20.340 1.00 50.54  ? 162  GLY H C   1 
ATOM   8614  O  O   . GLY D  4  162 ? 110.941 99.606  -21.430 1.00 54.80  ? 162  GLY H O   1 
ATOM   8615  N  N   . VAL D  4  163 ? 112.026 101.024 -20.068 1.00 50.65  ? 163  VAL H N   1 
ATOM   8616  C  CA  . VAL D  4  163 ? 112.740 101.753 -21.109 1.00 48.04  ? 163  VAL H CA  1 
ATOM   8617  C  C   . VAL D  4  163 ? 114.095 101.124 -21.402 1.00 49.02  ? 163  VAL H C   1 
ATOM   8618  O  O   . VAL D  4  163 ? 114.838 100.786 -20.478 1.00 53.27  ? 163  VAL H O   1 
ATOM   8619  C  CB  . VAL D  4  163 ? 112.940 103.214 -20.679 1.00 46.05  ? 163  VAL H CB  1 
ATOM   8620  C  CG1 . VAL D  4  163 ? 113.666 103.985 -21.762 1.00 46.96  ? 163  VAL H CG1 1 
ATOM   8621  C  CG2 . VAL D  4  163 ? 111.585 103.849 -20.348 1.00 41.26  ? 163  VAL H CG2 1 
ATOM   8622  N  N   . GLU D  4  164 ? 114.406 100.955 -22.682 1.00 48.98  ? 164  GLU H N   1 
ATOM   8623  C  CA  . GLU D  4  164 ? 115.688 100.396 -23.085 1.00 50.87  ? 164  GLU H CA  1 
ATOM   8624  C  C   . GLU D  4  164 ? 116.771 101.361 -22.625 1.00 49.59  ? 164  GLU H C   1 
ATOM   8625  O  O   . GLU D  4  164 ? 116.640 102.568 -22.806 1.00 50.17  ? 164  GLU H O   1 
ATOM   8626  C  CB  . GLU D  4  164 ? 115.746 100.234 -24.602 1.00 55.36  ? 164  GLU H CB  1 
ATOM   8627  C  CG  . GLU D  4  164 ? 117.030 99.594  -25.103 1.00 65.78  ? 164  GLU H CG  1 
ATOM   8628  C  CD  . GLU D  4  164 ? 117.109 99.545  -26.623 1.00 74.30  ? 164  GLU H CD  1 
ATOM   8629  O  OE1 . GLU D  4  164 ? 116.361 98.749  -27.233 1.00 79.67  ? 164  GLU H OE1 1 
ATOM   8630  O  OE2 . GLU D  4  164 ? 117.924 100.292 -27.215 1.00 78.72  ? 164  GLU H OE2 1 
ATOM   8631  N  N   . ALA D  4  165 ? 117.785 100.848 -21.938 1.00 46.34  ? 165  ALA H N   1 
ATOM   8632  C  CA  . ALA D  4  165 ? 118.756 101.716 -21.296 1.00 41.27  ? 165  ALA H CA  1 
ATOM   8633  C  C   . ALA D  4  165 ? 120.155 101.526 -21.863 1.00 39.70  ? 165  ALA H C   1 
ATOM   8634  O  O   . ALA D  4  165 ? 121.046 102.316 -21.563 1.00 41.92  ? 165  ALA H O   1 
ATOM   8635  C  CB  . ALA D  4  165 ? 118.755 101.479 -19.793 1.00 40.14  ? 165  ALA H CB  1 
ATOM   8636  N  N   . GLY D  4  166 ? 120.360 100.476 -22.657 1.00 34.18  ? 166  GLY H N   1 
ATOM   8637  C  CA  . GLY D  4  166 ? 121.670 100.246 -23.240 1.00 28.04  ? 166  GLY H CA  1 
ATOM   8638  C  C   . GLY D  4  166 ? 121.691 98.985  -24.071 1.00 27.31  ? 166  GLY H C   1 
ATOM   8639  O  O   . GLY D  4  166 ? 120.653 98.370  -24.276 1.00 29.90  ? 166  GLY H O   1 
ATOM   8640  N  N   . THR D  4  167 ? 122.879 98.521  -24.429 1.00 27.65  ? 167  THR H N   1 
ATOM   8641  C  CA  . THR D  4  167 ? 123.028 97.377  -25.323 1.00 29.23  ? 167  THR H CA  1 
ATOM   8642  C  C   . THR D  4  167 ? 124.215 96.555  -24.840 1.00 30.23  ? 167  THR H C   1 
ATOM   8643  O  O   . THR D  4  167 ? 125.272 97.112  -24.562 1.00 32.91  ? 167  THR H O   1 
ATOM   8644  C  CB  . THR D  4  167 ? 123.319 97.867  -26.779 1.00 37.66  ? 167  THR H CB  1 
ATOM   8645  O  OG1 . THR D  4  167 ? 122.178 98.585  -27.297 1.00 41.50  ? 167  THR H OG1 1 
ATOM   8646  C  CG2 . THR D  4  167 ? 123.708 96.683  -27.710 1.00 31.35  ? 167  THR H CG2 1 
ATOM   8647  N  N   . VAL D  4  168 ? 124.061 95.240  -24.749 1.00 30.64  ? 168  VAL H N   1 
ATOM   8648  C  CA  . VAL D  4  168 ? 125.094 94.412  -24.136 1.00 33.68  ? 168  VAL H CA  1 
ATOM   8649  C  C   . VAL D  4  168 ? 126.286 94.286  -25.053 1.00 34.21  ? 168  VAL H C   1 
ATOM   8650  O  O   . VAL D  4  168 ? 126.175 93.754  -26.145 1.00 36.64  ? 168  VAL H O   1 
ATOM   8651  C  CB  . VAL D  4  168 ? 124.563 92.994  -23.782 1.00 32.25  ? 168  VAL H CB  1 
ATOM   8652  C  CG1 . VAL D  4  168 ? 125.718 92.081  -23.294 1.00 24.50  ? 168  VAL H CG1 1 
ATOM   8653  C  CG2 . VAL D  4  168 ? 123.469 93.117  -22.729 1.00 30.81  ? 168  VAL H CG2 1 
ATOM   8654  N  N   . THR D  4  169 ? 127.441 94.730  -24.589 1.00 38.82  ? 169  THR H N   1 
ATOM   8655  C  CA  . THR D  4  169 ? 128.627 94.661  -25.415 1.00 43.23  ? 169  THR H CA  1 
ATOM   8656  C  C   . THR D  4  169 ? 129.474 93.434  -25.105 1.00 42.80  ? 169  THR H C   1 
ATOM   8657  O  O   . THR D  4  169 ? 130.219 92.965  -25.958 1.00 44.75  ? 169  THR H O   1 
ATOM   8658  C  CB  . THR D  4  169 ? 129.478 95.936  -25.275 1.00 45.75  ? 169  THR H CB  1 
ATOM   8659  O  OG1 . THR D  4  169 ? 130.309 95.837  -24.116 1.00 52.78  ? 169  THR H OG1 1 
ATOM   8660  C  CG2 . THR D  4  169 ? 128.591 97.164  -25.133 1.00 48.39  ? 169  THR H CG2 1 
ATOM   8661  N  N   . ASP D  4  170 ? 129.401 92.932  -23.878 1.00 44.86  ? 170  ASP H N   1 
ATOM   8662  C  CA  . ASP D  4  170 ? 130.237 91.789  -23.490 1.00 43.37  ? 170  ASP H CA  1 
ATOM   8663  C  C   . ASP D  4  170 ? 129.715 91.075  -22.236 1.00 44.20  ? 170  ASP H C   1 
ATOM   8664  O  O   . ASP D  4  170 ? 128.704 91.483  -21.651 1.00 45.14  ? 170  ASP H O   1 
ATOM   8665  C  CB  . ASP D  4  170 ? 131.676 92.256  -23.259 1.00 38.75  ? 170  ASP H CB  1 
ATOM   8666  C  CG  . ASP D  4  170 ? 132.717 91.261  -23.747 1.00 37.46  ? 170  ASP H CG  1 
ATOM   8667  O  OD1 . ASP D  4  170 ? 132.487 90.033  -23.741 1.00 35.90  ? 170  ASP H OD1 1 
ATOM   8668  O  OD2 . ASP D  4  170 ? 133.827 91.718  -24.072 1.00 42.37  ? 170  ASP H OD2 1 
ATOM   8669  N  N   . LEU D  4  171 ? 130.330 89.934  -21.930 1.00 42.74  ? 171  LEU H N   1 
ATOM   8670  C  CA  . LEU D  4  171 ? 130.107 89.212  -20.684 1.00 42.72  ? 171  LEU H CA  1 
ATOM   8671  C  C   . LEU D  4  171 ? 131.464 89.123  -19.990 1.00 43.08  ? 171  LEU H C   1 
ATOM   8672  O  O   . LEU D  4  171 ? 132.461 88.806  -20.639 1.00 44.15  ? 171  LEU H O   1 
ATOM   8673  C  CB  . LEU D  4  171 ? 129.616 87.788  -20.977 1.00 41.87  ? 171  LEU H CB  1 
ATOM   8674  C  CG  . LEU D  4  171 ? 128.381 87.507  -21.840 1.00 44.50  ? 171  LEU H CG  1 
ATOM   8675  C  CD1 . LEU D  4  171 ? 128.695 87.701  -23.294 1.00 42.51  ? 171  LEU H CD1 1 
ATOM   8676  C  CD2 . LEU D  4  171 ? 127.920 86.080  -21.617 1.00 41.49  ? 171  LEU H CD2 1 
ATOM   8677  N  N   . TRP D  4  172 ? 131.526 89.390  -18.689 1.00 42.94  ? 172  TRP H N   1 
ATOM   8678  C  CA  . TRP D  4  172 ? 132.765 89.121  -17.950 1.00 41.60  ? 172  TRP H CA  1 
ATOM   8679  C  C   . TRP D  4  172 ? 132.697 87.743  -17.291 1.00 38.53  ? 172  TRP H C   1 
ATOM   8680  O  O   . TRP D  4  172 ? 131.690 87.401  -16.666 1.00 39.47  ? 172  TRP H O   1 
ATOM   8681  C  CB  . TRP D  4  172 ? 133.023 90.199  -16.888 1.00 41.20  ? 172  TRP H CB  1 
ATOM   8682  C  CG  . TRP D  4  172 ? 133.360 91.558  -17.439 1.00 41.36  ? 172  TRP H CG  1 
ATOM   8683  C  CD1 . TRP D  4  172 ? 132.621 92.281  -18.325 1.00 40.84  ? 172  TRP H CD1 1 
ATOM   8684  C  CD2 . TRP D  4  172 ? 134.466 92.405  -17.052 1.00 41.83  ? 172  TRP H CD2 1 
ATOM   8685  N  NE1 . TRP D  4  172 ? 133.179 93.526  -18.499 1.00 41.71  ? 172  TRP H NE1 1 
ATOM   8686  C  CE2 . TRP D  4  172 ? 134.313 93.627  -17.736 1.00 39.88  ? 172  TRP H CE2 1 
ATOM   8687  C  CE3 . TRP D  4  172 ? 135.561 92.247  -16.194 1.00 40.09  ? 172  TRP H CE3 1 
ATOM   8688  C  CZ2 . TRP D  4  172 ? 135.214 94.689  -17.590 1.00 35.83  ? 172  TRP H CZ2 1 
ATOM   8689  C  CZ3 . TRP D  4  172 ? 136.452 93.301  -16.053 1.00 39.69  ? 172  TRP H CZ3 1 
ATOM   8690  C  CH2 . TRP D  4  172 ? 136.270 94.509  -16.748 1.00 34.42  ? 172  TRP H CH2 1 
ATOM   8691  N  N   . VAL D  4  173 ? 133.746 86.947  -17.471 1.00 37.67  ? 173  VAL H N   1 
ATOM   8692  C  CA  . VAL D  4  173 ? 133.780 85.580  -16.966 1.00 35.45  ? 173  VAL H CA  1 
ATOM   8693  C  C   . VAL D  4  173 ? 134.726 85.478  -15.770 1.00 39.67  ? 173  VAL H C   1 
ATOM   8694  O  O   . VAL D  4  173 ? 135.707 86.226  -15.684 1.00 41.11  ? 173  VAL H O   1 
ATOM   8695  C  CB  . VAL D  4  173 ? 134.274 84.591  -18.049 1.00 36.56  ? 173  VAL H CB  1 
ATOM   8696  C  CG1 . VAL D  4  173 ? 135.751 84.805  -18.320 1.00 32.11  ? 173  VAL H CG1 1 
ATOM   8697  C  CG2 . VAL D  4  173 ? 134.028 83.142  -17.611 1.00 34.48  ? 173  VAL H CG2 1 
ATOM   8698  N  N   . ASP D  4  174 ? 134.402 84.566  -14.849 1.00 38.14  ? 174  ASP H N   1 
ATOM   8699  C  CA  . ASP D  4  174 ? 135.292 84.132  -13.773 1.00 35.68  ? 174  ASP H CA  1 
ATOM   8700  C  C   . ASP D  4  174 ? 136.097 82.964  -14.340 1.00 35.19  ? 174  ASP H C   1 
ATOM   8701  O  O   . ASP D  4  174 ? 135.553 81.889  -14.587 1.00 38.42  ? 174  ASP H O   1 
ATOM   8702  C  CB  . ASP D  4  174 ? 134.449 83.669  -12.566 1.00 36.64  ? 174  ASP H CB  1 
ATOM   8703  C  CG  . ASP D  4  174 ? 135.284 83.347  -11.302 1.00 37.10  ? 174  ASP H CG  1 
ATOM   8704  O  OD1 . ASP D  4  174 ? 136.275 82.565  -11.360 1.00 30.12  ? 174  ASP H OD1 1 
ATOM   8705  O  OD2 . ASP D  4  174 ? 134.838 83.759  -10.208 1.00 35.24  ? 174  ASP H OD2 1 
ATOM   8706  N  N   . ARG D  4  175 ? 137.401 83.157  -14.467 1.00 32.32  ? 175  ARG H N   1 
ATOM   8707  C  CA  . ARG D  4  175 ? 138.291 82.158  -15.033 1.00 35.86  ? 175  ARG H CA  1 
ATOM   8708  C  C   . ARG D  4  175 ? 138.833 81.162  -14.026 1.00 37.23  ? 175  ARG H C   1 
ATOM   8709  O  O   . ARG D  4  175 ? 139.608 80.271  -14.394 1.00 37.97  ? 175  ARG H O   1 
ATOM   8710  C  CB  . ARG D  4  175 ? 139.464 82.847  -15.719 1.00 37.70  ? 175  ARG H CB  1 
ATOM   8711  C  CG  . ARG D  4  175 ? 139.021 83.825  -16.777 1.00 43.83  ? 175  ARG H CG  1 
ATOM   8712  C  CD  . ARG D  4  175 ? 140.144 84.094  -17.732 1.00 51.55  ? 175  ARG H CD  1 
ATOM   8713  N  NE  . ARG D  4  175 ? 140.843 85.342  -17.437 1.00 55.26  ? 175  ARG H NE  1 
ATOM   8714  C  CZ  . ARG D  4  175 ? 142.000 85.691  -17.994 1.00 58.59  ? 175  ARG H CZ  1 
ATOM   8715  N  NH1 . ARG D  4  175 ? 142.650 84.824  -18.775 1.00 65.25  ? 175  ARG H NH1 1 
ATOM   8716  N  NH2 . ARG D  4  175 ? 142.524 86.890  -17.751 1.00 55.89  ? 175  ARG H NH2 1 
ATOM   8717  N  N   . SER D  4  176 ? 138.568 81.403  -12.744 1.00 37.65  ? 176  SER H N   1 
ATOM   8718  C  CA  . SER D  4  176 ? 138.915 80.432  -11.714 1.00 36.83  ? 176  SER H CA  1 
ATOM   8719  C  C   . SER D  4  176 ? 137.805 79.381  -11.578 1.00 37.66  ? 176  SER H C   1 
ATOM   8720  O  O   . SER D  4  176 ? 138.089 78.181  -11.422 1.00 36.44  ? 176  SER H O   1 
ATOM   8721  C  CB  . SER D  4  176 ? 139.150 81.144  -10.383 1.00 37.38  ? 176  SER H CB  1 
ATOM   8722  O  OG  . SER D  4  176 ? 140.218 82.076  -10.474 1.00 36.44  ? 176  SER H OG  1 
ATOM   8723  N  N   . GLU D  4  177 ? 136.573 79.811  -11.861 1.00 35.24  ? 177  GLU H N   1 
ATOM   8724  C  CA  . GLU D  4  177 ? 135.379 78.991  -11.661 1.00 38.62  ? 177  GLU H CA  1 
ATOM   8725  C  C   . GLU D  4  177 ? 134.519 78.797  -12.917 1.00 38.86  ? 177  GLU H C   1 
ATOM   8726  O  O   . GLU D  4  177 ? 133.471 78.163  -12.845 1.00 40.11  ? 177  GLU H O   1 
ATOM   8727  C  CB  . GLU D  4  177 ? 134.500 79.596  -10.564 1.00 39.97  ? 177  GLU H CB  1 
ATOM   8728  C  CG  . GLU D  4  177 ? 135.104 79.544  -9.173  1.00 43.04  ? 177  GLU H CG  1 
ATOM   8729  C  CD  . GLU D  4  177 ? 134.112 79.950  -8.100  1.00 43.48  ? 177  GLU H CD  1 
ATOM   8730  O  OE1 . GLU D  4  177 ? 132.995 79.381  -8.060  1.00 40.62  ? 177  GLU H OE1 1 
ATOM   8731  O  OE2 . GLU D  4  177 ? 134.448 80.841  -7.300  1.00 41.47  ? 177  GLU H OE2 1 
ATOM   8732  N  N   . HIS D  4  178 ? 134.888 79.451  -14.016 1.00 36.44  ? 178  HIS H N   1 
ATOM   8733  C  CA  . HIS D  4  178 ? 134.232 79.244  -15.310 1.00 35.10  ? 178  HIS H CA  1 
ATOM   8734  C  C   . HIS D  4  178 ? 132.771 79.658  -15.218 1.00 33.21  ? 178  HIS H C   1 
ATOM   8735  O  O   . HIS D  4  178 ? 131.866 78.844  -15.409 1.00 30.14  ? 178  HIS H O   1 
ATOM   8736  C  CB  . HIS D  4  178 ? 134.306 77.770  -15.737 1.00 41.13  ? 178  HIS H CB  1 
ATOM   8737  C  CG  . HIS D  4  178 ? 135.666 77.316  -16.184 1.00 49.87  ? 178  HIS H CG  1 
ATOM   8738  N  ND1 . HIS D  4  178 ? 136.828 77.995  -15.873 1.00 54.45  ? 178  HIS H ND1 1 
ATOM   8739  C  CD2 . HIS D  4  178 ? 136.056 76.201  -16.851 1.00 54.67  ? 178  HIS H CD2 1 
ATOM   8740  C  CE1 . HIS D  4  178 ? 137.871 77.318  -16.321 1.00 56.52  ? 178  HIS H CE1 1 
ATOM   8741  N  NE2 . HIS D  4  178 ? 137.431 76.222  -16.919 1.00 57.28  ? 178  HIS H NE2 1 
ATOM   8742  N  N   . TYR D  4  179 ? 132.534 80.929  -14.944 1.00 29.41  ? 179  TYR H N   1 
ATOM   8743  C  CA  . TYR D  4  179 ? 131.209 81.343  -14.544 1.00 25.71  ? 179  TYR H CA  1 
ATOM   8744  C  C   . TYR D  4  179 ? 131.078 82.822  -14.846 1.00 24.19  ? 179  TYR H C   1 
ATOM   8745  O  O   . TYR D  4  179 ? 131.886 83.630  -14.403 1.00 23.98  ? 179  TYR H O   1 
ATOM   8746  C  CB  . TYR D  4  179 ? 131.032 81.048  -13.037 1.00 26.51  ? 179  TYR H CB  1 
ATOM   8747  C  CG  . TYR D  4  179 ? 129.670 81.365  -12.445 1.00 25.92  ? 179  TYR H CG  1 
ATOM   8748  C  CD1 . TYR D  4  179 ? 128.615 80.460  -12.548 1.00 29.05  ? 179  TYR H CD1 1 
ATOM   8749  C  CD2 . TYR D  4  179 ? 129.447 82.552  -11.738 1.00 30.81  ? 179  TYR H CD2 1 
ATOM   8750  C  CE1 . TYR D  4  179 ? 127.373 80.723  -11.955 1.00 27.88  ? 179  TYR H CE1 1 
ATOM   8751  C  CE2 . TYR D  4  179 ? 128.197 82.833  -11.155 1.00 30.88  ? 179  TYR H CE2 1 
ATOM   8752  C  CZ  . TYR D  4  179 ? 127.173 81.905  -11.262 1.00 28.32  ? 179  TYR H CZ  1 
ATOM   8753  O  OH  . TYR D  4  179 ? 125.972 82.122  -10.618 1.00 32.91  ? 179  TYR H OH  1 
ATOM   8754  N  N   . PHE D  4  180 ? 130.128 83.166  -15.694 1.00 24.01  ? 180  PHE H N   1 
ATOM   8755  C  CA  . PHE D  4  180 ? 129.866 84.562  -15.975 1.00 25.37  ? 180  PHE H CA  1 
ATOM   8756  C  C   . PHE D  4  180 ? 129.368 85.269  -14.714 1.00 25.07  ? 180  PHE H C   1 
ATOM   8757  O  O   . PHE D  4  180 ? 128.557 84.714  -13.974 1.00 27.65  ? 180  PHE H O   1 
ATOM   8758  C  CB  . PHE D  4  180 ? 128.836 84.674  -17.104 1.00 27.17  ? 180  PHE H CB  1 
ATOM   8759  C  CG  . PHE D  4  180 ? 129.350 84.213  -18.418 1.00 29.23  ? 180  PHE H CG  1 
ATOM   8760  C  CD1 . PHE D  4  180 ? 130.590 84.667  -18.888 1.00 36.37  ? 180  PHE H CD1 1 
ATOM   8761  C  CD2 . PHE D  4  180 ? 128.679 83.231  -19.136 1.00 31.29  ? 180  PHE H CD2 1 
ATOM   8762  C  CE1 . PHE D  4  180 ? 131.158 84.141  -20.050 1.00 31.48  ? 180  PHE H CE1 1 
ATOM   8763  C  CE2 . PHE D  4  180 ? 129.236 82.697  -20.297 1.00 30.81  ? 180  PHE H CE2 1 
ATOM   8764  C  CZ  . PHE D  4  180 ? 130.478 83.153  -20.755 1.00 30.73  ? 180  PHE H CZ  1 
ATOM   8765  N  N   . ARG D  4  181 ? 129.803 86.509  -14.492 1.00 24.15  ? 181  ARG H N   1 
ATOM   8766  C  CA  . ARG D  4  181 ? 129.377 87.248  -13.309 1.00 20.58  ? 181  ARG H CA  1 
ATOM   8767  C  C   . ARG D  4  181 ? 128.795 88.638  -13.605 1.00 23.40  ? 181  ARG H C   1 
ATOM   8768  O  O   . ARG D  4  181 ? 127.977 89.173  -12.828 1.00 22.12  ? 181  ARG H O   1 
ATOM   8769  C  CB  . ARG D  4  181 ? 130.537 87.346  -12.323 1.00 17.08  ? 181  ARG H CB  1 
ATOM   8770  C  CG  . ARG D  4  181 ? 131.055 85.986  -11.829 1.00 22.14  ? 181  ARG H CG  1 
ATOM   8771  C  CD  . ARG D  4  181 ? 131.789 86.138  -10.499 1.00 19.80  ? 181  ARG H CD  1 
ATOM   8772  N  NE  . ARG D  4  181 ? 132.425 84.904  -10.068 1.00 20.82  ? 181  ARG H NE  1 
ATOM   8773  C  CZ  . ARG D  4  181 ? 131.881 84.055  -9.199  1.00 19.43  ? 181  ARG H CZ  1 
ATOM   8774  N  NH1 . ARG D  4  181 ? 130.673 84.293  -8.723  1.00 17.06  ? 181  ARG H NH1 1 
ATOM   8775  N  NH2 . ARG D  4  181 ? 132.504 82.929  -8.874  1.00 15.86  ? 181  ARG H NH2 1 
ATOM   8776  N  N   . TYR D  4  182 ? 129.202 89.225  -14.729 1.00 24.73  ? 182  TYR H N   1 
ATOM   8777  C  CA  . TYR D  4  182 ? 128.613 90.488  -15.171 1.00 26.60  ? 182  TYR H CA  1 
ATOM   8778  C  C   . TYR D  4  182 ? 128.336 90.534  -16.664 1.00 25.97  ? 182  TYR H C   1 
ATOM   8779  O  O   . TYR D  4  182 ? 129.009 89.884  -17.472 1.00 25.71  ? 182  TYR H O   1 
ATOM   8780  C  CB  . TYR D  4  182 ? 129.513 91.677  -14.811 1.00 28.45  ? 182  TYR H CB  1 
ATOM   8781  C  CG  . TYR D  4  182 ? 129.961 91.716  -13.375 1.00 26.57  ? 182  TYR H CG  1 
ATOM   8782  C  CD1 . TYR D  4  182 ? 131.058 90.967  -12.944 1.00 22.07  ? 182  TYR H CD1 1 
ATOM   8783  C  CD2 . TYR D  4  182 ? 129.274 92.487  -12.441 1.00 29.90  ? 182  TYR H CD2 1 
ATOM   8784  C  CE1 . TYR D  4  182 ? 131.466 90.986  -11.615 1.00 22.25  ? 182  TYR H CE1 1 
ATOM   8785  C  CE2 . TYR D  4  182 ? 129.658 92.506  -11.105 1.00 28.60  ? 182  TYR H CE2 1 
ATOM   8786  C  CZ  . TYR D  4  182 ? 130.757 91.758  -10.699 1.00 26.64  ? 182  TYR H CZ  1 
ATOM   8787  O  OH  . TYR D  4  182 ? 131.116 91.781  -9.369  1.00 29.99  ? 182  TYR H OH  1 
ATOM   8788  N  N   . LEU D  4  183 ? 127.374 91.367  -17.024 1.00 30.46  ? 183  LEU H N   1 
ATOM   8789  C  CA  . LEU D  4  183 ? 127.226 91.796  -18.401 1.00 33.27  ? 183  LEU H CA  1 
ATOM   8790  C  C   . LEU D  4  183 ? 127.760 93.213  -18.491 1.00 36.26  ? 183  LEU H C   1 
ATOM   8791  O  O   . LEU D  4  183 ? 127.677 93.980  -17.516 1.00 39.73  ? 183  LEU H O   1 
ATOM   8792  C  CB  . LEU D  4  183 ? 125.756 91.780  -18.813 1.00 30.18  ? 183  LEU H CB  1 
ATOM   8793  C  CG  . LEU D  4  183 ? 125.087 90.413  -18.782 1.00 32.47  ? 183  LEU H CG  1 
ATOM   8794  C  CD1 . LEU D  4  183 ? 123.688 90.525  -19.343 1.00 30.29  ? 183  LEU H CD1 1 
ATOM   8795  C  CD2 . LEU D  4  183 ? 125.932 89.412  -19.562 1.00 29.61  ? 183  LEU H CD2 1 
ATOM   8796  N  N   . GLU D  4  184 ? 128.306 93.563  -19.652 1.00 36.11  ? 184  GLU H N   1 
ATOM   8797  C  CA  . GLU D  4  184 ? 128.659 94.944  -19.931 1.00 35.41  ? 184  GLU H CA  1 
ATOM   8798  C  C   . GLU D  4  184 ? 127.707 95.533  -20.947 1.00 34.82  ? 184  GLU H C   1 
ATOM   8799  O  O   . GLU D  4  184 ? 127.396 94.896  -21.953 1.00 31.73  ? 184  GLU H O   1 
ATOM   8800  C  CB  . GLU D  4  184 ? 130.067 95.024  -20.464 1.00 34.23  ? 184  GLU H CB  1 
ATOM   8801  C  CG  . GLU D  4  184 ? 130.665 96.399  -20.311 1.00 39.61  ? 184  GLU H CG  1 
ATOM   8802  C  CD  . GLU D  4  184 ? 132.169 96.415  -20.565 1.00 43.37  ? 184  GLU H CD  1 
ATOM   8803  O  OE1 . GLU D  4  184 ? 132.792 95.326  -20.619 1.00 42.48  ? 184  GLU H OE1 1 
ATOM   8804  O  OE2 . GLU D  4  184 ? 132.728 97.521  -20.722 1.00 45.29  ? 184  GLU H OE2 1 
ATOM   8805  N  N   . LEU D  4  185 ? 127.288 96.765  -20.713 1.00 36.00  ? 185  LEU H N   1 
ATOM   8806  C  CA  . LEU D  4  185 ? 126.409 97.450  -21.652 1.00 42.00  ? 185  LEU H CA  1 
ATOM   8807  C  C   . LEU D  4  185 ? 126.935 98.842  -22.014 1.00 44.74  ? 185  LEU H C   1 
ATOM   8808  O  O   . LEU D  4  185 ? 127.497 99.541  -21.161 1.00 46.12  ? 185  LEU H O   1 
ATOM   8809  C  CB  . LEU D  4  185 ? 124.990 97.571  -21.071 1.00 39.50  ? 185  LEU H CB  1 
ATOM   8810  C  CG  . LEU D  4  185 ? 124.838 98.322  -19.743 1.00 40.35  ? 185  LEU H CG  1 
ATOM   8811  C  CD1 . LEU D  4  185 ? 123.609 99.215  -19.755 1.00 36.89  ? 185  LEU H CD1 1 
ATOM   8812  C  CD2 . LEU D  4  185 ? 124.765 97.317  -18.616 1.00 42.58  ? 185  LEU H CD2 1 
ATOM   8813  N  N   . SER D  4  186 ? 126.746 99.240  -23.272 1.00 43.38  ? 186  SER H N   1 
ATOM   8814  C  CA  . SER D  4  186 ? 126.857 100.640 -23.641 1.00 43.57  ? 186  SER H CA  1 
ATOM   8815  C  C   . SER D  4  186 ? 125.585 101.338 -23.210 1.00 43.24  ? 186  SER H C   1 
ATOM   8816  O  O   . SER D  4  186 ? 124.478 100.904 -23.543 1.00 43.78  ? 186  SER H O   1 
ATOM   8817  C  CB  . SER D  4  186 ? 127.041 100.808 -25.147 1.00 44.47  ? 186  SER H CB  1 
ATOM   8818  O  OG  . SER D  4  186 ? 127.317 102.171 -25.458 1.00 53.99  ? 186  SER H OG  1 
ATOM   8819  N  N   . VAL D  4  187 ? 125.744 102.325 -22.347 1.00 44.77  ? 187  VAL H N   1 
ATOM   8820  C  CA  . VAL D  4  187 ? 124.610 103.070 -21.846 1.00 48.15  ? 187  VAL H CA  1 
ATOM   8821  C  C   . VAL D  4  187 ? 124.091 103.981 -22.941 1.00 53.50  ? 187  VAL H C   1 
ATOM   8822  O  O   . VAL D  4  187 ? 124.860 104.540 -23.731 1.00 56.34  ? 187  VAL H O   1 
ATOM   8823  C  CB  . VAL D  4  187 ? 124.998 103.903 -20.618 1.00 46.59  ? 187  VAL H CB  1 
ATOM   8824  C  CG1 . VAL D  4  187 ? 123.778 104.647 -20.070 1.00 46.46  ? 187  VAL H CG1 1 
ATOM   8825  C  CG2 . VAL D  4  187 ? 125.602 102.995 -19.560 1.00 42.25  ? 187  VAL H CG2 1 
ATOM   8826  N  N   . ALA D  4  188 ? 122.773 104.016 -23.061 1.00 60.17  ? 188  ALA H N   1 
ATOM   8827  C  CA  . ALA D  4  188 ? 122.113 104.828 -24.067 1.00 66.16  ? 188  ALA H CA  1 
ATOM   8828  C  C   . ALA D  4  188 ? 122.205 106.275 -23.640 1.00 70.62  ? 188  ALA H C   1 
ATOM   8829  O  O   . ALA D  4  188 ? 121.976 106.607 -22.474 1.00 70.83  ? 188  ALA H O   1 
ATOM   8830  C  CB  . ALA D  4  188 ? 120.642 104.412 -24.215 1.00 65.32  ? 188  ALA H CB  1 
ATOM   8831  N  N   . GLY D  4  189 ? 122.634 107.117 -24.573 1.00 77.77  ? 189  GLY H N   1 
ATOM   8832  C  CA  . GLY D  4  189 ? 122.713 108.542 -24.308 1.00 84.43  ? 189  GLY H CA  1 
ATOM   8833  C  C   . GLY D  4  189 ? 123.929 108.904 -23.477 1.00 87.80  ? 189  GLY H C   1 
ATOM   8834  O  O   . GLY D  4  189 ? 123.980 109.980 -22.864 1.00 89.86  ? 189  GLY H O   1 
ATOM   8835  N  N   . SER D  4  190 ? 124.864 107.962 -23.382 1.00 88.81  ? 190  SER H N   1 
ATOM   8836  C  CA  . SER D  4  190 ? 126.136 108.185 -22.711 1.00 87.24  ? 190  SER H CA  1 
ATOM   8837  C  C   . SER D  4  190 ? 127.224 107.487 -23.512 1.00 86.99  ? 190  SER H C   1 
ATOM   8838  O  O   . SER D  4  190 ? 126.944 106.671 -24.405 1.00 88.01  ? 190  SER H O   1 
ATOM   8839  C  CB  . SER D  4  190 ? 126.100 107.626 -21.282 1.00 85.34  ? 190  SER H CB  1 
ATOM   8840  O  OG  . SER D  4  190 ? 125.072 108.224 -20.511 1.00 83.31  ? 190  SER H OG  1 
ATOM   8841  N  N   . ALA D  4  191 ? 128.456 107.909 -23.287 1.00 84.88  ? 191  ALA H N   1 
ATOM   8842  C  CA  . ALA D  4  191 ? 129.581 107.150 -23.780 1.00 84.63  ? 191  ALA H CA  1 
ATOM   8843  C  C   . ALA D  4  191 ? 130.298 106.613 -22.561 1.00 83.39  ? 191  ALA H C   1 
ATOM   8844  O  O   . ALA D  4  191 ? 131.390 107.069 -22.215 1.00 84.98  ? 191  ALA H O   1 
ATOM   8845  C  CB  . ALA D  4  191 ? 130.496 108.030 -24.608 1.00 88.87  ? 191  ALA H CB  1 
ATOM   8846  N  N   . ARG D  4  192 ? 129.563 105.819 -21.791 1.00 79.61  ? 192  ARG H N   1 
ATOM   8847  C  CA  . ARG D  4  192 ? 130.140 105.043 -20.700 1.00 75.99  ? 192  ARG H CA  1 
ATOM   8848  C  C   . ARG D  4  192 ? 129.630 103.621 -20.862 1.00 73.21  ? 192  ARG H C   1 
ATOM   8849  O  O   . ARG D  4  192 ? 128.685 103.394 -21.627 1.00 74.20  ? 192  ARG H O   1 
ATOM   8850  C  CB  . ARG D  4  192 ? 129.703 105.602 -19.342 1.00 74.31  ? 192  ARG H CB  1 
ATOM   8851  C  CG  . ARG D  4  192 ? 128.198 105.626 -19.125 1.00 73.27  ? 192  ARG H CG  1 
ATOM   8852  C  CD  . ARG D  4  192 ? 127.836 105.540 -17.652 1.00 69.79  ? 192  ARG H CD  1 
ATOM   8853  N  NE  . ARG D  4  192 ? 128.464 104.390 -17.015 1.00 66.90  ? 192  ARG H NE  1 
ATOM   8854  C  CZ  . ARG D  4  192 ? 128.895 104.381 -15.761 1.00 64.72  ? 192  ARG H CZ  1 
ATOM   8855  N  NH1 . ARG D  4  192 ? 128.663 105.424 -14.971 1.00 61.74  ? 192  ARG H NH1 1 
ATOM   8856  N  NH2 . ARG D  4  192 ? 129.540 103.322 -15.295 1.00 61.59  ? 192  ARG H NH2 1 
ATOM   8857  N  N   . THR D  4  193 ? 130.327 102.659 -20.259 1.00 69.44  ? 193  THR H N   1 
ATOM   8858  C  CA  . THR D  4  193 ? 129.756 101.330 -20.054 1.00 63.05  ? 193  THR H CA  1 
ATOM   8859  C  C   . THR D  4  193 ? 129.338 101.152 -18.610 1.00 58.57  ? 193  THR H C   1 
ATOM   8860  O  O   . THR D  4  193 ? 129.821 101.851 -17.710 1.00 61.26  ? 193  THR H O   1 
ATOM   8861  C  CB  . THR D  4  193 ? 130.737 100.191 -20.384 1.00 61.33  ? 193  THR H CB  1 
ATOM   8862  O  OG1 . THR D  4  193 ? 132.017 100.481 -19.815 1.00 66.22  ? 193  THR H OG1 1 
ATOM   8863  C  CG2 . THR D  4  193 ? 130.850 99.993  -21.880 1.00 60.06  ? 193  THR H CG2 1 
ATOM   8864  N  N   . ALA D  4  194 ? 128.459 100.184 -18.402 1.00 50.59  ? 194  ALA H N   1 
ATOM   8865  C  CA  . ALA D  4  194 ? 128.108 99.753  -17.076 1.00 43.29  ? 194  ALA H CA  1 
ATOM   8866  C  C   . ALA D  4  194 ? 128.280 98.249  -17.069 1.00 39.48  ? 194  ALA H C   1 
ATOM   8867  O  O   . ALA D  4  194 ? 128.265 97.623  -18.129 1.00 38.47  ? 194  ALA H O   1 
ATOM   8868  C  CB  . ALA D  4  194 ? 126.681 100.132 -16.777 1.00 42.20  ? 194  ALA H CB  1 
ATOM   8869  N  N   . LEU D  4  195 ? 128.728 97.724  -15.936 1.00 37.85  ? 195  LEU H N   1 
ATOM   8870  C  CA  . LEU D  4  195 ? 128.620 96.298  -15.677 1.00 35.75  ? 195  LEU H CA  1 
ATOM   8871  C  C   . LEU D  4  195 ? 127.383 96.129  -14.831 1.00 33.71  ? 195  LEU H C   1 
ATOM   8872  O  O   . LEU D  4  195 ? 126.995 97.021  -14.091 1.00 30.67  ? 195  LEU H O   1 
ATOM   8873  C  CB  . LEU D  4  195 ? 129.827 95.759  -14.907 1.00 36.03  ? 195  LEU H CB  1 
ATOM   8874  C  CG  . LEU D  4  195 ? 131.236 95.851  -15.505 1.00 35.72  ? 195  LEU H CG  1 
ATOM   8875  C  CD1 . LEU D  4  195 ? 132.067 94.635  -15.133 1.00 33.08  ? 195  LEU H CD1 1 
ATOM   8876  C  CD2 . LEU D  4  195 ? 131.139 95.949  -16.993 1.00 37.99  ? 195  LEU H CD2 1 
ATOM   8877  N  N   . ILE D  4  196 ? 126.708 95.018  -15.022 1.00 33.50  ? 196  ILE H N   1 
ATOM   8878  C  CA  . ILE D  4  196 ? 125.593 94.679  -14.176 1.00 31.87  ? 196  ILE H CA  1 
ATOM   8879  C  C   . ILE D  4  196 ? 125.796 93.228  -13.829 1.00 32.59  ? 196  ILE H C   1 
ATOM   8880  O  O   . ILE D  4  196 ? 126.263 92.451  -14.670 1.00 32.35  ? 196  ILE H O   1 
ATOM   8881  C  CB  . ILE D  4  196 ? 124.273 94.879  -14.912 1.00 33.03  ? 196  ILE H CB  1 
ATOM   8882  C  CG1 . ILE D  4  196 ? 123.133 94.446  -14.025 1.00 35.82  ? 196  ILE H CG1 1 
ATOM   8883  C  CG2 . ILE D  4  196 ? 124.254 94.102  -16.211 1.00 35.07  ? 196  ILE H CG2 1 
ATOM   8884  C  CD1 . ILE D  4  196 ? 121.897 95.235  -14.243 1.00 38.99  ? 196  ILE H CD1 1 
ATOM   8885  N  N   . PRO D  4  197 ? 125.795 92.935  -12.528 1.00 33.47  ? 197  PRO H N   1 
ATOM   8886  C  CA  . PRO D  4  197 ? 126.055 91.566  -12.063 1.00 33.62  ? 197  PRO H CA  1 
ATOM   8887  C  C   . PRO D  4  197 ? 124.938 90.673  -12.578 1.00 33.04  ? 197  PRO H C   1 
ATOM   8888  O  O   . PRO D  4  197 ? 123.767 91.096  -12.620 1.00 32.02  ? 197  PRO H O   1 
ATOM   8889  C  CB  . PRO D  4  197 ? 126.023 91.687  -10.534 1.00 32.27  ? 197  PRO H CB  1 
ATOM   8890  C  CG  . PRO D  4  197 ? 126.130 93.160  -10.255 1.00 33.39  ? 197  PRO H CG  1 
ATOM   8891  C  CD  . PRO D  4  197 ? 125.491 93.848  -11.416 1.00 31.97  ? 197  PRO H CD  1 
ATOM   8892  N  N   . LEU D  4  198 ? 125.274 89.438  -12.937 1.00 31.57  ? 198  LEU H N   1 
ATOM   8893  C  CA  . LEU D  4  198 ? 124.315 88.610  -13.649 1.00 33.03  ? 198  LEU H CA  1 
ATOM   8894  C  C   . LEU D  4  198 ? 123.042 88.317  -12.846 1.00 36.05  ? 198  LEU H C   1 
ATOM   8895  O  O   . LEU D  4  198 ? 121.941 88.316  -13.406 1.00 34.88  ? 198  LEU H O   1 
ATOM   8896  C  CB  . LEU D  4  198 ? 124.981 87.331  -14.146 1.00 32.85  ? 198  LEU H CB  1 
ATOM   8897  C  CG  . LEU D  4  198 ? 125.389 87.509  -15.618 1.00 35.34  ? 198  LEU H CG  1 
ATOM   8898  C  CD1 . LEU D  4  198 ? 126.338 86.443  -16.033 1.00 36.56  ? 198  LEU H CD1 1 
ATOM   8899  C  CD2 . LEU D  4  198 ? 124.162 87.481  -16.522 1.00 35.03  ? 198  LEU H CD2 1 
ATOM   8900  N  N   . GLY D  4  199 ? 123.163 88.382  -11.523 1.00 34.76  ? 199  GLY H N   1 
ATOM   8901  C  CA  . GLY D  4  199 ? 122.020 88.169  -10.666 1.00 31.28  ? 199  GLY H CA  1 
ATOM   8902  C  C   . GLY D  4  199 ? 120.956 89.249  -10.742 1.00 35.14  ? 199  GLY H C   1 
ATOM   8903  O  O   . GLY D  4  199 ? 119.862 89.061  -10.207 1.00 34.33  ? 199  GLY H O   1 
ATOM   8904  N  N   . PHE D  4  200 ? 121.256 90.389  -11.358 1.00 33.44  ? 200  PHE H N   1 
ATOM   8905  C  CA  . PHE D  4  200 ? 120.244 91.438  -11.454 1.00 34.25  ? 200  PHE H CA  1 
ATOM   8906  C  C   . PHE D  4  200 ? 119.573 91.450  -12.828 1.00 35.19  ? 200  PHE H C   1 
ATOM   8907  O  O   . PHE D  4  200 ? 118.679 92.251  -13.116 1.00 30.96  ? 200  PHE H O   1 
ATOM   8908  C  CB  . PHE D  4  200 ? 120.874 92.778  -11.143 1.00 33.19  ? 200  PHE H CB  1 
ATOM   8909  C  CG  . PHE D  4  200 ? 121.220 92.957  -9.687  1.00 39.47  ? 200  PHE H CG  1 
ATOM   8910  C  CD1 . PHE D  4  200 ? 120.248 93.368  -8.769  1.00 38.86  ? 200  PHE H CD1 1 
ATOM   8911  C  CD2 . PHE D  4  200 ? 122.539 92.839  -9.248  1.00 36.82  ? 200  PHE H CD2 1 
ATOM   8912  C  CE1 . PHE D  4  200 ? 120.589 93.678  -7.448  1.00 36.57  ? 200  PHE H CE1 1 
ATOM   8913  C  CE2 . PHE D  4  200 ? 122.881 93.153  -7.932  1.00 36.80  ? 200  PHE H CE2 1 
ATOM   8914  C  CZ  . PHE D  4  200 ? 121.910 93.576  -7.037  1.00 36.86  ? 200  PHE H CZ  1 
ATOM   8915  N  N   . CYS D  4  201 ? 119.886 90.417  -13.588 1.00 35.92  ? 201  CYS H N   1 
ATOM   8916  C  CA  . CYS D  4  201 ? 119.504 90.331  -14.971 1.00 36.79  ? 201  CYS H CA  1 
ATOM   8917  C  C   . CYS D  4  201 ? 118.581 89.159  -15.124 1.00 38.90  ? 201  CYS H C   1 
ATOM   8918  O  O   . CYS D  4  201 ? 118.939 88.018  -14.792 1.00 39.23  ? 201  CYS H O   1 
ATOM   8919  C  CB  . CYS D  4  201 ? 120.734 90.087  -15.840 1.00 37.35  ? 201  CYS H CB  1 
ATOM   8920  S  SG  . CYS D  4  201 ? 121.837 91.501  -16.010 1.00 39.93  ? 201  CYS H SG  1 
ATOM   8921  N  N   . ASP D  4  202 ? 117.434 89.422  -15.729 1.00 39.65  ? 202  ASP H N   1 
ATOM   8922  C  CA  . ASP D  4  202 ? 116.632 88.356  -16.304 1.00 40.50  ? 202  ASP H CA  1 
ATOM   8923  C  C   . ASP D  4  202 ? 116.956 88.202  -17.797 1.00 38.70  ? 202  ASP H C   1 
ATOM   8924  O  O   . ASP D  4  202 ? 116.651 89.087  -18.619 1.00 36.08  ? 202  ASP H O   1 
ATOM   8925  C  CB  . ASP D  4  202 ? 115.153 88.658  -16.101 1.00 39.87  ? 202  ASP H CB  1 
ATOM   8926  C  CG  . ASP D  4  202 ? 114.265 87.489  -16.466 1.00 43.64  ? 202  ASP H CG  1 
ATOM   8927  O  OD1 . ASP D  4  202 ? 114.792 86.405  -16.855 1.00 43.34  ? 202  ASP H OD1 1 
ATOM   8928  O  OD2 . ASP D  4  202 ? 113.025 87.668  -16.358 1.00 46.65  ? 202  ASP H OD2 1 
ATOM   8929  N  N   . VAL D  4  203 ? 117.577 87.076  -18.131 1.00 37.71  ? 203  VAL H N   1 
ATOM   8930  C  CA  . VAL D  4  203 ? 118.081 86.842  -19.475 1.00 40.53  ? 203  VAL H CA  1 
ATOM   8931  C  C   . VAL D  4  203 ? 117.028 86.201  -20.381 1.00 46.32  ? 203  VAL H C   1 
ATOM   8932  O  O   . VAL D  4  203 ? 116.794 84.991  -20.322 1.00 49.27  ? 203  VAL H O   1 
ATOM   8933  C  CB  . VAL D  4  203 ? 119.331 85.953  -19.433 1.00 35.04  ? 203  VAL H CB  1 
ATOM   8934  C  CG1 . VAL D  4  203 ? 119.735 85.519  -20.827 1.00 36.66  ? 203  VAL H CG1 1 
ATOM   8935  C  CG2 . VAL D  4  203 ? 120.444 86.704  -18.793 1.00 33.67  ? 203  VAL H CG2 1 
ATOM   8936  N  N   . LYS D  4  204 ? 116.407 87.028  -21.221 1.00 50.77  ? 204  LYS H N   1 
ATOM   8937  C  CA  . LYS D  4  204 ? 115.493 86.566  -22.263 1.00 52.74  ? 204  LYS H CA  1 
ATOM   8938  C  C   . LYS D  4  204 ? 116.238 86.353  -23.572 1.00 55.70  ? 204  LYS H C   1 
ATOM   8939  O  O   . LYS D  4  204 ? 117.360 86.845  -23.752 1.00 55.88  ? 204  LYS H O   1 
ATOM   8940  C  CB  . LYS D  4  204 ? 114.394 87.594  -22.491 1.00 53.16  ? 204  LYS H CB  1 
ATOM   8941  C  CG  . LYS D  4  204 ? 113.681 87.984  -21.241 1.00 53.88  ? 204  LYS H CG  1 
ATOM   8942  C  CD  . LYS D  4  204 ? 113.039 86.771  -20.623 1.00 61.01  ? 204  LYS H CD  1 
ATOM   8943  C  CE  . LYS D  4  204 ? 112.019 87.171  -19.574 1.00 66.44  ? 204  LYS H CE  1 
ATOM   8944  N  NZ  . LYS D  4  204 ? 111.185 88.341  -19.987 1.00 72.16  ? 204  LYS H NZ  1 
ATOM   8945  N  N   . LYS D  4  205 ? 115.524 85.790  -24.544 1.00 58.00  ? 205  LYS H N   1 
ATOM   8946  C  CA  . LYS D  4  205 ? 116.085 85.530  -25.871 1.00 58.31  ? 205  LYS H CA  1 
ATOM   8947  C  C   . LYS D  4  205 ? 116.294 86.829  -26.651 1.00 57.08  ? 205  LYS H C   1 
ATOM   8948  O  O   . LYS D  4  205 ? 117.238 86.960  -27.425 1.00 56.02  ? 205  LYS H O   1 
ATOM   8949  C  CB  . LYS D  4  205 ? 115.150 84.610  -26.659 1.00 57.17  ? 205  LYS H CB  1 
ATOM   8950  C  CG  . LYS D  4  205 ? 115.867 83.719  -27.669 1.00 60.13  ? 205  LYS H CG  1 
ATOM   8951  C  CD  . LYS D  4  205 ? 116.524 82.524  -26.998 0.00 57.88  ? 205  LYS H CD  1 
ATOM   8952  C  CE  . LYS D  4  205 ? 117.499 81.822  -27.933 0.00 57.62  ? 205  LYS H CE  1 
ATOM   8953  N  NZ  . LYS D  4  205 ? 116.828 81.223  -29.121 0.00 56.95  ? 205  LYS H NZ  1 
ATOM   8954  N  N   . ASP D  4  206 ? 115.496 87.829  -26.303 1.00 57.49  ? 206  ASP H N   1 
ATOM   8955  C  CA  . ASP D  4  206 ? 115.282 88.999  -27.136 1.00 57.19  ? 206  ASP H CA  1 
ATOM   8956  C  C   . ASP D  4  206 ? 115.672 90.291  -26.409 1.00 56.58  ? 206  ASP H C   1 
ATOM   8957  O  O   . ASP D  4  206 ? 115.752 91.353  -27.032 1.00 57.86  ? 206  ASP H O   1 
ATOM   8958  C  CB  . ASP D  4  206 ? 113.804 89.056  -27.551 1.00 60.33  ? 206  ASP H CB  1 
ATOM   8959  C  CG  . ASP D  4  206 ? 112.847 89.145  -26.349 1.00 63.87  ? 206  ASP H CG  1 
ATOM   8960  O  OD1 . ASP D  4  206 ? 112.926 88.300  -25.421 1.00 65.28  ? 206  ASP H OD1 1 
ATOM   8961  O  OD2 . ASP D  4  206 ? 111.986 90.053  -26.354 1.00 68.26  ? 206  ASP H OD2 1 
ATOM   8962  N  N   . LYS D  4  207 ? 115.814 90.208  -25.083 1.00 52.42  ? 207  LYS H N   1 
ATOM   8963  C  CA  . LYS D  4  207 ? 116.214 91.341  -24.259 1.00 45.79  ? 207  LYS H CA  1 
ATOM   8964  C  C   . LYS D  4  207 ? 116.793 90.818  -22.974 1.00 45.04  ? 207  LYS H C   1 
ATOM   8965  O  O   . LYS D  4  207 ? 116.651 89.642  -22.658 1.00 44.73  ? 207  LYS H O   1 
ATOM   8966  C  CB  . LYS D  4  207 ? 115.022 92.228  -23.926 1.00 44.78  ? 207  LYS H CB  1 
ATOM   8967  C  CG  . LYS D  4  207 ? 113.761 91.470  -23.528 1.00 46.24  ? 207  LYS H CG  1 
ATOM   8968  C  CD  . LYS D  4  207 ? 112.576 92.433  -23.380 1.00 47.53  ? 207  LYS H CD  1 
ATOM   8969  C  CE  . LYS D  4  207 ? 111.225 91.741  -23.541 1.00 50.41  ? 207  LYS H CE  1 
ATOM   8970  N  NZ  . LYS D  4  207 ? 110.104 92.719  -23.466 0.00 48.72  ? 207  LYS H NZ  1 
ATOM   8971  N  N   . ILE D  4  208 ? 117.526 91.682  -22.289 1.00 42.43  ? 208  ILE H N   1 
ATOM   8972  C  CA  . ILE D  4  208 ? 117.980 91.438  -20.929 1.00 38.12  ? 208  ILE H CA  1 
ATOM   8973  C  C   . ILE D  4  208 ? 117.188 92.422  -20.049 1.00 40.55  ? 208  ILE H C   1 
ATOM   8974  O  O   . ILE D  4  208 ? 117.196 93.644  -20.293 1.00 37.33  ? 208  ILE H O   1 
ATOM   8975  C  CB  . ILE D  4  208 ? 119.492 91.758  -20.771 1.00 34.69  ? 208  ILE H CB  1 
ATOM   8976  C  CG1 . ILE D  4  208 ? 120.383 90.832  -21.636 1.00 28.50  ? 208  ILE H CG1 1 
ATOM   8977  C  CG2 . ILE D  4  208 ? 119.849 91.741  -19.318 1.00 32.96  ? 208  ILE H CG2 1 
ATOM   8978  C  CD1 . ILE D  4  208 ? 120.007 89.379  -21.662 1.00 26.76  ? 208  ILE H CD1 1 
ATOM   8979  N  N   . VAL D  4  209 ? 116.469 91.894  -19.062 1.00 38.05  ? 209  VAL H N   1 
ATOM   8980  C  CA  . VAL D  4  209 ? 115.629 92.738  -18.217 1.00 37.99  ? 209  VAL H CA  1 
ATOM   8981  C  C   . VAL D  4  209 ? 116.265 93.006  -16.852 1.00 39.74  ? 209  VAL H C   1 
ATOM   8982  O  O   . VAL D  4  209 ? 116.707 92.078  -16.159 1.00 44.94  ? 209  VAL H O   1 
ATOM   8983  C  CB  . VAL D  4  209 ? 114.254 92.101  -17.983 1.00 38.13  ? 209  VAL H CB  1 
ATOM   8984  C  CG1 . VAL D  4  209 ? 113.202 93.183  -17.767 1.00 39.80  ? 209  VAL H CG1 1 
ATOM   8985  C  CG2 . VAL D  4  209 ? 113.887 91.198  -19.144 1.00 37.21  ? 209  VAL H CG2 1 
ATOM   8986  N  N   . VAL D  4  210 ? 116.244 94.263  -16.430 1.00 36.15  ? 210  VAL H N   1 
ATOM   8987  C  CA  . VAL D  4  210 ? 116.855 94.650  -15.175 1.00 31.52  ? 210  VAL H CA  1 
ATOM   8988  C  C   . VAL D  4  210 ? 115.881 95.503  -14.386 1.00 34.99  ? 210  VAL H C   1 
ATOM   8989  O  O   . VAL D  4  210 ? 115.659 96.682  -14.706 1.00 35.06  ? 210  VAL H O   1 
ATOM   8990  C  CB  . VAL D  4  210 ? 118.136 95.424  -15.431 1.00 31.23  ? 210  VAL H CB  1 
ATOM   8991  C  CG1 . VAL D  4  210 ? 118.606 96.142  -14.155 1.00 32.36  ? 210  VAL H CG1 1 
ATOM   8992  C  CG2 . VAL D  4  210 ? 119.190 94.475  -15.964 1.00 33.25  ? 210  VAL H CG2 1 
ATOM   8993  N  N   . THR D  4  211 ? 115.336 94.913  -13.324 1.00 36.77  ? 211  THR H N   1 
ATOM   8994  C  CA  . THR D  4  211 ? 114.297 95.552  -12.505 1.00 35.73  ? 211  THR H CA  1 
ATOM   8995  C  C   . THR D  4  211 ? 114.810 96.437  -11.376 1.00 31.10  ? 211  THR H C   1 
ATOM   8996  O  O   . THR D  4  211 ? 114.034 97.165  -10.776 1.00 30.18  ? 211  THR H O   1 
ATOM   8997  C  CB  . THR D  4  211 ? 113.387 94.507  -11.866 1.00 37.39  ? 211  THR H CB  1 
ATOM   8998  O  OG1 . THR D  4  211 ? 113.810 93.193  -12.260 1.00 50.51  ? 211  THR H OG1 1 
ATOM   8999  C  CG2 . THR D  4  211 ? 111.972 94.728  -12.291 1.00 43.00  ? 211  THR H CG2 1 
ATOM   9000  N  N   . SER D  4  212 ? 116.061 96.245  -10.973 1.00 31.40  ? 212  SER H N   1 
ATOM   9001  C  CA  . SER D  4  212 ? 116.608 96.969  -9.831  1.00 31.57  ? 212  SER H CA  1 
ATOM   9002  C  C   . SER D  4  212 ? 116.526 98.475  -10.029 1.00 32.63  ? 212  SER H C   1 
ATOM   9003  O  O   . SER D  4  212 ? 116.105 99.194  -9.120  1.00 34.49  ? 212  SER H O   1 
ATOM   9004  C  CB  . SER D  4  212 ? 118.055 96.562  -9.593  1.00 29.51  ? 212  SER H CB  1 
ATOM   9005  O  OG  . SER D  4  212 ? 118.479 95.669  -10.613 1.00 33.84  ? 212  SER H OG  1 
ATOM   9006  N  N   . ILE D  4  213 ? 116.889 98.955  -11.221 1.00 34.48  ? 213  ILE H N   1 
ATOM   9007  C  CA  . ILE D  4  213 ? 116.921 100.400 -11.458 1.00 35.19  ? 213  ILE H CA  1 
ATOM   9008  C  C   . ILE D  4  213 ? 116.204 100.855 -12.715 1.00 37.72  ? 213  ILE H C   1 
ATOM   9009  O  O   . ILE D  4  213 ? 116.021 100.087 -13.657 1.00 37.89  ? 213  ILE H O   1 
ATOM   9010  C  CB  . ILE D  4  213 ? 118.350 100.937 -11.500 1.00 30.71  ? 213  ILE H CB  1 
ATOM   9011  C  CG1 . ILE D  4  213 ? 119.137 100.206 -12.578 1.00 25.44  ? 213  ILE H CG1 1 
ATOM   9012  C  CG2 . ILE D  4  213 ? 119.003 100.778 -10.116 1.00 29.65  ? 213  ILE H CG2 1 
ATOM   9013  C  CD1 . ILE D  4  213 ? 120.553 100.663 -12.660 1.00 31.89  ? 213  ILE H CD1 1 
ATOM   9014  N  N   . LEU D  4  214 ? 115.735 102.096 -12.680 1.00 38.49  ? 214  LEU H N   1 
ATOM   9015  C  CA  . LEU D  4  214 ? 115.111 102.722 -13.825 1.00 41.04  ? 214  LEU H CA  1 
ATOM   9016  C  C   . LEU D  4  214 ? 116.208 103.026 -14.821 1.00 43.92  ? 214  LEU H C   1 
ATOM   9017  O  O   . LEU D  4  214 ? 117.382 103.048 -14.455 1.00 47.13  ? 214  LEU H O   1 
ATOM   9018  C  CB  . LEU D  4  214 ? 114.417 104.009 -13.393 1.00 40.25  ? 214  LEU H CB  1 
ATOM   9019  C  CG  . LEU D  4  214 ? 113.321 103.826 -12.332 1.00 41.41  ? 214  LEU H CG  1 
ATOM   9020  C  CD1 . LEU D  4  214 ? 112.647 105.149 -12.010 1.00 40.77  ? 214  LEU H CD1 1 
ATOM   9021  C  CD2 . LEU D  4  214 ? 112.299 102.839 -12.825 1.00 39.62  ? 214  LEU H CD2 1 
ATOM   9022  N  N   . SER D  4  215 ? 115.831 103.238 -16.078 1.00 46.92  ? 215  SER H N   1 
ATOM   9023  C  CA  . SER D  4  215 ? 116.793 103.500 -17.151 1.00 48.62  ? 215  SER H CA  1 
ATOM   9024  C  C   . SER D  4  215 ? 117.684 104.704 -16.826 1.00 49.12  ? 215  SER H C   1 
ATOM   9025  O  O   . SER D  4  215 ? 118.897 104.675 -17.055 1.00 50.38  ? 215  SER H O   1 
ATOM   9026  C  CB  . SER D  4  215 ? 116.042 103.770 -18.441 1.00 48.32  ? 215  SER H CB  1 
ATOM   9027  O  OG  . SER D  4  215 ? 115.200 104.894 -18.256 1.00 50.11  ? 215  SER H OG  1 
ATOM   9028  N  N   . GLU D  4  216 ? 117.072 105.749 -16.273 1.00 49.87  ? 216  GLU H N   1 
ATOM   9029  C  CA  . GLU D  4  216 ? 117.781 106.962 -15.850 1.00 49.66  ? 216  GLU H CA  1 
ATOM   9030  C  C   . GLU D  4  216 ? 119.016 106.646 -15.008 1.00 48.55  ? 216  GLU H C   1 
ATOM   9031  O  O   . GLU D  4  216 ? 120.066 107.272 -15.165 1.00 46.93  ? 216  GLU H O   1 
ATOM   9032  C  CB  . GLU D  4  216 ? 116.850 107.870 -15.028 1.00 54.25  ? 216  GLU H CB  1 
ATOM   9033  C  CG  . GLU D  4  216 ? 115.685 108.504 -15.800 1.00 59.35  ? 216  GLU H CG  1 
ATOM   9034  C  CD  . GLU D  4  216 ? 114.547 107.537 -16.069 0.00 57.90  ? 216  GLU H CD  1 
ATOM   9035  O  OE1 . GLU D  4  216 ? 114.042 106.920 -15.107 0.00 58.43  ? 216  GLU H OE1 1 
ATOM   9036  O  OE2 . GLU D  4  216 ? 114.148 107.404 -17.244 0.00 58.43  ? 216  GLU H OE2 1 
ATOM   9037  N  N   . GLN D  4  217 ? 118.897 105.622 -14.165 1.00 45.66  ? 217  GLN H N   1 
ATOM   9038  C  CA  . GLN D  4  217 ? 119.844 105.400 -13.090 1.00 41.55  ? 217  GLN H CA  1 
ATOM   9039  C  C   . GLN D  4  217 ? 121.093 104.630 -13.508 1.00 39.86  ? 217  GLN H C   1 
ATOM   9040  O  O   . GLN D  4  217 ? 122.094 104.654 -12.801 1.00 41.01  ? 217  GLN H O   1 
ATOM   9041  C  CB  . GLN D  4  217 ? 119.135 104.717 -11.919 1.00 37.87  ? 217  GLN H CB  1 
ATOM   9042  C  CG  . GLN D  4  217 ? 118.106 105.624 -11.248 1.00 37.61  ? 217  GLN H CG  1 
ATOM   9043  C  CD  . GLN D  4  217 ? 117.067 104.877 -10.419 1.00 38.35  ? 217  GLN H CD  1 
ATOM   9044  O  OE1 . GLN D  4  217 ? 116.894 103.665 -10.551 1.00 45.98  ? 217  GLN H OE1 1 
ATOM   9045  N  NE2 . GLN D  4  217 ? 116.354 105.606 -9.578  1.00 35.93  ? 217  GLN H NE2 1 
ATOM   9046  N  N   . PHE D  4  218 ? 121.109 104.111 -14.731 1.00 39.73  ? 218  PHE H N   1 
ATOM   9047  C  CA  . PHE D  4  218 ? 122.308 103.436 -15.252 1.00 41.72  ? 218  PHE H CA  1 
ATOM   9048  C  C   . PHE D  4  218 ? 123.494 104.370 -15.460 1.00 41.66  ? 218  PHE H C   1 
ATOM   9049  O  O   . PHE D  4  218 ? 124.623 103.923 -15.662 1.00 44.23  ? 218  PHE H O   1 
ATOM   9050  C  CB  . PHE D  4  218 ? 122.011 102.779 -16.587 1.00 39.50  ? 218  PHE H CB  1 
ATOM   9051  C  CG  . PHE D  4  218 ? 121.542 101.379 -16.474 1.00 38.20  ? 218  PHE H CG  1 
ATOM   9052  C  CD1 . PHE D  4  218 ? 120.202 101.105 -16.204 1.00 35.84  ? 218  PHE H CD1 1 
ATOM   9053  C  CD2 . PHE D  4  218 ? 122.413 100.326 -16.745 1.00 38.08  ? 218  PHE H CD2 1 
ATOM   9054  C  CE1 . PHE D  4  218 ? 119.737 99.806  -16.217 1.00 31.83  ? 218  PHE H CE1 1 
ATOM   9055  C  CE2 . PHE D  4  218 ? 121.955 99.026  -16.760 1.00 35.89  ? 218  PHE H CE2 1 
ATOM   9056  C  CZ  . PHE D  4  218 ? 120.615 98.766  -16.499 1.00 34.01  ? 218  PHE H CZ  1 
ATOM   9057  N  N   . ALA D  4  219 ? 123.195 105.649 -15.615 1.00 41.41  ? 219  ALA H N   1 
ATOM   9058  C  CA  . ALA D  4  219 ? 124.214 106.644 -15.887 1.00 45.54  ? 219  ALA H CA  1 
ATOM   9059  C  C   . ALA D  4  219 ? 125.243 106.687 -14.758 1.00 48.17  ? 219  ALA H C   1 
ATOM   9060  O  O   . ALA D  4  219 ? 126.449 106.812 -14.994 1.00 48.58  ? 219  ALA H O   1 
ATOM   9061  C  CB  . ALA D  4  219 ? 123.560 108.005 -16.040 1.00 50.16  ? 219  ALA H CB  1 
ATOM   9062  N  N   . ASN D  4  220 ? 124.745 106.577 -13.529 1.00 48.05  ? 220  ASN H N   1 
ATOM   9063  C  CA  . ASN D  4  220 ? 125.566 106.753 -12.343 1.00 46.23  ? 220  ASN H CA  1 
ATOM   9064  C  C   . ASN D  4  220 ? 125.993 105.422 -11.747 1.00 41.87  ? 220  ASN H C   1 
ATOM   9065  O  O   . ASN D  4  220 ? 126.474 105.376 -10.623 1.00 43.15  ? 220  ASN H O   1 
ATOM   9066  C  CB  . ASN D  4  220 ? 124.806 107.573 -11.295 1.00 51.32  ? 220  ASN H CB  1 
ATOM   9067  C  CG  . ASN D  4  220 ? 124.411 108.966 -11.801 1.00 55.59  ? 220  ASN H CG  1 
ATOM   9068  O  OD1 . ASN D  4  220 ? 123.241 109.361 -11.722 1.00 58.35  ? 220  ASN H OD1 1 
ATOM   9069  N  ND2 . ASN D  4  220 ? 125.389 109.725 -12.287 1.00 57.75  ? 220  ASN H ND2 1 
ATOM   9070  N  N   . VAL D  4  221 ? 125.794 104.336 -12.487 1.00 39.85  ? 221  VAL H N   1 
ATOM   9071  C  CA  . VAL D  4  221 ? 126.439 103.076 -12.151 1.00 38.09  ? 221  VAL H CA  1 
ATOM   9072  C  C   . VAL D  4  221 ? 127.906 103.400 -12.007 1.00 40.78  ? 221  VAL H C   1 
ATOM   9073  O  O   . VAL D  4  221 ? 128.405 104.313 -12.654 1.00 38.82  ? 221  VAL H O   1 
ATOM   9074  C  CB  . VAL D  4  221 ? 126.299 102.027 -13.265 1.00 35.25  ? 221  VAL H CB  1 
ATOM   9075  C  CG1 . VAL D  4  221 ? 127.022 100.727 -12.874 1.00 30.56  ? 221  VAL H CG1 1 
ATOM   9076  C  CG2 . VAL D  4  221 ? 124.844 101.773 -13.538 1.00 37.88  ? 221  VAL H CG2 1 
ATOM   9077  N  N   . PRO D  4  222 ? 128.555 102.803 -11.007 1.00 43.91  ? 222  PRO H N   1 
ATOM   9078  C  CA  . PRO D  4  222 ? 129.980 103.029 -10.766 1.00 46.46  ? 222  PRO H CA  1 
ATOM   9079  C  C   . PRO D  4  222 ? 130.858 102.722 -11.980 1.00 47.10  ? 222  PRO H C   1 
ATOM   9080  O  O   . PRO D  4  222 ? 130.549 101.820 -12.769 1.00 47.81  ? 222  PRO H O   1 
ATOM   9081  C  CB  . PRO D  4  222 ? 130.278 102.106 -9.589  1.00 45.05  ? 222  PRO H CB  1 
ATOM   9082  C  CG  . PRO D  4  222 ? 129.006 102.107 -8.827  1.00 45.80  ? 222  PRO H CG  1 
ATOM   9083  C  CD  . PRO D  4  222 ? 127.925 102.099 -9.877  1.00 44.95  ? 222  PRO H CD  1 
ATOM   9084  N  N   . ARG D  4  223 ? 131.985 103.431 -12.068 1.00 47.74  ? 223  ARG H N   1 
ATOM   9085  C  CA  . ARG D  4  223 ? 132.909 103.328 -13.199 1.00 51.39  ? 223  ARG H CA  1 
ATOM   9086  C  C   . ARG D  4  223 ? 134.204 102.612 -12.797 1.00 47.66  ? 223  ARG H C   1 
ATOM   9087  O  O   . ARG D  4  223 ? 134.740 102.842 -11.711 1.00 49.96  ? 223  ARG H O   1 
ATOM   9088  C  CB  . ARG D  4  223 ? 133.237 104.731 -13.748 1.00 57.81  ? 223  ARG H CB  1 
ATOM   9089  C  CG  . ARG D  4  223 ? 132.003 105.606 -14.086 1.00 67.11  ? 223  ARG H CG  1 
ATOM   9090  C  CD  . ARG D  4  223 ? 132.341 106.834 -14.960 1.00 72.00  ? 223  ARG H CD  1 
ATOM   9091  N  NE  . ARG D  4  223 ? 131.157 107.343 -15.663 1.00 77.67  ? 223  ARG H NE  1 
ATOM   9092  C  CZ  . ARG D  4  223 ? 131.180 108.220 -16.667 1.00 76.62  ? 223  ARG H CZ  1 
ATOM   9093  N  NH1 . ARG D  4  223 ? 132.314 108.810 -17.022 0.00 76.91  ? 223  ARG H NH1 1 
ATOM   9094  N  NH2 . ARG D  4  223 ? 130.045 108.579 -17.253 0.00 76.91  ? 223  ARG H NH2 1 
ATOM   9095  N  N   . LEU D  4  224 ? 134.646 101.680 -13.630 1.00 42.89  ? 224  LEU H N   1 
ATOM   9096  C  CA  . LEU D  4  224 ? 135.917 101.021 -13.404 1.00 43.67  ? 224  LEU H CA  1 
ATOM   9097  C  C   . LEU D  4  224 ? 137.048 101.980 -13.730 1.00 47.96  ? 224  LEU H C   1 
ATOM   9098  O  O   . LEU D  4  224 ? 136.848 102.985 -14.409 1.00 50.20  ? 224  LEU H O   1 
ATOM   9099  C  CB  . LEU D  4  224 ? 136.045 99.792  -14.285 1.00 40.78  ? 224  LEU H CB  1 
ATOM   9100  C  CG  . LEU D  4  224 ? 134.919 98.779  -14.295 1.00 35.07  ? 224  LEU H CG  1 
ATOM   9101  C  CD1 . LEU D  4  224 ? 135.505 97.460  -14.757 1.00 36.36  ? 224  LEU H CD1 1 
ATOM   9102  C  CD2 . LEU D  4  224 ? 134.317 98.664  -12.914 1.00 35.53  ? 224  LEU H CD2 1 
ATOM   9103  N  N   . GLN D  4  225 ? 138.241 101.683 -13.237 1.00 54.11  ? 225  GLN H N   1 
ATOM   9104  C  CA  . GLN D  4  225 ? 139.384 102.544 -13.510 1.00 59.05  ? 225  GLN H CA  1 
ATOM   9105  C  C   . GLN D  4  225 ? 140.154 101.993 -14.695 1.00 60.96  ? 225  GLN H C   1 
ATOM   9106  O  O   . GLN D  4  225 ? 140.547 102.748 -15.578 1.00 65.39  ? 225  GLN H O   1 
ATOM   9107  C  CB  . GLN D  4  225 ? 140.301 102.654 -12.290 1.00 59.62  ? 225  GLN H CB  1 
ATOM   9108  C  CG  . GLN D  4  225 ? 140.624 104.091 -11.901 1.00 62.95  ? 225  GLN H CG  1 
ATOM   9109  C  CD  . GLN D  4  225 ? 141.832 104.189 -10.988 1.00 63.44  ? 225  GLN H CD  1 
ATOM   9110  O  OE1 . GLN D  4  225 ? 141.712 104.096 -9.768  0.00 62.39  ? 225  GLN H OE1 1 
ATOM   9111  N  NE2 . GLN D  4  225 ? 143.001 104.398 -11.576 0.00 62.39  ? 225  GLN H NE2 1 
ATOM   9112  N  N   . SER D  4  226 ? 140.445 100.695 -14.666 1.00 61.84  ? 226  SER H N   1 
ATOM   9113  C  CA  . SER D  4  226 ? 140.816 99.979  -15.881 1.00 61.54  ? 226  SER H CA  1 
ATOM   9114  C  C   . SER D  4  226 ? 139.495 99.556  -16.541 1.00 61.19  ? 226  SER H C   1 
ATOM   9115  O  O   . SER D  4  226 ? 138.432 99.675  -15.927 1.00 63.82  ? 226  SER H O   1 
ATOM   9116  C  CB  . SER D  4  226 ? 141.677 98.763  -15.536 1.00 62.69  ? 226  SER H CB  1 
ATOM   9117  O  OG  . SER D  4  226 ? 141.094 98.004  -14.486 1.00 71.64  ? 226  SER H OG  1 
ATOM   9118  N  N   . ARG D  4  227 ? 139.540 99.151  -17.807 1.00 59.08  ? 227  ARG H N   1 
ATOM   9119  C  CA  . ARG D  4  227 ? 138.316 98.799  -18.530 1.00 54.67  ? 227  ARG H CA  1 
ATOM   9120  C  C   . ARG D  4  227 ? 138.222 97.296  -18.823 1.00 51.02  ? 227  ARG H C   1 
ATOM   9121  O  O   . ARG D  4  227 ? 137.146 96.780  -19.155 1.00 47.58  ? 227  ARG H O   1 
ATOM   9122  C  CB  . ARG D  4  227 ? 138.231 99.602  -19.833 1.00 55.54  ? 227  ARG H CB  1 
ATOM   9123  C  CG  . ARG D  4  227 ? 136.967 100.432 -19.976 0.00 54.97  ? 227  ARG H CG  1 
ATOM   9124  C  CD  . ARG D  4  227 ? 136.875 101.064 -21.360 0.00 55.08  ? 227  ARG H CD  1 
ATOM   9125  N  NE  . ARG D  4  227 ? 136.859 100.060 -22.422 0.00 55.03  ? 227  ARG H NE  1 
ATOM   9126  C  CZ  . ARG D  4  227 ? 135.777 99.390  -22.807 0.00 55.05  ? 227  ARG H CZ  1 
ATOM   9127  N  NH1 . ARG D  4  227 ? 134.593 99.658  -22.268 0.00 55.05  ? 227  ARG H NH1 1 
ATOM   9128  N  NH2 . ARG D  4  227 ? 135.872 98.470  -23.756 0.00 55.05  ? 227  ARG H NH2 1 
ATOM   9129  N  N   . ASP D  4  228 ? 139.352 96.604  -18.684 1.00 48.30  ? 228  ASP H N   1 
ATOM   9130  C  CA  . ASP D  4  228 ? 139.406 95.160  -18.865 1.00 48.03  ? 228  ASP H CA  1 
ATOM   9131  C  C   . ASP D  4  228 ? 139.695 94.447  -17.561 1.00 45.02  ? 228  ASP H C   1 
ATOM   9132  O  O   . ASP D  4  228 ? 139.696 93.208  -17.493 1.00 40.81  ? 228  ASP H O   1 
ATOM   9133  C  CB  . ASP D  4  228 ? 140.469 94.808  -19.889 1.00 56.12  ? 228  ASP H CB  1 
ATOM   9134  C  CG  . ASP D  4  228 ? 140.073 95.215  -21.294 1.00 62.98  ? 228  ASP H CG  1 
ATOM   9135  O  OD1 . ASP D  4  228 ? 138.920 95.660  -21.508 1.00 67.09  ? 228  ASP H OD1 1 
ATOM   9136  O  OD2 . ASP D  4  228 ? 140.929 95.095  -22.191 1.00 69.76  ? 228  ASP H OD2 1 
ATOM   9137  N  N   . GLN D  4  229 ? 139.808 95.250  -16.507 1.00 42.74  ? 229  GLN H N   1 
ATOM   9138  C  CA  . GLN D  4  229 ? 139.898 94.743  -15.163 1.00 39.49  ? 229  GLN H CA  1 
ATOM   9139  C  C   . GLN D  4  229 ? 138.948 95.441  -14.228 1.00 36.82  ? 229  GLN H C   1 
ATOM   9140  O  O   . GLN D  4  229 ? 138.327 96.461  -14.561 1.00 31.06  ? 229  GLN H O   1 
ATOM   9141  C  CB  . GLN D  4  229 ? 141.304 94.889  -14.642 1.00 43.07  ? 229  GLN H CB  1 
ATOM   9142  C  CG  . GLN D  4  229 ? 142.199 93.735  -15.021 1.00 53.40  ? 229  GLN H CG  1 
ATOM   9143  C  CD  . GLN D  4  229 ? 143.672 94.028  -14.718 1.00 60.37  ? 229  GLN H CD  1 
ATOM   9144  O  OE1 . GLN D  4  229 ? 144.012 95.095  -14.175 1.00 59.75  ? 229  GLN H OE1 1 
ATOM   9145  N  NE2 . GLN D  4  229 ? 144.556 93.100  -15.105 1.00 64.04  ? 229  GLN H NE2 1 
ATOM   9146  N  N   . ILE D  4  230 ? 138.778 94.800  -13.080 1.00 37.81  ? 230  ILE H N   1 
ATOM   9147  C  CA  . ILE D  4  230 ? 137.875 95.248  -12.026 1.00 37.65  ? 230  ILE H CA  1 
ATOM   9148  C  C   . ILE D  4  230 ? 138.475 94.800  -10.687 1.00 37.06  ? 230  ILE H C   1 
ATOM   9149  O  O   . ILE D  4  230 ? 139.000 93.677  -10.578 1.00 38.27  ? 230  ILE H O   1 
ATOM   9150  C  CB  . ILE D  4  230 ? 136.451 94.638  -12.221 1.00 32.99  ? 230  ILE H CB  1 
ATOM   9151  C  CG1 . ILE D  4  230 ? 135.448 95.366  -11.341 1.00 30.79  ? 230  ILE H CG1 1 
ATOM   9152  C  CG2 . ILE D  4  230 ? 136.456 93.144  -11.951 1.00 24.99  ? 230  ILE H CG2 1 
ATOM   9153  C  CD1 . ILE D  4  230 ? 134.028 95.097  -11.725 1.00 27.07  ? 230  ILE H CD1 1 
ATOM   9154  N  N   . THR D  4  231 ? 138.507 95.713  -9.721  1.00 32.79  ? 231  THR H N   1 
ATOM   9155  C  CA  . THR D  4  231 ? 139.067 95.418  -8.411  1.00 33.52  ? 231  THR H CA  1 
ATOM   9156  C  C   . THR D  4  231 ? 138.000 94.853  -7.482  1.00 34.71  ? 231  THR H C   1 
ATOM   9157  O  O   . THR D  4  231 ? 136.810 95.191  -7.606  1.00 36.62  ? 231  THR H O   1 
ATOM   9158  C  CB  . THR D  4  231 ? 139.584 96.672  -7.753  1.00 34.13  ? 231  THR H CB  1 
ATOM   9159  O  OG1 . THR D  4  231 ? 138.466 97.512  -7.435  1.00 33.88  ? 231  THR H OG1 1 
ATOM   9160  C  CG2 . THR D  4  231 ? 140.545 97.398  -8.679  1.00 34.84  ? 231  THR H CG2 1 
ATOM   9161  N  N   . LEU D  4  232 ? 138.453 94.206  -6.417  1.00 30.39  ? 232  LEU H N   1 
ATOM   9162  C  CA  . LEU D  4  232 ? 137.534 93.684  -5.440  1.00 27.49  ? 232  LEU H CA  1 
ATOM   9163  C  C   . LEU D  4  232 ? 136.614 94.768  -4.947  1.00 27.64  ? 232  LEU H C   1 
ATOM   9164  O  O   . LEU D  4  232 ? 135.401 94.548  -4.831  1.00 28.17  ? 232  LEU H O   1 
ATOM   9165  C  CB  . LEU D  4  232 ? 138.276 93.077  -4.278  1.00 25.40  ? 232  LEU H CB  1 
ATOM   9166  C  CG  . LEU D  4  232 ? 138.916 91.751  -4.653  1.00 27.17  ? 232  LEU H CG  1 
ATOM   9167  C  CD1 . LEU D  4  232 ? 139.759 91.258  -3.467  1.00 31.69  ? 232  LEU H CD1 1 
ATOM   9168  C  CD2 . LEU D  4  232 ? 137.847 90.736  -5.013  1.00 25.36  ? 232  LEU H CD2 1 
ATOM   9169  N  N   . ARG D  4  233 ? 137.133 95.969  -4.751  1.00 24.67  ? 233  ARG H N   1 
ATOM   9170  C  CA  . ARG D  4  233 ? 136.240 96.955  -4.196  1.00 26.22  ? 233  ARG H CA  1 
ATOM   9171  C  C   . ARG D  4  233 ? 135.302 97.515  -5.233  1.00 29.27  ? 233  ARG H C   1 
ATOM   9172  O  O   . ARG D  4  233 ? 134.212 97.988  -4.909  1.00 33.97  ? 233  ARG H O   1 
ATOM   9173  C  CB  . ARG D  4  233 ? 136.967 98.088  -3.514  1.00 26.17  ? 233  ARG H CB  1 
ATOM   9174  C  CG  . ARG D  4  233 ? 135.965 98.979  -2.792  1.00 32.04  ? 233  ARG H CG  1 
ATOM   9175  C  CD  . ARG D  4  233 ? 136.555 100.306 -2.468  1.00 35.39  ? 233  ARG H CD  1 
ATOM   9176  N  NE  . ARG D  4  233 ? 137.707 100.113 -1.604  1.00 44.95  ? 233  ARG H NE  1 
ATOM   9177  C  CZ  . ARG D  4  233 ? 137.912 100.771 -0.472  1.00 49.59  ? 233  ARG H CZ  1 
ATOM   9178  N  NH1 . ARG D  4  233 ? 137.231 101.882 -0.210  1.00 56.10  ? 233  ARG H NH1 1 
ATOM   9179  N  NH2 . ARG D  4  233 ? 138.896 100.395 0.330   1.00 53.47  ? 233  ARG H NH2 1 
ATOM   9180  N  N   . GLU D  4  234 ? 135.682 97.434  -6.495  1.00 30.92  ? 234  GLU H N   1 
ATOM   9181  C  CA  . GLU D  4  234 ? 134.773 97.902  -7.529  1.00 31.06  ? 234  GLU H CA  1 
ATOM   9182  C  C   . GLU D  4  234 ? 133.595 96.941  -7.720  1.00 32.93  ? 234  GLU H C   1 
ATOM   9183  O  O   . GLU D  4  234 ? 132.430 97.370  -7.786  1.00 31.33  ? 234  GLU H O   1 
ATOM   9184  C  CB  . GLU D  4  234 ? 135.524 98.080  -8.829  1.00 29.54  ? 234  GLU H CB  1 
ATOM   9185  C  CG  . GLU D  4  234 ? 136.232 99.392  -8.910  1.00 28.60  ? 234  GLU H CG  1 
ATOM   9186  C  CD  . GLU D  4  234 ? 137.234 99.427  -10.031 1.00 29.88  ? 234  GLU H CD  1 
ATOM   9187  O  OE1 . GLU D  4  234 ? 137.737 98.351  -10.440 1.00 30.88  ? 234  GLU H OE1 1 
ATOM   9188  O  OE2 . GLU D  4  234 ? 137.561 100.550 -10.458 1.00 27.15  ? 234  GLU H OE2 1 
ATOM   9189  N  N   . GLU D  4  235 ? 133.901 95.641  -7.748  1.00 31.02  ? 235  GLU H N   1 
ATOM   9190  C  CA  . GLU D  4  235 ? 132.877 94.603  -7.743  1.00 27.49  ? 235  GLU H CA  1 
ATOM   9191  C  C   . GLU D  4  235 ? 131.843 94.926  -6.664  1.00 30.55  ? 235  GLU H C   1 
ATOM   9192  O  O   . GLU D  4  235 ? 130.624 94.833  -6.894  1.00 32.44  ? 235  GLU H O   1 
ATOM   9193  C  CB  . GLU D  4  235 ? 133.494 93.242  -7.442  1.00 23.55  ? 235  GLU H CB  1 
ATOM   9194  C  CG  . GLU D  4  235 ? 134.623 92.830  -8.359  1.00 23.57  ? 235  GLU H CG  1 
ATOM   9195  C  CD  . GLU D  4  235 ? 134.664 91.319  -8.588  1.00 26.58  ? 235  GLU H CD  1 
ATOM   9196  O  OE1 . GLU D  4  235 ? 133.647 90.776  -9.080  1.00 28.69  ? 235  GLU H OE1 1 
ATOM   9197  O  OE2 . GLU D  4  235 ? 135.705 90.668  -8.301  1.00 26.81  ? 235  GLU H OE2 1 
ATOM   9198  N  N   . ASP D  4  236 ? 132.333 95.361  -5.505  1.00 27.43  ? 236  ASP H N   1 
ATOM   9199  C  CA  . ASP D  4  236 ? 131.458 95.735  -4.408  1.00 27.62  ? 236  ASP H CA  1 
ATOM   9200  C  C   . ASP D  4  236 ? 130.638 96.990  -4.721  1.00 29.97  ? 236  ASP H C   1 
ATOM   9201  O  O   . ASP D  4  236 ? 129.426 97.047  -4.437  1.00 27.62  ? 236  ASP H O   1 
ATOM   9202  C  CB  . ASP D  4  236 ? 132.282 95.944  -3.136  1.00 32.75  ? 236  ASP H CB  1 
ATOM   9203  C  CG  . ASP D  4  236 ? 131.972 94.908  -2.054  1.00 34.09  ? 236  ASP H CG  1 
ATOM   9204  O  OD1 . ASP D  4  236 ? 132.025 93.690  -2.339  1.00 34.51  ? 236  ASP H OD1 1 
ATOM   9205  O  OD2 . ASP D  4  236 ? 131.702 95.315  -0.904  1.00 35.78  ? 236  ASP H OD2 1 
ATOM   9206  N  N   . LYS D  4  237 ? 131.286 97.973  -5.341  1.00 27.50  ? 237  LYS H N   1 
ATOM   9207  C  CA  . LYS D  4  237 ? 130.619 99.211  -5.703  1.00 28.09  ? 237  LYS H CA  1 
ATOM   9208  C  C   . LYS D  4  237 ? 129.494 98.963  -6.714  1.00 28.72  ? 237  LYS H C   1 
ATOM   9209  O  O   . LYS D  4  237 ? 128.361 99.404  -6.528  1.00 24.42  ? 237  LYS H O   1 
ATOM   9210  C  CB  . LYS D  4  237 ? 131.645 100.181 -6.286  1.00 30.48  ? 237  LYS H CB  1 
ATOM   9211  C  CG  . LYS D  4  237 ? 132.298 101.117 -5.267  1.00 31.72  ? 237  LYS H CG  1 
ATOM   9212  C  CD  . LYS D  4  237 ? 133.448 101.907 -5.877  1.00 33.30  ? 237  LYS H CD  1 
ATOM   9213  C  CE  . LYS D  4  237 ? 134.074 102.846 -4.866  1.00 35.40  ? 237  LYS H CE  1 
ATOM   9214  N  NZ  . LYS D  4  237 ? 135.522 103.022 -5.144  1.00 42.99  ? 237  LYS H NZ  1 
ATOM   9215  N  N   . VAL D  4  238 ? 129.846 98.295  -7.808  1.00 30.15  ? 238  VAL H N   1 
ATOM   9216  C  CA  . VAL D  4  238 ? 128.913 97.917  -8.864  1.00 30.90  ? 238  VAL H CA  1 
ATOM   9217  C  C   . VAL D  4  238 ? 127.696 97.140  -8.311  1.00 30.45  ? 238  VAL H C   1 
ATOM   9218  O  O   . VAL D  4  238 ? 126.546 97.561  -8.501  1.00 31.27  ? 238  VAL H O   1 
ATOM   9219  C  CB  . VAL D  4  238 ? 129.677 97.084  -9.950  1.00 30.39  ? 238  VAL H CB  1 
ATOM   9220  C  CG1 . VAL D  4  238 ? 128.719 96.451  -10.929 1.00 31.47  ? 238  VAL H CG1 1 
ATOM   9221  C  CG2 . VAL D  4  238 ? 130.682 97.975  -10.687 1.00 31.11  ? 238  VAL H CG2 1 
ATOM   9222  N  N   . SER D  4  239 ? 127.961 96.087  -7.534  1.00 29.73  ? 239  SER H N   1 
ATOM   9223  C  CA  . SER D  4  239 ? 126.912 95.210  -6.997  1.00 27.79  ? 239  SER H CA  1 
ATOM   9224  C  C   . SER D  4  239 ? 125.982 95.949  -6.066  1.00 26.04  ? 239  SER H C   1 
ATOM   9225  O  O   . SER D  4  239 ? 124.757 95.874  -6.208  1.00 27.17  ? 239  SER H O   1 
ATOM   9226  C  CB  . SER D  4  239 ? 127.535 94.030  -6.248  1.00 26.60  ? 239  SER H CB  1 
ATOM   9227  O  OG  . SER D  4  239 ? 128.389 93.274  -7.098  1.00 31.89  ? 239  SER H OG  1 
ATOM   9228  N  N   . ALA D  4  240 ? 126.566 96.647  -5.096  1.00 24.24  ? 240  ALA H N   1 
ATOM   9229  C  CA  . ALA D  4  240 ? 125.784 97.402  -4.135  1.00 26.94  ? 240  ALA H CA  1 
ATOM   9230  C  C   . ALA D  4  240 ? 124.883 98.424  -4.825  1.00 32.07  ? 240  ALA H C   1 
ATOM   9231  O  O   . ALA D  4  240 ? 123.782 98.709  -4.329  1.00 34.68  ? 240  ALA H O   1 
ATOM   9232  C  CB  . ALA D  4  240 ? 126.684 98.094  -3.170  1.00 24.73  ? 240  ALA H CB  1 
ATOM   9233  N  N   . TYR D  4  241 ? 125.328 98.950  -5.977  1.00 33.86  ? 241  TYR H N   1 
ATOM   9234  C  CA  . TYR D  4  241 ? 124.589 100.009 -6.684  1.00 31.79  ? 241  TYR H CA  1 
ATOM   9235  C  C   . TYR D  4  241 ? 123.206 99.533  -7.112  1.00 31.36  ? 241  TYR H C   1 
ATOM   9236  O  O   . TYR D  4  241 ? 122.214 100.228 -6.906  1.00 30.93  ? 241  TYR H O   1 
ATOM   9237  C  CB  . TYR D  4  241 ? 125.352 100.527 -7.920  1.00 32.89  ? 241  TYR H CB  1 
ATOM   9238  C  CG  . TYR D  4  241 ? 124.697 101.746 -8.602  1.00 31.52  ? 241  TYR H CG  1 
ATOM   9239  C  CD1 . TYR D  4  241 ? 124.829 103.028 -8.064  1.00 26.10  ? 241  TYR H CD1 1 
ATOM   9240  C  CD2 . TYR D  4  241 ? 123.865 101.594 -9.720  1.00 31.95  ? 241  TYR H CD2 1 
ATOM   9241  C  CE1 . TYR D  4  241 ? 124.142 104.111 -8.597  1.00 30.48  ? 241  TYR H CE1 1 
ATOM   9242  C  CE2 . TYR D  4  241 ? 123.175 102.684 -10.261 1.00 30.73  ? 241  TYR H CE2 1 
ATOM   9243  C  CZ  . TYR D  4  241 ? 123.314 103.931 -9.691  1.00 30.37  ? 241  TYR H CZ  1 
ATOM   9244  O  OH  . TYR D  4  241 ? 122.588 105.002 -10.174 1.00 34.52  ? 241  TYR H OH  1 
ATOM   9245  N  N   . TYR D  4  242 ? 123.125 98.325  -7.650  1.00 31.56  ? 242  TYR H N   1 
ATOM   9246  C  CA  . TYR D  4  242 ? 121.837 97.814  -8.083  1.00 31.99  ? 242  TYR H CA  1 
ATOM   9247  C  C   . TYR D  4  242 ? 120.983 97.380  -6.901  1.00 33.21  ? 242  TYR H C   1 
ATOM   9248  O  O   . TYR D  4  242 ? 119.804 97.751  -6.808  1.00 32.27  ? 242  TYR H O   1 
ATOM   9249  C  CB  . TYR D  4  242 ? 122.055 96.662  -9.047  1.00 38.66  ? 242  TYR H CB  1 
ATOM   9250  C  CG  . TYR D  4  242 ? 122.741 97.097  -10.323 1.00 44.24  ? 242  TYR H CG  1 
ATOM   9251  C  CD1 . TYR D  4  242 ? 122.002 97.591  -11.410 1.00 44.25  ? 242  TYR H CD1 1 
ATOM   9252  C  CD2 . TYR D  4  242 ? 124.126 97.017  -10.450 1.00 45.01  ? 242  TYR H CD2 1 
ATOM   9253  C  CE1 . TYR D  4  242 ? 122.627 97.981  -12.585 1.00 40.90  ? 242  TYR H CE1 1 
ATOM   9254  C  CE2 . TYR D  4  242 ? 124.757 97.401  -11.629 1.00 47.39  ? 242  TYR H CE2 1 
ATOM   9255  C  CZ  . TYR D  4  242 ? 124.002 97.876  -12.687 1.00 44.47  ? 242  TYR H CZ  1 
ATOM   9256  O  OH  . TYR D  4  242 ? 124.627 98.211  -13.855 1.00 45.05  ? 242  TYR H OH  1 
ATOM   9257  N  N   . ALA D  4  243 ? 121.617 96.683  -5.954  1.00 31.75  ? 243  ALA H N   1 
ATOM   9258  C  CA  . ALA D  4  243 ? 120.991 96.299  -4.699  1.00 26.48  ? 243  ALA H CA  1 
ATOM   9259  C  C   . ALA D  4  243 ? 120.267 97.492  -4.068  1.00 28.63  ? 243  ALA H C   1 
ATOM   9260  O  O   . ALA D  4  243 ? 119.138 97.367  -3.548  1.00 26.53  ? 243  ALA H O   1 
ATOM   9261  C  CB  . ALA D  4  243 ? 122.040 95.773  -3.764  1.00 25.29  ? 243  ALA H CB  1 
ATOM   9262  N  N   . GLY D  4  244 ? 120.877 98.667  -4.197  1.00 27.60  ? 244  GLY H N   1 
ATOM   9263  C  CA  . GLY D  4  244 ? 120.290 99.877  -3.640  1.00 29.63  ? 244  GLY H CA  1 
ATOM   9264  C  C   . GLY D  4  244 ? 119.013 100.321 -4.335  1.00 35.16  ? 244  GLY H C   1 
ATOM   9265  O  O   . GLY D  4  244 ? 118.127 100.948 -3.723  1.00 32.95  ? 244  GLY H O   1 
ATOM   9266  N  N   . GLY D  4  245 ? 118.920 100.012 -5.627  1.00 35.76  ? 245  GLY H N   1 
ATOM   9267  C  CA  . GLY D  4  245 ? 117.731 100.344 -6.380  1.00 33.33  ? 245  GLY H CA  1 
ATOM   9268  C  C   . GLY D  4  245 ? 116.542 99.618  -5.808  1.00 33.74  ? 245  GLY H C   1 
ATOM   9269  O  O   . GLY D  4  245 ? 115.459 100.193 -5.743  1.00 37.30  ? 245  GLY H O   1 
ATOM   9270  N  N   . LEU D  4  246 ? 116.785 98.445  -5.218  1.00 33.83  ? 246  LEU H N   1 
ATOM   9271  C  CA  . LEU D  4  246 ? 115.710 97.577  -4.728  1.00 30.80  ? 246  LEU H CA  1 
ATOM   9272  C  C   . LEU D  4  246 ? 114.936 98.275  -3.612  1.00 30.15  ? 246  LEU H C   1 
ATOM   9273  O  O   . LEU D  4  246 ? 113.740 98.055  -3.443  1.00 31.91  ? 246  LEU H O   1 
ATOM   9274  C  CB  . LEU D  4  246 ? 116.267 96.234  -4.229  1.00 27.73  ? 246  LEU H CB  1 
ATOM   9275  C  CG  . LEU D  4  246 ? 117.142 95.395  -5.168  1.00 25.45  ? 246  LEU H CG  1 
ATOM   9276  C  CD1 . LEU D  4  246 ? 117.739 94.230  -4.412  1.00 25.37  ? 246  LEU H CD1 1 
ATOM   9277  C  CD2 . LEU D  4  246 ? 116.328 94.865  -6.307  1.00 25.73  ? 246  LEU H CD2 1 
ATOM   9278  N  N   . LEU D  4  247 ? 115.586 99.202  -2.926  1.00 29.20  ? 247  LEU H N   1 
ATOM   9279  C  CA  . LEU D  4  247 ? 114.904 99.966  -1.896  1.00 33.03  ? 247  LEU H CA  1 
ATOM   9280  C  C   . LEU D  4  247 ? 114.612 101.395 -2.348  1.00 35.25  ? 247  LEU H C   1 
ATOM   9281  O  O   . LEU D  4  247 ? 113.664 102.014 -1.871  1.00 35.98  ? 247  LEU H O   1 
ATOM   9282  C  CB  . LEU D  4  247 ? 115.749 99.987  -0.618  1.00 32.57  ? 247  LEU H CB  1 
ATOM   9283  C  CG  . LEU D  4  247 ? 115.010 100.388 0.660   1.00 30.68  ? 247  LEU H CG  1 
ATOM   9284  C  CD1 . LEU D  4  247 ? 113.841 99.450  0.892   1.00 29.13  ? 247  LEU H CD1 1 
ATOM   9285  C  CD2 . LEU D  4  247 ? 115.966 100.344 1.832   1.00 30.34  ? 247  LEU H CD2 1 
ATOM   9286  N  N   . TYR D  4  248 ? 115.356 101.870 -3.346  1.00 37.88  ? 248  TYR H N   1 
ATOM   9287  C  CA  . TYR D  4  248 ? 115.472 103.303 -3.600  1.00 40.04  ? 248  TYR H CA  1 
ATOM   9288  C  C   . TYR D  4  248 ? 115.218 103.760 -5.042  1.00 39.60  ? 248  TYR H C   1 
ATOM   9289  O  O   . TYR D  4  248 ? 115.139 104.961 -5.295  1.00 38.80  ? 248  TYR H O   1 
ATOM   9290  C  CB  . TYR D  4  248 ? 116.856 103.797 -3.172  1.00 39.74  ? 248  TYR H CB  1 
ATOM   9291  C  CG  . TYR D  4  248 ? 117.158 103.718 -1.686  1.00 37.90  ? 248  TYR H CG  1 
ATOM   9292  C  CD1 . TYR D  4  248 ? 116.296 104.294 -0.745  1.00 38.54  ? 248  TYR H CD1 1 
ATOM   9293  C  CD2 . TYR D  4  248 ? 118.381 103.205 -1.233  1.00 36.86  ? 248  TYR H CD2 1 
ATOM   9294  C  CE1 . TYR D  4  248 ? 116.647 104.370 0.618   1.00 35.09  ? 248  TYR H CE1 1 
ATOM   9295  C  CE2 . TYR D  4  248 ? 118.743 103.278 0.114   1.00 37.38  ? 248  TYR H CE2 1 
ATOM   9296  C  CZ  . TYR D  4  248 ? 117.870 103.858 1.039   1.00 38.22  ? 248  TYR H CZ  1 
ATOM   9297  O  OH  . TYR D  4  248 ? 118.201 103.877 2.385   1.00 38.79  ? 248  TYR H OH  1 
ATOM   9298  N  N   . ALA D  4  249 ? 115.080 102.830 -5.981  1.00 41.01  ? 249  ALA H N   1 
ATOM   9299  C  CA  . ALA D  4  249 ? 114.895 103.211 -7.379  1.00 39.63  ? 249  ALA H CA  1 
ATOM   9300  C  C   . ALA D  4  249 ? 113.706 104.147 -7.492  1.00 39.93  ? 249  ALA H C   1 
ATOM   9301  O  O   . ALA D  4  249 ? 113.794 105.176 -8.143  1.00 44.27  ? 249  ALA H O   1 
ATOM   9302  C  CB  . ALA D  4  249 ? 114.681 102.003 -8.247  1.00 34.14  ? 249  ALA H CB  1 
ATOM   9303  N  N   . THR D  4  250 ? 112.640 103.865 -6.759  1.00 40.31  ? 250  THR H N   1 
ATOM   9304  C  CA  . THR D  4  250 ? 111.527 104.804 -6.700  1.00 42.95  ? 250  THR H CA  1 
ATOM   9305  C  C   . THR D  4  250 ? 111.054 104.997 -5.270  1.00 45.70  ? 250  THR H C   1 
ATOM   9306  O  O   . THR D  4  250 ? 111.276 104.136 -4.409  1.00 48.10  ? 250  THR H O   1 
ATOM   9307  C  CB  . THR D  4  250 ? 110.322 104.344 -7.565  1.00 46.76  ? 250  THR H CB  1 
ATOM   9308  O  OG1 . THR D  4  250 ? 109.339 103.699 -6.734  1.00 44.51  ? 250  THR H OG1 1 
ATOM   9309  C  CG2 . THR D  4  250 ? 110.779 103.410 -8.690  1.00 44.82  ? 250  THR H CG2 1 
ATOM   9310  N  N   . PRO D  4  251 ? 110.306 106.085 -5.018  1.00 47.47  ? 251  PRO H N   1 
ATOM   9311  C  CA  . PRO D  4  251 ? 110.067 106.606 -3.667  1.00 48.95  ? 251  PRO H CA  1 
ATOM   9312  C  C   . PRO D  4  251 ? 109.258 105.669 -2.793  1.00 48.44  ? 251  PRO H C   1 
ATOM   9313  O  O   . PRO D  4  251 ? 109.342 105.722 -1.562  1.00 48.72  ? 251  PRO H O   1 
ATOM   9314  C  CB  . PRO D  4  251 ? 109.309 107.914 -3.912  1.00 50.43  ? 251  PRO H CB  1 
ATOM   9315  C  CG  . PRO D  4  251 ? 109.690 108.303 -5.295  1.00 52.11  ? 251  PRO H CG  1 
ATOM   9316  C  CD  . PRO D  4  251 ? 109.766 106.999 -6.037  1.00 49.15  ? 251  PRO H CD  1 
ATOM   9317  N  N   . GLU D  4  252 ? 108.440 104.846 -3.428  1.00 48.66  ? 252  GLU H N   1 
ATOM   9318  C  CA  . GLU D  4  252 ? 107.536 104.006 -2.679  1.00 50.62  ? 252  GLU H CA  1 
ATOM   9319  C  C   . GLU D  4  252 ? 108.166 102.700 -2.229  1.00 48.53  ? 252  GLU H C   1 
ATOM   9320  O  O   . GLU D  4  252 ? 107.707 102.111 -1.253  1.00 50.31  ? 252  GLU H O   1 
ATOM   9321  C  CB  . GLU D  4  252 ? 106.285 103.733 -3.487  1.00 55.14  ? 252  GLU H CB  1 
ATOM   9322  C  CG  . GLU D  4  252 ? 106.550 103.246 -4.881  1.00 66.53  ? 252  GLU H CG  1 
ATOM   9323  C  CD  . GLU D  4  252 ? 105.293 102.718 -5.532  1.00 74.73  ? 252  GLU H CD  1 
ATOM   9324  O  OE1 . GLU D  4  252 ? 104.322 103.501 -5.704  1.00 79.77  ? 252  GLU H OE1 1 
ATOM   9325  O  OE2 . GLU D  4  252 ? 105.264 101.503 -5.826  1.00 78.33  ? 252  GLU H OE2 1 
ATOM   9326  N  N   . ARG D  4  253 ? 109.293 102.333 -2.834  1.00 43.47  ? 253  ARG H N   1 
ATOM   9327  C  CA  . ARG D  4  253 ? 109.988 101.103 -2.470  1.00 42.97  ? 253  ARG H CA  1 
ATOM   9328  C  C   . ARG D  4  253 ? 110.495 101.030 -1.017  1.00 46.65  ? 253  ARG H C   1 
ATOM   9329  O  O   . ARG D  4  253 ? 110.605 99.941  -0.449  1.00 52.86  ? 253  ARG H O   1 
ATOM   9330  C  CB  . ARG D  4  253 ? 111.144 100.859 -3.428  1.00 37.37  ? 253  ARG H CB  1 
ATOM   9331  C  CG  . ARG D  4  253 ? 110.692 100.635 -4.824  1.00 28.72  ? 253  ARG H CG  1 
ATOM   9332  C  CD  . ARG D  4  253 ? 111.862 100.292 -5.702  1.00 32.38  ? 253  ARG H CD  1 
ATOM   9333  N  NE  . ARG D  4  253 ? 111.388 99.837  -7.002  1.00 35.39  ? 253  ARG H NE  1 
ATOM   9334  C  CZ  . ARG D  4  253 ? 112.092 99.121  -7.876  1.00 38.80  ? 253  ARG H CZ  1 
ATOM   9335  N  NH1 . ARG D  4  253 ? 113.380 98.848  -7.661  1.00 38.43  ? 253  ARG H NH1 1 
ATOM   9336  N  NH2 . ARG D  4  253 ? 111.512 98.732  -9.011  1.00 37.40  ? 253  ARG H NH2 1 
ATOM   9337  N  N   . ALA D  4  254 ? 110.854 102.166 -0.427  1.00 46.17  ? 254  ALA H N   1 
ATOM   9338  C  CA  . ALA D  4  254 ? 111.276 102.177 0.974   1.00 46.23  ? 254  ALA H CA  1 
ATOM   9339  C  C   . ALA D  4  254 ? 110.076 102.003 1.904   1.00 46.26  ? 254  ALA H C   1 
ATOM   9340  O  O   . ALA D  4  254 ? 110.210 101.524 3.032   1.00 46.98  ? 254  ALA H O   1 
ATOM   9341  C  CB  . ALA D  4  254 ? 112.011 103.480 1.300   1.00 44.01  ? 254  ALA H CB  1 
ATOM   9342  N  N   . GLU D  4  255 ? 108.901 102.398 1.423   1.00 47.33  ? 255  GLU H N   1 
ATOM   9343  C  CA  . GLU D  4  255 ? 107.702 102.402 2.248   1.00 45.88  ? 255  GLU H CA  1 
ATOM   9344  C  C   . GLU D  4  255 ? 107.144 101.002 2.404   1.00 45.85  ? 255  GLU H C   1 
ATOM   9345  O  O   . GLU D  4  255 ? 107.516 100.074 1.669   1.00 43.97  ? 255  GLU H O   1 
ATOM   9346  C  CB  . GLU D  4  255 ? 106.618 103.303 1.642   1.00 45.47  ? 255  GLU H CB  1 
ATOM   9347  C  CG  . GLU D  4  255 ? 106.902 104.796 1.665   1.00 44.14  ? 255  GLU H CG  1 
ATOM   9348  C  CD  . GLU D  4  255 ? 107.711 105.250 2.871   1.00 46.78  ? 255  GLU H CD  1 
ATOM   9349  O  OE1 . GLU D  4  255 ? 107.334 104.938 4.030   1.00 47.66  ? 255  GLU H OE1 1 
ATOM   9350  O  OE2 . GLU D  4  255 ? 108.733 105.932 2.641   1.00 47.26  ? 255  GLU H OE2 1 
ATOM   9351  N  N   . SER D  4  256 ? 106.277 100.859 3.400   1.00 45.11  ? 256  SER H N   1 
ATOM   9352  C  CA  . SER D  4  256 ? 105.492 99.654  3.580   1.00 47.30  ? 256  SER H CA  1 
ATOM   9353  C  C   . SER D  4  256 ? 105.102 98.990  2.261   1.00 50.78  ? 256  SER H C   1 
ATOM   9354  O  O   . SER D  4  256 ? 104.624 99.646  1.335   1.00 55.60  ? 256  SER H O   1 
ATOM   9355  C  CB  . SER D  4  256 ? 104.241 99.983  4.371   1.00 46.47  ? 256  SER H CB  1 
ATOM   9356  O  OG  . SER D  4  256 ? 104.181 99.197  5.536   1.00 49.99  ? 256  SER H OG  1 
ATOM   9357  N  N   . LEU D  4  257 ? 105.455 97.718  2.149   1.00 53.25  ? 257  LEU H N   1 
ATOM   9358  C  CA  . LEU D  4  257 ? 105.159 96.893  0.989   1.00 54.27  ? 257  LEU H CA  1 
ATOM   9359  C  C   . LEU D  4  257 ? 103.653 96.805  0.737   1.00 57.04  ? 257  LEU H C   1 
ATOM   9360  O  O   . LEU D  4  257 ? 103.173 96.994  -0.383  1.00 58.73  ? 257  LEU H O   1 
ATOM   9361  C  CB  . LEU D  4  257 ? 105.729 95.500  1.241   1.00 55.79  ? 257  LEU H CB  1 
ATOM   9362  C  CG  . LEU D  4  257 ? 106.154 94.669  0.044   1.00 56.68  ? 257  LEU H CG  1 
ATOM   9363  C  CD1 . LEU D  4  257 ? 104.954 93.908  -0.487  1.00 55.96  ? 257  LEU H CD1 1 
ATOM   9364  C  CD2 . LEU D  4  257 ? 106.774 95.580  -1.014  1.00 58.55  ? 257  LEU H CD2 1 
ATOM   9365  N  N   . LEU D  4  258 ? 102.919 96.502  1.794   1.00 60.14  ? 258  LEU H N   1 
ATOM   9366  C  CA  . LEU D  4  258 ? 101.474 96.373  1.729   1.00 63.97  ? 258  LEU H CA  1 
ATOM   9367  C  C   . LEU D  4  258 ? 100.838 97.144  2.900   1.00 65.45  ? 258  LEU H C   1 
ATOM   9368  O  O   . LEU D  4  258 ? 99.730  96.763  3.342   1.00 68.68  ? 258  LEU H O   1 
ATOM   9369  C  CB  . LEU D  4  258 ? 101.079 94.880  1.767   1.00 65.22  ? 258  LEU H CB  1 
ATOM   9370  C  CG  . LEU D  4  258 ? 101.993 93.855  2.470   1.00 66.52  ? 258  LEU H CG  1 
ATOM   9371  C  CD1 . LEU D  4  258 ? 101.333 93.339  3.740   1.00 64.95  ? 258  LEU H CD1 1 
ATOM   9372  C  CD2 . LEU D  4  258 ? 102.316 92.692  1.535   1.00 67.89  ? 258  LEU H CD2 1 
ATOM   9373  O  OXT . LEU D  4  258 ? 101.448 98.142  3.359   1.00 66.04  ? 258  LEU H OXT 1 
HETATM 9374  C  CHA . HEM E  5  .   ? 79.480  9.590   18.144  1.00 36.08  ? 337  HEM C CHA 1 
HETATM 9375  C  CHB . HEM E  5  .   ? 75.825  10.503  15.060  1.00 31.96  ? 337  HEM C CHB 1 
HETATM 9376  C  CHC . HEM E  5  .   ? 78.681  13.427  12.529  1.00 30.59  ? 337  HEM C CHC 1 
HETATM 9377  C  CHD . HEM E  5  .   ? 82.384  12.360  15.469  1.00 28.84  ? 337  HEM C CHD 1 
HETATM 9378  C  C1A . HEM E  5  .   ? 78.250  9.532   17.473  1.00 37.10  ? 337  HEM C C1A 1 
HETATM 9379  C  C2A . HEM E  5  .   ? 77.133  8.677   17.838  1.00 40.49  ? 337  HEM C C2A 1 
HETATM 9380  C  C3A . HEM E  5  .   ? 76.070  9.076   17.105  1.00 39.91  ? 337  HEM C C3A 1 
HETATM 9381  C  C4A . HEM E  5  .   ? 76.573  9.987   16.109  1.00 38.26  ? 337  HEM C C4A 1 
HETATM 9382  C  CMA . HEM E  5  .   ? 74.624  8.596   17.288  1.00 37.21  ? 337  HEM C CMA 1 
HETATM 9383  C  CAA . HEM E  5  .   ? 77.100  7.522   18.829  1.00 41.62  ? 337  HEM C CAA 1 
HETATM 9384  C  CBA . HEM E  5  .   ? 77.523  6.212   18.186  1.00 44.99  ? 337  HEM C CBA 1 
HETATM 9385  C  CGA . HEM E  5  .   ? 77.943  5.202   19.212  1.00 47.31  ? 337  HEM C CGA 1 
HETATM 9386  O  O1A . HEM E  5  .   ? 79.100  5.280   19.678  1.00 49.71  ? 337  HEM C O1A 1 
HETATM 9387  O  O2A . HEM E  5  .   ? 77.092  4.384   19.614  1.00 48.26  ? 337  HEM C O2A 1 
HETATM 9388  C  C1B . HEM E  5  .   ? 76.298  11.386  14.100  1.00 32.86  ? 337  HEM C C1B 1 
HETATM 9389  C  C2B . HEM E  5  .   ? 75.507  11.932  13.023  1.00 34.10  ? 337  HEM C C2B 1 
HETATM 9390  C  C3B . HEM E  5  .   ? 76.267  12.839  12.398  1.00 32.17  ? 337  HEM C C3B 1 
HETATM 9391  C  C4B . HEM E  5  .   ? 77.581  12.747  12.972  1.00 32.81  ? 337  HEM C C4B 1 
HETATM 9392  C  CMB . HEM E  5  .   ? 74.067  11.598  12.681  1.00 39.45  ? 337  HEM C CMB 1 
HETATM 9393  C  CAB . HEM E  5  .   ? 76.007  13.867  11.368  1.00 30.13  ? 337  HEM C CAB 1 
HETATM 9394  C  CBB . HEM E  5  .   ? 74.814  14.704  11.782  1.00 29.63  ? 337  HEM C CBB 1 
HETATM 9395  C  C1C . HEM E  5  .   ? 79.929  13.383  13.109  1.00 31.96  ? 337  HEM C C1C 1 
HETATM 9396  C  C2C . HEM E  5  .   ? 81.078  14.042  12.573  1.00 31.43  ? 337  HEM C C2C 1 
HETATM 9397  C  C3C . HEM E  5  .   ? 82.133  13.653  13.313  1.00 31.27  ? 337  HEM C C3C 1 
HETATM 9398  C  C4C . HEM E  5  .   ? 81.620  12.866  14.413  1.00 30.25  ? 337  HEM C C4C 1 
HETATM 9399  C  CMC . HEM E  5  .   ? 80.963  14.929  11.327  1.00 25.63  ? 337  HEM C CMC 1 
HETATM 9400  C  CAC . HEM E  5  .   ? 83.606  13.911  13.146  1.00 31.97  ? 337  HEM C CAC 1 
HETATM 9401  C  CBC . HEM E  5  .   ? 83.954  15.376  12.937  1.00 30.02  ? 337  HEM C CBC 1 
HETATM 9402  C  C1D . HEM E  5  .   ? 81.909  11.562  16.511  1.00 30.92  ? 337  HEM C C1D 1 
HETATM 9403  C  C2D . HEM E  5  .   ? 82.666  11.156  17.690  1.00 32.65  ? 337  HEM C C2D 1 
HETATM 9404  C  C3D . HEM E  5  .   ? 81.822  10.445  18.476  1.00 31.57  ? 337  HEM C C3D 1 
HETATM 9405  C  C4D . HEM E  5  .   ? 80.574  10.349  17.759  1.00 32.17  ? 337  HEM C C4D 1 
HETATM 9406  C  CMD . HEM E  5  .   ? 84.115  11.474  18.079  1.00 29.72  ? 337  HEM C CMD 1 
HETATM 9407  C  CAD . HEM E  5  .   ? 82.152  9.922   19.873  1.00 27.83  ? 337  HEM C CAD 1 
HETATM 9408  C  CBD . HEM E  5  .   ? 81.630  10.942  20.871  1.00 30.65  ? 337  HEM C CBD 1 
HETATM 9409  C  CGD . HEM E  5  .   ? 82.060  10.674  22.296  1.00 32.78  ? 337  HEM C CGD 1 
HETATM 9410  O  O1D . HEM E  5  .   ? 81.342  11.115  23.223  1.00 31.96  ? 337  HEM C O1D 1 
HETATM 9411  O  O2D . HEM E  5  .   ? 83.109  10.026  22.505  1.00 31.00  ? 337  HEM C O2D 1 
HETATM 9412  N  NA  . HEM E  5  .   ? 77.912  10.255  16.349  1.00 33.48  ? 337  HEM C NA  1 
HETATM 9413  N  NB  . HEM E  5  .   ? 77.575  11.900  14.050  1.00 29.40  ? 337  HEM C NB  1 
HETATM 9414  N  NC  . HEM E  5  .   ? 80.267  12.677  14.235  1.00 29.03  ? 337  HEM C NC  1 
HETATM 9415  N  ND  . HEM E  5  .   ? 80.608  11.126  16.620  1.00 31.39  ? 337  HEM C ND  1 
HETATM 9416  FE FE  . HEM E  5  .   ? 79.073  11.513  15.293  1.00 35.20  ? 337  HEM C FE  1 
HETATM 9417  C  CHA . HEM F  5  .   ? 91.920  18.599  13.025  1.00 36.44  ? 338  HEM C CHA 1 
HETATM 9418  C  CHB . HEM F  5  .   ? 87.443  18.061  14.759  1.00 30.23  ? 338  HEM C CHB 1 
HETATM 9419  C  CHC . HEM F  5  .   ? 87.904  21.988  17.570  1.00 30.11  ? 338  HEM C CHC 1 
HETATM 9420  C  CHD . HEM F  5  .   ? 92.154  22.843  15.408  1.00 31.36  ? 338  HEM C CHD 1 
HETATM 9421  C  C1A . HEM F  5  .   ? 90.657  18.086  13.251  1.00 30.95  ? 338  HEM C C1A 1 
HETATM 9422  C  C2A . HEM F  5  .   ? 90.103  16.948  12.600  1.00 31.44  ? 338  HEM C C2A 1 
HETATM 9423  C  C3A . HEM F  5  .   ? 88.801  16.891  12.961  1.00 32.75  ? 338  HEM C C3A 1 
HETATM 9424  C  C4A . HEM F  5  .   ? 88.616  17.863  14.023  1.00 30.57  ? 338  HEM C C4A 1 
HETATM 9425  C  CMA . HEM F  5  .   ? 87.745  16.004  12.253  1.00 29.39  ? 338  HEM C CMA 1 
HETATM 9426  C  CAA . HEM F  5  .   ? 90.824  16.042  11.643  1.00 32.56  ? 338  HEM C CAA 1 
HETATM 9427  C  CBA . HEM F  5  .   ? 90.790  16.728  10.311  1.00 34.71  ? 338  HEM C CBA 1 
HETATM 9428  C  CGA . HEM F  5  .   ? 91.354  15.859  9.219   1.00 37.46  ? 338  HEM C CGA 1 
HETATM 9429  O  O1A . HEM F  5  .   ? 90.584  15.465  8.329   1.00 34.69  ? 338  HEM C O1A 1 
HETATM 9430  O  O2A . HEM F  5  .   ? 92.554  15.527  9.266   1.00 38.08  ? 338  HEM C O2A 1 
HETATM 9431  C  C1B . HEM F  5  .   ? 87.158  19.092  15.657  1.00 28.61  ? 338  HEM C C1B 1 
HETATM 9432  C  C2B . HEM F  5  .   ? 85.971  19.177  16.485  1.00 32.53  ? 338  HEM C C2B 1 
HETATM 9433  C  C3B . HEM F  5  .   ? 86.115  20.253  17.295  1.00 29.19  ? 338  HEM C C3B 1 
HETATM 9434  C  C4B . HEM F  5  .   ? 87.398  20.830  16.993  1.00 29.58  ? 338  HEM C C4B 1 
HETATM 9435  C  CMB . HEM F  5  .   ? 84.790  18.219  16.504  1.00 30.84  ? 338  HEM C CMB 1 
HETATM 9436  C  CAB . HEM F  5  .   ? 85.199  20.914  18.300  1.00 26.08  ? 338  HEM C CAB 1 
HETATM 9437  C  CBB . HEM F  5  .   ? 84.715  19.963  19.392  1.00 22.15  ? 338  HEM C CBB 1 
HETATM 9438  C  C1C . HEM F  5  .   ? 89.085  22.608  17.173  1.00 27.83  ? 338  HEM C C1C 1 
HETATM 9439  C  C2C . HEM F  5  .   ? 89.569  23.871  17.663  1.00 21.31  ? 338  HEM C C2C 1 
HETATM 9440  C  C3C . HEM F  5  .   ? 90.704  24.143  16.994  1.00 24.86  ? 338  HEM C C3C 1 
HETATM 9441  C  C4C . HEM F  5  .   ? 90.973  23.029  16.121  1.00 27.73  ? 338  HEM C C4C 1 
HETATM 9442  C  CMC . HEM F  5  .   ? 88.950  24.695  18.711  1.00 18.67  ? 338  HEM C CMC 1 
HETATM 9443  C  CAC . HEM F  5  .   ? 91.688  25.248  16.923  1.00 24.13  ? 338  HEM C CAC 1 
HETATM 9444  C  CBC . HEM F  5  .   ? 92.217  25.664  18.274  1.00 15.42  ? 338  HEM C CBC 1 
HETATM 9445  C  C1D . HEM F  5  .   ? 92.490  21.727  14.632  1.00 32.77  ? 338  HEM C C1D 1 
HETATM 9446  C  C2D . HEM F  5  .   ? 93.796  21.494  14.050  1.00 34.42  ? 338  HEM C C2D 1 
HETATM 9447  C  C3D . HEM F  5  .   ? 93.758  20.281  13.440  1.00 33.49  ? 338  HEM C C3D 1 
HETATM 9448  C  C4D . HEM F  5  .   ? 92.411  19.785  13.582  1.00 34.73  ? 338  HEM C C4D 1 
HETATM 9449  C  CMD . HEM F  5  .   ? 95.020  22.403  14.187  1.00 30.99  ? 338  HEM C CMD 1 
HETATM 9450  C  CAD . HEM F  5  .   ? 94.980  19.578  12.833  1.00 33.58  ? 338  HEM C CAD 1 
HETATM 9451  C  CBD . HEM F  5  .   ? 95.159  19.588  11.342  1.00 35.55  ? 338  HEM C CBD 1 
HETATM 9452  C  CGD . HEM F  5  .   ? 94.284  18.573  10.667  1.00 42.97  ? 338  HEM C CGD 1 
HETATM 9453  O  O1D . HEM F  5  .   ? 94.417  17.366  10.976  1.00 44.39  ? 338  HEM C O1D 1 
HETATM 9454  O  O2D . HEM F  5  .   ? 93.408  18.995  9.884   1.00 47.02  ? 338  HEM C O2D 1 
HETATM 9455  N  NA  . HEM F  5  .   ? 89.724  18.660  14.082  1.00 27.87  ? 338  HEM C NA  1 
HETATM 9456  N  NB  . HEM F  5  .   ? 88.003  20.132  15.962  1.00 28.37  ? 338  HEM C NB  1 
HETATM 9457  N  NC  . HEM F  5  .   ? 89.925  22.133  16.180  1.00 30.70  ? 338  HEM C NC  1 
HETATM 9458  N  ND  . HEM F  5  .   ? 91.687  20.627  14.403  1.00 30.85  ? 338  HEM C ND  1 
HETATM 9459  FE FE  . HEM F  5  .   ? 89.821  20.355  15.100  1.00 32.50  ? 338  HEM C FE  1 
HETATM 9460  C  CHA . HEM G  5  .   ? 106.429 41.228  25.147  1.00 19.96  ? 339  HEM C CHA 1 
HETATM 9461  C  CHB . HEM G  5  .   ? 107.496 44.296  21.565  1.00 13.35  ? 339  HEM C CHB 1 
HETATM 9462  C  CHC . HEM G  5  .   ? 102.998 43.920  19.837  1.00 20.25  ? 339  HEM C CHC 1 
HETATM 9463  C  CHD . HEM G  5  .   ? 101.788 41.381  23.791  1.00 22.11  ? 339  HEM C CHD 1 
HETATM 9464  C  C1A . HEM G  5  .   ? 107.110 42.074  24.298  1.00 18.94  ? 339  HEM C C1A 1 
HETATM 9465  C  C2A . HEM G  5  .   ? 108.503 42.418  24.421  1.00 12.74  ? 339  HEM C C2A 1 
HETATM 9466  C  C3A . HEM G  5  .   ? 108.769 43.330  23.469  1.00 11.94  ? 339  HEM C C3A 1 
HETATM 9467  C  C4A . HEM G  5  .   ? 107.573 43.503  22.696  1.00 13.79  ? 339  HEM C C4A 1 
HETATM 9468  C  CMA . HEM G  5  .   ? 110.043 44.081  23.185  1.00 18.50  ? 339  HEM C CMA 1 
HETATM 9469  C  CAA . HEM G  5  .   ? 109.476 41.926  25.449  1.00 15.32  ? 339  HEM C CAA 1 
HETATM 9470  C  CBA . HEM G  5  .   ? 109.265 42.555  26.823  1.00 10.81  ? 339  HEM C CBA 1 
HETATM 9471  C  CGA . HEM G  5  .   ? 110.344 42.166  27.797  1.00 14.84  ? 339  HEM C CGA 1 
HETATM 9472  O  O1A . HEM G  5  .   ? 111.483 41.895  27.360  1.00 18.42  ? 339  HEM C O1A 1 
HETATM 9473  O  O2A . HEM G  5  .   ? 110.067 42.143  29.012  1.00 15.50  ? 339  HEM C O2A 1 
HETATM 9474  C  C1B . HEM G  5  .   ? 106.375 44.492  20.788  1.00 15.41  ? 339  HEM C C1B 1 
HETATM 9475  C  C2B . HEM G  5  .   ? 106.356 45.229  19.544  1.00 11.29  ? 339  HEM C C2B 1 
HETATM 9476  C  C3B . HEM G  5  .   ? 105.118 45.047  18.996  1.00 15.02  ? 339  HEM C C3B 1 
HETATM 9477  C  C4B . HEM G  5  .   ? 104.358 44.228  19.937  1.00 20.82  ? 339  HEM C C4B 1 
HETATM 9478  C  CMB . HEM G  5  .   ? 107.575 45.985  19.049  1.00 6.27   ? 339  HEM C CMB 1 
HETATM 9479  C  CAB . HEM G  5  .   ? 104.414 45.554  17.749  1.00 15.78  ? 339  HEM C CAB 1 
HETATM 9480  C  CBB . HEM G  5  .   ? 105.120 45.082  16.505  1.00 14.44  ? 339  HEM C CBB 1 
HETATM 9481  C  C1C . HEM G  5  .   ? 102.253 43.274  20.835  1.00 22.01  ? 339  HEM C C1C 1 
HETATM 9482  C  C2C . HEM G  5  .   ? 100.808 43.118  20.828  1.00 20.81  ? 339  HEM C C2C 1 
HETATM 9483  C  C3C . HEM G  5  .   ? 100.466 42.557  22.000  1.00 20.36  ? 339  HEM C C3C 1 
HETATM 9484  C  C4C . HEM G  5  .   ? 101.695 42.211  22.677  1.00 24.22  ? 339  HEM C C4C 1 
HETATM 9485  C  CMC . HEM G  5  .   ? 99.863  43.528  19.695  1.00 18.70  ? 339  HEM C CMC 1 
HETATM 9486  C  CAC . HEM G  5  .   ? 99.165  42.223  22.690  1.00 21.39  ? 339  HEM C CAC 1 
HETATM 9487  C  CBC . HEM G  5  .   ? 98.107  41.549  21.789  1.00 19.12  ? 339  HEM C CBC 1 
HETATM 9488  C  C1D . HEM G  5  .   ? 102.965 41.048  24.456  1.00 22.67  ? 339  HEM C C1D 1 
HETATM 9489  C  C2D . HEM G  5  .   ? 103.047 40.160  25.603  1.00 20.85  ? 339  HEM C C2D 1 
HETATM 9490  C  C3D . HEM G  5  .   ? 104.348 40.131  25.995  1.00 21.99  ? 339  HEM C C3D 1 
HETATM 9491  C  C4D . HEM G  5  .   ? 105.077 40.972  25.075  1.00 23.67  ? 339  HEM C C4D 1 
HETATM 9492  C  CMD . HEM G  5  .   ? 101.887 39.384  26.212  1.00 22.15  ? 339  HEM C CMD 1 
HETATM 9493  C  CAD . HEM G  5  .   ? 104.970 39.294  27.133  1.00 20.39  ? 339  HEM C CAD 1 
HETATM 9494  C  CBD . HEM G  5  .   ? 105.648 38.013  26.626  1.00 24.75  ? 339  HEM C CBD 1 
HETATM 9495  C  CGD . HEM G  5  .   ? 105.663 36.866  27.637  1.00 27.53  ? 339  HEM C CGD 1 
HETATM 9496  O  O1D . HEM G  5  .   ? 105.686 35.705  27.199  1.00 28.98  ? 339  HEM C O1D 1 
HETATM 9497  O  O2D . HEM G  5  .   ? 105.721 37.101  28.862  1.00 34.27  ? 339  HEM C O2D 1 
HETATM 9498  N  NA  . HEM G  5  .   ? 106.540 42.774  23.259  1.00 15.29  ? 339  HEM C NA  1 
HETATM 9499  N  NB  . HEM G  5  .   ? 105.140 43.924  21.044  1.00 17.21  ? 339  HEM C NB  1 
HETATM 9500  N  NC  . HEM G  5  .   ? 102.758 42.810  22.035  1.00 21.43  ? 339  HEM C NC  1 
HETATM 9501  N  ND  . HEM G  5  .   ? 104.225 41.518  24.130  1.00 20.90  ? 339  HEM C ND  1 
HETATM 9502  FE FE  . HEM G  5  .   ? 104.648 42.782  22.620  1.00 20.14  ? 339  HEM C FE  1 
HETATM 9503  C  CHA . HEM H  5  .   ? 90.764  37.131  23.011  1.00 27.54  ? 340  HEM C CHA 1 
HETATM 9504  C  CHB . HEM H  5  .   ? 95.460  37.498  21.939  1.00 24.97  ? 340  HEM C CHB 1 
HETATM 9505  C  CHC . HEM H  5  .   ? 95.526  32.875  20.506  1.00 23.65  ? 340  HEM C CHC 1 
HETATM 9506  C  CHD . HEM H  5  .   ? 90.804  32.589  21.283  1.00 21.54  ? 340  HEM C CHD 1 
HETATM 9507  C  C1A . HEM H  5  .   ? 92.050  37.644  22.851  1.00 26.68  ? 340  HEM C C1A 1 
HETATM 9508  C  C2A . HEM H  5  .   ? 92.455  38.991  23.180  1.00 23.47  ? 340  HEM C C2A 1 
HETATM 9509  C  C3A . HEM H  5  .   ? 93.748  39.114  22.847  1.00 22.31  ? 340  HEM C C3A 1 
HETATM 9510  C  C4A . HEM H  5  .   ? 94.167  37.827  22.338  1.00 23.41  ? 340  HEM C C4A 1 
HETATM 9511  C  CMA . HEM H  5  .   ? 94.552  40.397  23.015  1.00 19.41  ? 340  HEM C CMA 1 
HETATM 9512  C  CAA . HEM H  5  .   ? 91.593  40.010  23.773  1.00 20.45  ? 340  HEM C CAA 1 
HETATM 9513  C  CBA . HEM H  5  .   ? 91.218  41.148  22.897  1.00 18.68  ? 340  HEM C CBA 1 
HETATM 9514  C  CGA . HEM H  5  .   ? 90.354  42.153  23.628  1.00 26.19  ? 340  HEM C CGA 1 
HETATM 9515  O  O1A . HEM H  5  .   ? 90.189  42.034  24.864  1.00 31.77  ? 340  HEM C O1A 1 
HETATM 9516  O  O2A . HEM H  5  .   ? 89.871  43.102  22.980  1.00 26.18  ? 340  HEM C O2A 1 
HETATM 9517  C  C1B . HEM H  5  .   ? 95.882  36.258  21.456  1.00 24.17  ? 340  HEM C C1B 1 
HETATM 9518  C  C2B . HEM H  5  .   ? 97.243  35.960  21.032  1.00 26.00  ? 340  HEM C C2B 1 
HETATM 9519  C  C3B . HEM H  5  .   ? 97.279  34.650  20.712  1.00 22.47  ? 340  HEM C C3B 1 
HETATM 9520  C  C4B . HEM H  5  .   ? 95.921  34.155  20.837  1.00 22.71  ? 340  HEM C C4B 1 
HETATM 9521  C  CMB . HEM H  5  .   ? 98.413  36.936  20.957  1.00 24.60  ? 340  HEM C CMB 1 
HETATM 9522  C  CAB . HEM H  5  .   ? 98.419  33.682  20.298  1.00 19.37  ? 340  HEM C CAB 1 
HETATM 9523  C  CBB . HEM H  5  .   ? 99.550  33.599  21.327  1.00 16.06  ? 340  HEM C CBB 1 
HETATM 9524  C  C1C . HEM H  5  .   ? 94.243  32.380  20.555  1.00 24.99  ? 340  HEM C C1C 1 
HETATM 9525  C  C2C . HEM H  5  .   ? 93.820  31.115  20.008  1.00 19.56  ? 340  HEM C C2C 1 
HETATM 9526  C  C3C . HEM H  5  .   ? 92.479  31.073  20.146  1.00 20.84  ? 340  HEM C C3C 1 
HETATM 9527  C  C4C . HEM H  5  .   ? 92.087  32.278  20.854  1.00 23.99  ? 340  HEM C C4C 1 
HETATM 9528  C  CMC . HEM H  5  .   ? 94.740  30.055  19.373  1.00 10.82  ? 340  HEM C CMC 1 
HETATM 9529  C  CAC . HEM H  5  .   ? 91.402  30.056  19.765  1.00 23.80  ? 340  HEM C CAC 1 
HETATM 9530  C  CBC . HEM H  5  .   ? 91.533  28.660  20.399  1.00 17.32  ? 340  HEM C CBC 1 
HETATM 9531  C  C1D . HEM H  5  .   ? 90.394  33.784  21.857  1.00 25.20  ? 340  HEM C C1D 1 
HETATM 9532  C  C2D . HEM H  5  .   ? 89.034  34.086  22.230  1.00 24.96  ? 340  HEM C C2D 1 
HETATM 9533  C  C3D . HEM H  5  .   ? 89.013  35.368  22.664  1.00 27.73  ? 340  HEM C C3D 1 
HETATM 9534  C  C4D . HEM H  5  .   ? 90.371  35.849  22.645  1.00 24.75  ? 340  HEM C C4D 1 
HETATM 9535  C  CMD . HEM H  5  .   ? 87.866  33.154  22.056  1.00 25.40  ? 340  HEM C CMD 1 
HETATM 9536  C  CAD . HEM H  5  .   ? 87.814  36.176  22.910  1.00 28.59  ? 340  HEM C CAD 1 
HETATM 9537  C  CBD . HEM H  5  .   ? 87.656  36.754  24.278  1.00 36.64  ? 340  HEM C CBD 1 
HETATM 9538  C  CGD . HEM H  5  .   ? 86.580  37.820  24.315  1.00 45.09  ? 340  HEM C CGD 1 
HETATM 9539  O  O1D . HEM H  5  .   ? 86.557  38.611  25.284  1.00 53.45  ? 340  HEM C O1D 1 
HETATM 9540  O  O2D . HEM H  5  .   ? 85.761  37.881  23.367  1.00 48.29  ? 340  HEM C O2D 1 
HETATM 9541  N  NA  . HEM H  5  .   ? 93.110  36.944  22.314  1.00 23.35  ? 340  HEM C NA  1 
HETATM 9542  N  NB  . HEM H  5  .   ? 95.076  35.149  21.284  1.00 20.38  ? 340  HEM C NB  1 
HETATM 9543  N  NC  . HEM H  5  .   ? 93.160  33.121  20.980  1.00 25.02  ? 340  HEM C NC  1 
HETATM 9544  N  ND  . HEM H  5  .   ? 91.195  34.888  22.090  1.00 23.62  ? 340  HEM C ND  1 
HETATM 9545  FE FE  . HEM H  5  .   ? 93.100  35.059  21.641  1.00 19.24  ? 340  HEM C FE  1 
HETATM 9546  MG MG  . BCB I  6  .   ? 111.993 58.805  12.279  1.00 13.77  ? 302  BCB L MG  1 
HETATM 9547  C  CHA . BCB I  6  .   ? 110.039 61.442  11.160  1.00 13.23  ? 302  BCB L CHA 1 
HETATM 9548  C  CHB . BCB I  6  .   ? 114.821 60.379  11.133  1.00 14.71  ? 302  BCB L CHB 1 
HETATM 9549  C  CHC . BCB I  6  .   ? 113.845 56.181  13.387  1.00 13.36  ? 302  BCB L CHC 1 
HETATM 9550  C  CHD . BCB I  6  .   ? 109.245 57.673  14.034  1.00 12.57  ? 302  BCB L CHD 1 
HETATM 9551  N  NA  . BCB I  6  .   ? 112.367 60.651  11.297  1.00 14.12  ? 302  BCB L NA  1 
HETATM 9552  C  C1A . BCB I  6  .   ? 111.403 61.575  10.866  1.00 11.67  ? 302  BCB L C1A 1 
HETATM 9553  C  C2A . BCB I  6  .   ? 112.108 62.688  10.100  1.00 10.69  ? 302  BCB L C2A 1 
HETATM 9554  C  C3A . BCB I  6  .   ? 113.566 62.506  10.457  1.00 11.28  ? 302  BCB L C3A 1 
HETATM 9555  C  C4A . BCB I  6  .   ? 113.647 61.089  10.961  1.00 13.00  ? 302  BCB L C4A 1 
HETATM 9556  C  CMA . BCB I  6  .   ? 114.485 62.621  9.264   1.00 11.25  ? 302  BCB L CMA 1 
HETATM 9557  C  CAA . BCB I  6  .   ? 111.689 64.141  10.358  1.00 3.16   ? 302  BCB L CAA 1 
HETATM 9558  C  CBA . BCB I  6  .   ? 111.623 64.535  11.797  1.00 11.89  ? 302  BCB L CBA 1 
HETATM 9559  C  CGA . BCB I  6  .   ? 110.683 65.700  12.025  1.00 18.74  ? 302  BCB L CGA 1 
HETATM 9560  O  O1A . BCB I  6  .   ? 109.538 65.711  11.573  1.00 22.35  ? 302  BCB L O1A 1 
HETATM 9561  O  O2A . BCB I  6  .   ? 111.072 66.806  12.646  1.00 20.27  ? 302  BCB L O2A 1 
HETATM 9562  N  NB  . BCB I  6  .   ? 113.944 58.364  12.260  1.00 11.19  ? 302  BCB L NB  1 
HETATM 9563  C  C1B . BCB I  6  .   ? 114.954 59.123  11.710  1.00 12.94  ? 302  BCB L C1B 1 
HETATM 9564  C  C2B . BCB I  6  .   ? 116.201 58.403  11.818  1.00 12.17  ? 302  BCB L C2B 1 
HETATM 9565  C  C3B . BCB I  6  .   ? 115.937 57.224  12.436  1.00 12.91  ? 302  BCB L C3B 1 
HETATM 9566  C  C4B . BCB I  6  .   ? 114.511 57.188  12.702  1.00 15.32  ? 302  BCB L C4B 1 
HETATM 9567  C  CMB . BCB I  6  .   ? 117.543 59.026  11.335  1.00 17.43  ? 302  BCB L CMB 1 
HETATM 9568  C  CAB . BCB I  6  .   ? 116.743 56.096  12.855  1.00 14.63  ? 302  BCB L CAB 1 
HETATM 9569  O  OBB . BCB I  6  .   ? 116.326 55.007  13.241  1.00 14.83  ? 302  BCB L OBB 1 
HETATM 9570  C  CBB . BCB I  6  .   ? 118.209 56.214  12.500  1.00 12.34  ? 302  BCB L CBB 1 
HETATM 9571  N  NC  . BCB I  6  .   ? 111.611 57.231  13.546  1.00 10.25  ? 302  BCB L NC  1 
HETATM 9572  C  C1C . BCB I  6  .   ? 112.512 56.204  13.776  1.00 13.76  ? 302  BCB L C1C 1 
HETATM 9573  C  C2C . BCB I  6  .   ? 111.832 55.154  14.597  1.00 10.19  ? 302  BCB L C2C 1 
HETATM 9574  C  C3C . BCB I  6  .   ? 110.494 55.720  14.930  1.00 9.93   ? 302  BCB L C3C 1 
HETATM 9575  C  C4C . BCB I  6  .   ? 110.409 56.916  14.186  1.00 13.22  ? 302  BCB L C4C 1 
HETATM 9576  C  CMC . BCB I  6  .   ? 111.681 53.921  13.733  1.00 17.24  ? 302  BCB L CMC 1 
HETATM 9577  C  CAC . BCB I  6  .   ? 109.568 55.235  15.769  1.00 9.25   ? 302  BCB L CAC 1 
HETATM 9578  C  CBC . BCB I  6  .   ? 109.777 53.941  16.469  1.00 14.42  ? 302  BCB L CBC 1 
HETATM 9579  N  ND  . BCB I  6  .   ? 110.084 59.348  12.516  1.00 11.92  ? 302  BCB L ND  1 
HETATM 9580  C  C1D . BCB I  6  .   ? 109.070 58.802  13.255  1.00 11.57  ? 302  BCB L C1D 1 
HETATM 9581  C  C2D . BCB I  6  .   ? 107.830 59.515  13.048  1.00 9.59   ? 302  BCB L C2D 1 
HETATM 9582  C  C3D . BCB I  6  .   ? 108.130 60.500  12.173  1.00 11.65  ? 302  BCB L C3D 1 
HETATM 9583  C  C4D . BCB I  6  .   ? 109.538 60.438  11.927  1.00 10.99  ? 302  BCB L C4D 1 
HETATM 9584  C  CMD . BCB I  6  .   ? 106.517 59.223  13.696  1.00 8.18   ? 302  BCB L CMD 1 
HETATM 9585  C  CAD . BCB I  6  .   ? 107.619 61.587  11.372  1.00 15.98  ? 302  BCB L CAD 1 
HETATM 9586  O  OBD . BCB I  6  .   ? 106.463 62.028  11.226  1.00 17.85  ? 302  BCB L OBD 1 
HETATM 9587  C  CBD . BCB I  6  .   ? 108.823 62.272  10.699  1.00 17.37  ? 302  BCB L CBD 1 
HETATM 9588  C  CGD . BCB I  6  .   ? 108.696 61.975  9.211   1.00 21.48  ? 302  BCB L CGD 1 
HETATM 9589  O  O1D . BCB I  6  .   ? 108.955 62.919  8.431   1.00 24.64  ? 302  BCB L O1D 1 
HETATM 9590  O  O2D . BCB I  6  .   ? 108.458 60.673  8.770   1.00 24.57  ? 302  BCB L O2D 1 
HETATM 9591  C  CED . BCB I  6  .   ? 108.364 60.509  7.426   1.00 24.17  ? 302  BCB L CED 1 
HETATM 9592  C  C1  . BCB I  6  .   ? 110.046 67.797  12.896  1.00 15.11  ? 302  BCB L C1  1 
HETATM 9593  C  C2  . BCB I  6  .   ? 110.673 68.941  13.398  1.00 14.12  ? 302  BCB L C2  1 
HETATM 9594  C  C3  . BCB I  6  .   ? 110.002 70.147  13.437  1.00 15.68  ? 302  BCB L C3  1 
HETATM 9595  C  C4  . BCB I  6  .   ? 108.577 70.316  12.951  1.00 11.62  ? 302  BCB L C4  1 
HETATM 9596  C  C5  . BCB I  6  .   ? 110.706 71.354  13.989  1.00 18.09  ? 302  BCB L C5  1 
HETATM 9597  C  C6  . BCB I  6  .   ? 109.942 72.642  13.885  1.00 17.04  ? 302  BCB L C6  1 
HETATM 9598  C  C7  . BCB I  6  .   ? 110.781 73.813  14.349  1.00 13.07  ? 302  BCB L C7  1 
HETATM 9599  C  C8  . BCB I  6  .   ? 109.958 75.079  14.446  1.00 11.90  ? 302  BCB L C8  1 
HETATM 9600  C  C9  . BCB I  6  .   ? 109.710 75.557  13.075  1.00 16.28  ? 302  BCB L C9  1 
HETATM 9601  C  C10 . BCB I  6  .   ? 110.588 76.146  15.315  1.00 12.45  ? 302  BCB L C10 1 
HETATM 9602  C  C11 . BCB I  6  .   ? 110.689 75.747  16.767  1.00 17.41  ? 302  BCB L C11 1 
HETATM 9603  C  C12 . BCB I  6  .   ? 111.403 76.840  17.540  1.00 15.28  ? 302  BCB L C12 1 
HETATM 9604  C  C13 . BCB I  6  .   ? 111.543 76.564  19.018  1.00 12.89  ? 302  BCB L C13 1 
HETATM 9605  C  C14 . BCB I  6  .   ? 110.164 76.272  19.554  1.00 16.69  ? 302  BCB L C14 1 
HETATM 9606  C  C15 . BCB I  6  .   ? 112.034 77.854  19.652  1.00 15.93  ? 302  BCB L C15 1 
HETATM 9607  C  C16 . BCB I  6  .   ? 113.507 77.896  19.947  1.00 18.19  ? 302  BCB L C16 1 
HETATM 9608  C  C17 . BCB I  6  .   ? 113.701 78.447  21.344  1.00 18.34  ? 302  BCB L C17 1 
HETATM 9609  C  C18 . BCB I  6  .   ? 115.110 78.944  21.626  1.00 18.40  ? 302  BCB L C18 1 
HETATM 9610  C  C19 . BCB I  6  .   ? 115.207 80.397  21.288  1.00 14.79  ? 302  BCB L C19 1 
HETATM 9611  C  C20 . BCB I  6  .   ? 116.113 78.151  20.822  1.00 17.40  ? 302  BCB L C20 1 
HETATM 9612  MG MG  . BCB J  6  .   ? 111.991 67.249  18.865  1.00 16.53  ? 304  BCB L MG  1 
HETATM 9613  C  CHA . BCB J  6  .   ? 115.047 66.147  20.202  1.00 16.20  ? 304  BCB L CHA 1 
HETATM 9614  C  CHB . BCB J  6  .   ? 112.664 70.373  20.116  1.00 12.13  ? 304  BCB L CHB 1 
HETATM 9615  C  CHC . BCB J  6  .   ? 109.430 68.483  16.987  1.00 8.69   ? 304  BCB L CHC 1 
HETATM 9616  C  CHD . BCB J  6  .   ? 111.814 64.263  17.175  1.00 13.69  ? 304  BCB L CHD 1 
HETATM 9617  N  NA  . BCB J  6  .   ? 113.552 68.083  20.113  1.00 9.07   ? 304  BCB L NA  1 
HETATM 9618  C  C1A . BCB J  6  .   ? 114.740 67.463  20.506  1.00 14.26  ? 304  BCB L C1A 1 
HETATM 9619  C  C2A . BCB J  6  .   ? 115.585 68.442  21.278  1.00 13.96  ? 304  BCB L C2A 1 
HETATM 9620  C  C3A . BCB J  6  .   ? 114.647 69.586  21.545  1.00 10.76  ? 304  BCB L C3A 1 
HETATM 9621  C  C4A . BCB J  6  .   ? 113.540 69.394  20.543  1.00 12.56  ? 304  BCB L C4A 1 
HETATM 9622  C  CMA . BCB J  6  .   ? 114.018 69.456  22.926  1.00 12.22  ? 304  BCB L CMA 1 
HETATM 9623  C  CAA . BCB J  6  .   ? 116.780 68.932  20.444  1.00 10.89  ? 304  BCB L CAA 1 
HETATM 9624  C  CBA . BCB J  6  .   ? 116.387 69.373  19.048  1.00 12.52  ? 304  BCB L CBA 1 
HETATM 9625  C  CGA . BCB J  6  .   ? 117.444 70.157  18.337  1.00 15.54  ? 304  BCB L CGA 1 
HETATM 9626  O  O1A . BCB J  6  .   ? 118.554 70.309  18.825  1.00 16.67  ? 304  BCB L O1A 1 
HETATM 9627  O  O2A . BCB J  6  .   ? 117.187 70.686  17.071  1.00 20.16  ? 304  BCB L O2A 1 
HETATM 9628  N  NB  . BCB J  6  .   ? 111.190 69.056  18.624  1.00 15.20  ? 304  BCB L NB  1 
HETATM 9629  C  C1B . BCB J  6  .   ? 111.610 70.221  19.230  1.00 18.56  ? 304  BCB L C1B 1 
HETATM 9630  C  C2B . BCB J  6  .   ? 110.767 71.310  18.790  1.00 23.52  ? 304  BCB L C2B 1 
HETATM 9631  C  C3B . BCB J  6  .   ? 109.816 70.790  17.958  1.00 19.33  ? 304  BCB L C3B 1 
HETATM 9632  C  C4B . BCB J  6  .   ? 110.114 69.371  17.811  1.00 17.08  ? 304  BCB L C4B 1 
HETATM 9633  C  CMB . BCB J  6  .   ? 111.072 72.729  19.265  1.00 20.41  ? 304  BCB L CMB 1 
HETATM 9634  C  CAB . BCB J  6  .   ? 108.691 71.367  17.221  1.00 21.63  ? 304  BCB L CAB 1 
HETATM 9635  O  OBB . BCB J  6  .   ? 108.023 70.793  16.355  1.00 21.04  ? 304  BCB L OBB 1 
HETATM 9636  C  CBB . BCB J  6  .   ? 108.414 72.835  17.485  1.00 16.00  ? 304  BCB L CBB 1 
HETATM 9637  N  NC  . BCB J  6  .   ? 110.795 66.468  17.382  1.00 14.25  ? 304  BCB L NC  1 
HETATM 9638  C  C1C . BCB J  6  .   ? 109.728 67.143  16.816  1.00 15.33  ? 304  BCB L C1C 1 
HETATM 9639  C  C2C . BCB J  6  .   ? 108.899 66.142  16.066  1.00 16.12  ? 304  BCB L C2C 1 
HETATM 9640  C  C3C . BCB J  6  .   ? 109.729 64.899  16.031  1.00 16.10  ? 304  BCB L C3C 1 
HETATM 9641  C  C4C . BCB J  6  .   ? 110.839 65.182  16.841  1.00 15.22  ? 304  BCB L C4C 1 
HETATM 9642  C  CMC . BCB J  6  .   ? 107.617 65.872  16.821  1.00 14.71  ? 304  BCB L CMC 1 
HETATM 9643  C  CAC . BCB J  6  .   ? 109.572 63.810  15.221  1.00 18.17  ? 304  BCB L CAC 1 
HETATM 9644  C  CBC . BCB J  6  .   ? 108.450 63.753  14.196  1.00 13.76  ? 304  BCB L CBC 1 
HETATM 9645  N  ND  . BCB J  6  .   ? 113.096 65.596  18.735  1.00 10.50  ? 304  BCB L ND  1 
HETATM 9646  C  C1D . BCB J  6  .   ? 112.860 64.420  18.072  1.00 16.13  ? 304  BCB L C1D 1 
HETATM 9647  C  C2D . BCB J  6  .   ? 113.751 63.369  18.552  1.00 13.23  ? 304  BCB L C2D 1 
HETATM 9648  C  C3D . BCB J  6  .   ? 114.640 64.002  19.338  1.00 14.28  ? 304  BCB L C3D 1 
HETATM 9649  C  C4D . BCB J  6  .   ? 114.245 65.369  19.427  1.00 13.98  ? 304  BCB L C4D 1 
HETATM 9650  C  CMD . BCB J  6  .   ? 113.631 61.898  18.331  1.00 10.72  ? 304  BCB L CMD 1 
HETATM 9651  C  CAD . BCB J  6  .   ? 115.750 63.832  20.222  1.00 17.35  ? 304  BCB L CAD 1 
HETATM 9652  O  OBD . BCB J  6  .   ? 116.195 62.816  20.747  1.00 18.86  ? 304  BCB L OBD 1 
HETATM 9653  C  CBD . BCB J  6  .   ? 116.156 65.223  20.726  1.00 17.84  ? 304  BCB L CBD 1 
HETATM 9654  C  CGD . BCB J  6  .   ? 115.996 65.189  22.262  1.00 19.50  ? 304  BCB L CGD 1 
HETATM 9655  O  O1D . BCB J  6  .   ? 117.069 65.117  22.907  1.00 15.57  ? 304  BCB L O1D 1 
HETATM 9656  O  O2D . BCB J  6  .   ? 114.773 65.290  22.905  1.00 23.39  ? 304  BCB L O2D 1 
HETATM 9657  C  CED . BCB J  6  .   ? 114.769 65.244  24.273  1.00 22.37  ? 304  BCB L CED 1 
HETATM 9658  C  C1  . BCB J  6  .   ? 118.293 71.367  16.422  1.00 22.02  ? 304  BCB L C1  1 
HETATM 9659  C  C2  . BCB J  6  .   ? 118.224 72.715  16.785  1.00 20.53  ? 304  BCB L C2  1 
HETATM 9660  C  C3  . BCB J  6  .   ? 119.285 73.401  17.307  1.00 15.39  ? 304  BCB L C3  1 
HETATM 9661  C  C4  . BCB J  6  .   ? 120.605 72.738  17.514  1.00 17.88  ? 304  BCB L C4  1 
HETATM 9662  C  C5  . BCB J  6  .   ? 119.144 74.806  17.722  1.00 19.03  ? 304  BCB L C5  1 
HETATM 9663  C  C6  . BCB J  6  .   ? 118.807 74.844  19.196  1.00 24.07  ? 304  BCB L C6  1 
HETATM 9664  C  C7  . BCB J  6  .   ? 117.349 74.531  19.456  1.00 23.42  ? 304  BCB L C7  1 
HETATM 9665  C  C8  . BCB J  6  .   ? 117.022 74.342  20.938  1.00 23.55  ? 304  BCB L C8  1 
HETATM 9666  C  C9  . BCB J  6  .   ? 117.704 73.085  21.518  1.00 17.85  ? 304  BCB L C9  1 
HETATM 9667  C  C10 . BCB J  6  .   ? 115.516 74.217  21.079  1.00 18.37  ? 304  BCB L C10 1 
HETATM 9668  C  C11 . BCB J  6  .   ? 115.086 73.756  22.438  1.00 18.32  ? 304  BCB L C11 1 
HETATM 9669  C  C12 . BCB J  6  .   ? 113.599 73.830  22.550  1.00 18.39  ? 304  BCB L C12 1 
HETATM 9670  C  C13 . BCB J  6  .   ? 113.102 74.166  23.954  1.00 25.64  ? 304  BCB L C13 1 
HETATM 9671  C  C14 . BCB J  6  .   ? 113.168 72.968  24.862  1.00 18.93  ? 304  BCB L C14 1 
HETATM 9672  C  C15 . BCB J  6  .   ? 111.636 74.553  23.803  1.00 26.47  ? 304  BCB L C15 1 
HETATM 9673  C  C16 . BCB J  6  .   ? 111.181 75.536  24.819  1.00 29.79  ? 304  BCB L C16 1 
HETATM 9674  C  C17 . BCB J  6  .   ? 110.281 76.535  24.160  1.00 35.83  ? 304  BCB L C17 1 
HETATM 9675  C  C18 . BCB J  6  .   ? 109.844 77.676  25.067  1.00 39.48  ? 304  BCB L C18 1 
HETATM 9676  C  C19 . BCB J  6  .   ? 109.216 77.125  26.342  1.00 42.41  ? 304  BCB L C19 1 
HETATM 9677  C  C20 . BCB J  6  .   ? 111.035 78.595  25.371  1.00 44.58  ? 304  BCB L C20 1 
HETATM 9678  C  C1  . BPB K  7  .   ? 110.115 82.545  17.552  1.00 22.00  ? 402  BPB L C1  1 
HETATM 9679  C  C2  . BPB K  7  .   ? 109.840 81.694  18.650  1.00 21.14  ? 402  BPB L C2  1 
HETATM 9680  C  C3  . BPB K  7  .   ? 110.530 81.563  19.846  1.00 22.36  ? 402  BPB L C3  1 
HETATM 9681  C  C4  . BPB K  7  .   ? 111.830 82.257  20.272  1.00 20.33  ? 402  BPB L C4  1 
HETATM 9682  C  C5  . BPB K  7  .   ? 109.915 80.756  20.961  1.00 20.36  ? 402  BPB L C5  1 
HETATM 9683  C  C6  . BPB K  7  .   ? 108.449 80.434  20.715  1.00 15.03  ? 402  BPB L C6  1 
HETATM 9684  C  C7  . BPB K  7  .   ? 107.949 79.510  21.792  1.00 16.37  ? 402  BPB L C7  1 
HETATM 9685  C  C8  . BPB K  7  .   ? 106.526 79.036  21.567  1.00 16.36  ? 402  BPB L C8  1 
HETATM 9686  C  C9  . BPB K  7  .   ? 105.637 80.255  21.478  1.00 16.36  ? 402  BPB L C9  1 
HETATM 9687  N  NA  . BPB K  7  .   ? 114.885 77.029  14.028  1.00 20.24  ? 402  BPB L NA  1 
HETATM 9688  N  NB  . BPB K  7  .   ? 114.698 74.117  14.057  1.00 13.86  ? 402  BPB L NB  1 
HETATM 9689  N  NC  . BPB K  7  .   ? 115.016 74.102  11.005  1.00 22.61  ? 402  BPB L NC  1 
HETATM 9690  N  ND  . BPB K  7  .   ? 115.272 76.830  10.999  1.00 17.14  ? 402  BPB L ND  1 
HETATM 9691  C  C10 . BPB K  7  .   ? 106.073 78.114  22.698  1.00 18.27  ? 402  BPB L C10 1 
HETATM 9692  C  C11 . BPB K  7  .   ? 106.594 76.677  22.610  1.00 19.60  ? 402  BPB L C11 1 
HETATM 9693  C  C12 . BPB K  7  .   ? 105.965 75.930  21.461  1.00 22.05  ? 402  BPB L C12 1 
HETATM 9694  C  C13 . BPB K  7  .   ? 106.040 74.404  21.546  1.00 21.04  ? 402  BPB L C13 1 
HETATM 9695  C  C14 . BPB K  7  .   ? 105.778 73.830  20.167  1.00 26.78  ? 402  BPB L C14 1 
HETATM 9696  C  C15 . BPB K  7  .   ? 107.292 73.776  22.141  1.00 14.84  ? 402  BPB L C15 1 
HETATM 9697  C  C16 . BPB K  7  .   ? 107.360 72.260  22.042  1.00 13.21  ? 402  BPB L C16 1 
HETATM 9698  C  C17 . BPB K  7  .   ? 108.597 71.757  22.801  1.00 7.41   ? 402  BPB L C17 1 
HETATM 9699  C  C18 . BPB K  7  .   ? 108.786 70.249  22.839  1.00 8.67   ? 402  BPB L C18 1 
HETATM 9700  C  C19 . BPB K  7  .   ? 110.134 69.909  23.434  1.00 7.71   ? 402  BPB L C19 1 
HETATM 9701  C  C1A . BPB K  7  .   ? 114.874 78.398  13.731  1.00 17.79  ? 402  BPB L C1A 1 
HETATM 9702  O  O1A . BPB K  7  .   ? 110.817 80.777  15.885  1.00 13.44  ? 402  BPB L O1A 1 
HETATM 9703  C  C1B . BPB K  7  .   ? 114.625 74.293  15.412  1.00 16.30  ? 402  BPB L C1B 1 
HETATM 9704  C  C1C . BPB K  7  .   ? 114.791 72.763  11.284  1.00 17.17  ? 402  BPB L C1C 1 
HETATM 9705  C  C1D . BPB K  7  .   ? 115.555 76.718  9.687   1.00 17.86  ? 402  BPB L C1D 1 
HETATM 9706  O  O1D . BPB K  7  .   ? 116.199 81.994  13.422  1.00 18.13  ? 402  BPB L O1D 1 
HETATM 9707  C  C20 . BPB K  7  .   ? 108.567 69.571  21.491  1.00 2.00   ? 402  BPB L C20 1 
HETATM 9708  C  C2A . BPB K  7  .   ? 114.686 79.172  15.008  1.00 15.34  ? 402  BPB L C2A 1 
HETATM 9709  O  O2A . BPB K  7  .   ? 111.509 82.383  17.195  1.00 22.83  ? 402  BPB L O2A 1 
HETATM 9710  C  C2B . BPB K  7  .   ? 114.313 73.024  16.057  1.00 19.51  ? 402  BPB L C2B 1 
HETATM 9711  C  C2C . BPB K  7  .   ? 114.874 72.011  10.003  1.00 20.29  ? 402  BPB L C2C 1 
HETATM 9712  C  C2D . BPB K  7  .   ? 115.862 78.003  9.085   1.00 20.83  ? 402  BPB L C2D 1 
HETATM 9713  O  O2D . BPB K  7  .   ? 117.675 80.315  12.829  1.00 17.59  ? 402  BPB L O2D 1 
HETATM 9714  C  C3A . BPB K  7  .   ? 114.867 78.150  16.103  1.00 19.41  ? 402  BPB L C3A 1 
HETATM 9715  C  C3B . BPB K  7  .   ? 114.298 72.059  15.082  1.00 19.12  ? 402  BPB L C3B 1 
HETATM 9716  C  C3C . BPB K  7  .   ? 115.159 73.044  8.943   1.00 17.19  ? 402  BPB L C3C 1 
HETATM 9717  C  C3D . BPB K  7  .   ? 115.702 78.902  10.106  1.00 17.20  ? 402  BPB L C3D 1 
HETATM 9718  C  C4A . BPB K  7  .   ? 114.800 76.803  15.400  1.00 18.02  ? 402  BPB L C4A 1 
HETATM 9719  C  C4B . BPB K  7  .   ? 114.520 72.758  13.809  1.00 17.09  ? 402  BPB L C4B 1 
HETATM 9720  C  C4C . BPB K  7  .   ? 115.261 74.252  9.632   1.00 22.43  ? 402  BPB L C4C 1 
HETATM 9721  C  C4D . BPB K  7  .   ? 115.309 78.158  11.270  1.00 16.70  ? 402  BPB L C4D 1 
HETATM 9722  C  CAA . BPB K  7  .   ? 113.299 79.765  15.103  1.00 8.04   ? 402  BPB L CAA 1 
HETATM 9723  C  CAB . BPB K  7  .   ? 114.082 70.598  15.132  1.00 17.08  ? 402  BPB L CAB 1 
HETATM 9724  C  CAC . BPB K  7  .   ? 115.060 72.912  7.597   1.00 17.60  ? 402  BPB L CAC 1 
HETATM 9725  C  CAD . BPB K  7  .   ? 115.739 80.295  10.490  1.00 17.52  ? 402  BPB L CAD 1 
HETATM 9726  C  CBA . BPB K  7  .   ? 113.193 80.802  16.191  1.00 15.75  ? 402  BPB L CBA 1 
HETATM 9727  C  CBB . BPB K  7  .   ? 114.745 69.794  14.050  1.00 5.89   ? 402  BPB L CBB 1 
HETATM 9728  O  OBB . BPB K  7  .   ? 113.640 69.969  16.108  1.00 16.84  ? 402  BPB L OBB 1 
HETATM 9729  C  CBC . BPB K  7  .   ? 114.684 71.546  6.935   1.00 15.34  ? 402  BPB L CBC 1 
HETATM 9730  C  CBD . BPB K  7  .   ? 115.261 80.399  11.956  1.00 17.56  ? 402  BPB L CBD 1 
HETATM 9731  O  OBD . BPB K  7  .   ? 115.868 81.310  9.807   1.00 19.69  ? 402  BPB L OBD 1 
HETATM 9732  C  CED . BPB K  7  .   ? 118.482 80.549  13.942  1.00 14.83  ? 402  BPB L CED 1 
HETATM 9733  C  CGA . BPB K  7  .   ? 111.788 81.327  16.386  1.00 17.60  ? 402  BPB L CGA 1 
HETATM 9734  C  CGD . BPB K  7  .   ? 116.442 80.956  12.762  1.00 17.99  ? 402  BPB L CGD 1 
HETATM 9735  C  CHA . BPB K  7  .   ? 115.093 78.936  12.415  1.00 18.16  ? 402  BPB L CHA 1 
HETATM 9736  C  CHB . BPB K  7  .   ? 114.680 75.545  16.038  1.00 17.26  ? 402  BPB L CHB 1 
HETATM 9737  C  CHC . BPB K  7  .   ? 114.567 72.178  12.533  1.00 16.87  ? 402  BPB L CHC 1 
HETATM 9738  C  CHD . BPB K  7  .   ? 115.540 75.490  9.041   1.00 19.53  ? 402  BPB L CHD 1 
HETATM 9739  C  CMA . BPB K  7  .   ? 116.232 78.336  16.788  1.00 14.94  ? 402  BPB L CMA 1 
HETATM 9740  C  CMB . BPB K  7  .   ? 113.923 72.773  17.515  1.00 18.31  ? 402  BPB L CMB 1 
HETATM 9741  C  CMC . BPB K  7  .   ? 116.028 71.018  10.129  1.00 18.70  ? 402  BPB L CMC 1 
HETATM 9742  C  CMD . BPB K  7  .   ? 116.223 78.218  7.590   1.00 14.61  ? 402  BPB L CMD 1 
HETATM 9743  N  N1  . ATZ L  8  .   ? 132.136 70.930  -2.679  1.00 34.24  ? 502  ATZ L N1  1 
HETATM 9744  C  C2  . ATZ L  8  .   ? 131.649 69.803  -2.203  1.00 36.10  ? 502  ATZ L C2  1 
HETATM 9745  CL CL2 . ATZ L  8  .   ? 131.214 69.875  -0.511  1.00 30.64  ? 502  ATZ L CL2 1 
HETATM 9746  N  N3  . ATZ L  8  .   ? 131.449 68.626  -2.789  1.00 33.03  ? 502  ATZ L N3  1 
HETATM 9747  C  C4  . ATZ L  8  .   ? 131.842 68.652  -4.105  1.00 35.91  ? 502  ATZ L C4  1 
HETATM 9748  N  N5  . ATZ L  8  .   ? 132.355 69.710  -4.736  1.00 35.31  ? 502  ATZ L N5  1 
HETATM 9749  C  C6  . ATZ L  8  .   ? 132.480 70.813  -3.995  1.00 33.57  ? 502  ATZ L C6  1 
HETATM 9750  N  N7  . ATZ L  8  .   ? 131.717 67.520  -4.842  1.00 34.60  ? 502  ATZ L N7  1 
HETATM 9751  C  C8  . ATZ L  8  .   ? 131.196 66.210  -4.452  1.00 33.52  ? 502  ATZ L C8  1 
HETATM 9752  C  C9  . ATZ L  8  .   ? 131.854 65.647  -3.175  1.00 26.10  ? 502  ATZ L C9  1 
HETATM 9753  C  C10 . ATZ L  8  .   ? 129.691 66.209  -4.466  1.00 33.99  ? 502  ATZ L C10 1 
HETATM 9754  N  N11 . ATZ L  8  .   ? 132.992 71.922  -4.577  1.00 32.53  ? 502  ATZ L N11 1 
HETATM 9755  C  C12 . ATZ L  8  .   ? 133.207 73.208  -3.926  1.00 24.06  ? 502  ATZ L C12 1 
HETATM 9756  C  C13 . ATZ L  8  .   ? 133.853 74.113  -4.906  1.00 21.18  ? 502  ATZ L C13 1 
HETATM 9757  N  N1  . LDA M  9  .   ? 116.737 65.744  36.050  1.00 72.03  ? 702  LDA L N1  1 
HETATM 9758  O  O1  . LDA M  9  .   ? 116.161 65.706  37.118  1.00 72.81  ? 702  LDA L O1  1 
HETATM 9759  C  CM1 . LDA M  9  .   ? 116.021 64.968  35.086  1.00 75.05  ? 702  LDA L CM1 1 
HETATM 9760  C  CM2 . LDA M  9  .   ? 116.810 67.109  35.566  1.00 73.37  ? 702  LDA L CM2 1 
HETATM 9761  C  C1  . LDA M  9  .   ? 118.073 65.176  36.183  1.00 69.30  ? 702  LDA L C1  1 
HETATM 9762  C  C2  . LDA M  9  .   ? 119.101 64.795  35.131  1.00 64.49  ? 702  LDA L C2  1 
HETATM 9763  C  C3  . LDA M  9  .   ? 120.009 63.671  35.635  1.00 62.17  ? 702  LDA L C3  1 
HETATM 9764  C  C4  . LDA M  9  .   ? 120.951 63.130  34.558  1.00 57.60  ? 702  LDA L C4  1 
HETATM 9765  C  C5  . LDA M  9  .   ? 120.242 62.190  33.593  1.00 54.89  ? 702  LDA L C5  1 
HETATM 9766  C  C6  . LDA M  9  .   ? 119.484 62.959  32.519  1.00 51.91  ? 702  LDA L C6  1 
HETATM 9767  C  C7  . LDA M  9  .   ? 118.809 62.037  31.534  1.00 48.38  ? 702  LDA L C7  1 
HETATM 9768  C  C8  . LDA M  9  .   ? 118.263 62.822  30.353  1.00 44.14  ? 702  LDA L C8  1 
HETATM 9769  C  C9  . LDA M  9  .   ? 117.691 61.874  29.316  1.00 41.45  ? 702  LDA L C9  1 
HETATM 9770  C  C10 . LDA M  9  .   ? 117.595 62.517  27.956  1.00 34.85  ? 702  LDA L C10 1 
HETATM 9771  C  C11 . LDA M  9  .   ? 117.153 61.501  26.935  1.00 34.61  ? 702  LDA L C11 1 
HETATM 9772  C  C12 . LDA M  9  .   ? 117.061 62.089  25.561  1.00 34.98  ? 702  LDA L C12 1 
HETATM 9773  N  N1  . LDA N  9  .   ? 122.642 88.171  23.577  1.00 79.62  ? 705  LDA L N1  1 
HETATM 9774  O  O1  . LDA N  9  .   ? 122.335 87.417  24.499  0.00 77.86  ? 705  LDA L O1  1 
HETATM 9775  C  CM1 . LDA N  9  .   ? 121.557 89.089  23.280  0.00 77.86  ? 705  LDA L CM1 1 
HETATM 9776  C  CM2 . LDA N  9  .   ? 123.785 88.977  23.943  0.00 77.86  ? 705  LDA L CM2 1 
HETATM 9777  C  C1  . LDA N  9  .   ? 122.949 87.399  22.379  1.00 78.46  ? 705  LDA L C1  1 
HETATM 9778  C  C2  . LDA N  9  .   ? 121.833 86.613  21.676  1.00 78.20  ? 705  LDA L C2  1 
HETATM 9779  C  C3  . LDA N  9  .   ? 121.522 85.276  22.351  1.00 74.65  ? 705  LDA L C3  1 
HETATM 9780  C  C4  . LDA N  9  .   ? 120.013 85.077  22.490  1.00 70.18  ? 705  LDA L C4  1 
HETATM 9781  C  C5  . LDA N  9  .   ? 119.594 83.628  22.275  1.00 67.62  ? 705  LDA L C5  1 
HETATM 9782  C  C6  . LDA N  9  .   ? 120.459 82.656  23.051  1.00 64.68  ? 705  LDA L C6  1 
HETATM 9783  C  C7  . LDA N  9  .   ? 119.938 81.238  22.929  1.00 62.21  ? 705  LDA L C7  1 
HETATM 9784  C  C8  . LDA N  9  .   ? 120.956 80.255  23.479  1.00 65.95  ? 705  LDA L C8  1 
HETATM 9785  C  C9  . LDA N  9  .   ? 120.302 78.954  23.928  1.00 67.70  ? 705  LDA L C9  1 
HETATM 9786  C  C10 . LDA N  9  .   ? 120.149 77.962  22.780  1.00 68.30  ? 705  LDA L C10 1 
HETATM 9787  C  C11 . LDA N  9  .   ? 119.454 76.675  23.230  1.00 69.86  ? 705  LDA L C11 1 
HETATM 9788  C  C12 . LDA N  9  .   ? 120.280 75.657  24.008  1.00 70.19  ? 705  LDA L C12 1 
HETATM 9789  FE FE  . FE2 O  10 .   ? 129.810 78.154  2.707   1.00 24.88  ? 500  FE2 M FE  1 
HETATM 9790  S  S   . SO4 P  11 .   ? 142.297 75.642  12.295  1.00 37.73  ? 802  SO4 M S   1 
HETATM 9791  O  O1  . SO4 P  11 .   ? 141.622 75.906  11.059  1.00 47.12  ? 802  SO4 M O1  1 
HETATM 9792  O  O2  . SO4 P  11 .   ? 141.369 75.002  13.172  1.00 51.44  ? 802  SO4 M O2  1 
HETATM 9793  O  O3  . SO4 P  11 .   ? 143.350 74.711  12.092  1.00 41.99  ? 802  SO4 M O3  1 
HETATM 9794  O  O4  . SO4 P  11 .   ? 142.747 76.868  12.911  1.00 47.26  ? 802  SO4 M O4  1 
HETATM 9795  S  S   . SO4 Q  11 .   ? 114.614 90.943  -6.542  1.00 90.06  ? 803  SO4 M S   1 
HETATM 9796  O  O1  . SO4 Q  11 .   ? 115.330 90.901  -5.260  1.00 90.89  ? 803  SO4 M O1  1 
HETATM 9797  O  O2  . SO4 Q  11 .   ? 113.648 89.898  -6.420  1.00 88.60  ? 803  SO4 M O2  1 
HETATM 9798  O  O3  . SO4 Q  11 .   ? 113.913 92.179  -6.777  1.00 88.17  ? 803  SO4 M O3  1 
HETATM 9799  O  O4  . SO4 Q  11 .   ? 115.451 90.744  -7.672  1.00 84.85  ? 803  SO4 M O4  1 
HETATM 9800  S  S   . SO4 R  11 .   ? 147.588 58.250  -2.459  1.00 53.93  ? 804  SO4 M S   1 
HETATM 9801  O  O1  . SO4 R  11 .   ? 148.425 57.934  -3.544  1.00 54.46  ? 804  SO4 M O1  1 
HETATM 9802  O  O2  . SO4 R  11 .   ? 147.958 59.456  -1.818  1.00 49.45  ? 804  SO4 M O2  1 
HETATM 9803  O  O3  . SO4 R  11 .   ? 146.316 58.535  -3.015  1.00 50.94  ? 804  SO4 M O3  1 
HETATM 9804  O  O4  . SO4 R  11 .   ? 147.671 57.091  -1.594  1.00 45.04  ? 804  SO4 M O4  1 
HETATM 9805  MG MG  . BCB S  6  .   ? 121.952 52.830  6.738   1.00 22.67  ? 805  BCB M MG  1 
HETATM 9806  C  CHA . BCB S  6  .   ? 119.181 53.986  4.959   1.00 24.35  ? 805  BCB M CHA 1 
HETATM 9807  C  CHB . BCB S  6  .   ? 123.595 52.347  3.757   1.00 26.42  ? 805  BCB M CHB 1 
HETATM 9808  C  CHC . BCB S  6  .   ? 124.781 52.161  8.470   1.00 24.22  ? 805  BCB M CHC 1 
HETATM 9809  C  CHD . BCB S  6  .   ? 120.364 53.831  9.660   1.00 21.18  ? 805  BCB M CHD 1 
HETATM 9810  N  NA  . BCB S  6  .   ? 121.451 53.135  4.655   1.00 27.93  ? 805  BCB M NA  1 
HETATM 9811  C  C1A . BCB S  6  .   ? 120.256 53.647  4.157   1.00 23.93  ? 805  BCB M C1A 1 
HETATM 9812  C  C2A . BCB S  6  .   ? 120.350 53.756  2.657   1.00 27.55  ? 805  BCB M C2A 1 
HETATM 9813  C  C3A . BCB S  6  .   ? 121.550 52.924  2.303   1.00 24.72  ? 805  BCB M C3A 1 
HETATM 9814  C  C4A . BCB S  6  .   ? 122.279 52.743  3.614   1.00 26.68  ? 805  BCB M C4A 1 
HETATM 9815  C  CMA . BCB S  6  .   ? 121.109 51.566  1.773   1.00 22.46  ? 805  BCB M CMA 1 
HETATM 9816  C  CAA . BCB S  6  .   ? 120.592 55.208  2.261   1.00 26.63  ? 805  BCB M CAA 1 
HETATM 9817  C  CBA . BCB S  6  .   ? 121.982 55.692  2.637   1.00 33.64  ? 805  BCB M CBA 1 
HETATM 9818  C  CGA . BCB S  6  .   ? 122.157 57.154  2.391   1.00 35.09  ? 805  BCB M CGA 1 
HETATM 9819  O  O1A . BCB S  6  .   ? 121.424 57.701  1.579   1.00 40.33  ? 805  BCB M O1A 1 
HETATM 9820  O  O2A . BCB S  6  .   ? 123.175 57.907  3.130   1.00 41.80  ? 805  BCB M O2A 1 
HETATM 9821  N  NB  . BCB S  6  .   ? 123.858 52.531  6.214   1.00 27.00  ? 805  BCB M NB  1 
HETATM 9822  C  C1B . BCB S  6  .   ? 124.314 52.264  4.942   1.00 26.97  ? 805  BCB M C1B 1 
HETATM 9823  C  C2B . BCB S  6  .   ? 125.710 51.921  5.017   1.00 28.75  ? 805  BCB M C2B 1 
HETATM 9824  C  C3B . BCB S  6  .   ? 126.058 51.898  6.322   1.00 29.60  ? 805  BCB M C3B 1 
HETATM 9825  C  C4B . BCB S  6  .   ? 124.872 52.198  7.089   1.00 26.32  ? 805  BCB M C4B 1 
HETATM 9826  C  CMB . BCB S  6  .   ? 126.593 51.645  3.833   1.00 22.22  ? 805  BCB M CMB 1 
HETATM 9827  C  CAB . BCB S  6  .   ? 127.304 51.613  7.007   1.00 33.17  ? 805  BCB M CAB 1 
HETATM 9828  O  OBB . BCB S  6  .   ? 128.113 50.825  6.528   1.00 36.03  ? 805  BCB M OBB 1 
HETATM 9829  C  CBB . BCB S  6  .   ? 127.820 52.680  7.942   1.00 35.69  ? 805  BCB M CBB 1 
HETATM 9830  N  NC  . BCB S  6  .   ? 122.485 52.999  8.736   1.00 21.87  ? 805  BCB M NC  1 
HETATM 9831  C  C1C . BCB S  6  .   ? 123.681 52.510  9.231   1.00 21.67  ? 805  BCB M C1C 1 
HETATM 9832  C  C2C . BCB S  6  .   ? 123.622 52.535  10.721  1.00 17.55  ? 805  BCB M C2C 1 
HETATM 9833  C  C3C . BCB S  6  .   ? 122.399 53.349  11.040  1.00 21.31  ? 805  BCB M C3C 1 
HETATM 9834  C  C4C . BCB S  6  .   ? 121.704 53.443  9.806   1.00 19.52  ? 805  BCB M C4C 1 
HETATM 9835  C  CMC . BCB S  6  .   ? 123.434 51.081  11.138  1.00 13.30  ? 805  BCB M CMC 1 
HETATM 9836  C  CAC . BCB S  6  .   ? 122.035 53.977  12.255  1.00 17.12  ? 805  BCB M CAC 1 
HETATM 9837  C  CBC . BCB S  6  .   ? 122.756 53.766  13.575  1.00 8.25   ? 805  BCB M CBC 1 
HETATM 9838  N  ND  . BCB S  6  .   ? 120.166 53.582  7.260   1.00 23.19  ? 805  BCB M ND  1 
HETATM 9839  C  C1D . BCB S  6  .   ? 119.622 53.892  8.483   1.00 21.08  ? 805  BCB M C1D 1 
HETATM 9840  C  C2D . BCB S  6  .   ? 118.216 54.253  8.353   1.00 21.93  ? 805  BCB M C2D 1 
HETATM 9841  C  C3D . BCB S  6  .   ? 117.998 54.317  6.991   1.00 26.40  ? 805  BCB M C3D 1 
HETATM 9842  C  C4D . BCB S  6  .   ? 119.214 53.928  6.343   1.00 25.67  ? 805  BCB M C4D 1 
HETATM 9843  C  CMD . BCB S  6  .   ? 117.208 54.430  9.502   1.00 11.36  ? 805  BCB M CMD 1 
HETATM 9844  C  CAD . BCB S  6  .   ? 117.045 54.605  5.926   1.00 24.92  ? 805  BCB M CAD 1 
HETATM 9845  O  OBD . BCB S  6  .   ? 115.900 55.040  5.965   1.00 27.31  ? 805  BCB M OBD 1 
HETATM 9846  C  CBD . BCB S  6  .   ? 117.751 54.402  4.581   1.00 20.71  ? 805  BCB M CBD 1 
HETATM 9847  C  CGD . BCB S  6  .   ? 117.126 53.150  3.981   1.00 21.80  ? 805  BCB M CGD 1 
HETATM 9848  O  O1D . BCB S  6  .   ? 116.559 53.326  2.901   1.00 20.53  ? 805  BCB M O1D 1 
HETATM 9849  O  O2D . BCB S  6  .   ? 117.170 51.904  4.561   1.00 28.16  ? 805  BCB M O2D 1 
HETATM 9850  C  CED . BCB S  6  .   ? 116.444 50.925  3.911   1.00 24.62  ? 805  BCB M CED 1 
HETATM 9851  C  C1  . BCB S  6  .   ? 123.528 59.231  2.629   1.00 40.79  ? 805  BCB M C1  1 
HETATM 9852  C  C2  . BCB S  6  .   ? 124.247 59.075  1.365   1.00 38.93  ? 805  BCB M C2  1 
HETATM 9853  C  C3  . BCB S  6  .   ? 125.403 59.621  0.842   1.00 41.03  ? 805  BCB M C3  1 
HETATM 9854  C  C4  . BCB S  6  .   ? 126.188 60.597  1.690   1.00 39.79  ? 805  BCB M C4  1 
HETATM 9855  C  C5  . BCB S  6  .   ? 125.870 59.259  -0.582  1.00 41.72  ? 805  BCB M C5  1 
HETATM 9856  C  C6  . BCB S  6  .   ? 126.973 60.103  -1.186  1.00 46.50  ? 805  BCB M C6  1 
HETATM 9857  C  C7  . BCB S  6  .   ? 126.484 61.485  -1.654  1.00 51.44  ? 805  BCB M C7  1 
HETATM 9858  C  C8  . BCB S  6  .   ? 127.594 62.547  -1.832  1.00 52.53  ? 805  BCB M C8  1 
HETATM 9859  C  C9  . BCB S  6  .   ? 127.049 64.015  -1.900  1.00 48.24  ? 805  BCB M C9  1 
HETATM 9860  C  C10 . BCB S  6  .   ? 128.384 62.215  -3.099  1.00 51.53  ? 805  BCB M C10 1 
HETATM 9861  C  C11 . BCB S  6  .   ? 129.414 61.096  -2.930  1.00 53.76  ? 805  BCB M C11 1 
HETATM 9862  C  C12 . BCB S  6  .   ? 130.328 61.015  -4.155  1.00 58.81  ? 805  BCB M C12 1 
HETATM 9863  C  C13 . BCB S  6  .   ? 129.706 60.347  -5.389  1.00 59.72  ? 805  BCB M C13 1 
HETATM 9864  C  C14 . BCB S  6  .   ? 130.099 58.851  -5.392  1.00 61.16  ? 805  BCB M C14 1 
HETATM 9865  C  C15 . BCB S  6  .   ? 129.743 60.985  -6.802  1.00 61.64  ? 805  BCB M C15 1 
HETATM 9866  C  C16 . BCB S  6  .   ? 130.697 60.294  -7.829  1.00 61.87  ? 805  BCB M C16 1 
HETATM 9867  C  C17 . BCB S  6  .   ? 130.579 60.864  -9.276  1.00 61.93  ? 805  BCB M C17 1 
HETATM 9868  C  C18 . BCB S  6  .   ? 131.667 60.345  -10.251 1.00 62.87  ? 805  BCB M C18 1 
HETATM 9869  C  C19 . BCB S  6  .   ? 131.988 61.326  -11.393 1.00 59.29  ? 805  BCB M C19 1 
HETATM 9870  C  C20 . BCB S  6  .   ? 131.337 58.959  -10.823 1.00 59.29  ? 805  BCB M C20 1 
HETATM 9871  MG MG  . BCB T  6  .   ? 118.113 56.801  16.261  1.00 13.33  ? 806  BCB M MG  1 
HETATM 9872  C  CHA . BCB T  6  .   ? 121.540 56.335  16.213  1.00 15.12  ? 806  BCB M CHA 1 
HETATM 9873  C  CHB . BCB T  6  .   ? 118.521 59.806  14.583  1.00 11.38  ? 806  BCB M CHB 1 
HETATM 9874  C  CHC . BCB T  6  .   ? 114.763 57.246  16.425  1.00 7.99   ? 806  BCB M CHC 1 
HETATM 9875  C  CHD . BCB T  6  .   ? 117.778 53.410  16.937  1.00 15.94  ? 806  BCB M CHD 1 
HETATM 9876  N  NA  . BCB T  6  .   ? 119.802 57.897  15.459  1.00 12.02  ? 806  BCB M NA  1 
HETATM 9877  C  C1A . BCB T  6  .   ? 121.132 57.570  15.694  1.00 13.76  ? 806  BCB M C1A 1 
HETATM 9878  C  C2A . BCB T  6  .   ? 122.024 58.603  15.054  1.00 14.75  ? 806  BCB M C2A 1 
HETATM 9879  C  C3A . BCB T  6  .   ? 121.075 59.540  14.350  1.00 9.69   ? 806  BCB M C3A 1 
HETATM 9880  C  C4A . BCB T  6  .   ? 119.706 59.113  14.806  1.00 7.49   ? 806  BCB M C4A 1 
HETATM 9881  C  CMA . BCB T  6  .   ? 121.346 60.977  14.727  1.00 14.79  ? 806  BCB M CMA 1 
HETATM 9882  C  CAA . BCB T  6  .   ? 122.792 57.736  14.086  1.00 20.01  ? 806  BCB M CAA 1 
HETATM 9883  C  CBA . BCB T  6  .   ? 123.993 58.332  13.548  1.00 21.78  ? 806  BCB M CBA 1 
HETATM 9884  C  CGA . BCB T  6  .   ? 123.972 58.241  12.071  1.00 22.85  ? 806  BCB M CGA 1 
HETATM 9885  O  O1A . BCB T  6  .   ? 123.800 59.252  11.415  1.00 26.94  ? 806  BCB M O1A 1 
HETATM 9886  O  O2A . BCB T  6  .   ? 124.056 57.073  11.321  1.00 27.70  ? 806  BCB M O2A 1 
HETATM 9887  N  NB  . BCB T  6  .   ? 116.870 58.244  15.615  1.00 11.69  ? 806  BCB M NB  1 
HETATM 9888  C  C1B . BCB T  6  .   ? 117.227 59.409  14.967  1.00 9.11   ? 806  BCB M C1B 1 
HETATM 9889  C  C2B . BCB T  6  .   ? 116.047 60.221  14.810  1.00 9.99   ? 806  BCB M C2B 1 
HETATM 9890  C  C3B . BCB T  6  .   ? 114.988 59.533  15.345  1.00 6.66   ? 806  BCB M C3B 1 
HETATM 9891  C  C4B . BCB T  6  .   ? 115.509 58.280  15.850  1.00 8.26   ? 806  BCB M C4B 1 
HETATM 9892  C  CMB . BCB T  6  .   ? 116.160 61.608  14.186  1.00 7.72   ? 806  BCB M CMB 1 
HETATM 9893  C  CAB . BCB T  6  .   ? 113.582 59.856  15.528  1.00 9.95   ? 806  BCB M CAB 1 
HETATM 9894  O  OBB . BCB T  6  .   ? 112.699 59.117  15.932  1.00 18.96  ? 806  BCB M OBB 1 
HETATM 9895  C  CBB . BCB T  6  .   ? 113.161 61.185  14.942  1.00 10.99  ? 806  BCB M CBB 1 
HETATM 9896  N  NC  . BCB T  6  .   ? 116.546 55.533  16.611  1.00 15.77  ? 806  BCB M NC  1 
HETATM 9897  C  C1C . BCB T  6  .   ? 115.250 55.991  16.797  1.00 13.71  ? 806  BCB M C1C 1 
HETATM 9898  C  C2C . BCB T  6  .   ? 114.456 54.853  17.373  1.00 15.92  ? 806  BCB M C2C 1 
HETATM 9899  C  C3C . BCB T  6  .   ? 115.316 53.637  17.168  1.00 14.91  ? 806  BCB M C3C 1 
HETATM 9900  C  C4C . BCB T  6  .   ? 116.585 54.151  16.864  1.00 15.75  ? 806  BCB M C4C 1 
HETATM 9901  C  CMC . BCB T  6  .   ? 114.292 55.140  18.864  1.00 13.01  ? 806  BCB M CMC 1 
HETATM 9902  C  CAC . BCB T  6  .   ? 114.949 52.306  17.056  1.00 13.69  ? 806  BCB M CAC 1 
HETATM 9903  C  CBC . BCB T  6  .   ? 113.589 51.775  17.414  1.00 25.53  ? 806  BCB M CBC 1 
HETATM 9904  N  ND  . BCB T  6  .   ? 119.335 55.205  16.468  1.00 15.72  ? 806  BCB M ND  1 
HETATM 9905  C  C1D . BCB T  6  .   ? 119.079 53.886  16.769  1.00 16.97  ? 806  BCB M C1D 1 
HETATM 9906  C  C2D . BCB T  6  .   ? 120.317 53.153  17.020  1.00 14.48  ? 806  BCB M C2D 1 
HETATM 9907  C  C3D . BCB T  6  .   ? 121.306 54.085  16.849  1.00 16.13  ? 806  BCB M C3D 1 
HETATM 9908  C  C4D . BCB T  6  .   ? 120.687 55.312  16.464  1.00 14.80  ? 806  BCB M C4D 1 
HETATM 9909  C  CMD . BCB T  6  .   ? 120.436 51.675  17.483  1.00 7.83   ? 806  BCB M CMD 1 
HETATM 9910  C  CAD . BCB T  6  .   ? 122.718 54.349  16.925  1.00 18.02  ? 806  BCB M CAD 1 
HETATM 9911  O  OBD . BCB T  6  .   ? 123.669 53.590  17.015  1.00 27.83  ? 806  BCB M OBD 1 
HETATM 9912  C  CBD . BCB T  6  .   ? 122.939 55.824  16.584  1.00 17.15  ? 806  BCB M CBD 1 
HETATM 9913  C  CGD . BCB T  6  .   ? 123.264 56.506  17.911  1.00 17.90  ? 806  BCB M CGD 1 
HETATM 9914  O  O1D . BCB T  6  .   ? 123.573 57.713  17.851  1.00 23.21  ? 806  BCB M O1D 1 
HETATM 9915  O  O2D . BCB T  6  .   ? 123.065 55.868  19.099  1.00 19.58  ? 806  BCB M O2D 1 
HETATM 9916  C  CED . BCB T  6  .   ? 123.928 56.329  20.050  1.00 18.04  ? 806  BCB M CED 1 
HETATM 9917  C  C1  . BCB T  6  .   ? 124.175 57.267  9.879   1.00 26.96  ? 806  BCB M C1  1 
HETATM 9918  C  C2  . BCB T  6  .   ? 125.598 57.565  9.556   1.00 21.31  ? 806  BCB M C2  1 
HETATM 9919  C  C3  . BCB T  6  .   ? 126.467 56.490  9.499   1.00 19.98  ? 806  BCB M C3  1 
HETATM 9920  C  C4  . BCB T  6  .   ? 125.907 55.086  9.746   1.00 13.37  ? 806  BCB M C4  1 
HETATM 9921  C  C5  . BCB T  6  .   ? 127.963 56.587  9.274   1.00 16.74  ? 806  BCB M C5  1 
HETATM 9922  C  C6  . BCB T  6  .   ? 128.542 56.074  7.979   1.00 19.41  ? 806  BCB M C6  1 
HETATM 9923  C  C7  . BCB T  6  .   ? 130.020 56.396  7.876   1.00 19.26  ? 806  BCB M C7  1 
HETATM 9924  C  C8  . BCB T  6  .   ? 130.807 55.536  6.882   1.00 23.88  ? 806  BCB M C8  1 
HETATM 9925  C  C9  . BCB T  6  .   ? 132.235 56.037  6.741   1.00 21.18  ? 806  BCB M C9  1 
HETATM 9926  C  C10 . BCB T  6  .   ? 130.201 55.328  5.495   1.00 24.41  ? 806  BCB M C10 1 
HETATM 9927  C  C11 . BCB T  6  .   ? 130.792 54.134  4.789   1.00 25.53  ? 806  BCB M C11 1 
HETATM 9928  C  C12 . BCB T  6  .   ? 130.065 53.821  3.513   1.00 28.78  ? 806  BCB M C12 1 
HETATM 9929  C  C13 . BCB T  6  .   ? 130.912 53.042  2.501   1.00 30.82  ? 806  BCB M C13 1 
HETATM 9930  C  C14 . BCB T  6  .   ? 130.287 53.139  1.133   1.00 29.24  ? 806  BCB M C14 1 
HETATM 9931  C  C15 . BCB T  6  .   ? 131.055 51.578  2.907   1.00 30.95  ? 806  BCB M C15 1 
HETATM 9932  C  C16 . BCB T  6  .   ? 131.195 50.590  1.746   1.00 32.19  ? 806  BCB M C16 1 
HETATM 9933  C  C17 . BCB T  6  .   ? 130.309 49.390  1.993   1.00 32.87  ? 806  BCB M C17 1 
HETATM 9934  C  C18 . BCB T  6  .   ? 130.761 48.098  1.317   1.00 36.51  ? 806  BCB M C18 1 
HETATM 9935  C  C19 . BCB T  6  .   ? 130.122 46.927  2.051   1.00 32.71  ? 806  BCB M C19 1 
HETATM 9936  C  C20 . BCB T  6  .   ? 132.278 47.965  1.274   1.00 31.97  ? 806  BCB M C20 1 
HETATM 9937  C  C1  . BPB U  7  .   ? 135.269 52.746  0.474   1.00 48.57  ? 401  BPB M C1  1 
HETATM 9938  C  C2  . BPB U  7  .   ? 135.375 51.977  -0.827  1.00 57.49  ? 401  BPB M C2  1 
HETATM 9939  C  C3  . BPB U  7  .   ? 134.604 51.006  -1.484  1.00 63.71  ? 401  BPB M C3  1 
HETATM 9940  C  C4  . BPB U  7  .   ? 133.293 50.416  -0.923  1.00 66.25  ? 401  BPB M C4  1 
HETATM 9941  C  C5  . BPB U  7  .   ? 134.965 50.440  -2.876  1.00 64.38  ? 401  BPB M C5  1 
HETATM 9942  C  C6  . BPB U  7  .   ? 134.033 49.472  -3.579  1.00 65.33  ? 401  BPB M C6  1 
HETATM 9943  C  C7  . BPB U  7  .   ? 133.096 50.199  -4.523  1.00 69.23  ? 401  BPB M C7  1 
HETATM 9944  C  C8  . BPB U  7  .   ? 132.827 49.451  -5.840  1.00 76.77  ? 401  BPB M C8  1 
HETATM 9945  C  C9  . BPB U  7  .   ? 131.950 50.295  -6.771  1.00 77.71  ? 401  BPB M C9  1 
HETATM 9946  N  NA  . BPB U  7  .   ? 130.893 58.909  2.927   1.00 33.37  ? 401  BPB M NA  1 
HETATM 9947  N  NB  . BPB U  7  .   ? 128.348 58.673  4.446   1.00 28.01  ? 401  BPB M NB  1 
HETATM 9948  N  NC  . BPB U  7  .   ? 129.184 60.620  6.499   1.00 23.40  ? 401  BPB M NC  1 
HETATM 9949  N  ND  . BPB U  7  .   ? 131.473 60.971  4.933   1.00 29.97  ? 401  BPB M ND  1 
HETATM 9950  C  C10 . BPB U  7  .   ? 132.366 47.982  -5.799  1.00 79.66  ? 401  BPB M C10 1 
HETATM 9951  C  C11 . BPB U  7  .   ? 132.351 47.246  -7.157  1.00 81.86  ? 401  BPB M C11 1 
HETATM 9952  C  C12 . BPB U  7  .   ? 131.912 45.774  -7.008  1.00 80.96  ? 401  BPB M C12 1 
HETATM 9953  C  C13 . BPB U  7  .   ? 132.144 44.910  -8.251  1.00 80.35  ? 401  BPB M C13 1 
HETATM 9954  C  C14 . BPB U  7  .   ? 131.542 43.528  -8.087  0.00 80.53  ? 401  BPB M C14 1 
HETATM 9955  C  C15 . BPB U  7  .   ? 133.583 44.837  -8.766  0.00 80.99  ? 401  BPB M C15 1 
HETATM 9956  C  C16 . BPB U  7  .   ? 133.788 45.497  -10.121 0.00 81.45  ? 401  BPB M C16 1 
HETATM 9957  C  C17 . BPB U  7  .   ? 135.249 45.464  -10.540 0.00 82.03  ? 401  BPB M C17 1 
HETATM 9958  C  C18 . BPB U  7  .   ? 135.530 46.134  -11.887 0.00 82.31  ? 401  BPB M C18 1 
HETATM 9959  C  C19 . BPB U  7  .   ? 134.926 45.333  -13.032 0.00 82.51  ? 401  BPB M C19 1 
HETATM 9960  C  C1A . BPB U  7  .   ? 132.170 59.171  2.438   1.00 34.31  ? 401  BPB M C1A 1 
HETATM 9961  O  O1A . BPB U  7  .   ? 134.855 54.966  2.344   1.00 39.41  ? 401  BPB M O1A 1 
HETATM 9962  C  C1B . BPB U  7  .   ? 128.138 57.710  3.454   1.00 31.15  ? 401  BPB M C1B 1 
HETATM 9963  C  C1C . BPB U  7  .   ? 128.017 60.160  7.083   1.00 23.56  ? 401  BPB M C1C 1 
HETATM 9964  C  C1D . BPB U  7  .   ? 131.692 62.032  5.797   1.00 27.50  ? 401  BPB M C1D 1 
HETATM 9965  O  O1D . BPB U  7  .   ? 135.125 60.562  0.353   1.00 32.21  ? 401  BPB M O1D 1 
HETATM 9966  C  C20 . BPB U  7  .   ? 137.025 46.327  -12.093 0.00 82.51  ? 401  BPB M C20 1 
HETATM 9967  C  C2A . BPB U  7  .   ? 132.468 58.257  1.272   1.00 33.34  ? 401  BPB M C2A 1 
HETATM 9968  O  O2A . BPB U  7  .   ? 135.236 54.171  0.160   1.00 43.55  ? 401  BPB M O2A 1 
HETATM 9969  C  C2B . BPB U  7  .   ? 126.919 56.997  3.732   1.00 28.65  ? 401  BPB M C2B 1 
HETATM 9970  C  C2C . BPB U  7  .   ? 127.813 60.892  8.372   1.00 18.76  ? 401  BPB M C2C 1 
HETATM 9971  C  C2D . BPB U  7  .   ? 132.892 62.757  5.388   1.00 26.06  ? 401  BPB M C2D 1 
HETATM 9972  O  O2D . BPB U  7  .   ? 133.279 61.977  0.617   1.00 30.55  ? 401  BPB M O2D 1 
HETATM 9973  C  C3A . BPB U  7  .   ? 131.132 57.666  0.927   1.00 33.30  ? 401  BPB M C3A 1 
HETATM 9974  C  C3B . BPB U  7  .   ? 126.458 57.423  4.909   1.00 28.55  ? 401  BPB M C3B 1 
HETATM 9975  C  C3C . BPB U  7  .   ? 128.850 61.997  8.362   1.00 18.60  ? 401  BPB M C3C 1 
HETATM 9976  C  C3D . BPB U  7  .   ? 133.452 62.055  4.355   1.00 31.10  ? 401  BPB M C3D 1 
HETATM 9977  C  C4A . BPB U  7  .   ? 130.271 57.936  2.156   1.00 34.08  ? 401  BPB M C4A 1 
HETATM 9978  C  C4B . BPB U  7  .   ? 127.323 58.500  5.353   1.00 27.35  ? 401  BPB M C4B 1 
HETATM 9979  C  C4C . BPB U  7  .   ? 129.658 61.709  7.233   1.00 21.18  ? 401  BPB M C4C 1 
HETATM 9980  C  C4D . BPB U  7  .   ? 132.571 60.964  4.067   1.00 33.37  ? 401  BPB M C4D 1 
HETATM 9981  C  CAA . BPB U  7  .   ? 133.431 57.164  1.719   1.00 31.23  ? 401  BPB M CAA 1 
HETATM 9982  C  CAB . BPB U  7  .   ? 125.387 56.969  5.758   1.00 25.77  ? 401  BPB M CAB 1 
HETATM 9983  C  CAC . BPB U  7  .   ? 128.906 63.182  9.105   1.00 20.99  ? 401  BPB M CAC 1 
HETATM 9984  C  CAD . BPB U  7  .   ? 134.566 61.963  3.415   1.00 30.96  ? 401  BPB M CAD 1 
HETATM 9985  C  CBA . BPB U  7  .   ? 133.770 56.186  0.635   1.00 34.28  ? 401  BPB M CBA 1 
HETATM 9986  C  CBB . BPB U  7  .   ? 124.408 58.073  6.018   1.00 25.62  ? 401  BPB M CBB 1 
HETATM 9987  O  OBB . BPB U  7  .   ? 125.030 55.818  5.977   1.00 37.42  ? 401  BPB M OBB 1 
HETATM 9988  C  CBC . BPB U  7  .   ? 128.002 63.605  10.268  1.00 14.95  ? 401  BPB M CBC 1 
HETATM 9989  C  CBD . BPB U  7  .   ? 134.388 60.668  2.590   1.00 31.17  ? 401  BPB M CBD 1 
HETATM 9990  O  OBD . BPB U  7  .   ? 135.537 62.693  3.243   1.00 32.39  ? 401  BPB M OBD 1 
HETATM 9991  C  CED . BPB U  7  .   ? 133.428 62.678  -0.582  1.00 28.56  ? 401  BPB M CED 1 
HETATM 9992  C  CGA . BPB U  7  .   ? 134.624 55.060  1.140   1.00 37.27  ? 401  BPB M CGA 1 
HETATM 9993  C  CGD . BPB U  7  .   ? 134.289 61.095  1.117   1.00 30.34  ? 401  BPB M CGD 1 
HETATM 9994  C  CHA . BPB U  7  .   ? 132.978 60.171  2.984   1.00 34.80  ? 401  BPB M CHA 1 
HETATM 9995  C  CHB . BPB U  7  .   ? 129.014 57.387  2.409   1.00 33.10  ? 401  BPB M CHB 1 
HETATM 9996  C  CHC . BPB U  7  .   ? 127.181 59.192  6.557   1.00 24.60  ? 401  BPB M CHC 1 
HETATM 9997  C  CHD . BPB U  7  .   ? 130.841 62.367  6.868   1.00 25.40  ? 401  BPB M CHD 1 
HETATM 9998  C  CMA . BPB U  7  .   ? 130.519 58.415  -0.243  1.00 32.67  ? 401  BPB M CMA 1 
HETATM 9999  C  CMB . BPB U  7  .   ? 126.243 55.881  3.011   1.00 29.06  ? 401  BPB M CMB 1 
HETATM 10000 C  CMC . BPB U  7  .   ? 126.395 61.445  8.423   1.00 15.55  ? 401  BPB M CMC 1 
HETATM 10001 C  CMD . BPB U  7  .   ? 133.344 64.046  5.986   1.00 18.85  ? 401  BPB M CMD 1 
HETATM 10002 C  C1  . MQ7 V  12 .   ? 125.446 82.238  7.790   1.00 17.27  ? 501  MQ7 M C1  1 
HETATM 10003 O  O1  . MQ7 V  12 .   ? 125.580 81.469  6.834   1.00 24.97  ? 501  MQ7 M O1  1 
HETATM 10004 C  C2  . MQ7 V  12 .   ? 124.580 81.904  8.906   1.00 18.22  ? 501  MQ7 M C2  1 
HETATM 10005 C  C2M . MQ7 V  12 .   ? 123.681 80.693  8.756   1.00 15.43  ? 501  MQ7 M C2M 1 
HETATM 10006 C  C3  . MQ7 V  12 .   ? 124.630 82.628  10.061  1.00 18.24  ? 501  MQ7 M C3  1 
HETATM 10007 C  C4  . MQ7 V  12 .   ? 125.512 83.757  10.153  1.00 17.76  ? 501  MQ7 M C4  1 
HETATM 10008 O  O4  . MQ7 V  12 .   ? 125.571 84.385  11.203  1.00 21.58  ? 501  MQ7 M O4  1 
HETATM 10009 C  C5  . MQ7 V  12 .   ? 126.377 84.086  9.048   1.00 19.74  ? 501  MQ7 M C5  1 
HETATM 10010 C  C6  . MQ7 V  12 .   ? 127.262 85.145  9.164   1.00 21.87  ? 501  MQ7 M C6  1 
HETATM 10011 C  C7  . MQ7 V  12 .   ? 128.121 85.436  8.139   1.00 15.06  ? 501  MQ7 M C7  1 
HETATM 10012 C  C8  . MQ7 V  12 .   ? 128.094 84.676  7.004   1.00 12.74  ? 501  MQ7 M C8  1 
HETATM 10013 C  C9  . MQ7 V  12 .   ? 127.208 83.634  6.898   1.00 18.31  ? 501  MQ7 M C9  1 
HETATM 10014 C  C10 . MQ7 V  12 .   ? 126.353 83.347  7.920   1.00 16.94  ? 501  MQ7 M C10 1 
HETATM 10015 C  C11 . MQ7 V  12 .   ? 123.851 82.213  11.268  1.00 20.85  ? 501  MQ7 M C11 1 
HETATM 10016 C  C12 . MQ7 V  12 .   ? 124.636 81.392  12.149  1.00 14.30  ? 501  MQ7 M C12 1 
HETATM 10017 C  C13 . MQ7 V  12 .   ? 125.226 81.511  13.387  1.00 14.95  ? 501  MQ7 M C13 1 
HETATM 10018 C  C14 . MQ7 V  12 .   ? 125.217 82.755  14.218  1.00 13.97  ? 501  MQ7 M C14 1 
HETATM 10019 C  C15 . MQ7 V  12 .   ? 125.957 80.335  14.019  1.00 17.03  ? 501  MQ7 M C15 1 
HETATM 10020 C  C16 . MQ7 V  12 .   ? 125.156 80.032  15.285  1.00 21.89  ? 501  MQ7 M C16 1 
HETATM 10021 C  C17 . MQ7 V  12 .   ? 123.860 79.473  14.988  1.00 18.33  ? 501  MQ7 M C17 1 
HETATM 10022 C  C18 . MQ7 V  12 .   ? 123.266 78.258  15.313  1.00 21.63  ? 501  MQ7 M C18 1 
HETATM 10023 C  C19 . MQ7 V  12 .   ? 123.862 77.114  16.149  1.00 17.78  ? 501  MQ7 M C19 1 
HETATM 10024 C  C20 . MQ7 V  12 .   ? 121.890 77.893  14.845  1.00 15.76  ? 501  MQ7 M C20 1 
HETATM 10025 C  C21 . MQ7 V  12 .   ? 121.020 77.968  16.064  1.00 21.19  ? 501  MQ7 M C21 1 
HETATM 10026 C  C22 . MQ7 V  12 .   ? 120.712 79.297  16.389  1.00 19.05  ? 501  MQ7 M C22 1 
HETATM 10027 C  C23 . MQ7 V  12 .   ? 120.136 79.642  17.592  1.00 17.27  ? 501  MQ7 M C23 1 
HETATM 10028 C  C24 . MQ7 V  12 .   ? 119.868 78.603  18.643  1.00 14.25  ? 501  MQ7 M C24 1 
HETATM 10029 C  C25 . MQ7 V  12 .   ? 119.771 81.035  17.996  1.00 15.13  ? 501  MQ7 M C25 1 
HETATM 10030 C  C26 . MQ7 V  12 .   ? 118.359 80.963  18.507  1.00 16.57  ? 501  MQ7 M C26 1 
HETATM 10031 C  C27 . MQ7 V  12 .   ? 118.016 82.272  18.864  1.00 17.32  ? 501  MQ7 M C27 1 
HETATM 10032 C  C28 . MQ7 V  12 .   ? 116.837 82.980  18.699  1.00 16.83  ? 501  MQ7 M C28 1 
HETATM 10033 C  C29 . MQ7 V  12 .   ? 115.568 82.424  18.021  1.00 16.57  ? 501  MQ7 M C29 1 
HETATM 10034 C  C30 . MQ7 V  12 .   ? 116.748 84.417  19.189  1.00 16.76  ? 501  MQ7 M C30 1 
HETATM 10035 C  C31 . MQ7 V  12 .   ? 115.793 84.625  20.358  1.00 20.94  ? 501  MQ7 M C31 1 
HETATM 10036 C  C32 . MQ7 V  12 .   ? 115.557 86.061  20.593  1.00 21.96  ? 501  MQ7 M C32 1 
HETATM 10037 C  C33 . MQ7 V  12 .   ? 114.377 86.782  20.793  1.00 25.10  ? 501  MQ7 M C33 1 
HETATM 10038 C  C34 . MQ7 V  12 .   ? 112.964 86.165  20.826  1.00 25.20  ? 501  MQ7 M C34 1 
HETATM 10039 C  C35 . MQ7 V  12 .   ? 114.288 88.314  20.962  1.00 25.28  ? 501  MQ7 M C35 1 
HETATM 10040 C  C36 . MQ7 V  12 .   ? 113.834 88.986  19.651  1.00 23.65  ? 501  MQ7 M C36 1 
HETATM 10041 C  C37 . MQ7 V  12 .   ? 113.754 90.432  19.888  1.00 30.56  ? 501  MQ7 M C37 1 
HETATM 10042 C  C38 . MQ7 V  12 .   ? 112.853 91.346  19.346  1.00 28.96  ? 501  MQ7 M C38 1 
HETATM 10043 C  C39 . MQ7 V  12 .   ? 111.775 90.900  18.336  1.00 22.27  ? 501  MQ7 M C39 1 
HETATM 10044 C  C40 . MQ7 V  12 .   ? 112.839 92.839  19.656  1.00 29.71  ? 501  MQ7 M C40 1 
HETATM 10045 C  C41 . MQ7 V  12 .   ? 112.215 93.275  20.977  1.00 38.30  ? 501  MQ7 M C41 1 
HETATM 10046 C  C42 . MQ7 V  12 .   ? 113.182 92.821  21.965  1.00 47.46  ? 501  MQ7 M C42 1 
HETATM 10047 C  C43 . MQ7 V  12 .   ? 113.203 92.328  23.270  1.00 48.36  ? 501  MQ7 M C43 1 
HETATM 10048 C  C44 . MQ7 V  12 .   ? 111.991 92.092  24.193  1.00 46.87  ? 501  MQ7 M C44 1 
HETATM 10049 C  C45 . MQ7 V  12 .   ? 114.538 91.938  23.936  1.00 48.74  ? 501  MQ7 M C45 1 
HETATM 10050 C  C1  . NS5 W  13 .   ? 127.383 48.733  -8.145  0.00 70.67  ? 600  NS5 M C1  1 
HETATM 10051 C  CM1 . NS5 W  13 .   ? 128.642 49.571  -7.995  0.00 70.89  ? 600  NS5 M CM1 1 
HETATM 10052 C  CM2 . NS5 W  13 .   ? 126.856 48.800  -9.569  0.00 70.89  ? 600  NS5 M CM2 1 
HETATM 10053 C  C2  . NS5 W  13 .   ? 127.633 47.282  -7.722  0.00 70.32  ? 600  NS5 M C2  1 
HETATM 10054 C  C3  . NS5 W  13 .   ? 127.818 47.083  -6.224  0.00 69.68  ? 600  NS5 M C3  1 
HETATM 10055 C  C4  . NS5 W  13 .   ? 126.524 47.347  -5.464  0.00 68.95  ? 600  NS5 M C4  1 
HETATM 10056 C  C5  . NS5 W  13 .   ? 126.691 47.258  -3.992  0.00 68.28  ? 600  NS5 M C5  1 
HETATM 10057 C  C6  . NS5 W  13 .   ? 127.353 48.428  -3.353  0.00 68.35  ? 600  NS5 M C6  1 
HETATM 10058 C  C7  . NS5 W  13 .   ? 126.138 46.256  -3.284  0.00 67.64  ? 600  NS5 M C7  1 
HETATM 10059 C  C8  . NS5 W  13 .   ? 126.187 46.156  -1.804  1.00 66.52  ? 600  NS5 M C8  1 
HETATM 10060 C  C9  . NS5 W  13 .   ? 125.236 45.097  -1.267  1.00 66.12  ? 600  NS5 M C9  1 
HETATM 10061 C  C10 . NS5 W  13 .   ? 124.613 45.532  0.039   1.00 66.55  ? 600  NS5 M C10 1 
HETATM 10062 C  C11 . NS5 W  13 .   ? 123.358 46.310  -0.095  1.00 67.04  ? 600  NS5 M C11 1 
HETATM 10063 C  C12 . NS5 W  13 .   ? 125.296 45.418  1.202   1.00 63.52  ? 600  NS5 M C12 1 
HETATM 10064 C  C13 . NS5 W  13 .   ? 124.887 45.842  2.530   1.00 59.02  ? 600  NS5 M C13 1 
HETATM 10065 C  C14 . NS5 W  13 .   ? 124.637 47.113  2.889   1.00 54.52  ? 600  NS5 M C14 1 
HETATM 10066 C  C15 . NS5 W  13 .   ? 124.330 47.576  4.218   1.00 48.44  ? 600  NS5 M C15 1 
HETATM 10067 C  C16 . NS5 W  13 .   ? 123.217 48.545  4.240   1.00 45.80  ? 600  NS5 M C16 1 
HETATM 10068 C  C17 . NS5 W  13 .   ? 125.195 47.452  5.246   1.00 48.95  ? 600  NS5 M C17 1 
HETATM 10069 C  C18 . NS5 W  13 .   ? 125.067 48.151  6.482   1.00 44.38  ? 600  NS5 M C18 1 
HETATM 10070 C  C19 . NS5 W  13 .   ? 125.857 48.179  7.565   1.00 44.11  ? 600  NS5 M C19 1 
HETATM 10071 C  C20 . NS5 W  13 .   ? 126.932 47.308  7.934   1.00 40.58  ? 600  NS5 M C20 1 
HETATM 10072 C  C21 . NS5 W  13 .   ? 127.749 47.601  8.976   1.00 40.35  ? 600  NS5 M C21 1 
HETATM 10073 C  C22 . NS5 W  13 .   ? 127.803 48.949  9.583   1.00 36.62  ? 600  NS5 M C22 1 
HETATM 10074 C  C23 . NS5 W  13 .   ? 128.497 46.548  9.703   1.00 39.87  ? 600  NS5 M C23 1 
HETATM 10075 C  C24 . NS5 W  13 .   ? 129.714 46.712  10.259  1.00 39.43  ? 600  NS5 M C24 1 
HETATM 10076 C  C25 . NS5 W  13 .   ? 130.587 45.637  10.695  1.00 39.84  ? 600  NS5 M C25 1 
HETATM 10077 C  C26 . NS5 W  13 .   ? 131.919 45.679  10.865  1.00 38.43  ? 600  NS5 M C26 1 
HETATM 10078 C  C27 . NS5 W  13 .   ? 132.714 46.921  10.697  1.00 34.05  ? 600  NS5 M C27 1 
HETATM 10079 C  C28 . NS5 W  13 .   ? 132.642 44.533  11.407  1.00 42.01  ? 600  NS5 M C28 1 
HETATM 10080 C  C29 . NS5 W  13 .   ? 133.978 44.551  11.591  1.00 48.93  ? 600  NS5 M C29 1 
HETATM 10081 C  C30 . NS5 W  13 .   ? 134.846 43.465  12.085  1.00 52.47  ? 600  NS5 M C30 1 
HETATM 10082 C  C31 . NS5 W  13 .   ? 136.184 43.527  12.365  1.00 54.00  ? 600  NS5 M C31 1 
HETATM 10083 C  C32 . NS5 W  13 .   ? 137.059 44.710  11.993  1.00 47.77  ? 600  NS5 M C32 1 
HETATM 10084 C  C33 . NS5 W  13 .   ? 136.814 42.539  13.349  1.00 50.27  ? 600  NS5 M C33 1 
HETATM 10085 C  C34 . NS5 W  13 .   ? 137.288 41.274  12.655  0.00 51.34  ? 600  NS5 M C34 1 
HETATM 10086 C  C35 . NS5 W  13 .   ? 137.749 40.263  13.637  0.00 51.02  ? 600  NS5 M C35 1 
HETATM 10087 C  C36 . NS5 W  13 .   ? 138.175 39.027  13.320  0.00 51.16  ? 600  NS5 M C36 1 
HETATM 10088 C  CM3 . NS5 W  13 .   ? 138.388 38.585  11.919  0.00 51.15  ? 600  NS5 M CM3 1 
HETATM 10089 C  CM4 . NS5 W  13 .   ? 138.543 38.029  14.353  0.00 51.15  ? 600  NS5 M CM4 1 
HETATM 10090 N  N1  . LDA X  9  .   ? 150.900 58.637  0.327   1.00 100.14 ? 704  LDA M N1  1 
HETATM 10091 O  O1  . LDA X  9  .   ? 151.813 59.226  0.976   1.00 103.94 ? 704  LDA M O1  1 
HETATM 10092 C  CM1 . LDA X  9  .   ? 149.592 59.044  0.814   1.00 102.08 ? 704  LDA M CM1 1 
HETATM 10093 C  CM2 . LDA X  9  .   ? 150.999 58.980  -1.087  1.00 101.51 ? 704  LDA M CM2 1 
HETATM 10094 C  C1  . LDA X  9  .   ? 151.007 57.179  0.479   1.00 93.64  ? 704  LDA M C1  1 
HETATM 10095 C  C2  . LDA X  9  .   ? 150.114 56.131  -0.151  1.00 82.74  ? 704  LDA M C2  1 
HETATM 10096 C  C3  . LDA X  9  .   ? 149.814 55.035  0.829   1.00 74.87  ? 704  LDA M C3  1 
HETATM 10097 C  C4  . LDA X  9  .   ? 148.832 54.059  0.241   1.00 72.30  ? 704  LDA M C4  1 
HETATM 10098 C  C5  . LDA X  9  .   ? 148.430 53.026  1.272   1.00 71.05  ? 704  LDA M C5  1 
HETATM 10099 C  C6  . LDA X  9  .   ? 147.574 51.936  0.659   1.00 71.95  ? 704  LDA M C6  1 
HETATM 10100 C  C7  . LDA X  9  .   ? 146.603 51.345  1.679   1.00 74.07  ? 704  LDA M C7  1 
HETATM 10101 C  C8  . LDA X  9  .   ? 147.300 50.521  2.769   1.00 72.88  ? 704  LDA M C8  1 
HETATM 10102 C  C9  . LDA X  9  .   ? 146.535 50.605  4.104   1.00 73.66  ? 704  LDA M C9  1 
HETATM 10103 C  C10 . LDA X  9  .   ? 145.173 49.888  4.057   1.00 71.58  ? 704  LDA M C10 1 
HETATM 10104 C  C11 . LDA X  9  .   ? 144.183 50.434  5.096   1.00 70.84  ? 704  LDA M C11 1 
HETATM 10105 C  C12 . LDA X  9  .   ? 144.554 50.260  6.570   1.00 67.99  ? 704  LDA M C12 1 
HETATM 10106 N  N1  . LDA Y  9  .   ? 125.978 30.438  3.367   0.00 86.93  ? 706  LDA M N1  1 
HETATM 10107 O  O1  . LDA Y  9  .   ? 124.925 31.072  3.273   0.00 87.42  ? 706  LDA M O1  1 
HETATM 10108 C  CM1 . LDA Y  9  .   ? 126.759 30.899  4.503   0.00 87.42  ? 706  LDA M CM1 1 
HETATM 10109 C  CM2 . LDA Y  9  .   ? 125.694 29.030  3.571   0.00 87.42  ? 706  LDA M CM2 1 
HETATM 10110 C  C1  . LDA Y  9  .   ? 126.768 30.591  2.147   1.00 86.04  ? 706  LDA M C1  1 
HETATM 10111 C  C2  . LDA Y  9  .   ? 128.031 29.810  1.800   1.00 83.95  ? 706  LDA M C2  1 
HETATM 10112 C  C3  . LDA Y  9  .   ? 129.134 30.723  1.291   1.00 83.14  ? 706  LDA M C3  1 
HETATM 10113 C  C4  . LDA Y  9  .   ? 128.803 31.313  -0.075  1.00 81.95  ? 706  LDA M C4  1 
HETATM 10114 C  C5  . LDA Y  9  .   ? 129.557 32.618  -0.315  1.00 82.06  ? 706  LDA M C5  1 
HETATM 10115 C  C6  . LDA Y  9  .   ? 131.074 32.419  -0.446  1.00 81.13  ? 706  LDA M C6  1 
HETATM 10116 C  C7  . LDA Y  9  .   ? 131.818 33.757  -0.435  1.00 79.73  ? 706  LDA M C7  1 
HETATM 10117 C  C8  . LDA Y  9  .   ? 132.805 33.891  -1.590  1.00 77.86  ? 706  LDA M C8  1 
HETATM 10118 C  C9  . LDA Y  9  .   ? 132.656 35.247  -2.263  1.00 77.82  ? 706  LDA M C9  1 
HETATM 10119 C  C10 . LDA Y  9  .   ? 133.749 35.505  -3.285  1.00 79.32  ? 706  LDA M C10 1 
HETATM 10120 C  C11 . LDA Y  9  .   ? 135.014 36.035  -2.621  1.00 81.06  ? 706  LDA M C11 1 
HETATM 10121 C  C12 . LDA Y  9  .   ? 136.033 36.567  -3.617  1.00 82.60  ? 706  LDA M C12 1 
HETATM 10122 S  S   . SO4 Z  11 .   ? 128.240 90.287  21.046  1.00 65.24  ? 801  SO4 H S   1 
HETATM 10123 O  O1  . SO4 Z  11 .   ? 127.695 90.100  19.727  1.00 65.66  ? 801  SO4 H O1  1 
HETATM 10124 O  O2  . SO4 Z  11 .   ? 127.746 89.358  22.018  1.00 66.64  ? 801  SO4 H O2  1 
HETATM 10125 O  O3  . SO4 Z  11 .   ? 129.637 90.150  20.919  1.00 62.05  ? 801  SO4 H O3  1 
HETATM 10126 O  O4  . SO4 Z  11 .   ? 127.902 91.569  21.556  1.00 65.17  ? 801  SO4 H O4  1 
HETATM 10127 N  N1  . LDA AA 9  .   ? 125.253 82.845  22.794  1.00 26.27  ? 701  LDA H N1  1 
HETATM 10128 O  O1  . LDA AA 9  .   ? 126.457 82.611  22.754  1.00 27.40  ? 701  LDA H O1  1 
HETATM 10129 C  CM1 . LDA AA 9  .   ? 124.750 82.596  24.085  1.00 29.89  ? 701  LDA H CM1 1 
HETATM 10130 C  CM2 . LDA AA 9  .   ? 125.011 84.235  22.467  1.00 18.77  ? 701  LDA H CM2 1 
HETATM 10131 C  C1  . LDA AA 9  .   ? 124.517 81.958  21.907  1.00 25.13  ? 701  LDA H C1  1 
HETATM 10132 C  C2  . LDA AA 9  .   ? 124.655 80.432  22.025  1.00 26.96  ? 701  LDA H C2  1 
HETATM 10133 C  C3  . LDA AA 9  .   ? 123.954 79.692  20.866  1.00 29.96  ? 701  LDA H C3  1 
HETATM 10134 C  C4  . LDA AA 9  .   ? 124.578 78.318  20.604  1.00 31.56  ? 701  LDA H C4  1 
HETATM 10135 C  C5  . LDA AA 9  .   ? 123.563 77.160  20.619  1.00 32.27  ? 701  LDA H C5  1 
HETATM 10136 C  C6  . LDA AA 9  .   ? 124.263 75.791  20.636  1.00 28.13  ? 701  LDA H C6  1 
HETATM 10137 C  C7  . LDA AA 9  .   ? 123.353 74.721  21.196  1.00 28.25  ? 701  LDA H C7  1 
HETATM 10138 C  C8  . LDA AA 9  .   ? 123.976 73.326  21.207  1.00 28.10  ? 701  LDA H C8  1 
HETATM 10139 C  C9  . LDA AA 9  .   ? 122.856 72.305  21.141  1.00 30.76  ? 701  LDA H C9  1 
HETATM 10140 C  C10 . LDA AA 9  .   ? 123.363 70.879  21.196  1.00 36.58  ? 701  LDA H C10 1 
HETATM 10141 C  C11 . LDA AA 9  .   ? 122.231 69.882  20.925  1.00 33.10  ? 701  LDA H C11 1 
HETATM 10142 C  C12 . LDA AA 9  .   ? 121.085 69.910  21.933  1.00 37.60  ? 701  LDA H C12 1 
HETATM 10143 N  N1  . LDA BA 9  .   ? 141.749 86.251  24.885  1.00 36.98  ? 703  LDA H N1  1 
HETATM 10144 O  O1  . LDA BA 9  .   ? 142.615 85.907  25.680  1.00 40.39  ? 703  LDA H O1  1 
HETATM 10145 C  CM1 . LDA BA 9  .   ? 141.216 85.069  24.261  1.00 35.10  ? 703  LDA H CM1 1 
HETATM 10146 C  CM2 . LDA BA 9  .   ? 140.654 86.979  25.550  1.00 34.07  ? 703  LDA H CM2 1 
HETATM 10147 C  C1  . LDA BA 9  .   ? 142.318 87.096  23.882  1.00 33.37  ? 703  LDA H C1  1 
HETATM 10148 C  C2  . LDA BA 9  .   ? 142.864 88.396  24.342  1.00 30.88  ? 703  LDA H C2  1 
HETATM 10149 C  C3  . LDA BA 9  .   ? 143.769 88.959  23.299  1.00 33.80  ? 703  LDA H C3  1 
HETATM 10150 C  C4  . LDA BA 9  .   ? 143.082 90.033  22.482  1.00 36.86  ? 703  LDA H C4  1 
HETATM 10151 C  C5  . LDA BA 9  .   ? 144.079 90.628  21.506  1.00 46.33  ? 703  LDA H C5  1 
HETATM 10152 C  C6  . LDA BA 9  .   ? 143.541 91.848  20.790  1.00 50.35  ? 703  LDA H C6  1 
HETATM 10153 C  C7  . LDA BA 9  .   ? 143.375 91.562  19.310  1.00 55.97  ? 703  LDA H C7  1 
HETATM 10154 C  C8  . LDA BA 9  .   ? 143.803 92.758  18.459  1.00 61.61  ? 703  LDA H C8  1 
HETATM 10155 C  C9  . LDA BA 9  .   ? 142.807 93.915  18.581  1.00 62.87  ? 703  LDA H C9  1 
HETATM 10156 C  C10 . LDA BA 9  .   ? 142.062 94.155  17.271  1.00 65.09  ? 703  LDA H C10 1 
HETATM 10157 C  C11 . LDA BA 9  .   ? 140.703 94.806  17.488  1.00 64.38  ? 703  LDA H C11 1 
HETATM 10158 C  C12 . LDA BA 9  .   ? 140.889 96.185  18.068  1.00 67.92  ? 703  LDA H C12 1 
HETATM 10159 O  O   . HOH CA 14 .   ? 90.966  49.893  20.351  1.00 34.41  ? 901  HOH C O   1 
HETATM 10160 O  O   . HOH CA 14 .   ? 91.635  54.042  6.073   1.00 40.55  ? 904  HOH C O   1 
HETATM 10161 O  O   . HOH CA 14 .   ? 109.263 28.675  23.294  1.00 24.10  ? 905  HOH C O   1 
HETATM 10162 O  O   . HOH CA 14 .   ? 128.878 40.087  33.821  1.00 29.14  ? 906  HOH C O   1 
HETATM 10163 O  O   . HOH CA 14 .   ? 100.335 33.853  15.514  1.00 27.11  ? 907  HOH C O   1 
HETATM 10164 O  O   . HOH CA 14 .   ? 104.393 32.090  6.475   1.00 26.43  ? 914  HOH C O   1 
HETATM 10165 O  O   . HOH CA 14 .   ? 103.609 45.263  7.882   1.00 20.46  ? 915  HOH C O   1 
HETATM 10166 O  O   . HOH CA 14 .   ? 84.575  32.560  8.510   1.00 40.25  ? 916  HOH C O   1 
HETATM 10167 O  O   . HOH CA 14 .   ? 98.957  31.493  10.839  1.00 39.86  ? 917  HOH C O   1 
HETATM 10168 O  O   . HOH CA 14 .   ? 117.059 39.374  11.411  1.00 9.48   ? 918  HOH C O   1 
HETATM 10169 O  O   . HOH CA 14 .   ? 119.690 38.635  12.921  1.00 28.86  ? 919  HOH C O   1 
HETATM 10170 O  O   . HOH CA 14 .   ? 87.822  35.859  13.114  1.00 13.51  ? 921  HOH C O   1 
HETATM 10171 O  O   . HOH CA 14 .   ? 95.404  57.254  19.452  1.00 26.81  ? 925  HOH C O   1 
HETATM 10172 O  O   . HOH CA 14 .   ? 85.063  31.598  19.556  1.00 31.85  ? 926  HOH C O   1 
HETATM 10173 O  O   . HOH CA 14 .   ? 97.424  57.786  23.014  1.00 32.82  ? 928  HOH C O   1 
HETATM 10174 O  O   . HOH CA 14 .   ? 93.977  47.723  24.359  1.00 22.45  ? 929  HOH C O   1 
HETATM 10175 O  O   . HOH CA 14 .   ? 119.291 39.789  23.086  1.00 46.95  ? 931  HOH C O   1 
HETATM 10176 O  O   . HOH CA 14 .   ? 110.310 50.268  25.041  1.00 14.33  ? 932  HOH C O   1 
HETATM 10177 O  O   . HOH CA 14 .   ? 104.666 47.922  27.440  1.00 14.33  ? 933  HOH C O   1 
HETATM 10178 O  O   . HOH CA 14 .   ? 108.273 31.417  27.871  1.00 36.05  ? 934  HOH C O   1 
HETATM 10179 O  O   . HOH CA 14 .   ? 106.588 35.745  31.521  1.00 53.40  ? 937  HOH C O   1 
HETATM 10180 O  O   . HOH CA 14 .   ? 111.966 41.889  30.984  1.00 24.07  ? 938  HOH C O   1 
HETATM 10181 O  O   . HOH CA 14 .   ? 107.514 42.650  29.917  1.00 31.38  ? 940  HOH C O   1 
HETATM 10182 O  O   . HOH CA 14 .   ? 92.596  63.195  30.962  1.00 46.03  ? 943  HOH C O   1 
HETATM 10183 O  O   . HOH CA 14 .   ? 126.956 40.403  40.720  1.00 24.08  ? 944  HOH C O   1 
HETATM 10184 O  O   . HOH CA 14 .   ? 95.825  48.929  14.046  1.00 28.78  ? 945  HOH C O   1 
HETATM 10185 O  O   . HOH CA 14 .   ? 112.377 25.975  2.422   1.00 49.11  ? 948  HOH C O   1 
HETATM 10186 O  O   . HOH CA 14 .   ? 83.508  20.929  4.757   1.00 41.82  ? 949  HOH C O   1 
HETATM 10187 O  O   . HOH CA 14 .   ? 89.875  34.564  5.365   1.00 45.02  ? 950  HOH C O   1 
HETATM 10188 O  O   . HOH CA 14 .   ? 93.415  47.478  5.640   1.00 39.12  ? 951  HOH C O   1 
HETATM 10189 O  O   . HOH CA 14 .   ? 115.202 37.018  6.486   1.00 21.14  ? 952  HOH C O   1 
HETATM 10190 O  O   . HOH CA 14 .   ? 91.743  59.307  7.180   1.00 71.70  ? 954  HOH C O   1 
HETATM 10191 O  O   . HOH CA 14 .   ? 111.354 37.853  7.723   1.00 35.14  ? 955  HOH C O   1 
HETATM 10192 O  O   . HOH CA 14 .   ? 99.061  29.636  8.367   1.00 41.74  ? 956  HOH C O   1 
HETATM 10193 O  O   . HOH CA 14 .   ? 72.747  26.353  12.238  1.00 42.69  ? 959  HOH C O   1 
HETATM 10194 O  O   . HOH CA 14 .   ? 77.280  35.149  14.680  1.00 38.61  ? 960  HOH C O   1 
HETATM 10195 O  O   . HOH CA 14 .   ? 90.153  60.503  15.158  1.00 28.48  ? 961  HOH C O   1 
HETATM 10196 O  O   . HOH CA 14 .   ? 103.192 17.042  15.420  1.00 47.28  ? 963  HOH C O   1 
HETATM 10197 O  O   . HOH CA 14 .   ? 67.681  21.067  17.186  1.00 38.94  ? 966  HOH C O   1 
HETATM 10198 O  O   . HOH CA 14 .   ? 88.835  43.616  20.449  1.00 40.20  ? 967  HOH C O   1 
HETATM 10199 O  O   . HOH CA 14 .   ? 113.953 35.609  22.626  1.00 34.00  ? 968  HOH C O   1 
HETATM 10200 O  O   . HOH CA 14 .   ? 96.280  14.366  21.453  1.00 50.27  ? 969  HOH C O   1 
HETATM 10201 O  O   . HOH CA 14 .   ? 112.112 50.372  27.295  1.00 23.93  ? 970  HOH C O   1 
HETATM 10202 O  O   . HOH CA 14 .   ? 98.701  55.584  29.291  1.00 23.30  ? 972  HOH C O   1 
HETATM 10203 O  O   . HOH CA 14 .   ? 108.054 34.214  27.628  1.00 37.25  ? 973  HOH C O   1 
HETATM 10204 O  O   . HOH CA 14 .   ? 102.189 55.789  31.844  1.00 31.24  ? 976  HOH C O   1 
HETATM 10205 O  O   . HOH CA 14 .   ? 117.474 49.859  38.367  1.00 35.42  ? 979  HOH C O   1 
HETATM 10206 O  O   . HOH CA 14 .   ? 92.952  47.794  8.467   1.00 41.58  ? 980  HOH C O   1 
HETATM 10207 O  O   . HOH CA 14 .   ? 75.062  25.709  15.216  1.00 45.33  ? 982  HOH C O   1 
HETATM 10208 O  O   . HOH CA 14 .   ? 76.203  35.867  16.943  1.00 39.49  ? 983  HOH C O   1 
HETATM 10209 O  O   . HOH CA 14 .   ? 93.890  47.117  15.162  1.00 20.21  ? 984  HOH C O   1 
HETATM 10210 O  O   . HOH CA 14 .   ? 112.167 49.658  23.323  1.00 20.03  ? 985  HOH C O   1 
HETATM 10211 O  O   . HOH CA 14 .   ? 90.161  37.005  28.596  1.00 45.77  ? 986  HOH C O   1 
HETATM 10212 O  O   . HOH CA 14 .   ? 96.045  52.529  28.678  1.00 43.12  ? 987  HOH C O   1 
HETATM 10213 O  O   . HOH CA 14 .   ? 100.983 54.432  29.766  1.00 23.89  ? 988  HOH C O   1 
HETATM 10214 O  O   . HOH CA 14 .   ? 91.066  43.866  14.539  1.00 22.57  ? 1070 HOH C O   1 
HETATM 10215 O  O   . HOH CA 14 .   ? 90.353  44.512  11.968  1.00 32.01  ? 1075 HOH C O   1 
HETATM 10216 O  O   . HOH CA 14 .   ? 97.614  27.082  6.543   1.00 29.96  ? 1076 HOH C O   1 
HETATM 10217 O  O   . HOH CA 14 .   ? 81.562  29.868  21.988  1.00 25.71  ? 1077 HOH C O   1 
HETATM 10218 O  O   . HOH CA 14 .   ? 82.425  30.663  19.694  1.00 26.33  ? 1078 HOH C O   1 
HETATM 10219 O  O   . HOH CA 14 .   ? 104.146 35.158  -2.660  1.00 51.52  ? 1080 HOH C O   1 
HETATM 10220 O  O   . HOH CA 14 .   ? 96.881  33.499  2.778   1.00 30.24  ? 1081 HOH C O   1 
HETATM 10221 O  O   . HOH CA 14 .   ? 100.257 34.216  -0.340  1.00 61.51  ? 1082 HOH C O   1 
HETATM 10222 O  O   . HOH CA 14 .   ? 99.456  34.328  2.276   1.00 23.22  ? 1083 HOH C O   1 
HETATM 10223 O  O   . HOH CA 14 .   ? 106.524 46.447  35.442  1.00 29.01  ? 1089 HOH C O   1 
HETATM 10224 O  O   . HOH CA 14 .   ? 97.842  68.033  29.683  1.00 42.44  ? 1090 HOH C O   1 
HETATM 10225 O  O   . HOH CA 14 .   ? 125.041 39.051  23.564  1.00 58.27  ? 1095 HOH C O   1 
HETATM 10226 O  O   . HOH CA 14 .   ? 121.377 48.832  37.843  1.00 36.87  ? 1096 HOH C O   1 
HETATM 10227 O  O   . HOH CA 14 .   ? 84.688  34.184  19.357  1.00 29.70  ? 1097 HOH C O   1 
HETATM 10228 O  O   . HOH CA 14 .   ? 94.030  64.578  32.951  1.00 40.38  ? 1102 HOH C O   1 
HETATM 10229 O  O   . HOH CA 14 .   ? 77.969  20.823  -0.773  1.00 39.75  ? 1129 HOH C O   1 
HETATM 10230 O  O   . HOH CA 14 .   ? 97.991  33.561  -2.023  1.00 49.48  ? 1131 HOH C O   1 
HETATM 10231 O  O   . HOH CA 14 .   ? 99.074  32.449  -4.338  1.00 59.87  ? 1132 HOH C O   1 
HETATM 10232 O  O   . HOH CA 14 .   ? 114.685 32.831  0.011   1.00 42.28  ? 1133 HOH C O   1 
HETATM 10233 O  O   . HOH CA 14 .   ? 112.698 36.988  5.550   1.00 17.35  ? 1134 HOH C O   1 
HETATM 10234 O  O   . HOH CA 14 .   ? 90.913  24.754  4.934   1.00 48.34  ? 1136 HOH C O   1 
HETATM 10235 O  O   . HOH CA 14 .   ? 88.301  31.710  7.370   1.00 43.84  ? 1144 HOH C O   1 
HETATM 10236 O  O   . HOH CA 14 .   ? 102.546 38.173  8.660   1.00 33.67  ? 1145 HOH C O   1 
HETATM 10237 O  O   . HOH CA 14 .   ? 101.293 38.250  5.136   1.00 27.07  ? 1146 HOH C O   1 
HETATM 10238 O  O   . HOH CA 14 .   ? 104.787 26.318  1.359   1.00 41.06  ? 1148 HOH C O   1 
HETATM 10239 O  O   . HOH CA 14 .   ? 109.685 27.214  4.615   1.00 38.52  ? 1149 HOH C O   1 
HETATM 10240 O  O   . HOH CA 14 .   ? 103.793 26.581  8.665   1.00 44.71  ? 1150 HOH C O   1 
HETATM 10241 O  O   . HOH CA 14 .   ? 120.089 32.663  6.828   1.00 76.24  ? 1152 HOH C O   1 
HETATM 10242 O  O   . HOH CA 14 .   ? 117.455 32.605  5.503   1.00 42.53  ? 1154 HOH C O   1 
HETATM 10243 O  O   . HOH CA 14 .   ? 95.184  35.079  4.496   1.00 39.75  ? 1155 HOH C O   1 
HETATM 10244 O  O   . HOH CA 14 .   ? 99.738  36.857  3.255   1.00 40.52  ? 1156 HOH C O   1 
HETATM 10245 O  O   . HOH CA 14 .   ? 87.899  57.007  13.873  1.00 62.49  ? 1157 HOH C O   1 
HETATM 10246 O  O   . HOH CA 14 .   ? 90.098  59.204  9.390   1.00 53.27  ? 1158 HOH C O   1 
HETATM 10247 O  O   . HOH CA 14 .   ? 88.955  58.246  16.501  1.00 41.97  ? 1159 HOH C O   1 
HETATM 10248 O  O   . HOH CA 14 .   ? 88.418  54.726  21.366  1.00 51.85  ? 1160 HOH C O   1 
HETATM 10249 O  O   . HOH CA 14 .   ? 91.313  48.492  22.955  1.00 32.04  ? 1161 HOH C O   1 
HETATM 10250 O  O   . HOH CA 14 .   ? 89.353  59.226  23.329  1.00 37.47  ? 1162 HOH C O   1 
HETATM 10251 O  O   . HOH CA 14 .   ? 80.365  36.355  14.013  1.00 47.66  ? 1165 HOH C O   1 
HETATM 10252 O  O   . HOH CA 14 .   ? 115.879 30.997  9.575   1.00 45.16  ? 1166 HOH C O   1 
HETATM 10253 O  O   . HOH CA 14 .   ? 89.858  45.234  16.293  1.00 24.49  ? 1167 HOH C O   1 
HETATM 10254 O  O   . HOH CA 14 .   ? 88.115  47.252  19.326  1.00 69.09  ? 1168 HOH C O   1 
HETATM 10255 O  O   . HOH CA 14 .   ? 98.955  44.518  10.720  1.00 72.18  ? 1171 HOH C O   1 
HETATM 10256 O  O   . HOH CA 14 .   ? 104.403 20.921  19.847  1.00 54.53  ? 1173 HOH C O   1 
HETATM 10257 O  O   . HOH CA 14 .   ? 104.457 17.676  22.345  1.00 54.82  ? 1174 HOH C O   1 
HETATM 10258 O  O   . HOH CA 14 .   ? 77.363  37.766  18.483  1.00 72.58  ? 1178 HOH C O   1 
HETATM 10259 O  O   . HOH CA 14 .   ? 73.636  19.840  21.880  1.00 42.71  ? 1184 HOH C O   1 
HETATM 10260 O  O   . HOH CA 14 .   ? 70.712  27.155  22.044  1.00 41.16  ? 1185 HOH C O   1 
HETATM 10261 O  O   . HOH CA 14 .   ? 76.895  27.427  15.909  1.00 44.11  ? 1186 HOH C O   1 
HETATM 10262 O  O   . HOH CA 14 .   ? 98.720  61.509  20.258  1.00 40.77  ? 1187 HOH C O   1 
HETATM 10263 O  O   . HOH CA 14 .   ? 97.184  58.709  17.629  1.00 37.52  ? 1188 HOH C O   1 
HETATM 10264 O  O   . HOH CA 14 .   ? 95.679  59.163  21.519  1.00 31.90  ? 1189 HOH C O   1 
HETATM 10265 O  O   . HOH CA 14 .   ? 97.487  53.308  30.846  1.00 51.82  ? 1190 HOH C O   1 
HETATM 10266 O  O   . HOH CA 14 .   ? 66.644  12.278  24.044  1.00 61.66  ? 1191 HOH C O   1 
HETATM 10267 O  O   . HOH CA 14 .   ? 93.169  41.258  31.683  1.00 46.72  ? 1192 HOH C O   1 
HETATM 10268 O  O   . HOH CA 14 .   ? 91.746  37.450  31.754  1.00 71.00  ? 1193 HOH C O   1 
HETATM 10269 O  O   . HOH CA 14 .   ? 88.658  35.881  31.860  1.00 46.74  ? 1194 HOH C O   1 
HETATM 10270 O  O   . HOH CA 14 .   ? 94.290  38.551  31.927  1.00 45.33  ? 1195 HOH C O   1 
HETATM 10271 O  O   . HOH CA 14 .   ? 95.850  38.272  34.468  1.00 58.75  ? 1196 HOH C O   1 
HETATM 10272 O  O   . HOH CA 14 .   ? 90.254  41.903  30.937  1.00 55.19  ? 1200 HOH C O   1 
HETATM 10273 O  O   . HOH CA 14 .   ? 88.830  42.861  27.892  1.00 62.80  ? 1202 HOH C O   1 
HETATM 10274 O  O   . HOH CA 14 .   ? 88.957  38.712  26.461  1.00 62.47  ? 1203 HOH C O   1 
HETATM 10275 O  O   . HOH CA 14 .   ? 88.186  57.542  21.683  1.00 47.64  ? 1207 HOH C O   1 
HETATM 10276 O  O   . HOH CA 14 .   ? 87.167  58.272  18.936  1.00 64.45  ? 1208 HOH C O   1 
HETATM 10277 O  O   . HOH CA 14 .   ? 75.959  34.553  12.391  1.00 69.42  ? 1209 HOH C O   1 
HETATM 10278 O  O   . HOH CA 14 .   ? 118.855 39.666  25.785  1.00 44.26  ? 1211 HOH C O   1 
HETATM 10279 O  O   . HOH CA 14 .   ? 78.664  24.327  30.408  1.00 64.28  ? 1212 HOH C O   1 
HETATM 10280 O  O   . HOH CA 14 .   ? 78.895  26.807  28.644  1.00 52.38  ? 1213 HOH C O   1 
HETATM 10281 O  O   . HOH CA 14 .   ? 96.169  44.270  8.630   1.00 79.59  ? 1214 HOH C O   1 
HETATM 10282 O  O   . HOH CA 14 .   ? 91.999  28.305  11.072  1.00 27.37  ? 1217 HOH C O   1 
HETATM 10283 O  O   . HOH CA 14 .   ? 71.629  15.285  29.824  1.00 53.56  ? 1219 HOH C O   1 
HETATM 10284 O  O   . HOH CA 14 .   ? 111.390 25.210  4.882   1.00 42.81  ? 1220 HOH C O   1 
HETATM 10285 O  O   . HOH CA 14 .   ? 77.302  12.557  4.403   1.00 45.72  ? 1221 HOH C O   1 
HETATM 10286 O  O   . HOH CA 14 .   ? 109.490 48.011  34.534  1.00 53.52  ? 1222 HOH C O   1 
HETATM 10287 O  O   . HOH CA 14 .   ? 105.611 28.561  11.119  1.00 25.40  ? 1225 HOH C O   1 
HETATM 10288 O  O   . HOH CA 14 .   ? 101.266 40.830  6.641   1.00 43.45  ? 1232 HOH C O   1 
HETATM 10289 O  O   . HOH CA 14 .   ? 94.485  46.383  10.666  1.00 50.76  ? 1233 HOH C O   1 
HETATM 10290 O  O   . HOH CA 14 .   ? 72.623  31.860  16.949  1.00 63.54  ? 1234 HOH C O   1 
HETATM 10291 O  O   . HOH CA 14 .   ? 89.033  45.688  24.004  1.00 50.63  ? 1235 HOH C O   1 
HETATM 10292 O  O   . HOH CA 14 .   ? 89.677  46.481  27.899  1.00 67.05  ? 1236 HOH C O   1 
HETATM 10293 O  O   . HOH DA 14 .   ? 99.087  60.243  15.785  1.00 20.96  ? 902  HOH L O   1 
HETATM 10294 O  O   . HOH DA 14 .   ? 98.122  56.840  13.691  1.00 16.66  ? 903  HOH L O   1 
HETATM 10295 O  O   . HOH DA 14 .   ? 111.199 44.756  11.183  1.00 21.00  ? 909  HOH L O   1 
HETATM 10296 O  O   . HOH DA 14 .   ? 111.108 50.269  14.021  1.00 26.78  ? 910  HOH L O   1 
HETATM 10297 O  O   . HOH DA 14 .   ? 108.609 51.237  14.146  1.00 30.95  ? 911  HOH L O   1 
HETATM 10298 O  O   . HOH DA 14 .   ? 99.817  63.851  13.962  1.00 20.90  ? 922  HOH L O   1 
HETATM 10299 O  O   . HOH DA 14 .   ? 111.745 53.113  20.798  1.00 24.48  ? 927  HOH L O   1 
HETATM 10300 O  O   . HOH DA 14 .   ? 109.879 56.753  23.972  1.00 14.06  ? 930  HOH L O   1 
HETATM 10301 O  O   . HOH DA 14 .   ? 108.247 65.352  28.877  1.00 27.35  ? 936  HOH L O   1 
HETATM 10302 O  O   . HOH DA 14 .   ? 113.537 44.981  -3.243  1.00 55.76  ? 946  HOH L O   1 
HETATM 10303 O  O   . HOH DA 14 .   ? 98.577  48.997  11.678  1.00 40.21  ? 958  HOH L O   1 
HETATM 10304 O  O   . HOH DA 14 .   ? 96.040  57.203  15.076  1.00 21.63  ? 962  HOH L O   1 
HETATM 10305 O  O   . HOH DA 14 .   ? 95.051  55.447  16.850  1.00 21.28  ? 965  HOH L O   1 
HETATM 10306 O  O   . HOH DA 14 .   ? 93.739  60.574  28.453  1.00 33.32  ? 971  HOH L O   1 
HETATM 10307 O  O   . HOH DA 14 .   ? 96.583  70.438  30.332  1.00 40.83  ? 974  HOH L O   1 
HETATM 10308 O  O   . HOH DA 14 .   ? 109.103 68.911  29.120  1.00 25.48  ? 989  HOH L O   1 
HETATM 10309 O  O   . HOH DA 14 .   ? 112.672 87.027  12.576  1.00 25.01  ? 992  HOH L O   1 
HETATM 10310 O  O   . HOH DA 14 .   ? 113.561 54.673  7.510   1.00 20.41  ? 993  HOH L O   1 
HETATM 10311 O  O   . HOH DA 14 .   ? 114.848 74.983  4.853   1.00 24.50  ? 994  HOH L O   1 
HETATM 10312 O  O   . HOH DA 14 .   ? 124.065 95.648  16.552  1.00 21.80  ? 1000 HOH L O   1 
HETATM 10313 O  O   . HOH DA 14 .   ? 141.222 65.419  -11.028 1.00 31.16  ? 1008 HOH L O   1 
HETATM 10314 O  O   . HOH DA 14 .   ? 142.604 82.965  -1.978  1.00 18.63  ? 1014 HOH L O   1 
HETATM 10315 O  O   . HOH DA 14 .   ? 139.940 69.993  1.828   1.00 39.84  ? 1018 HOH L O   1 
HETATM 10316 O  O   . HOH DA 14 .   ? 115.987 105.008 3.746   1.00 28.21  ? 1019 HOH L O   1 
HETATM 10317 O  O   . HOH DA 14 .   ? 120.600 98.411  4.578   1.00 17.07  ? 1021 HOH L O   1 
HETATM 10318 O  O   . HOH DA 14 .   ? 107.431 96.305  10.295  1.00 26.66  ? 1025 HOH L O   1 
HETATM 10319 O  O   . HOH DA 14 .   ? 140.440 73.457  -10.801 1.00 35.37  ? 1029 HOH L O   1 
HETATM 10320 O  O   . HOH DA 14 .   ? 115.381 92.306  -1.465  1.00 40.29  ? 1031 HOH L O   1 
HETATM 10321 O  O   . HOH DA 14 .   ? 145.840 80.489  7.335   1.00 37.00  ? 1033 HOH L O   1 
HETATM 10322 O  O   . HOH DA 14 .   ? 129.241 101.873 8.832   1.00 36.72  ? 1052 HOH L O   1 
HETATM 10323 O  O   . HOH DA 14 .   ? 107.233 98.977  11.272  1.00 32.48  ? 1054 HOH L O   1 
HETATM 10324 O  O   . HOH DA 14 .   ? 109.365 92.685  12.067  1.00 33.92  ? 1056 HOH L O   1 
HETATM 10325 O  O   . HOH DA 14 .   ? 146.740 78.324  8.550   1.00 44.86  ? 1066 HOH L O   1 
HETATM 10326 O  O   . HOH DA 14 .   ? 117.455 86.092  3.318   1.00 20.01  ? 1067 HOH L O   1 
HETATM 10327 O  O   . HOH DA 14 .   ? 128.680 76.021  -8.728  1.00 47.93  ? 1068 HOH L O   1 
HETATM 10328 O  O   . HOH DA 14 .   ? 96.497  70.586  27.326  1.00 33.00  ? 1091 HOH L O   1 
HETATM 10329 O  O   . HOH DA 14 .   ? 132.444 73.523  -0.865  1.00 25.79  ? 1098 HOH L O   1 
HETATM 10330 O  O   . HOH DA 14 .   ? 132.509 75.945  -1.962  1.00 23.84  ? 1099 HOH L O   1 
HETATM 10331 O  O   . HOH DA 14 .   ? 92.758  66.838  34.373  1.00 49.09  ? 1101 HOH L O   1 
HETATM 10332 O  O   . HOH DA 14 .   ? 98.826  70.767  32.203  1.00 38.96  ? 1103 HOH L O   1 
HETATM 10333 O  O   . HOH DA 14 .   ? 118.706 88.330  -4.118  1.00 38.98  ? 1114 HOH L O   1 
HETATM 10334 O  O   . HOH DA 14 .   ? 149.288 73.738  -4.629  1.00 56.27  ? 1119 HOH L O   1 
HETATM 10335 O  O   . HOH DA 14 .   ? 144.342 78.823  11.450  1.00 44.93  ? 1127 HOH L O   1 
HETATM 10336 O  O   . HOH DA 14 .   ? 112.109 96.176  -2.194  1.00 75.35  ? 1128 HOH L O   1 
HETATM 10337 O  O   . HOH DA 14 .   ? 115.078 94.817  -0.885  1.00 46.75  ? 1130 HOH L O   1 
HETATM 10338 O  O   . HOH DA 14 .   ? 135.729 77.650  -6.178  1.00 32.15  ? 1137 HOH L O   1 
HETATM 10339 O  O   . HOH DA 14 .   ? 134.726 79.353  -2.143  1.00 24.34  ? 1138 HOH L O   1 
HETATM 10340 O  O   . HOH DA 14 .   ? 129.783 77.787  -10.308 1.00 72.44  ? 1139 HOH L O   1 
HETATM 10341 O  O   . HOH DA 14 .   ? 133.443 102.417 12.643  1.00 60.94  ? 1143 HOH L O   1 
HETATM 10342 O  O   . HOH DA 14 .   ? 100.864 44.915  8.064   1.00 25.40  ? 1147 HOH L O   1 
HETATM 10343 O  O   . HOH DA 14 .   ? 111.649 104.681 12.773  1.00 52.92  ? 1163 HOH L O   1 
HETATM 10344 O  O   . HOH DA 14 .   ? 109.455 102.194 6.961   1.00 30.40  ? 1164 HOH L O   1 
HETATM 10345 O  O   . HOH DA 14 .   ? 84.684  67.620  16.176  1.00 53.44  ? 1180 HOH L O   1 
HETATM 10346 O  O   . HOH DA 14 .   ? 123.329 105.694 14.289  1.00 46.99  ? 1218 HOH L O   1 
HETATM 10347 O  O   . HOH DA 14 .   ? 113.040 92.906  -3.394  1.00 67.24  ? 1231 HOH L O   1 
HETATM 10348 O  O   . HOH DA 14 .   ? 103.365 68.265  33.548  1.00 34.87  ? 1237 HOH L O   1 
HETATM 10349 O  O   . HOH DA 14 .   ? 103.970 69.860  35.601  1.00 27.51  ? 1238 HOH L O   1 
HETATM 10350 O  O   . HOH EA 14 .   ? 112.455 50.632  20.596  1.00 26.24  ? 908  HOH M O   1 
HETATM 10351 O  O   . HOH EA 14 .   ? 129.302 49.363  23.783  1.00 25.31  ? 912  HOH M O   1 
HETATM 10352 O  O   . HOH EA 14 .   ? 126.888 46.330  18.025  1.00 14.07  ? 913  HOH M O   1 
HETATM 10353 O  O   . HOH EA 14 .   ? 113.628 48.585  12.636  1.00 25.03  ? 920  HOH M O   1 
HETATM 10354 O  O   . HOH EA 14 .   ? 122.009 37.872  13.851  1.00 28.52  ? 923  HOH M O   1 
HETATM 10355 O  O   . HOH EA 14 .   ? 123.037 41.605  15.438  1.00 27.49  ? 924  HOH M O   1 
HETATM 10356 O  O   . HOH EA 14 .   ? 124.966 44.654  28.855  1.00 21.96  ? 935  HOH M O   1 
HETATM 10357 O  O   . HOH EA 14 .   ? 122.780 42.202  30.839  1.00 35.42  ? 939  HOH M O   1 
HETATM 10358 O  O   . HOH EA 14 .   ? 130.993 26.197  7.605   1.00 47.41  ? 941  HOH M O   1 
HETATM 10359 O  O   . HOH EA 14 .   ? 112.761 47.972  25.274  1.00 23.99  ? 942  HOH M O   1 
HETATM 10360 O  O   . HOH EA 14 .   ? 119.714 43.483  1.260   1.00 35.63  ? 947  HOH M O   1 
HETATM 10361 O  O   . HOH EA 14 .   ? 117.347 37.725  5.193   1.00 30.42  ? 953  HOH M O   1 
HETATM 10362 O  O   . HOH EA 14 .   ? 116.467 41.134  9.563   1.00 19.89  ? 957  HOH M O   1 
HETATM 10363 O  O   . HOH EA 14 .   ? 122.603 37.907  16.374  1.00 17.16  ? 964  HOH M O   1 
HETATM 10364 O  O   . HOH EA 14 .   ? 96.604  50.659  30.487  1.00 20.08  ? 975  HOH M O   1 
HETATM 10365 O  O   . HOH EA 14 .   ? 126.743 53.947  33.817  1.00 39.67  ? 977  HOH M O   1 
HETATM 10366 O  O   . HOH EA 14 .   ? 96.752  41.090  34.928  1.00 31.32  ? 978  HOH M O   1 
HETATM 10367 O  O   . HOH EA 14 .   ? 132.620 26.937  9.431   1.00 35.13  ? 981  HOH M O   1 
HETATM 10368 O  O   . HOH EA 14 .   ? 121.228 66.880  8.810   1.00 23.86  ? 990  HOH M O   1 
HETATM 10369 O  O   . HOH EA 14 .   ? 116.610 60.110  21.958  1.00 17.24  ? 991  HOH M O   1 
HETATM 10370 O  O   . HOH EA 14 .   ? 133.614 69.607  -11.553 1.00 32.38  ? 996  HOH M O   1 
HETATM 10371 O  O   . HOH EA 14 .   ? 121.421 87.065  -4.555  1.00 22.30  ? 997  HOH M O   1 
HETATM 10372 O  O   . HOH EA 14 .   ? 135.530 85.327  8.219   1.00 20.52  ? 1001 HOH M O   1 
HETATM 10373 O  O   . HOH EA 14 .   ? 136.113 83.972  12.002  1.00 17.81  ? 1002 HOH M O   1 
HETATM 10374 O  O   . HOH EA 14 .   ? 133.369 97.900  4.926   1.00 43.26  ? 1003 HOH M O   1 
HETATM 10375 O  O   . HOH EA 14 .   ? 140.077 82.053  -5.184  1.00 34.01  ? 1012 HOH M O   1 
HETATM 10376 O  O   . HOH EA 14 .   ? 136.760 86.113  -4.705  1.00 30.49  ? 1013 HOH M O   1 
HETATM 10377 O  O   . HOH EA 14 .   ? 132.461 78.772  -1.277  1.00 21.83  ? 1016 HOH