data_5T4S
# 
_entry.id   5T4S 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5T4S         
WWPDB D_1000223698 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5T4S 
_pdbx_database_status.recvd_initial_deposition_date   2016-08-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Snell, G.P.'  1 
'Behnke, C.A.' 2 
'Okada, K.'    3 
'Oki, H.'      4 
'Sang, B.C.'   5 
'Lane, W.'     6 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Bioorg.Med.Chem. 
_citation.journal_id_ASTM           BMECEP 
_citation.journal_id_CSD            1200 
_citation.journal_id_ISSN           1464-3391 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                6066 
_citation.page_last                 6074 
_citation.title                     'Novel approach of fragment-based lead discovery applied to renin inhibitors.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.bmc.2016.09.065 
_citation.pdbx_database_id_PubMed   27720325 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tawada, M.'   1  ? 
primary 'Suzuki, S.'   2  ? 
primary 'Imaeda, Y.'   3  ? 
primary 'Oki, H.'      4  ? 
primary 'Snell, G.'    5  ? 
primary 'Behnke, C.A.' 6  ? 
primary 'Kondo, M.'    7  ? 
primary 'Tarui, N.'    8  ? 
primary 'Tanaka, T.'   9  ? 
primary 'Kuroita, T.'  10 ? 
primary 'Tomimoto, M.' 11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5T4S 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     139.927 
_cell.length_a_esd                 ? 
_cell.length_b                     139.927 
_cell.length_b_esd                 ? 
_cell.length_c                     139.927 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        24 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5T4S 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                198 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Renin                                                            37153.852 2   3.4.23.15 ? ? ? 
2 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose                         221.208   2   ?         ? ? ? 
3 non-polymer syn '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' 266.331   1   ?         ? ? ? 
4 non-polymer syn 'DIMETHYL SULFOXIDE'                                             78.133    2   ?         ? ? ? 
5 non-polymer syn '6-chloro-N-[(furan-2-yl)methyl]pyrazin-2-amine'                 209.632   1   ?         ? ? ? 
6 non-polymer syn 'TRIETHYLENE GLYCOL'                                             150.173   1   ?         ? ? ? 
7 water       nat water                                                            18.015    141 ?         ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Angiotensinogenase 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;TLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTL
RYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFY
YNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEK
LMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIR
KFYTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;TLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTL
RYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFY
YNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEK
LMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIR
KFYTEFDRRNNRIGFALAR
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   LEU n 
1 3   GLY n 
1 4   ASN n 
1 5   THR n 
1 6   THR n 
1 7   SER n 
1 8   SER n 
1 9   VAL n 
1 10  ILE n 
1 11  LEU n 
1 12  THR n 
1 13  ASN n 
1 14  TYR n 
1 15  MET n 
1 16  ASP n 
1 17  THR n 
1 18  GLN n 
1 19  TYR n 
1 20  TYR n 
1 21  GLY n 
1 22  GLU n 
1 23  ILE n 
1 24  GLY n 
1 25  ILE n 
1 26  GLY n 
1 27  THR n 
1 28  PRO n 
1 29  PRO n 
1 30  GLN n 
1 31  THR n 
1 32  PHE n 
1 33  LYS n 
1 34  VAL n 
1 35  VAL n 
1 36  PHE n 
1 37  ASP n 
1 38  THR n 
1 39  GLY n 
1 40  SER n 
1 41  SER n 
1 42  ASN n 
1 43  VAL n 
1 44  TRP n 
1 45  VAL n 
1 46  PRO n 
1 47  SER n 
1 48  SER n 
1 49  LYS n 
1 50  CYS n 
1 51  SER n 
1 52  ARG n 
1 53  LEU n 
1 54  TYR n 
1 55  THR n 
1 56  ALA n 
1 57  CYS n 
1 58  VAL n 
1 59  TYR n 
1 60  HIS n 
1 61  LYS n 
1 62  LEU n 
1 63  PHE n 
1 64  ASP n 
1 65  ALA n 
1 66  SER n 
1 67  ASP n 
1 68  SER n 
1 69  SER n 
1 70  SER n 
1 71  TYR n 
1 72  LYS n 
1 73  HIS n 
1 74  ASN n 
1 75  GLY n 
1 76  THR n 
1 77  GLU n 
1 78  LEU n 
1 79  THR n 
1 80  LEU n 
1 81  ARG n 
1 82  TYR n 
1 83  SER n 
1 84  THR n 
1 85  GLY n 
1 86  THR n 
1 87  VAL n 
1 88  SER n 
1 89  GLY n 
1 90  PHE n 
1 91  LEU n 
1 92  SER n 
1 93  GLN n 
1 94  ASP n 
1 95  ILE n 
1 96  ILE n 
1 97  THR n 
1 98  VAL n 
1 99  GLY n 
1 100 GLY n 
1 101 ILE n 
1 102 THR n 
1 103 VAL n 
1 104 THR n 
1 105 GLN n 
1 106 MET n 
1 107 PHE n 
1 108 GLY n 
1 109 GLU n 
1 110 VAL n 
1 111 THR n 
1 112 GLU n 
1 113 MET n 
1 114 PRO n 
1 115 ALA n 
1 116 LEU n 
1 117 PRO n 
1 118 PHE n 
1 119 MET n 
1 120 LEU n 
1 121 ALA n 
1 122 GLU n 
1 123 PHE n 
1 124 ASP n 
1 125 GLY n 
1 126 VAL n 
1 127 VAL n 
1 128 GLY n 
1 129 MET n 
1 130 GLY n 
1 131 PHE n 
1 132 ILE n 
1 133 GLU n 
1 134 GLN n 
1 135 ALA n 
1 136 ILE n 
1 137 GLY n 
1 138 ARG n 
1 139 VAL n 
1 140 THR n 
1 141 PRO n 
1 142 ILE n 
1 143 PHE n 
1 144 ASP n 
1 145 ASN n 
1 146 ILE n 
1 147 ILE n 
1 148 SER n 
1 149 GLN n 
1 150 GLY n 
1 151 VAL n 
1 152 LEU n 
1 153 LYS n 
1 154 GLU n 
1 155 ASP n 
1 156 VAL n 
1 157 PHE n 
1 158 SER n 
1 159 PHE n 
1 160 TYR n 
1 161 TYR n 
1 162 ASN n 
1 163 ARG n 
1 164 ASP n 
1 165 SER n 
1 166 GLU n 
1 167 ASN n 
1 168 SER n 
1 169 GLN n 
1 170 SER n 
1 171 LEU n 
1 172 GLY n 
1 173 GLY n 
1 174 GLN n 
1 175 ILE n 
1 176 VAL n 
1 177 LEU n 
1 178 GLY n 
1 179 GLY n 
1 180 SER n 
1 181 ASP n 
1 182 PRO n 
1 183 GLN n 
1 184 HIS n 
1 185 TYR n 
1 186 GLU n 
1 187 GLY n 
1 188 ASN n 
1 189 PHE n 
1 190 HIS n 
1 191 TYR n 
1 192 ILE n 
1 193 ASN n 
1 194 LEU n 
1 195 ILE n 
1 196 LYS n 
1 197 THR n 
1 198 GLY n 
1 199 VAL n 
1 200 TRP n 
1 201 GLN n 
1 202 ILE n 
1 203 GLN n 
1 204 MET n 
1 205 LYS n 
1 206 GLY n 
1 207 VAL n 
1 208 SER n 
1 209 VAL n 
1 210 GLY n 
1 211 SER n 
1 212 SER n 
1 213 THR n 
1 214 LEU n 
1 215 LEU n 
1 216 CYS n 
1 217 GLU n 
1 218 ASP n 
1 219 GLY n 
1 220 CYS n 
1 221 LEU n 
1 222 ALA n 
1 223 LEU n 
1 224 VAL n 
1 225 ASP n 
1 226 THR n 
1 227 GLY n 
1 228 ALA n 
1 229 SER n 
1 230 TYR n 
1 231 ILE n 
1 232 SER n 
1 233 GLY n 
1 234 SER n 
1 235 THR n 
1 236 SER n 
1 237 SER n 
1 238 ILE n 
1 239 GLU n 
1 240 LYS n 
1 241 LEU n 
1 242 MET n 
1 243 GLU n 
1 244 ALA n 
1 245 LEU n 
1 246 GLY n 
1 247 ALA n 
1 248 LYS n 
1 249 LYS n 
1 250 ARG n 
1 251 LEU n 
1 252 PHE n 
1 253 ASP n 
1 254 TYR n 
1 255 VAL n 
1 256 VAL n 
1 257 LYS n 
1 258 CYS n 
1 259 ASN n 
1 260 GLU n 
1 261 GLY n 
1 262 PRO n 
1 263 THR n 
1 264 LEU n 
1 265 PRO n 
1 266 ASP n 
1 267 ILE n 
1 268 SER n 
1 269 PHE n 
1 270 HIS n 
1 271 LEU n 
1 272 GLY n 
1 273 GLY n 
1 274 LYS n 
1 275 GLU n 
1 276 TYR n 
1 277 THR n 
1 278 LEU n 
1 279 THR n 
1 280 SER n 
1 281 ALA n 
1 282 ASP n 
1 283 TYR n 
1 284 VAL n 
1 285 PHE n 
1 286 GLN n 
1 287 GLU n 
1 288 SER n 
1 289 TYR n 
1 290 SER n 
1 291 SER n 
1 292 LYS n 
1 293 LYS n 
1 294 LEU n 
1 295 CYS n 
1 296 THR n 
1 297 LEU n 
1 298 ALA n 
1 299 ILE n 
1 300 HIS n 
1 301 ALA n 
1 302 MET n 
1 303 ASP n 
1 304 ILE n 
1 305 PRO n 
1 306 PRO n 
1 307 PRO n 
1 308 THR n 
1 309 GLY n 
1 310 PRO n 
1 311 THR n 
1 312 TRP n 
1 313 ALA n 
1 314 LEU n 
1 315 GLY n 
1 316 ALA n 
1 317 THR n 
1 318 PHE n 
1 319 ILE n 
1 320 ARG n 
1 321 LYS n 
1 322 PHE n 
1 323 TYR n 
1 324 THR n 
1 325 GLU n 
1 326 PHE n 
1 327 ASP n 
1 328 ARG n 
1 329 ARG n 
1 330 ASN n 
1 331 ASN n 
1 332 ARG n 
1 333 ILE n 
1 334 GLY n 
1 335 PHE n 
1 336 ALA n 
1 337 LEU n 
1 338 ALA n 
1 339 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   339 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 REN 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               Human 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            'HEK 293' 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RENI_HUMAN 
_struct_ref.pdbx_db_accession          P00797 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTL
RYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFY
YNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEK
LMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIR
KFYTEFDRRNNRIGFALAR
;
_struct_ref.pdbx_align_begin           68 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5T4S A 1 ? 339 ? P00797 68 ? 406 ? 2 340 
2 1 5T4S B 1 ? 339 ? P00797 68 ? 406 ? 2 340 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
77O non-polymer                  . '6-chloro-N-[(furan-2-yl)methyl]pyrazin-2-amine'                 ? 'C9 H8 Cl N3 O'  209.632 
ALA 'L-peptide linking'          y ALANINE                                                          ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                                         ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                                                       ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                                                  ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                                         ? 'C3 H7 N O2 S'   121.158 
DMS non-polymer                  . 'DIMETHYL SULFOXIDE'                                             ? 'C2 H6 O S'      78.133  
GLN 'L-peptide linking'          y GLUTAMINE                                                        ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                                                  ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                                          ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                                        ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                                            ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                                                       ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                                          ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                                           ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                                                       ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose                         ? 'C8 H15 N O6'    221.208 
PG6 non-polymer                  . '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' ? 'C12 H26 O6'     266.331 
PGE non-polymer                  . 'TRIETHYLENE GLYCOL'                                             ? 'C6 H14 O4'      150.173 
PHE 'L-peptide linking'          y PHENYLALANINE                                                    ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                                          ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                                           ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'          y THREONINE                                                        ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                                                       ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                                         ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                                           ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5T4S 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.07 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         59.97 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.764 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.9 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '26% PEG600, 0.06M citrate, 0.04M citric acid' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 4r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2006-08-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si(220)' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.3' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.3 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5T4S 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.640 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       27163 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.000 
_reflns.pdbx_Rmerge_I_obs                0.073 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         19.397 
_reflns.pdbx_netI_over_sigmaI            13.500 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.083 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         135521 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.640 2.730  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.565 ? ? ? ? ? ? ? ? 4.400 ? ? ? ? ? ? ? 1  1 ? ? 
2.730 2.840  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.435 ? ? ? ? ? ? ? ? 4.500 ? ? ? ? ? ? ? 2  1 ? ? 
2.840 2.970  ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.297 ? ? ? ? ? ? ? ? 4.700 ? ? ? ? ? ? ? 3  1 ? ? 
2.970 3.130  ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.205 ? ? ? ? ? ? ? ? 4.800 ? ? ? ? ? ? ? 4  1 ? ? 
3.130 3.330  ? ? ? ? ? ? ? 99.800  ? ? ? ? 0.132 ? ? ? ? ? ? ? ? 5.000 ? ? ? ? ? ? ? 5  1 ? ? 
3.330 3.580  ? ? ? ? ? ? ? 99.700  ? ? ? ? 0.092 ? ? ? ? ? ? ? ? 5.200 ? ? ? ? ? ? ? 6  1 ? ? 
3.580 3.940  ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.070 ? ? ? ? ? ? ? ? 5.400 ? ? ? ? ? ? ? 7  1 ? ? 
3.940 4.510  ? ? ? ? ? ? ? 99.900  ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 5.300 ? ? ? ? ? ? ? 8  1 ? ? 
4.510 5.690  ? ? ? ? ? ? ? 100.000 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 5.300 ? ? ? ? ? ? ? 9  1 ? ? 
5.690 50.000 ? ? ? ? ? ? ? 99.700  ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 5.200 ? ? ? ? ? ? ? 10 1 ? ? 
# 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            0.0000 
_refine.B_iso_max                                131.460 
_refine.B_iso_mean                               60.7850 
_refine.B_iso_min                                35.250 
_refine.correlation_coeff_Fo_to_Fc               0.9470 
_refine.correlation_coeff_Fo_to_Fc_free          0.9210 
_refine.details                                  'U VALUES      : WITH TLS ADDED' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5T4S 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.6400 
_refine.ls_d_res_low                             50.0 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     25595 
_refine.ls_number_reflns_R_free                  1352 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.2000 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2076 
_refine.ls_R_factor_R_free                       0.2581 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2048 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.6010 
_refine.pdbx_overall_ESU_R_Free                  0.3160 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             23.4640 
_refine.overall_SU_ML                            0.2440 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.6400 
_refine_hist.d_res_low                        50.0 
_refine_hist.pdbx_number_atoms_ligand         78 
_refine_hist.number_atoms_solvent             141 
_refine_hist.number_atoms_total               5282 
_refine_hist.pdbx_number_residues_total       665 
_refine_hist.pdbx_B_iso_mean_ligand           72.45 
_refine_hist.pdbx_B_iso_mean_solvent          52.63 
_refine_hist.pdbx_number_atoms_protein        5063 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.008  0.019  5267 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 1.339  1.960  7137 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 7.076  5.000  661  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 35.099 24.292 212  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 16.798 15.000 810  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 16.918 15.000 16   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.081  0.200  809  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.021  3916 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 1.454  4.242  2656 ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 2.400  6.355  3310 ? r_mcangle_it           ? ? 
'X-RAY DIFFRACTION' ? 1.826  4.387  2611 ? r_scbond_it            ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.6380 
_refine_ls_shell.d_res_low                        2.7060 
_refine_ls_shell.number_reflns_all                1962 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             87 
_refine_ls_shell.number_reflns_R_work             1875 
_refine_ls_shell.percent_reflns_obs               99.9000 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.4000 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.2850 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5T4S 
_struct.title                        'Novel Approach of Fragment-Based Lead Discovery applied to Renin Inhibitors' 
_struct.pdbx_descriptor              'Renin (E.C.3.4.23.15)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5T4S 
_struct_keywords.text            'protein-ligand complex, HYDROLASE-HYDROLASE inhibitor complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE inhibitor' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 4 ? 
G N N 2 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 7 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TYR A 54  ? TYR A 59  ? TYR A 55  TYR A 60  1 ? 6  
HELX_P HELX_P2  AA2 ASP A 64  ? SER A 68  ? ASP A 65  SER A 69  5 ? 5  
HELX_P HELX_P3  AA3 PRO A 114 ? MET A 119 ? PRO A 115 MET A 120 1 ? 6  
HELX_P HELX_P4  AA4 PHE A 131 ? VAL A 139 ? PHE A 132 VAL A 140 5 ? 9  
HELX_P HELX_P5  AA5 PRO A 141 ? GLN A 149 ? PRO A 142 GLN A 150 1 ? 9  
HELX_P HELX_P6  AA6 ASP A 181 ? GLN A 183 ? ASP A 182 GLN A 184 5 ? 3  
HELX_P HELX_P7  AA7 SER A 234 ? GLY A 246 ? SER A 235 GLY A 247 1 ? 13 
HELX_P HELX_P8  AA8 ASN A 259 ? GLY A 261 ? ASN A 260 GLY A 262 5 ? 3  
HELX_P HELX_P9  AA9 THR A 279 ? VAL A 284 ? THR A 280 VAL A 285 1 ? 6  
HELX_P HELX_P10 AB1 GLY A 315 ? LYS A 321 ? GLY A 316 LYS A 322 1 ? 7  
HELX_P HELX_P11 AB2 TYR B 54  ? VAL B 58  ? TYR B 55  VAL B 59  5 ? 5  
HELX_P HELX_P12 AB3 ASP B 64  ? SER B 68  ? ASP B 65  SER B 69  5 ? 5  
HELX_P HELX_P13 AB4 PRO B 114 ? MET B 119 ? PRO B 115 MET B 120 1 ? 6  
HELX_P HELX_P14 AB5 PHE B 131 ? ALA B 135 ? PHE B 132 ALA B 136 5 ? 5  
HELX_P HELX_P15 AB6 PRO B 141 ? GLN B 149 ? PRO B 142 GLN B 150 1 ? 9  
HELX_P HELX_P16 AB7 ASP B 181 ? GLN B 183 ? ASP B 182 GLN B 184 5 ? 3  
HELX_P HELX_P17 AB8 SER B 234 ? GLY B 246 ? SER B 235 GLY B 247 1 ? 13 
HELX_P HELX_P18 AB9 ASN B 259 ? LEU B 264 ? ASN B 260 LEU B 265 5 ? 6  
HELX_P HELX_P19 AC1 THR B 279 ? VAL B 284 ? THR B 280 VAL B 285 1 ? 6  
HELX_P HELX_P20 AC2 GLY B 315 ? LYS B 321 ? GLY B 316 LYS B 322 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 50  SG  ? ? ? 1_555 A CYS 57  SG ? ? A CYS 51  A CYS 58  1_555 ? ? ? ? ? ? ? 2.024 ? ?               
disulf2 disulf ?   ? A CYS 216 SG  ? ? ? 1_555 A CYS 220 SG ? ? A CYS 217 A CYS 221 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf3 disulf ?   ? A CYS 258 SG  ? ? ? 1_555 A CYS 295 SG ? ? A CYS 259 A CYS 296 1_555 ? ? ? ? ? ? ? 2.056 ? ?               
disulf4 disulf ?   ? B CYS 50  SG  ? ? ? 1_555 B CYS 57  SG ? ? B CYS 51  B CYS 58  1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf5 disulf ?   ? B CYS 216 SG  ? ? ? 1_555 B CYS 220 SG ? ? B CYS 217 B CYS 221 1_555 ? ? ? ? ? ? ? 2.027 ? ?               
disulf6 disulf ?   ? B CYS 258 SG  ? ? ? 1_555 B CYS 295 SG ? ? B CYS 259 B CYS 296 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
covale1 covale one ? A ASN 74  ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 75  A NAG 401 1_555 ? ? ? ? ? ? ? 1.449 ? N-Glycosylation 
covale2 covale one ? B ASN 74  ND2 ? ? ? 1_555 G NAG .   C1 ? ? B ASN 75  B NAG 401 1_555 ? ? ? ? ? ? ? 1.448 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 THR 27  A . ? THR 28  A PRO 28  A ? PRO 29  A 1 -5.18 
2 LEU 116 A . ? LEU 117 A PRO 117 A ? PRO 118 A 1 12.00 
3 PRO 306 A . ? PRO 307 A PRO 307 A ? PRO 308 A 1 3.23  
4 GLY 309 A . ? GLY 310 A PRO 310 A ? PRO 311 A 1 -2.14 
5 THR 27  B . ? THR 28  B PRO 28  B ? PRO 29  B 1 -1.57 
6 LEU 116 B . ? LEU 117 B PRO 117 B ? PRO 118 B 1 3.13  
7 PRO 306 B . ? PRO 307 B PRO 307 B ? PRO 308 B 1 6.95  
8 GLY 309 B . ? GLY 310 B PRO 310 B ? PRO 311 B 1 -2.59 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 9  ? 
AA2 ? 13 ? 
AA3 ? 5  ? 
AA4 ? 3  ? 
AA5 ? 3  ? 
AA6 ? 9  ? 
AA7 ? 13 ? 
AA8 ? 5  ? 
AA9 ? 4  ? 
AB1 ? 3  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? anti-parallel 
AA1 3  4  ? anti-parallel 
AA1 4  5  ? anti-parallel 
AA1 5  6  ? anti-parallel 
AA1 6  7  ? anti-parallel 
AA1 7  8  ? anti-parallel 
AA1 8  9  ? anti-parallel 
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? parallel      
AA2 4  5  ? anti-parallel 
AA2 5  6  ? parallel      
AA2 6  7  ? anti-parallel 
AA2 7  8  ? anti-parallel 
AA2 8  9  ? anti-parallel 
AA2 9  10 ? anti-parallel 
AA2 10 11 ? anti-parallel 
AA2 11 12 ? anti-parallel 
AA2 12 13 ? anti-parallel 
AA3 1  2  ? anti-parallel 
AA3 2  3  ? parallel      
AA3 3  4  ? anti-parallel 
AA3 4  5  ? parallel      
AA4 1  2  ? anti-parallel 
AA4 2  3  ? anti-parallel 
AA5 1  2  ? anti-parallel 
AA5 2  3  ? anti-parallel 
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? anti-parallel 
AA6 5  6  ? anti-parallel 
AA6 6  7  ? anti-parallel 
AA6 7  8  ? anti-parallel 
AA6 8  9  ? anti-parallel 
AA7 1  2  ? anti-parallel 
AA7 2  3  ? anti-parallel 
AA7 3  4  ? parallel      
AA7 4  5  ? anti-parallel 
AA7 5  6  ? parallel      
AA7 6  7  ? anti-parallel 
AA7 7  8  ? anti-parallel 
AA7 8  9  ? anti-parallel 
AA7 9  10 ? anti-parallel 
AA7 10 11 ? anti-parallel 
AA7 11 12 ? anti-parallel 
AA7 12 13 ? anti-parallel 
AA8 1  2  ? anti-parallel 
AA8 2  3  ? parallel      
AA8 3  4  ? anti-parallel 
AA8 4  5  ? parallel      
AA9 1  2  ? anti-parallel 
AA9 2  3  ? anti-parallel 
AA9 3  4  ? anti-parallel 
AB1 1  2  ? anti-parallel 
AB1 2  3  ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LYS A 72  ? ARG A 81  ? LYS A 73  ARG A 82  
AA1 2  THR A 86  ? VAL A 98  ? THR A 87  VAL A 99  
AA1 3  GLN A 18  ? ILE A 25  ? GLN A 19  ILE A 26  
AA1 4  SER A 7   ? TYR A 14  ? SER A 8   TYR A 15  
AA1 5  GLY A 173 ? LEU A 177 ? GLY A 174 LEU A 178 
AA1 6  VAL A 156 ? TYR A 161 ? VAL A 157 TYR A 162 
AA1 7  PHE A 322 ? ASP A 327 ? PHE A 323 ASP A 328 
AA1 8  ARG A 332 ? ALA A 338 ? ARG A 333 ALA A 339 
AA1 9  TYR A 185 ? ASN A 193 ? TYR A 186 ASN A 194 
AA2 1  LYS A 72  ? ARG A 81  ? LYS A 73  ARG A 82  
AA2 2  THR A 86  ? VAL A 98  ? THR A 87  VAL A 99  
AA2 3  ILE A 101 ? GLU A 112 ? ILE A 102 GLU A 113 
AA2 4  VAL A 43  ? PRO A 46  ? VAL A 44  PRO A 47  
AA2 5  GLY A 125 ? GLY A 128 ? GLY A 126 GLY A 129 
AA2 6  GLN A 30  ? ASP A 37  ? GLN A 31  ASP A 38  
AA2 7  GLN A 18  ? ILE A 25  ? GLN A 19  ILE A 26  
AA2 8  SER A 7   ? TYR A 14  ? SER A 8   TYR A 15  
AA2 9  GLY A 173 ? LEU A 177 ? GLY A 174 LEU A 178 
AA2 10 VAL A 156 ? TYR A 161 ? VAL A 157 TYR A 162 
AA2 11 PHE A 322 ? ASP A 327 ? PHE A 323 ASP A 328 
AA2 12 ARG A 332 ? ALA A 338 ? ARG A 333 ALA A 339 
AA2 13 TYR A 185 ? ASN A 193 ? TYR A 186 ASN A 194 
AA3 1  GLN A 201 ? MET A 204 ? GLN A 202 MET A 205 
AA3 2  CYS A 220 ? VAL A 224 ? CYS A 221 VAL A 225 
AA3 3  TRP A 312 ? LEU A 314 ? TRP A 313 LEU A 315 
AA3 4  ILE A 231 ? GLY A 233 ? ILE A 232 GLY A 234 
AA3 5  ILE A 299 ? ALA A 301 ? ILE A 300 ALA A 302 
AA4 1  GLY A 206 ? VAL A 209 ? GLY A 207 VAL A 210 
AA4 2  ILE A 267 ? LEU A 271 ? ILE A 268 LEU A 272 
AA4 3  LYS A 274 ? LEU A 278 ? LYS A 275 LEU A 279 
AA5 1  LYS A 248 ? LYS A 249 ? LYS A 249 LYS A 250 
AA5 2  TYR A 254 ? LYS A 257 ? TYR A 255 LYS A 258 
AA5 3  LEU A 294 ? THR A 296 ? LEU A 295 THR A 297 
AA6 1  LYS B 72  ? LEU B 80  ? LYS B 73  LEU B 81  
AA6 2  VAL B 87  ? VAL B 98  ? VAL B 88  VAL B 99  
AA6 3  GLN B 18  ? ILE B 25  ? GLN B 19  ILE B 26  
AA6 4  SER B 7   ? TYR B 14  ? SER B 8   TYR B 15  
AA6 5  GLY B 173 ? LEU B 177 ? GLY B 174 LEU B 178 
AA6 6  VAL B 156 ? TYR B 161 ? VAL B 157 TYR B 162 
AA6 7  PHE B 322 ? ASP B 327 ? PHE B 323 ASP B 328 
AA6 8  ARG B 332 ? ALA B 338 ? ARG B 333 ALA B 339 
AA6 9  TYR B 185 ? ASN B 193 ? TYR B 186 ASN B 194 
AA7 1  LYS B 72  ? LEU B 80  ? LYS B 73  LEU B 81  
AA7 2  VAL B 87  ? VAL B 98  ? VAL B 88  VAL B 99  
AA7 3  ILE B 101 ? GLU B 112 ? ILE B 102 GLU B 113 
AA7 4  VAL B 43  ? PRO B 46  ? VAL B 44  PRO B 47  
AA7 5  GLY B 125 ? GLY B 128 ? GLY B 126 GLY B 129 
AA7 6  GLN B 30  ? ASP B 37  ? GLN B 31  ASP B 38  
AA7 7  GLN B 18  ? ILE B 25  ? GLN B 19  ILE B 26  
AA7 8  SER B 7   ? TYR B 14  ? SER B 8   TYR B 15  
AA7 9  GLY B 173 ? LEU B 177 ? GLY B 174 LEU B 178 
AA7 10 VAL B 156 ? TYR B 161 ? VAL B 157 TYR B 162 
AA7 11 PHE B 322 ? ASP B 327 ? PHE B 323 ASP B 328 
AA7 12 ARG B 332 ? ALA B 338 ? ARG B 333 ALA B 339 
AA7 13 TYR B 185 ? ASN B 193 ? TYR B 186 ASN B 194 
AA8 1  GLN B 201 ? MET B 204 ? GLN B 202 MET B 205 
AA8 2  CYS B 220 ? VAL B 224 ? CYS B 221 VAL B 225 
AA8 3  TRP B 312 ? LEU B 314 ? TRP B 313 LEU B 315 
AA8 4  ILE B 231 ? GLY B 233 ? ILE B 232 GLY B 234 
AA8 5  ILE B 299 ? ALA B 301 ? ILE B 300 ALA B 302 
AA9 1  SER B 212 ? LEU B 215 ? SER B 213 LEU B 216 
AA9 2  VAL B 207 ? VAL B 209 ? VAL B 208 VAL B 210 
AA9 3  ILE B 267 ? LEU B 271 ? ILE B 268 LEU B 272 
AA9 4  LYS B 274 ? LEU B 278 ? LYS B 275 LEU B 279 
AB1 1  LYS B 248 ? LYS B 249 ? LYS B 249 LYS B 250 
AB1 2  TYR B 254 ? LYS B 257 ? TYR B 255 LYS B 258 
AB1 3  LEU B 294 ? THR B 296 ? LEU B 295 THR B 297 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N LYS A 72  ? N LYS A 73  O GLN A 93  ? O GLN A 94  
AA1 2  3  O THR A 97  ? O THR A 98  N GLY A 24  ? N GLY A 25  
AA1 3  4  O GLN A 18  ? O GLN A 19  N TYR A 14  ? N TYR A 15  
AA1 4  5  N SER A 7   ? N SER A 8   O LEU A 177 ? O LEU A 178 
AA1 5  6  O GLN A 174 ? O GLN A 175 N TYR A 160 ? N TYR A 161 
AA1 6  7  N PHE A 157 ? N PHE A 158 O PHE A 326 ? O PHE A 327 
AA1 7  8  N GLU A 325 ? N GLU A 326 O GLY A 334 ? O GLY A 335 
AA1 8  9  O ILE A 333 ? O ILE A 334 N ILE A 192 ? N ILE A 193 
AA2 1  2  N LYS A 72  ? N LYS A 73  O GLN A 93  ? O GLN A 94  
AA2 2  3  N PHE A 90  ? N PHE A 91  O GLU A 109 ? O GLU A 110 
AA2 3  4  O GLY A 108 ? O GLY A 109 N VAL A 43  ? N VAL A 44  
AA2 4  5  N TRP A 44  ? N TRP A 45  O VAL A 126 ? O VAL A 127 
AA2 5  6  O VAL A 127 ? O VAL A 128 N VAL A 35  ? N VAL A 36  
AA2 6  7  O GLN A 30  ? O GLN A 31  N ILE A 25  ? N ILE A 26  
AA2 7  8  O GLN A 18  ? O GLN A 19  N TYR A 14  ? N TYR A 15  
AA2 8  9  N SER A 7   ? N SER A 8   O LEU A 177 ? O LEU A 178 
AA2 9  10 O GLN A 174 ? O GLN A 175 N TYR A 160 ? N TYR A 161 
AA2 10 11 N PHE A 157 ? N PHE A 158 O PHE A 326 ? O PHE A 327 
AA2 11 12 N GLU A 325 ? N GLU A 326 O GLY A 334 ? O GLY A 335 
AA2 12 13 O ILE A 333 ? O ILE A 334 N ILE A 192 ? N ILE A 193 
AA3 1  2  N MET A 204 ? N MET A 205 O CYS A 220 ? O CYS A 221 
AA3 2  3  N LEU A 223 ? N LEU A 224 O LEU A 314 ? O LEU A 315 
AA3 3  4  O ALA A 313 ? O ALA A 314 N SER A 232 ? N SER A 233 
AA3 4  5  N ILE A 231 ? N ILE A 232 O HIS A 300 ? O HIS A 301 
AA4 1  2  N GLY A 206 ? N GLY A 207 O HIS A 270 ? O HIS A 271 
AA4 2  3  N PHE A 269 ? N PHE A 270 O TYR A 276 ? O TYR A 277 
AA5 1  2  N LYS A 248 ? N LYS A 249 O VAL A 255 ? O VAL A 256 
AA5 2  3  N VAL A 256 ? N VAL A 257 O CYS A 295 ? O CYS A 296 
AA6 1  2  N GLY B 75  ? N GLY B 76  O LEU B 91  ? O LEU B 92  
AA6 2  3  O THR B 97  ? O THR B 98  N GLY B 24  ? N GLY B 25  
AA6 3  4  O GLN B 18  ? O GLN B 19  N TYR B 14  ? N TYR B 15  
AA6 4  5  N SER B 7   ? N SER B 8   O LEU B 177 ? O LEU B 178 
AA6 5  6  O GLN B 174 ? O GLN B 175 N TYR B 160 ? N TYR B 161 
AA6 6  7  N PHE B 157 ? N PHE B 158 O PHE B 326 ? O PHE B 327 
AA6 7  8  N GLU B 325 ? N GLU B 326 O GLY B 334 ? O GLY B 335 
AA6 8  9  O ILE B 333 ? O ILE B 334 N ILE B 192 ? N ILE B 193 
AA7 1  2  N GLY B 75  ? N GLY B 76  O LEU B 91  ? O LEU B 92  
AA7 2  3  N PHE B 90  ? N PHE B 91  O GLU B 109 ? O GLU B 110 
AA7 3  4  O GLY B 108 ? O GLY B 109 N VAL B 43  ? N VAL B 44  
AA7 4  5  N TRP B 44  ? N TRP B 45  O VAL B 126 ? O VAL B 127 
AA7 5  6  O VAL B 127 ? O VAL B 128 N VAL B 35  ? N VAL B 36  
AA7 6  7  O VAL B 34  ? O VAL B 35  N GLY B 21  ? N GLY B 22  
AA7 7  8  O GLN B 18  ? O GLN B 19  N TYR B 14  ? N TYR B 15  
AA7 8  9  N SER B 7   ? N SER B 8   O LEU B 177 ? O LEU B 178 
AA7 9  10 O GLN B 174 ? O GLN B 175 N TYR B 160 ? N TYR B 161 
AA7 10 11 N PHE B 157 ? N PHE B 158 O PHE B 326 ? O PHE B 327 
AA7 11 12 N GLU B 325 ? N GLU B 326 O GLY B 334 ? O GLY B 335 
AA7 12 13 O ILE B 333 ? O ILE B 334 N ILE B 192 ? N ILE B 193 
AA8 1  2  N ILE B 202 ? N ILE B 203 O ALA B 222 ? O ALA B 223 
AA8 2  3  N LEU B 223 ? N LEU B 224 O LEU B 314 ? O LEU B 315 
AA8 3  4  O ALA B 313 ? O ALA B 314 N SER B 232 ? N SER B 233 
AA8 4  5  N ILE B 231 ? N ILE B 232 O HIS B 300 ? O HIS B 301 
AA9 1  2  O LEU B 215 ? O LEU B 216 N VAL B 207 ? N VAL B 208 
AA9 2  3  N SER B 208 ? N SER B 209 O SER B 268 ? O SER B 269 
AA9 3  4  N ILE B 267 ? N ILE B 268 O LEU B 278 ? O LEU B 279 
AB1 1  2  N LYS B 248 ? N LYS B 249 O VAL B 255 ? O VAL B 256 
AB1 2  3  N VAL B 256 ? N VAL B 257 O CYS B 295 ? O CYS B 296 
# 
_atom_sites.entry_id                    5T4S 
_atom_sites.fract_transf_matrix[1][1]   0.007147 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007147 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007147 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . THR A 1 1   ? 0.938   -26.613 -64.484 1.00 106.12 ? 2   THR A N   1 
ATOM   2    C  CA  . THR A 1 1   ? 0.658   -25.260 -65.066 1.00 107.73 ? 2   THR A CA  1 
ATOM   3    C  C   . THR A 1 1   ? 0.690   -24.150 -63.993 1.00 104.90 ? 2   THR A C   1 
ATOM   4    O  O   . THR A 1 1   ? 0.052   -24.276 -62.943 1.00 100.83 ? 2   THR A O   1 
ATOM   5    C  CB  . THR A 1 1   ? -0.652  -25.252 -65.915 1.00 107.52 ? 2   THR A CB  1 
ATOM   6    O  OG1 . THR A 1 1   ? -0.845  -23.962 -66.513 1.00 103.94 ? 2   THR A OG1 1 
ATOM   7    C  CG2 . THR A 1 1   ? -1.902  -25.636 -65.083 1.00 107.39 ? 2   THR A CG2 1 
ATOM   8    N  N   . LEU A 1 2   ? 1.459   -23.091 -64.266 1.00 105.19 ? 3   LEU A N   1 
ATOM   9    C  CA  . LEU A 1 2   ? 1.645   -21.954 -63.346 1.00 102.02 ? 3   LEU A CA  1 
ATOM   10   C  C   . LEU A 1 2   ? 1.551   -20.602 -64.067 1.00 103.45 ? 3   LEU A C   1 
ATOM   11   O  O   . LEU A 1 2   ? 2.052   -20.453 -65.188 1.00 106.66 ? 3   LEU A O   1 
ATOM   12   C  CB  . LEU A 1 2   ? 2.998   -22.041 -62.615 1.00 100.50 ? 3   LEU A CB  1 
ATOM   13   C  CG  . LEU A 1 2   ? 3.478   -23.286 -61.848 1.00 99.54  ? 3   LEU A CG  1 
ATOM   14   C  CD1 . LEU A 1 2   ? 4.939   -23.119 -61.449 1.00 99.75  ? 3   LEU A CD1 1 
ATOM   15   C  CD2 . LEU A 1 2   ? 2.625   -23.599 -60.625 1.00 95.21  ? 3   LEU A CD2 1 
ATOM   16   N  N   . GLY A 1 3   ? 0.917   -19.628 -63.411 1.00 100.89 ? 4   GLY A N   1 
ATOM   17   C  CA  . GLY A 1 3   ? 0.797   -18.257 -63.930 1.00 97.45  ? 4   GLY A CA  1 
ATOM   18   C  C   . GLY A 1 3   ? 1.808   -17.314 -63.304 1.00 96.17  ? 4   GLY A C   1 
ATOM   19   O  O   . GLY A 1 3   ? 2.953   -17.705 -63.052 1.00 95.14  ? 4   GLY A O   1 
ATOM   20   N  N   . ASN A 1 4   ? 1.385   -16.074 -63.052 1.00 95.13  ? 5   ASN A N   1 
ATOM   21   C  CA  . ASN A 1 4   ? 2.262   -15.060 -62.447 1.00 94.79  ? 5   ASN A CA  1 
ATOM   22   C  C   . ASN A 1 4   ? 1.636   -14.236 -61.307 1.00 89.50  ? 5   ASN A C   1 
ATOM   23   O  O   . ASN A 1 4   ? 2.324   -13.445 -60.658 1.00 89.42  ? 5   ASN A O   1 
ATOM   24   C  CB  . ASN A 1 4   ? 2.851   -14.143 -63.530 1.00 99.89  ? 5   ASN A CB  1 
ATOM   25   C  CG  . ASN A 1 4   ? 4.349   -13.916 -63.358 1.00 105.04 ? 5   ASN A CG  1 
ATOM   26   O  OD1 . ASN A 1 4   ? 5.128   -14.150 -64.284 1.00 109.25 ? 5   ASN A OD1 1 
ATOM   27   N  ND2 . ASN A 1 4   ? 4.760   -13.464 -62.172 1.00 103.21 ? 5   ASN A ND2 1 
ATOM   28   N  N   . THR A 1 5   ? 0.341   -14.440 -61.071 1.00 85.07  ? 6   THR A N   1 
ATOM   29   C  CA  . THR A 1 5   ? -0.403  -13.797 -59.985 1.00 82.58  ? 6   THR A CA  1 
ATOM   30   C  C   . THR A 1 5   ? 0.074   -14.308 -58.620 1.00 81.38  ? 6   THR A C   1 
ATOM   31   O  O   . THR A 1 5   ? 0.352   -15.496 -58.443 1.00 82.40  ? 6   THR A O   1 
ATOM   32   C  CB  . THR A 1 5   ? -1.933  -14.051 -60.135 1.00 81.08  ? 6   THR A CB  1 
ATOM   33   O  OG1 . THR A 1 5   ? -2.375  -13.612 -61.426 1.00 82.80  ? 6   THR A OG1 1 
ATOM   34   C  CG2 . THR A 1 5   ? -2.766  -13.337 -59.057 1.00 77.70  ? 6   THR A CG2 1 
ATOM   35   N  N   . THR A 1 6   ? 0.203   -13.379 -57.679 1.00 79.38  ? 7   THR A N   1 
ATOM   36   C  CA  . THR A 1 6   ? 0.245   -13.688 -56.256 1.00 73.70  ? 7   THR A CA  1 
ATOM   37   C  C   . THR A 1 6   ? -0.979  -12.995 -55.659 1.00 72.53  ? 7   THR A C   1 
ATOM   38   O  O   . THR A 1 6   ? -1.470  -12.007 -56.223 1.00 74.18  ? 7   THR A O   1 
ATOM   39   C  CB  . THR A 1 6   ? 1.576   -13.243 -55.607 1.00 73.35  ? 7   THR A CB  1 
ATOM   40   O  OG1 . THR A 1 6   ? 1.784   -13.970 -54.398 1.00 72.18  ? 7   THR A OG1 1 
ATOM   41   C  CG2 . THR A 1 6   ? 1.621   -11.734 -55.310 1.00 75.35  ? 7   THR A CG2 1 
ATOM   42   N  N   . SER A 1 7   ? -1.499  -13.517 -54.552 1.00 69.73  ? 8   SER A N   1 
ATOM   43   C  CA  . SER A 1 7   ? -2.709  -12.946 -53.961 1.00 67.32  ? 8   SER A CA  1 
ATOM   44   C  C   . SER A 1 7   ? -2.793  -13.121 -52.452 1.00 64.49  ? 8   SER A C   1 
ATOM   45   O  O   . SER A 1 7   ? -2.617  -14.224 -51.942 1.00 66.02  ? 8   SER A O   1 
ATOM   46   C  CB  . SER A 1 7   ? -3.950  -13.526 -54.627 1.00 67.03  ? 8   SER A CB  1 
ATOM   47   O  OG  . SER A 1 7   ? -5.106  -13.015 -54.005 1.00 69.97  ? 8   SER A OG  1 
ATOM   48   N  N   . SER A 1 8   ? -3.087  -12.032 -51.748 1.00 62.10  ? 9   SER A N   1 
ATOM   49   C  CA  . SER A 1 8   ? -3.152  -12.066 -50.293 1.00 59.38  ? 9   SER A CA  1 
ATOM   50   C  C   . SER A 1 8   ? -4.577  -11.958 -49.743 1.00 57.02  ? 9   SER A C   1 
ATOM   51   O  O   . SER A 1 8   ? -5.422  -11.271 -50.317 1.00 58.78  ? 9   SER A O   1 
ATOM   52   C  CB  . SER A 1 8   ? -2.229  -11.009 -49.676 1.00 60.30  ? 9   SER A CB  1 
ATOM   53   O  OG  . SER A 1 8   ? -2.850  -9.743  -49.606 1.00 63.45  ? 9   SER A OG  1 
ATOM   54   N  N   . VAL A 1 9   ? -4.823  -12.665 -48.643 1.00 53.76  ? 10  VAL A N   1 
ATOM   55   C  CA  . VAL A 1 9   ? -6.061  -12.551 -47.864 1.00 53.30  ? 10  VAL A CA  1 
ATOM   56   C  C   . VAL A 1 9   ? -5.713  -11.931 -46.503 1.00 51.76  ? 10  VAL A C   1 
ATOM   57   O  O   . VAL A 1 9   ? -4.840  -12.436 -45.791 1.00 50.24  ? 10  VAL A O   1 
ATOM   58   C  CB  . VAL A 1 9   ? -6.769  -13.925 -47.681 1.00 52.66  ? 10  VAL A CB  1 
ATOM   59   C  CG1 . VAL A 1 9   ? -8.139  -13.761 -47.039 1.00 51.90  ? 10  VAL A CG1 1 
ATOM   60   C  CG2 . VAL A 1 9   ? -6.923  -14.638 -49.012 1.00 53.96  ? 10  VAL A CG2 1 
ATOM   61   N  N   . ILE A 1 10  ? -6.378  -10.824 -46.166 1.00 51.48  ? 11  ILE A N   1 
ATOM   62   C  CA  . ILE A 1 10  ? -6.165  -10.128 -44.883 1.00 50.93  ? 11  ILE A CA  1 
ATOM   63   C  C   . ILE A 1 10  ? -6.924  -10.880 -43.784 1.00 48.14  ? 11  ILE A C   1 
ATOM   64   O  O   . ILE A 1 10  ? -8.109  -11.191 -43.956 1.00 48.34  ? 11  ILE A O   1 
ATOM   65   C  CB  . ILE A 1 10  ? -6.615  -8.635  -44.950 1.00 53.41  ? 11  ILE A CB  1 
ATOM   66   C  CG1 . ILE A 1 10  ? -5.990  -7.885  -46.150 1.00 56.65  ? 11  ILE A CG1 1 
ATOM   67   C  CG2 . ILE A 1 10  ? -6.371  -7.899  -43.630 1.00 53.02  ? 11  ILE A CG2 1 
ATOM   68   C  CD1 . ILE A 1 10  ? -4.468  -7.824  -46.206 1.00 58.19  ? 11  ILE A CD1 1 
ATOM   69   N  N   . LEU A 1 11  ? -6.247  -11.182 -42.673 1.00 45.13  ? 12  LEU A N   1 
ATOM   70   C  CA  . LEU A 1 11  ? -6.899  -11.876 -41.553 1.00 44.62  ? 12  LEU A CA  1 
ATOM   71   C  C   . LEU A 1 11  ? -7.094  -11.032 -40.291 1.00 44.53  ? 12  LEU A C   1 
ATOM   72   O  O   . LEU A 1 11  ? -6.268  -10.193 -39.952 1.00 45.40  ? 12  LEU A O   1 
ATOM   73   C  CB  . LEU A 1 11  ? -6.185  -13.186 -41.189 1.00 43.14  ? 12  LEU A CB  1 
ATOM   74   C  CG  . LEU A 1 11  ? -5.847  -14.241 -42.238 1.00 43.08  ? 12  LEU A CG  1 
ATOM   75   C  CD1 . LEU A 1 11  ? -4.989  -15.321 -41.600 1.00 42.13  ? 12  LEU A CD1 1 
ATOM   76   C  CD2 . LEU A 1 11  ? -7.089  -14.834 -42.889 1.00 41.64  ? 12  LEU A CD2 1 
ATOM   77   N  N   . THR A 1 12  ? -8.211  -11.270 -39.617 1.00 45.21  ? 13  THR A N   1 
ATOM   78   C  CA  . THR A 1 12  ? -8.527  -10.662 -38.332 1.00 46.07  ? 13  THR A CA  1 
ATOM   79   C  C   . THR A 1 12  ? -8.111  -11.639 -37.229 1.00 45.21  ? 13  THR A C   1 
ATOM   80   O  O   . THR A 1 12  ? -8.415  -12.836 -37.297 1.00 42.79  ? 13  THR A O   1 
ATOM   81   C  CB  . THR A 1 12  ? -10.034 -10.335 -38.272 1.00 46.52  ? 13  THR A CB  1 
ATOM   82   O  OG1 . THR A 1 12  ? -10.330 -9.385  -39.297 1.00 47.01  ? 13  THR A OG1 1 
ATOM   83   C  CG2 . THR A 1 12  ? -10.455 -9.753  -36.928 1.00 45.90  ? 13  THR A CG2 1 
ATOM   84   N  N   . ASN A 1 13  ? -7.376  -11.116 -36.251 1.00 45.77  ? 14  ASN A N   1 
ATOM   85   C  CA  . ASN A 1 13  ? -6.948  -11.877 -35.081 1.00 46.13  ? 14  ASN A CA  1 
ATOM   86   C  C   . ASN A 1 13  ? -7.944  -11.645 -33.955 1.00 48.22  ? 14  ASN A C   1 
ATOM   87   O  O   . ASN A 1 13  ? -8.013  -10.557 -33.371 1.00 50.05  ? 14  ASN A O   1 
ATOM   88   C  CB  . ASN A 1 13  ? -5.527  -11.468 -34.650 1.00 44.76  ? 14  ASN A CB  1 
ATOM   89   C  CG  . ASN A 1 13  ? -5.007  -12.246 -33.442 1.00 44.64  ? 14  ASN A CG  1 
ATOM   90   O  OD1 . ASN A 1 13  ? -5.754  -12.936 -32.738 1.00 44.68  ? 14  ASN A OD1 1 
ATOM   91   N  ND2 . ASN A 1 13  ? -3.701  -12.143 -33.204 1.00 43.78  ? 14  ASN A ND2 1 
ATOM   92   N  N   . TYR A 1 14  ? -8.720  -12.680 -33.670 1.00 48.93  ? 15  TYR A N   1 
ATOM   93   C  CA  . TYR A 1 14  ? -9.624  -12.669 -32.538 1.00 50.43  ? 15  TYR A CA  1 
ATOM   94   C  C   . TYR A 1 14  ? -8.987  -13.392 -31.360 1.00 47.69  ? 15  TYR A C   1 
ATOM   95   O  O   . TYR A 1 14  ? -8.776  -14.607 -31.426 1.00 47.71  ? 15  TYR A O   1 
ATOM   96   C  CB  . TYR A 1 14  ? -10.981 -13.302 -32.915 1.00 50.46  ? 15  TYR A CB  1 
ATOM   97   C  CG  . TYR A 1 14  ? -11.914 -13.548 -31.739 1.00 52.01  ? 15  TYR A CG  1 
ATOM   98   C  CD1 . TYR A 1 14  ? -12.421 -12.485 -30.980 1.00 52.18  ? 15  TYR A CD1 1 
ATOM   99   C  CD2 . TYR A 1 14  ? -12.290 -14.852 -31.383 1.00 53.81  ? 15  TYR A CD2 1 
ATOM   100  C  CE1 . TYR A 1 14  ? -13.269 -12.714 -29.903 1.00 55.08  ? 15  TYR A CE1 1 
ATOM   101  C  CE2 . TYR A 1 14  ? -13.145 -15.091 -30.310 1.00 54.37  ? 15  TYR A CE2 1 
ATOM   102  C  CZ  . TYR A 1 14  ? -13.631 -14.019 -29.571 1.00 55.37  ? 15  TYR A CZ  1 
ATOM   103  O  OH  . TYR A 1 14  ? -14.480 -14.248 -28.506 1.00 57.79  ? 15  TYR A OH  1 
ATOM   104  N  N   . MET A 1 15  ? -8.642  -12.617 -30.325 1.00 48.48  ? 16  MET A N   1 
ATOM   105  C  CA  A MET A 1 15  ? -8.165  -13.099 -29.016 0.50 49.37  ? 16  MET A CA  1 
ATOM   106  C  CA  B MET A 1 15  ? -8.269  -13.176 -29.014 0.50 49.62  ? 16  MET A CA  1 
ATOM   107  C  C   . MET A 1 15  ? -7.061  -14.155 -29.070 1.00 49.36  ? 16  MET A C   1 
ATOM   108  O  O   . MET A 1 15  ? -6.876  -14.959 -28.150 1.00 51.93  ? 16  MET A O   1 
ATOM   109  C  CB  A MET A 1 15  ? -9.340  -13.528 -28.131 0.50 49.96  ? 16  MET A CB  1 
ATOM   110  C  CB  B MET A 1 15  ? -9.539  -13.824 -28.399 0.50 50.53  ? 16  MET A CB  1 
ATOM   111  C  CG  A MET A 1 15  ? -9.796  -12.440 -27.175 0.50 52.13  ? 16  MET A CG  1 
ATOM   112  C  CG  B MET A 1 15  ? -9.499  -14.304 -26.955 0.50 52.94  ? 16  MET A CG  1 
ATOM   113  S  SD  A MET A 1 15  ? -11.451 -12.749 -26.552 0.50 53.75  ? 16  MET A SD  1 
ATOM   114  S  SD  B MET A 1 15  ? -10.833 -15.487 -26.643 0.50 53.33  ? 16  MET A SD  1 
ATOM   115  C  CE  A MET A 1 15  ? -11.513 -14.535 -26.678 0.50 51.98  ? 16  MET A CE  1 
ATOM   116  C  CE  B MET A 1 15  ? -12.129 -14.374 -26.111 0.50 55.24  ? 16  MET A CE  1 
ATOM   117  N  N   . ASP A 1 16  ? -6.262  -14.102 -30.143 1.00 47.92  ? 17  ASP A N   1 
ATOM   118  C  CA  . ASP A 1 16  ? -5.145  -15.047 -30.394 1.00 46.55  ? 17  ASP A CA  1 
ATOM   119  C  C   . ASP A 1 16  ? -5.550  -16.515 -30.640 1.00 46.58  ? 17  ASP A C   1 
ATOM   120  O  O   . ASP A 1 16  ? -4.686  -17.396 -30.716 1.00 45.95  ? 17  ASP A O   1 
ATOM   121  C  CB  . ASP A 1 16  ? -4.084  -14.975 -29.287 1.00 47.09  ? 17  ASP A CB  1 
ATOM   122  C  CG  . ASP A 1 16  ? -2.930  -14.065 -29.630 1.00 47.93  ? 17  ASP A CG  1 
ATOM   123  O  OD1 . ASP A 1 16  ? -3.028  -13.256 -30.585 1.00 47.41  ? 17  ASP A OD1 1 
ATOM   124  O  OD2 . ASP A 1 16  ? -1.906  -14.166 -28.919 1.00 51.07  ? 17  ASP A OD2 1 
ATOM   125  N  N   . THR A 1 17  ? -6.850  -16.770 -30.767 1.00 43.82  ? 18  THR A N   1 
ATOM   126  C  CA  . THR A 1 17  ? -7.346  -18.130 -30.929 1.00 44.45  ? 18  THR A CA  1 
ATOM   127  C  C   . THR A 1 17  ? -8.064  -18.338 -32.262 1.00 44.76  ? 18  THR A C   1 
ATOM   128  O  O   . THR A 1 17  ? -8.117  -19.453 -32.772 1.00 44.01  ? 18  THR A O   1 
ATOM   129  C  CB  . THR A 1 17  ? -8.275  -18.554 -29.772 1.00 44.83  ? 18  THR A CB  1 
ATOM   130  O  OG1 . THR A 1 17  ? -9.325  -17.598 -29.619 1.00 46.07  ? 18  THR A OG1 1 
ATOM   131  C  CG2 . THR A 1 17  ? -7.506  -18.672 -28.461 1.00 45.01  ? 18  THR A CG2 1 
ATOM   132  N  N   . GLN A 1 18  ? -8.615  -17.268 -32.825 1.00 44.92  ? 19  GLN A N   1 
ATOM   133  C  CA  . GLN A 1 18  ? -9.344  -17.373 -34.084 1.00 43.97  ? 19  GLN A CA  1 
ATOM   134  C  C   . GLN A 1 18  ? -8.795  -16.372 -35.091 1.00 43.70  ? 19  GLN A C   1 
ATOM   135  O  O   . GLN A 1 18  ? -8.773  -15.165 -34.828 1.00 44.78  ? 19  GLN A O   1 
ATOM   136  C  CB  . GLN A 1 18  ? -10.850 -17.186 -33.857 1.00 43.57  ? 19  GLN A CB  1 
ATOM   137  C  CG  . GLN A 1 18  ? -11.515 -18.313 -33.069 1.00 42.60  ? 19  GLN A CG  1 
ATOM   138  C  CD  . GLN A 1 18  ? -12.969 -18.035 -32.749 1.00 42.95  ? 19  GLN A CD  1 
ATOM   139  O  OE1 . GLN A 1 18  ? -13.724 -17.559 -33.596 1.00 45.01  ? 19  GLN A OE1 1 
ATOM   140  N  NE2 . GLN A 1 18  ? -13.370 -18.328 -31.520 1.00 42.82  ? 19  GLN A NE2 1 
ATOM   141  N  N   . TYR A 1 19  ? -8.325  -16.896 -36.221 1.00 42.25  ? 20  TYR A N   1 
ATOM   142  C  CA  . TYR A 1 19  ? -7.764  -16.093 -37.305 1.00 42.38  ? 20  TYR A CA  1 
ATOM   143  C  C   . TYR A 1 19  ? -8.592  -16.328 -38.551 1.00 43.41  ? 20  TYR A C   1 
ATOM   144  O  O   . TYR A 1 19  ? -8.622  -17.443 -39.082 1.00 45.76  ? 20  TYR A O   1 
ATOM   145  C  CB  . TYR A 1 19  ? -6.305  -16.467 -37.565 1.00 40.91  ? 20  TYR A CB  1 
ATOM   146  C  CG  . TYR A 1 19  ? -5.344  -16.079 -36.465 1.00 41.40  ? 20  TYR A CG  1 
ATOM   147  C  CD1 . TYR A 1 19  ? -5.137  -16.917 -35.356 1.00 41.84  ? 20  TYR A CD1 1 
ATOM   148  C  CD2 . TYR A 1 19  ? -4.624  -14.877 -36.535 1.00 41.87  ? 20  TYR A CD2 1 
ATOM   149  C  CE1 . TYR A 1 19  ? -4.250  -16.560 -34.340 1.00 43.27  ? 20  TYR A CE1 1 
ATOM   150  C  CE2 . TYR A 1 19  ? -3.730  -14.513 -35.536 1.00 42.24  ? 20  TYR A CE2 1 
ATOM   151  C  CZ  . TYR A 1 19  ? -3.549  -15.353 -34.441 1.00 43.85  ? 20  TYR A CZ  1 
ATOM   152  O  OH  . TYR A 1 19  ? -2.668  -15.001 -33.451 1.00 45.66  ? 20  TYR A OH  1 
ATOM   153  N  N   . TYR A 1 20  ? -9.275  -15.283 -39.009 1.00 42.90  ? 21  TYR A N   1 
ATOM   154  C  CA  . TYR A 1 20  ? -10.234 -15.435 -40.094 1.00 42.47  ? 21  TYR A CA  1 
ATOM   155  C  C   . TYR A 1 20  ? -10.139 -14.345 -41.158 1.00 45.49  ? 21  TYR A C   1 
ATOM   156  O  O   . TYR A 1 20  ? -9.682  -13.236 -40.882 1.00 48.19  ? 21  TYR A O   1 
ATOM   157  C  CB  . TYR A 1 20  ? -11.659 -15.544 -39.531 1.00 41.80  ? 21  TYR A CB  1 
ATOM   158  C  CG  . TYR A 1 20  ? -12.142 -14.344 -38.734 1.00 42.62  ? 21  TYR A CG  1 
ATOM   159  C  CD1 . TYR A 1 20  ? -12.695 -13.224 -39.376 1.00 43.27  ? 21  TYR A CD1 1 
ATOM   160  C  CD2 . TYR A 1 20  ? -12.075 -14.335 -37.337 1.00 42.61  ? 21  TYR A CD2 1 
ATOM   161  C  CE1 . TYR A 1 20  ? -13.156 -12.134 -38.653 1.00 45.04  ? 21  TYR A CE1 1 
ATOM   162  C  CE2 . TYR A 1 20  ? -12.531 -13.245 -36.600 1.00 44.38  ? 21  TYR A CE2 1 
ATOM   163  C  CZ  . TYR A 1 20  ? -13.071 -12.146 -37.262 1.00 47.71  ? 21  TYR A CZ  1 
ATOM   164  O  OH  . TYR A 1 20  ? -13.522 -11.049 -36.544 1.00 51.31  ? 21  TYR A OH  1 
ATOM   165  N  N   . GLY A 1 21  ? -10.566 -14.678 -42.372 1.00 45.35  ? 22  GLY A N   1 
ATOM   166  C  CA  . GLY A 1 21  ? -10.624 -13.732 -43.476 1.00 46.46  ? 22  GLY A CA  1 
ATOM   167  C  C   . GLY A 1 21  ? -11.994 -13.701 -44.122 1.00 49.38  ? 22  GLY A C   1 
ATOM   168  O  O   . GLY A 1 21  ? -12.891 -14.463 -43.753 1.00 50.13  ? 22  GLY A O   1 
ATOM   169  N  N   . GLU A 1 22  ? -12.142 -12.812 -45.095 1.00 52.04  ? 23  GLU A N   1 
ATOM   170  C  CA  . GLU A 1 22  ? -13.389 -12.620 -45.808 1.00 52.96  ? 23  GLU A CA  1 
ATOM   171  C  C   . GLU A 1 22  ? -13.325 -13.374 -47.124 1.00 51.63  ? 23  GLU A C   1 
ATOM   172  O  O   . GLU A 1 22  ? -12.328 -13.284 -47.848 1.00 54.33  ? 23  GLU A O   1 
ATOM   173  C  CB  . GLU A 1 22  ? -13.599 -11.131 -46.086 1.00 59.50  ? 23  GLU A CB  1 
ATOM   174  C  CG  . GLU A 1 22  ? -15.007 -10.620 -45.835 1.00 66.91  ? 23  GLU A CG  1 
ATOM   175  C  CD  . GLU A 1 22  ? -15.213 -10.149 -44.403 1.00 73.30  ? 23  GLU A CD  1 
ATOM   176  O  OE1 . GLU A 1 22  ? -15.327 -11.002 -43.493 1.00 74.92  ? 23  GLU A OE1 1 
ATOM   177  O  OE2 . GLU A 1 22  ? -15.273 -8.918  -44.187 1.00 77.47  ? 23  GLU A OE2 1 
ATOM   178  N  N   . ILE A 1 23  ? -14.378 -14.140 -47.409 1.00 47.64  ? 24  ILE A N   1 
ATOM   179  C  CA  . ILE A 1 23  ? -14.630 -14.697 -48.742 1.00 45.55  ? 24  ILE A CA  1 
ATOM   180  C  C   . ILE A 1 23  ? -16.035 -14.279 -49.186 1.00 46.37  ? 24  ILE A C   1 
ATOM   181  O  O   . ILE A 1 23  ? -16.888 -13.977 -48.347 1.00 46.95  ? 24  ILE A O   1 
ATOM   182  C  CB  . ILE A 1 23  ? -14.468 -16.248 -48.810 1.00 45.58  ? 24  ILE A CB  1 
ATOM   183  C  CG1 . ILE A 1 23  ? -15.484 -16.975 -47.913 1.00 43.61  ? 24  ILE A CG1 1 
ATOM   184  C  CG2 . ILE A 1 23  ? -13.031 -16.666 -48.505 1.00 45.44  ? 24  ILE A CG2 1 
ATOM   185  C  CD1 . ILE A 1 23  ? -15.770 -18.405 -48.311 1.00 42.61  ? 24  ILE A CD1 1 
ATOM   186  N  N   . GLY A 1 24  ? -16.272 -14.250 -50.496 1.00 46.53  ? 25  GLY A N   1 
ATOM   187  C  CA  . GLY A 1 24  ? -17.592 -13.940 -51.040 1.00 45.83  ? 25  GLY A CA  1 
ATOM   188  C  C   . GLY A 1 24  ? -18.140 -15.128 -51.799 1.00 47.84  ? 25  GLY A C   1 
ATOM   189  O  O   . GLY A 1 24  ? -17.461 -15.659 -52.678 1.00 49.69  ? 25  GLY A O   1 
ATOM   190  N  N   . ILE A 1 25  ? -19.356 -15.553 -51.453 1.00 46.54  ? 26  ILE A N   1 
ATOM   191  C  CA  . ILE A 1 25  ? -20.036 -16.661 -52.150 1.00 47.47  ? 26  ILE A CA  1 
ATOM   192  C  C   . ILE A 1 25  ? -21.287 -16.160 -52.889 1.00 47.96  ? 26  ILE A C   1 
ATOM   193  O  O   . ILE A 1 25  ? -22.147 -15.494 -52.292 1.00 46.28  ? 26  ILE A O   1 
ATOM   194  C  CB  . ILE A 1 25  ? -20.396 -17.836 -51.192 1.00 46.72  ? 26  ILE A CB  1 
ATOM   195  C  CG1 . ILE A 1 25  ? -19.163 -18.299 -50.408 1.00 45.76  ? 26  ILE A CG1 1 
ATOM   196  C  CG2 . ILE A 1 25  ? -20.976 -19.021 -51.961 1.00 45.30  ? 26  ILE A CG2 1 
ATOM   197  C  CD1 . ILE A 1 25  ? -19.467 -19.138 -49.189 1.00 43.05  ? 26  ILE A CD1 1 
ATOM   198  N  N   . GLY A 1 26  ? -21.367 -16.467 -54.187 1.00 46.44  ? 27  GLY A N   1 
ATOM   199  C  CA  . GLY A 1 26  ? -22.574 -16.212 -54.972 1.00 45.41  ? 27  GLY A CA  1 
ATOM   200  C  C   . GLY A 1 26  ? -22.566 -14.937 -55.788 1.00 47.88  ? 27  GLY A C   1 
ATOM   201  O  O   . GLY A 1 26  ? -21.598 -14.173 -55.752 1.00 49.99  ? 27  GLY A O   1 
ATOM   202  N  N   . THR A 1 27  ? -23.655 -14.729 -56.529 1.00 47.32  ? 28  THR A N   1 
ATOM   203  C  CA  . THR A 1 27  ? -23.894 -13.514 -57.304 1.00 49.33  ? 28  THR A CA  1 
ATOM   204  C  C   . THR A 1 27  ? -25.244 -12.895 -56.886 1.00 49.45  ? 28  THR A C   1 
ATOM   205  O  O   . THR A 1 27  ? -26.285 -13.532 -57.078 1.00 48.85  ? 28  THR A O   1 
ATOM   206  C  CB  . THR A 1 27  ? -23.858 -13.799 -58.818 1.00 50.40  ? 28  THR A CB  1 
ATOM   207  O  OG1 . THR A 1 27  ? -22.698 -14.587 -59.107 1.00 51.90  ? 28  THR A OG1 1 
ATOM   208  C  CG2 . THR A 1 27  ? -23.816 -12.498 -59.629 1.00 48.88  ? 28  THR A CG2 1 
ATOM   209  N  N   . PRO A 1 28  ? -25.239 -11.691 -56.288 1.00 49.73  ? 29  PRO A N   1 
ATOM   210  C  CA  . PRO A 1 28  ? -24.022 -10.953 -55.898 1.00 49.02  ? 29  PRO A CA  1 
ATOM   211  C  C   . PRO A 1 28  ? -23.312 -11.636 -54.721 1.00 46.81  ? 29  PRO A C   1 
ATOM   212  O  O   . PRO A 1 28  ? -23.897 -12.552 -54.129 1.00 44.78  ? 29  PRO A O   1 
ATOM   213  C  CB  . PRO A 1 28  ? -24.568 -9.588  -55.468 1.00 49.37  ? 29  PRO A CB  1 
ATOM   214  C  CG  . PRO A 1 28  ? -25.939 -9.882  -54.970 1.00 50.32  ? 29  PRO A CG  1 
ATOM   215  C  CD  . PRO A 1 28  ? -26.464 -10.987 -55.855 1.00 50.72  ? 29  PRO A CD  1 
ATOM   216  N  N   . PRO A 1 29  ? -22.061 -11.217 -54.394 1.00 46.96  ? 30  PRO A N   1 
ATOM   217  C  CA  . PRO A 1 29  ? -21.350 -11.905 -53.310 1.00 45.66  ? 30  PRO A CA  1 
ATOM   218  C  C   . PRO A 1 29  ? -22.064 -11.781 -51.970 1.00 45.38  ? 30  PRO A C   1 
ATOM   219  O  O   . PRO A 1 29  ? -22.474 -10.687 -51.589 1.00 45.44  ? 30  PRO A O   1 
ATOM   220  C  CB  . PRO A 1 29  ? -19.992 -11.185 -53.254 1.00 45.38  ? 30  PRO A CB  1 
ATOM   221  C  CG  . PRO A 1 29  ? -19.841 -10.537 -54.591 1.00 46.87  ? 30  PRO A CG  1 
ATOM   222  C  CD  . PRO A 1 29  ? -21.230 -10.148 -54.988 1.00 46.51  ? 30  PRO A CD  1 
ATOM   223  N  N   . GLN A 1 30  ? -22.257 -12.921 -51.312 1.00 44.99  ? 31  GLN A N   1 
ATOM   224  C  CA  . GLN A 1 30  ? -22.600 -12.970 -49.894 1.00 44.73  ? 31  GLN A CA  1 
ATOM   225  C  C   . GLN A 1 30  ? -21.284 -13.242 -49.167 1.00 45.10  ? 31  GLN A C   1 
ATOM   226  O  O   . GLN A 1 30  ? -20.595 -14.211 -49.476 1.00 45.26  ? 31  GLN A O   1 
ATOM   227  C  CB  . GLN A 1 30  ? -23.614 -14.079 -49.611 1.00 42.87  ? 31  GLN A CB  1 
ATOM   228  C  CG  . GLN A 1 30  ? -24.959 -13.891 -50.296 1.00 42.62  ? 31  GLN A CG  1 
ATOM   229  C  CD  . GLN A 1 30  ? -25.893 -15.075 -50.113 1.00 42.68  ? 31  GLN A CD  1 
ATOM   230  O  OE1 . GLN A 1 30  ? -26.063 -15.582 -49.007 1.00 42.85  ? 31  GLN A OE1 1 
ATOM   231  N  NE2 . GLN A 1 30  ? -26.513 -15.515 -51.205 1.00 43.58  ? 31  GLN A NE2 1 
ATOM   232  N  N   . THR A 1 31  ? -20.922 -12.368 -48.229 1.00 47.12  ? 32  THR A N   1 
ATOM   233  C  CA  . THR A 1 31  ? -19.614 -12.432 -47.563 1.00 45.33  ? 32  THR A CA  1 
ATOM   234  C  C   . THR A 1 31  ? -19.642 -13.263 -46.280 1.00 43.93  ? 32  THR A C   1 
ATOM   235  O  O   . THR A 1 31  ? -20.626 -13.255 -45.547 1.00 42.74  ? 32  THR A O   1 
ATOM   236  C  CB  . THR A 1 31  ? -19.038 -11.027 -47.266 1.00 46.71  ? 32  THR A CB  1 
ATOM   237  O  OG1 . THR A 1 31  ? -19.886 -10.347 -46.334 1.00 47.87  ? 32  THR A OG1 1 
ATOM   238  C  CG2 . THR A 1 31  ? -18.889 -10.195 -48.557 1.00 45.16  ? 32  THR A CG2 1 
ATOM   239  N  N   . PHE A 1 32  ? -18.558 -13.994 -46.036 1.00 43.04  ? 33  PHE A N   1 
ATOM   240  C  CA  . PHE A 1 32  ? -18.432 -14.849 -44.860 1.00 41.88  ? 33  PHE A CA  1 
ATOM   241  C  C   . PHE A 1 32  ? -17.057 -14.715 -44.230 1.00 42.72  ? 33  PHE A C   1 
ATOM   242  O  O   . PHE A 1 32  ? -16.054 -14.569 -44.937 1.00 42.03  ? 33  PHE A O   1 
ATOM   243  C  CB  . PHE A 1 32  ? -18.711 -16.314 -45.224 1.00 41.47  ? 33  PHE A CB  1 
ATOM   244  C  CG  . PHE A 1 32  ? -20.110 -16.548 -45.689 1.00 42.42  ? 33  PHE A CG  1 
ATOM   245  C  CD1 . PHE A 1 32  ? -20.442 -16.398 -47.036 1.00 44.34  ? 33  PHE A CD1 1 
ATOM   246  C  CD2 . PHE A 1 32  ? -21.112 -16.867 -44.781 1.00 42.78  ? 33  PHE A CD2 1 
ATOM   247  C  CE1 . PHE A 1 32  ? -21.748 -16.574 -47.466 1.00 45.89  ? 33  PHE A CE1 1 
ATOM   248  C  CE2 . PHE A 1 32  ? -22.420 -17.055 -45.204 1.00 42.64  ? 33  PHE A CE2 1 
ATOM   249  C  CZ  . PHE A 1 32  ? -22.735 -16.905 -46.543 1.00 44.21  ? 33  PHE A CZ  1 
ATOM   250  N  N   . LYS A 1 33  ? -17.029 -14.753 -42.898 1.00 42.87  ? 34  LYS A N   1 
ATOM   251  C  CA  . LYS A 1 33  ? -15.788 -14.822 -42.140 1.00 43.44  ? 34  LYS A CA  1 
ATOM   252  C  C   . LYS A 1 33  ? -15.441 -16.294 -42.051 1.00 42.57  ? 34  LYS A C   1 
ATOM   253  O  O   . LYS A 1 33  ? -16.263 -17.109 -41.623 1.00 42.43  ? 34  LYS A O   1 
ATOM   254  C  CB  . LYS A 1 33  ? -15.942 -14.210 -40.749 1.00 45.28  ? 34  LYS A CB  1 
ATOM   255  C  CG  . LYS A 1 33  ? -16.482 -12.791 -40.751 1.00 47.36  ? 34  LYS A CG  1 
ATOM   256  C  CD  . LYS A 1 33  ? -16.802 -12.298 -39.354 1.00 50.33  ? 34  LYS A CD  1 
ATOM   257  C  CE  . LYS A 1 33  ? -18.085 -11.489 -39.371 1.00 56.15  ? 34  LYS A CE  1 
ATOM   258  N  NZ  . LYS A 1 33  ? -18.004 -10.314 -38.459 1.00 63.41  ? 34  LYS A NZ  1 
ATOM   259  N  N   . VAL A 1 34  ? -14.239 -16.639 -42.503 1.00 42.65  ? 35  VAL A N   1 
ATOM   260  C  CA  . VAL A 1 34  ? -13.826 -18.043 -42.587 1.00 43.31  ? 35  VAL A CA  1 
ATOM   261  C  C   . VAL A 1 34  ? -12.426 -18.289 -42.038 1.00 45.43  ? 35  VAL A C   1 
ATOM   262  O  O   . VAL A 1 34  ? -11.530 -17.451 -42.184 1.00 47.95  ? 35  VAL A O   1 
ATOM   263  C  CB  . VAL A 1 34  ? -13.909 -18.608 -44.032 1.00 41.51  ? 35  VAL A CB  1 
ATOM   264  C  CG1 . VAL A 1 34  ? -15.357 -18.773 -44.477 1.00 40.60  ? 35  VAL A CG1 1 
ATOM   265  C  CG2 . VAL A 1 34  ? -13.118 -17.747 -45.013 1.00 41.09  ? 35  VAL A CG2 1 
ATOM   266  N  N   . VAL A 1 35  ? -12.243 -19.454 -41.431 1.00 44.92  ? 36  VAL A N   1 
ATOM   267  C  CA  . VAL A 1 35  ? -10.928 -19.884 -41.000 1.00 45.18  ? 36  VAL A CA  1 
ATOM   268  C  C   . VAL A 1 35  ? -10.330 -20.694 -42.132 1.00 45.99  ? 36  VAL A C   1 
ATOM   269  O  O   . VAL A 1 35  ? -10.987 -21.573 -42.697 1.00 48.80  ? 36  VAL A O   1 
ATOM   270  C  CB  . VAL A 1 35  ? -10.984 -20.707 -39.688 1.00 46.34  ? 36  VAL A CB  1 
ATOM   271  C  CG1 . VAL A 1 35  ? -9.669  -21.438 -39.433 1.00 46.70  ? 36  VAL A CG1 1 
ATOM   272  C  CG2 . VAL A 1 35  ? -11.296 -19.798 -38.518 1.00 45.26  ? 36  VAL A CG2 1 
ATOM   273  N  N   . PHE A 1 36  ? -9.084  -20.382 -42.463 1.00 45.73  ? 37  PHE A N   1 
ATOM   274  C  CA  . PHE A 1 36  ? -8.346  -21.132 -43.455 1.00 43.27  ? 37  PHE A CA  1 
ATOM   275  C  C   . PHE A 1 36  ? -7.550  -22.184 -42.713 1.00 44.23  ? 37  PHE A C   1 
ATOM   276  O  O   . PHE A 1 36  ? -6.619  -21.866 -41.962 1.00 44.85  ? 37  PHE A O   1 
ATOM   277  C  CB  . PHE A 1 36  ? -7.477  -20.200 -44.286 1.00 42.20  ? 37  PHE A CB  1 
ATOM   278  C  CG  . PHE A 1 36  ? -8.263  -19.240 -45.139 1.00 41.79  ? 37  PHE A CG  1 
ATOM   279  C  CD1 . PHE A 1 36  ? -8.833  -18.083 -44.589 1.00 41.36  ? 37  PHE A CD1 1 
ATOM   280  C  CD2 . PHE A 1 36  ? -8.432  -19.483 -46.501 1.00 41.57  ? 37  PHE A CD2 1 
ATOM   281  C  CE1 . PHE A 1 36  ? -9.559  -17.202 -45.379 1.00 40.42  ? 37  PHE A CE1 1 
ATOM   282  C  CE2 . PHE A 1 36  ? -9.157  -18.604 -47.297 1.00 41.16  ? 37  PHE A CE2 1 
ATOM   283  C  CZ  . PHE A 1 36  ? -9.719  -17.463 -46.735 1.00 40.94  ? 37  PHE A CZ  1 
ATOM   284  N  N   . ASP A 1 37  ? -7.951  -23.438 -42.926 1.00 45.38  ? 38  ASP A N   1 
ATOM   285  C  CA  . ASP A 1 37  ? -7.570  -24.570 -42.078 1.00 46.42  ? 38  ASP A CA  1 
ATOM   286  C  C   . ASP A 1 37  ? -6.854  -25.669 -42.869 1.00 50.05  ? 38  ASP A C   1 
ATOM   287  O  O   . ASP A 1 37  ? -7.466  -26.393 -43.666 1.00 51.95  ? 38  ASP A O   1 
ATOM   288  C  CB  . ASP A 1 37  ? -8.812  -25.105 -41.344 1.00 45.34  ? 38  ASP A CB  1 
ATOM   289  C  CG  . ASP A 1 37  ? -8.567  -26.414 -40.596 1.00 49.63  ? 38  ASP A CG  1 
ATOM   290  O  OD1 . ASP A 1 37  ? -7.423  -26.702 -40.176 1.00 51.36  ? 38  ASP A OD1 1 
ATOM   291  O  OD2 . ASP A 1 37  ? -9.547  -27.164 -40.401 1.00 51.64  ? 38  ASP A OD2 1 
ATOM   292  N  N   . THR A 1 38  ? -5.553  -25.791 -42.614 1.00 49.00  ? 39  THR A N   1 
ATOM   293  C  CA  . THR A 1 38  ? -4.719  -26.818 -43.239 1.00 48.88  ? 39  THR A CA  1 
ATOM   294  C  C   . THR A 1 38  ? -5.010  -28.228 -42.718 1.00 48.71  ? 39  THR A C   1 
ATOM   295  O  O   . THR A 1 38  ? -4.574  -29.210 -43.313 1.00 53.04  ? 39  THR A O   1 
ATOM   296  C  CB  . THR A 1 38  ? -3.212  -26.500 -43.094 1.00 49.56  ? 39  THR A CB  1 
ATOM   297  O  OG1 . THR A 1 38  ? -2.901  -26.205 -41.726 1.00 46.79  ? 39  THR A OG1 1 
ATOM   298  C  CG2 . THR A 1 38  ? -2.832  -25.309 -43.969 1.00 49.06  ? 39  THR A CG2 1 
ATOM   299  N  N   . GLY A 1 39  ? -5.757  -28.320 -41.623 1.00 47.07  ? 40  GLY A N   1 
ATOM   300  C  CA  . GLY A 1 39  ? -6.096  -29.596 -41.001 1.00 47.52  ? 40  GLY A CA  1 
ATOM   301  C  C   . GLY A 1 39  ? -7.323  -30.284 -41.570 1.00 47.54  ? 40  GLY A C   1 
ATOM   302  O  O   . GLY A 1 39  ? -7.613  -31.418 -41.198 1.00 50.46  ? 40  GLY A O   1 
ATOM   303  N  N   . SER A 1 40  ? -8.042  -29.600 -42.459 1.00 46.43  ? 41  SER A N   1 
ATOM   304  C  CA  . SER A 1 40  ? -9.220  -30.151 -43.141 1.00 46.58  ? 41  SER A CA  1 
ATOM   305  C  C   . SER A 1 40  ? -9.242  -29.686 -44.601 1.00 47.77  ? 41  SER A C   1 
ATOM   306  O  O   . SER A 1 40  ? -8.371  -28.919 -45.007 1.00 50.23  ? 41  SER A O   1 
ATOM   307  C  CB  . SER A 1 40  ? -10.503 -29.765 -42.400 1.00 43.88  ? 41  SER A CB  1 
ATOM   308  O  OG  . SER A 1 40  ? -10.686 -28.361 -42.390 1.00 40.98  ? 41  SER A OG  1 
ATOM   309  N  N   . SER A 1 41  ? -10.218 -30.146 -45.388 1.00 48.64  ? 42  SER A N   1 
ATOM   310  C  CA  . SER A 1 41  ? -10.198 -29.926 -46.846 1.00 50.01  ? 42  SER A CA  1 
ATOM   311  C  C   . SER A 1 41  ? -11.521 -29.451 -47.464 1.00 50.41  ? 42  SER A C   1 
ATOM   312  O  O   . SER A 1 41  ? -11.601 -29.246 -48.675 1.00 52.76  ? 42  SER A O   1 
ATOM   313  C  CB  . SER A 1 41  ? -9.720  -31.187 -47.569 1.00 50.55  ? 42  SER A CB  1 
ATOM   314  O  OG  . SER A 1 41  ? -8.525  -31.705 -47.011 1.00 51.37  ? 42  SER A OG  1 
ATOM   315  N  N   . ASN A 1 42  ? -12.551 -29.287 -46.643 1.00 48.23  ? 43  ASN A N   1 
ATOM   316  C  CA  . ASN A 1 42  ? -13.841 -28.828 -47.131 1.00 46.38  ? 43  ASN A CA  1 
ATOM   317  C  C   . ASN A 1 42  ? -14.067 -27.354 -46.868 1.00 46.16  ? 43  ASN A C   1 
ATOM   318  O  O   . ASN A 1 42  ? -13.606 -26.812 -45.853 1.00 48.37  ? 43  ASN A O   1 
ATOM   319  C  CB  . ASN A 1 42  ? -14.968 -29.644 -46.502 1.00 45.06  ? 43  ASN A CB  1 
ATOM   320  C  CG  . ASN A 1 42  ? -14.999 -31.070 -47.004 1.00 47.89  ? 43  ASN A CG  1 
ATOM   321  O  OD1 . ASN A 1 42  ? -14.151 -31.895 -46.643 1.00 48.52  ? 43  ASN A OD1 1 
ATOM   322  N  ND2 . ASN A 1 42  ? -15.989 -31.375 -47.836 1.00 48.00  ? 43  ASN A ND2 1 
ATOM   323  N  N   . VAL A 1 43  ? -14.762 -26.706 -47.798 1.00 44.07  ? 44  VAL A N   1 
ATOM   324  C  CA  . VAL A 1 43  ? -15.327 -25.388 -47.555 1.00 40.94  ? 44  VAL A CA  1 
ATOM   325  C  C   . VAL A 1 43  ? -16.750 -25.587 -47.041 1.00 41.38  ? 44  VAL A C   1 
ATOM   326  O  O   . VAL A 1 43  ? -17.530 -26.362 -47.610 1.00 40.03  ? 44  VAL A O   1 
ATOM   327  C  CB  . VAL A 1 43  ? -15.361 -24.519 -48.826 1.00 41.65  ? 44  VAL A CB  1 
ATOM   328  C  CG1 . VAL A 1 43  ? -15.829 -23.098 -48.509 1.00 41.49  ? 44  VAL A CG1 1 
ATOM   329  C  CG2 . VAL A 1 43  ? -14.002 -24.489 -49.507 1.00 42.19  ? 44  VAL A CG2 1 
ATOM   330  N  N   . TRP A 1 44  ? -17.084 -24.905 -45.949 1.00 42.15  ? 45  TRP A N   1 
ATOM   331  C  CA  . TRP A 1 44  ? -18.482 -24.787 -45.531 1.00 42.08  ? 45  TRP A CA  1 
ATOM   332  C  C   . TRP A 1 44  ? -18.785 -23.428 -44.949 1.00 42.27  ? 45  TRP A C   1 
ATOM   333  O  O   . TRP A 1 44  ? -17.906 -22.761 -44.407 1.00 44.98  ? 45  TRP A O   1 
ATOM   334  C  CB  . TRP A 1 44  ? -18.888 -25.887 -44.547 1.00 42.80  ? 45  TRP A CB  1 
ATOM   335  C  CG  . TRP A 1 44  ? -18.230 -25.809 -43.186 1.00 42.94  ? 45  TRP A CG  1 
ATOM   336  C  CD1 . TRP A 1 44  ? -17.086 -26.429 -42.810 1.00 43.19  ? 45  TRP A CD1 1 
ATOM   337  C  CD2 . TRP A 1 44  ? -18.698 -25.093 -42.030 1.00 42.71  ? 45  TRP A CD2 1 
ATOM   338  N  NE1 . TRP A 1 44  ? -16.802 -26.159 -41.494 1.00 44.07  ? 45  TRP A NE1 1 
ATOM   339  C  CE2 . TRP A 1 44  ? -17.772 -25.334 -40.990 1.00 43.55  ? 45  TRP A CE2 1 
ATOM   340  C  CE3 . TRP A 1 44  ? -19.806 -24.266 -41.773 1.00 41.84  ? 45  TRP A CE3 1 
ATOM   341  C  CZ2 . TRP A 1 44  ? -17.915 -24.777 -39.704 1.00 42.84  ? 45  TRP A CZ2 1 
ATOM   342  C  CZ3 . TRP A 1 44  ? -19.957 -23.721 -40.493 1.00 42.89  ? 45  TRP A CZ3 1 
ATOM   343  C  CH2 . TRP A 1 44  ? -19.011 -23.980 -39.474 1.00 42.39  ? 45  TRP A CH2 1 
ATOM   344  N  N   . VAL A 1 45  ? -20.045 -23.035 -45.077 1.00 41.86  ? 46  VAL A N   1 
ATOM   345  C  CA  . VAL A 1 45  ? -20.597 -21.849 -44.427 1.00 40.50  ? 46  VAL A CA  1 
ATOM   346  C  C   . VAL A 1 45  ? -21.985 -22.226 -43.905 1.00 39.69  ? 46  VAL A C   1 
ATOM   347  O  O   . VAL A 1 45  ? -22.557 -23.214 -44.375 1.00 40.08  ? 46  VAL A O   1 
ATOM   348  C  CB  . VAL A 1 45  ? -20.653 -20.623 -45.379 1.00 40.72  ? 46  VAL A CB  1 
ATOM   349  C  CG1 . VAL A 1 45  ? -19.245 -20.127 -45.697 1.00 38.42  ? 46  VAL A CG1 1 
ATOM   350  C  CG2 . VAL A 1 45  ? -21.452 -20.923 -46.647 1.00 39.91  ? 46  VAL A CG2 1 
ATOM   351  N  N   . PRO A 1 46  ? -22.531 -21.469 -42.925 1.00 40.13  ? 47  PRO A N   1 
ATOM   352  C  CA  . PRO A 1 46  ? -23.872 -21.830 -42.471 1.00 39.60  ? 47  PRO A CA  1 
ATOM   353  C  C   . PRO A 1 46  ? -24.920 -21.513 -43.540 1.00 41.05  ? 47  PRO A C   1 
ATOM   354  O  O   . PRO A 1 46  ? -24.762 -20.564 -44.314 1.00 40.79  ? 47  PRO A O   1 
ATOM   355  C  CB  . PRO A 1 46  ? -24.076 -20.955 -41.230 1.00 39.94  ? 47  PRO A CB  1 
ATOM   356  C  CG  . PRO A 1 46  ? -22.715 -20.505 -40.828 1.00 40.97  ? 47  PRO A CG  1 
ATOM   357  C  CD  . PRO A 1 46  ? -21.982 -20.360 -42.124 1.00 40.65  ? 47  PRO A CD  1 
ATOM   358  N  N   . SER A 1 47  ? -25.967 -22.328 -43.577 1.00 40.94  ? 48  SER A N   1 
ATOM   359  C  CA  . SER A 1 47  ? -27.008 -22.228 -44.575 1.00 41.49  ? 48  SER A CA  1 
ATOM   360  C  C   . SER A 1 47  ? -28.206 -21.453 -44.052 1.00 42.98  ? 48  SER A C   1 
ATOM   361  O  O   . SER A 1 47  ? -28.549 -21.544 -42.863 1.00 42.20  ? 48  SER A O   1 
ATOM   362  C  CB  . SER A 1 47  ? -27.459 -23.630 -44.959 1.00 41.12  ? 48  SER A CB  1 
ATOM   363  O  OG  . SER A 1 47  ? -28.314 -23.589 -46.073 1.00 43.30  ? 48  SER A OG  1 
ATOM   364  N  N   . SER A 1 48  ? -28.860 -20.714 -44.952 1.00 43.46  ? 49  SER A N   1 
ATOM   365  C  CA  . SER A 1 48  ? -30.177 -20.119 -44.666 1.00 45.35  ? 49  SER A CA  1 
ATOM   366  C  C   . SER A 1 48  ? -31.204 -21.211 -44.312 1.00 44.20  ? 49  SER A C   1 
ATOM   367  O  O   . SER A 1 48  ? -32.217 -20.947 -43.680 1.00 43.80  ? 49  SER A O   1 
ATOM   368  C  CB  . SER A 1 48  ? -30.670 -19.293 -45.863 1.00 44.98  ? 49  SER A CB  1 
ATOM   369  O  OG  . SER A 1 48  ? -30.840 -20.120 -47.001 1.00 43.84  ? 49  SER A OG  1 
ATOM   370  N  N   . LYS A 1 49  ? -30.908 -22.440 -44.722 1.00 45.71  ? 50  LYS A N   1 
ATOM   371  C  CA  . LYS A 1 49  ? -31.775 -23.591 -44.494 1.00 46.28  ? 50  LYS A CA  1 
ATOM   372  C  C   . LYS A 1 49  ? -31.549 -24.225 -43.120 1.00 47.00  ? 50  LYS A C   1 
ATOM   373  O  O   . LYS A 1 49  ? -32.240 -25.176 -42.749 1.00 47.86  ? 50  LYS A O   1 
ATOM   374  C  CB  . LYS A 1 49  ? -31.618 -24.597 -45.641 1.00 45.16  ? 50  LYS A CB  1 
ATOM   375  C  CG  . LYS A 1 49  ? -32.117 -24.026 -46.959 1.00 45.13  ? 50  LYS A CG  1 
ATOM   376  C  CD  . LYS A 1 49  ? -32.121 -25.029 -48.095 1.00 47.62  ? 50  LYS A CD  1 
ATOM   377  C  CE  . LYS A 1 49  ? -32.529 -24.366 -49.410 1.00 48.27  ? 50  LYS A CE  1 
ATOM   378  N  NZ  . LYS A 1 49  ? -31.526 -23.376 -49.923 1.00 47.18  ? 50  LYS A NZ  1 
ATOM   379  N  N   . CYS A 1 50  ? -30.587 -23.676 -42.374 1.00 47.81  ? 51  CYS A N   1 
ATOM   380  C  CA  . CYS A 1 50  ? -30.341 -24.045 -40.981 1.00 48.40  ? 51  CYS A CA  1 
ATOM   381  C  C   . CYS A 1 50  ? -31.489 -23.558 -40.113 1.00 49.17  ? 51  CYS A C   1 
ATOM   382  O  O   . CYS A 1 50  ? -31.800 -22.356 -40.108 1.00 51.25  ? 51  CYS A O   1 
ATOM   383  C  CB  . CYS A 1 50  ? -29.019 -23.446 -40.487 1.00 48.12  ? 51  CYS A CB  1 
ATOM   384  S  SG  . CYS A 1 50  ? -28.598 -23.802 -38.766 1.00 49.48  ? 51  CYS A SG  1 
ATOM   385  N  N   . SER A 1 51  ? -32.113 -24.499 -39.402 1.00 48.09  ? 52  SER A N   1 
ATOM   386  C  CA  . SER A 1 51  ? -33.172 -24.210 -38.440 1.00 48.78  ? 52  SER A CA  1 
ATOM   387  C  C   . SER A 1 51  ? -32.708 -23.149 -37.455 1.00 49.01  ? 52  SER A C   1 
ATOM   388  O  O   . SER A 1 51  ? -31.597 -23.237 -36.910 1.00 48.56  ? 52  SER A O   1 
ATOM   389  C  CB  . SER A 1 51  ? -33.566 -25.481 -37.684 1.00 50.69  ? 52  SER A CB  1 
ATOM   390  O  OG  . SER A 1 51  ? -34.542 -25.213 -36.690 1.00 54.41  ? 52  SER A OG  1 
ATOM   391  N  N   . ARG A 1 52  ? -33.551 -22.142 -37.237 1.00 49.40  ? 53  ARG A N   1 
ATOM   392  C  CA  . ARG A 1 52  ? -33.245 -21.086 -36.259 1.00 48.98  ? 53  ARG A CA  1 
ATOM   393  C  C   . ARG A 1 52  ? -33.185 -21.576 -34.814 1.00 47.17  ? 53  ARG A C   1 
ATOM   394  O  O   . ARG A 1 52  ? -32.727 -20.855 -33.937 1.00 47.04  ? 53  ARG A O   1 
ATOM   395  C  CB  . ARG A 1 52  ? -34.188 -19.884 -36.395 1.00 51.02  ? 53  ARG A CB  1 
ATOM   396  C  CG  . ARG A 1 52  ? -34.135 -19.168 -37.739 1.00 51.51  ? 53  ARG A CG  1 
ATOM   397  C  CD  . ARG A 1 52  ? -32.737 -18.770 -38.176 1.00 50.13  ? 53  ARG A CD  1 
ATOM   398  N  NE  . ARG A 1 52  ? -32.513 -19.356 -39.486 1.00 54.07  ? 53  ARG A NE  1 
ATOM   399  C  CZ  . ARG A 1 52  ? -32.617 -18.723 -40.654 1.00 53.88  ? 53  ARG A CZ  1 
ATOM   400  N  NH1 . ARG A 1 52  ? -32.898 -17.426 -40.732 1.00 54.46  ? 53  ARG A NH1 1 
ATOM   401  N  NH2 . ARG A 1 52  ? -32.409 -19.406 -41.763 1.00 53.61  ? 53  ARG A NH2 1 
ATOM   402  N  N   . LEU A 1 53  ? -33.615 -22.820 -34.595 1.00 47.50  ? 54  LEU A N   1 
ATOM   403  C  CA  . LEU A 1 53  ? -33.428 -23.529 -33.321 1.00 46.98  ? 54  LEU A CA  1 
ATOM   404  C  C   . LEU A 1 53  ? -31.963 -23.848 -33.031 1.00 45.95  ? 54  LEU A C   1 
ATOM   405  O  O   . LEU A 1 53  ? -31.591 -24.021 -31.868 1.00 46.87  ? 54  LEU A O   1 
ATOM   406  C  CB  . LEU A 1 53  ? -34.285 -24.790 -33.261 1.00 46.51  ? 54  LEU A CB  1 
ATOM   407  C  CG  . LEU A 1 53  ? -35.779 -24.574 -33.037 1.00 48.03  ? 54  LEU A CG  1 
ATOM   408  C  CD1 . LEU A 1 53  ? -36.561 -25.789 -33.521 1.00 48.60  ? 54  LEU A CD1 1 
ATOM   409  C  CD2 . LEU A 1 53  ? -36.100 -24.259 -31.579 1.00 48.99  ? 54  LEU A CD2 1 
ATOM   410  N  N   . TYR A 1 54  ? -31.140 -23.920 -34.082 1.00 44.55  ? 55  TYR A N   1 
ATOM   411  C  CA  . TYR A 1 54  ? -29.694 -23.743 -33.928 1.00 44.87  ? 55  TYR A CA  1 
ATOM   412  C  C   . TYR A 1 54  ? -29.379 -22.252 -33.743 1.00 45.92  ? 55  TYR A C   1 
ATOM   413  O  O   . TYR A 1 54  ? -29.424 -21.463 -34.698 1.00 45.51  ? 55  TYR A O   1 
ATOM   414  C  CB  . TYR A 1 54  ? -28.901 -24.344 -35.094 1.00 43.13  ? 55  TYR A CB  1 
ATOM   415  C  CG  . TYR A 1 54  ? -29.040 -25.839 -35.194 1.00 44.78  ? 55  TYR A CG  1 
ATOM   416  C  CD1 . TYR A 1 54  ? -28.348 -26.691 -34.317 1.00 45.07  ? 55  TYR A CD1 1 
ATOM   417  C  CD2 . TYR A 1 54  ? -29.878 -26.413 -36.160 1.00 45.22  ? 55  TYR A CD2 1 
ATOM   418  C  CE1 . TYR A 1 54  ? -28.489 -28.068 -34.402 1.00 46.05  ? 55  TYR A CE1 1 
ATOM   419  C  CE2 . TYR A 1 54  ? -30.030 -27.788 -36.251 1.00 46.00  ? 55  TYR A CE2 1 
ATOM   420  C  CZ  . TYR A 1 54  ? -29.334 -28.606 -35.372 1.00 47.00  ? 55  TYR A CZ  1 
ATOM   421  O  OH  . TYR A 1 54  ? -29.485 -29.957 -35.473 1.00 48.49  ? 55  TYR A OH  1 
ATOM   422  N  N   . THR A 1 55  ? -29.084 -21.885 -32.497 1.00 46.28  ? 56  THR A N   1 
ATOM   423  C  CA  . THR A 1 55  ? -28.793 -20.504 -32.112 1.00 47.33  ? 56  THR A CA  1 
ATOM   424  C  C   . THR A 1 55  ? -27.560 -19.935 -32.818 1.00 46.87  ? 56  THR A C   1 
ATOM   425  O  O   . THR A 1 55  ? -27.498 -18.732 -33.076 1.00 48.41  ? 56  THR A O   1 
ATOM   426  C  CB  . THR A 1 55  ? -28.661 -20.391 -30.586 1.00 48.28  ? 56  THR A CB  1 
ATOM   427  O  OG1 . THR A 1 55  ? -29.841 -20.943 -29.993 1.00 50.26  ? 56  THR A OG1 1 
ATOM   428  C  CG2 . THR A 1 55  ? -28.491 -18.932 -30.122 1.00 47.16  ? 56  THR A CG2 1 
ATOM   429  N  N   . ALA A 1 56  ? -26.602 -20.805 -33.136 1.00 46.15  ? 57  ALA A N   1 
ATOM   430  C  CA  . ALA A 1 56  ? -25.415 -20.441 -33.908 1.00 45.17  ? 57  ALA A CA  1 
ATOM   431  C  C   . ALA A 1 56  ? -25.773 -19.936 -35.309 1.00 46.06  ? 57  ALA A C   1 
ATOM   432  O  O   . ALA A 1 56  ? -25.060 -19.110 -35.878 1.00 48.06  ? 57  ALA A O   1 
ATOM   433  C  CB  . ALA A 1 56  ? -24.451 -21.618 -33.990 1.00 43.21  ? 57  ALA A CB  1 
ATOM   434  N  N   . CYS A 1 57  ? -26.881 -20.420 -35.858 1.00 47.44  ? 58  CYS A N   1 
ATOM   435  C  CA  . CYS A 1 57  ? -27.345 -19.927 -37.142 1.00 48.22  ? 58  CYS A CA  1 
ATOM   436  C  C   . CYS A 1 57  ? -28.022 -18.558 -37.027 1.00 50.44  ? 58  CYS A C   1 
ATOM   437  O  O   . CYS A 1 57  ? -28.022 -17.775 -37.983 1.00 54.47  ? 58  CYS A O   1 
ATOM   438  C  CB  . CYS A 1 57  ? -28.217 -20.965 -37.820 1.00 48.25  ? 58  CYS A CB  1 
ATOM   439  S  SG  . CYS A 1 57  ? -27.222 -22.387 -38.319 1.00 51.30  ? 58  CYS A SG  1 
ATOM   440  N  N   . VAL A 1 58  ? -28.569 -18.266 -35.850 1.00 48.30  ? 59  VAL A N   1 
ATOM   441  C  CA  . VAL A 1 58  ? -29.081 -16.935 -35.535 1.00 48.73  ? 59  VAL A CA  1 
ATOM   442  C  C   . VAL A 1 58  ? -27.922 -15.909 -35.437 1.00 48.89  ? 59  VAL A C   1 
ATOM   443  O  O   . VAL A 1 58  ? -28.097 -14.760 -35.827 1.00 51.71  ? 59  VAL A O   1 
ATOM   444  C  CB  . VAL A 1 58  ? -29.994 -16.967 -34.269 1.00 50.43  ? 59  VAL A CB  1 
ATOM   445  C  CG1 . VAL A 1 58  ? -30.355 -15.573 -33.772 1.00 50.50  ? 59  VAL A CG1 1 
ATOM   446  C  CG2 . VAL A 1 58  ? -31.267 -17.776 -34.525 1.00 49.02  ? 59  VAL A CG2 1 
ATOM   447  N  N   . TYR A 1 59  ? -26.747 -16.337 -34.966 1.00 47.41  ? 60  TYR A N   1 
ATOM   448  C  CA  . TYR A 1 59  ? -25.610 -15.432 -34.672 1.00 47.71  ? 60  TYR A CA  1 
ATOM   449  C  C   . TYR A 1 59  ? -24.486 -15.406 -35.724 1.00 46.06  ? 60  TYR A C   1 
ATOM   450  O  O   . TYR A 1 59  ? -23.376 -14.935 -35.450 1.00 47.34  ? 60  TYR A O   1 
ATOM   451  C  CB  . TYR A 1 59  ? -24.997 -15.785 -33.313 1.00 47.45  ? 60  TYR A CB  1 
ATOM   452  C  CG  . TYR A 1 59  ? -25.712 -15.224 -32.117 1.00 49.89  ? 60  TYR A CG  1 
ATOM   453  C  CD1 . TYR A 1 59  ? -26.910 -15.794 -31.655 1.00 50.92  ? 60  TYR A CD1 1 
ATOM   454  C  CD2 . TYR A 1 59  ? -25.177 -14.144 -31.412 1.00 51.19  ? 60  TYR A CD2 1 
ATOM   455  C  CE1 . TYR A 1 59  ? -27.564 -15.285 -30.537 1.00 52.61  ? 60  TYR A CE1 1 
ATOM   456  C  CE2 . TYR A 1 59  ? -25.827 -13.629 -30.292 1.00 53.22  ? 60  TYR A CE2 1 
ATOM   457  C  CZ  . TYR A 1 59  ? -27.017 -14.201 -29.864 1.00 53.36  ? 60  TYR A CZ  1 
ATOM   458  O  OH  . TYR A 1 59  ? -27.654 -13.692 -28.760 1.00 57.43  ? 60  TYR A OH  1 
ATOM   459  N  N   . HIS A 1 60  ? -24.774 -15.922 -36.911 1.00 43.89  ? 61  HIS A N   1 
ATOM   460  C  CA  . HIS A 1 60  ? -23.797 -16.019 -37.982 1.00 41.77  ? 61  HIS A CA  1 
ATOM   461  C  C   . HIS A 1 60  ? -24.416 -15.708 -39.333 1.00 41.26  ? 61  HIS A C   1 
ATOM   462  O  O   . HIS A 1 60  ? -25.634 -15.829 -39.512 1.00 40.38  ? 61  HIS A O   1 
ATOM   463  C  CB  . HIS A 1 60  ? -23.164 -17.411 -38.003 1.00 42.12  ? 61  HIS A CB  1 
ATOM   464  C  CG  . HIS A 1 60  ? -22.081 -17.586 -36.991 1.00 44.20  ? 61  HIS A CG  1 
ATOM   465  N  ND1 . HIS A 1 60  ? -22.229 -18.371 -35.869 1.00 43.94  ? 61  HIS A ND1 1 
ATOM   466  C  CD2 . HIS A 1 60  ? -20.832 -17.064 -36.925 1.00 43.37  ? 61  HIS A CD2 1 
ATOM   467  C  CE1 . HIS A 1 60  ? -21.115 -18.328 -35.160 1.00 44.36  ? 61  HIS A CE1 1 
ATOM   468  N  NE2 . HIS A 1 60  ? -20.249 -17.548 -35.781 1.00 42.39  ? 61  HIS A NE2 1 
ATOM   469  N  N   . LYS A 1 61  ? -23.566 -15.294 -40.272 1.00 40.35  ? 62  LYS A N   1 
ATOM   470  C  CA  . LYS A 1 61  ? -23.976 -15.097 -41.645 1.00 44.10  ? 62  LYS A CA  1 
ATOM   471  C  C   . LYS A 1 61  ? -24.418 -16.433 -42.265 1.00 44.39  ? 62  LYS A C   1 
ATOM   472  O  O   . LYS A 1 61  ? -23.778 -17.484 -42.065 1.00 44.06  ? 62  LYS A O   1 
ATOM   473  C  CB  . LYS A 1 61  ? -22.846 -14.451 -42.446 1.00 47.69  ? 62  LYS A CB  1 
ATOM   474  C  CG  . LYS A 1 61  ? -23.265 -13.889 -43.801 1.00 51.55  ? 62  LYS A CG  1 
ATOM   475  C  CD  . LYS A 1 61  ? -24.030 -12.579 -43.693 1.00 53.50  ? 62  LYS A CD  1 
ATOM   476  C  CE  . LYS A 1 61  ? -23.881 -11.778 -44.972 1.00 56.02  ? 62  LYS A CE  1 
ATOM   477  N  NZ  . LYS A 1 61  ? -22.519 -11.176 -45.063 1.00 58.52  ? 62  LYS A NZ  1 
ATOM   478  N  N   . LEU A 1 62  ? -25.542 -16.383 -42.974 1.00 43.97  ? 63  LEU A N   1 
ATOM   479  C  CA  . LEU A 1 62  ? -26.125 -17.570 -43.610 1.00 43.59  ? 63  LEU A CA  1 
ATOM   480  C  C   . LEU A 1 62  ? -26.114 -17.415 -45.116 1.00 43.82  ? 63  LEU A C   1 
ATOM   481  O  O   . LEU A 1 62  ? -26.524 -16.370 -45.637 1.00 49.06  ? 63  LEU A O   1 
ATOM   482  C  CB  . LEU A 1 62  ? -27.554 -17.805 -43.112 1.00 42.19  ? 63  LEU A CB  1 
ATOM   483  C  CG  . LEU A 1 62  ? -27.814 -17.867 -41.599 1.00 42.54  ? 63  LEU A CG  1 
ATOM   484  C  CD1 . LEU A 1 62  ? -29.294 -18.012 -41.308 1.00 42.61  ? 63  LEU A CD1 1 
ATOM   485  C  CD2 . LEU A 1 62  ? -27.061 -19.007 -40.930 1.00 43.09  ? 63  LEU A CD2 1 
ATOM   486  N  N   . PHE A 1 63  ? -25.619 -18.432 -45.817 1.00 43.34  ? 64  PHE A N   1 
ATOM   487  C  CA  . PHE A 1 63  ? -25.684 -18.440 -47.280 1.00 43.25  ? 64  PHE A CA  1 
ATOM   488  C  C   . PHE A 1 63  ? -27.100 -18.729 -47.741 1.00 44.89  ? 64  PHE A C   1 
ATOM   489  O  O   . PHE A 1 63  ? -27.700 -19.737 -47.345 1.00 48.03  ? 64  PHE A O   1 
ATOM   490  C  CB  . PHE A 1 63  ? -24.686 -19.418 -47.909 1.00 41.21  ? 64  PHE A CB  1 
ATOM   491  C  CG  . PHE A 1 63  ? -24.795 -19.506 -49.406 1.00 41.17  ? 64  PHE A CG  1 
ATOM   492  C  CD1 . PHE A 1 63  ? -24.353 -18.459 -50.217 1.00 40.90  ? 64  PHE A CD1 1 
ATOM   493  C  CD2 . PHE A 1 63  ? -25.366 -20.634 -50.011 1.00 41.56  ? 64  PHE A CD2 1 
ATOM   494  C  CE1 . PHE A 1 63  ? -24.467 -18.533 -51.596 1.00 40.27  ? 64  PHE A CE1 1 
ATOM   495  C  CE2 . PHE A 1 63  ? -25.478 -20.717 -51.391 1.00 41.33  ? 64  PHE A CE2 1 
ATOM   496  C  CZ  . PHE A 1 63  ? -25.026 -19.662 -52.181 1.00 41.91  ? 64  PHE A CZ  1 
ATOM   497  N  N   . ASP A 1 64  ? -27.624 -17.837 -48.571 1.00 45.81  ? 65  ASP A N   1 
ATOM   498  C  CA  . ASP A 1 64  ? -28.964 -17.995 -49.112 1.00 49.19  ? 65  ASP A CA  1 
ATOM   499  C  C   . ASP A 1 64  ? -28.873 -18.260 -50.606 1.00 48.81  ? 65  ASP A C   1 
ATOM   500  O  O   . ASP A 1 64  ? -28.664 -17.338 -51.412 1.00 49.45  ? 65  ASP A O   1 
ATOM   501  C  CB  . ASP A 1 64  ? -29.830 -16.761 -48.799 1.00 54.00  ? 65  ASP A CB  1 
ATOM   502  C  CG  . ASP A 1 64  ? -31.325 -17.041 -48.899 1.00 56.70  ? 65  ASP A CG  1 
ATOM   503  O  OD1 . ASP A 1 64  ? -31.758 -17.776 -49.814 1.00 58.47  ? 65  ASP A OD1 1 
ATOM   504  O  OD2 . ASP A 1 64  ? -32.079 -16.505 -48.061 1.00 58.14  ? 65  ASP A OD2 1 
ATOM   505  N  N   . ALA A 1 65  ? -29.023 -19.538 -50.958 1.00 48.83  ? 66  ALA A N   1 
ATOM   506  C  CA  . ALA A 1 65  ? -29.019 -20.009 -52.350 1.00 47.42  ? 66  ALA A CA  1 
ATOM   507  C  C   . ALA A 1 65  ? -30.037 -19.270 -53.215 1.00 47.83  ? 66  ALA A C   1 
ATOM   508  O  O   . ALA A 1 65  ? -29.766 -18.979 -54.385 1.00 49.33  ? 66  ALA A O   1 
ATOM   509  C  CB  . ALA A 1 65  ? -29.263 -21.514 -52.407 1.00 46.37  ? 66  ALA A CB  1 
ATOM   510  N  N   . SER A 1 66  ? -31.191 -18.959 -52.624 1.00 46.60  ? 67  SER A N   1 
ATOM   511  C  CA  . SER A 1 66  ? -32.278 -18.254 -53.310 1.00 48.85  ? 67  SER A CA  1 
ATOM   512  C  C   . SER A 1 66  ? -31.954 -16.791 -53.676 1.00 49.56  ? 67  SER A C   1 
ATOM   513  O  O   . SER A 1 66  ? -32.742 -16.142 -54.367 1.00 49.84  ? 67  SER A O   1 
ATOM   514  C  CB  . SER A 1 66  ? -33.558 -18.320 -52.475 1.00 49.26  ? 67  SER A CB  1 
ATOM   515  O  OG  . SER A 1 66  ? -33.941 -19.660 -52.236 1.00 49.32  ? 67  SER A OG  1 
ATOM   516  N  N   . ASP A 1 67  ? -30.805 -16.287 -53.216 1.00 47.87  ? 68  ASP A N   1 
ATOM   517  C  CA  . ASP A 1 67  ? -30.340 -14.937 -53.561 1.00 48.52  ? 68  ASP A CA  1 
ATOM   518  C  C   . ASP A 1 67  ? -29.126 -14.949 -54.493 1.00 47.41  ? 68  ASP A C   1 
ATOM   519  O  O   . ASP A 1 67  ? -28.561 -13.891 -54.788 1.00 48.93  ? 68  ASP A O   1 
ATOM   520  C  CB  . ASP A 1 67  ? -30.027 -14.119 -52.295 1.00 48.99  ? 68  ASP A CB  1 
ATOM   521  C  CG  . ASP A 1 67  ? -31.260 -13.862 -51.425 1.00 51.54  ? 68  ASP A CG  1 
ATOM   522  O  OD1 . ASP A 1 67  ? -32.386 -13.727 -51.964 1.00 52.01  ? 68  ASP A OD1 1 
ATOM   523  O  OD2 . ASP A 1 67  ? -31.090 -13.779 -50.185 1.00 51.99  ? 68  ASP A OD2 1 
ATOM   524  N  N   . SER A 1 68  ? -28.722 -16.138 -54.944 1.00 45.46  ? 69  SER A N   1 
ATOM   525  C  CA  . SER A 1 68  ? -27.561 -16.272 -55.829 1.00 44.19  ? 69  SER A CA  1 
ATOM   526  C  C   . SER A 1 68  ? -27.949 -16.772 -57.214 1.00 45.07  ? 69  SER A C   1 
ATOM   527  O  O   . SER A 1 68  ? -28.481 -17.876 -57.358 1.00 45.24  ? 69  SER A O   1 
ATOM   528  C  CB  . SER A 1 68  ? -26.504 -17.175 -55.206 1.00 42.52  ? 69  SER A CB  1 
ATOM   529  O  OG  . SER A 1 68  ? -25.380 -17.269 -56.056 1.00 43.70  ? 69  SER A OG  1 
ATOM   530  N  N   . SER A 1 69  ? -27.669 -15.959 -58.230 1.00 45.64  ? 70  SER A N   1 
ATOM   531  C  CA  . SER A 1 69  ? -28.001 -16.316 -59.610 1.00 46.46  ? 70  SER A CA  1 
ATOM   532  C  C   . SER A 1 69  ? -27.004 -17.309 -60.243 1.00 46.00  ? 70  SER A C   1 
ATOM   533  O  O   . SER A 1 69  ? -27.238 -17.805 -61.345 1.00 46.85  ? 70  SER A O   1 
ATOM   534  C  CB  . SER A 1 69  ? -28.156 -15.060 -60.469 1.00 47.70  ? 70  SER A CB  1 
ATOM   535  O  OG  . SER A 1 69  ? -26.894 -14.510 -60.775 1.00 51.03  ? 70  SER A OG  1 
ATOM   536  N  N   . SER A 1 70  ? -25.909 -17.592 -59.537 1.00 45.08  ? 71  SER A N   1 
ATOM   537  C  CA  . SER A 1 70  ? -24.839 -18.469 -60.029 1.00 45.09  ? 71  SER A CA  1 
ATOM   538  C  C   . SER A 1 70  ? -24.744 -19.785 -59.235 1.00 44.78  ? 71  SER A C   1 
ATOM   539  O  O   . SER A 1 70  ? -23.881 -20.638 -59.492 1.00 45.62  ? 71  SER A O   1 
ATOM   540  C  CB  . SER A 1 70  ? -23.513 -17.725 -60.008 1.00 44.02  ? 71  SER A CB  1 
ATOM   541  O  OG  . SER A 1 70  ? -23.285 -17.180 -58.724 1.00 44.05  ? 71  SER A OG  1 
ATOM   542  N  N   . TYR A 1 71  ? -25.653 -19.939 -58.283 1.00 43.03  ? 72  TYR A N   1 
ATOM   543  C  CA  . TYR A 1 71  ? -25.795 -21.156 -57.511 1.00 44.00  ? 72  TYR A CA  1 
ATOM   544  C  C   . TYR A 1 71  ? -26.118 -22.359 -58.391 1.00 44.90  ? 72  TYR A C   1 
ATOM   545  O  O   . TYR A 1 71  ? -26.891 -22.257 -59.348 1.00 47.19  ? 72  TYR A O   1 
ATOM   546  C  CB  . TYR A 1 71  ? -26.890 -20.944 -56.462 1.00 43.53  ? 72  TYR A CB  1 
ATOM   547  C  CG  . TYR A 1 71  ? -27.446 -22.196 -55.828 1.00 42.70  ? 72  TYR A CG  1 
ATOM   548  C  CD1 . TYR A 1 71  ? -26.735 -22.872 -54.834 1.00 41.15  ? 72  TYR A CD1 1 
ATOM   549  C  CD2 . TYR A 1 71  ? -28.711 -22.687 -56.197 1.00 44.06  ? 72  TYR A CD2 1 
ATOM   550  C  CE1 . TYR A 1 71  ? -27.255 -24.012 -54.233 1.00 41.56  ? 72  TYR A CE1 1 
ATOM   551  C  CE2 . TYR A 1 71  ? -29.236 -23.828 -55.602 1.00 43.29  ? 72  TYR A CE2 1 
ATOM   552  C  CZ  . TYR A 1 71  ? -28.503 -24.480 -54.618 1.00 41.98  ? 72  TYR A CZ  1 
ATOM   553  O  OH  . TYR A 1 71  ? -29.005 -25.600 -54.018 1.00 42.09  ? 72  TYR A OH  1 
ATOM   554  N  N   . LYS A 1 72  ? -25.504 -23.490 -58.067 1.00 45.27  ? 73  LYS A N   1 
ATOM   555  C  CA  . LYS A 1 72  ? -25.819 -24.757 -58.724 1.00 47.23  ? 73  LYS A CA  1 
ATOM   556  C  C   . LYS A 1 72  ? -26.047 -25.820 -57.660 1.00 46.46  ? 73  LYS A C   1 
ATOM   557  O  O   . LYS A 1 72  ? -25.148 -26.115 -56.858 1.00 46.09  ? 73  LYS A O   1 
ATOM   558  C  CB  . LYS A 1 72  ? -24.731 -25.162 -59.731 1.00 48.32  ? 73  LYS A CB  1 
ATOM   559  C  CG  . LYS A 1 72  ? -24.647 -24.248 -60.948 1.00 50.90  ? 73  LYS A CG  1 
ATOM   560  C  CD  . LYS A 1 72  ? -24.119 -24.978 -62.172 1.00 56.12  ? 73  LYS A CD  1 
ATOM   561  C  CE  . LYS A 1 72  ? -24.294 -24.163 -63.448 1.00 56.34  ? 73  LYS A CE  1 
ATOM   562  N  NZ  . LYS A 1 72  ? -23.116 -23.283 -63.672 1.00 57.55  ? 73  LYS A NZ  1 
ATOM   563  N  N   . HIS A 1 73  ? -27.270 -26.355 -57.647 1.00 45.98  ? 74  HIS A N   1 
ATOM   564  C  CA  . HIS A 1 73  ? -27.720 -27.356 -56.670 1.00 45.51  ? 74  HIS A CA  1 
ATOM   565  C  C   . HIS A 1 73  ? -26.921 -28.645 -56.797 1.00 47.27  ? 74  HIS A C   1 
ATOM   566  O  O   . HIS A 1 73  ? -26.481 -29.005 -57.896 1.00 48.97  ? 74  HIS A O   1 
ATOM   567  C  CB  . HIS A 1 73  ? -29.227 -27.621 -56.863 1.00 45.36  ? 74  HIS A CB  1 
ATOM   568  C  CG  . HIS A 1 73  ? -29.768 -28.769 -56.059 1.00 46.56  ? 74  HIS A CG  1 
ATOM   569  N  ND1 . HIS A 1 73  ? -29.941 -30.034 -56.589 1.00 47.37  ? 74  HIS A ND1 1 
ATOM   570  C  CD2 . HIS A 1 73  ? -30.187 -28.842 -54.771 1.00 45.51  ? 74  HIS A CD2 1 
ATOM   571  C  CE1 . HIS A 1 73  ? -30.433 -30.837 -55.660 1.00 45.82  ? 74  HIS A CE1 1 
ATOM   572  N  NE2 . HIS A 1 73  ? -30.588 -30.140 -54.546 1.00 45.56  ? 74  HIS A NE2 1 
ATOM   573  N  N   . ASN A 1 74  ? -26.694 -29.300 -55.662 1.00 48.47  ? 75  ASN A N   1 
ATOM   574  C  CA  . ASN A 1 74  ? -26.253 -30.694 -55.633 1.00 51.01  ? 75  ASN A CA  1 
ATOM   575  C  C   . ASN A 1 74  ? -27.046 -31.452 -54.570 1.00 49.87  ? 75  ASN A C   1 
ATOM   576  O  O   . ASN A 1 74  ? -27.761 -32.392 -54.900 1.00 51.30  ? 75  ASN A O   1 
ATOM   577  C  CB  . ASN A 1 74  ? -24.728 -30.828 -55.439 1.00 55.78  ? 75  ASN A CB  1 
ATOM   578  C  CG  . ASN A 1 74  ? -24.263 -32.275 -55.498 1.00 60.83  ? 75  ASN A CG  1 
ATOM   579  O  OD1 . ASN A 1 74  ? -24.157 -32.927 -54.460 1.00 62.45  ? 75  ASN A OD1 1 
ATOM   580  N  ND2 . ASN A 1 74  ? -24.005 -32.787 -56.711 1.00 64.82  ? 75  ASN A ND2 1 
ATOM   581  N  N   . GLY A 1 75  ? -26.934 -31.029 -53.310 1.00 46.78  ? 76  GLY A N   1 
ATOM   582  C  CA  . GLY A 1 75  ? -27.775 -31.550 -52.242 1.00 45.63  ? 76  GLY A CA  1 
ATOM   583  C  C   . GLY A 1 75  ? -27.334 -32.820 -51.526 1.00 48.72  ? 76  GLY A C   1 
ATOM   584  O  O   . GLY A 1 75  ? -28.057 -33.302 -50.642 1.00 49.31  ? 76  GLY A O   1 
ATOM   585  N  N   . THR A 1 76  ? -26.169 -33.367 -51.889 1.00 49.26  ? 77  THR A N   1 
ATOM   586  C  CA  . THR A 1 76  ? -25.601 -34.527 -51.177 1.00 52.02  ? 77  THR A CA  1 
ATOM   587  C  C   . THR A 1 76  ? -25.293 -34.169 -49.722 1.00 52.23  ? 77  THR A C   1 
ATOM   588  O  O   . THR A 1 76  ? -24.646 -33.136 -49.449 1.00 49.87  ? 77  THR A O   1 
ATOM   589  C  CB  . THR A 1 76  ? -24.311 -35.056 -51.841 1.00 51.84  ? 77  THR A CB  1 
ATOM   590  O  OG1 . THR A 1 76  ? -24.544 -35.253 -53.234 1.00 54.70  ? 77  THR A OG1 1 
ATOM   591  C  CG2 . THR A 1 76  ? -23.889 -36.381 -51.235 1.00 51.88  ? 77  THR A CG2 1 
ATOM   592  N  N   . GLU A 1 77  ? -25.766 -35.025 -48.811 1.00 52.98  ? 78  GLU A N   1 
ATOM   593  C  CA  . GLU A 1 77  ? -25.553 -34.854 -47.378 1.00 55.70  ? 78  GLU A CA  1 
ATOM   594  C  C   . GLU A 1 77  ? -24.074 -34.951 -47.053 1.00 54.42  ? 78  GLU A C   1 
ATOM   595  O  O   . GLU A 1 77  ? -23.346 -35.745 -47.650 1.00 54.80  ? 78  GLU A O   1 
ATOM   596  C  CB  . GLU A 1 77  ? -26.347 -35.880 -46.552 1.00 61.69  ? 78  GLU A CB  1 
ATOM   597  C  CG  . GLU A 1 77  ? -27.873 -35.784 -46.665 1.00 72.35  ? 78  GLU A CG  1 
ATOM   598  C  CD  . GLU A 1 77  ? -28.455 -34.447 -46.200 1.00 80.91  ? 78  GLU A CD  1 
ATOM   599  O  OE1 . GLU A 1 77  ? -29.241 -33.840 -46.964 1.00 85.39  ? 78  GLU A OE1 1 
ATOM   600  O  OE2 . GLU A 1 77  ? -28.133 -33.989 -45.077 1.00 86.35  ? 78  GLU A OE2 1 
ATOM   601  N  N   . LEU A 1 78  ? -23.621 -34.102 -46.141 1.00 53.23  ? 79  LEU A N   1 
ATOM   602  C  CA  . LEU A 1 78  ? -22.274 -34.234 -45.620 1.00 54.42  ? 79  LEU A CA  1 
ATOM   603  C  C   . LEU A 1 78  ? -22.137 -33.814 -44.156 1.00 53.17  ? 79  LEU A C   1 
ATOM   604  O  O   . LEU A 1 78  ? -22.754 -32.851 -43.697 1.00 51.88  ? 79  LEU A O   1 
ATOM   605  C  CB  . LEU A 1 78  ? -21.238 -33.562 -46.537 1.00 53.88  ? 79  LEU A CB  1 
ATOM   606  C  CG  . LEU A 1 78  ? -20.722 -32.146 -46.330 1.00 53.49  ? 79  LEU A CG  1 
ATOM   607  C  CD1 . LEU A 1 78  ? -19.421 -31.987 -47.103 1.00 53.28  ? 79  LEU A CD1 1 
ATOM   608  C  CD2 . LEU A 1 78  ? -21.756 -31.112 -46.741 1.00 54.03  ? 79  LEU A CD2 1 
ATOM   609  N  N   . THR A 1 79  ? -21.325 -34.590 -43.448 1.00 52.61  ? 80  THR A N   1 
ATOM   610  C  CA  . THR A 1 79  ? -20.981 -34.358 -42.061 1.00 50.88  ? 80  THR A CA  1 
ATOM   611  C  C   . THR A 1 79  ? -19.475 -34.110 -41.998 1.00 49.63  ? 80  THR A C   1 
ATOM   612  O  O   . THR A 1 79  ? -18.679 -34.896 -42.535 1.00 51.05  ? 80  THR A O   1 
ATOM   613  C  CB  . THR A 1 79  ? -21.401 -35.563 -41.197 1.00 50.95  ? 80  THR A CB  1 
ATOM   614  O  OG1 . THR A 1 79  ? -22.822 -35.709 -41.273 1.00 50.58  ? 80  THR A OG1 1 
ATOM   615  C  CG2 . THR A 1 79  ? -20.982 -35.391 -39.744 1.00 49.22  ? 80  THR A CG2 1 
ATOM   616  N  N   . LEU A 1 80  ? -19.108 -33.002 -41.363 1.00 45.91  ? 81  LEU A N   1 
ATOM   617  C  CA  . LEU A 1 80  ? -17.715 -32.616 -41.181 1.00 44.79  ? 81  LEU A CA  1 
ATOM   618  C  C   . LEU A 1 80  ? -17.393 -32.661 -39.698 1.00 46.68  ? 81  LEU A C   1 
ATOM   619  O  O   . LEU A 1 80  ? -18.028 -31.973 -38.889 1.00 46.14  ? 81  LEU A O   1 
ATOM   620  C  CB  . LEU A 1 80  ? -17.455 -31.225 -41.777 1.00 42.43  ? 81  LEU A CB  1 
ATOM   621  C  CG  . LEU A 1 80  ? -17.842 -31.020 -43.251 1.00 41.41  ? 81  LEU A CG  1 
ATOM   622  C  CD1 . LEU A 1 80  ? -17.888 -29.554 -43.616 1.00 38.54  ? 81  LEU A CD1 1 
ATOM   623  C  CD2 . LEU A 1 80  ? -16.909 -31.784 -44.181 1.00 42.21  ? 81  LEU A CD2 1 
ATOM   624  N  N   . ARG A 1 81  ? -16.433 -33.510 -39.348 1.00 50.73  ? 82  ARG A N   1 
ATOM   625  C  CA  . ARG A 1 81  ? -16.056 -33.738 -37.957 1.00 54.42  ? 82  ARG A CA  1 
ATOM   626  C  C   . ARG A 1 81  ? -14.713 -33.088 -37.676 1.00 54.78  ? 82  ARG A C   1 
ATOM   627  O  O   . ARG A 1 81  ? -13.715 -33.427 -38.313 1.00 59.83  ? 82  ARG A O   1 
ATOM   628  C  CB  . ARG A 1 81  ? -16.026 -35.238 -37.638 1.00 56.57  ? 82  ARG A CB  1 
ATOM   629  C  CG  . ARG A 1 81  ? -17.386 -35.818 -37.277 1.00 60.03  ? 82  ARG A CG  1 
ATOM   630  C  CD  . ARG A 1 81  ? -17.503 -37.324 -37.509 1.00 66.39  ? 82  ARG A CD  1 
ATOM   631  N  NE  . ARG A 1 81  ? -16.626 -38.114 -36.636 1.00 74.19  ? 82  ARG A NE  1 
ATOM   632  C  CZ  . ARG A 1 81  ? -16.772 -39.414 -36.359 1.00 77.39  ? 82  ARG A CZ  1 
ATOM   633  N  NH1 . ARG A 1 81  ? -17.781 -40.118 -36.866 1.00 78.06  ? 82  ARG A NH1 1 
ATOM   634  N  NH2 . ARG A 1 81  ? -15.901 -40.015 -35.554 1.00 77.16  ? 82  ARG A NH2 1 
ATOM   635  N  N   . TYR A 1 82  ? -14.711 -32.134 -36.744 1.00 51.68  ? 83  TYR A N   1 
ATOM   636  C  CA  . TYR A 1 82  ? -13.494 -31.473 -36.263 1.00 49.60  ? 83  TYR A CA  1 
ATOM   637  C  C   . TYR A 1 82  ? -13.206 -31.910 -34.821 1.00 50.42  ? 83  TYR A C   1 
ATOM   638  O  O   . TYR A 1 82  ? -14.006 -32.618 -34.218 1.00 51.17  ? 83  TYR A O   1 
ATOM   639  C  CB  . TYR A 1 82  ? -13.634 -29.943 -36.370 1.00 47.78  ? 83  TYR A CB  1 
ATOM   640  C  CG  . TYR A 1 82  ? -13.973 -29.466 -37.769 1.00 47.22  ? 83  TYR A CG  1 
ATOM   641  C  CD1 . TYR A 1 82  ? -15.303 -29.407 -38.206 1.00 45.50  ? 83  TYR A CD1 1 
ATOM   642  C  CD2 . TYR A 1 82  ? -12.960 -29.089 -38.666 1.00 45.85  ? 83  TYR A CD2 1 
ATOM   643  C  CE1 . TYR A 1 82  ? -15.618 -28.997 -39.492 1.00 44.26  ? 83  TYR A CE1 1 
ATOM   644  C  CE2 . TYR A 1 82  ? -13.268 -28.672 -39.953 1.00 45.52  ? 83  TYR A CE2 1 
ATOM   645  C  CZ  . TYR A 1 82  ? -14.599 -28.633 -40.359 1.00 45.66  ? 83  TYR A CZ  1 
ATOM   646  O  OH  . TYR A 1 82  ? -14.914 -28.222 -41.627 1.00 45.77  ? 83  TYR A OH  1 
ATOM   647  N  N   . SER A 1 83  ? -12.062 -31.489 -34.285 1.00 53.88  ? 84  SER A N   1 
ATOM   648  C  CA  . SER A 1 83  ? -11.626 -31.794 -32.909 1.00 56.34  ? 84  SER A CA  1 
ATOM   649  C  C   . SER A 1 83  ? -12.603 -31.323 -31.834 1.00 55.31  ? 84  SER A C   1 
ATOM   650  O  O   . SER A 1 83  ? -12.805 -32.004 -30.826 1.00 54.87  ? 84  SER A O   1 
ATOM   651  C  CB  . SER A 1 83  ? -10.273 -31.132 -32.627 1.00 56.47  ? 84  SER A CB  1 
ATOM   652  O  OG  . SER A 1 83  ? -9.256  -31.653 -33.457 1.00 64.39  ? 84  SER A OG  1 
ATOM   653  N  N   . THR A 1 84  ? -13.188 -30.151 -32.069 1.00 52.11  ? 85  THR A N   1 
ATOM   654  C  CA  . THR A 1 84  ? -13.941 -29.425 -31.060 1.00 52.09  ? 85  THR A CA  1 
ATOM   655  C  C   . THR A 1 84  ? -15.430 -29.423 -31.367 1.00 52.20  ? 85  THR A C   1 
ATOM   656  O  O   . THR A 1 84  ? -16.231 -28.922 -30.567 1.00 55.32  ? 85  THR A O   1 
ATOM   657  C  CB  . THR A 1 84  ? -13.448 -27.969 -30.938 1.00 52.02  ? 85  THR A CB  1 
ATOM   658  O  OG1 . THR A 1 84  ? -13.536 -27.322 -32.215 1.00 51.32  ? 85  THR A OG1 1 
ATOM   659  C  CG2 . THR A 1 84  ? -12.005 -27.929 -30.447 1.00 50.96  ? 85  THR A CG2 1 
ATOM   660  N  N   . GLY A 1 85  ? -15.798 -29.988 -32.517 1.00 48.64  ? 86  GLY A N   1 
ATOM   661  C  CA  . GLY A 1 85  ? -17.192 -30.069 -32.898 1.00 48.59  ? 86  GLY A CA  1 
ATOM   662  C  C   . GLY A 1 85  ? -17.477 -30.536 -34.304 1.00 48.68  ? 86  GLY A C   1 
ATOM   663  O  O   . GLY A 1 85  ? -16.576 -30.713 -35.117 1.00 47.57  ? 86  GLY A O   1 
ATOM   664  N  N   . THR A 1 86  ? -18.763 -30.710 -34.583 1.00 48.48  ? 87  THR A N   1 
ATOM   665  C  CA  . THR A 1 86  ? -19.223 -31.304 -35.821 1.00 48.51  ? 87  THR A CA  1 
ATOM   666  C  C   . THR A 1 86  ? -20.244 -30.401 -36.494 1.00 48.96  ? 87  THR A C   1 
ATOM   667  O  O   . THR A 1 86  ? -21.043 -29.758 -35.818 1.00 48.72  ? 87  THR A O   1 
ATOM   668  C  CB  . THR A 1 86  ? -19.828 -32.685 -35.524 1.00 49.22  ? 87  THR A CB  1 
ATOM   669  O  OG1 . THR A 1 86  ? -18.856 -33.465 -34.829 1.00 50.12  ? 87  THR A OG1 1 
ATOM   670  C  CG2 . THR A 1 86  ? -20.241 -33.425 -36.785 1.00 48.23  ? 87  THR A CG2 1 
ATOM   671  N  N   . VAL A 1 87  ? -20.186 -30.330 -37.823 1.00 49.47  ? 88  VAL A N   1 
ATOM   672  C  CA  . VAL A 1 87  ? -21.245 -29.688 -38.602 1.00 48.80  ? 88  VAL A CA  1 
ATOM   673  C  C   . VAL A 1 87  ? -21.820 -30.664 -39.611 1.00 49.00  ? 88  VAL A C   1 
ATOM   674  O  O   . VAL A 1 87  ? -21.118 -31.544 -40.111 1.00 51.54  ? 88  VAL A O   1 
ATOM   675  C  CB  . VAL A 1 87  ? -20.817 -28.372 -39.304 1.00 47.79  ? 88  VAL A CB  1 
ATOM   676  C  CG1 . VAL A 1 87  ? -20.709 -27.244 -38.301 1.00 47.05  ? 88  VAL A CG1 1 
ATOM   677  C  CG2 . VAL A 1 87  ? -19.530 -28.529 -40.113 1.00 50.82  ? 88  VAL A CG2 1 
ATOM   678  N  N   . SER A 1 88  ? -23.105 -30.498 -39.894 1.00 48.52  ? 89  SER A N   1 
ATOM   679  C  CA  . SER A 1 88  ? -23.785 -31.303 -40.889 1.00 47.27  ? 89  SER A CA  1 
ATOM   680  C  C   . SER A 1 88  ? -24.603 -30.408 -41.803 1.00 45.12  ? 89  SER A C   1 
ATOM   681  O  O   . SER A 1 88  ? -25.030 -29.315 -41.406 1.00 44.11  ? 89  SER A O   1 
ATOM   682  C  CB  . SER A 1 88  ? -24.667 -32.350 -40.212 1.00 48.85  ? 89  SER A CB  1 
ATOM   683  O  OG  . SER A 1 88  ? -25.122 -33.300 -41.152 1.00 49.28  ? 89  SER A OG  1 
ATOM   684  N  N   . GLY A 1 89  ? -24.794 -30.875 -43.034 1.00 43.90  ? 90  GLY A N   1 
ATOM   685  C  CA  . GLY A 1 89  ? -25.560 -30.155 -44.036 1.00 41.89  ? 90  GLY A CA  1 
ATOM   686  C  C   . GLY A 1 89  ? -25.504 -30.851 -45.372 1.00 43.39  ? 90  GLY A C   1 
ATOM   687  O  O   . GLY A 1 89  ? -25.554 -32.078 -45.452 1.00 45.46  ? 90  GLY A O   1 
ATOM   688  N  N   . PHE A 1 90  ? -25.410 -30.066 -46.434 1.00 43.11  ? 91  PHE A N   1 
ATOM   689  C  CA  . PHE A 1 90  ? -25.446 -30.614 -47.781 1.00 44.31  ? 91  PHE A CA  1 
ATOM   690  C  C   . PHE A 1 90  ? -24.523 -29.829 -48.710 1.00 43.75  ? 91  PHE A C   1 
ATOM   691  O  O   . PHE A 1 90  ? -24.139 -28.703 -48.401 1.00 41.40  ? 91  PHE A O   1 
ATOM   692  C  CB  . PHE A 1 90  ? -26.893 -30.683 -48.317 1.00 44.07  ? 91  PHE A CB  1 
ATOM   693  C  CG  . PHE A 1 90  ? -27.566 -29.350 -48.429 1.00 43.39  ? 91  PHE A CG  1 
ATOM   694  C  CD1 . PHE A 1 90  ? -27.429 -28.574 -49.590 1.00 44.80  ? 91  PHE A CD1 1 
ATOM   695  C  CD2 . PHE A 1 90  ? -28.345 -28.859 -47.380 1.00 44.24  ? 91  PHE A CD2 1 
ATOM   696  C  CE1 . PHE A 1 90  ? -28.040 -27.324 -49.687 1.00 45.39  ? 91  PHE A CE1 1 
ATOM   697  C  CE2 . PHE A 1 90  ? -28.963 -27.610 -47.471 1.00 44.50  ? 91  PHE A CE2 1 
ATOM   698  C  CZ  . PHE A 1 90  ? -28.812 -26.844 -48.626 1.00 44.70  ? 91  PHE A CZ  1 
ATOM   699  N  N   . LEU A 1 91  ? -24.175 -30.435 -49.841 1.00 45.15  ? 92  LEU A N   1 
ATOM   700  C  CA  . LEU A 1 91  ? -23.294 -29.799 -50.814 1.00 45.58  ? 92  LEU A CA  1 
ATOM   701  C  C   . LEU A 1 91  ? -24.028 -28.853 -51.748 1.00 45.75  ? 92  LEU A C   1 
ATOM   702  O  O   . LEU A 1 91  ? -25.164 -29.112 -52.160 1.00 49.14  ? 92  LEU A O   1 
ATOM   703  C  CB  . LEU A 1 91  ? -22.534 -30.847 -51.628 1.00 47.49  ? 92  LEU A CB  1 
ATOM   704  C  CG  . LEU A 1 91  ? -21.448 -31.644 -50.898 1.00 50.20  ? 92  LEU A CG  1 
ATOM   705  C  CD1 . LEU A 1 91  ? -20.939 -32.783 -51.778 1.00 51.90  ? 92  LEU A CD1 1 
ATOM   706  C  CD2 . LEU A 1 91  ? -20.305 -30.733 -50.466 1.00 49.97  ? 92  LEU A CD2 1 
ATOM   707  N  N   . SER A 1 92  ? -23.357 -27.755 -52.074 1.00 44.15  ? 93  SER A N   1 
ATOM   708  C  CA  . SER A 1 92  ? -23.812 -26.809 -53.085 1.00 44.38  ? 93  SER A CA  1 
ATOM   709  C  C   . SER A 1 92  ? -22.610 -26.336 -53.882 1.00 45.52  ? 93  SER A C   1 
ATOM   710  O  O   . SER A 1 92  ? -21.479 -26.447 -53.420 1.00 45.78  ? 93  SER A O   1 
ATOM   711  C  CB  . SER A 1 92  ? -24.512 -25.614 -52.438 1.00 42.11  ? 93  SER A CB  1 
ATOM   712  O  OG  . SER A 1 92  ? -25.762 -25.995 -51.900 1.00 43.80  ? 93  SER A OG  1 
ATOM   713  N  N   . GLN A 1 93  ? -22.867 -25.822 -55.080 1.00 47.30  ? 94  GLN A N   1 
ATOM   714  C  CA  . GLN A 1 93  ? -21.837 -25.223 -55.914 1.00 48.67  ? 94  GLN A CA  1 
ATOM   715  C  C   . GLN A 1 93  ? -22.182 -23.759 -56.173 1.00 49.09  ? 94  GLN A C   1 
ATOM   716  O  O   . GLN A 1 93  ? -23.338 -23.425 -56.468 1.00 48.48  ? 94  GLN A O   1 
ATOM   717  C  CB  . GLN A 1 93  ? -21.726 -25.991 -57.227 1.00 50.75  ? 94  GLN A CB  1 
ATOM   718  C  CG  . GLN A 1 93  ? -20.592 -25.553 -58.137 1.00 53.87  ? 94  GLN A CG  1 
ATOM   719  C  CD  . GLN A 1 93  ? -20.682 -26.191 -59.506 1.00 57.39  ? 94  GLN A CD  1 
ATOM   720  O  OE1 . GLN A 1 93  ? -20.579 -27.409 -59.643 1.00 58.48  ? 94  GLN A OE1 1 
ATOM   721  N  NE2 . GLN A 1 93  ? -20.886 -25.367 -60.532 1.00 59.27  ? 94  GLN A NE2 1 
ATOM   722  N  N   . ASP A 1 94  ? -21.176 -22.895 -56.040 1.00 48.56  ? 95  ASP A N   1 
ATOM   723  C  CA  . ASP A 1 94  ? -21.289 -21.479 -56.408 1.00 49.30  ? 95  ASP A CA  1 
ATOM   724  C  C   . ASP A 1 94  ? -19.915 -20.866 -56.693 1.00 50.75  ? 95  ASP A C   1 
ATOM   725  O  O   . ASP A 1 94  ? -18.875 -21.504 -56.502 1.00 51.27  ? 95  ASP A O   1 
ATOM   726  C  CB  . ASP A 1 94  ? -22.010 -20.683 -55.307 1.00 46.88  ? 95  ASP A CB  1 
ATOM   727  C  CG  . ASP A 1 94  ? -22.877 -19.558 -55.855 1.00 46.39  ? 95  ASP A CG  1 
ATOM   728  O  OD1 . ASP A 1 94  ? -22.499 -18.903 -56.849 1.00 46.51  ? 95  ASP A OD1 1 
ATOM   729  O  OD2 . ASP A 1 94  ? -23.948 -19.313 -55.269 1.00 45.49  ? 95  ASP A OD2 1 
ATOM   730  N  N   . ILE A 1 95  ? -19.937 -19.633 -57.181 1.00 52.60  ? 96  ILE A N   1 
ATOM   731  C  CA  . ILE A 1 95  ? -18.757 -18.801 -57.342 1.00 56.16  ? 96  ILE A CA  1 
ATOM   732  C  C   . ILE A 1 95  ? -18.274 -18.339 -55.961 1.00 55.77  ? 96  ILE A C   1 
ATOM   733  O  O   . ILE A 1 95  ? -19.074 -17.872 -55.144 1.00 58.52  ? 96  ILE A O   1 
ATOM   734  C  CB  . ILE A 1 95  ? -19.102 -17.631 -58.287 1.00 61.12  ? 96  ILE A CB  1 
ATOM   735  C  CG1 . ILE A 1 95  ? -19.000 -18.114 -59.741 1.00 64.34  ? 96  ILE A CG1 1 
ATOM   736  C  CG2 . ILE A 1 95  ? -18.231 -16.404 -58.040 1.00 64.07  ? 96  ILE A CG2 1 
ATOM   737  C  CD1 . ILE A 1 95  ? -19.956 -17.434 -60.698 1.00 68.56  ? 96  ILE A CD1 1 
ATOM   738  N  N   . ILE A 1 96  ? -16.979 -18.520 -55.693 1.00 54.39  ? 97  ILE A N   1 
ATOM   739  C  CA  . ILE A 1 96  ? -16.347 -18.046 -54.450 1.00 52.49  ? 97  ILE A CA  1 
ATOM   740  C  C   . ILE A 1 96  ? -15.168 -17.134 -54.773 1.00 52.65  ? 97  ILE A C   1 
ATOM   741  O  O   . ILE A 1 96  ? -14.298 -17.505 -55.562 1.00 54.79  ? 97  ILE A O   1 
ATOM   742  C  CB  . ILE A 1 96  ? -15.900 -19.203 -53.506 1.00 51.84  ? 97  ILE A CB  1 
ATOM   743  C  CG1 . ILE A 1 96  ? -17.116 -20.033 -53.060 1.00 49.55  ? 97  ILE A CG1 1 
ATOM   744  C  CG2 . ILE A 1 96  ? -15.116 -18.662 -52.302 1.00 49.07  ? 97  ILE A CG2 1 
ATOM   745  C  CD1 . ILE A 1 96  ? -16.825 -21.128 -52.051 1.00 48.58  ? 97  ILE A CD1 1 
ATOM   746  N  N   . THR A 1 97  ? -15.161 -15.940 -54.180 1.00 52.66  ? 98  THR A N   1 
ATOM   747  C  CA  . THR A 1 97  ? -14.008 -15.039 -54.265 1.00 53.93  ? 98  THR A CA  1 
ATOM   748  C  C   . THR A 1 97  ? -13.191 -15.095 -52.986 1.00 53.71  ? 98  THR A C   1 
ATOM   749  O  O   . THR A 1 97  ? -13.735 -15.089 -51.875 1.00 53.20  ? 98  THR A O   1 
ATOM   750  C  CB  . THR A 1 97  ? -14.367 -13.575 -54.607 1.00 55.53  ? 98  THR A CB  1 
ATOM   751  O  OG1 . THR A 1 97  ? -15.516 -13.161 -53.860 1.00 58.32  ? 98  THR A OG1 1 
ATOM   752  C  CG2 . THR A 1 97  ? -14.672 -13.435 -56.072 1.00 57.74  ? 98  THR A CG2 1 
ATOM   753  N  N   . VAL A 1 98  ? -11.879 -15.177 -53.176 1.00 52.62  ? 99  VAL A N   1 
ATOM   754  C  CA  . VAL A 1 98  ? -10.895 -15.228 -52.108 1.00 50.61  ? 99  VAL A CA  1 
ATOM   755  C  C   . VAL A 1 98  ? -9.631  -14.579 -52.675 1.00 52.74  ? 99  VAL A C   1 
ATOM   756  O  O   . VAL A 1 98  ? -9.072  -15.060 -53.673 1.00 54.18  ? 99  VAL A O   1 
ATOM   757  C  CB  . VAL A 1 98  ? -10.693 -16.682 -51.564 1.00 49.41  ? 99  VAL A CB  1 
ATOM   758  C  CG1 . VAL A 1 98  ? -10.604 -17.715 -52.680 1.00 49.70  ? 99  VAL A CG1 1 
ATOM   759  C  CG2 . VAL A 1 98  ? -9.494  -16.782 -50.626 1.00 48.64  ? 99  VAL A CG2 1 
ATOM   760  N  N   . GLY A 1 99  ? -9.228  -13.464 -52.058 1.00 52.54  ? 100 GLY A N   1 
ATOM   761  C  CA  . GLY A 1 99  ? -8.118  -12.624 -52.531 1.00 53.45  ? 100 GLY A CA  1 
ATOM   762  C  C   . GLY A 1 99  ? -8.236  -12.129 -53.970 1.00 57.33  ? 100 GLY A C   1 
ATOM   763  O  O   . GLY A 1 99  ? -7.238  -12.040 -54.696 1.00 59.11  ? 100 GLY A O   1 
ATOM   764  N  N   . GLY A 1 100 ? -9.455  -11.822 -54.402 1.00 56.57  ? 101 GLY A N   1 
ATOM   765  C  CA  . GLY A 1 100 ? -9.680  -11.403 -55.788 1.00 60.53  ? 101 GLY A CA  1 
ATOM   766  C  C   . GLY A 1 100 ? -9.504  -12.495 -56.831 1.00 61.51  ? 101 GLY A C   1 
ATOM   767  O  O   . GLY A 1 100 ? -9.441  -12.206 -58.026 1.00 64.87  ? 101 GLY A O   1 
ATOM   768  N  N   . ILE A 1 101 ? -9.412  -13.744 -56.379 1.00 59.63  ? 102 ILE A N   1 
ATOM   769  C  CA  . ILE A 1 101 ? -9.492  -14.897 -57.263 1.00 60.07  ? 102 ILE A CA  1 
ATOM   770  C  C   . ILE A 1 101 ? -10.901 -15.468 -57.150 1.00 59.33  ? 102 ILE A C   1 
ATOM   771  O  O   . ILE A 1 101 ? -11.408 -15.660 -56.046 1.00 59.37  ? 102 ILE A O   1 
ATOM   772  C  CB  . ILE A 1 101 ? -8.403  -15.954 -56.953 1.00 60.42  ? 102 ILE A CB  1 
ATOM   773  C  CG1 . ILE A 1 101 ? -7.045  -15.460 -57.462 1.00 61.90  ? 102 ILE A CG1 1 
ATOM   774  C  CG2 . ILE A 1 101 ? -8.734  -17.307 -57.589 1.00 59.30  ? 102 ILE A CG2 1 
ATOM   775  C  CD1 . ILE A 1 101 ? -5.853  -16.061 -56.747 1.00 63.21  ? 102 ILE A CD1 1 
ATOM   776  N  N   . THR A 1 102 ? -11.513 -15.711 -58.309 1.00 59.17  ? 103 THR A N   1 
ATOM   777  C  CA  . THR A 1 102 ? -12.840 -16.293 -58.433 1.00 57.64  ? 103 THR A CA  1 
ATOM   778  C  C   . THR A 1 102 ? -12.693 -17.762 -58.842 1.00 57.70  ? 103 THR A C   1 
ATOM   779  O  O   . THR A 1 102 ? -12.057 -18.069 -59.855 1.00 58.90  ? 103 THR A O   1 
ATOM   780  C  CB  . THR A 1 102 ? -13.669 -15.505 -59.477 1.00 59.63  ? 103 THR A CB  1 
ATOM   781  O  OG1 . THR A 1 102 ? -13.932 -14.194 -58.974 1.00 60.05  ? 103 THR A OG1 1 
ATOM   782  C  CG2 . THR A 1 102 ? -14.997 -16.177 -59.787 1.00 60.63  ? 103 THR A CG2 1 
ATOM   783  N  N   . VAL A 1 103 ? -13.260 -18.655 -58.032 1.00 55.06  ? 104 VAL A N   1 
ATOM   784  C  CA  . VAL A 1 103 ? -13.362 -20.081 -58.370 1.00 55.12  ? 104 VAL A CA  1 
ATOM   785  C  C   . VAL A 1 103 ? -14.782 -20.604 -58.206 1.00 54.68  ? 104 VAL A C   1 
ATOM   786  O  O   . VAL A 1 103 ? -15.480 -20.271 -57.239 1.00 53.36  ? 104 VAL A O   1 
ATOM   787  C  CB  . VAL A 1 103 ? -12.409 -20.996 -57.551 1.00 55.05  ? 104 VAL A CB  1 
ATOM   788  C  CG1 . VAL A 1 103 ? -11.014 -20.989 -58.135 1.00 59.46  ? 104 VAL A CG1 1 
ATOM   789  C  CG2 . VAL A 1 103 ? -12.373 -20.622 -56.078 1.00 53.95  ? 104 VAL A CG2 1 
ATOM   790  N  N   . THR A 1 104 ? -15.199 -21.421 -59.168 1.00 55.33  ? 105 THR A N   1 
ATOM   791  C  CA  . THR A 1 104 ? -16.393 -22.242 -59.029 1.00 53.59  ? 105 THR A CA  1 
ATOM   792  C  C   . THR A 1 104 ? -16.028 -23.369 -58.061 1.00 54.06  ? 105 THR A C   1 
ATOM   793  O  O   . THR A 1 104 ? -15.081 -24.131 -58.303 1.00 55.86  ? 105 THR A O   1 
ATOM   794  C  CB  . THR A 1 104 ? -16.868 -22.773 -60.394 1.00 52.67  ? 105 THR A CB  1 
ATOM   795  O  OG1 . THR A 1 104 ? -17.121 -21.663 -61.262 1.00 51.45  ? 105 THR A OG1 1 
ATOM   796  C  CG2 . THR A 1 104 ? -18.133 -23.583 -60.249 1.00 50.49  ? 105 THR A CG2 1 
ATOM   797  N  N   . GLN A 1 105 ? -16.773 -23.440 -56.960 1.00 51.98  ? 106 GLN A N   1 
ATOM   798  C  CA  . GLN A 1 105 ? -16.429 -24.291 -55.839 1.00 50.37  ? 106 GLN A CA  1 
ATOM   799  C  C   . GLN A 1 105 ? -17.646 -24.973 -55.247 1.00 51.39  ? 106 GLN A C   1 
ATOM   800  O  O   . GLN A 1 105 ? -18.655 -24.324 -54.942 1.00 50.19  ? 106 GLN A O   1 
ATOM   801  C  CB  . GLN A 1 105 ? -15.726 -23.460 -54.756 1.00 49.39  ? 106 GLN A CB  1 
ATOM   802  C  CG  . GLN A 1 105 ? -15.219 -24.235 -53.534 1.00 46.73  ? 106 GLN A CG  1 
ATOM   803  C  CD  . GLN A 1 105 ? -14.098 -25.209 -53.858 1.00 46.90  ? 106 GLN A CD  1 
ATOM   804  O  OE1 . GLN A 1 105 ? -13.263 -24.965 -54.736 1.00 47.31  ? 106 GLN A OE1 1 
ATOM   805  N  NE2 . GLN A 1 105 ? -14.077 -26.322 -53.147 1.00 46.42  ? 106 GLN A NE2 1 
ATOM   806  N  N   . MET A 1 106 ? -17.533 -26.288 -55.091 1.00 52.88  ? 107 MET A N   1 
ATOM   807  C  CA  . MET A 1 106 ? -18.447 -27.053 -54.261 1.00 54.46  ? 107 MET A CA  1 
ATOM   808  C  C   . MET A 1 106 ? -18.107 -26.806 -52.788 1.00 51.47  ? 107 MET A C   1 
ATOM   809  O  O   . MET A 1 106 ? -16.937 -26.784 -52.403 1.00 53.22  ? 107 MET A O   1 
ATOM   810  C  CB  . MET A 1 106 ? -18.357 -28.538 -54.591 1.00 61.11  ? 107 MET A CB  1 
ATOM   811  C  CG  . MET A 1 106 ? -19.040 -28.933 -55.886 1.00 70.87  ? 107 MET A CG  1 
ATOM   812  S  SD  . MET A 1 106 ? -20.698 -29.561 -55.580 1.00 80.40  ? 107 MET A SD  1 
ATOM   813  C  CE  . MET A 1 106 ? -20.336 -31.287 -55.250 1.00 78.77  ? 107 MET A CE  1 
ATOM   814  N  N   . PHE A 1 107 ? -19.138 -26.607 -51.979 1.00 47.22  ? 108 PHE A N   1 
ATOM   815  C  CA  . PHE A 1 107 ? -18.988 -26.305 -50.561 1.00 44.51  ? 108 PHE A CA  1 
ATOM   816  C  C   . PHE A 1 107 ? -20.196 -26.830 -49.796 1.00 43.18  ? 108 PHE A C   1 
ATOM   817  O  O   . PHE A 1 107 ? -21.228 -27.140 -50.389 1.00 42.87  ? 108 PHE A O   1 
ATOM   818  C  CB  . PHE A 1 107 ? -18.819 -24.788 -50.334 1.00 43.82  ? 108 PHE A CB  1 
ATOM   819  C  CG  . PHE A 1 107 ? -20.016 -23.961 -50.757 1.00 42.89  ? 108 PHE A CG  1 
ATOM   820  C  CD1 . PHE A 1 107 ? -20.132 -23.489 -52.070 1.00 42.05  ? 108 PHE A CD1 1 
ATOM   821  C  CD2 . PHE A 1 107 ? -21.026 -23.633 -49.836 1.00 42.11  ? 108 PHE A CD2 1 
ATOM   822  C  CE1 . PHE A 1 107 ? -21.237 -22.730 -52.459 1.00 41.95  ? 108 PHE A CE1 1 
ATOM   823  C  CE2 . PHE A 1 107 ? -22.127 -22.864 -50.222 1.00 41.55  ? 108 PHE A CE2 1 
ATOM   824  C  CZ  . PHE A 1 107 ? -22.233 -22.415 -51.538 1.00 41.50  ? 108 PHE A CZ  1 
ATOM   825  N  N   . GLY A 1 108 ? -20.067 -26.913 -48.480 1.00 42.30  ? 109 GLY A N   1 
ATOM   826  C  CA  . GLY A 1 108 ? -21.164 -27.350 -47.634 1.00 42.35  ? 109 GLY A CA  1 
ATOM   827  C  C   . GLY A 1 108 ? -22.015 -26.183 -47.183 1.00 43.01  ? 109 GLY A C   1 
ATOM   828  O  O   . GLY A 1 108 ? -21.503 -25.167 -46.695 1.00 43.06  ? 109 GLY A O   1 
ATOM   829  N  N   . GLU A 1 109 ? -23.317 -26.316 -47.392 1.00 42.82  ? 110 GLU A N   1 
ATOM   830  C  CA  . GLU A 1 109 ? -24.289 -25.488 -46.718 1.00 43.06  ? 110 GLU A CA  1 
ATOM   831  C  C   . GLU A 1 109 ? -24.629 -26.232 -45.431 1.00 42.76  ? 110 GLU A C   1 
ATOM   832  O  O   . GLU A 1 109 ? -25.195 -27.331 -45.458 1.00 43.86  ? 110 GLU A O   1 
ATOM   833  C  CB  . GLU A 1 109 ? -25.524 -25.283 -47.590 1.00 44.48  ? 110 GLU A CB  1 
ATOM   834  C  CG  . GLU A 1 109 ? -25.325 -24.295 -48.725 1.00 46.93  ? 110 GLU A CG  1 
ATOM   835  C  CD  . GLU A 1 109 ? -26.640 -23.771 -49.282 1.00 49.15  ? 110 GLU A CD  1 
ATOM   836  O  OE1 . GLU A 1 109 ? -27.367 -23.075 -48.535 1.00 48.22  ? 110 GLU A OE1 1 
ATOM   837  O  OE2 . GLU A 1 109 ? -26.938 -24.045 -50.469 1.00 47.11  ? 110 GLU A OE2 1 
ATOM   838  N  N   . VAL A 1 110 ? -24.255 -25.642 -44.306 1.00 40.71  ? 111 VAL A N   1 
ATOM   839  C  CA  . VAL A 1 110 ? -24.432 -26.290 -43.016 1.00 40.28  ? 111 VAL A CA  1 
ATOM   840  C  C   . VAL A 1 110 ? -25.811 -25.947 -42.440 1.00 41.81  ? 111 VAL A C   1 
ATOM   841  O  O   . VAL A 1 110 ? -26.160 -24.770 -42.280 1.00 41.74  ? 111 VAL A O   1 
ATOM   842  C  CB  . VAL A 1 110 ? -23.258 -25.951 -42.073 1.00 38.22  ? 111 VAL A CB  1 
ATOM   843  C  CG1 . VAL A 1 110 ? -23.601 -26.220 -40.612 1.00 38.76  ? 111 VAL A CG1 1 
ATOM   844  C  CG2 . VAL A 1 110 ? -22.027 -26.737 -42.495 1.00 37.58  ? 111 VAL A CG2 1 
ATOM   845  N  N   . THR A 1 111 ? -26.586 -26.991 -42.158 1.00 42.14  ? 112 THR A N   1 
ATOM   846  C  CA  . THR A 1 111 ? -27.943 -26.862 -41.635 1.00 41.95  ? 112 THR A CA  1 
ATOM   847  C  C   . THR A 1 111 ? -28.020 -27.296 -40.167 1.00 44.32  ? 112 THR A C   1 
ATOM   848  O  O   . THR A 1 111 ? -29.057 -27.125 -39.509 1.00 44.68  ? 112 THR A O   1 
ATOM   849  C  CB  . THR A 1 111 ? -28.948 -27.683 -42.466 1.00 41.63  ? 112 THR A CB  1 
ATOM   850  O  OG1 . THR A 1 111 ? -28.423 -28.992 -42.686 1.00 44.12  ? 112 THR A OG1 1 
ATOM   851  C  CG2 . THR A 1 111 ? -29.199 -27.045 -43.805 1.00 41.82  ? 112 THR A CG2 1 
ATOM   852  N  N   . GLU A 1 112 ? -26.926 -27.872 -39.667 1.00 45.04  ? 113 GLU A N   1 
ATOM   853  C  CA  . GLU A 1 112 ? -26.839 -28.348 -38.284 1.00 47.18  ? 113 GLU A CA  1 
ATOM   854  C  C   . GLU A 1 112 ? -25.507 -27.906 -37.688 1.00 46.73  ? 113 GLU A C   1 
ATOM   855  O  O   . GLU A 1 112 ? -24.434 -28.373 -38.087 1.00 43.80  ? 113 GLU A O   1 
ATOM   856  C  CB  . GLU A 1 112 ? -27.042 -29.868 -38.195 1.00 50.22  ? 113 GLU A CB  1 
ATOM   857  C  CG  . GLU A 1 112 ? -28.475 -30.309 -38.472 1.00 54.31  ? 113 GLU A CG  1 
ATOM   858  C  CD  . GLU A 1 112 ? -28.614 -31.795 -38.720 1.00 59.63  ? 113 GLU A CD  1 
ATOM   859  O  OE1 . GLU A 1 112 ? -28.061 -32.283 -39.729 1.00 62.38  ? 113 GLU A OE1 1 
ATOM   860  O  OE2 . GLU A 1 112 ? -29.297 -32.473 -37.919 1.00 62.15  ? 113 GLU A OE2 1 
ATOM   861  N  N   . MET A 1 113 ? -25.603 -26.980 -36.737 1.00 47.06  ? 114 MET A N   1 
ATOM   862  C  CA  . MET A 1 113 ? -24.460 -26.237 -36.245 1.00 46.57  ? 114 MET A CA  1 
ATOM   863  C  C   . MET A 1 113 ? -24.625 -26.031 -34.734 1.00 47.08  ? 114 MET A C   1 
ATOM   864  O  O   . MET A 1 113 ? -25.283 -25.067 -34.313 1.00 47.71  ? 114 MET A O   1 
ATOM   865  C  CB  . MET A 1 113 ? -24.381 -24.910 -36.992 1.00 47.31  ? 114 MET A CB  1 
ATOM   866  C  CG  . MET A 1 113 ? -23.064 -24.163 -36.898 1.00 50.20  ? 114 MET A CG  1 
ATOM   867  S  SD  . MET A 1 113 ? -23.281 -22.563 -37.710 1.00 52.50  ? 114 MET A SD  1 
ATOM   868  C  CE  . MET A 1 113 ? -21.741 -21.766 -37.297 1.00 51.80  ? 114 MET A CE  1 
ATOM   869  N  N   . PRO A 1 114 ? -24.040 -26.944 -33.918 1.00 45.69  ? 115 PRO A N   1 
ATOM   870  C  CA  . PRO A 1 114 ? -24.202 -26.977 -32.454 1.00 47.24  ? 115 PRO A CA  1 
ATOM   871  C  C   . PRO A 1 114 ? -23.747 -25.688 -31.773 1.00 47.91  ? 115 PRO A C   1 
ATOM   872  O  O   . PRO A 1 114 ? -22.690 -25.136 -32.119 1.00 47.63  ? 115 PRO A O   1 
ATOM   873  C  CB  . PRO A 1 114 ? -23.303 -28.143 -32.012 1.00 47.42  ? 115 PRO A CB  1 
ATOM   874  C  CG  . PRO A 1 114 ? -23.052 -28.948 -33.237 1.00 46.57  ? 115 PRO A CG  1 
ATOM   875  C  CD  . PRO A 1 114 ? -23.125 -27.999 -34.389 1.00 44.80  ? 115 PRO A CD  1 
ATOM   876  N  N   . ALA A 1 115 ? -24.554 -25.229 -30.818 1.00 48.82  ? 116 ALA A N   1 
ATOM   877  C  CA  . ALA A 1 115 ? -24.292 -24.001 -30.065 1.00 48.78  ? 116 ALA A CA  1 
ATOM   878  C  C   . ALA A 1 115 ? -22.943 -24.043 -29.360 1.00 47.76  ? 116 ALA A C   1 
ATOM   879  O  O   . ALA A 1 115 ? -22.194 -23.075 -29.407 1.00 48.48  ? 116 ALA A O   1 
ATOM   880  C  CB  . ALA A 1 115 ? -25.422 -23.723 -29.082 1.00 51.01  ? 116 ALA A CB  1 
ATOM   881  N  N   . LEU A 1 116 ? -22.630 -25.164 -28.718 1.00 47.53  ? 117 LEU A N   1 
ATOM   882  C  CA  . LEU A 1 116 ? -21.260 -25.431 -28.315 1.00 46.99  ? 117 LEU A CA  1 
ATOM   883  C  C   . LEU A 1 116 ? -20.649 -26.363 -29.366 1.00 45.70  ? 117 LEU A C   1 
ATOM   884  O  O   . LEU A 1 116 ? -21.122 -27.484 -29.508 1.00 47.90  ? 117 LEU A O   1 
ATOM   885  C  CB  . LEU A 1 116 ? -21.207 -26.022 -26.903 1.00 49.35  ? 117 LEU A CB  1 
ATOM   886  C  CG  . LEU A 1 116 ? -21.815 -25.196 -25.755 1.00 52.09  ? 117 LEU A CG  1 
ATOM   887  C  CD1 . LEU A 1 116 ? -21.812 -26.009 -24.469 1.00 56.43  ? 117 LEU A CD1 1 
ATOM   888  C  CD2 . LEU A 1 116 ? -21.107 -23.861 -25.525 1.00 50.81  ? 117 LEU A CD2 1 
ATOM   889  N  N   . PRO A 1 117 ? -19.621 -25.929 -30.107 1.00 43.69  ? 118 PRO A N   1 
ATOM   890  C  CA  . PRO A 1 117 ? -18.856 -24.710 -29.831 1.00 43.45  ? 118 PRO A CA  1 
ATOM   891  C  C   . PRO A 1 117 ? -19.198 -23.480 -30.687 1.00 43.37  ? 118 PRO A C   1 
ATOM   892  O  O   . PRO A 1 117 ? -18.624 -22.413 -30.458 1.00 44.23  ? 118 PRO A O   1 
ATOM   893  C  CB  . PRO A 1 117 ? -17.436 -25.148 -30.194 1.00 42.33  ? 118 PRO A CB  1 
ATOM   894  C  CG  . PRO A 1 117 ? -17.649 -26.036 -31.387 1.00 40.32  ? 118 PRO A CG  1 
ATOM   895  C  CD  . PRO A 1 117 ? -18.943 -26.768 -31.120 1.00 41.95  ? 118 PRO A CD  1 
ATOM   896  N  N   . PHE A 1 118 ? -20.093 -23.619 -31.662 1.00 42.43  ? 119 PHE A N   1 
ATOM   897  C  CA  . PHE A 1 118 ? -20.211 -22.613 -32.727 1.00 43.14  ? 119 PHE A CA  1 
ATOM   898  C  C   . PHE A 1 118 ? -20.735 -21.230 -32.327 1.00 44.97  ? 119 PHE A C   1 
ATOM   899  O  O   . PHE A 1 118 ? -20.522 -20.267 -33.060 1.00 43.85  ? 119 PHE A O   1 
ATOM   900  C  CB  . PHE A 1 118 ? -20.892 -23.194 -33.976 1.00 42.05  ? 119 PHE A CB  1 
ATOM   901  C  CG  . PHE A 1 118 ? -20.066 -24.256 -34.644 1.00 40.79  ? 119 PHE A CG  1 
ATOM   902  C  CD1 . PHE A 1 118 ? -19.004 -23.906 -35.478 1.00 38.26  ? 119 PHE A CD1 1 
ATOM   903  C  CD2 . PHE A 1 118 ? -20.303 -25.606 -34.385 1.00 41.41  ? 119 PHE A CD2 1 
ATOM   904  C  CE1 . PHE A 1 118 ? -18.212 -24.879 -36.064 1.00 38.28  ? 119 PHE A CE1 1 
ATOM   905  C  CE2 . PHE A 1 118 ? -19.509 -26.589 -34.966 1.00 40.84  ? 119 PHE A CE2 1 
ATOM   906  C  CZ  . PHE A 1 118 ? -18.462 -26.223 -35.805 1.00 39.84  ? 119 PHE A CZ  1 
ATOM   907  N  N   . MET A 1 119 ? -21.361 -21.129 -31.149 1.00 47.36  ? 120 MET A N   1 
ATOM   908  C  CA  . MET A 1 119 ? -21.668 -19.833 -30.531 1.00 48.82  ? 120 MET A CA  1 
ATOM   909  C  C   . MET A 1 119 ? -20.405 -19.065 -30.169 1.00 48.90  ? 120 MET A C   1 
ATOM   910  O  O   . MET A 1 119 ? -20.423 -17.829 -30.118 1.00 50.43  ? 120 MET A O   1 
ATOM   911  C  CB  . MET A 1 119 ? -22.513 -19.996 -29.272 1.00 52.09  ? 120 MET A CB  1 
ATOM   912  C  CG  . MET A 1 119 ? -23.988 -20.219 -29.532 1.00 55.47  ? 120 MET A CG  1 
ATOM   913  S  SD  . MET A 1 119 ? -24.697 -18.874 -30.489 1.00 59.55  ? 120 MET A SD  1 
ATOM   914  C  CE  . MET A 1 119 ? -25.020 -17.684 -29.181 1.00 57.83  ? 120 MET A CE  1 
ATOM   915  N  N   . LEU A 1 120 ? -19.323 -19.807 -29.916 1.00 46.00  ? 121 LEU A N   1 
ATOM   916  C  CA  . LEU A 1 120 ? -18.049 -19.234 -29.498 1.00 43.51  ? 121 LEU A CA  1 
ATOM   917  C  C   . LEU A 1 120 ? -17.153 -18.914 -30.682 1.00 42.88  ? 121 LEU A C   1 
ATOM   918  O  O   . LEU A 1 120 ? -16.030 -18.451 -30.495 1.00 44.66  ? 121 LEU A O   1 
ATOM   919  C  CB  . LEU A 1 120 ? -17.331 -20.147 -28.491 1.00 42.81  ? 121 LEU A CB  1 
ATOM   920  C  CG  . LEU A 1 120 ? -17.936 -20.408 -27.102 1.00 44.69  ? 121 LEU A CG  1 
ATOM   921  C  CD1 . LEU A 1 120 ? -17.050 -21.373 -26.331 1.00 45.50  ? 121 LEU A CD1 1 
ATOM   922  C  CD2 . LEU A 1 120 ? -18.140 -19.135 -26.288 1.00 45.29  ? 121 LEU A CD2 1 
ATOM   923  N  N   . ALA A 1 121 ? -17.650 -19.156 -31.894 1.00 41.15  ? 122 ALA A N   1 
ATOM   924  C  CA  . ALA A 1 121 ? -16.932 -18.779 -33.110 1.00 40.81  ? 122 ALA A CA  1 
ATOM   925  C  C   . ALA A 1 121 ? -17.249 -17.344 -33.532 1.00 42.21  ? 122 ALA A C   1 
ATOM   926  O  O   . ALA A 1 121 ? -18.428 -16.963 -33.643 1.00 41.00  ? 122 ALA A O   1 
ATOM   927  C  CB  . ALA A 1 121 ? -17.259 -19.744 -34.238 1.00 39.82  ? 122 ALA A CB  1 
ATOM   928  N  N   . GLU A 1 122 ? -16.196 -16.551 -33.734 1.00 43.74  ? 123 GLU A N   1 
ATOM   929  C  CA  . GLU A 1 122 ? -16.305 -15.266 -34.431 1.00 47.69  ? 123 GLU A CA  1 
ATOM   930  C  C   . GLU A 1 122 ? -16.530 -15.475 -35.927 1.00 47.14  ? 123 GLU A C   1 
ATOM   931  O  O   . GLU A 1 122 ? -17.304 -14.752 -36.547 1.00 50.47  ? 123 GLU A O   1 
ATOM   932  C  CB  . GLU A 1 122 ? -15.064 -14.398 -34.214 1.00 50.94  ? 123 GLU A CB  1 
ATOM   933  C  CG  . GLU A 1 122 ? -15.240 -13.276 -33.200 1.00 56.91  ? 123 GLU A CG  1 
ATOM   934  C  CD  . GLU A 1 122 ? -16.056 -12.096 -33.712 1.00 60.85  ? 123 GLU A CD  1 
ATOM   935  O  OE1 . GLU A 1 122 ? -16.453 -12.072 -34.902 1.00 62.90  ? 123 GLU A OE1 1 
ATOM   936  O  OE2 . GLU A 1 122 ? -16.297 -11.170 -32.911 1.00 64.65  ? 123 GLU A OE2 1 
ATOM   937  N  N   . PHE A 1 123 ? -15.851 -16.472 -36.492 1.00 45.31  ? 124 PHE A N   1 
ATOM   938  C  CA  . PHE A 1 123 ? -15.998 -16.838 -37.897 1.00 43.55  ? 124 PHE A CA  1 
ATOM   939  C  C   . PHE A 1 123 ? -17.336 -17.519 -38.155 1.00 42.38  ? 124 PHE A C   1 
ATOM   940  O  O   . PHE A 1 123 ? -17.967 -18.008 -37.218 1.00 43.73  ? 124 PHE A O   1 
ATOM   941  C  CB  . PHE A 1 123 ? -14.835 -17.735 -38.349 1.00 42.54  ? 124 PHE A CB  1 
ATOM   942  C  CG  . PHE A 1 123 ? -14.715 -19.034 -37.593 1.00 42.76  ? 124 PHE A CG  1 
ATOM   943  C  CD1 . PHE A 1 123 ? -13.969 -19.107 -36.403 1.00 42.58  ? 124 PHE A CD1 1 
ATOM   944  C  CD2 . PHE A 1 123 ? -15.315 -20.209 -38.081 1.00 41.76  ? 124 PHE A CD2 1 
ATOM   945  C  CE1 . PHE A 1 123 ? -13.842 -20.313 -35.717 1.00 40.83  ? 124 PHE A CE1 1 
ATOM   946  C  CE2 . PHE A 1 123 ? -15.186 -21.415 -37.396 1.00 40.83  ? 124 PHE A CE2 1 
ATOM   947  C  CZ  . PHE A 1 123 ? -14.446 -21.465 -36.217 1.00 40.72  ? 124 PHE A CZ  1 
ATOM   948  N  N   . ASP A 1 124 ? -17.747 -17.543 -39.424 1.00 40.35  ? 125 ASP A N   1 
ATOM   949  C  CA  . ASP A 1 124 ? -18.964 -18.223 -39.881 1.00 38.38  ? 125 ASP A CA  1 
ATOM   950  C  C   . ASP A 1 124 ? -18.683 -19.638 -40.381 1.00 38.26  ? 125 ASP A C   1 
ATOM   951  O  O   . ASP A 1 124 ? -19.443 -20.572 -40.107 1.00 36.11  ? 125 ASP A O   1 
ATOM   952  C  CB  . ASP A 1 124 ? -19.617 -17.427 -41.016 1.00 39.36  ? 125 ASP A CB  1 
ATOM   953  C  CG  . ASP A 1 124 ? -19.936 -16.008 -40.624 1.00 39.09  ? 125 ASP A CG  1 
ATOM   954  O  OD1 . ASP A 1 124 ? -20.809 -15.820 -39.756 1.00 40.58  ? 125 ASP A OD1 1 
ATOM   955  O  OD2 . ASP A 1 124 ? -19.324 -15.085 -41.193 1.00 37.98  ? 125 ASP A OD2 1 
ATOM   956  N  N   . GLY A 1 125 ? -17.593 -19.794 -41.126 1.00 38.93  ? 126 GLY A N   1 
ATOM   957  C  CA  . GLY A 1 125 ? -17.293 -21.074 -41.744 1.00 40.37  ? 126 GLY A CA  1 
ATOM   958  C  C   . GLY A 1 125 ? -15.827 -21.389 -41.862 1.00 40.91  ? 126 GLY A C   1 
ATOM   959  O  O   . GLY A 1 125 ? -14.987 -20.723 -41.263 1.00 41.96  ? 126 GLY A O   1 
ATOM   960  N  N   . VAL A 1 126 ? -15.524 -22.426 -42.633 1.00 41.48  ? 127 VAL A N   1 
ATOM   961  C  CA  . VAL A 1 126 ? -14.152 -22.912 -42.771 1.00 42.21  ? 127 VAL A CA  1 
ATOM   962  C  C   . VAL A 1 126 ? -13.813 -23.072 -44.249 1.00 41.86  ? 127 VAL A C   1 
ATOM   963  O  O   . VAL A 1 126 ? -14.642 -23.520 -45.034 1.00 44.28  ? 127 VAL A O   1 
ATOM   964  C  CB  . VAL A 1 126 ? -13.912 -24.246 -41.996 1.00 42.26  ? 127 VAL A CB  1 
ATOM   965  C  CG1 . VAL A 1 126 ? -12.467 -24.719 -42.143 1.00 42.20  ? 127 VAL A CG1 1 
ATOM   966  C  CG2 . VAL A 1 126 ? -14.244 -24.091 -40.513 1.00 41.58  ? 127 VAL A CG2 1 
ATOM   967  N  N   . VAL A 1 127 ? -12.599 -22.673 -44.610 1.00 41.59  ? 128 VAL A N   1 
ATOM   968  C  CA  . VAL A 1 127 ? -12.020 -22.981 -45.909 1.00 42.09  ? 128 VAL A CA  1 
ATOM   969  C  C   . VAL A 1 127 ? -10.879 -23.960 -45.640 1.00 42.78  ? 128 VAL A C   1 
ATOM   970  O  O   . VAL A 1 127 ? -9.834  -23.577 -45.104 1.00 44.07  ? 128 VAL A O   1 
ATOM   971  C  CB  . VAL A 1 127 ? -11.539 -21.701 -46.647 1.00 41.44  ? 128 VAL A CB  1 
ATOM   972  C  CG1 . VAL A 1 127 ? -10.651 -22.045 -47.834 1.00 40.94  ? 128 VAL A CG1 1 
ATOM   973  C  CG2 . VAL A 1 127 ? -12.727 -20.873 -47.116 1.00 40.52  ? 128 VAL A CG2 1 
ATOM   974  N  N   . GLY A 1 128 ? -11.103 -25.227 -45.982 1.00 42.55  ? 129 GLY A N   1 
ATOM   975  C  CA  . GLY A 1 128 ? -10.090 -26.265 -45.808 1.00 42.91  ? 129 GLY A CA  1 
ATOM   976  C  C   . GLY A 1 128 ? -8.956  -26.083 -46.801 1.00 44.29  ? 129 GLY A C   1 
ATOM   977  O  O   . GLY A 1 128 ? -9.201  -25.880 -47.988 1.00 44.74  ? 129 GLY A O   1 
ATOM   978  N  N   . MET A 1 129 ? -7.721  -26.129 -46.306 1.00 43.92  ? 130 MET A N   1 
ATOM   979  C  CA  . MET A 1 129 ? -6.521  -25.972 -47.139 1.00 45.56  ? 130 MET A CA  1 
ATOM   980  C  C   . MET A 1 129 ? -5.733  -27.287 -47.258 1.00 46.94  ? 130 MET A C   1 
ATOM   981  O  O   . MET A 1 129 ? -4.608  -27.315 -47.775 1.00 48.37  ? 130 MET A O   1 
ATOM   982  C  CB  . MET A 1 129 ? -5.625  -24.845 -46.596 1.00 46.15  ? 130 MET A CB  1 
ATOM   983  C  CG  . MET A 1 129 ? -6.282  -23.467 -46.527 1.00 47.16  ? 130 MET A CG  1 
ATOM   984  S  SD  . MET A 1 129 ? -6.804  -22.795 -48.121 1.00 49.68  ? 130 MET A SD  1 
ATOM   985  C  CE  . MET A 1 129 ? -5.231  -22.489 -48.942 1.00 46.94  ? 130 MET A CE  1 
ATOM   986  N  N   . GLY A 1 130 ? -6.334  -28.372 -46.774 1.00 46.76  ? 131 GLY A N   1 
ATOM   987  C  CA  . GLY A 1 130 ? -5.760  -29.705 -46.883 1.00 48.48  ? 131 GLY A CA  1 
ATOM   988  C  C   . GLY A 1 130 ? -5.931  -30.292 -48.270 1.00 50.08  ? 131 GLY A C   1 
ATOM   989  O  O   . GLY A 1 130 ? -6.509  -29.663 -49.155 1.00 49.74  ? 131 GLY A O   1 
ATOM   990  N  N   . PHE A 1 131 ? -5.432  -31.509 -48.452 1.00 52.52  ? 132 PHE A N   1 
ATOM   991  C  CA  . PHE A 1 131 ? -5.437  -32.167 -49.756 1.00 55.30  ? 132 PHE A CA  1 
ATOM   992  C  C   . PHE A 1 131 ? -6.787  -32.817 -50.029 1.00 56.02  ? 132 PHE A C   1 
ATOM   993  O  O   . PHE A 1 131 ? -7.575  -33.021 -49.103 1.00 55.38  ? 132 PHE A O   1 
ATOM   994  C  CB  . PHE A 1 131 ? -4.338  -33.225 -49.807 1.00 57.36  ? 132 PHE A CB  1 
ATOM   995  C  CG  . PHE A 1 131 ? -2.941  -32.674 -49.728 1.00 58.28  ? 132 PHE A CG  1 
ATOM   996  C  CD1 . PHE A 1 131 ? -2.394  -32.261 -48.500 1.00 57.26  ? 132 PHE A CD1 1 
ATOM   997  C  CD2 . PHE A 1 131 ? -2.152  -32.593 -50.877 1.00 59.68  ? 132 PHE A CD2 1 
ATOM   998  C  CE1 . PHE A 1 131 ? -1.098  -31.768 -48.429 1.00 57.90  ? 132 PHE A CE1 1 
ATOM   999  C  CE2 . PHE A 1 131 ? -0.855  -32.097 -50.810 1.00 61.27  ? 132 PHE A CE2 1 
ATOM   1000 C  CZ  . PHE A 1 131 ? -0.328  -31.684 -49.585 1.00 59.91  ? 132 PHE A CZ  1 
ATOM   1001 N  N   . ILE A 1 132 ? -7.039  -33.160 -51.294 1.00 58.36  ? 133 ILE A N   1 
ATOM   1002 C  CA  . ILE A 1 132 ? -8.274  -33.865 -51.700 1.00 58.21  ? 133 ILE A CA  1 
ATOM   1003 C  C   . ILE A 1 132 ? -8.480  -35.199 -50.953 1.00 59.85  ? 133 ILE A C   1 
ATOM   1004 O  O   . ILE A 1 132 ? -9.610  -35.560 -50.643 1.00 60.02  ? 133 ILE A O   1 
ATOM   1005 C  CB  . ILE A 1 132 ? -8.394  -34.001 -53.252 1.00 59.26  ? 133 ILE A CB  1 
ATOM   1006 C  CG1 . ILE A 1 132 ? -9.822  -34.398 -53.666 1.00 58.87  ? 133 ILE A CG1 1 
ATOM   1007 C  CG2 . ILE A 1 132 ? -7.302  -34.902 -53.839 1.00 60.30  ? 133 ILE A CG2 1 
ATOM   1008 C  CD1 . ILE A 1 132 ? -10.116 -34.293 -55.149 1.00 59.59  ? 133 ILE A CD1 1 
ATOM   1009 N  N   . GLU A 1 133 ? -7.383  -35.888 -50.632 1.00 62.36  ? 134 GLU A N   1 
ATOM   1010 C  CA  . GLU A 1 133 ? -7.414  -37.178 -49.926 1.00 64.37  ? 134 GLU A CA  1 
ATOM   1011 C  C   . GLU A 1 133 ? -8.162  -37.116 -48.587 1.00 64.82  ? 134 GLU A C   1 
ATOM   1012 O  O   . GLU A 1 133 ? -8.828  -38.078 -48.201 1.00 65.61  ? 134 GLU A O   1 
ATOM   1013 C  CB  . GLU A 1 133 ? -5.996  -37.731 -49.729 1.00 65.48  ? 134 GLU A CB  1 
ATOM   1014 C  CG  . GLU A 1 133 ? -5.270  -38.107 -51.022 1.00 69.54  ? 134 GLU A CG  1 
ATOM   1015 C  CD  . GLU A 1 133 ? -4.430  -36.976 -51.616 1.00 70.82  ? 134 GLU A CD  1 
ATOM   1016 O  OE1 . GLU A 1 133 ? -4.870  -35.803 -51.626 1.00 69.53  ? 134 GLU A OE1 1 
ATOM   1017 O  OE2 . GLU A 1 133 ? -3.314  -37.261 -52.092 1.00 73.15  ? 134 GLU A OE2 1 
ATOM   1018 N  N   . GLN A 1 134 ? -8.066  -35.978 -47.899 1.00 64.48  ? 135 GLN A N   1 
ATOM   1019 C  CA  . GLN A 1 134 ? -8.779  -35.775 -46.635 1.00 64.69  ? 135 GLN A CA  1 
ATOM   1020 C  C   . GLN A 1 134 ? -10.172 -35.129 -46.791 1.00 60.69  ? 135 GLN A C   1 
ATOM   1021 O  O   . GLN A 1 134 ? -10.876 -34.920 -45.797 1.00 58.18  ? 135 GLN A O   1 
ATOM   1022 C  CB  . GLN A 1 134 ? -7.910  -35.004 -45.615 1.00 66.64  ? 135 GLN A CB  1 
ATOM   1023 C  CG  . GLN A 1 134 ? -6.628  -35.710 -45.155 1.00 71.05  ? 135 GLN A CG  1 
ATOM   1024 C  CD  . GLN A 1 134 ? -6.807  -37.178 -44.770 1.00 74.75  ? 135 GLN A CD  1 
ATOM   1025 O  OE1 . GLN A 1 134 ? -7.707  -37.532 -44.006 1.00 76.68  ? 135 GLN A OE1 1 
ATOM   1026 N  NE2 . GLN A 1 134 ? -5.934  -38.038 -45.292 1.00 76.54  ? 135 GLN A NE2 1 
ATOM   1027 N  N   . ALA A 1 135 ? -10.572 -34.843 -48.033 1.00 58.51  ? 136 ALA A N   1 
ATOM   1028 C  CA  . ALA A 1 135 ? -11.851 -34.180 -48.301 1.00 55.30  ? 136 ALA A CA  1 
ATOM   1029 C  C   . ALA A 1 135 ? -13.023 -35.142 -48.216 1.00 57.22  ? 136 ALA A C   1 
ATOM   1030 O  O   . ALA A 1 135 ? -13.019 -36.208 -48.848 1.00 60.44  ? 136 ALA A O   1 
ATOM   1031 C  CB  . ALA A 1 135 ? -11.831 -33.477 -49.644 1.00 52.43  ? 136 ALA A CB  1 
ATOM   1032 N  N   . ILE A 1 136 ? -14.019 -34.746 -47.426 1.00 55.96  ? 137 ILE A N   1 
ATOM   1033 C  CA  . ILE A 1 136 ? -15.236 -35.529 -47.216 1.00 56.42  ? 137 ILE A CA  1 
ATOM   1034 C  C   . ILE A 1 136 ? -16.131 -35.364 -48.436 1.00 55.51  ? 137 ILE A C   1 
ATOM   1035 O  O   . ILE A 1 136 ? -16.401 -34.237 -48.857 1.00 55.03  ? 137 ILE A O   1 
ATOM   1036 C  CB  . ILE A 1 136 ? -15.976 -35.095 -45.917 1.00 56.05  ? 137 ILE A CB  1 
ATOM   1037 C  CG1 . ILE A 1 136 ? -15.052 -35.176 -44.673 1.00 55.82  ? 137 ILE A CG1 1 
ATOM   1038 C  CG2 . ILE A 1 136 ? -17.300 -35.843 -45.732 1.00 55.60  ? 137 ILE A CG2 1 
ATOM   1039 C  CD1 . ILE A 1 136 ? -14.557 -36.554 -44.284 1.00 55.65  ? 137 ILE A CD1 1 
ATOM   1040 N  N   . GLY A 1 137 ? -16.582 -36.493 -48.985 1.00 55.97  ? 138 GLY A N   1 
ATOM   1041 C  CA  . GLY A 1 137 ? -17.385 -36.527 -50.210 1.00 56.01  ? 138 GLY A CA  1 
ATOM   1042 C  C   . GLY A 1 137 ? -16.544 -36.427 -51.474 1.00 57.98  ? 138 GLY A C   1 
ATOM   1043 O  O   . GLY A 1 137 ? -17.078 -36.207 -52.559 1.00 58.23  ? 138 GLY A O   1 
ATOM   1044 N  N   . ARG A 1 138 ? -15.226 -36.582 -51.326 1.00 60.15  ? 139 ARG A N   1 
ATOM   1045 C  CA  . ARG A 1 138 ? -14.247 -36.444 -52.424 1.00 62.97  ? 139 ARG A CA  1 
ATOM   1046 C  C   . ARG A 1 138 ? -14.403 -35.130 -53.241 1.00 61.25  ? 139 ARG A C   1 
ATOM   1047 O  O   . ARG A 1 138 ? -14.106 -35.088 -54.441 1.00 64.07  ? 139 ARG A O   1 
ATOM   1048 C  CB  . ARG A 1 138 ? -14.235 -37.702 -53.330 1.00 64.54  ? 139 ARG A CB  1 
ATOM   1049 C  CG  . ARG A 1 138 ? -13.798 -38.993 -52.645 1.00 63.86  ? 139 ARG A CG  1 
ATOM   1050 N  N   . VAL A 1 139 ? -14.870 -34.071 -52.577 1.00 57.06  ? 140 VAL A N   1 
ATOM   1051 C  CA  . VAL A 1 139 ? -15.043 -32.750 -53.207 1.00 54.56  ? 140 VAL A CA  1 
ATOM   1052 C  C   . VAL A 1 139 ? -13.680 -32.072 -53.366 1.00 53.63  ? 140 VAL A C   1 
ATOM   1053 O  O   . VAL A 1 139 ? -12.883 -32.034 -52.427 1.00 53.20  ? 140 VAL A O   1 
ATOM   1054 C  CB  . VAL A 1 139 ? -16.113 -31.855 -52.481 1.00 51.50  ? 140 VAL A CB  1 
ATOM   1055 C  CG1 . VAL A 1 139 ? -16.003 -31.947 -50.979 1.00 51.53  ? 140 VAL A CG1 1 
ATOM   1056 C  CG2 . VAL A 1 139 ? -16.024 -30.392 -52.897 1.00 49.89  ? 140 VAL A CG2 1 
ATOM   1057 N  N   . THR A 1 140 ? -13.417 -31.566 -54.570 1.00 53.11  ? 141 THR A N   1 
ATOM   1058 C  CA  . THR A 1 140 ? -12.181 -30.844 -54.864 1.00 53.48  ? 141 THR A CA  1 
ATOM   1059 C  C   . THR A 1 140 ? -12.014 -29.644 -53.908 1.00 53.02  ? 141 THR A C   1 
ATOM   1060 O  O   . THR A 1 140 ? -12.907 -28.789 -53.822 1.00 52.47  ? 141 THR A O   1 
ATOM   1061 C  CB  . THR A 1 140 ? -12.132 -30.385 -56.341 1.00 54.06  ? 141 THR A CB  1 
ATOM   1062 O  OG1 . THR A 1 140 ? -12.557 -31.460 -57.197 1.00 52.67  ? 141 THR A OG1 1 
ATOM   1063 C  CG2 . THR A 1 140 ? -10.716 -29.945 -56.726 1.00 52.33  ? 141 THR A CG2 1 
ATOM   1064 N  N   . PRO A 1 141 ? -10.888 -29.599 -53.162 1.00 52.87  ? 142 PRO A N   1 
ATOM   1065 C  CA  . PRO A 1 141 ? -10.626 -28.466 -52.272 1.00 51.13  ? 142 PRO A CA  1 
ATOM   1066 C  C   . PRO A 1 141 ? -10.418 -27.187 -53.062 1.00 51.35  ? 142 PRO A C   1 
ATOM   1067 O  O   . PRO A 1 141 ? -10.040 -27.246 -54.236 1.00 52.25  ? 142 PRO A O   1 
ATOM   1068 C  CB  . PRO A 1 141 ? -9.324  -28.858 -51.576 1.00 51.44  ? 142 PRO A CB  1 
ATOM   1069 C  CG  . PRO A 1 141 ? -9.249  -30.335 -51.706 1.00 52.55  ? 142 PRO A CG  1 
ATOM   1070 C  CD  . PRO A 1 141 ? -9.828  -30.615 -53.055 1.00 54.07  ? 142 PRO A CD  1 
ATOM   1071 N  N   . ILE A 1 142 ? -10.659 -26.049 -52.413 1.00 49.97  ? 143 ILE A N   1 
ATOM   1072 C  CA  . ILE A 1 142 ? -10.554 -24.730 -53.053 1.00 50.95  ? 143 ILE A CA  1 
ATOM   1073 C  C   . ILE A 1 142 ? -9.174  -24.437 -53.679 1.00 52.23  ? 143 ILE A C   1 
ATOM   1074 O  O   . ILE A 1 142 ? -9.111  -23.936 -54.800 1.00 54.78  ? 143 ILE A O   1 
ATOM   1075 C  CB  . ILE A 1 142 ? -11.085 -23.592 -52.133 1.00 49.59  ? 143 ILE A CB  1 
ATOM   1076 C  CG1 . ILE A 1 142 ? -11.319 -22.296 -52.926 1.00 48.67  ? 143 ILE A CG1 1 
ATOM   1077 C  CG2 . ILE A 1 142 ? -10.196 -23.410 -50.908 1.00 50.07  ? 143 ILE A CG2 1 
ATOM   1078 C  CD1 . ILE A 1 142 ? -12.308 -21.337 -52.293 1.00 47.08  ? 143 ILE A CD1 1 
ATOM   1079 N  N   . PHE A 1 143 ? -8.087  -24.785 -52.991 1.00 51.62  ? 144 PHE A N   1 
ATOM   1080 C  CA  . PHE A 1 143 ? -6.751  -24.542 -53.539 1.00 51.86  ? 144 PHE A CA  1 
ATOM   1081 C  C   . PHE A 1 143 ? -6.460  -25.338 -54.805 1.00 54.48  ? 144 PHE A C   1 
ATOM   1082 O  O   . PHE A 1 143 ? -5.843  -24.804 -55.726 1.00 57.76  ? 144 PHE A O   1 
ATOM   1083 C  CB  . PHE A 1 143 ? -5.647  -24.756 -52.508 1.00 50.09  ? 144 PHE A CB  1 
ATOM   1084 C  CG  . PHE A 1 143 ? -4.362  -24.070 -52.860 1.00 50.93  ? 144 PHE A CG  1 
ATOM   1085 C  CD1 . PHE A 1 143 ? -4.229  -22.683 -52.711 1.00 50.80  ? 144 PHE A CD1 1 
ATOM   1086 C  CD2 . PHE A 1 143 ? -3.283  -24.796 -53.349 1.00 52.38  ? 144 PHE A CD2 1 
ATOM   1087 C  CE1 . PHE A 1 143 ? -3.042  -22.042 -53.042 1.00 51.27  ? 144 PHE A CE1 1 
ATOM   1088 C  CE2 . PHE A 1 143 ? -2.089  -24.158 -53.680 1.00 53.99  ? 144 PHE A CE2 1 
ATOM   1089 C  CZ  . PHE A 1 143 ? -1.969  -22.784 -53.525 1.00 53.28  ? 144 PHE A CZ  1 
ATOM   1090 N  N   . ASP A 1 144 ? -6.904  -26.598 -54.854 1.00 55.82  ? 145 ASP A N   1 
ATOM   1091 C  CA  . ASP A 1 144 ? -6.772  -27.426 -56.069 1.00 58.26  ? 145 ASP A CA  1 
ATOM   1092 C  C   . ASP A 1 144 ? -7.479  -26.761 -57.239 1.00 60.08  ? 145 ASP A C   1 
ATOM   1093 O  O   . ASP A 1 144 ? -6.951  -26.737 -58.359 1.00 63.75  ? 145 ASP A O   1 
ATOM   1094 C  CB  . ASP A 1 144 ? -7.341  -28.829 -55.874 1.00 57.41  ? 145 ASP A CB  1 
ATOM   1095 C  CG  . ASP A 1 144 ? -6.621  -29.611 -54.807 1.00 58.84  ? 145 ASP A CG  1 
ATOM   1096 O  OD1 . ASP A 1 144 ? -6.661  -29.194 -53.633 1.00 59.02  ? 145 ASP A OD1 1 
ATOM   1097 O  OD2 . ASP A 1 144 ? -6.030  -30.659 -55.131 1.00 61.38  ? 145 ASP A OD2 1 
ATOM   1098 N  N   . ASN A 1 145 ? -8.660  -26.206 -56.960 1.00 57.81  ? 146 ASN A N   1 
ATOM   1099 C  CA  . ASN A 1 145 ? -9.418  -25.449 -57.943 1.00 57.28  ? 146 ASN A CA  1 
ATOM   1100 C  C   . ASN A 1 145 ? -8.726  -24.166 -58.389 1.00 57.62  ? 146 ASN A C   1 
ATOM   1101 O  O   . ASN A 1 145 ? -8.757  -23.838 -59.580 1.00 60.88  ? 146 ASN A O   1 
ATOM   1102 C  CB  . ASN A 1 145 ? -10.854 -25.201 -57.465 1.00 55.33  ? 146 ASN A CB  1 
ATOM   1103 C  CG  . ASN A 1 145 ? -11.782 -26.368 -57.775 1.00 55.79  ? 146 ASN A CG  1 
ATOM   1104 O  OD1 . ASN A 1 145 ? -11.699 -26.979 -58.841 1.00 55.86  ? 146 ASN A OD1 1 
ATOM   1105 N  ND2 . ASN A 1 145 ? -12.680 -26.679 -56.843 1.00 54.60  ? 146 ASN A ND2 1 
ATOM   1106 N  N   . ILE A 1 146 ? -8.087  -23.459 -57.452 1.00 56.35  ? 147 ILE A N   1 
ATOM   1107 C  CA  . ILE A 1 146 ? -7.289  -22.267 -57.792 1.00 58.26  ? 147 ILE A CA  1 
ATOM   1108 C  C   . ILE A 1 146 ? -6.050  -22.660 -58.612 1.00 63.01  ? 147 ILE A C   1 
ATOM   1109 O  O   . ILE A 1 146 ? -5.666  -21.926 -59.520 1.00 66.87  ? 147 ILE A O   1 
ATOM   1110 C  CB  . ILE A 1 146 ? -6.902  -21.405 -56.560 1.00 56.27  ? 147 ILE A CB  1 
ATOM   1111 C  CG1 . ILE A 1 146 ? -8.148  -20.886 -55.834 1.00 53.36  ? 147 ILE A CG1 1 
ATOM   1112 C  CG2 . ILE A 1 146 ? -6.066  -20.196 -56.974 1.00 56.83  ? 147 ILE A CG2 1 
ATOM   1113 C  CD1 . ILE A 1 146 ? -7.894  -20.328 -54.443 1.00 51.31  ? 147 ILE A CD1 1 
ATOM   1114 N  N   . ILE A 1 147 ? -5.459  -23.821 -58.311 1.00 65.36  ? 148 ILE A N   1 
ATOM   1115 C  CA  . ILE A 1 147 ? -4.306  -24.354 -59.063 1.00 70.52  ? 148 ILE A CA  1 
ATOM   1116 C  C   . ILE A 1 147 ? -4.638  -24.631 -60.537 1.00 74.73  ? 148 ILE A C   1 
ATOM   1117 O  O   . ILE A 1 147 ? -3.835  -24.300 -61.421 1.00 79.90  ? 148 ILE A O   1 
ATOM   1118 C  CB  . ILE A 1 147 ? -3.654  -25.580 -58.347 1.00 70.87  ? 148 ILE A CB  1 
ATOM   1119 C  CG1 . ILE A 1 147 ? -2.806  -25.127 -57.141 1.00 70.88  ? 148 ILE A CG1 1 
ATOM   1120 C  CG2 . ILE A 1 147 ? -2.812  -26.444 -59.287 1.00 71.87  ? 148 ILE A CG2 1 
ATOM   1121 C  CD1 . ILE A 1 147 ? -1.736  -24.076 -57.420 1.00 71.88  ? 148 ILE A CD1 1 
ATOM   1122 N  N   . SER A 1 148 ? -5.821  -25.208 -60.782 1.00 73.21  ? 149 SER A N   1 
ATOM   1123 C  CA  . SER A 1 148 ? -6.302  -25.564 -62.127 1.00 73.75  ? 149 SER A CA  1 
ATOM   1124 C  C   . SER A 1 148 ? -6.345  -24.381 -63.090 1.00 74.84  ? 149 SER A C   1 
ATOM   1125 O  O   . SER A 1 148 ? -6.167  -24.550 -64.299 1.00 77.51  ? 149 SER A O   1 
ATOM   1126 C  CB  . SER A 1 148 ? -7.697  -26.190 -62.052 1.00 73.41  ? 149 SER A CB  1 
ATOM   1127 O  OG  . SER A 1 148 ? -7.655  -27.478 -61.475 1.00 74.13  ? 149 SER A OG  1 
ATOM   1128 N  N   . GLN A 1 149 ? -6.576  -23.192 -62.535 1.00 73.46  ? 150 GLN A N   1 
ATOM   1129 C  CA  . GLN A 1 149 ? -6.706  -21.954 -63.305 1.00 73.73  ? 150 GLN A CA  1 
ATOM   1130 C  C   . GLN A 1 149 ? -5.395  -21.479 -63.937 1.00 73.16  ? 150 GLN A C   1 
ATOM   1131 O  O   . GLN A 1 149 ? -5.421  -20.698 -64.888 1.00 74.37  ? 150 GLN A O   1 
ATOM   1132 C  CB  . GLN A 1 149 ? -7.314  -20.845 -62.436 1.00 73.80  ? 150 GLN A CB  1 
ATOM   1133 C  CG  . GLN A 1 149 ? -8.706  -21.164 -61.903 1.00 74.63  ? 150 GLN A CG  1 
ATOM   1134 C  CD  . GLN A 1 149 ? -9.384  -19.981 -61.235 1.00 75.87  ? 150 GLN A CD  1 
ATOM   1135 O  OE1 . GLN A 1 149 ? -8.735  -19.100 -60.670 1.00 78.38  ? 150 GLN A OE1 1 
ATOM   1136 N  NE2 . GLN A 1 149 ? -10.707 -19.962 -61.296 1.00 77.24  ? 150 GLN A NE2 1 
ATOM   1137 N  N   . GLY A 1 150 ? -4.265  -21.951 -63.408 1.00 71.58  ? 151 GLY A N   1 
ATOM   1138 C  CA  . GLY A 1 150 ? -2.935  -21.600 -63.921 1.00 74.22  ? 151 GLY A CA  1 
ATOM   1139 C  C   . GLY A 1 150 ? -2.632  -20.113 -63.834 1.00 74.67  ? 151 GLY A C   1 
ATOM   1140 O  O   . GLY A 1 150 ? -2.153  -19.511 -64.801 1.00 77.17  ? 151 GLY A O   1 
ATOM   1141 N  N   . VAL A 1 151 ? -2.932  -19.526 -62.676 1.00 70.83  ? 152 VAL A N   1 
ATOM   1142 C  CA  . VAL A 1 151 ? -2.752  -18.093 -62.443 1.00 69.82  ? 152 VAL A CA  1 
ATOM   1143 C  C   . VAL A 1 151 ? -1.721  -17.806 -61.350 1.00 71.07  ? 152 VAL A C   1 
ATOM   1144 O  O   . VAL A 1 151 ? -0.990  -16.822 -61.436 1.00 74.23  ? 152 VAL A O   1 
ATOM   1145 C  CB  . VAL A 1 151 ? -4.086  -17.336 -62.174 1.00 66.84  ? 152 VAL A CB  1 
ATOM   1146 C  CG1 . VAL A 1 151 ? -4.900  -17.196 -63.456 1.00 66.21  ? 152 VAL A CG1 1 
ATOM   1147 C  CG2 . VAL A 1 151 ? -4.910  -17.986 -61.064 1.00 63.74  ? 152 VAL A CG2 1 
ATOM   1148 N  N   . LEU A 1 152 ? -1.656  -18.674 -60.341 1.00 70.66  ? 153 LEU A N   1 
ATOM   1149 C  CA  . LEU A 1 152 ? -0.688  -18.539 -59.254 1.00 69.59  ? 153 LEU A CA  1 
ATOM   1150 C  C   . LEU A 1 152 ? 0.754   -18.756 -59.727 1.00 72.54  ? 153 LEU A C   1 
ATOM   1151 O  O   . LEU A 1 152 ? 1.017   -19.630 -60.561 1.00 74.10  ? 153 LEU A O   1 
ATOM   1152 C  CB  . LEU A 1 152 ? -1.018  -19.501 -58.115 1.00 67.53  ? 153 LEU A CB  1 
ATOM   1153 C  CG  . LEU A 1 152 ? -2.342  -19.394 -57.354 1.00 66.85  ? 153 LEU A CG  1 
ATOM   1154 C  CD1 . LEU A 1 152 ? -2.386  -20.492 -56.305 1.00 64.81  ? 153 LEU A CD1 1 
ATOM   1155 C  CD2 . LEU A 1 152 ? -2.565  -18.034 -56.697 1.00 65.88  ? 153 LEU A CD2 1 
ATOM   1156 N  N   . LYS A 1 153 ? 1.669   -17.949 -59.185 1.00 73.48  ? 154 LYS A N   1 
ATOM   1157 C  CA  . LYS A 1 153 ? 3.103   -17.996 -59.514 1.00 77.48  ? 154 LYS A CA  1 
ATOM   1158 C  C   . LYS A 1 153 ? 3.755   -19.314 -59.082 1.00 76.95  ? 154 LYS A C   1 
ATOM   1159 O  O   . LYS A 1 153 ? 4.640   -19.831 -59.770 1.00 79.05  ? 154 LYS A O   1 
ATOM   1160 C  CB  . LYS A 1 153 ? 3.835   -16.796 -58.889 1.00 78.80  ? 154 LYS A CB  1 
ATOM   1161 C  CG  . LYS A 1 153 ? 5.202   -16.502 -59.486 1.00 84.67  ? 154 LYS A CG  1 
ATOM   1162 C  CD  . LYS A 1 153 ? 5.762   -15.155 -59.046 1.00 87.94  ? 154 LYS A CD  1 
ATOM   1163 C  CE  . LYS A 1 153 ? 7.023   -14.821 -59.843 1.00 93.58  ? 154 LYS A CE  1 
ATOM   1164 N  NZ  . LYS A 1 153 ? 7.508   -13.422 -59.667 1.00 94.34  ? 154 LYS A NZ  1 
ATOM   1165 N  N   . GLU A 1 154 ? 3.302   -19.843 -57.947 1.00 74.45  ? 155 GLU A N   1 
ATOM   1166 C  CA  . GLU A 1 154 ? 3.801   -21.095 -57.382 1.00 75.77  ? 155 GLU A CA  1 
ATOM   1167 C  C   . GLU A 1 154 ? 2.657   -21.922 -56.792 1.00 73.42  ? 155 GLU A C   1 
ATOM   1168 O  O   . GLU A 1 154 ? 1.626   -21.379 -56.370 1.00 70.33  ? 155 GLU A O   1 
ATOM   1169 C  CB  . GLU A 1 154 ? 4.831   -20.816 -56.281 1.00 78.91  ? 155 GLU A CB  1 
ATOM   1170 C  CG  . GLU A 1 154 ? 6.190   -20.298 -56.739 1.00 85.77  ? 155 GLU A CG  1 
ATOM   1171 C  CD  . GLU A 1 154 ? 6.844   -19.396 -55.702 1.00 88.86  ? 155 GLU A CD  1 
ATOM   1172 O  OE1 . GLU A 1 154 ? 7.939   -19.744 -55.209 1.00 91.42  ? 155 GLU A OE1 1 
ATOM   1173 O  OE2 . GLU A 1 154 ? 6.260   -18.336 -55.370 1.00 89.48  ? 155 GLU A OE2 1 
ATOM   1174 N  N   . ASP A 1 155 ? 2.862   -23.237 -56.745 1.00 73.10  ? 156 ASP A N   1 
ATOM   1175 C  CA  . ASP A 1 155 ? 1.950   -24.165 -56.082 1.00 70.15  ? 156 ASP A CA  1 
ATOM   1176 C  C   . ASP A 1 155 ? 2.166   -24.141 -54.541 1.00 67.32  ? 156 ASP A C   1 
ATOM   1177 O  O   . ASP A 1 155 ? 2.409   -25.180 -53.905 1.00 65.70  ? 156 ASP A O   1 
ATOM   1178 C  CB  . ASP A 1 155 ? 2.142   -25.565 -56.686 1.00 73.42  ? 156 ASP A CB  1 
ATOM   1179 C  CG  . ASP A 1 155 ? 0.972   -26.510 -56.419 1.00 74.22  ? 156 ASP A CG  1 
ATOM   1180 O  OD1 . ASP A 1 155 ? 0.056   -26.179 -55.633 1.00 72.76  ? 156 ASP A OD1 1 
ATOM   1181 O  OD2 . ASP A 1 155 ? 0.980   -27.614 -57.005 1.00 77.03  ? 156 ASP A OD2 1 
ATOM   1182 N  N   . VAL A 1 156 ? 2.081   -22.939 -53.960 1.00 63.67  ? 157 VAL A N   1 
ATOM   1183 C  CA  . VAL A 1 156 ? 2.281   -22.720 -52.517 1.00 59.43  ? 157 VAL A CA  1 
ATOM   1184 C  C   . VAL A 1 156 ? 1.265   -21.733 -51.921 1.00 56.61  ? 157 VAL A C   1 
ATOM   1185 O  O   . VAL A 1 156 ? 0.695   -20.890 -52.625 1.00 56.95  ? 157 VAL A O   1 
ATOM   1186 C  CB  . VAL A 1 156 ? 3.727   -22.252 -52.145 1.00 59.99  ? 157 VAL A CB  1 
ATOM   1187 C  CG1 . VAL A 1 156 ? 4.804   -23.182 -52.697 1.00 62.38  ? 157 VAL A CG1 1 
ATOM   1188 C  CG2 . VAL A 1 156 ? 3.995   -20.829 -52.603 1.00 61.36  ? 157 VAL A CG2 1 
ATOM   1189 N  N   . PHE A 1 157 ? 1.036   -21.861 -50.619 1.00 52.61  ? 158 PHE A N   1 
ATOM   1190 C  CA  . PHE A 1 157 ? 0.383   -20.818 -49.847 1.00 49.77  ? 158 PHE A CA  1 
ATOM   1191 C  C   . PHE A 1 157 ? 1.081   -20.658 -48.498 1.00 51.05  ? 158 PHE A C   1 
ATOM   1192 O  O   . PHE A 1 157 ? 1.663   -21.616 -47.962 1.00 50.78  ? 158 PHE A O   1 
ATOM   1193 C  CB  . PHE A 1 157 ? -1.135  -21.043 -49.714 1.00 46.23  ? 158 PHE A CB  1 
ATOM   1194 C  CG  . PHE A 1 157 ? -1.511  -22.352 -49.088 1.00 45.01  ? 158 PHE A CG  1 
ATOM   1195 C  CD1 . PHE A 1 157 ? -1.644  -22.470 -47.700 1.00 42.75  ? 158 PHE A CD1 1 
ATOM   1196 C  CD2 . PHE A 1 157 ? -1.749  -23.478 -49.885 1.00 45.43  ? 158 PHE A CD2 1 
ATOM   1197 C  CE1 . PHE A 1 157 ? -1.988  -23.686 -47.123 1.00 41.97  ? 158 PHE A CE1 1 
ATOM   1198 C  CE2 . PHE A 1 157 ? -2.096  -24.694 -49.307 1.00 44.92  ? 158 PHE A CE2 1 
ATOM   1199 C  CZ  . PHE A 1 157 ? -2.216  -24.797 -47.925 1.00 42.73  ? 158 PHE A CZ  1 
ATOM   1200 N  N   . SER A 1 158 ? 1.027   -19.439 -47.966 1.00 51.46  ? 159 SER A N   1 
ATOM   1201 C  CA  . SER A 1 158 ? 1.763   -19.086 -46.761 1.00 51.71  ? 159 SER A CA  1 
ATOM   1202 C  C   . SER A 1 158 ? 0.867   -18.429 -45.731 1.00 50.75  ? 159 SER A C   1 
ATOM   1203 O  O   . SER A 1 158 ? -0.055  -17.694 -46.092 1.00 50.92  ? 159 SER A O   1 
ATOM   1204 C  CB  . SER A 1 158 ? 2.913   -18.147 -47.106 1.00 51.50  ? 159 SER A CB  1 
ATOM   1205 O  OG  . SER A 1 158 ? 3.870   -18.788 -47.915 1.00 53.36  ? 159 SER A OG  1 
ATOM   1206 N  N   . PHE A 1 159 ? 1.162   -18.692 -44.457 1.00 49.15  ? 160 PHE A N   1 
ATOM   1207 C  CA  . PHE A 1 159 ? 0.429   -18.120 -43.337 1.00 47.28  ? 160 PHE A CA  1 
ATOM   1208 C  C   . PHE A 1 159 ? 1.320   -17.239 -42.478 1.00 48.31  ? 160 PHE A C   1 
ATOM   1209 O  O   . PHE A 1 159 ? 2.446   -17.620 -42.116 1.00 49.43  ? 160 PHE A O   1 
ATOM   1210 C  CB  . PHE A 1 159 ? -0.189  -19.219 -42.463 1.00 46.74  ? 160 PHE A CB  1 
ATOM   1211 C  CG  . PHE A 1 159 ? -1.528  -19.729 -42.955 1.00 46.51  ? 160 PHE A CG  1 
ATOM   1212 C  CD1 . PHE A 1 159 ? -1.623  -20.520 -44.115 1.00 46.29  ? 160 PHE A CD1 1 
ATOM   1213 C  CD2 . PHE A 1 159 ? -2.699  -19.453 -42.235 1.00 44.85  ? 160 PHE A CD2 1 
ATOM   1214 C  CE1 . PHE A 1 159 ? -2.854  -21.000 -44.551 1.00 45.38  ? 160 PHE A CE1 1 
ATOM   1215 C  CE2 . PHE A 1 159 ? -3.935  -19.928 -42.666 1.00 42.66  ? 160 PHE A CE2 1 
ATOM   1216 C  CZ  . PHE A 1 159 ? -4.008  -20.705 -43.821 1.00 45.30  ? 160 PHE A CZ  1 
ATOM   1217 N  N   . TYR A 1 160 ? 0.804   -16.050 -42.181 1.00 47.21  ? 161 TYR A N   1 
ATOM   1218 C  CA  . TYR A 1 160 ? 1.311   -15.211 -41.116 1.00 45.78  ? 161 TYR A CA  1 
ATOM   1219 C  C   . TYR A 1 160 ? 0.197   -14.990 -40.097 1.00 45.28  ? 161 TYR A C   1 
ATOM   1220 O  O   . TYR A 1 160 ? -0.881  -14.532 -40.459 1.00 46.33  ? 161 TYR A O   1 
ATOM   1221 C  CB  . TYR A 1 160 ? 1.799   -13.871 -41.671 1.00 46.86  ? 161 TYR A CB  1 
ATOM   1222 C  CG  . TYR A 1 160 ? 2.010   -12.813 -40.606 1.00 45.95  ? 161 TYR A CG  1 
ATOM   1223 C  CD1 . TYR A 1 160 ? 3.042   -12.942 -39.671 1.00 45.07  ? 161 TYR A CD1 1 
ATOM   1224 C  CD2 . TYR A 1 160 ? 1.176   -11.687 -40.527 1.00 44.87  ? 161 TYR A CD2 1 
ATOM   1225 C  CE1 . TYR A 1 160 ? 3.235   -11.994 -38.686 1.00 45.05  ? 161 TYR A CE1 1 
ATOM   1226 C  CE2 . TYR A 1 160 ? 1.372   -10.724 -39.540 1.00 44.72  ? 161 TYR A CE2 1 
ATOM   1227 C  CZ  . TYR A 1 160 ? 2.403   -10.890 -38.624 1.00 44.50  ? 161 TYR A CZ  1 
ATOM   1228 O  OH  . TYR A 1 160 ? 2.636   -9.971  -37.637 1.00 44.33  ? 161 TYR A OH  1 
ATOM   1229 N  N   . TYR A 1 161 ? 0.463   -15.329 -38.835 1.00 45.63  ? 162 TYR A N   1 
ATOM   1230 C  CA  . TYR A 1 161 ? -0.421  -14.984 -37.714 1.00 45.51  ? 162 TYR A CA  1 
ATOM   1231 C  C   . TYR A 1 161 ? 0.272   -13.999 -36.779 1.00 47.76  ? 162 TYR A C   1 
ATOM   1232 O  O   . TYR A 1 161 ? 1.326   -14.313 -36.211 1.00 50.79  ? 162 TYR A O   1 
ATOM   1233 C  CB  . TYR A 1 161 ? -0.842  -16.229 -36.917 1.00 45.30  ? 162 TYR A CB  1 
ATOM   1234 C  CG  . TYR A 1 161 ? -1.840  -17.165 -37.589 1.00 44.73  ? 162 TYR A CG  1 
ATOM   1235 C  CD1 . TYR A 1 161 ? -2.574  -16.768 -38.712 1.00 44.12  ? 162 TYR A CD1 1 
ATOM   1236 C  CD2 . TYR A 1 161 ? -2.070  -18.448 -37.074 1.00 43.93  ? 162 TYR A CD2 1 
ATOM   1237 C  CE1 . TYR A 1 161 ? -3.475  -17.631 -39.314 1.00 42.99  ? 162 TYR A CE1 1 
ATOM   1238 C  CE2 . TYR A 1 161 ? -2.974  -19.314 -37.672 1.00 42.57  ? 162 TYR A CE2 1 
ATOM   1239 C  CZ  . TYR A 1 161 ? -3.673  -18.895 -38.789 1.00 42.77  ? 162 TYR A CZ  1 
ATOM   1240 O  OH  . TYR A 1 161 ? -4.593  -19.722 -39.385 1.00 44.44  ? 162 TYR A OH  1 
ATOM   1241 N  N   . ASN A 1 162 ? -0.323  -12.813 -36.631 1.00 47.97  ? 163 ASN A N   1 
ATOM   1242 C  CA  . ASN A 1 162 ? 0.176   -11.752 -35.749 1.00 47.33  ? 163 ASN A CA  1 
ATOM   1243 C  C   . ASN A 1 162 ? -0.256  -11.991 -34.301 1.00 48.42  ? 163 ASN A C   1 
ATOM   1244 O  O   . ASN A 1 162 ? -1.019  -12.908 -34.023 1.00 47.11  ? 163 ASN A O   1 
ATOM   1245 C  CB  . ASN A 1 162 ? -0.365  -10.403 -36.257 1.00 47.26  ? 163 ASN A CB  1 
ATOM   1246 C  CG  . ASN A 1 162 ? 0.383   -9.184  -35.706 1.00 46.97  ? 163 ASN A CG  1 
ATOM   1247 O  OD1 . ASN A 1 162 ? 1.429   -9.288  -35.053 1.00 46.39  ? 163 ASN A OD1 1 
ATOM   1248 N  ND2 . ASN A 1 162 ? -0.172  -8.012  -35.966 1.00 46.22  ? 163 ASN A ND2 1 
ATOM   1249 N  N   . ARG A 1 163 ? 0.258   -11.172 -33.385 1.00 55.50  ? 164 ARG A N   1 
ATOM   1250 C  CA  . ARG A 1 163 ? -0.341  -10.951 -32.056 1.00 61.43  ? 164 ARG A CA  1 
ATOM   1251 C  C   . ARG A 1 163 ? -1.303  -9.740  -32.142 1.00 67.12  ? 164 ARG A C   1 
ATOM   1252 O  O   . ARG A 1 163 ? -1.496  -9.194  -33.237 1.00 68.84  ? 164 ARG A O   1 
ATOM   1253 C  CB  . ARG A 1 163 ? 0.771   -10.745 -31.032 1.00 65.32  ? 164 ARG A CB  1 
ATOM   1254 C  CG  . ARG A 1 163 ? 1.790   -11.883 -31.036 1.00 67.83  ? 164 ARG A CG  1 
ATOM   1255 C  CD  . ARG A 1 163 ? 3.195   -11.412 -30.697 1.00 69.70  ? 164 ARG A CD  1 
ATOM   1256 N  NE  . ARG A 1 163 ? 4.188   -12.445 -31.007 1.00 73.83  ? 164 ARG A NE  1 
ATOM   1257 C  CZ  . ARG A 1 163 ? 4.998   -12.438 -32.068 1.00 74.96  ? 164 ARG A CZ  1 
ATOM   1258 N  NH1 . ARG A 1 163 ? 5.856   -13.436 -32.246 1.00 70.39  ? 164 ARG A NH1 1 
ATOM   1259 N  NH2 . ARG A 1 163 ? 4.966   -11.438 -32.948 1.00 77.37  ? 164 ARG A NH2 1 
ATOM   1260 N  N   . ASP A 1 164 ? -1.937  -9.335  -31.035 1.00 73.34  ? 165 ASP A N   1 
ATOM   1261 C  CA  . ASP A 1 164 ? -2.867  -8.180  -31.071 1.00 78.49  ? 165 ASP A CA  1 
ATOM   1262 C  C   . ASP A 1 164 ? -3.015  -7.418  -29.753 1.00 83.27  ? 165 ASP A C   1 
ATOM   1263 O  O   . ASP A 1 164 ? -3.717  -6.400  -29.689 1.00 91.59  ? 165 ASP A O   1 
ATOM   1264 C  CB  . ASP A 1 164 ? -4.251  -8.578  -31.640 1.00 80.31  ? 165 ASP A CB  1 
ATOM   1265 C  CG  . ASP A 1 164 ? -5.160  -9.252  -30.610 1.00 81.59  ? 165 ASP A CG  1 
ATOM   1266 O  OD1 . ASP A 1 164 ? -4.745  -10.250 -29.974 1.00 80.57  ? 165 ASP A OD1 1 
ATOM   1267 O  OD2 . ASP A 1 164 ? -6.308  -8.783  -30.455 1.00 80.96  ? 165 ASP A OD2 1 
ATOM   1268 N  N   . SER A 1 168 ? -3.602  -2.761  -31.754 1.00 99.98  ? 169 SER A N   1 
ATOM   1269 C  CA  . SER A 1 168 ? -4.842  -3.531  -31.833 1.00 103.60 ? 169 SER A CA  1 
ATOM   1270 C  C   . SER A 1 168 ? -5.738  -3.125  -33.022 1.00 105.24 ? 169 SER A C   1 
ATOM   1271 O  O   . SER A 1 168 ? -6.736  -3.799  -33.317 1.00 107.54 ? 169 SER A O   1 
ATOM   1272 C  CB  . SER A 1 168 ? -5.608  -3.459  -30.506 1.00 103.71 ? 169 SER A CB  1 
ATOM   1273 O  OG  . SER A 1 168 ? -6.164  -2.171  -30.293 1.00 102.16 ? 169 SER A OG  1 
ATOM   1274 N  N   . GLN A 1 169 ? -5.386  -2.017  -33.678 1.00 103.25 ? 170 GLN A N   1 
ATOM   1275 C  CA  . GLN A 1 169 ? -5.935  -1.661  -34.991 1.00 99.54  ? 170 GLN A CA  1 
ATOM   1276 C  C   . GLN A 1 169 ? -4.816  -1.797  -36.043 1.00 97.46  ? 170 GLN A C   1 
ATOM   1277 O  O   . GLN A 1 169 ? -4.374  -0.818  -36.663 1.00 99.84  ? 170 GLN A O   1 
ATOM   1278 C  CB  . GLN A 1 169 ? -6.565  -0.262  -34.970 1.00 100.39 ? 170 GLN A CB  1 
ATOM   1279 N  N   . SER A 1 170 ? -4.355  -3.039  -36.200 1.00 90.62  ? 171 SER A N   1 
ATOM   1280 C  CA  . SER A 1 170 ? -3.279  -3.421  -37.118 1.00 82.59  ? 171 SER A CA  1 
ATOM   1281 C  C   . SER A 1 170 ? -3.614  -4.775  -37.772 1.00 77.34  ? 171 SER A C   1 
ATOM   1282 O  O   . SER A 1 170 ? -4.691  -5.334  -37.530 1.00 78.31  ? 171 SER A O   1 
ATOM   1283 C  CB  . SER A 1 170 ? -1.944  -3.496  -36.368 1.00 84.00  ? 171 SER A CB  1 
ATOM   1284 O  OG  . SER A 1 170 ? -1.891  -4.630  -35.511 1.00 80.14  ? 171 SER A OG  1 
ATOM   1285 N  N   . LEU A 1 171 ? -2.688  -5.293  -38.582 1.00 68.92  ? 172 LEU A N   1 
ATOM   1286 C  CA  . LEU A 1 171 ? -2.888  -6.528  -39.349 1.00 61.80  ? 172 LEU A CA  1 
ATOM   1287 C  C   . LEU A 1 171 ? -2.920  -7.792  -38.477 1.00 56.66  ? 172 LEU A C   1 
ATOM   1288 O  O   . LEU A 1 171 ? -1.893  -8.203  -37.931 1.00 55.99  ? 172 LEU A O   1 
ATOM   1289 C  CB  . LEU A 1 171 ? -1.798  -6.654  -40.426 1.00 62.16  ? 172 LEU A CB  1 
ATOM   1290 C  CG  . LEU A 1 171 ? -1.918  -7.790  -41.443 1.00 60.52  ? 172 LEU A CG  1 
ATOM   1291 C  CD1 . LEU A 1 171 ? -2.819  -7.412  -42.607 1.00 61.06  ? 172 LEU A CD1 1 
ATOM   1292 C  CD2 . LEU A 1 171 ? -0.542  -8.154  -41.944 1.00 60.16  ? 172 LEU A CD2 1 
ATOM   1293 N  N   . GLY A 1 172 ? -4.093  -8.413  -38.374 1.00 50.42  ? 173 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 172 ? -4.261  -9.621  -37.558 1.00 47.08  ? 173 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 172 ? -3.597  -10.875 -38.110 1.00 47.45  ? 173 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 172 ? -3.179  -11.754 -37.352 1.00 48.82  ? 173 GLY A O   1 
ATOM   1297 N  N   . GLY A 1 173 ? -3.501  -10.963 -39.430 1.00 45.33  ? 174 GLY A N   1 
ATOM   1298 C  CA  . GLY A 1 173 ? -2.813  -12.058 -40.086 1.00 44.71  ? 174 GLY A CA  1 
ATOM   1299 C  C   . GLY A 1 173 ? -2.853  -11.868 -41.581 1.00 46.34  ? 174 GLY A C   1 
ATOM   1300 O  O   . GLY A 1 173 ? -3.417  -10.878 -42.060 1.00 47.61  ? 174 GLY A O   1 
ATOM   1301 N  N   . GLN A 1 174 ? -2.260  -12.811 -42.317 1.00 46.00  ? 175 GLN A N   1 
ATOM   1302 C  CA  . GLN A 1 174 ? -2.189  -12.742 -43.784 1.00 48.32  ? 175 GLN A CA  1 
ATOM   1303 C  C   . GLN A 1 174 ? -1.923  -14.112 -44.396 1.00 48.59  ? 175 GLN A C   1 
ATOM   1304 O  O   . GLN A 1 174 ? -1.036  -14.836 -43.944 1.00 50.18  ? 175 GLN A O   1 
ATOM   1305 C  CB  . GLN A 1 174 ? -1.107  -11.743 -44.236 1.00 49.91  ? 175 GLN A CB  1 
ATOM   1306 C  CG  . GLN A 1 174 ? -1.066  -11.436 -45.730 1.00 50.43  ? 175 GLN A CG  1 
ATOM   1307 C  CD  . GLN A 1 174 ? 0.332   -11.069 -46.213 1.00 53.70  ? 175 GLN A CD  1 
ATOM   1308 O  OE1 . GLN A 1 174 ? 1.297   -11.802 -45.985 1.00 54.43  ? 175 GLN A OE1 1 
ATOM   1309 N  NE2 . GLN A 1 174 ? 0.445   -9.934  -46.888 1.00 54.06  ? 175 GLN A NE2 1 
ATOM   1310 N  N   . ILE A 1 175 ? -2.713  -14.454 -45.412 1.00 48.90  ? 176 ILE A N   1 
ATOM   1311 C  CA  . ILE A 1 175 ? -2.461  -15.616 -46.254 1.00 50.05  ? 176 ILE A CA  1 
ATOM   1312 C  C   . ILE A 1 175 ? -2.095  -15.141 -47.652 1.00 51.62  ? 176 ILE A C   1 
ATOM   1313 O  O   . ILE A 1 175 ? -2.877  -14.439 -48.288 1.00 52.11  ? 176 ILE A O   1 
ATOM   1314 C  CB  . ILE A 1 175 ? -3.673  -16.560 -46.331 1.00 49.26  ? 176 ILE A CB  1 
ATOM   1315 C  CG1 . ILE A 1 175 ? -3.911  -17.186 -44.976 1.00 50.80  ? 176 ILE A CG1 1 
ATOM   1316 C  CG2 . ILE A 1 175 ? -3.442  -17.693 -47.329 1.00 50.30  ? 176 ILE A CG2 1 
ATOM   1317 C  CD1 . ILE A 1 175 ? -5.371  -17.412 -44.704 1.00 52.03  ? 176 ILE A CD1 1 
ATOM   1318 N  N   . VAL A 1 176 ? -0.905  -15.520 -48.110 1.00 51.16  ? 177 VAL A N   1 
ATOM   1319 C  CA  . VAL A 1 176 ? -0.520  -15.317 -49.501 1.00 52.98  ? 177 VAL A CA  1 
ATOM   1320 C  C   . VAL A 1 176 ? -0.825  -16.616 -50.244 1.00 52.98  ? 177 VAL A C   1 
ATOM   1321 O  O   . VAL A 1 176 ? -0.369  -17.692 -49.846 1.00 54.00  ? 177 VAL A O   1 
ATOM   1322 C  CB  . VAL A 1 176 ? 0.978   -14.913 -49.666 1.00 54.53  ? 177 VAL A CB  1 
ATOM   1323 C  CG1 . VAL A 1 176 ? 1.308   -14.634 -51.125 1.00 55.87  ? 177 VAL A CG1 1 
ATOM   1324 C  CG2 . VAL A 1 176 ? 1.324   -13.689 -48.825 1.00 52.76  ? 177 VAL A CG2 1 
ATOM   1325 N  N   . LEU A 1 177 ? -1.622  -16.508 -51.301 1.00 52.18  ? 178 LEU A N   1 
ATOM   1326 C  CA  . LEU A 1 177 ? -1.848  -17.608 -52.221 1.00 51.72  ? 178 LEU A CA  1 
ATOM   1327 C  C   . LEU A 1 177 ? -0.921  -17.413 -53.413 1.00 54.57  ? 178 LEU A C   1 
ATOM   1328 O  O   . LEU A 1 177 ? -1.000  -16.399 -54.117 1.00 56.31  ? 178 LEU A O   1 
ATOM   1329 C  CB  . LEU A 1 177 ? -3.315  -17.656 -52.661 1.00 51.93  ? 178 LEU A CB  1 
ATOM   1330 C  CG  . LEU A 1 177 ? -4.416  -17.689 -51.582 1.00 51.94  ? 178 LEU A CG  1 
ATOM   1331 C  CD1 . LEU A 1 177 ? -5.784  -17.395 -52.183 1.00 51.09  ? 178 LEU A CD1 1 
ATOM   1332 C  CD2 . LEU A 1 177 ? -4.447  -19.002 -50.809 1.00 50.41  ? 178 LEU A CD2 1 
ATOM   1333 N  N   . GLY A 1 178 ? -0.019  -18.370 -53.614 1.00 55.40  ? 179 GLY A N   1 
ATOM   1334 C  CA  . GLY A 1 178 ? 0.892   -18.346 -54.763 1.00 58.17  ? 179 GLY A CA  1 
ATOM   1335 C  C   . GLY A 1 178 ? 2.325   -17.964 -54.438 1.00 59.35  ? 179 GLY A C   1 
ATOM   1336 O  O   . GLY A 1 178 ? 3.181   -17.941 -55.323 1.00 62.03  ? 179 GLY A O   1 
ATOM   1337 N  N   . GLY A 1 179 ? 2.586   -17.658 -53.171 1.00 57.87  ? 180 GLY A N   1 
ATOM   1338 C  CA  . GLY A 1 179 ? 3.929   -17.325 -52.715 1.00 59.15  ? 180 GLY A CA  1 
ATOM   1339 C  C   . GLY A 1 179 ? 3.972   -17.112 -51.224 1.00 58.68  ? 180 GLY A C   1 
ATOM   1340 O  O   . GLY A 1 179 ? 3.110   -17.601 -50.487 1.00 56.90  ? 180 GLY A O   1 
ATOM   1341 N  N   . SER A 1 180 ? 4.995   -16.385 -50.788 1.00 60.54  ? 181 SER A N   1 
ATOM   1342 C  CA  . SER A 1 180 ? 5.114   -15.920 -49.411 1.00 59.25  ? 181 SER A CA  1 
ATOM   1343 C  C   . SER A 1 180 ? 5.324   -14.406 -49.432 1.00 59.05  ? 181 SER A C   1 
ATOM   1344 O  O   . SER A 1 180 ? 5.560   -13.826 -50.495 1.00 60.55  ? 181 SER A O   1 
ATOM   1345 C  CB  . SER A 1 180 ? 6.265   -16.637 -48.697 1.00 60.62  ? 181 SER A CB  1 
ATOM   1346 O  OG  . SER A 1 180 ? 7.514   -16.365 -49.323 1.00 65.14  ? 181 SER A OG  1 
ATOM   1347 N  N   . ASP A 1 181 ? 5.221   -13.769 -48.267 1.00 58.07  ? 182 ASP A N   1 
ATOM   1348 C  CA  . ASP A 1 181 ? 5.460   -12.326 -48.147 1.00 57.80  ? 182 ASP A CA  1 
ATOM   1349 C  C   . ASP A 1 181 ? 6.694   -12.036 -47.262 1.00 57.24  ? 182 ASP A C   1 
ATOM   1350 O  O   . ASP A 1 181 ? 6.631   -12.201 -46.029 1.00 54.66  ? 182 ASP A O   1 
ATOM   1351 C  CB  . ASP A 1 181 ? 4.196   -11.617 -47.635 1.00 55.43  ? 182 ASP A CB  1 
ATOM   1352 C  CG  . ASP A 1 181 ? 4.292   -10.090 -47.671 1.00 56.76  ? 182 ASP A CG  1 
ATOM   1353 O  OD1 . ASP A 1 181 ? 5.331   -9.507  -48.069 1.00 59.18  ? 182 ASP A OD1 1 
ATOM   1354 O  OD2 . ASP A 1 181 ? 3.295   -9.460  -47.271 1.00 56.43  ? 182 ASP A OD2 1 
ATOM   1355 N  N   . PRO A 1 182 ? 7.808   -11.588 -47.889 1.00 57.94  ? 183 PRO A N   1 
ATOM   1356 C  CA  . PRO A 1 182 ? 9.085   -11.350 -47.180 1.00 59.79  ? 183 PRO A CA  1 
ATOM   1357 C  C   . PRO A 1 182 ? 8.998   -10.277 -46.089 1.00 59.39  ? 183 PRO A C   1 
ATOM   1358 O  O   . PRO A 1 182 ? 9.855   -10.234 -45.207 1.00 60.82  ? 183 PRO A O   1 
ATOM   1359 C  CB  . PRO A 1 182 ? 10.047  -10.895 -48.292 1.00 61.05  ? 183 PRO A CB  1 
ATOM   1360 C  CG  . PRO A 1 182 ? 9.376   -11.244 -49.580 1.00 61.85  ? 183 PRO A CG  1 
ATOM   1361 C  CD  . PRO A 1 182 ? 7.900   -11.200 -49.308 1.00 60.05  ? 183 PRO A CD  1 
ATOM   1362 N  N   . GLN A 1 183 ? 7.968   -9.434  -46.153 1.00 57.99  ? 184 GLN A N   1 
ATOM   1363 C  CA  . GLN A 1 183 ? 7.719   -8.410  -45.140 1.00 56.99  ? 184 GLN A CA  1 
ATOM   1364 C  C   . GLN A 1 183 ? 7.294   -8.985  -43.765 1.00 53.52  ? 184 GLN A C   1 
ATOM   1365 O  O   . GLN A 1 183 ? 7.350   -8.274  -42.761 1.00 51.47  ? 184 GLN A O   1 
ATOM   1366 C  CB  . GLN A 1 183 ? 6.696   -7.384  -45.661 1.00 57.00  ? 184 GLN A CB  1 
ATOM   1367 N  N   . HIS A 1 184 ? 6.894   -10.262 -43.733 1.00 51.63  ? 185 HIS A N   1 
ATOM   1368 C  CA  . HIS A 1 184 ? 6.459   -10.937 -42.498 1.00 50.32  ? 185 HIS A CA  1 
ATOM   1369 C  C   . HIS A 1 184 ? 7.346   -12.091 -41.996 1.00 50.00  ? 185 HIS A C   1 
ATOM   1370 O  O   . HIS A 1 184 ? 6.996   -12.747 -41.013 1.00 50.26  ? 185 HIS A O   1 
ATOM   1371 C  CB  . HIS A 1 184 ? 4.980   -11.371 -42.593 1.00 49.95  ? 185 HIS A CB  1 
ATOM   1372 C  CG  . HIS A 1 184 ? 4.028   -10.219 -42.666 1.00 51.43  ? 185 HIS A CG  1 
ATOM   1373 N  ND1 . HIS A 1 184 ? 3.185   -10.017 -43.738 1.00 52.52  ? 185 HIS A ND1 1 
ATOM   1374 C  CD2 . HIS A 1 184 ? 3.821   -9.178  -41.822 1.00 51.72  ? 185 HIS A CD2 1 
ATOM   1375 C  CE1 . HIS A 1 184 ? 2.491   -8.908  -43.546 1.00 53.27  ? 185 HIS A CE1 1 
ATOM   1376 N  NE2 . HIS A 1 184 ? 2.859   -8.379  -42.391 1.00 52.61  ? 185 HIS A NE2 1 
ATOM   1377 N  N   . TYR A 1 185 ? 8.476   -12.334 -42.661 1.00 49.92  ? 186 TYR A N   1 
ATOM   1378 C  CA  . TYR A 1 185 ? 9.447   -13.336 -42.216 1.00 49.89  ? 186 TYR A CA  1 
ATOM   1379 C  C   . TYR A 1 185 ? 10.886  -12.864 -42.403 1.00 52.04  ? 186 TYR A C   1 
ATOM   1380 O  O   . TYR A 1 185 ? 11.155  -11.950 -43.179 1.00 53.70  ? 186 TYR A O   1 
ATOM   1381 C  CB  . TYR A 1 185 ? 9.208   -14.714 -42.883 1.00 49.95  ? 186 TYR A CB  1 
ATOM   1382 C  CG  . TYR A 1 185 ? 9.508   -14.801 -44.377 1.00 51.95  ? 186 TYR A CG  1 
ATOM   1383 C  CD1 . TYR A 1 185 ? 10.829  -14.922 -44.850 1.00 53.46  ? 186 TYR A CD1 1 
ATOM   1384 C  CD2 . TYR A 1 185 ? 8.475   -14.791 -45.317 1.00 51.67  ? 186 TYR A CD2 1 
ATOM   1385 C  CE1 . TYR A 1 185 ? 11.106  -15.008 -46.204 1.00 54.97  ? 186 TYR A CE1 1 
ATOM   1386 C  CE2 . TYR A 1 185 ? 8.747   -14.876 -46.677 1.00 53.69  ? 186 TYR A CE2 1 
ATOM   1387 C  CZ  . TYR A 1 185 ? 10.062  -14.977 -47.111 1.00 56.24  ? 186 TYR A CZ  1 
ATOM   1388 O  OH  . TYR A 1 185 ? 10.339  -15.064 -48.458 1.00 60.59  ? 186 TYR A OH  1 
ATOM   1389 N  N   . GLU A 1 186 ? 11.810  -13.496 -41.690 1.00 53.23  ? 187 GLU A N   1 
ATOM   1390 C  CA  . GLU A 1 186 ? 13.237  -13.163 -41.795 1.00 56.14  ? 187 GLU A CA  1 
ATOM   1391 C  C   . GLU A 1 186 ? 14.090  -14.415 -41.654 1.00 57.26  ? 187 GLU A C   1 
ATOM   1392 O  O   . GLU A 1 186 ? 13.610  -15.456 -41.184 1.00 55.74  ? 187 GLU A O   1 
ATOM   1393 C  CB  . GLU A 1 186 ? 13.645  -12.099 -40.768 1.00 55.99  ? 187 GLU A CB  1 
ATOM   1394 C  CG  . GLU A 1 186 ? 13.318  -12.453 -39.322 1.00 54.76  ? 187 GLU A CG  1 
ATOM   1395 C  CD  . GLU A 1 186 ? 13.508  -11.301 -38.357 1.00 55.04  ? 187 GLU A CD  1 
ATOM   1396 O  OE1 . GLU A 1 186 ? 13.700  -10.146 -38.792 1.00 56.62  ? 187 GLU A OE1 1 
ATOM   1397 O  OE2 . GLU A 1 186 ? 13.457  -11.560 -37.144 1.00 54.14  ? 187 GLU A OE2 1 
ATOM   1398 N  N   . GLY A 1 187 ? 15.351  -14.302 -42.066 1.00 60.01  ? 188 GLY A N   1 
ATOM   1399 C  CA  . GLY A 1 187 ? 16.216  -15.463 -42.251 1.00 62.21  ? 188 GLY A CA  1 
ATOM   1400 C  C   . GLY A 1 187 ? 15.693  -16.363 -43.360 1.00 63.62  ? 188 GLY A C   1 
ATOM   1401 O  O   . GLY A 1 187 ? 14.814  -15.972 -44.149 1.00 61.43  ? 188 GLY A O   1 
ATOM   1402 N  N   . ASN A 1 188 ? 16.229  -17.576 -43.409 1.00 66.76  ? 189 ASN A N   1 
ATOM   1403 C  CA  . ASN A 1 188 ? 15.853  -18.547 -44.432 1.00 69.13  ? 189 ASN A CA  1 
ATOM   1404 C  C   . ASN A 1 188 ? 14.696  -19.424 -43.998 1.00 66.77  ? 189 ASN A C   1 
ATOM   1405 O  O   . ASN A 1 188 ? 14.511  -19.677 -42.800 1.00 65.95  ? 189 ASN A O   1 
ATOM   1406 C  CB  . ASN A 1 188 ? 17.045  -19.436 -44.790 1.00 72.08  ? 189 ASN A CB  1 
ATOM   1407 C  CG  . ASN A 1 188 ? 18.196  -18.653 -45.376 1.00 75.39  ? 189 ASN A CG  1 
ATOM   1408 O  OD1 . ASN A 1 188 ? 19.230  -18.467 -44.727 1.00 76.05  ? 189 ASN A OD1 1 
ATOM   1409 N  ND2 . ASN A 1 188 ? 18.019  -18.173 -46.602 1.00 76.45  ? 189 ASN A ND2 1 
ATOM   1410 N  N   . PHE A 1 189 ? 13.921  -19.879 -44.979 1.00 65.30  ? 190 PHE A N   1 
ATOM   1411 C  CA  . PHE A 1 189 ? 13.015  -20.990 -44.762 1.00 63.79  ? 190 PHE A CA  1 
ATOM   1412 C  C   . PHE A 1 189 ? 13.830  -22.261 -44.558 1.00 65.63  ? 190 PHE A C   1 
ATOM   1413 O  O   . PHE A 1 189 ? 14.844  -22.478 -45.230 1.00 67.48  ? 190 PHE A O   1 
ATOM   1414 C  CB  . PHE A 1 189 ? 12.055  -21.168 -45.937 1.00 63.52  ? 190 PHE A CB  1 
ATOM   1415 C  CG  . PHE A 1 189 ? 10.876  -20.244 -45.905 1.00 62.35  ? 190 PHE A CG  1 
ATOM   1416 C  CD1 . PHE A 1 189 ? 9.840   -20.434 -44.985 1.00 60.20  ? 190 PHE A CD1 1 
ATOM   1417 C  CD2 . PHE A 1 189 ? 10.784  -19.185 -46.809 1.00 63.97  ? 190 PHE A CD2 1 
ATOM   1418 C  CE1 . PHE A 1 189 ? 8.746   -19.575 -44.959 1.00 58.51  ? 190 PHE A CE1 1 
ATOM   1419 C  CE2 . PHE A 1 189 ? 9.687   -18.330 -46.792 1.00 61.29  ? 190 PHE A CE2 1 
ATOM   1420 C  CZ  . PHE A 1 189 ? 8.671   -18.523 -45.864 1.00 59.00  ? 190 PHE A CZ  1 
ATOM   1421 N  N   . HIS A 1 190 ? 13.401  -23.068 -43.595 1.00 65.13  ? 191 HIS A N   1 
ATOM   1422 C  CA  . HIS A 1 190 ? 13.938  -24.404 -43.402 1.00 66.56  ? 191 HIS A CA  1 
ATOM   1423 C  C   . HIS A 1 190 ? 12.796  -25.375 -43.607 1.00 65.90  ? 191 HIS A C   1 
ATOM   1424 O  O   . HIS A 1 190 ? 11.747  -25.287 -42.955 1.00 63.78  ? 191 HIS A O   1 
ATOM   1425 C  CB  . HIS A 1 190 ? 14.609  -24.546 -42.034 1.00 67.83  ? 191 HIS A CB  1 
ATOM   1426 C  CG  . HIS A 1 190 ? 15.776  -23.625 -41.853 1.00 71.53  ? 191 HIS A CG  1 
ATOM   1427 N  ND1 . HIS A 1 190 ? 17.049  -23.941 -42.279 1.00 74.30  ? 191 HIS A ND1 1 
ATOM   1428 C  CD2 . HIS A 1 190 ? 15.853  -22.376 -41.332 1.00 71.48  ? 191 HIS A CD2 1 
ATOM   1429 C  CE1 . HIS A 1 190 ? 17.864  -22.937 -42.010 1.00 76.15  ? 191 HIS A CE1 1 
ATOM   1430 N  NE2 . HIS A 1 190 ? 17.163  -21.975 -41.434 1.00 74.84  ? 191 HIS A NE2 1 
ATOM   1431 N  N   . TYR A 1 191 ? 13.006  -26.276 -44.558 1.00 67.72  ? 192 TYR A N   1 
ATOM   1432 C  CA  . TYR A 1 191 ? 11.958  -27.152 -45.048 1.00 65.75  ? 192 TYR A CA  1 
ATOM   1433 C  C   . TYR A 1 191 ? 12.016  -28.532 -44.423 1.00 66.45  ? 192 TYR A C   1 
ATOM   1434 O  O   . TYR A 1 191 ? 13.093  -29.057 -44.128 1.00 69.13  ? 192 TYR A O   1 
ATOM   1435 C  CB  . TYR A 1 191 ? 12.034  -27.251 -46.569 1.00 66.59  ? 192 TYR A CB  1 
ATOM   1436 C  CG  . TYR A 1 191 ? 11.764  -25.942 -47.278 1.00 66.11  ? 192 TYR A CG  1 
ATOM   1437 C  CD1 . TYR A 1 191 ? 10.454  -25.528 -47.540 1.00 64.47  ? 192 TYR A CD1 1 
ATOM   1438 C  CD2 . TYR A 1 191 ? 12.817  -25.114 -47.694 1.00 67.79  ? 192 TYR A CD2 1 
ATOM   1439 C  CE1 . TYR A 1 191 ? 10.192  -24.332 -48.194 1.00 64.88  ? 192 TYR A CE1 1 
ATOM   1440 C  CE2 . TYR A 1 191 ? 12.568  -23.910 -48.351 1.00 67.96  ? 192 TYR A CE2 1 
ATOM   1441 C  CZ  . TYR A 1 191 ? 11.252  -23.526 -48.597 1.00 67.60  ? 192 TYR A CZ  1 
ATOM   1442 O  OH  . TYR A 1 191 ? 10.983  -22.342 -49.243 1.00 69.26  ? 192 TYR A OH  1 
ATOM   1443 N  N   . ILE A 1 192 ? 10.834  -29.090 -44.198 1.00 65.54  ? 193 ILE A N   1 
ATOM   1444 C  CA  . ILE A 1 192 ? 10.660  -30.483 -43.792 1.00 66.63  ? 193 ILE A CA  1 
ATOM   1445 C  C   . ILE A 1 192 ? 9.663   -31.114 -44.774 1.00 66.81  ? 193 ILE A C   1 
ATOM   1446 O  O   . ILE A 1 192 ? 8.582   -30.560 -45.008 1.00 63.31  ? 193 ILE A O   1 
ATOM   1447 C  CB  . ILE A 1 192 ? 10.139  -30.617 -42.332 1.00 64.68  ? 193 ILE A CB  1 
ATOM   1448 C  CG1 . ILE A 1 192 ? 10.965  -29.780 -41.352 1.00 63.28  ? 193 ILE A CG1 1 
ATOM   1449 C  CG2 . ILE A 1 192 ? 10.135  -32.071 -41.871 1.00 66.05  ? 193 ILE A CG2 1 
ATOM   1450 C  CD1 . ILE A 1 192 ? 10.300  -28.496 -40.926 1.00 60.39  ? 193 ILE A CD1 1 
ATOM   1451 N  N   . ASN A 1 193 ? 10.045  -32.250 -45.360 1.00 69.57  ? 194 ASN A N   1 
ATOM   1452 C  CA  . ASN A 1 193 ? 9.151   -33.025 -46.227 1.00 70.61  ? 194 ASN A CA  1 
ATOM   1453 C  C   . ASN A 1 193 ? 8.014   -33.644 -45.428 1.00 69.34  ? 194 ASN A C   1 
ATOM   1454 O  O   . ASN A 1 193 ? 8.206   -34.037 -44.270 1.00 68.93  ? 194 ASN A O   1 
ATOM   1455 C  CB  . ASN A 1 193 ? 9.907   -34.143 -46.958 1.00 74.02  ? 194 ASN A CB  1 
ATOM   1456 C  CG  . ASN A 1 193 ? 11.055  -33.632 -47.807 1.00 77.03  ? 194 ASN A CG  1 
ATOM   1457 O  OD1 . ASN A 1 193 ? 11.172  -32.437 -48.077 1.00 77.04  ? 194 ASN A OD1 1 
ATOM   1458 N  ND2 . ASN A 1 193 ? 11.918  -34.546 -48.230 1.00 81.08  ? 194 ASN A ND2 1 
ATOM   1459 N  N   . LEU A 1 194 ? 6.839   -33.711 -46.055 1.00 68.42  ? 195 LEU A N   1 
ATOM   1460 C  CA  . LEU A 1 194 ? 5.685   -34.426 -45.515 1.00 68.06  ? 195 LEU A CA  1 
ATOM   1461 C  C   . LEU A 1 194 ? 5.962   -35.927 -45.421 1.00 71.11  ? 195 LEU A C   1 
ATOM   1462 O  O   . LEU A 1 194 ? 6.661   -36.490 -46.274 1.00 70.85  ? 195 LEU A O   1 
ATOM   1463 C  CB  . LEU A 1 194 ? 4.441   -34.206 -46.396 1.00 67.03  ? 195 LEU A CB  1 
ATOM   1464 C  CG  . LEU A 1 194 ? 3.868   -32.803 -46.642 1.00 65.88  ? 195 LEU A CG  1 
ATOM   1465 C  CD1 . LEU A 1 194 ? 2.730   -32.839 -47.651 1.00 65.23  ? 195 LEU A CD1 1 
ATOM   1466 C  CD2 . LEU A 1 194 ? 3.397   -32.149 -45.358 1.00 64.11  ? 195 LEU A CD2 1 
ATOM   1467 N  N   . ILE A 1 195 ? 5.407   -36.552 -44.379 1.00 72.61  ? 196 ILE A N   1 
ATOM   1468 C  CA  . ILE A 1 195 ? 5.346   -38.015 -44.239 1.00 77.50  ? 196 ILE A CA  1 
ATOM   1469 C  C   . ILE A 1 195 ? 4.813   -38.631 -45.534 1.00 79.74  ? 196 ILE A C   1 
ATOM   1470 O  O   . ILE A 1 195 ? 5.450   -39.512 -46.122 1.00 84.25  ? 196 ILE A O   1 
ATOM   1471 C  CB  . ILE A 1 195 ? 4.468   -38.439 -43.018 1.00 77.04  ? 196 ILE A CB  1 
ATOM   1472 C  CG1 . ILE A 1 195 ? 5.080   -37.957 -41.680 1.00 75.35  ? 196 ILE A CG1 1 
ATOM   1473 C  CG2 . ILE A 1 195 ? 4.162   -39.945 -43.023 1.00 78.41  ? 196 ILE A CG2 1 
ATOM   1474 C  CD1 . ILE A 1 195 ? 6.390   -38.610 -41.259 1.00 78.68  ? 196 ILE A CD1 1 
ATOM   1475 N  N   . LYS A 1 196 ? 3.653   -38.135 -45.963 1.00 80.17  ? 197 LYS A N   1 
ATOM   1476 C  CA  . LYS A 1 196 ? 3.012   -38.508 -47.218 1.00 82.96  ? 197 LYS A CA  1 
ATOM   1477 C  C   . LYS A 1 196 ? 2.215   -37.308 -47.741 1.00 80.95  ? 197 LYS A C   1 
ATOM   1478 O  O   . LYS A 1 196 ? 1.767   -36.460 -46.951 1.00 80.31  ? 197 LYS A O   1 
ATOM   1479 C  CB  . LYS A 1 196 ? 2.106   -39.744 -47.013 1.00 85.06  ? 197 LYS A CB  1 
ATOM   1480 C  CG  . LYS A 1 196 ? 0.647   -39.462 -46.655 1.00 83.13  ? 197 LYS A CG  1 
ATOM   1481 C  CD  . LYS A 1 196 ? 0.049   -40.438 -45.655 1.00 84.74  ? 197 LYS A CD  1 
ATOM   1482 C  CE  . LYS A 1 196 ? 0.011   -39.819 -44.264 1.00 84.19  ? 197 LYS A CE  1 
ATOM   1483 N  NZ  . LYS A 1 196 ? -1.227  -40.195 -43.527 1.00 82.44  ? 197 LYS A NZ  1 
ATOM   1484 N  N   . THR A 1 197 ? 2.056   -37.234 -49.064 1.00 80.50  ? 198 THR A N   1 
ATOM   1485 C  CA  . THR A 1 197 ? 1.085   -36.323 -49.694 1.00 76.72  ? 198 THR A CA  1 
ATOM   1486 C  C   . THR A 1 197 ? -0.332  -36.720 -49.249 1.00 73.92  ? 198 THR A C   1 
ATOM   1487 O  O   . THR A 1 197 ? -0.635  -37.907 -49.095 1.00 76.80  ? 198 THR A O   1 
ATOM   1488 C  CB  . THR A 1 197 ? 1.221   -36.270 -51.251 1.00 78.72  ? 198 THR A CB  1 
ATOM   1489 O  OG1 . THR A 1 197 ? 0.199   -35.430 -51.814 1.00 75.88  ? 198 THR A OG1 1 
ATOM   1490 C  CG2 . THR A 1 197 ? 1.156   -37.674 -51.906 1.00 80.26  ? 198 THR A CG2 1 
ATOM   1491 N  N   . GLY A 1 198 ? -1.184  -35.729 -49.020 1.00 69.30  ? 199 GLY A N   1 
ATOM   1492 C  CA  . GLY A 1 198 ? -2.545  -35.993 -48.557 1.00 66.04  ? 199 GLY A CA  1 
ATOM   1493 C  C   . GLY A 1 198 ? -2.872  -35.335 -47.232 1.00 62.05  ? 199 GLY A C   1 
ATOM   1494 O  O   . GLY A 1 198 ? -4.023  -34.982 -46.984 1.00 59.21  ? 199 GLY A O   1 
ATOM   1495 N  N   . VAL A 1 199 ? -1.851  -35.182 -46.387 1.00 61.60  ? 200 VAL A N   1 
ATOM   1496 C  CA  . VAL A 1 199 ? -1.973  -34.576 -45.057 1.00 60.09  ? 200 VAL A CA  1 
ATOM   1497 C  C   . VAL A 1 199 ? -0.785  -33.637 -44.831 1.00 58.77  ? 200 VAL A C   1 
ATOM   1498 O  O   . VAL A 1 199 ? 0.348   -33.988 -45.152 1.00 62.35  ? 200 VAL A O   1 
ATOM   1499 C  CB  . VAL A 1 199 ? -2.010  -35.640 -43.923 1.00 61.47  ? 200 VAL A CB  1 
ATOM   1500 C  CG1 . VAL A 1 199 ? -2.508  -35.032 -42.621 1.00 59.89  ? 200 VAL A CG1 1 
ATOM   1501 C  CG2 . VAL A 1 199 ? -2.897  -36.825 -44.283 1.00 62.83  ? 200 VAL A CG2 1 
ATOM   1502 N  N   . TRP A 1 200 ? -1.049  -32.454 -44.277 1.00 57.22  ? 201 TRP A N   1 
ATOM   1503 C  CA  . TRP A 1 200 ? -0.000  -31.490 -43.919 1.00 56.65  ? 201 TRP A CA  1 
ATOM   1504 C  C   . TRP A 1 200 ? 0.660   -31.885 -42.592 1.00 57.44  ? 201 TRP A C   1 
ATOM   1505 O  O   . TRP A 1 200 ? 0.565   -31.176 -41.580 1.00 57.00  ? 201 TRP A O   1 
ATOM   1506 C  CB  . TRP A 1 200 ? -0.552  -30.056 -43.862 1.00 53.87  ? 201 TRP A CB  1 
ATOM   1507 C  CG  . TRP A 1 200 ? -0.913  -29.452 -45.196 1.00 53.63  ? 201 TRP A CG  1 
ATOM   1508 C  CD1 . TRP A 1 200 ? -2.162  -29.096 -45.616 1.00 53.38  ? 201 TRP A CD1 1 
ATOM   1509 C  CD2 . TRP A 1 200 ? -0.018  -29.121 -46.277 1.00 53.26  ? 201 TRP A CD2 1 
ATOM   1510 N  NE1 . TRP A 1 200 ? -2.106  -28.570 -46.890 1.00 53.32  ? 201 TRP A NE1 1 
ATOM   1511 C  CE2 . TRP A 1 200 ? -0.805  -28.569 -47.316 1.00 52.44  ? 201 TRP A CE2 1 
ATOM   1512 C  CE3 . TRP A 1 200 ? 1.368   -29.232 -46.465 1.00 53.96  ? 201 TRP A CE3 1 
ATOM   1513 C  CZ2 . TRP A 1 200 ? -0.254  -28.131 -48.527 1.00 53.09  ? 201 TRP A CZ2 1 
ATOM   1514 C  CZ3 . TRP A 1 200 ? 1.920   -28.796 -47.679 1.00 55.00  ? 201 TRP A CZ3 1 
ATOM   1515 C  CH2 . TRP A 1 200 ? 1.106   -28.255 -48.691 1.00 54.49  ? 201 TRP A CH2 1 
ATOM   1516 N  N   . GLN A 1 201 ? 1.326   -33.034 -42.621 1.00 59.34  ? 202 GLN A N   1 
ATOM   1517 C  CA  . GLN A 1 201 ? 1.914   -33.646 -41.441 1.00 60.28  ? 202 GLN A CA  1 
ATOM   1518 C  C   . GLN A 1 201 ? 3.359   -33.984 -41.742 1.00 62.72  ? 202 GLN A C   1 
ATOM   1519 O  O   . GLN A 1 201 ? 3.684   -34.425 -42.848 1.00 67.55  ? 202 GLN A O   1 
ATOM   1520 C  CB  . GLN A 1 201 ? 1.135   -34.908 -41.063 1.00 60.89  ? 202 GLN A CB  1 
ATOM   1521 C  CG  . GLN A 1 201 ? 1.472   -35.502 -39.704 1.00 61.26  ? 202 GLN A CG  1 
ATOM   1522 C  CD  . GLN A 1 201 ? 0.529   -36.615 -39.311 1.00 62.89  ? 202 GLN A CD  1 
ATOM   1523 O  OE1 . GLN A 1 201 ? -0.212  -36.494 -38.343 1.00 62.65  ? 202 GLN A OE1 1 
ATOM   1524 N  NE2 . GLN A 1 201 ? 0.541   -37.705 -40.072 1.00 66.89  ? 202 GLN A NE2 1 
ATOM   1525 N  N   . ILE A 1 202 ? 4.210   -33.777 -40.745 1.00 62.42  ? 203 ILE A N   1 
ATOM   1526 C  CA  . ILE A 1 202 ? 5.652   -33.968 -40.860 1.00 64.45  ? 203 ILE A CA  1 
ATOM   1527 C  C   . ILE A 1 202 ? 6.189   -34.773 -39.682 1.00 66.11  ? 203 ILE A C   1 
ATOM   1528 O  O   . ILE A 1 202 ? 5.591   -34.782 -38.604 1.00 63.58  ? 203 ILE A O   1 
ATOM   1529 C  CB  . ILE A 1 202 ? 6.405   -32.614 -40.934 1.00 64.23  ? 203 ILE A CB  1 
ATOM   1530 C  CG1 . ILE A 1 202 ? 5.896   -31.631 -39.852 1.00 62.01  ? 203 ILE A CG1 1 
ATOM   1531 C  CG2 . ILE A 1 202 ? 6.294   -32.029 -42.337 1.00 63.99  ? 203 ILE A CG2 1 
ATOM   1532 C  CD1 . ILE A 1 202 ? 6.836   -30.490 -39.507 1.00 60.39  ? 203 ILE A CD1 1 
ATOM   1533 N  N   . GLN A 1 203 ? 7.312   -35.454 -39.905 1.00 70.13  ? 204 GLN A N   1 
ATOM   1534 C  CA  . GLN A 1 203 ? 8.069   -36.085 -38.832 1.00 73.70  ? 204 GLN A CA  1 
ATOM   1535 C  C   . GLN A 1 203 ? 8.534   -35.030 -37.812 1.00 72.67  ? 204 GLN A C   1 
ATOM   1536 O  O   . GLN A 1 203 ? 8.956   -33.937 -38.188 1.00 72.16  ? 204 GLN A O   1 
ATOM   1537 C  CB  . GLN A 1 203 ? 9.264   -36.847 -39.416 1.00 78.18  ? 204 GLN A CB  1 
ATOM   1538 C  CG  . GLN A 1 203 ? 10.162  -37.554 -38.399 1.00 82.80  ? 204 GLN A CG  1 
ATOM   1539 C  CD  . GLN A 1 203 ? 9.711   -38.963 -38.038 1.00 86.75  ? 204 GLN A CD  1 
ATOM   1540 O  OE1 . GLN A 1 203 ? 10.527  -39.887 -38.009 1.00 90.65  ? 204 GLN A OE1 1 
ATOM   1541 N  NE2 . GLN A 1 203 ? 8.419   -39.138 -37.750 1.00 85.40  ? 204 GLN A NE2 1 
ATOM   1542 N  N   . MET A 1 204 ? 8.410   -35.362 -36.529 1.00 72.21  ? 205 MET A N   1 
ATOM   1543 C  CA  . MET A 1 204 ? 8.996   -34.581 -35.446 1.00 71.17  ? 205 MET A CA  1 
ATOM   1544 C  C   . MET A 1 204 ? 9.963   -35.467 -34.661 1.00 74.16  ? 205 MET A C   1 
ATOM   1545 O  O   . MET A 1 204 ? 9.609   -36.577 -34.261 1.00 77.16  ? 205 MET A O   1 
ATOM   1546 C  CB  . MET A 1 204 ? 7.908   -33.996 -34.541 1.00 68.87  ? 205 MET A CB  1 
ATOM   1547 C  CG  . MET A 1 204 ? 8.440   -33.179 -33.370 1.00 68.47  ? 205 MET A CG  1 
ATOM   1548 S  SD  . MET A 1 204 ? 7.322   -31.882 -32.819 1.00 66.33  ? 205 MET A SD  1 
ATOM   1549 C  CE  . MET A 1 204 ? 6.052   -32.835 -32.006 1.00 64.97  ? 205 MET A CE  1 
ATOM   1550 N  N   . LYS A 1 205 ? 11.173  -34.958 -34.442 1.00 74.45  ? 206 LYS A N   1 
ATOM   1551 C  CA  . LYS A 1 205 ? 12.269  -35.739 -33.866 1.00 76.72  ? 206 LYS A CA  1 
ATOM   1552 C  C   . LYS A 1 205 ? 12.362  -35.657 -32.336 1.00 75.83  ? 206 LYS A C   1 
ATOM   1553 O  O   . LYS A 1 205 ? 13.055  -36.466 -31.713 1.00 80.60  ? 206 LYS A O   1 
ATOM   1554 C  CB  . LYS A 1 205 ? 13.606  -35.333 -34.501 1.00 79.26  ? 206 LYS A CB  1 
ATOM   1555 C  CG  . LYS A 1 205 ? 13.701  -35.515 -36.012 1.00 81.99  ? 206 LYS A CG  1 
ATOM   1556 C  CD  . LYS A 1 205 ? 14.969  -34.862 -36.555 1.00 84.92  ? 206 LYS A CD  1 
ATOM   1557 C  CE  . LYS A 1 205 ? 15.053  -34.927 -38.073 1.00 85.43  ? 206 LYS A CE  1 
ATOM   1558 N  NZ  . LYS A 1 205 ? 16.426  -34.600 -38.553 1.00 87.65  ? 206 LYS A NZ  1 
ATOM   1559 N  N   . GLY A 1 206 ? 11.677  -34.688 -31.734 1.00 71.25  ? 207 GLY A N   1 
ATOM   1560 C  CA  . GLY A 1 206 ? 11.683  -34.529 -30.278 1.00 69.68  ? 207 GLY A CA  1 
ATOM   1561 C  C   . GLY A 1 206 ? 10.978  -33.286 -29.773 1.00 68.29  ? 207 GLY A C   1 
ATOM   1562 O  O   . GLY A 1 206 ? 10.822  -32.298 -30.506 1.00 67.53  ? 207 GLY A O   1 
ATOM   1563 N  N   . VAL A 1 207 ? 10.526  -33.354 -28.522 1.00 67.45  ? 208 VAL A N   1 
ATOM   1564 C  CA  . VAL A 1 207 ? 9.986   -32.195 -27.807 1.00 65.54  ? 208 VAL A CA  1 
ATOM   1565 C  C   . VAL A 1 207 ? 10.806  -32.019 -26.530 1.00 67.29  ? 208 VAL A C   1 
ATOM   1566 O  O   . VAL A 1 207 ? 10.973  -32.961 -25.755 1.00 69.62  ? 208 VAL A O   1 
ATOM   1567 C  CB  . VAL A 1 207 ? 8.464   -32.315 -27.505 1.00 63.94  ? 208 VAL A CB  1 
ATOM   1568 C  CG1 . VAL A 1 207 ? 7.970   -31.162 -26.642 1.00 63.56  ? 208 VAL A CG1 1 
ATOM   1569 C  CG2 . VAL A 1 207 ? 7.649   -32.334 -28.784 1.00 61.93  ? 208 VAL A CG2 1 
ATOM   1570 N  N   . SER A 1 208 ? 11.330  -30.811 -26.338 1.00 67.67  ? 209 SER A N   1 
ATOM   1571 C  CA  . SER A 1 208 ? 12.132  -30.480 -25.165 1.00 69.44  ? 209 SER A CA  1 
ATOM   1572 C  C   . SER A 1 208 ? 11.425  -29.508 -24.241 1.00 69.15  ? 209 SER A C   1 
ATOM   1573 O  O   . SER A 1 208 ? 10.771  -28.567 -24.695 1.00 68.51  ? 209 SER A O   1 
ATOM   1574 C  CB  . SER A 1 208 ? 13.474  -29.883 -25.582 1.00 70.24  ? 209 SER A CB  1 
ATOM   1575 O  OG  . SER A 1 208 ? 14.404  -30.902 -25.884 1.00 75.88  ? 209 SER A OG  1 
ATOM   1576 N  N   . VAL A 1 209 ? 11.563  -29.758 -22.943 1.00 71.04  ? 210 VAL A N   1 
ATOM   1577 C  CA  . VAL A 1 209 ? 11.211  -28.797 -21.906 1.00 70.24  ? 210 VAL A CA  1 
ATOM   1578 C  C   . VAL A 1 209 ? 12.528  -28.373 -21.250 1.00 72.05  ? 210 VAL A C   1 
ATOM   1579 O  O   . VAL A 1 209 ? 13.203  -29.181 -20.612 1.00 73.03  ? 210 VAL A O   1 
ATOM   1580 C  CB  . VAL A 1 209 ? 10.196  -29.389 -20.901 1.00 70.88  ? 210 VAL A CB  1 
ATOM   1581 C  CG1 . VAL A 1 209 ? 10.059  -28.518 -19.658 1.00 72.10  ? 210 VAL A CG1 1 
ATOM   1582 C  CG2 . VAL A 1 209 ? 8.839   -29.564 -21.565 1.00 69.05  ? 210 VAL A CG2 1 
ATOM   1583 N  N   . GLY A 1 210 ? 12.894  -27.108 -21.444 1.00 72.30  ? 211 GLY A N   1 
ATOM   1584 C  CA  . GLY A 1 210 ? 14.169  -26.578 -20.969 1.00 76.29  ? 211 GLY A CA  1 
ATOM   1585 C  C   . GLY A 1 210 ? 15.259  -26.700 -22.019 1.00 78.19  ? 211 GLY A C   1 
ATOM   1586 O  O   . GLY A 1 210 ? 15.461  -27.768 -22.598 1.00 78.99  ? 211 GLY A O   1 
ATOM   1587 N  N   . THR A 1 213 ? 15.523  -33.716 -23.369 1.00 95.27  ? 214 THR A N   1 
ATOM   1588 C  CA  . THR A 1 213 ? 14.425  -34.051 -24.268 1.00 96.08  ? 214 THR A CA  1 
ATOM   1589 C  C   . THR A 1 213 ? 13.460  -35.028 -23.574 1.00 96.22  ? 214 THR A C   1 
ATOM   1590 O  O   . THR A 1 213 ? 13.642  -36.253 -23.613 1.00 98.39  ? 214 THR A O   1 
ATOM   1591 C  CB  . THR A 1 213 ? 14.941  -34.588 -25.632 1.00 97.78  ? 214 THR A CB  1 
ATOM   1592 O  OG1 . THR A 1 213 ? 15.937  -33.697 -26.156 1.00 97.02  ? 214 THR A OG1 1 
ATOM   1593 C  CG2 . THR A 1 213 ? 13.800  -34.721 -26.656 1.00 95.24  ? 214 THR A CG2 1 
ATOM   1594 N  N   . LEU A 1 214 ? 12.438  -34.455 -22.937 1.00 92.97  ? 215 LEU A N   1 
ATOM   1595 C  CA  . LEU A 1 214 ? 11.474  -35.209 -22.130 1.00 91.31  ? 215 LEU A CA  1 
ATOM   1596 C  C   . LEU A 1 214 ? 10.494  -36.051 -22.952 1.00 88.30  ? 215 LEU A C   1 
ATOM   1597 O  O   . LEU A 1 214 ? 10.109  -37.137 -22.520 1.00 89.31  ? 215 LEU A O   1 
ATOM   1598 C  CB  . LEU A 1 214 ? 10.708  -34.269 -21.188 1.00 89.87  ? 215 LEU A CB  1 
ATOM   1599 N  N   . LEU A 1 215 ? 10.102  -35.555 -24.127 1.00 84.77  ? 216 LEU A N   1 
ATOM   1600 C  CA  . LEU A 1 215 ? 9.026   -36.169 -24.925 1.00 81.72  ? 216 LEU A CA  1 
ATOM   1601 C  C   . LEU A 1 215 ? 9.390   -36.435 -26.385 1.00 80.57  ? 216 LEU A C   1 
ATOM   1602 O  O   . LEU A 1 215 ? 10.343  -35.847 -26.905 1.00 78.59  ? 216 LEU A O   1 
ATOM   1603 C  CB  . LEU A 1 215 ? 7.763   -35.311 -24.848 1.00 79.61  ? 216 LEU A CB  1 
ATOM   1604 C  CG  . LEU A 1 215 ? 7.017   -35.316 -23.513 1.00 80.69  ? 216 LEU A CG  1 
ATOM   1605 C  CD1 . LEU A 1 215 ? 6.445   -33.939 -23.237 1.00 79.39  ? 216 LEU A CD1 1 
ATOM   1606 C  CD2 . LEU A 1 215 ? 5.923   -36.373 -23.495 1.00 83.85  ? 216 LEU A CD2 1 
ATOM   1607 N  N   . CYS A 1 216 ? 8.625   -37.329 -27.024 1.00 82.31  ? 217 CYS A N   1 
ATOM   1608 C  CA  . CYS A 1 216 ? 8.781   -37.696 -28.445 1.00 84.55  ? 217 CYS A CA  1 
ATOM   1609 C  C   . CYS A 1 216 ? 10.230  -38.097 -28.819 1.00 87.79  ? 217 CYS A C   1 
ATOM   1610 O  O   . CYS A 1 216 ? 10.735  -37.750 -29.890 1.00 87.62  ? 217 CYS A O   1 
ATOM   1611 C  CB  . CYS A 1 216 ? 8.228   -36.562 -29.330 1.00 83.97  ? 217 CYS A CB  1 
ATOM   1612 S  SG  . CYS A 1 216 ? 8.359   -36.754 -31.125 1.00 86.19  ? 217 CYS A SG  1 
ATOM   1613 N  N   . GLU A 1 217 ? 10.888  -38.842 -27.931 1.00 91.32  ? 218 GLU A N   1 
ATOM   1614 C  CA  . GLU A 1 217 ? 12.328  -39.130 -28.074 1.00 95.18  ? 218 GLU A CA  1 
ATOM   1615 C  C   . GLU A 1 217 ? 12.680  -40.217 -29.100 1.00 96.62  ? 218 GLU A C   1 
ATOM   1616 O  O   . GLU A 1 217 ? 13.849  -40.383 -29.459 1.00 95.59  ? 218 GLU A O   1 
ATOM   1617 C  CB  . GLU A 1 217 ? 12.992  -39.385 -26.711 1.00 98.83  ? 218 GLU A CB  1 
ATOM   1618 C  CG  . GLU A 1 217 ? 12.245  -40.327 -25.774 1.00 102.80 ? 218 GLU A CG  1 
ATOM   1619 C  CD  . GLU A 1 217 ? 12.557  -40.067 -24.308 1.00 104.87 ? 218 GLU A CD  1 
ATOM   1620 O  OE1 . GLU A 1 217 ? 13.750  -40.068 -23.925 1.00 104.87 ? 218 GLU A OE1 1 
ATOM   1621 O  OE2 . GLU A 1 217 ? 11.597  -39.866 -23.533 1.00 105.22 ? 218 GLU A OE2 1 
ATOM   1622 N  N   . ASP A 1 218 ? 11.661  -40.932 -29.574 1.00 98.04  ? 219 ASP A N   1 
ATOM   1623 C  CA  . ASP A 1 218 ? 11.809  -41.920 -30.648 1.00 101.42 ? 219 ASP A CA  1 
ATOM   1624 C  C   . ASP A 1 218 ? 11.299  -41.395 -31.994 1.00 98.30  ? 219 ASP A C   1 
ATOM   1625 O  O   . ASP A 1 218 ? 11.454  -42.055 -33.027 1.00 100.52 ? 219 ASP A O   1 
ATOM   1626 C  CB  . ASP A 1 218 ? 11.097  -43.231 -30.277 1.00 103.45 ? 219 ASP A CB  1 
ATOM   1627 C  CG  . ASP A 1 218 ? 11.896  -44.087 -29.301 1.00 107.05 ? 219 ASP A CG  1 
ATOM   1628 O  OD1 . ASP A 1 218 ? 12.992  -43.675 -28.863 1.00 106.69 ? 219 ASP A OD1 1 
ATOM   1629 O  OD2 . ASP A 1 218 ? 11.419  -45.191 -28.971 1.00 111.11 ? 219 ASP A OD2 1 
ATOM   1630 N  N   . GLY A 1 219 ? 10.709  -40.202 -31.973 1.00 93.21  ? 220 GLY A N   1 
ATOM   1631 C  CA  . GLY A 1 219 ? 10.068  -39.626 -33.146 1.00 88.56  ? 220 GLY A CA  1 
ATOM   1632 C  C   . GLY A 1 219 ? 8.560   -39.719 -33.037 1.00 86.50  ? 220 GLY A C   1 
ATOM   1633 O  O   . GLY A 1 219 ? 8.024   -40.686 -32.489 1.00 89.20  ? 220 GLY A O   1 
ATOM   1634 N  N   . CYS A 1 220 ? 7.880   -38.700 -33.552 1.00 82.52  ? 221 CYS A N   1 
ATOM   1635 C  CA  . CYS A 1 220 ? 6.421   -38.641 -33.547 1.00 80.84  ? 221 CYS A CA  1 
ATOM   1636 C  C   . CYS A 1 220 ? 5.927   -37.779 -34.703 1.00 77.59  ? 221 CYS A C   1 
ATOM   1637 O  O   . CYS A 1 220 ? 6.727   -37.286 -35.507 1.00 78.04  ? 221 CYS A O   1 
ATOM   1638 C  CB  . CYS A 1 220 ? 5.894   -38.116 -32.203 1.00 81.72  ? 221 CYS A CB  1 
ATOM   1639 S  SG  . CYS A 1 220 ? 6.460   -36.457 -31.778 1.00 83.09  ? 221 CYS A SG  1 
ATOM   1640 N  N   . LEU A 1 221 ? 4.611   -37.607 -34.784 1.00 73.09  ? 222 LEU A N   1 
ATOM   1641 C  CA  . LEU A 1 221 ? 4.007   -36.843 -35.865 1.00 69.93  ? 222 LEU A CA  1 
ATOM   1642 C  C   . LEU A 1 221 ? 3.596   -35.437 -35.430 1.00 65.94  ? 222 LEU A C   1 
ATOM   1643 O  O   . LEU A 1 221 ? 3.181   -35.217 -34.288 1.00 65.38  ? 222 LEU A O   1 
ATOM   1644 C  CB  . LEU A 1 221 ? 2.820   -37.608 -36.472 1.00 69.45  ? 222 LEU A CB  1 
ATOM   1645 C  CG  . LEU A 1 221 ? 3.078   -39.024 -37.010 1.00 71.50  ? 222 LEU A CG  1 
ATOM   1646 C  CD1 . LEU A 1 221 ? 1.780   -39.664 -37.476 1.00 70.40  ? 222 LEU A CD1 1 
ATOM   1647 C  CD2 . LEU A 1 221 ? 4.112   -39.038 -38.129 1.00 72.62  ? 222 LEU A CD2 1 
ATOM   1648 N  N   . ALA A 1 222 ? 3.731   -34.493 -36.356 1.00 62.40  ? 223 ALA A N   1 
ATOM   1649 C  CA  . ALA A 1 222 ? 3.319   -33.121 -36.137 1.00 58.70  ? 223 ALA A CA  1 
ATOM   1650 C  C   . ALA A 1 222 ? 2.454   -32.625 -37.294 1.00 56.78  ? 223 ALA A C   1 
ATOM   1651 O  O   . ALA A 1 222 ? 2.921   -32.468 -38.426 1.00 56.03  ? 223 ALA A O   1 
ATOM   1652 C  CB  . ALA A 1 222 ? 4.535   -32.226 -35.929 1.00 59.21  ? 223 ALA A CB  1 
ATOM   1653 N  N   . LEU A 1 223 ? 1.181   -32.400 -36.995 1.00 55.77  ? 224 LEU A N   1 
ATOM   1654 C  CA  . LEU A 1 223 ? 0.252   -31.822 -37.941 1.00 55.91  ? 224 LEU A CA  1 
ATOM   1655 C  C   . LEU A 1 223 ? 0.391   -30.307 -37.887 1.00 55.19  ? 224 LEU A C   1 
ATOM   1656 O  O   . LEU A 1 223 ? 0.210   -29.705 -36.828 1.00 56.00  ? 224 LEU A O   1 
ATOM   1657 C  CB  . LEU A 1 223 ? -1.179  -32.261 -37.614 1.00 55.66  ? 224 LEU A CB  1 
ATOM   1658 C  CG  . LEU A 1 223 ? -2.300  -31.872 -38.584 1.00 56.24  ? 224 LEU A CG  1 
ATOM   1659 C  CD1 . LEU A 1 223 ? -2.143  -32.563 -39.935 1.00 56.95  ? 224 LEU A CD1 1 
ATOM   1660 C  CD2 . LEU A 1 223 ? -3.651  -32.205 -37.966 1.00 55.45  ? 224 LEU A CD2 1 
ATOM   1661 N  N   . VAL A 1 224 ? 0.740   -29.695 -39.017 1.00 54.51  ? 225 VAL A N   1 
ATOM   1662 C  CA  . VAL A 1 224 ? 0.875   -28.239 -39.077 1.00 52.61  ? 225 VAL A CA  1 
ATOM   1663 C  C   . VAL A 1 224 ? -0.490  -27.655 -39.425 1.00 51.99  ? 225 VAL A C   1 
ATOM   1664 O  O   . VAL A 1 224 ? -0.873  -27.581 -40.597 1.00 52.94  ? 225 VAL A O   1 
ATOM   1665 C  CB  . VAL A 1 224 ? 2.004   -27.776 -40.027 1.00 52.97  ? 225 VAL A CB  1 
ATOM   1666 C  CG1 . VAL A 1 224 ? 2.141   -26.253 -39.992 1.00 50.83  ? 225 VAL A CG1 1 
ATOM   1667 C  CG2 . VAL A 1 224 ? 3.329   -28.436 -39.644 1.00 52.26  ? 225 VAL A CG2 1 
ATOM   1668 N  N   . ASP A 1 225 ? -1.206  -27.246 -38.378 1.00 51.55  ? 226 ASP A N   1 
ATOM   1669 C  CA  . ASP A 1 225 ? -2.652  -27.006 -38.426 1.00 51.95  ? 226 ASP A CA  1 
ATOM   1670 C  C   . ASP A 1 225 ? -3.013  -25.531 -38.218 1.00 49.76  ? 226 ASP A C   1 
ATOM   1671 O  O   . ASP A 1 225 ? -3.121  -25.054 -37.085 1.00 48.45  ? 226 ASP A O   1 
ATOM   1672 C  CB  . ASP A 1 225 ? -3.347  -27.900 -37.380 1.00 53.36  ? 226 ASP A CB  1 
ATOM   1673 C  CG  . ASP A 1 225 ? -4.852  -28.008 -37.574 1.00 54.74  ? 226 ASP A CG  1 
ATOM   1674 O  OD1 . ASP A 1 225 ? -5.450  -27.197 -38.308 1.00 56.69  ? 226 ASP A OD1 1 
ATOM   1675 O  OD2 . ASP A 1 225 ? -5.452  -28.925 -36.968 1.00 55.82  ? 226 ASP A OD2 1 
ATOM   1676 N  N   . THR A 1 226 ? -3.233  -24.827 -39.324 1.00 47.93  ? 227 THR A N   1 
ATOM   1677 C  CA  . THR A 1 226 ? -3.591  -23.403 -39.291 1.00 46.91  ? 227 THR A CA  1 
ATOM   1678 C  C   . THR A 1 226 ? -4.959  -23.116 -38.652 1.00 45.99  ? 227 THR A C   1 
ATOM   1679 O  O   . THR A 1 226 ? -5.243  -21.971 -38.277 1.00 46.88  ? 227 THR A O   1 
ATOM   1680 C  CB  . THR A 1 226 ? -3.534  -22.761 -40.689 1.00 46.06  ? 227 THR A CB  1 
ATOM   1681 O  OG1 . THR A 1 226 ? -4.408  -23.465 -41.582 1.00 47.79  ? 227 THR A OG1 1 
ATOM   1682 C  CG2 . THR A 1 226 ? -2.124  -22.778 -41.227 1.00 45.49  ? 227 THR A CG2 1 
ATOM   1683 N  N   . GLY A 1 227 ? -5.781  -24.161 -38.526 1.00 44.34  ? 228 GLY A N   1 
ATOM   1684 C  CA  . GLY A 1 227 ? -7.106  -24.088 -37.907 1.00 42.47  ? 228 GLY A CA  1 
ATOM   1685 C  C   . GLY A 1 227 ? -7.153  -24.491 -36.438 1.00 44.24  ? 228 GLY A C   1 
ATOM   1686 O  O   . GLY A 1 227 ? -8.191  -24.327 -35.785 1.00 43.27  ? 228 GLY A O   1 
ATOM   1687 N  N   . ALA A 1 228 ? -6.047  -25.036 -35.922 1.00 43.87  ? 229 ALA A N   1 
ATOM   1688 C  CA  . ALA A 1 228 ? -5.888  -25.281 -34.483 1.00 44.14  ? 229 ALA A CA  1 
ATOM   1689 C  C   . ALA A 1 228 ? -5.388  -24.003 -33.795 1.00 45.58  ? 229 ALA A C   1 
ATOM   1690 O  O   . ALA A 1 228 ? -4.461  -23.340 -34.285 1.00 46.51  ? 229 ALA A O   1 
ATOM   1691 C  CB  . ALA A 1 228 ? -4.930  -26.433 -34.236 1.00 43.77  ? 229 ALA A CB  1 
ATOM   1692 N  N   . SER A 1 229 ? -6.017  -23.644 -32.677 1.00 45.67  ? 230 SER A N   1 
ATOM   1693 C  CA  . SER A 1 229 ? -5.609  -22.466 -31.907 1.00 45.09  ? 230 SER A CA  1 
ATOM   1694 C  C   . SER A 1 229 ? -4.302  -22.693 -31.173 1.00 47.75  ? 230 SER A C   1 
ATOM   1695 O  O   . SER A 1 229 ? -3.501  -21.770 -31.000 1.00 51.00  ? 230 SER A O   1 
ATOM   1696 C  CB  . SER A 1 229 ? -6.675  -22.085 -30.893 1.00 42.68  ? 230 SER A CB  1 
ATOM   1697 O  OG  . SER A 1 229 ? -7.832  -21.636 -31.546 1.00 43.94  ? 230 SER A OG  1 
ATOM   1698 N  N   . TYR A 1 230 ? -4.094  -23.929 -30.744 1.00 48.86  ? 231 TYR A N   1 
ATOM   1699 C  CA  . TYR A 1 230 ? -3.040  -24.238 -29.807 1.00 51.56  ? 231 TYR A CA  1 
ATOM   1700 C  C   . TYR A 1 230 ? -2.035  -25.211 -30.410 1.00 51.60  ? 231 TYR A C   1 
ATOM   1701 O  O   . TYR A 1 230 ? -2.178  -25.657 -31.557 1.00 49.74  ? 231 TYR A O   1 
ATOM   1702 C  CB  . TYR A 1 230 ? -3.659  -24.778 -28.509 1.00 54.39  ? 231 TYR A CB  1 
ATOM   1703 C  CG  . TYR A 1 230 ? -4.830  -23.948 -28.013 1.00 58.69  ? 231 TYR A CG  1 
ATOM   1704 C  CD1 . TYR A 1 230 ? -4.634  -22.659 -27.478 1.00 59.36  ? 231 TYR A CD1 1 
ATOM   1705 C  CD2 . TYR A 1 230 ? -6.143  -24.438 -28.099 1.00 62.87  ? 231 TYR A CD2 1 
ATOM   1706 C  CE1 . TYR A 1 230 ? -5.705  -21.891 -27.033 1.00 61.46  ? 231 TYR A CE1 1 
ATOM   1707 C  CE2 . TYR A 1 230 ? -7.227  -23.681 -27.651 1.00 65.63  ? 231 TYR A CE2 1 
ATOM   1708 C  CZ  . TYR A 1 230 ? -7.005  -22.409 -27.124 1.00 67.10  ? 231 TYR A CZ  1 
ATOM   1709 O  OH  . TYR A 1 230 ? -8.084  -21.665 -26.693 1.00 69.65  ? 231 TYR A OH  1 
ATOM   1710 N  N   . ILE A 1 231 ? -0.988  -25.483 -29.645 1.00 52.36  ? 232 ILE A N   1 
ATOM   1711 C  CA  . ILE A 1 231 ? -0.164  -26.651 -29.864 1.00 53.60  ? 232 ILE A CA  1 
ATOM   1712 C  C   . ILE A 1 231 ? -0.851  -27.740 -29.064 1.00 55.58  ? 232 ILE A C   1 
ATOM   1713 O  O   . ILE A 1 231 ? -1.154  -27.551 -27.889 1.00 59.56  ? 232 ILE A O   1 
ATOM   1714 C  CB  . ILE A 1 231 ? 1.294   -26.421 -29.416 1.00 53.25  ? 232 ILE A CB  1 
ATOM   1715 C  CG1 . ILE A 1 231 ? 2.020   -25.589 -30.474 1.00 51.14  ? 232 ILE A CG1 1 
ATOM   1716 C  CG2 . ILE A 1 231 ? 2.017   -27.746 -29.180 1.00 55.30  ? 232 ILE A CG2 1 
ATOM   1717 C  CD1 . ILE A 1 231 ? 3.220   -24.833 -29.955 1.00 52.95  ? 232 ILE A CD1 1 
ATOM   1718 N  N   . SER A 1 232 ? -1.148  -28.855 -29.714 1.00 56.32  ? 233 SER A N   1 
ATOM   1719 C  CA  . SER A 1 232 ? -1.691  -30.004 -29.005 1.00 57.16  ? 233 SER A CA  1 
ATOM   1720 C  C   . SER A 1 232 ? -0.806  -31.229 -29.173 1.00 58.19  ? 233 SER A C   1 
ATOM   1721 O  O   . SER A 1 232 ? -0.139  -31.383 -30.191 1.00 59.56  ? 233 SER A O   1 
ATOM   1722 C  CB  . SER A 1 232 ? -3.131  -30.293 -29.433 1.00 56.53  ? 233 SER A CB  1 
ATOM   1723 O  OG  . SER A 1 232 ? -3.227  -30.461 -30.831 1.00 56.71  ? 233 SER A OG  1 
ATOM   1724 N  N   . GLY A 1 233 ? -0.775  -32.062 -28.139 1.00 57.77  ? 234 GLY A N   1 
ATOM   1725 C  CA  . GLY A 1 233 ? -0.203  -33.396 -28.214 1.00 58.21  ? 234 GLY A CA  1 
ATOM   1726 C  C   . GLY A 1 233 ? -1.244  -34.379 -27.726 1.00 60.33  ? 234 GLY A C   1 
ATOM   1727 O  O   . GLY A 1 233 ? -2.367  -33.986 -27.383 1.00 59.44  ? 234 GLY A O   1 
ATOM   1728 N  N   . SER A 1 234 ? -0.876  -35.658 -27.706 1.00 63.14  ? 235 SER A N   1 
ATOM   1729 C  CA  . SER A 1 234 ? -1.692  -36.707 -27.092 1.00 65.07  ? 235 SER A CA  1 
ATOM   1730 C  C   . SER A 1 234 ? -1.846  -36.466 -25.582 1.00 67.20  ? 235 SER A C   1 
ATOM   1731 O  O   . SER A 1 234 ? -1.018  -35.765 -24.972 1.00 66.76  ? 235 SER A O   1 
ATOM   1732 C  CB  . SER A 1 234 ? -1.072  -38.081 -27.353 1.00 66.28  ? 235 SER A CB  1 
ATOM   1733 O  OG  . SER A 1 234 ? 0.154   -38.225 -26.657 1.00 67.56  ? 235 SER A OG  1 
ATOM   1734 N  N   . THR A 1 235 ? -2.899  -37.045 -24.996 1.00 68.52  ? 236 THR A N   1 
ATOM   1735 C  CA  . THR A 1 235 ? -3.238  -36.846 -23.577 1.00 69.81  ? 236 THR A CA  1 
ATOM   1736 C  C   . THR A 1 235 ? -2.049  -37.124 -22.660 1.00 72.28  ? 236 THR A C   1 
ATOM   1737 O  O   . THR A 1 235 ? -1.673  -36.257 -21.865 1.00 72.95  ? 236 THR A O   1 
ATOM   1738 C  CB  . THR A 1 235 ? -4.503  -37.638 -23.151 1.00 70.56  ? 236 THR A CB  1 
ATOM   1739 O  OG1 . THR A 1 235 ? -5.652  -37.052 -23.770 1.00 68.10  ? 236 THR A OG1 1 
ATOM   1740 C  CG2 . THR A 1 235 ? -4.717  -37.605 -21.637 1.00 71.38  ? 236 THR A CG2 1 
ATOM   1741 N  N   . SER A 1 236 ? -1.448  -38.304 -22.799 1.00 74.88  ? 237 SER A N   1 
ATOM   1742 C  CA  . SER A 1 236 ? -0.304  -38.678 -21.965 1.00 79.34  ? 237 SER A CA  1 
ATOM   1743 C  C   . SER A 1 236 ? 0.936   -37.815 -22.233 1.00 77.14  ? 237 SER A C   1 
ATOM   1744 O  O   . SER A 1 236 ? 1.693   -37.531 -21.304 1.00 78.16  ? 237 SER A O   1 
ATOM   1745 C  CB  . SER A 1 236 ? 0.011   -40.177 -22.066 1.00 82.44  ? 237 SER A CB  1 
ATOM   1746 O  OG  . SER A 1 236 ? 0.293   -40.556 -23.399 1.00 84.69  ? 237 SER A OG  1 
ATOM   1747 N  N   . SER A 1 237 ? 1.120   -37.384 -23.484 1.00 75.11  ? 238 SER A N   1 
ATOM   1748 C  CA  . SER A 1 237 ? 2.207   -36.460 -23.842 1.00 75.07  ? 238 SER A CA  1 
ATOM   1749 C  C   . SER A 1 237 ? 2.070   -35.094 -23.171 1.00 72.87  ? 238 SER A C   1 
ATOM   1750 O  O   . SER A 1 237 ? 3.060   -34.538 -22.682 1.00 73.21  ? 238 SER A O   1 
ATOM   1751 C  CB  . SER A 1 237 ? 2.330   -36.287 -25.359 1.00 74.51  ? 238 SER A CB  1 
ATOM   1752 O  OG  . SER A 1 237 ? 3.363   -37.106 -25.874 1.00 78.45  ? 238 SER A OG  1 
ATOM   1753 N  N   . ILE A 1 238 ? 0.843   -34.573 -23.152 1.00 69.89  ? 239 ILE A N   1 
ATOM   1754 C  CA  . ILE A 1 238 ? 0.539   -33.284 -22.534 1.00 67.33  ? 239 ILE A CA  1 
ATOM   1755 C  C   . ILE A 1 238 ? 0.589   -33.384 -21.004 1.00 70.25  ? 239 ILE A C   1 
ATOM   1756 O  O   . ILE A 1 238 ? 1.228   -32.553 -20.361 1.00 70.29  ? 239 ILE A O   1 
ATOM   1757 C  CB  . ILE A 1 238 ? -0.765  -32.658 -23.116 1.00 64.78  ? 239 ILE A CB  1 
ATOM   1758 C  CG1 . ILE A 1 238 ? -0.587  -32.322 -24.608 1.00 62.36  ? 239 ILE A CG1 1 
ATOM   1759 C  CG2 . ILE A 1 238 ? -1.209  -31.406 -22.373 1.00 62.69  ? 239 ILE A CG2 1 
ATOM   1760 C  CD1 . ILE A 1 238 ? 0.667   -31.545 -24.985 1.00 60.01  ? 239 ILE A CD1 1 
ATOM   1761 N  N   . GLU A 1 239 ? -0.027  -34.424 -20.439 1.00 73.06  ? 240 GLU A N   1 
ATOM   1762 C  CA  . GLU A 1 239 ? 0.093   -34.735 -19.002 1.00 76.40  ? 240 GLU A CA  1 
ATOM   1763 C  C   . GLU A 1 239 ? 1.535   -34.695 -18.481 1.00 75.48  ? 240 GLU A C   1 
ATOM   1764 O  O   . GLU A 1 239 ? 1.784   -34.164 -17.393 1.00 75.66  ? 240 GLU A O   1 
ATOM   1765 C  CB  . GLU A 1 239 ? -0.536  -36.095 -18.678 1.00 81.82  ? 240 GLU A CB  1 
ATOM   1766 C  CG  . GLU A 1 239 ? -2.044  -36.061 -18.454 1.00 83.81  ? 240 GLU A CG  1 
ATOM   1767 C  CD  . GLU A 1 239 ? -2.664  -37.441 -18.266 1.00 89.08  ? 240 GLU A CD  1 
ATOM   1768 O  OE1 . GLU A 1 239 ? -3.891  -37.560 -18.478 1.00 90.24  ? 240 GLU A OE1 1 
ATOM   1769 O  OE2 . GLU A 1 239 ? -1.945  -38.403 -17.903 1.00 91.57  ? 240 GLU A OE2 1 
ATOM   1770 N  N   . LYS A 1 240 ? 2.464   -35.249 -19.266 1.00 74.35  ? 241 LYS A N   1 
ATOM   1771 C  CA  . LYS A 1 240 ? 3.895   -35.267 -18.927 1.00 75.30  ? 241 LYS A CA  1 
ATOM   1772 C  C   . LYS A 1 240 ? 4.555   -33.906 -19.148 1.00 72.75  ? 241 LYS A C   1 
ATOM   1773 O  O   . LYS A 1 240 ? 5.393   -33.485 -18.341 1.00 73.44  ? 241 LYS A O   1 
ATOM   1774 C  CB  . LYS A 1 240 ? 4.639   -36.363 -19.703 1.00 75.73  ? 241 LYS A CB  1 
ATOM   1775 N  N   . LEU A 1 241 ? 4.176   -33.234 -20.239 1.00 70.28  ? 242 LEU A N   1 
ATOM   1776 C  CA  . LEU A 1 241 ? 4.612   -31.861 -20.526 1.00 68.62  ? 242 LEU A CA  1 
ATOM   1777 C  C   . LEU A 1 241 ? 4.221   -30.918 -19.388 1.00 68.49  ? 242 LEU A C   1 
ATOM   1778 O  O   . LEU A 1 241 ? 5.045   -30.142 -18.914 1.00 70.29  ? 242 LEU A O   1 
ATOM   1779 C  CB  . LEU A 1 241 ? 4.023   -31.362 -21.853 1.00 66.64  ? 242 LEU A CB  1 
ATOM   1780 C  CG  . LEU A 1 241 ? 4.564   -30.046 -22.426 1.00 65.93  ? 242 LEU A CG  1 
ATOM   1781 C  CD1 . LEU A 1 241 ? 5.670   -30.303 -23.432 1.00 67.77  ? 242 LEU A CD1 1 
ATOM   1782 C  CD2 . LEU A 1 241 ? 3.458   -29.249 -23.088 1.00 62.99  ? 242 LEU A CD2 1 
ATOM   1783 N  N   . MET A 1 242 ? 2.972   -31.031 -18.942 1.00 68.77  ? 243 MET A N   1 
ATOM   1784 C  CA  . MET A 1 242 ? 2.387   -30.149 -17.930 1.00 68.26  ? 243 MET A CA  1 
ATOM   1785 C  C   . MET A 1 242 ? 2.907   -30.388 -16.513 1.00 71.45  ? 243 MET A C   1 
ATOM   1786 O  O   . MET A 1 242 ? 3.085   -29.434 -15.739 1.00 70.87  ? 243 MET A O   1 
ATOM   1787 C  CB  . MET A 1 242 ? 0.862   -30.234 -17.978 1.00 66.30  ? 243 MET A CB  1 
ATOM   1788 C  CG  . MET A 1 242 ? 0.279   -29.785 -19.311 1.00 63.79  ? 243 MET A CG  1 
ATOM   1789 S  SD  . MET A 1 242 ? 0.636   -28.063 -19.679 1.00 61.93  ? 243 MET A SD  1 
ATOM   1790 C  CE  . MET A 1 242 ? -0.210  -27.813 -21.230 1.00 62.25  ? 243 MET A CE  1 
ATOM   1791 N  N   . GLU A 1 243 ? 3.148   -31.658 -16.186 1.00 74.49  ? 244 GLU A N   1 
ATOM   1792 C  CA  . GLU A 1 243 ? 3.826   -32.046 -14.952 1.00 78.15  ? 244 GLU A CA  1 
ATOM   1793 C  C   . GLU A 1 243 ? 5.160   -31.302 -14.812 1.00 77.12  ? 244 GLU A C   1 
ATOM   1794 O  O   . GLU A 1 243 ? 5.444   -30.751 -13.747 1.00 78.33  ? 244 GLU A O   1 
ATOM   1795 C  CB  . GLU A 1 243 ? 4.038   -33.561 -14.915 1.00 82.81  ? 244 GLU A CB  1 
ATOM   1796 C  CG  . GLU A 1 243 ? 4.487   -34.105 -13.564 1.00 88.67  ? 244 GLU A CG  1 
ATOM   1797 C  CD  . GLU A 1 243 ? 4.571   -35.621 -13.530 1.00 93.40  ? 244 GLU A CD  1 
ATOM   1798 O  OE1 . GLU A 1 243 ? 3.686   -36.292 -14.109 1.00 94.83  ? 244 GLU A OE1 1 
ATOM   1799 O  OE2 . GLU A 1 243 ? 5.521   -36.148 -12.910 1.00 96.45  ? 244 GLU A OE2 1 
ATOM   1800 N  N   . ALA A 1 244 ? 5.940   -31.268 -15.899 1.00 75.54  ? 245 ALA A N   1 
ATOM   1801 C  CA  . ALA A 1 244 ? 7.239   -30.576 -15.954 1.00 75.92  ? 245 ALA A CA  1 
ATOM   1802 C  C   . ALA A 1 244 ? 7.136   -29.050 -15.821 1.00 75.62  ? 245 ALA A C   1 
ATOM   1803 O  O   . ALA A 1 244 ? 8.066   -28.407 -15.316 1.00 76.70  ? 245 ALA A O   1 
ATOM   1804 C  CB  . ALA A 1 244 ? 7.989   -30.949 -17.228 1.00 73.88  ? 245 ALA A CB  1 
ATOM   1805 N  N   . LEU A 1 245 ? 6.017   -28.485 -16.284 1.00 73.18  ? 246 LEU A N   1 
ATOM   1806 C  CA  . LEU A 1 245 ? 5.744   -27.047 -16.176 1.00 69.70  ? 246 LEU A CA  1 
ATOM   1807 C  C   . LEU A 1 245 ? 5.138   -26.637 -14.824 1.00 70.29  ? 246 LEU A C   1 
ATOM   1808 O  O   . LEU A 1 245 ? 5.096   -25.448 -14.499 1.00 70.53  ? 246 LEU A O   1 
ATOM   1809 C  CB  . LEU A 1 245 ? 4.829   -26.581 -17.318 1.00 66.93  ? 246 LEU A CB  1 
ATOM   1810 C  CG  . LEU A 1 245 ? 5.184   -26.838 -18.789 1.00 65.87  ? 246 LEU A CG  1 
ATOM   1811 C  CD1 . LEU A 1 245 ? 4.048   -26.354 -19.671 1.00 63.28  ? 246 LEU A CD1 1 
ATOM   1812 C  CD2 . LEU A 1 245 ? 6.498   -26.196 -19.220 1.00 66.67  ? 246 LEU A CD2 1 
ATOM   1813 N  N   . GLY A 1 246 ? 4.677   -27.617 -14.045 1.00 71.16  ? 247 GLY A N   1 
ATOM   1814 C  CA  . GLY A 1 246 ? 3.962   -27.358 -12.792 1.00 71.25  ? 247 GLY A CA  1 
ATOM   1815 C  C   . GLY A 1 246 ? 2.563   -26.811 -13.031 1.00 70.43  ? 247 GLY A C   1 
ATOM   1816 O  O   . GLY A 1 246 ? 2.031   -26.061 -12.208 1.00 70.49  ? 247 GLY A O   1 
ATOM   1817 N  N   . ALA A 1 247 ? 1.974   -27.195 -14.164 1.00 68.28  ? 248 ALA A N   1 
ATOM   1818 C  CA  . ALA A 1 247 ? 0.640   -26.757 -14.558 1.00 68.26  ? 248 ALA A CA  1 
ATOM   1819 C  C   . ALA A 1 247 ? -0.428  -27.762 -14.129 1.00 70.52  ? 248 ALA A C   1 
ATOM   1820 O  O   . ALA A 1 247 ? -0.229  -28.977 -14.226 1.00 71.97  ? 248 ALA A O   1 
ATOM   1821 C  CB  . ALA A 1 247 ? 0.584   -26.516 -16.063 1.00 64.67  ? 248 ALA A CB  1 
ATOM   1822 N  N   . LYS A 1 248 ? -1.557  -27.240 -13.655 1.00 71.56  ? 249 LYS A N   1 
ATOM   1823 C  CA  . LYS A 1 248 ? -2.676  -28.066 -13.215 1.00 74.65  ? 249 LYS A CA  1 
ATOM   1824 C  C   . LYS A 1 248 ? -3.766  -28.152 -14.285 1.00 72.16  ? 249 LYS A C   1 
ATOM   1825 O  O   . LYS A 1 248 ? -4.006  -27.192 -15.028 1.00 69.13  ? 249 LYS A O   1 
ATOM   1826 C  CB  . LYS A 1 248 ? -3.230  -27.579 -11.869 1.00 78.47  ? 249 LYS A CB  1 
ATOM   1827 C  CG  . LYS A 1 248 ? -2.332  -27.937 -10.683 1.00 84.50  ? 249 LYS A CG  1 
ATOM   1828 C  CD  . LYS A 1 248 ? -2.916  -27.518 -9.334  1.00 89.45  ? 249 LYS A CD  1 
ATOM   1829 C  CE  . LYS A 1 248 ? -3.803  -28.590 -8.702  1.00 91.24  ? 249 LYS A CE  1 
ATOM   1830 N  NZ  . LYS A 1 248 ? -5.149  -28.740 -9.330  1.00 89.45  ? 249 LYS A NZ  1 
ATOM   1831 N  N   . LYS A 1 249 ? -4.399  -29.323 -14.356 1.00 72.39  ? 250 LYS A N   1 
ATOM   1832 C  CA  . LYS A 1 249 ? -5.407  -29.631 -15.365 1.00 70.59  ? 250 LYS A CA  1 
ATOM   1833 C  C   . LYS A 1 249 ? -6.759  -29.083 -14.968 1.00 69.63  ? 250 LYS A C   1 
ATOM   1834 O  O   . LYS A 1 249 ? -7.207  -29.260 -13.832 1.00 71.76  ? 250 LYS A O   1 
ATOM   1835 C  CB  . LYS A 1 249 ? -5.506  -31.146 -15.585 1.00 73.60  ? 250 LYS A CB  1 
ATOM   1836 C  CG  . LYS A 1 249 ? -6.274  -31.552 -16.830 1.00 73.41  ? 250 LYS A CG  1 
ATOM   1837 C  CD  . LYS A 1 249 ? -6.358  -33.065 -16.963 1.00 77.59  ? 250 LYS A CD  1 
ATOM   1838 C  CE  . LYS A 1 249 ? -7.351  -33.473 -18.047 1.00 78.82  ? 250 LYS A CE  1 
ATOM   1839 N  NZ  . LYS A 1 249 ? -8.774  -33.348 -17.617 1.00 78.67  ? 250 LYS A NZ  1 
ATOM   1840 N  N   . ARG A 1 250 ? -7.391  -28.401 -15.914 1.00 65.97  ? 251 ARG A N   1 
ATOM   1841 C  CA  . ARG A 1 250 ? -8.796  -28.048 -15.806 1.00 65.86  ? 251 ARG A CA  1 
ATOM   1842 C  C   . ARG A 1 250 ? -9.521  -28.791 -16.920 1.00 67.61  ? 251 ARG A C   1 
ATOM   1843 O  O   . ARG A 1 250 ? -8.892  -29.557 -17.664 1.00 68.53  ? 251 ARG A O   1 
ATOM   1844 C  CB  . ARG A 1 250 ? -8.998  -26.537 -15.884 1.00 62.91  ? 251 ARG A CB  1 
ATOM   1845 C  CG  . ARG A 1 250 ? -8.261  -25.751 -14.798 1.00 64.25  ? 251 ARG A CG  1 
ATOM   1846 C  CD  . ARG A 1 250 ? -8.776  -24.327 -14.625 1.00 63.17  ? 251 ARG A CD  1 
ATOM   1847 N  NE  . ARG A 1 250 ? -8.986  -23.639 -15.904 1.00 61.52  ? 251 ARG A NE  1 
ATOM   1848 C  CZ  . ARG A 1 250 ? -9.219  -22.336 -16.049 1.00 59.52  ? 251 ARG A CZ  1 
ATOM   1849 N  NH1 . ARG A 1 250 ? -9.405  -21.837 -17.262 1.00 54.73  ? 251 ARG A NH1 1 
ATOM   1850 N  NH2 . ARG A 1 250 ? -9.253  -21.529 -14.995 1.00 62.22  ? 251 ARG A NH2 1 
ATOM   1851 N  N   . LEU A 1 251 ? -10.833 -28.593 -17.023 1.00 69.24  ? 252 LEU A N   1 
ATOM   1852 C  CA  . LEU A 1 251 ? -11.660 -29.353 -17.959 1.00 69.64  ? 252 LEU A CA  1 
ATOM   1853 C  C   . LEU A 1 251 ? -11.245 -29.201 -19.429 1.00 69.10  ? 252 LEU A C   1 
ATOM   1854 O  O   . LEU A 1 251 ? -11.093 -30.196 -20.141 1.00 70.55  ? 252 LEU A O   1 
ATOM   1855 C  CB  . LEU A 1 251 ? -13.142 -29.015 -17.761 1.00 69.17  ? 252 LEU A CB  1 
ATOM   1856 C  CG  . LEU A 1 251 ? -14.219 -29.853 -18.466 1.00 69.52  ? 252 LEU A CG  1 
ATOM   1857 C  CD1 . LEU A 1 251 ? -14.024 -31.359 -18.312 1.00 68.68  ? 252 LEU A CD1 1 
ATOM   1858 C  CD2 . LEU A 1 251 ? -15.582 -29.428 -17.951 1.00 70.07  ? 252 LEU A CD2 1 
ATOM   1859 N  N   . PHE A 1 252 ? -11.034 -27.961 -19.860 1.00 68.23  ? 253 PHE A N   1 
ATOM   1860 C  CA  . PHE A 1 252 ? -10.720 -27.669 -21.259 1.00 64.91  ? 253 PHE A CA  1 
ATOM   1861 C  C   . PHE A 1 252 ? -9.283  -27.230 -21.505 1.00 62.38  ? 253 PHE A C   1 
ATOM   1862 O  O   . PHE A 1 252 ? -8.832  -27.205 -22.648 1.00 61.59  ? 253 PHE A O   1 
ATOM   1863 C  CB  . PHE A 1 252 ? -11.696 -26.630 -21.810 1.00 63.10  ? 253 PHE A CB  1 
ATOM   1864 C  CG  . PHE A 1 252 ? -13.128 -27.020 -21.652 1.00 66.39  ? 253 PHE A CG  1 
ATOM   1865 C  CD1 . PHE A 1 252 ? -13.663 -28.084 -22.389 1.00 67.70  ? 253 PHE A CD1 1 
ATOM   1866 C  CD2 . PHE A 1 252 ? -13.948 -26.337 -20.759 1.00 69.01  ? 253 PHE A CD2 1 
ATOM   1867 C  CE1 . PHE A 1 252 ? -14.991 -28.451 -22.244 1.00 68.27  ? 253 PHE A CE1 1 
ATOM   1868 C  CE2 . PHE A 1 252 ? -15.280 -26.700 -20.605 1.00 71.91  ? 253 PHE A CE2 1 
ATOM   1869 C  CZ  . PHE A 1 252 ? -15.801 -27.756 -21.352 1.00 72.32  ? 253 PHE A CZ  1 
ATOM   1870 N  N   . ASP A 1 253 ? -8.570  -26.884 -20.437 1.00 63.23  ? 254 ASP A N   1 
ATOM   1871 C  CA  . ASP A 1 253 ? -7.224  -26.327 -20.561 1.00 62.74  ? 254 ASP A CA  1 
ATOM   1872 C  C   . ASP A 1 253 ? -6.323  -26.687 -19.386 1.00 62.71  ? 254 ASP A C   1 
ATOM   1873 O  O   . ASP A 1 253 ? -6.777  -27.265 -18.397 1.00 64.79  ? 254 ASP A O   1 
ATOM   1874 C  CB  . ASP A 1 253 ? -7.280  -24.792 -20.765 1.00 61.37  ? 254 ASP A CB  1 
ATOM   1875 C  CG  . ASP A 1 253 ? -7.835  -24.026 -19.549 1.00 62.95  ? 254 ASP A CG  1 
ATOM   1876 O  OD1 . ASP A 1 253 ? -8.235  -24.627 -18.525 1.00 63.07  ? 254 ASP A OD1 1 
ATOM   1877 O  OD2 . ASP A 1 253 ? -7.870  -22.782 -19.627 1.00 63.34  ? 254 ASP A OD2 1 
ATOM   1878 N  N   . TYR A 1 254 ? -5.046  -26.350 -19.526 1.00 60.71  ? 255 TYR A N   1 
ATOM   1879 C  CA  . TYR A 1 254 ? -4.121  -26.334 -18.413 1.00 62.43  ? 255 TYR A CA  1 
ATOM   1880 C  C   . TYR A 1 254 ? -3.839  -24.897 -18.016 1.00 60.91  ? 255 TYR A C   1 
ATOM   1881 O  O   . TYR A 1 254 ? -3.773  -23.997 -18.865 1.00 56.74  ? 255 TYR A O   1 
ATOM   1882 C  CB  . TYR A 1 254 ? -2.831  -27.064 -18.770 1.00 64.21  ? 255 TYR A CB  1 
ATOM   1883 C  CG  . TYR A 1 254 ? -2.983  -28.563 -18.789 1.00 66.95  ? 255 TYR A CG  1 
ATOM   1884 C  CD1 . TYR A 1 254 ? -3.497  -29.224 -19.913 1.00 66.46  ? 255 TYR A CD1 1 
ATOM   1885 C  CD2 . TYR A 1 254 ? -2.625  -29.329 -17.675 1.00 69.70  ? 255 TYR A CD2 1 
ATOM   1886 C  CE1 . TYR A 1 254 ? -3.649  -30.607 -19.920 1.00 68.76  ? 255 TYR A CE1 1 
ATOM   1887 C  CE2 . TYR A 1 254 ? -2.754  -30.712 -17.682 1.00 72.19  ? 255 TYR A CE2 1 
ATOM   1888 C  CZ  . TYR A 1 254 ? -3.267  -31.343 -18.804 1.00 72.37  ? 255 TYR A CZ  1 
ATOM   1889 O  OH  . TYR A 1 254 ? -3.404  -32.710 -18.803 1.00 77.34  ? 255 TYR A OH  1 
ATOM   1890 N  N   . VAL A 1 255 ? -3.703  -24.695 -16.710 1.00 62.51  ? 256 VAL A N   1 
ATOM   1891 C  CA  . VAL A 1 255 ? -3.372  -23.391 -16.152 1.00 60.98  ? 256 VAL A CA  1 
ATOM   1892 C  C   . VAL A 1 255 ? -2.179  -23.474 -15.230 1.00 62.85  ? 256 VAL A C   1 
ATOM   1893 O  O   . VAL A 1 255 ? -1.937  -24.496 -14.579 1.00 64.87  ? 256 VAL A O   1 
ATOM   1894 C  CB  . VAL A 1 255 ? -4.540  -22.716 -15.375 1.00 60.67  ? 256 VAL A CB  1 
ATOM   1895 C  CG1 . VAL A 1 255 ? -5.606  -22.189 -16.330 1.00 57.73  ? 256 VAL A CG1 1 
ATOM   1896 C  CG2 . VAL A 1 255 ? -5.113  -23.629 -14.288 1.00 61.59  ? 256 VAL A CG2 1 
ATOM   1897 N  N   . VAL A 1 256 ? -1.449  -22.369 -15.190 1.00 61.55  ? 257 VAL A N   1 
ATOM   1898 C  CA  . VAL A 1 256 ? -0.423  -22.141 -14.206 1.00 62.21  ? 257 VAL A CA  1 
ATOM   1899 C  C   . VAL A 1 256 ? -0.844  -20.881 -13.431 1.00 62.33  ? 257 VAL A C   1 
ATOM   1900 O  O   . VAL A 1 256 ? -1.678  -20.112 -13.918 1.00 61.23  ? 257 VAL A O   1 
ATOM   1901 C  CB  . VAL A 1 256 ? 0.954   -22.057 -14.907 1.00 61.40  ? 257 VAL A CB  1 
ATOM   1902 C  CG1 . VAL A 1 256 ? 1.324   -20.631 -15.297 1.00 60.65  ? 257 VAL A CG1 1 
ATOM   1903 C  CG2 . VAL A 1 256 ? 2.018   -22.708 -14.049 1.00 66.25  ? 257 VAL A CG2 1 
ATOM   1904 N  N   . LYS A 1 257 ? -0.314  -20.691 -12.220 1.00 64.22  ? 258 LYS A N   1 
ATOM   1905 C  CA  . LYS A 1 257 ? -0.555  -19.453 -11.466 1.00 64.58  ? 258 LYS A CA  1 
ATOM   1906 C  C   . LYS A 1 257 ? 0.181   -18.319 -12.180 1.00 62.27  ? 258 LYS A C   1 
ATOM   1907 O  O   . LYS A 1 257 ? 1.357   -18.468 -12.520 1.00 62.20  ? 258 LYS A O   1 
ATOM   1908 C  CB  . LYS A 1 257 ? -0.107  -19.594 -10.006 1.00 66.99  ? 258 LYS A CB  1 
ATOM   1909 N  N   . CYS A 1 258 ? -0.516  -17.208 -12.424 1.00 62.00  ? 259 CYS A N   1 
ATOM   1910 C  CA  . CYS A 1 258 ? -0.036  -16.144 -13.334 1.00 61.31  ? 259 CYS A CA  1 
ATOM   1911 C  C   . CYS A 1 258 ? 1.368   -15.619 -13.034 1.00 62.95  ? 259 CYS A C   1 
ATOM   1912 O  O   . CYS A 1 258 ? 2.121   -15.306 -13.963 1.00 62.68  ? 259 CYS A O   1 
ATOM   1913 C  CB  . CYS A 1 258 ? -1.025  -14.986 -13.416 1.00 60.71  ? 259 CYS A CB  1 
ATOM   1914 S  SG  . CYS A 1 258 ? -2.568  -15.405 -14.238 1.00 61.38  ? 259 CYS A SG  1 
ATOM   1915 N  N   . ASN A 1 259 ? 1.706   -15.541 -11.747 1.00 64.30  ? 260 ASN A N   1 
ATOM   1916 C  CA  . ASN A 1 259 ? 3.022   -15.105 -11.298 1.00 66.27  ? 260 ASN A CA  1 
ATOM   1917 C  C   . ASN A 1 259 ? 4.171   -15.991 -11.792 1.00 67.78  ? 260 ASN A C   1 
ATOM   1918 O  O   . ASN A 1 259 ? 5.243   -15.484 -12.135 1.00 67.76  ? 260 ASN A O   1 
ATOM   1919 C  CB  . ASN A 1 259 ? 3.055   -14.968 -9.764  1.00 68.35  ? 260 ASN A CB  1 
ATOM   1920 C  CG  . ASN A 1 259 ? 2.947   -16.304 -9.041  1.00 68.76  ? 260 ASN A CG  1 
ATOM   1921 O  OD1 . ASN A 1 259 ? 2.061   -17.110 -9.311  1.00 68.82  ? 260 ASN A OD1 1 
ATOM   1922 N  ND2 . ASN A 1 259 ? 3.851   -16.537 -8.112  1.00 70.88  ? 260 ASN A ND2 1 
ATOM   1923 N  N   . GLU A 1 260 ? 3.945   -17.304 -11.836 1.00 70.17  ? 261 GLU A N   1 
ATOM   1924 C  CA  . GLU A 1 260 ? 5.009   -18.237 -12.206 1.00 73.21  ? 261 GLU A CA  1 
ATOM   1925 C  C   . GLU A 1 260 ? 5.096   -18.429 -13.724 1.00 70.86  ? 261 GLU A C   1 
ATOM   1926 O  O   . GLU A 1 260 ? 5.958   -19.160 -14.219 1.00 70.66  ? 261 GLU A O   1 
ATOM   1927 C  CB  . GLU A 1 260 ? 4.912   -19.561 -11.421 1.00 77.89  ? 261 GLU A CB  1 
ATOM   1928 C  CG  . GLU A 1 260 ? 3.702   -20.432 -11.725 1.00 82.36  ? 261 GLU A CG  1 
ATOM   1929 C  CD  . GLU A 1 260 ? 3.263   -21.319 -10.563 1.00 88.83  ? 261 GLU A CD  1 
ATOM   1930 O  OE1 . GLU A 1 260 ? 2.192   -21.960 -10.690 1.00 89.08  ? 261 GLU A OE1 1 
ATOM   1931 O  OE2 . GLU A 1 260 ? 3.969   -21.378 -9.526  1.00 91.76  ? 261 GLU A OE2 1 
ATOM   1932 N  N   . GLY A 1 261 ? 4.206   -17.740 -14.439 1.00 68.18  ? 262 GLY A N   1 
ATOM   1933 C  CA  . GLY A 1 261 ? 4.169   -17.714 -15.895 1.00 65.44  ? 262 GLY A CA  1 
ATOM   1934 C  C   . GLY A 1 261 ? 5.469   -17.366 -16.612 1.00 66.12  ? 262 GLY A C   1 
ATOM   1935 O  O   . GLY A 1 261 ? 5.916   -18.151 -17.444 1.00 67.82  ? 262 GLY A O   1 
ATOM   1936 N  N   . PRO A 1 262 ? 6.085   -16.194 -16.312 1.00 66.66  ? 263 PRO A N   1 
ATOM   1937 C  CA  . PRO A 1 262 ? 7.341   -15.837 -17.002 1.00 66.27  ? 263 PRO A CA  1 
ATOM   1938 C  C   . PRO A 1 262 ? 8.554   -16.724 -16.670 1.00 69.06  ? 263 PRO A C   1 
ATOM   1939 O  O   . PRO A 1 262 ? 9.523   -16.741 -17.433 1.00 73.11  ? 263 PRO A O   1 
ATOM   1940 C  CB  . PRO A 1 262 ? 7.596   -14.395 -16.545 1.00 66.50  ? 263 PRO A CB  1 
ATOM   1941 C  CG  . PRO A 1 262 ? 6.271   -13.884 -16.100 1.00 65.20  ? 263 PRO A CG  1 
ATOM   1942 C  CD  . PRO A 1 262 ? 5.590   -15.069 -15.493 1.00 66.17  ? 263 PRO A CD  1 
ATOM   1943 N  N   . THR A 1 263 ? 8.489   -17.446 -15.552 1.00 70.43  ? 264 THR A N   1 
ATOM   1944 C  CA  . THR A 1 263 ? 9.571   -18.332 -15.083 1.00 70.87  ? 264 THR A CA  1 
ATOM   1945 C  C   . THR A 1 263 ? 9.499   -19.755 -15.675 1.00 67.91  ? 264 THR A C   1 
ATOM   1946 O  O   . THR A 1 263 ? 10.376  -20.590 -15.421 1.00 68.95  ? 264 THR A O   1 
ATOM   1947 C  CB  . THR A 1 263 ? 9.601   -18.432 -13.531 1.00 74.50  ? 264 THR A CB  1 
ATOM   1948 O  OG1 . THR A 1 263 ? 8.471   -19.187 -13.059 1.00 73.15  ? 264 THR A OG1 1 
ATOM   1949 C  CG2 . THR A 1 263 ? 9.611   -17.042 -12.883 1.00 75.77  ? 264 THR A CG2 1 
ATOM   1950 N  N   . LEU A 1 264 ? 8.442   -20.022 -16.438 1.00 63.88  ? 265 LEU A N   1 
ATOM   1951 C  CA  . LEU A 1 264 ? 8.245   -21.305 -17.112 1.00 62.59  ? 265 LEU A CA  1 
ATOM   1952 C  C   . LEU A 1 264 ? 9.328   -21.551 -18.176 1.00 61.49  ? 265 LEU A C   1 
ATOM   1953 O  O   . LEU A 1 264 ? 9.705   -20.620 -18.892 1.00 59.01  ? 265 LEU A O   1 
ATOM   1954 C  CB  . LEU A 1 264 ? 6.842   -21.358 -17.732 1.00 60.34  ? 265 LEU A CB  1 
ATOM   1955 C  CG  . LEU A 1 264 ? 5.660   -22.081 -17.055 1.00 61.89  ? 265 LEU A CG  1 
ATOM   1956 C  CD1 . LEU A 1 264 ? 5.745   -22.230 -15.535 1.00 62.24  ? 265 LEU A CD1 1 
ATOM   1957 C  CD2 . LEU A 1 264 ? 4.353   -21.418 -17.460 1.00 59.19  ? 265 LEU A CD2 1 
ATOM   1958 N  N   . PRO A 1 265 ? 9.844   -22.800 -18.269 1.00 62.80  ? 266 PRO A N   1 
ATOM   1959 C  CA  . PRO A 1 265 ? 10.929  -23.114 -19.218 1.00 62.15  ? 266 PRO A CA  1 
ATOM   1960 C  C   . PRO A 1 265 ? 10.542  -22.964 -20.694 1.00 59.04  ? 266 PRO A C   1 
ATOM   1961 O  O   . PRO A 1 265 ? 9.365   -22.828 -21.020 1.00 56.20  ? 266 PRO A O   1 
ATOM   1962 C  CB  . PRO A 1 265 ? 11.260  -24.582 -18.900 1.00 63.31  ? 266 PRO A CB  1 
ATOM   1963 C  CG  . PRO A 1 265 ? 10.030  -25.116 -18.262 1.00 63.46  ? 266 PRO A CG  1 
ATOM   1964 C  CD  . PRO A 1 265 ? 9.501   -23.977 -17.447 1.00 63.79  ? 266 PRO A CD  1 
ATOM   1965 N  N   . ASP A 1 266 ? 11.554  -22.971 -21.557 1.00 60.00  ? 267 ASP A N   1 
ATOM   1966 C  CA  . ASP A 1 266 ? 11.386  -23.029 -23.005 1.00 59.68  ? 267 ASP A CA  1 
ATOM   1967 C  C   . ASP A 1 266 ? 10.872  -24.398 -23.458 1.00 60.17  ? 267 ASP A C   1 
ATOM   1968 O  O   . ASP A 1 266 ? 11.209  -25.428 -22.855 1.00 61.77  ? 267 ASP A O   1 
ATOM   1969 C  CB  . ASP A 1 266 ? 12.721  -22.731 -23.699 1.00 61.74  ? 267 ASP A CB  1 
ATOM   1970 C  CG  . ASP A 1 266 ? 13.186  -21.294 -23.504 1.00 62.92  ? 267 ASP A CG  1 
ATOM   1971 O  OD1 . ASP A 1 266 ? 12.402  -20.456 -23.010 1.00 64.13  ? 267 ASP A OD1 1 
ATOM   1972 O  OD2 . ASP A 1 266 ? 14.345  -20.993 -23.851 1.00 66.23  ? 267 ASP A OD2 1 
ATOM   1973 N  N   . ILE A 1 267 ? 10.049  -24.394 -24.509 1.00 57.73  ? 268 ILE A N   1 
ATOM   1974 C  CA  . ILE A 1 267 ? 9.582   -25.624 -25.153 1.00 57.16  ? 268 ILE A CA  1 
ATOM   1975 C  C   . ILE A 1 267 ? 10.058  -25.652 -26.602 1.00 57.77  ? 268 ILE A C   1 
ATOM   1976 O  O   . ILE A 1 267 ? 9.762   -24.743 -27.387 1.00 57.32  ? 268 ILE A O   1 
ATOM   1977 C  CB  . ILE A 1 267 ? 8.052   -25.810 -25.066 1.00 56.36  ? 268 ILE A CB  1 
ATOM   1978 C  CG1 . ILE A 1 267 ? 7.582   -25.692 -23.608 1.00 57.70  ? 268 ILE A CG1 1 
ATOM   1979 C  CG2 . ILE A 1 267 ? 7.648   -27.158 -25.668 1.00 56.72  ? 268 ILE A CG2 1 
ATOM   1980 C  CD1 . ILE A 1 267 ? 6.081   -25.746 -23.404 1.00 56.55  ? 268 ILE A CD1 1 
ATOM   1981 N  N   . SER A 1 268 ? 10.802  -26.699 -26.940 1.00 60.08  ? 269 SER A N   1 
ATOM   1982 C  CA  . SER A 1 268 ? 11.439  -26.815 -28.244 1.00 61.27  ? 269 SER A CA  1 
ATOM   1983 C  C   . SER A 1 268 ? 10.935  -28.020 -29.027 1.00 63.28  ? 269 SER A C   1 
ATOM   1984 O  O   . SER A 1 268 ? 10.806  -29.123 -28.480 1.00 66.01  ? 269 SER A O   1 
ATOM   1985 C  CB  . SER A 1 268 ? 12.952  -26.880 -28.080 1.00 63.53  ? 269 SER A CB  1 
ATOM   1986 O  OG  . SER A 1 268 ? 13.413  -25.737 -27.384 1.00 65.84  ? 269 SER A OG  1 
ATOM   1987 N  N   . PHE A 1 269 ? 10.656  -27.794 -30.308 1.00 60.49  ? 270 PHE A N   1 
ATOM   1988 C  CA  . PHE A 1 269 ? 10.145  -28.821 -31.201 1.00 60.12  ? 270 PHE A CA  1 
ATOM   1989 C  C   . PHE A 1 269 ? 11.213  -29.071 -32.248 1.00 62.35  ? 270 PHE A C   1 
ATOM   1990 O  O   . PHE A 1 269 ? 11.637  -28.144 -32.943 1.00 63.50  ? 270 PHE A O   1 
ATOM   1991 C  CB  . PHE A 1 269 ? 8.817   -28.375 -31.841 1.00 57.46  ? 270 PHE A CB  1 
ATOM   1992 C  CG  . PHE A 1 269 ? 7.743   -28.025 -30.839 1.00 56.00  ? 270 PHE A CG  1 
ATOM   1993 C  CD1 . PHE A 1 269 ? 7.638   -26.724 -30.324 1.00 53.93  ? 270 PHE A CD1 1 
ATOM   1994 C  CD2 . PHE A 1 269 ? 6.836   -28.996 -30.396 1.00 55.76  ? 270 PHE A CD2 1 
ATOM   1995 C  CE1 . PHE A 1 269 ? 6.656   -26.407 -29.388 1.00 53.12  ? 270 PHE A CE1 1 
ATOM   1996 C  CE2 . PHE A 1 269 ? 5.848   -28.681 -29.461 1.00 54.55  ? 270 PHE A CE2 1 
ATOM   1997 C  CZ  . PHE A 1 269 ? 5.761   -27.387 -28.956 1.00 53.87  ? 270 PHE A CZ  1 
ATOM   1998 N  N   . HIS A 1 270 ? 11.657  -30.322 -32.335 1.00 65.39  ? 271 HIS A N   1 
ATOM   1999 C  CA  . HIS A 1 270 ? 12.763  -30.709 -33.210 1.00 69.54  ? 271 HIS A CA  1 
ATOM   2000 C  C   . HIS A 1 270 ? 12.212  -31.114 -34.585 1.00 69.05  ? 271 HIS A C   1 
ATOM   2001 O  O   . HIS A 1 270 ? 11.762  -32.249 -34.785 1.00 69.52  ? 271 HIS A O   1 
ATOM   2002 C  CB  . HIS A 1 270 ? 13.609  -31.813 -32.535 1.00 73.07  ? 271 HIS A CB  1 
ATOM   2003 C  CG  . HIS A 1 270 ? 14.911  -32.122 -33.222 1.00 78.50  ? 271 HIS A CG  1 
ATOM   2004 N  ND1 . HIS A 1 270 ? 15.448  -31.339 -34.224 1.00 79.79  ? 271 HIS A ND1 1 
ATOM   2005 C  CD2 . HIS A 1 270 ? 15.803  -33.123 -33.016 1.00 81.53  ? 271 HIS A CD2 1 
ATOM   2006 C  CE1 . HIS A 1 270 ? 16.598  -31.858 -34.622 1.00 82.05  ? 271 HIS A CE1 1 
ATOM   2007 N  NE2 . HIS A 1 270 ? 16.835  -32.941 -33.905 1.00 82.61  ? 271 HIS A NE2 1 
ATOM   2008 N  N   . LEU A 1 271 ? 12.235  -30.157 -35.517 1.00 67.36  ? 272 LEU A N   1 
ATOM   2009 C  CA  . LEU A 1 271 ? 11.702  -30.357 -36.870 1.00 67.23  ? 272 LEU A CA  1 
ATOM   2010 C  C   . LEU A 1 271 ? 12.757  -30.189 -37.967 1.00 69.25  ? 272 LEU A C   1 
ATOM   2011 O  O   . LEU A 1 271 ? 13.349  -29.111 -38.121 1.00 67.72  ? 272 LEU A O   1 
ATOM   2012 C  CB  . LEU A 1 271 ? 10.507  -29.432 -37.138 1.00 64.68  ? 272 LEU A CB  1 
ATOM   2013 C  CG  . LEU A 1 271 ? 9.349   -29.353 -36.136 1.00 63.63  ? 272 LEU A CG  1 
ATOM   2014 C  CD1 . LEU A 1 271 ? 8.498   -28.129 -36.432 1.00 61.68  ? 272 LEU A CD1 1 
ATOM   2015 C  CD2 . LEU A 1 271 ? 8.497   -30.613 -36.138 1.00 63.91  ? 272 LEU A CD2 1 
ATOM   2016 N  N   . GLY A 1 272 ? 12.974  -31.275 -38.712 1.00 71.42  ? 273 GLY A N   1 
ATOM   2017 C  CA  . GLY A 1 272 ? 13.875  -31.319 -39.869 1.00 74.43  ? 273 GLY A CA  1 
ATOM   2018 C  C   . GLY A 1 272 ? 15.260  -30.722 -39.705 1.00 76.75  ? 273 GLY A C   1 
ATOM   2019 O  O   . GLY A 1 272 ? 15.721  -29.985 -40.577 1.00 78.35  ? 273 GLY A O   1 
ATOM   2020 N  N   . GLY A 1 273 ? 15.918  -31.030 -38.589 1.00 78.73  ? 274 GLY A N   1 
ATOM   2021 C  CA  . GLY A 1 273 ? 17.290  -30.569 -38.347 1.00 82.13  ? 274 GLY A CA  1 
ATOM   2022 C  C   . GLY A 1 273 ? 17.411  -29.377 -37.415 1.00 81.51  ? 274 GLY A C   1 
ATOM   2023 O  O   . GLY A 1 273 ? 18.302  -29.354 -36.560 1.00 83.62  ? 274 GLY A O   1 
ATOM   2024 N  N   . LYS A 1 274 ? 16.522  -28.393 -37.590 1.00 79.47  ? 275 LYS A N   1 
ATOM   2025 C  CA  . LYS A 1 274 ? 16.473  -27.181 -36.752 1.00 76.30  ? 275 LYS A CA  1 
ATOM   2026 C  C   . LYS A 1 274 ? 15.643  -27.398 -35.485 1.00 74.22  ? 275 LYS A C   1 
ATOM   2027 O  O   . LYS A 1 274 ? 14.793  -28.287 -35.432 1.00 74.55  ? 275 LYS A O   1 
ATOM   2028 C  CB  . LYS A 1 274 ? 15.927  -25.989 -37.552 1.00 73.58  ? 275 LYS A CB  1 
ATOM   2029 N  N   . GLU A 1 275 ? 15.903  -26.584 -34.465 1.00 74.73  ? 276 GLU A N   1 
ATOM   2030 C  CA  . GLU A 1 275 ? 15.193  -26.671 -33.189 1.00 74.31  ? 276 GLU A CA  1 
ATOM   2031 C  C   . GLU A 1 275 ? 14.335  -25.414 -33.010 1.00 69.66  ? 276 GLU A C   1 
ATOM   2032 O  O   . GLU A 1 275 ? 14.867  -24.307 -32.921 1.00 70.49  ? 276 GLU A O   1 
ATOM   2033 C  CB  . GLU A 1 275 ? 16.199  -26.849 -32.038 1.00 77.47  ? 276 GLU A CB  1 
ATOM   2034 C  CG  . GLU A 1 275 ? 15.625  -27.440 -30.752 1.00 79.63  ? 276 GLU A CG  1 
ATOM   2035 C  CD  . GLU A 1 275 ? 15.475  -28.957 -30.772 1.00 82.28  ? 276 GLU A CD  1 
ATOM   2036 O  OE1 . GLU A 1 275 ? 16.427  -29.666 -31.163 1.00 83.84  ? 276 GLU A OE1 1 
ATOM   2037 O  OE2 . GLU A 1 275 ? 14.399  -29.451 -30.370 1.00 83.41  ? 276 GLU A OE2 1 
ATOM   2038 N  N   . TYR A 1 276 ? 13.014  -25.603 -32.976 1.00 65.92  ? 277 TYR A N   1 
ATOM   2039 C  CA  . TYR A 1 276 ? 12.029  -24.508 -32.930 1.00 61.89  ? 277 TYR A CA  1 
ATOM   2040 C  C   . TYR A 1 276 ? 11.550  -24.203 -31.511 1.00 59.94  ? 277 TYR A C   1 
ATOM   2041 O  O   . TYR A 1 276 ? 10.685  -24.891 -30.967 1.00 58.94  ? 277 TYR A O   1 
ATOM   2042 C  CB  . TYR A 1 276 ? 10.841  -24.817 -33.848 1.00 60.45  ? 277 TYR A CB  1 
ATOM   2043 C  CG  . TYR A 1 276 ? 11.210  -24.860 -35.310 1.00 61.28  ? 277 TYR A CG  1 
ATOM   2044 C  CD1 . TYR A 1 276 ? 11.619  -26.057 -35.917 1.00 62.38  ? 277 TYR A CD1 1 
ATOM   2045 C  CD2 . TYR A 1 276 ? 11.168  -23.703 -36.089 1.00 59.45  ? 277 TYR A CD2 1 
ATOM   2046 C  CE1 . TYR A 1 276 ? 11.972  -26.094 -37.259 1.00 63.45  ? 277 TYR A CE1 1 
ATOM   2047 C  CE2 . TYR A 1 276 ? 11.517  -23.731 -37.431 1.00 61.63  ? 277 TYR A CE2 1 
ATOM   2048 C  CZ  . TYR A 1 276 ? 11.913  -24.928 -38.013 1.00 63.50  ? 277 TYR A CZ  1 
ATOM   2049 O  OH  . TYR A 1 276 ? 12.256  -24.956 -39.343 1.00 65.84  ? 277 TYR A OH  1 
ATOM   2050 N  N   . THR A 1 277 ? 12.113  -23.152 -30.927 1.00 59.25  ? 278 THR A N   1 
ATOM   2051 C  CA  . THR A 1 277 ? 11.948  -22.881 -29.504 1.00 59.55  ? 278 THR A CA  1 
ATOM   2052 C  C   . THR A 1 277 ? 10.870  -21.837 -29.243 1.00 58.46  ? 278 THR A C   1 
ATOM   2053 O  O   . THR A 1 277 ? 10.802  -20.812 -29.930 1.00 57.81  ? 278 THR A O   1 
ATOM   2054 C  CB  . THR A 1 277 ? 13.290  -22.462 -28.870 1.00 59.95  ? 278 THR A CB  1 
ATOM   2055 O  OG1 . THR A 1 277 ? 14.273  -23.455 -29.170 1.00 62.95  ? 278 THR A OG1 1 
ATOM   2056 C  CG2 . THR A 1 277 ? 13.181  -22.333 -27.358 1.00 59.47  ? 278 THR A CG2 1 
ATOM   2057 N  N   . LEU A 1 278 ? 10.017  -22.129 -28.261 1.00 56.83  ? 279 LEU A N   1 
ATOM   2058 C  CA  . LEU A 1 278 ? 9.069   -21.156 -27.737 1.00 54.56  ? 279 LEU A CA  1 
ATOM   2059 C  C   . LEU A 1 278 ? 9.420   -20.832 -26.290 1.00 54.40  ? 279 LEU A C   1 
ATOM   2060 O  O   . LEU A 1 278 ? 9.653   -21.736 -25.487 1.00 55.85  ? 279 LEU A O   1 
ATOM   2061 C  CB  . LEU A 1 278 ? 7.623   -21.670 -27.828 1.00 53.60  ? 279 LEU A CB  1 
ATOM   2062 C  CG  . LEU A 1 278 ? 6.942   -22.181 -29.114 1.00 54.35  ? 279 LEU A CG  1 
ATOM   2063 C  CD1 . LEU A 1 278 ? 5.442   -21.941 -29.025 1.00 52.24  ? 279 LEU A CD1 1 
ATOM   2064 C  CD2 . LEU A 1 278 ? 7.470   -21.576 -30.407 1.00 54.98  ? 279 LEU A CD2 1 
ATOM   2065 N  N   . THR A 1 279 ? 9.480   -19.542 -25.969 1.00 53.86  ? 280 THR A N   1 
ATOM   2066 C  CA  . THR A 1 279 ? 9.559   -19.090 -24.574 1.00 54.04  ? 280 THR A CA  1 
ATOM   2067 C  C   . THR A 1 279 ? 8.140   -19.063 -23.971 1.00 53.07  ? 280 THR A C   1 
ATOM   2068 O  O   . THR A 1 279 ? 7.141   -19.137 -24.707 1.00 50.20  ? 280 THR A O   1 
ATOM   2069 C  CB  . THR A 1 279 ? 10.221  -17.697 -24.439 1.00 54.86  ? 280 THR A CB  1 
ATOM   2070 O  OG1 . THR A 1 279 ? 9.373   -16.696 -25.017 1.00 55.49  ? 280 THR A OG1 1 
ATOM   2071 C  CG2 . THR A 1 279 ? 11.590  -17.664 -25.110 1.00 53.86  ? 280 THR A CG2 1 
ATOM   2072 N  N   . SER A 1 280 ? 8.062   -18.962 -22.643 1.00 52.32  ? 281 SER A N   1 
ATOM   2073 C  CA  . SER A 1 280 ? 6.789   -18.821 -21.926 1.00 52.40  ? 281 SER A CA  1 
ATOM   2074 C  C   . SER A 1 280 ? 5.901   -17.713 -22.494 1.00 52.20  ? 281 SER A C   1 
ATOM   2075 O  O   . SER A 1 280 ? 4.691   -17.890 -22.608 1.00 52.41  ? 281 SER A O   1 
ATOM   2076 C  CB  . SER A 1 280 ? 7.011   -18.628 -20.420 1.00 53.80  ? 281 SER A CB  1 
ATOM   2077 O  OG  . SER A 1 280 ? 8.012   -17.663 -20.135 1.00 55.36  ? 281 SER A OG  1 
ATOM   2078 N  N   . ALA A 1 281 ? 6.515   -16.599 -22.891 1.00 53.30  ? 282 ALA A N   1 
ATOM   2079 C  CA  . ALA A 1 281 ? 5.814   -15.501 -23.562 1.00 53.24  ? 282 ALA A CA  1 
ATOM   2080 C  C   . ALA A 1 281 ? 5.100   -15.924 -24.853 1.00 53.14  ? 282 ALA A C   1 
ATOM   2081 O  O   . ALA A 1 281 ? 4.102   -15.312 -25.230 1.00 54.71  ? 282 ALA A O   1 
ATOM   2082 C  CB  . ALA A 1 281 ? 6.772   -14.356 -23.835 1.00 54.49  ? 282 ALA A CB  1 
ATOM   2083 N  N   . ASP A 1 282 ? 5.607   -16.970 -25.510 1.00 52.91  ? 283 ASP A N   1 
ATOM   2084 C  CA  . ASP A 1 282 ? 5.010   -17.500 -26.742 1.00 51.01  ? 283 ASP A CA  1 
ATOM   2085 C  C   . ASP A 1 282 ? 3.858   -18.482 -26.497 1.00 50.15  ? 283 ASP A C   1 
ATOM   2086 O  O   . ASP A 1 282 ? 3.095   -18.760 -27.426 1.00 48.33  ? 283 ASP A O   1 
ATOM   2087 C  CB  . ASP A 1 282 ? 6.070   -18.171 -27.638 1.00 51.82  ? 283 ASP A CB  1 
ATOM   2088 C  CG  . ASP A 1 282 ? 7.216   -17.243 -28.001 1.00 53.47  ? 283 ASP A CG  1 
ATOM   2089 O  OD1 . ASP A 1 282 ? 6.949   -16.171 -28.577 1.00 53.89  ? 283 ASP A OD1 1 
ATOM   2090 O  OD2 . ASP A 1 282 ? 8.389   -17.592 -27.724 1.00 54.37  ? 283 ASP A OD2 1 
ATOM   2091 N  N   . TYR A 1 283 ? 3.738   -19.015 -25.276 1.00 49.33  ? 284 TYR A N   1 
ATOM   2092 C  CA  . TYR A 1 283 ? 2.694   -20.016 -24.978 1.00 49.65  ? 284 TYR A CA  1 
ATOM   2093 C  C   . TYR A 1 283 ? 1.802   -19.745 -23.750 1.00 51.64  ? 284 TYR A C   1 
ATOM   2094 O  O   . TYR A 1 283 ? 0.836   -20.476 -23.522 1.00 52.48  ? 284 TYR A O   1 
ATOM   2095 C  CB  . TYR A 1 283 ? 3.252   -21.462 -24.980 1.00 48.51  ? 284 TYR A CB  1 
ATOM   2096 C  CG  . TYR A 1 283 ? 4.161   -21.843 -23.825 1.00 48.60  ? 284 TYR A CG  1 
ATOM   2097 C  CD1 . TYR A 1 283 ? 3.637   -22.208 -22.578 1.00 50.48  ? 284 TYR A CD1 1 
ATOM   2098 C  CD2 . TYR A 1 283 ? 5.544   -21.871 -23.985 1.00 49.24  ? 284 TYR A CD2 1 
ATOM   2099 C  CE1 . TYR A 1 283 ? 4.468   -22.565 -21.520 1.00 51.90  ? 284 TYR A CE1 1 
ATOM   2100 C  CE2 . TYR A 1 283 ? 6.388   -22.218 -22.932 1.00 50.88  ? 284 TYR A CE2 1 
ATOM   2101 C  CZ  . TYR A 1 283 ? 5.844   -22.567 -21.704 1.00 51.75  ? 284 TYR A CZ  1 
ATOM   2102 O  OH  . TYR A 1 283 ? 6.666   -22.923 -20.664 1.00 52.84  ? 284 TYR A OH  1 
ATOM   2103 N  N   . VAL A 1 284 ? 2.115   -18.703 -22.977 1.00 52.85  ? 285 VAL A N   1 
ATOM   2104 C  CA  . VAL A 1 284 ? 1.289   -18.316 -21.819 1.00 52.90  ? 285 VAL A CA  1 
ATOM   2105 C  C   . VAL A 1 284 ? 0.443   -17.102 -22.188 1.00 52.84  ? 285 VAL A C   1 
ATOM   2106 O  O   . VAL A 1 284 ? 0.958   -16.131 -22.743 1.00 54.11  ? 285 VAL A O   1 
ATOM   2107 C  CB  . VAL A 1 284 ? 2.125   -18.007 -20.539 1.00 52.02  ? 285 VAL A CB  1 
ATOM   2108 C  CG1 . VAL A 1 284 ? 1.223   -17.756 -19.339 1.00 52.84  ? 285 VAL A CG1 1 
ATOM   2109 C  CG2 . VAL A 1 284 ? 3.076   -19.141 -20.207 1.00 52.31  ? 285 VAL A CG2 1 
ATOM   2110 N  N   . PHE A 1 285 ? -0.852  -17.175 -21.889 1.00 54.68  ? 286 PHE A N   1 
ATOM   2111 C  CA  . PHE A 1 285 ? -1.721  -16.002 -21.889 1.00 54.99  ? 286 PHE A CA  1 
ATOM   2112 C  C   . PHE A 1 285 ? -1.480  -15.190 -20.608 1.00 57.53  ? 286 PHE A C   1 
ATOM   2113 O  O   . PHE A 1 285 ? -2.197  -15.356 -19.612 1.00 59.03  ? 286 PHE A O   1 
ATOM   2114 C  CB  . PHE A 1 285 ? -3.197  -16.414 -21.990 1.00 55.33  ? 286 PHE A CB  1 
ATOM   2115 C  CG  . PHE A 1 285 ? -3.599  -16.959 -23.335 1.00 55.64  ? 286 PHE A CG  1 
ATOM   2116 C  CD1 . PHE A 1 285 ? -4.046  -16.103 -24.349 1.00 54.71  ? 286 PHE A CD1 1 
ATOM   2117 C  CD2 . PHE A 1 285 ? -3.567  -18.339 -23.585 1.00 56.16  ? 286 PHE A CD2 1 
ATOM   2118 C  CE1 . PHE A 1 285 ? -4.423  -16.610 -25.594 1.00 56.04  ? 286 PHE A CE1 1 
ATOM   2119 C  CE2 . PHE A 1 285 ? -3.945  -18.851 -24.827 1.00 55.60  ? 286 PHE A CE2 1 
ATOM   2120 C  CZ  . PHE A 1 285 ? -4.371  -17.986 -25.834 1.00 55.29  ? 286 PHE A CZ  1 
ATOM   2121 N  N   . GLN A 1 286 ? -0.452  -14.335 -20.629 1.00 59.21  ? 287 GLN A N   1 
ATOM   2122 C  CA  . GLN A 1 286 ? -0.180  -13.395 -19.527 1.00 63.23  ? 287 GLN A CA  1 
ATOM   2123 C  C   . GLN A 1 286 ? -1.228  -12.286 -19.469 1.00 66.46  ? 287 GLN A C   1 
ATOM   2124 O  O   . GLN A 1 286 ? -1.122  -11.280 -20.180 1.00 70.08  ? 287 GLN A O   1 
ATOM   2125 C  CB  . GLN A 1 286 ? 1.212   -12.762 -19.657 1.00 61.30  ? 287 GLN A CB  1 
ATOM   2126 C  CG  . GLN A 1 286 ? 2.386   -13.690 -19.392 1.00 62.89  ? 287 GLN A CG  1 
ATOM   2127 C  CD  . GLN A 1 286 ? 2.461   -14.207 -17.964 1.00 63.49  ? 287 GLN A CD  1 
ATOM   2128 O  OE1 . GLN A 1 286 ? 1.980   -13.582 -17.015 1.00 63.02  ? 287 GLN A OE1 1 
ATOM   2129 N  NE2 . GLN A 1 286 ? 3.088   -15.355 -17.809 1.00 64.40  ? 287 GLN A NE2 1 
ATOM   2130 N  N   . GLU A 1 287 ? -2.242  -12.474 -18.633 1.00 69.47  ? 288 GLU A N   1 
ATOM   2131 C  CA  . GLU A 1 287 ? -3.285  -11.461 -18.465 1.00 73.69  ? 288 GLU A CA  1 
ATOM   2132 C  C   . GLU A 1 287 ? -3.165  -10.747 -17.128 1.00 74.92  ? 288 GLU A C   1 
ATOM   2133 O  O   . GLU A 1 287 ? -3.803  -9.711  -16.905 1.00 78.17  ? 288 GLU A O   1 
ATOM   2134 C  CB  . GLU A 1 287 ? -4.668  -12.079 -18.636 1.00 78.22  ? 288 GLU A CB  1 
ATOM   2135 C  CG  . GLU A 1 287 ? -5.068  -12.258 -20.096 1.00 81.84  ? 288 GLU A CG  1 
ATOM   2136 C  CD  . GLU A 1 287 ? -6.066  -13.384 -20.306 1.00 87.59  ? 288 GLU A CD  1 
ATOM   2137 O  OE1 . GLU A 1 287 ? -6.493  -13.583 -21.467 1.00 89.88  ? 288 GLU A OE1 1 
ATOM   2138 O  OE2 . GLU A 1 287 ? -6.422  -14.073 -19.318 1.00 89.66  ? 288 GLU A OE2 1 
ATOM   2139 N  N   . SER A 1 288 ? -2.320  -11.308 -16.265 1.00 72.05  ? 289 SER A N   1 
ATOM   2140 C  CA  . SER A 1 288 ? -2.089  -10.838 -14.907 1.00 71.33  ? 289 SER A CA  1 
ATOM   2141 C  C   . SER A 1 288 ? -0.711  -11.334 -14.466 1.00 69.72  ? 289 SER A C   1 
ATOM   2142 O  O   . SER A 1 288 ? -0.139  -12.220 -15.100 1.00 66.79  ? 289 SER A O   1 
ATOM   2143 C  CB  . SER A 1 288 ? -3.195  -11.372 -13.982 1.00 72.62  ? 289 SER A CB  1 
ATOM   2144 O  OG  . SER A 1 288 ? -2.893  -11.166 -12.615 1.00 74.98  ? 289 SER A OG  1 
ATOM   2145 N  N   . TYR A 1 289 ? -0.173  -10.743 -13.400 1.00 71.65  ? 290 TYR A N   1 
ATOM   2146 C  CA  . TYR A 1 289 ? 1.071   -11.221 -12.783 1.00 72.22  ? 290 TYR A CA  1 
ATOM   2147 C  C   . TYR A 1 289 ? 0.836   -11.675 -11.340 1.00 73.27  ? 290 TYR A C   1 
ATOM   2148 O  O   . TYR A 1 289 ? 1.786   -11.947 -10.601 1.00 74.00  ? 290 TYR A O   1 
ATOM   2149 C  CB  . TYR A 1 289 ? 2.178   -10.153 -12.859 1.00 73.93  ? 290 TYR A CB  1 
ATOM   2150 C  CG  . TYR A 1 289 ? 2.684   -9.840  -14.263 1.00 74.08  ? 290 TYR A CG  1 
ATOM   2151 C  CD1 . TYR A 1 289 ? 3.397   -10.798 -15.010 1.00 72.04  ? 290 TYR A CD1 1 
ATOM   2152 C  CD2 . TYR A 1 289 ? 2.468   -8.574  -14.843 1.00 73.76  ? 290 TYR A CD2 1 
ATOM   2153 C  CE1 . TYR A 1 289 ? 3.865   -10.512 -16.292 1.00 71.19  ? 290 TYR A CE1 1 
ATOM   2154 C  CE2 . TYR A 1 289 ? 2.936   -8.277  -16.123 1.00 72.89  ? 290 TYR A CE2 1 
ATOM   2155 C  CZ  . TYR A 1 289 ? 3.632   -9.248  -16.845 1.00 72.64  ? 290 TYR A CZ  1 
ATOM   2156 O  OH  . TYR A 1 289 ? 4.098   -8.961  -18.115 1.00 71.11  ? 290 TYR A OH  1 
ATOM   2157 N  N   . SER A 1 290 ? -0.440  -11.767 -10.964 1.00 73.93  ? 291 SER A N   1 
ATOM   2158 C  CA  . SER A 1 290 ? -0.870  -12.145 -9.616  1.00 75.70  ? 291 SER A CA  1 
ATOM   2159 C  C   . SER A 1 290 ? -0.674  -13.636 -9.334  1.00 75.62  ? 291 SER A C   1 
ATOM   2160 O  O   . SER A 1 290 ? -0.806  -14.471 -10.234 1.00 73.39  ? 291 SER A O   1 
ATOM   2161 C  CB  . SER A 1 290 ? -2.340  -11.754 -9.419  1.00 76.76  ? 291 SER A CB  1 
ATOM   2162 O  OG  . SER A 1 290 ? -2.886  -12.297 -8.231  1.00 80.19  ? 291 SER A OG  1 
ATOM   2163 N  N   . SER A 1 291 ? -0.358  -13.954 -8.078  1.00 78.09  ? 292 SER A N   1 
ATOM   2164 C  CA  . SER A 1 291 ? -0.267  -15.344 -7.620  1.00 79.14  ? 292 SER A CA  1 
ATOM   2165 C  C   . SER A 1 291 ? -1.650  -15.956 -7.392  1.00 79.86  ? 292 SER A C   1 
ATOM   2166 O  O   . SER A 1 291 ? -1.821  -17.169 -7.515  1.00 81.79  ? 292 SER A O   1 
ATOM   2167 C  CB  . SER A 1 291 ? 0.593   -15.459 -6.357  1.00 81.09  ? 292 SER A CB  1 
ATOM   2168 O  OG  . SER A 1 291 ? -0.071  -14.930 -5.223  1.00 83.64  ? 292 SER A OG  1 
ATOM   2169 N  N   . LYS A 1 292 ? -2.627  -15.105 -7.081  1.00 81.57  ? 293 LYS A N   1 
ATOM   2170 C  CA  . LYS A 1 292 ? -3.999  -15.536 -6.784  1.00 83.04  ? 293 LYS A CA  1 
ATOM   2171 C  C   . LYS A 1 292 ? -4.922  -15.618 -8.021  1.00 80.95  ? 293 LYS A C   1 
ATOM   2172 O  O   . LYS A 1 292 ? -6.135  -15.823 -7.883  1.00 83.42  ? 293 LYS A O   1 
ATOM   2173 C  CB  . LYS A 1 292 ? -4.605  -14.656 -5.678  1.00 84.98  ? 293 LYS A CB  1 
ATOM   2174 N  N   . LYS A 1 293 ? -4.341  -15.476 -9.216  1.00 77.40  ? 294 LYS A N   1 
ATOM   2175 C  CA  . LYS A 1 293 ? -5.061  -15.620 -10.492 1.00 73.69  ? 294 LYS A CA  1 
ATOM   2176 C  C   . LYS A 1 293 ? -4.452  -16.756 -11.302 1.00 70.22  ? 294 LYS A C   1 
ATOM   2177 O  O   . LYS A 1 293 ? -3.263  -17.057 -11.166 1.00 70.89  ? 294 LYS A O   1 
ATOM   2178 C  CB  . LYS A 1 293 ? -4.989  -14.334 -11.328 1.00 74.28  ? 294 LYS A CB  1 
ATOM   2179 C  CG  . LYS A 1 293 ? -5.574  -13.081 -10.695 1.00 78.52  ? 294 LYS A CG  1 
ATOM   2180 C  CD  . LYS A 1 293 ? -6.966  -12.746 -11.203 1.00 80.44  ? 294 LYS A CD  1 
ATOM   2181 C  CE  . LYS A 1 293 ? -7.308  -11.302 -10.857 1.00 85.46  ? 294 LYS A CE  1 
ATOM   2182 N  NZ  . LYS A 1 293 ? -8.770  -11.010 -10.863 1.00 89.26  ? 294 LYS A NZ  1 
ATOM   2183 N  N   . LEU A 1 294 ? -5.266  -17.377 -12.150 1.00 66.78  ? 295 LEU A N   1 
ATOM   2184 C  CA  . LEU A 1 294 ? -4.802  -18.466 -13.007 1.00 64.25  ? 295 LEU A CA  1 
ATOM   2185 C  C   . LEU A 1 294 ? -4.683  -18.020 -14.469 1.00 61.77  ? 295 LEU A C   1 
ATOM   2186 O  O   . LEU A 1 294 ? -5.506  -17.244 -14.970 1.00 61.06  ? 295 LEU A O   1 
ATOM   2187 C  CB  . LEU A 1 294 ? -5.708  -19.696 -12.872 1.00 64.32  ? 295 LEU A CB  1 
ATOM   2188 C  CG  . LEU A 1 294 ? -5.798  -20.403 -11.509 1.00 67.24  ? 295 LEU A CG  1 
ATOM   2189 C  CD1 . LEU A 1 294 ? -7.110  -21.169 -11.403 1.00 68.03  ? 295 LEU A CD1 1 
ATOM   2190 C  CD2 . LEU A 1 294 ? -4.607  -21.313 -11.220 1.00 66.60  ? 295 LEU A CD2 1 
ATOM   2191 N  N   . CYS A 1 295 ? -3.638  -18.500 -15.133 1.00 58.75  ? 296 CYS A N   1 
ATOM   2192 C  CA  . CYS A 1 295 ? -3.351  -18.128 -16.506 1.00 57.56  ? 296 CYS A CA  1 
ATOM   2193 C  C   . CYS A 1 295 ? -3.337  -19.361 -17.421 1.00 57.37  ? 296 CYS A C   1 
ATOM   2194 O  O   . CYS A 1 295 ? -2.720  -20.380 -17.097 1.00 58.92  ? 296 CYS A O   1 
ATOM   2195 C  CB  . CYS A 1 295 ? -2.016  -17.374 -16.571 1.00 58.31  ? 296 CYS A CB  1 
ATOM   2196 S  SG  . CYS A 1 295 ? -2.096  -15.593 -16.230 1.00 59.92  ? 296 CYS A SG  1 
ATOM   2197 N  N   . THR A 1 296 ? -4.015  -19.260 -18.561 1.00 55.60  ? 297 THR A N   1 
ATOM   2198 C  CA  . THR A 1 296 ? -4.140  -20.374 -19.501 1.00 55.91  ? 297 THR A CA  1 
ATOM   2199 C  C   . THR A 1 296 ? -2.900  -20.532 -20.371 1.00 56.44  ? 297 THR A C   1 
ATOM   2200 O  O   . THR A 1 296 ? -2.297  -19.543 -20.794 1.00 58.50  ? 297 THR A O   1 
ATOM   2201 C  CB  . THR A 1 296 ? -5.412  -20.223 -20.360 1.00 54.95  ? 297 THR A CB  1 
ATOM   2202 O  OG1 . THR A 1 296 ? -6.550  -20.383 -19.510 1.00 57.78  ? 297 THR A OG1 1 
ATOM   2203 C  CG2 . THR A 1 296 ? -5.492  -21.271 -21.469 1.00 54.67  ? 297 THR A CG2 1 
ATOM   2204 N  N   . LEU A 1 297 ? -2.522  -21.783 -20.619 1.00 56.89  ? 298 LEU A N   1 
ATOM   2205 C  CA  . LEU A 1 297 ? -1.458  -22.092 -21.563 1.00 55.07  ? 298 LEU A CA  1 
ATOM   2206 C  C   . LEU A 1 297 ? -2.043  -22.408 -22.923 1.00 54.57  ? 298 LEU A C   1 
ATOM   2207 O  O   . LEU A 1 297 ? -3.101  -23.044 -23.032 1.00 55.59  ? 298 LEU A O   1 
ATOM   2208 C  CB  . LEU A 1 297 ? -0.595  -23.251 -21.068 1.00 55.32  ? 298 LEU A CB  1 
ATOM   2209 C  CG  . LEU A 1 297 ? -0.073  -23.206 -19.633 1.00 56.31  ? 298 LEU A CG  1 
ATOM   2210 C  CD1 . LEU A 1 297 ? 0.751   -24.446 -19.384 1.00 56.80  ? 298 LEU A CD1 1 
ATOM   2211 C  CD2 . LEU A 1 297 ? 0.745   -21.952 -19.352 1.00 56.41  ? 298 LEU A CD2 1 
ATOM   2212 N  N   . ALA A 1 298 ? -1.344  -21.953 -23.956 1.00 53.34  ? 299 ALA A N   1 
ATOM   2213 C  CA  . ALA A 1 298 ? -1.744  -22.152 -25.344 1.00 51.63  ? 299 ALA A CA  1 
ATOM   2214 C  C   . ALA A 1 298 ? -1.279  -23.518 -25.903 1.00 52.99  ? 299 ALA A C   1 
ATOM   2215 O  O   . ALA A 1 298 ? -0.999  -23.661 -27.099 1.00 52.51  ? 299 ALA A O   1 
ATOM   2216 C  CB  . ALA A 1 298 ? -1.233  -20.994 -26.188 1.00 50.24  ? 299 ALA A CB  1 
ATOM   2217 N  N   . ILE A 1 299 ? -1.194  -24.506 -25.013 1.00 55.39  ? 300 ILE A N   1 
ATOM   2218 C  CA  . ILE A 1 299 ? -0.879  -25.894 -25.344 1.00 57.24  ? 300 ILE A CA  1 
ATOM   2219 C  C   . ILE A 1 299 ? -1.962  -26.759 -24.703 1.00 59.98  ? 300 ILE A C   1 
ATOM   2220 O  O   . ILE A 1 299 ? -2.223  -26.644 -23.506 1.00 61.85  ? 300 ILE A O   1 
ATOM   2221 C  CB  . ILE A 1 299 ? 0.512   -26.334 -24.819 1.00 58.74  ? 300 ILE A CB  1 
ATOM   2222 C  CG1 . ILE A 1 299 ? 1.593   -25.309 -25.174 1.00 57.93  ? 300 ILE A CG1 1 
ATOM   2223 C  CG2 . ILE A 1 299 ? 0.901   -27.698 -25.381 1.00 58.95  ? 300 ILE A CG2 1 
ATOM   2224 C  CD1 . ILE A 1 299 ? 2.768   -25.310 -24.225 1.00 58.23  ? 300 ILE A CD1 1 
ATOM   2225 N  N   . HIS A 1 300 ? -2.586  -27.613 -25.504 1.00 62.62  ? 301 HIS A N   1 
ATOM   2226 C  CA  . HIS A 1 300 ? -3.736  -28.412 -25.072 1.00 66.34  ? 301 HIS A CA  1 
ATOM   2227 C  C   . HIS A 1 300 ? -3.511  -29.909 -25.294 1.00 67.16  ? 301 HIS A C   1 
ATOM   2228 O  O   . HIS A 1 300 ? -2.588  -30.309 -26.002 1.00 64.97  ? 301 HIS A O   1 
ATOM   2229 C  CB  . HIS A 1 300 ? -5.001  -27.953 -25.816 1.00 68.76  ? 301 HIS A CB  1 
ATOM   2230 C  CG  . HIS A 1 300 ? -5.583  -26.669 -25.300 1.00 75.47  ? 301 HIS A CG  1 
ATOM   2231 N  ND1 . HIS A 1 300 ? -6.896  -26.559 -24.893 1.00 78.14  ? 301 HIS A ND1 1 
ATOM   2232 C  CD2 . HIS A 1 300 ? -5.033  -25.441 -25.126 1.00 77.34  ? 301 HIS A CD2 1 
ATOM   2233 C  CE1 . HIS A 1 300 ? -7.131  -25.319 -24.497 1.00 79.06  ? 301 HIS A CE1 1 
ATOM   2234 N  NE2 . HIS A 1 300 ? -6.018  -24.620 -24.633 1.00 78.46  ? 301 HIS A NE2 1 
ATOM   2235 N  N   . ALA A 1 301 ? -4.350  -30.728 -24.665 1.00 69.33  ? 302 ALA A N   1 
ATOM   2236 C  CA  . ALA A 1 301 ? -4.417  -32.150 -24.969 1.00 70.93  ? 302 ALA A CA  1 
ATOM   2237 C  C   . ALA A 1 301 ? -5.490  -32.376 -26.031 1.00 71.02  ? 302 ALA A C   1 
ATOM   2238 O  O   . ALA A 1 301 ? -6.608  -31.869 -25.905 1.00 69.97  ? 302 ALA A O   1 
ATOM   2239 C  CB  . ALA A 1 301 ? -4.716  -32.949 -23.712 1.00 72.01  ? 302 ALA A CB  1 
ATOM   2240 N  N   . MET A 1 302 ? -5.133  -33.099 -27.091 1.00 74.97  ? 303 MET A N   1 
ATOM   2241 C  CA  . MET A 1 302 ? -6.081  -33.492 -28.137 1.00 80.69  ? 303 MET A CA  1 
ATOM   2242 C  C   . MET A 1 302 ? -5.664  -34.839 -28.687 1.00 81.40  ? 303 MET A C   1 
ATOM   2243 O  O   . MET A 1 302 ? -4.579  -34.974 -29.262 1.00 84.26  ? 303 MET A O   1 
ATOM   2244 C  CB  . MET A 1 302 ? -6.118  -32.471 -29.276 1.00 85.45  ? 303 MET A CB  1 
ATOM   2245 C  CG  . MET A 1 302 ? -7.509  -31.989 -29.640 1.00 93.43  ? 303 MET A CG  1 
ATOM   2246 S  SD  . MET A 1 302 ? -7.894  -30.499 -28.697 1.00 108.02 ? 303 MET A SD  1 
ATOM   2247 C  CE  . MET A 1 302 ? -9.660  -30.371 -28.952 1.00 105.81 ? 303 MET A CE  1 
ATOM   2248 N  N   . ASP A 1 303 ? -6.514  -35.840 -28.493 1.00 82.28  ? 304 ASP A N   1 
ATOM   2249 C  CA  . ASP A 1 303 ? -6.253  -37.157 -29.048 1.00 82.55  ? 304 ASP A CA  1 
ATOM   2250 C  C   . ASP A 1 303 ? -6.883  -37.278 -30.420 1.00 82.58  ? 304 ASP A C   1 
ATOM   2251 O  O   . ASP A 1 303 ? -8.051  -37.642 -30.557 1.00 86.03  ? 304 ASP A O   1 
ATOM   2252 C  CB  . ASP A 1 303 ? -6.716  -38.250 -28.098 1.00 81.98  ? 304 ASP A CB  1 
ATOM   2253 C  CG  . ASP A 1 303 ? -5.802  -38.395 -26.907 1.00 83.11  ? 304 ASP A CG  1 
ATOM   2254 O  OD1 . ASP A 1 303 ? -4.565  -38.451 -27.097 1.00 81.36  ? 304 ASP A OD1 1 
ATOM   2255 O  OD2 . ASP A 1 303 ? -6.327  -38.467 -25.780 1.00 84.15  ? 304 ASP A OD2 1 
ATOM   2256 N  N   . ILE A 1 304 ? -6.086  -36.923 -31.426 1.00 82.43  ? 305 ILE A N   1 
ATOM   2257 C  CA  . ILE A 1 304 ? -6.468  -37.010 -32.833 1.00 80.00  ? 305 ILE A CA  1 
ATOM   2258 C  C   . ILE A 1 304 ? -6.484  -38.498 -33.219 1.00 81.26  ? 305 ILE A C   1 
ATOM   2259 O  O   . ILE A 1 304 ? -5.514  -39.215 -32.940 1.00 78.87  ? 305 ILE A O   1 
ATOM   2260 C  CB  . ILE A 1 304 ? -5.520  -36.159 -33.721 1.00 79.89  ? 305 ILE A CB  1 
ATOM   2261 C  CG1 . ILE A 1 304 ? -5.684  -34.667 -33.386 1.00 76.63  ? 305 ILE A CG1 1 
ATOM   2262 C  CG2 . ILE A 1 304 ? -5.782  -36.386 -35.209 1.00 79.52  ? 305 ILE A CG2 1 
ATOM   2263 C  CD1 . ILE A 1 304 ? -4.399  -33.863 -33.402 1.00 75.61  ? 305 ILE A CD1 1 
ATOM   2264 N  N   . PRO A 1 305 ? -7.602  -38.970 -33.824 1.00 82.20  ? 306 PRO A N   1 
ATOM   2265 C  CA  . PRO A 1 305 ? -7.745  -40.400 -34.133 1.00 83.58  ? 306 PRO A CA  1 
ATOM   2266 C  C   . PRO A 1 305 ? -6.923  -40.876 -35.347 1.00 83.84  ? 306 PRO A C   1 
ATOM   2267 O  O   . PRO A 1 305 ? -6.587  -40.057 -36.214 1.00 80.51  ? 306 PRO A O   1 
ATOM   2268 C  CB  . PRO A 1 305 ? -9.244  -40.543 -34.417 1.00 83.03  ? 306 PRO A CB  1 
ATOM   2269 C  CG  . PRO A 1 305 ? -9.666  -39.205 -34.924 1.00 79.13  ? 306 PRO A CG  1 
ATOM   2270 C  CD  . PRO A 1 305 ? -8.812  -38.203 -34.203 1.00 79.22  ? 306 PRO A CD  1 
ATOM   2271 N  N   . PRO A 1 306 ? -6.597  -42.193 -35.404 1.00 87.26  ? 307 PRO A N   1 
ATOM   2272 C  CA  . PRO A 1 306 ? -6.106  -42.848 -36.629 1.00 88.07  ? 307 PRO A CA  1 
ATOM   2273 C  C   . PRO A 1 306 ? -6.999  -42.564 -37.860 1.00 86.56  ? 307 PRO A C   1 
ATOM   2274 O  O   . PRO A 1 306 ? -8.210  -42.374 -37.688 1.00 83.57  ? 307 PRO A O   1 
ATOM   2275 C  CB  . PRO A 1 306 ? -6.152  -44.331 -36.262 1.00 90.49  ? 307 PRO A CB  1 
ATOM   2276 C  CG  . PRO A 1 306 ? -5.850  -44.343 -34.805 1.00 92.28  ? 307 PRO A CG  1 
ATOM   2277 C  CD  . PRO A 1 306 ? -6.486  -43.097 -34.238 1.00 89.57  ? 307 PRO A CD  1 
ATOM   2278 N  N   . PRO A 1 307 ? -6.432  -42.514 -39.076 1.00 86.46  ? 308 PRO A N   1 
ATOM   2279 C  CA  . PRO A 1 307 ? -5.010  -42.779 -39.343 1.00 86.42  ? 308 PRO A CA  1 
ATOM   2280 C  C   . PRO A 1 307 ? -4.070  -41.565 -39.204 1.00 84.09  ? 308 PRO A C   1 
ATOM   2281 O  O   . PRO A 1 307 ? -2.842  -41.743 -39.225 1.00 83.33  ? 308 PRO A O   1 
ATOM   2282 C  CB  . PRO A 1 307 ? -5.026  -43.288 -40.787 1.00 86.80  ? 308 PRO A CB  1 
ATOM   2283 C  CG  . PRO A 1 307 ? -6.215  -42.635 -41.412 1.00 84.98  ? 308 PRO A CG  1 
ATOM   2284 C  CD  . PRO A 1 307 ? -7.175  -42.233 -40.321 1.00 85.47  ? 308 PRO A CD  1 
ATOM   2285 N  N   . THR A 1 308 ? -4.644  -40.363 -39.067 1.00 80.21  ? 309 THR A N   1 
ATOM   2286 C  CA  . THR A 1 308 ? -3.875  -39.129 -38.840 1.00 79.89  ? 309 THR A CA  1 
ATOM   2287 C  C   . THR A 1 308 ? -3.138  -39.181 -37.490 1.00 79.58  ? 309 THR A C   1 
ATOM   2288 O  O   . THR A 1 308 ? -1.962  -38.815 -37.406 1.00 78.09  ? 309 THR A O   1 
ATOM   2289 C  CB  . THR A 1 308 ? -4.770  -37.866 -38.928 1.00 79.09  ? 309 THR A CB  1 
ATOM   2290 O  OG1 . THR A 1 308 ? -5.583  -37.930 -40.103 1.00 80.48  ? 309 THR A OG1 1 
ATOM   2291 C  CG2 . THR A 1 308 ? -3.934  -36.586 -38.988 1.00 79.32  ? 309 THR A CG2 1 
ATOM   2292 N  N   . GLY A 1 309 ? -3.830  -39.666 -36.456 1.00 79.38  ? 310 GLY A N   1 
ATOM   2293 C  CA  . GLY A 1 309 ? -3.279  -39.754 -35.104 1.00 79.10  ? 310 GLY A CA  1 
ATOM   2294 C  C   . GLY A 1 309 ? -2.740  -41.118 -34.679 1.00 81.62  ? 310 GLY A C   1 
ATOM   2295 O  O   . GLY A 1 309 ? -2.894  -42.093 -35.418 1.00 82.85  ? 310 GLY A O   1 
ATOM   2296 N  N   . PRO A 1 310 ? -2.103  -41.206 -33.501 1.00 82.18  ? 311 PRO A N   1 
ATOM   2297 C  CA  . PRO A 1 310 ? -1.855  -40.054 -32.617 1.00 79.93  ? 311 PRO A CA  1 
ATOM   2298 C  C   . PRO A 1 310 ? -0.809  -39.103 -33.189 1.00 77.04  ? 311 PRO A C   1 
ATOM   2299 O  O   . PRO A 1 310 ? 0.189   -39.548 -33.769 1.00 77.58  ? 311 PRO A O   1 
ATOM   2300 C  CB  . PRO A 1 310 ? -1.328  -40.699 -31.327 1.00 81.86  ? 311 PRO A CB  1 
ATOM   2301 C  CG  . PRO A 1 310 ? -1.762  -42.122 -31.397 1.00 84.92  ? 311 PRO A CG  1 
ATOM   2302 C  CD  . PRO A 1 310 ? -1.725  -42.472 -32.852 1.00 84.75  ? 311 PRO A CD  1 
ATOM   2303 N  N   . THR A 1 311 ? -1.064  -37.805 -33.034 1.00 72.54  ? 312 THR A N   1 
ATOM   2304 C  CA  . THR A 1 311 ? -0.194  -36.755 -33.570 1.00 69.50  ? 312 THR A CA  1 
ATOM   2305 C  C   . THR A 1 311 ? -0.226  -35.480 -32.725 1.00 67.48  ? 312 THR A C   1 
ATOM   2306 O  O   . THR A 1 311 ? -1.230  -35.169 -32.072 1.00 69.92  ? 312 THR A O   1 
ATOM   2307 C  CB  . THR A 1 311 ? -0.518  -36.436 -35.062 1.00 66.17  ? 312 THR A CB  1 
ATOM   2308 O  OG1 . THR A 1 311 ? 0.339   -35.391 -35.542 1.00 63.90  ? 312 THR A OG1 1 
ATOM   2309 C  CG2 . THR A 1 311 ? -1.973  -36.024 -35.261 1.00 62.68  ? 312 THR A CG2 1 
ATOM   2310 N  N   . TRP A 1 312 ? 0.883   -34.751 -32.739 1.00 64.59  ? 313 TRP A N   1 
ATOM   2311 C  CA  . TRP A 1 312 ? 0.885   -33.389 -32.244 1.00 62.36  ? 313 TRP A CA  1 
ATOM   2312 C  C   . TRP A 1 312 ? 0.244   -32.498 -33.301 1.00 60.79  ? 313 TRP A C   1 
ATOM   2313 O  O   . TRP A 1 312 ? 0.265   -32.832 -34.490 1.00 62.97  ? 313 TRP A O   1 
ATOM   2314 C  CB  . TRP A 1 312 ? 2.304   -32.916 -31.959 1.00 62.82  ? 313 TRP A CB  1 
ATOM   2315 C  CG  . TRP A 1 312 ? 2.947   -33.577 -30.778 1.00 64.96  ? 313 TRP A CG  1 
ATOM   2316 C  CD1 . TRP A 1 312 ? 3.441   -34.851 -30.719 1.00 66.25  ? 313 TRP A CD1 1 
ATOM   2317 C  CD2 . TRP A 1 312 ? 3.206   -32.988 -29.494 1.00 64.58  ? 313 TRP A CD2 1 
ATOM   2318 N  NE1 . TRP A 1 312 ? 3.973   -35.098 -29.479 1.00 68.13  ? 313 TRP A NE1 1 
ATOM   2319 C  CE2 . TRP A 1 312 ? 3.843   -33.975 -28.704 1.00 66.59  ? 313 TRP A CE2 1 
ATOM   2320 C  CE3 . TRP A 1 312 ? 2.953   -31.729 -28.930 1.00 62.18  ? 313 TRP A CE3 1 
ATOM   2321 C  CZ2 . TRP A 1 312 ? 4.232   -33.743 -27.377 1.00 66.20  ? 313 TRP A CZ2 1 
ATOM   2322 C  CZ3 . TRP A 1 312 ? 3.339   -31.498 -27.605 1.00 62.56  ? 313 TRP A CZ3 1 
ATOM   2323 C  CH2 . TRP A 1 312 ? 3.974   -32.501 -26.849 1.00 65.21  ? 313 TRP A CH2 1 
ATOM   2324 N  N   . ALA A 1 313 ? -0.355  -31.392 -32.870 1.00 56.45  ? 314 ALA A N   1 
ATOM   2325 C  CA  . ALA A 1 313 ? -0.816  -30.374 -33.801 1.00 54.43  ? 314 ALA A CA  1 
ATOM   2326 C  C   . ALA A 1 313 ? -0.120  -29.055 -33.496 1.00 55.18  ? 314 ALA A C   1 
ATOM   2327 O  O   . ALA A 1 313 ? -0.137  -28.578 -32.352 1.00 54.49  ? 314 ALA A O   1 
ATOM   2328 C  CB  . ALA A 1 313 ? -2.327  -30.229 -33.773 1.00 51.51  ? 314 ALA A CB  1 
ATOM   2329 N  N   . LEU A 1 314 ? 0.533   -28.502 -34.517 1.00 52.95  ? 315 LEU A N   1 
ATOM   2330 C  CA  . LEU A 1 314 ? 1.200   -27.216 -34.403 1.00 51.91  ? 315 LEU A CA  1 
ATOM   2331 C  C   . LEU A 1 314 ? 0.274   -26.153 -34.973 1.00 50.00  ? 315 LEU A C   1 
ATOM   2332 O  O   . LEU A 1 314 ? 0.148   -26.000 -36.195 1.00 50.83  ? 315 LEU A O   1 
ATOM   2333 C  CB  . LEU A 1 314 ? 2.580   -27.228 -35.082 1.00 51.04  ? 315 LEU A CB  1 
ATOM   2334 C  CG  . LEU A 1 314 ? 3.625   -28.238 -34.587 1.00 53.16  ? 315 LEU A CG  1 
ATOM   2335 C  CD1 . LEU A 1 314 ? 4.878   -28.153 -35.445 1.00 54.05  ? 315 LEU A CD1 1 
ATOM   2336 C  CD2 . LEU A 1 314 ? 3.973   -28.092 -33.108 1.00 52.59  ? 315 LEU A CD2 1 
ATOM   2337 N  N   . GLY A 1 315 ? -0.396  -25.448 -34.067 1.00 48.05  ? 316 GLY A N   1 
ATOM   2338 C  CA  . GLY A 1 315 ? -1.385  -24.450 -34.433 1.00 47.20  ? 316 GLY A CA  1 
ATOM   2339 C  C   . GLY A 1 315 ? -0.918  -23.016 -34.336 1.00 46.77  ? 316 GLY A C   1 
ATOM   2340 O  O   . GLY A 1 315 ? 0.274   -22.715 -34.507 1.00 46.57  ? 316 GLY A O   1 
ATOM   2341 N  N   . ALA A 1 316 ? -1.872  -22.132 -34.053 1.00 46.72  ? 317 ALA A N   1 
ATOM   2342 C  CA  . ALA A 1 316 ? -1.629  -20.688 -34.021 1.00 47.89  ? 317 ALA A CA  1 
ATOM   2343 C  C   . ALA A 1 316 ? -0.501  -20.279 -33.063 1.00 48.78  ? 317 ALA A C   1 
ATOM   2344 O  O   . ALA A 1 316 ? 0.244   -19.348 -33.362 1.00 50.23  ? 317 ALA A O   1 
ATOM   2345 C  CB  . ALA A 1 316 ? -2.910  -19.951 -33.688 1.00 48.52  ? 317 ALA A CB  1 
ATOM   2346 N  N   . THR A 1 317 ? -0.378  -20.988 -31.937 1.00 47.53  ? 318 THR A N   1 
ATOM   2347 C  CA  . THR A 1 317 ? 0.725   -20.810 -30.982 1.00 47.72  ? 318 THR A CA  1 
ATOM   2348 C  C   . THR A 1 317 ? 2.092   -20.957 -31.682 1.00 48.38  ? 318 THR A C   1 
ATOM   2349 O  O   . THR A 1 317 ? 2.986   -20.141 -31.471 1.00 48.01  ? 318 THR A O   1 
ATOM   2350 C  CB  . THR A 1 317 ? 0.621   -21.812 -29.808 1.00 47.73  ? 318 THR A CB  1 
ATOM   2351 O  OG1 . THR A 1 317 ? -0.728  -21.863 -29.332 1.00 48.38  ? 318 THR A OG1 1 
ATOM   2352 C  CG2 . THR A 1 317 ? 1.546   -21.439 -28.657 1.00 46.50  ? 318 THR A CG2 1 
ATOM   2353 N  N   . PHE A 1 318 ? 2.228   -21.981 -32.523 1.00 47.25  ? 319 PHE A N   1 
ATOM   2354 C  CA  . PHE A 1 318 ? 3.460   -22.218 -33.268 1.00 47.64  ? 319 PHE A CA  1 
ATOM   2355 C  C   . PHE A 1 318 ? 3.632   -21.241 -34.433 1.00 47.99  ? 319 PHE A C   1 
ATOM   2356 O  O   . PHE A 1 318 ? 4.692   -20.632 -34.569 1.00 48.45  ? 319 PHE A O   1 
ATOM   2357 C  CB  . PHE A 1 318 ? 3.523   -23.667 -33.763 1.00 47.16  ? 319 PHE A CB  1 
ATOM   2358 C  CG  . PHE A 1 318 ? 4.885   -24.084 -34.230 1.00 47.94  ? 319 PHE A CG  1 
ATOM   2359 C  CD1 . PHE A 1 318 ? 5.835   -24.550 -33.316 1.00 47.54  ? 319 PHE A CD1 1 
ATOM   2360 C  CD2 . PHE A 1 318 ? 5.225   -24.016 -35.586 1.00 46.84  ? 319 PHE A CD2 1 
ATOM   2361 C  CE1 . PHE A 1 318 ? 7.098   -24.931 -33.743 1.00 48.63  ? 319 PHE A CE1 1 
ATOM   2362 C  CE2 . PHE A 1 318 ? 6.486   -24.400 -36.014 1.00 48.56  ? 319 PHE A CE2 1 
ATOM   2363 C  CZ  . PHE A 1 318 ? 7.421   -24.858 -35.093 1.00 49.59  ? 319 PHE A CZ  1 
ATOM   2364 N  N   . ILE A 1 319 ? 2.583   -21.101 -35.249 1.00 47.22  ? 320 ILE A N   1 
ATOM   2365 C  CA  . ILE A 1 319 ? 2.579   -20.262 -36.454 1.00 46.72  ? 320 ILE A CA  1 
ATOM   2366 C  C   . ILE A 1 319 ? 2.813   -18.775 -36.152 1.00 47.50  ? 320 ILE A C   1 
ATOM   2367 O  O   . ILE A 1 319 ? 3.415   -18.075 -36.965 1.00 50.35  ? 320 ILE A O   1 
ATOM   2368 C  CB  . ILE A 1 319 ? 1.290   -20.487 -37.290 1.00 48.10  ? 320 ILE A CB  1 
ATOM   2369 C  CG1 . ILE A 1 319 ? 1.223   -21.935 -37.801 1.00 49.67  ? 320 ILE A CG1 1 
ATOM   2370 C  CG2 . ILE A 1 319 ? 1.202   -19.541 -38.484 1.00 48.38  ? 320 ILE A CG2 1 
ATOM   2371 C  CD1 . ILE A 1 319 ? -0.188  -22.474 -37.927 1.00 49.12  ? 320 ILE A CD1 1 
ATOM   2372 N  N   . ARG A 1 320 ? 2.367   -18.297 -34.989 1.00 46.56  ? 321 ARG A N   1 
ATOM   2373 C  CA  . ARG A 1 320 ? 2.659   -16.919 -34.562 1.00 46.98  ? 321 ARG A CA  1 
ATOM   2374 C  C   . ARG A 1 320 ? 4.162   -16.636 -34.554 1.00 48.36  ? 321 ARG A C   1 
ATOM   2375 O  O   . ARG A 1 320 ? 4.604   -15.601 -35.057 1.00 50.02  ? 321 ARG A O   1 
ATOM   2376 C  CB  . ARG A 1 320 ? 2.062   -16.597 -33.188 1.00 45.16  ? 321 ARG A CB  1 
ATOM   2377 C  CG  . ARG A 1 320 ? 0.673   -15.991 -33.231 1.00 44.23  ? 321 ARG A CG  1 
ATOM   2378 C  CD  . ARG A 1 320 ? 0.277   -15.386 -31.887 1.00 43.85  ? 321 ARG A CD  1 
ATOM   2379 N  NE  . ARG A 1 320 ? 0.192   -16.378 -30.816 1.00 43.13  ? 321 ARG A NE  1 
ATOM   2380 C  CZ  . ARG A 1 320 ? -0.867  -17.149 -30.569 1.00 44.54  ? 321 ARG A CZ  1 
ATOM   2381 N  NH1 . ARG A 1 320 ? -1.970  -17.068 -31.312 1.00 45.00  ? 321 ARG A NH1 1 
ATOM   2382 N  NH2 . ARG A 1 320 ? -0.824  -18.017 -29.570 1.00 44.07  ? 321 ARG A NH2 1 
ATOM   2383 N  N   . LYS A 1 321 ? 4.934   -17.565 -33.993 1.00 48.02  ? 322 LYS A N   1 
ATOM   2384 C  CA  . LYS A 1 321 ? 6.383   -17.427 -33.969 1.00 49.48  ? 322 LYS A CA  1 
ATOM   2385 C  C   . LYS A 1 321 ? 7.024   -17.739 -35.331 1.00 48.83  ? 322 LYS A C   1 
ATOM   2386 O  O   . LYS A 1 321 ? 8.014   -17.100 -35.722 1.00 48.60  ? 322 LYS A O   1 
ATOM   2387 C  CB  . LYS A 1 321 ? 6.995   -18.266 -32.846 1.00 49.40  ? 322 LYS A CB  1 
ATOM   2388 C  CG  . LYS A 1 321 ? 8.482   -18.033 -32.708 1.00 53.39  ? 322 LYS A CG  1 
ATOM   2389 C  CD  . LYS A 1 321 ? 8.933   -17.895 -31.276 1.00 56.29  ? 322 LYS A CD  1 
ATOM   2390 C  CE  . LYS A 1 321 ? 10.425  -17.637 -31.254 1.00 57.55  ? 322 LYS A CE  1 
ATOM   2391 N  NZ  . LYS A 1 321 ? 10.958  -18.137 -29.964 1.00 63.13  ? 322 LYS A NZ  1 
ATOM   2392 N  N   . PHE A 1 322 ? 6.449   -18.699 -36.055 1.00 47.04  ? 323 PHE A N   1 
ATOM   2393 C  CA  . PHE A 1 322 ? 7.049   -19.159 -37.304 1.00 48.35  ? 323 PHE A CA  1 
ATOM   2394 C  C   . PHE A 1 322 ? 6.138   -19.030 -38.513 1.00 48.49  ? 323 PHE A C   1 
ATOM   2395 O  O   . PHE A 1 322 ? 5.131   -19.741 -38.635 1.00 49.07  ? 323 PHE A O   1 
ATOM   2396 C  CB  . PHE A 1 322 ? 7.610   -20.576 -37.156 1.00 48.27  ? 323 PHE A CB  1 
ATOM   2397 C  CG  . PHE A 1 322 ? 8.577   -20.719 -36.018 1.00 48.52  ? 323 PHE A CG  1 
ATOM   2398 C  CD1 . PHE A 1 322 ? 9.871   -20.188 -36.108 1.00 50.05  ? 323 PHE A CD1 1 
ATOM   2399 C  CD2 . PHE A 1 322 ? 8.194   -21.361 -34.841 1.00 47.71  ? 323 PHE A CD2 1 
ATOM   2400 C  CE1 . PHE A 1 322 ? 10.767  -20.312 -35.049 1.00 50.55  ? 323 PHE A CE1 1 
ATOM   2401 C  CE2 . PHE A 1 322 ? 9.084   -21.487 -33.781 1.00 49.27  ? 323 PHE A CE2 1 
ATOM   2402 C  CZ  . PHE A 1 322 ? 10.373  -20.965 -33.885 1.00 49.89  ? 323 PHE A CZ  1 
ATOM   2403 N  N   . TYR A 1 323 ? 6.505   -18.099 -39.391 1.00 48.46  ? 324 TYR A N   1 
ATOM   2404 C  CA  . TYR A 1 323 ? 5.875   -17.940 -40.696 1.00 48.50  ? 324 TYR A CA  1 
ATOM   2405 C  C   . TYR A 1 323 ? 5.978   -19.268 -41.435 1.00 49.90  ? 324 TYR A C   1 
ATOM   2406 O  O   . TYR A 1 323 ? 7.068   -19.837 -41.554 1.00 52.48  ? 324 TYR A O   1 
ATOM   2407 C  CB  . TYR A 1 323 ? 6.577   -16.835 -41.476 1.00 48.45  ? 324 TYR A CB  1 
ATOM   2408 C  CG  . TYR A 1 323 ? 5.885   -16.420 -42.746 1.00 48.76  ? 324 TYR A CG  1 
ATOM   2409 C  CD1 . TYR A 1 323 ? 6.099   -17.115 -43.942 1.00 49.76  ? 324 TYR A CD1 1 
ATOM   2410 C  CD2 . TYR A 1 323 ? 5.027   -15.317 -42.764 1.00 48.10  ? 324 TYR A CD2 1 
ATOM   2411 C  CE1 . TYR A 1 323 ? 5.469   -16.734 -45.115 1.00 49.81  ? 324 TYR A CE1 1 
ATOM   2412 C  CE2 . TYR A 1 323 ? 4.392   -14.925 -43.937 1.00 48.37  ? 324 TYR A CE2 1 
ATOM   2413 C  CZ  . TYR A 1 323 ? 4.616   -15.637 -45.107 1.00 49.03  ? 324 TYR A CZ  1 
ATOM   2414 O  OH  . TYR A 1 323 ? 3.995   -15.250 -46.268 1.00 48.78  ? 324 TYR A OH  1 
ATOM   2415 N  N   . THR A 1 324 ? 4.834   -19.759 -41.905 1.00 48.92  ? 325 THR A N   1 
ATOM   2416 C  CA  . THR A 1 324 ? 4.735   -21.096 -42.476 1.00 49.60  ? 325 THR A CA  1 
ATOM   2417 C  C   . THR A 1 324 ? 4.377   -21.061 -43.963 1.00 50.36  ? 325 THR A C   1 
ATOM   2418 O  O   . THR A 1 324 ? 3.387   -20.446 -44.356 1.00 51.15  ? 325 THR A O   1 
ATOM   2419 C  CB  . THR A 1 324 ? 3.714   -21.951 -41.692 1.00 47.99  ? 325 THR A CB  1 
ATOM   2420 O  OG1 . THR A 1 324 ? 4.037   -21.922 -40.297 1.00 46.55  ? 325 THR A OG1 1 
ATOM   2421 C  CG2 . THR A 1 324 ? 3.733   -23.394 -42.168 1.00 49.30  ? 325 THR A CG2 1 
ATOM   2422 N  N   . GLU A 1 325 ? 5.195   -21.715 -44.779 1.00 52.02  ? 326 GLU A N   1 
ATOM   2423 C  CA  . GLU A 1 325 ? 4.886   -21.898 -46.191 1.00 54.85  ? 326 GLU A CA  1 
ATOM   2424 C  C   . GLU A 1 325 ? 4.455   -23.343 -46.421 1.00 55.44  ? 326 GLU A C   1 
ATOM   2425 O  O   . GLU A 1 325 ? 5.123   -24.284 -45.986 1.00 57.74  ? 326 GLU A O   1 
ATOM   2426 C  CB  . GLU A 1 325 ? 6.083   -21.542 -47.086 1.00 58.10  ? 326 GLU A CB  1 
ATOM   2427 C  CG  . GLU A 1 325 ? 5.740   -21.485 -48.573 1.00 61.44  ? 326 GLU A CG  1 
ATOM   2428 C  CD  . GLU A 1 325 ? 6.952   -21.524 -49.485 1.00 65.67  ? 326 GLU A CD  1 
ATOM   2429 O  OE1 . GLU A 1 325 ? 7.705   -22.517 -49.454 1.00 69.34  ? 326 GLU A OE1 1 
ATOM   2430 O  OE2 . GLU A 1 325 ? 7.145   -20.568 -50.262 1.00 68.02  ? 326 GLU A OE2 1 
ATOM   2431 N  N   . PHE A 1 326 ? 3.333   -23.506 -47.109 1.00 53.59  ? 327 PHE A N   1 
ATOM   2432 C  CA  . PHE A 1 326 ? 2.823   -24.819 -47.449 1.00 52.85  ? 327 PHE A CA  1 
ATOM   2433 C  C   . PHE A 1 326 ? 3.056   -25.092 -48.930 1.00 56.05  ? 327 PHE A C   1 
ATOM   2434 O  O   . PHE A 1 326 ? 2.367   -24.536 -49.787 1.00 56.09  ? 327 PHE A O   1 
ATOM   2435 C  CB  . PHE A 1 326 ? 1.344   -24.912 -47.094 1.00 49.83  ? 327 PHE A CB  1 
ATOM   2436 C  CG  . PHE A 1 326 ? 1.061   -24.787 -45.624 1.00 47.06  ? 327 PHE A CG  1 
ATOM   2437 C  CD1 . PHE A 1 326 ? 1.054   -25.922 -44.802 1.00 46.08  ? 327 PHE A CD1 1 
ATOM   2438 C  CD2 . PHE A 1 326 ? 0.794   -23.537 -45.053 1.00 44.55  ? 327 PHE A CD2 1 
ATOM   2439 C  CE1 . PHE A 1 326 ? 0.791   -25.810 -43.438 1.00 45.63  ? 327 PHE A CE1 1 
ATOM   2440 C  CE2 . PHE A 1 326 ? 0.528   -23.423 -43.691 1.00 44.19  ? 327 PHE A CE2 1 
ATOM   2441 C  CZ  . PHE A 1 326 ? 0.525   -24.561 -42.883 1.00 43.68  ? 327 PHE A CZ  1 
ATOM   2442 N  N   . ASP A 1 327 ? 4.043   -25.937 -49.219 1.00 58.30  ? 328 ASP A N   1 
ATOM   2443 C  CA  . ASP A 1 327 ? 4.439   -26.231 -50.592 1.00 62.70  ? 328 ASP A CA  1 
ATOM   2444 C  C   . ASP A 1 327 ? 3.781   -27.506 -51.126 1.00 64.79  ? 328 ASP A C   1 
ATOM   2445 O  O   . ASP A 1 327 ? 4.148   -28.619 -50.730 1.00 67.27  ? 328 ASP A O   1 
ATOM   2446 C  CB  . ASP A 1 327 ? 5.972   -26.301 -50.707 1.00 64.76  ? 328 ASP A CB  1 
ATOM   2447 C  CG  . ASP A 1 327 ? 6.472   -26.383 -52.158 1.00 69.44  ? 328 ASP A CG  1 
ATOM   2448 O  OD1 . ASP A 1 327 ? 5.672   -26.585 -53.101 1.00 70.66  ? 328 ASP A OD1 1 
ATOM   2449 O  OD2 . ASP A 1 327 ? 7.699   -26.251 -52.359 1.00 73.36  ? 328 ASP A OD2 1 
ATOM   2450 N  N   . ARG A 1 328 ? 2.831   -27.333 -52.044 1.00 63.24  ? 329 ARG A N   1 
ATOM   2451 C  CA  . ARG A 1 328 ? 2.184   -28.467 -52.702 1.00 64.66  ? 329 ARG A CA  1 
ATOM   2452 C  C   . ARG A 1 328 ? 2.998   -29.106 -53.835 1.00 67.49  ? 329 ARG A C   1 
ATOM   2453 O  O   . ARG A 1 328 ? 2.916   -30.322 -54.027 1.00 69.31  ? 329 ARG A O   1 
ATOM   2454 C  CB  . ARG A 1 328 ? 0.788   -28.102 -53.193 1.00 63.98  ? 329 ARG A CB  1 
ATOM   2455 C  CG  . ARG A 1 328 ? -0.252  -28.059 -52.094 1.00 62.58  ? 329 ARG A CG  1 
ATOM   2456 C  CD  . ARG A 1 328 ? -1.659  -28.139 -52.638 1.00 64.82  ? 329 ARG A CD  1 
ATOM   2457 N  NE  . ARG A 1 328 ? -1.886  -29.405 -53.329 1.00 69.89  ? 329 ARG A NE  1 
ATOM   2458 C  CZ  . ARG A 1 328 ? -3.058  -30.027 -53.423 1.00 71.73  ? 329 ARG A CZ  1 
ATOM   2459 N  NH1 . ARG A 1 328 ? -3.135  -31.174 -54.088 1.00 73.54  ? 329 ARG A NH1 1 
ATOM   2460 N  NH2 . ARG A 1 328 ? -4.143  -29.524 -52.844 1.00 69.84  ? 329 ARG A NH2 1 
ATOM   2461 N  N   . ARG A 1 329 ? 3.765   -28.299 -54.578 1.00 67.96  ? 330 ARG A N   1 
ATOM   2462 C  CA  . ARG A 1 329 ? 4.577   -28.812 -55.699 1.00 71.21  ? 330 ARG A CA  1 
ATOM   2463 C  C   . ARG A 1 329 ? 5.663   -29.778 -55.224 1.00 71.79  ? 330 ARG A C   1 
ATOM   2464 O  O   . ARG A 1 329 ? 5.926   -30.783 -55.882 1.00 73.81  ? 330 ARG A O   1 
ATOM   2465 C  CB  . ARG A 1 329 ? 5.203   -27.682 -56.538 1.00 72.90  ? 330 ARG A CB  1 
ATOM   2466 C  CG  . ARG A 1 329 ? 5.606   -28.113 -57.949 1.00 75.13  ? 330 ARG A CG  1 
ATOM   2467 C  CD  . ARG A 1 329 ? 6.523   -27.107 -58.629 1.00 77.53  ? 330 ARG A CD  1 
ATOM   2468 N  N   . ASN A 1 330 ? 6.269   -29.469 -54.078 1.00 70.10  ? 331 ASN A N   1 
ATOM   2469 C  CA  . ASN A 1 330 ? 7.361   -30.271 -53.524 1.00 71.19  ? 331 ASN A CA  1 
ATOM   2470 C  C   . ASN A 1 330 ? 7.010   -31.060 -52.249 1.00 70.12  ? 331 ASN A C   1 
ATOM   2471 O  O   . ASN A 1 330 ? 7.901   -31.619 -51.605 1.00 70.55  ? 331 ASN A O   1 
ATOM   2472 C  CB  . ASN A 1 330 ? 8.600   -29.390 -53.298 1.00 71.58  ? 331 ASN A CB  1 
ATOM   2473 C  CG  . ASN A 1 330 ? 9.109   -28.736 -54.575 1.00 73.45  ? 331 ASN A CG  1 
ATOM   2474 O  OD1 . ASN A 1 330 ? 9.176   -27.512 -54.659 1.00 73.41  ? 331 ASN A OD1 1 
ATOM   2475 N  ND2 . ASN A 1 330 ? 9.481   -29.545 -55.566 1.00 74.53  ? 331 ASN A ND2 1 
ATOM   2476 N  N   . ASN A 1 331 ? 5.718   -31.099 -51.903 1.00 68.73  ? 332 ASN A N   1 
ATOM   2477 C  CA  . ASN A 1 331 ? 5.184   -31.813 -50.718 1.00 68.61  ? 332 ASN A CA  1 
ATOM   2478 C  C   . ASN A 1 331 ? 5.966   -31.633 -49.401 1.00 67.40  ? 332 ASN A C   1 
ATOM   2479 O  O   . ASN A 1 331 ? 6.344   -32.599 -48.727 1.00 67.62  ? 332 ASN A O   1 
ATOM   2480 C  CB  . ASN A 1 331 ? 4.925   -33.293 -51.043 1.00 72.17  ? 332 ASN A CB  1 
ATOM   2481 C  CG  . ASN A 1 331 ? 3.785   -33.479 -52.027 1.00 74.00  ? 332 ASN A CG  1 
ATOM   2482 O  OD1 . ASN A 1 331 ? 2.626   -33.153 -51.736 1.00 73.24  ? 332 ASN A OD1 1 
ATOM   2483 N  ND2 . ASN A 1 331 ? 4.106   -34.006 -53.203 1.00 76.65  ? 332 ASN A ND2 1 
ATOM   2484 N  N   . ARG A 1 332 ? 6.185   -30.367 -49.057 1.00 65.35  ? 333 ARG A N   1 
ATOM   2485 C  CA  . ARG A 1 332 ? 6.971   -29.961 -47.892 1.00 64.16  ? 333 ARG A CA  1 
ATOM   2486 C  C   . ARG A 1 332 ? 6.289   -28.809 -47.165 1.00 62.24  ? 333 ARG A C   1 
ATOM   2487 O  O   . ARG A 1 332 ? 5.305   -28.242 -47.652 1.00 62.38  ? 333 ARG A O   1 
ATOM   2488 C  CB  . ARG A 1 332 ? 8.389   -29.540 -48.305 1.00 64.82  ? 333 ARG A CB  1 
ATOM   2489 C  CG  . ARG A 1 332 ? 8.466   -28.989 -49.717 1.00 66.44  ? 333 ARG A CG  1 
ATOM   2490 C  CD  . ARG A 1 332 ? 9.232   -27.690 -49.849 1.00 65.29  ? 333 ARG A CD  1 
ATOM   2491 N  NE  . ARG A 1 332 ? 10.680  -27.868 -49.927 1.00 66.35  ? 333 ARG A NE  1 
ATOM   2492 C  CZ  . ARG A 1 332 ? 11.510  -27.025 -50.540 1.00 65.94  ? 333 ARG A CZ  1 
ATOM   2493 N  NH1 . ARG A 1 332 ? 11.044  -25.944 -51.158 1.00 64.39  ? 333 ARG A NH1 1 
ATOM   2494 N  NH2 . ARG A 1 332 ? 12.812  -27.266 -50.536 1.00 66.18  ? 333 ARG A NH2 1 
ATOM   2495 N  N   . ILE A 1 333 ? 6.811   -28.489 -45.984 1.00 61.28  ? 334 ILE A N   1 
ATOM   2496 C  CA  . ILE A 1 333 ? 6.415   -27.309 -45.231 1.00 57.37  ? 334 ILE A CA  1 
ATOM   2497 C  C   . ILE A 1 333 ? 7.689   -26.526 -44.937 1.00 58.16  ? 334 ILE A C   1 
ATOM   2498 O  O   . ILE A 1 333 ? 8.697   -27.107 -44.533 1.00 59.37  ? 334 ILE A O   1 
ATOM   2499 C  CB  . ILE A 1 333 ? 5.658   -27.686 -43.934 1.00 55.86  ? 334 ILE A CB  1 
ATOM   2500 C  CG1 . ILE A 1 333 ? 4.287   -28.290 -44.276 1.00 54.56  ? 334 ILE A CG1 1 
ATOM   2501 C  CG2 . ILE A 1 333 ? 5.489   -26.474 -43.016 1.00 54.30  ? 334 ILE A CG2 1 
ATOM   2502 C  CD1 . ILE A 1 333 ? 3.695   -29.173 -43.198 1.00 53.43  ? 334 ILE A CD1 1 
ATOM   2503 N  N   . GLY A 1 334 ? 7.638   -25.217 -45.175 1.00 58.22  ? 335 GLY A N   1 
ATOM   2504 C  CA  . GLY A 1 334 ? 8.730   -24.311 -44.832 1.00 58.97  ? 335 GLY A CA  1 
ATOM   2505 C  C   . GLY A 1 334 ? 8.411   -23.479 -43.613 1.00 57.07  ? 335 GLY A C   1 
ATOM   2506 O  O   . GLY A 1 334 ? 7.285   -23.001 -43.462 1.00 56.86  ? 335 GLY A O   1 
ATOM   2507 N  N   . PHE A 1 335 ? 9.403   -23.325 -42.737 1.00 57.17  ? 336 PHE A N   1 
ATOM   2508 C  CA  . PHE A 1 335 ? 9.293   -22.443 -41.576 1.00 55.17  ? 336 PHE A CA  1 
ATOM   2509 C  C   . PHE A 1 335 ? 10.362  -21.365 -41.603 1.00 54.04  ? 336 PHE A C   1 
ATOM   2510 O  O   . PHE A 1 335 ? 11.529  -21.644 -41.863 1.00 55.54  ? 336 PHE A O   1 
ATOM   2511 C  CB  . PHE A 1 335 ? 9.399   -23.229 -40.263 1.00 55.84  ? 336 PHE A CB  1 
ATOM   2512 C  CG  . PHE A 1 335 ? 8.249   -24.166 -40.006 1.00 55.75  ? 336 PHE A CG  1 
ATOM   2513 C  CD1 . PHE A 1 335 ? 6.954   -23.681 -39.803 1.00 54.61  ? 336 PHE A CD1 1 
ATOM   2514 C  CD2 . PHE A 1 335 ? 8.465   -25.542 -39.945 1.00 56.88  ? 336 PHE A CD2 1 
ATOM   2515 C  CE1 . PHE A 1 335 ? 5.899   -24.558 -39.555 1.00 54.68  ? 336 PHE A CE1 1 
ATOM   2516 C  CE2 . PHE A 1 335 ? 7.418   -26.422 -39.696 1.00 55.66  ? 336 PHE A CE2 1 
ATOM   2517 C  CZ  . PHE A 1 335 ? 6.134   -25.930 -39.498 1.00 55.42  ? 336 PHE A CZ  1 
ATOM   2518 N  N   . ALA A 1 336 ? 9.944   -20.134 -41.348 1.00 52.17  ? 337 ALA A N   1 
ATOM   2519 C  CA  . ALA A 1 336 ? 10.871  -19.026 -41.119 1.00 54.51  ? 337 ALA A CA  1 
ATOM   2520 C  C   . ALA A 1 336 ? 10.401  -18.196 -39.924 1.00 52.23  ? 337 ALA A C   1 
ATOM   2521 O  O   . ALA A 1 336 ? 9.221   -18.238 -39.572 1.00 52.21  ? 337 ALA A O   1 
ATOM   2522 C  CB  . ALA A 1 336 ? 11.021  -18.166 -42.370 1.00 54.71  ? 337 ALA A CB  1 
ATOM   2523 N  N   . LEU A 1 337 ? 11.332  -17.478 -39.294 1.00 51.70  ? 338 LEU A N   1 
ATOM   2524 C  CA  . LEU A 1 337 ? 11.037  -16.581 -38.171 1.00 51.24  ? 338 LEU A CA  1 
ATOM   2525 C  C   . LEU A 1 337 ? 10.082  -15.460 -38.602 1.00 49.87  ? 338 LEU A C   1 
ATOM   2526 O  O   . LEU A 1 337 ? 10.408  -14.676 -39.490 1.00 52.17  ? 338 LEU A O   1 
ATOM   2527 C  CB  . LEU A 1 337 ? 12.342  -15.963 -37.639 1.00 52.42  ? 338 LEU A CB  1 
ATOM   2528 C  CG  . LEU A 1 337 ? 12.689  -15.887 -36.142 1.00 53.38  ? 338 LEU A CG  1 
ATOM   2529 C  CD1 . LEU A 1 337 ? 13.746  -14.814 -35.927 1.00 53.38  ? 338 LEU A CD1 1 
ATOM   2530 C  CD2 . LEU A 1 337 ? 11.501  -15.639 -35.220 1.00 51.22  ? 338 LEU A CD2 1 
ATOM   2531 N  N   . ALA A 1 338 ? 8.907   -15.396 -37.982 1.00 47.95  ? 339 ALA A N   1 
ATOM   2532 C  CA  . ALA A 1 338 ? 7.937   -14.344 -38.282 1.00 47.75  ? 339 ALA A CA  1 
ATOM   2533 C  C   . ALA A 1 338 ? 8.389   -12.976 -37.762 1.00 49.08  ? 339 ALA A C   1 
ATOM   2534 O  O   . ALA A 1 338 ? 9.149   -12.890 -36.792 1.00 48.82  ? 339 ALA A O   1 
ATOM   2535 C  CB  . ALA A 1 338 ? 6.563   -14.704 -37.735 1.00 45.41  ? 339 ALA A CB  1 
ATOM   2536 N  N   . ARG A 1 339 ? 7.925   -11.915 -38.423 1.00 51.19  ? 340 ARG A N   1 
ATOM   2537 C  CA  . ARG A 1 339 ? 8.235   -10.538 -38.016 1.00 53.43  ? 340 ARG A CA  1 
ATOM   2538 C  C   . ARG A 1 339 ? 7.013   -9.595  -38.063 1.00 54.51  ? 340 ARG A C   1 
ATOM   2539 O  O   . ARG A 1 339 ? 6.119   -9.729  -38.917 1.00 55.26  ? 340 ARG A O   1 
ATOM   2540 C  CB  . ARG A 1 339 ? 9.432   -9.993  -38.821 1.00 54.36  ? 340 ARG A CB  1 
ATOM   2541 C  CG  . ARG A 1 339 ? 9.121   -9.488  -40.219 1.00 55.02  ? 340 ARG A CG  1 
ATOM   2542 C  CD  . ARG A 1 339 ? 10.336  -9.469  -41.132 1.00 58.29  ? 340 ARG A CD  1 
ATOM   2543 N  NE  . ARG A 1 339 ? 11.290  -8.421  -40.784 1.00 64.23  ? 340 ARG A NE  1 
ATOM   2544 C  CZ  . ARG A 1 339 ? 12.414  -8.158  -41.452 1.00 69.30  ? 340 ARG A CZ  1 
ATOM   2545 N  NH1 . ARG A 1 339 ? 12.750  -8.857  -42.535 1.00 73.07  ? 340 ARG A NH1 1 
ATOM   2546 N  NH2 . ARG A 1 339 ? 13.212  -7.186  -41.031 1.00 69.14  ? 340 ARG A NH2 1 
ATOM   2547 N  N   . LEU B 1 2   ? 27.090  -1.807  -46.097 1.00 71.23  ? 3   LEU B N   1 
ATOM   2548 C  CA  . LEU B 1 2   ? 25.651  -1.565  -46.435 1.00 74.03  ? 3   LEU B CA  1 
ATOM   2549 C  C   . LEU B 1 2   ? 25.103  -2.469  -47.552 1.00 76.42  ? 3   LEU B C   1 
ATOM   2550 O  O   . LEU B 1 2   ? 25.683  -2.564  -48.643 1.00 77.35  ? 3   LEU B O   1 
ATOM   2551 C  CB  . LEU B 1 2   ? 25.401  -0.077  -46.752 1.00 74.35  ? 3   LEU B CB  1 
ATOM   2552 C  CG  . LEU B 1 2   ? 24.741  0.859   -45.716 1.00 72.66  ? 3   LEU B CG  1 
ATOM   2553 C  CD1 . LEU B 1 2   ? 25.355  0.787   -44.318 1.00 70.94  ? 3   LEU B CD1 1 
ATOM   2554 C  CD2 . LEU B 1 2   ? 24.719  2.300   -46.223 1.00 71.92  ? 3   LEU B CD2 1 
ATOM   2555 N  N   . GLY B 1 3   ? 23.982  -3.129  -47.247 1.00 75.52  ? 4   GLY B N   1 
ATOM   2556 C  CA  . GLY B 1 3   ? 23.274  -4.002  -48.177 1.00 74.68  ? 4   GLY B CA  1 
ATOM   2557 C  C   . GLY B 1 3   ? 21.765  -3.796  -48.158 1.00 76.22  ? 4   GLY B C   1 
ATOM   2558 O  O   . GLY B 1 3   ? 21.280  -2.659  -48.129 1.00 71.66  ? 4   GLY B O   1 
ATOM   2559 N  N   . ASN B 1 4   ? 21.035  -4.911  -48.128 1.00 78.11  ? 5   ASN B N   1 
ATOM   2560 C  CA  . ASN B 1 4   ? 19.617  -4.961  -48.493 1.00 78.72  ? 5   ASN B CA  1 
ATOM   2561 C  C   . ASN B 1 4   ? 18.645  -5.203  -47.325 1.00 75.11  ? 5   ASN B C   1 
ATOM   2562 O  O   . ASN B 1 4   ? 17.443  -4.939  -47.456 1.00 73.89  ? 5   ASN B O   1 
ATOM   2563 C  CB  . ASN B 1 4   ? 19.430  -6.057  -49.562 1.00 84.59  ? 5   ASN B CB  1 
ATOM   2564 C  CG  . ASN B 1 4   ? 18.345  -5.737  -50.593 1.00 90.26  ? 5   ASN B CG  1 
ATOM   2565 O  OD1 . ASN B 1 4   ? 18.173  -6.486  -51.564 1.00 93.19  ? 5   ASN B OD1 1 
ATOM   2566 N  ND2 . ASN B 1 4   ? 17.614  -4.639  -50.396 1.00 89.68  ? 5   ASN B ND2 1 
ATOM   2567 N  N   . THR B 1 5   ? 19.161  -5.679  -46.191 1.00 70.26  ? 6   THR B N   1 
ATOM   2568 C  CA  . THR B 1 5   ? 18.305  -6.281  -45.161 1.00 68.21  ? 6   THR B CA  1 
ATOM   2569 C  C   . THR B 1 5   ? 18.129  -5.507  -43.849 1.00 65.95  ? 6   THR B C   1 
ATOM   2570 O  O   . THR B 1 5   ? 18.962  -4.677  -43.466 1.00 65.35  ? 6   THR B O   1 
ATOM   2571 C  CB  . THR B 1 5   ? 18.740  -7.733  -44.816 1.00 70.28  ? 6   THR B CB  1 
ATOM   2572 O  OG1 . THR B 1 5   ? 20.005  -7.719  -44.145 1.00 70.11  ? 6   THR B OG1 1 
ATOM   2573 C  CG2 . THR B 1 5   ? 18.816  -8.625  -46.073 1.00 73.51  ? 6   THR B CG2 1 
ATOM   2574 N  N   . THR B 1 6   ? 17.004  -5.781  -43.191 1.00 62.85  ? 7   THR B N   1 
ATOM   2575 C  CA  . THR B 1 6   ? 16.795  -5.455  -41.783 1.00 57.11  ? 7   THR B CA  1 
ATOM   2576 C  C   . THR B 1 6   ? 16.565  -6.756  -41.007 1.00 56.22  ? 7   THR B C   1 
ATOM   2577 O  O   . THR B 1 6   ? 16.332  -7.820  -41.599 1.00 57.43  ? 7   THR B O   1 
ATOM   2578 C  CB  . THR B 1 6   ? 15.620  -4.475  -41.558 1.00 54.90  ? 7   THR B CB  1 
ATOM   2579 O  OG1 . THR B 1 6   ? 14.422  -5.008  -42.129 1.00 55.10  ? 7   THR B OG1 1 
ATOM   2580 C  CG2 . THR B 1 6   ? 15.916  -3.110  -42.181 1.00 55.42  ? 7   THR B CG2 1 
ATOM   2581 N  N   . SER B 1 7   ? 16.661  -6.665  -39.685 1.00 54.65  ? 8   SER B N   1 
ATOM   2582 C  CA  . SER B 1 7   ? 16.391  -7.790  -38.805 1.00 54.42  ? 8   SER B CA  1 
ATOM   2583 C  C   . SER B 1 7   ? 15.693  -7.292  -37.554 1.00 52.30  ? 8   SER B C   1 
ATOM   2584 O  O   . SER B 1 7   ? 16.220  -6.444  -36.832 1.00 50.62  ? 8   SER B O   1 
ATOM   2585 C  CB  . SER B 1 7   ? 17.682  -8.517  -38.441 1.00 55.52  ? 8   SER B CB  1 
ATOM   2586 O  OG  . SER B 1 7   ? 17.396  -9.786  -37.889 1.00 59.78  ? 8   SER B OG  1 
ATOM   2587 N  N   . SER B 1 8   ? 14.500  -7.820  -37.315 1.00 52.73  ? 9   SER B N   1 
ATOM   2588 C  CA  . SER B 1 8   ? 13.705  -7.436  -36.161 1.00 52.05  ? 9   SER B CA  1 
ATOM   2589 C  C   . SER B 1 8   ? 13.677  -8.537  -35.105 1.00 51.70  ? 9   SER B C   1 
ATOM   2590 O  O   . SER B 1 8   ? 13.716  -9.717  -35.437 1.00 53.20  ? 9   SER B O   1 
ATOM   2591 C  CB  . SER B 1 8   ? 12.291  -7.068  -36.598 1.00 52.79  ? 9   SER B CB  1 
ATOM   2592 O  OG  . SER B 1 8   ? 11.586  -8.220  -36.992 1.00 54.39  ? 9   SER B OG  1 
ATOM   2593 N  N   . VAL B 1 9   ? 13.633  -8.138  -33.835 1.00 50.33  ? 10  VAL B N   1 
ATOM   2594 C  CA  . VAL B 1 9   ? 13.482  -9.073  -32.714 1.00 49.30  ? 10  VAL B CA  1 
ATOM   2595 C  C   . VAL B 1 9   ? 12.289  -8.610  -31.887 1.00 48.39  ? 10  VAL B C   1 
ATOM   2596 O  O   . VAL B 1 9   ? 12.273  -7.469  -31.410 1.00 48.29  ? 10  VAL B O   1 
ATOM   2597 C  CB  . VAL B 1 9   ? 14.766  -9.163  -31.848 1.00 49.36  ? 10  VAL B CB  1 
ATOM   2598 C  CG1 . VAL B 1 9   ? 14.575  -10.090 -30.658 1.00 49.28  ? 10  VAL B CG1 1 
ATOM   2599 C  CG2 . VAL B 1 9   ? 15.953  -9.625  -32.680 1.00 49.53  ? 10  VAL B CG2 1 
ATOM   2600 N  N   . ILE B 1 10  ? 11.289  -9.490  -31.758 1.00 48.81  ? 11  ILE B N   1 
ATOM   2601 C  CA  . ILE B 1 10  ? 10.094  -9.257  -30.932 1.00 48.80  ? 11  ILE B CA  1 
ATOM   2602 C  C   . ILE B 1 10  ? 10.499  -9.297  -29.453 1.00 49.04  ? 11  ILE B C   1 
ATOM   2603 O  O   . ILE B 1 10  ? 11.212  -10.207 -29.018 1.00 50.50  ? 11  ILE B O   1 
ATOM   2604 C  CB  . ILE B 1 10  ? 8.968   -10.304 -31.198 1.00 49.84  ? 11  ILE B CB  1 
ATOM   2605 C  CG1 . ILE B 1 10  ? 8.629   -10.446 -32.702 1.00 52.07  ? 11  ILE B CG1 1 
ATOM   2606 C  CG2 . ILE B 1 10  ? 7.729   -10.039 -30.339 1.00 48.88  ? 11  ILE B CG2 1 
ATOM   2607 C  CD1 . ILE B 1 10  ? 7.920   -9.277  -33.370 1.00 53.63  ? 11  ILE B CD1 1 
ATOM   2608 N  N   . LEU B 1 11  ? 10.042  -8.305  -28.697 1.00 47.20  ? 12  LEU B N   1 
ATOM   2609 C  CA  . LEU B 1 11  ? 10.375  -8.192  -27.283 1.00 46.33  ? 12  LEU B CA  1 
ATOM   2610 C  C   . LEU B 1 11  ? 9.185   -8.525  -26.402 1.00 47.54  ? 12  LEU B C   1 
ATOM   2611 O  O   . LEU B 1 11  ? 8.037   -8.229  -26.747 1.00 47.19  ? 12  LEU B O   1 
ATOM   2612 C  CB  . LEU B 1 11  ? 10.897  -6.790  -26.958 1.00 45.15  ? 12  LEU B CB  1 
ATOM   2613 C  CG  . LEU B 1 11  ? 12.025  -6.215  -27.832 1.00 44.78  ? 12  LEU B CG  1 
ATOM   2614 C  CD1 . LEU B 1 11  ? 12.349  -4.800  -27.396 1.00 42.09  ? 12  LEU B CD1 1 
ATOM   2615 C  CD2 . LEU B 1 11  ? 13.280  -7.094  -27.827 1.00 44.72  ? 12  LEU B CD2 1 
ATOM   2616 N  N   . THR B 1 12  ? 9.481   -9.182  -25.284 1.00 47.93  ? 13  THR B N   1 
ATOM   2617 C  CA  . THR B 1 12  ? 8.525   -9.390  -24.211 1.00 47.17  ? 13  THR B CA  1 
ATOM   2618 C  C   . THR B 1 12  ? 8.593   -8.181  -23.277 1.00 46.61  ? 13  THR B C   1 
ATOM   2619 O  O   . THR B 1 12  ? 9.681   -7.782  -22.855 1.00 45.00  ? 13  THR B O   1 
ATOM   2620 C  CB  . THR B 1 12  ? 8.833   -10.700 -23.461 1.00 48.06  ? 13  THR B CB  1 
ATOM   2621 O  OG1 . THR B 1 12  ? 8.686   -11.798 -24.368 1.00 49.09  ? 13  THR B OG1 1 
ATOM   2622 C  CG2 . THR B 1 12  ? 7.898   -10.906 -22.257 1.00 47.56  ? 13  THR B CG2 1 
ATOM   2623 N  N   . ASN B 1 13  ? 7.429   -7.592  -22.998 1.00 47.57  ? 14  ASN B N   1 
ATOM   2624 C  CA  . ASN B 1 13  ? 7.277   -6.559  -21.977 1.00 46.72  ? 14  ASN B CA  1 
ATOM   2625 C  C   . ASN B 1 13  ? 6.865   -7.234  -20.674 1.00 50.19  ? 14  ASN B C   1 
ATOM   2626 O  O   . ASN B 1 13  ? 5.713   -7.690  -20.527 1.00 50.50  ? 14  ASN B O   1 
ATOM   2627 C  CB  . ASN B 1 13  ? 6.221   -5.531  -22.406 1.00 46.27  ? 14  ASN B CB  1 
ATOM   2628 C  CG  . ASN B 1 13  ? 5.981   -4.426  -21.376 1.00 46.00  ? 14  ASN B CG  1 
ATOM   2629 O  OD1 . ASN B 1 13  ? 6.441   -4.480  -20.233 1.00 46.97  ? 14  ASN B OD1 1 
ATOM   2630 N  ND2 . ASN B 1 13  ? 5.242   -3.406  -21.793 1.00 44.06  ? 14  ASN B ND2 1 
ATOM   2631 N  N   . TYR B 1 14  ? 7.812   -7.292  -19.737 1.00 49.52  ? 15  TYR B N   1 
ATOM   2632 C  CA  . TYR B 1 14  ? 7.504   -7.669  -18.366 1.00 51.58  ? 15  TYR B CA  1 
ATOM   2633 C  C   . TYR B 1 14  ? 7.316   -6.417  -17.513 1.00 51.83  ? 15  TYR B C   1 
ATOM   2634 O  O   . TYR B 1 14  ? 8.267   -5.658  -17.283 1.00 52.62  ? 15  TYR B O   1 
ATOM   2635 C  CB  . TYR B 1 14  ? 8.582   -8.591  -17.794 1.00 52.36  ? 15  TYR B CB  1 
ATOM   2636 C  CG  . TYR B 1 14  ? 8.401   -8.957  -16.335 1.00 53.63  ? 15  TYR B CG  1 
ATOM   2637 C  CD1 . TYR B 1 14  ? 7.545   -9.993  -15.952 1.00 55.04  ? 15  TYR B CD1 1 
ATOM   2638 C  CD2 . TYR B 1 14  ? 9.105   -8.274  -15.333 1.00 53.52  ? 15  TYR B CD2 1 
ATOM   2639 C  CE1 . TYR B 1 14  ? 7.387   -10.337 -14.614 1.00 57.03  ? 15  TYR B CE1 1 
ATOM   2640 C  CE2 . TYR B 1 14  ? 8.949   -8.608  -13.992 1.00 55.68  ? 15  TYR B CE2 1 
ATOM   2641 C  CZ  . TYR B 1 14  ? 8.094   -9.641  -13.637 1.00 57.34  ? 15  TYR B CZ  1 
ATOM   2642 O  OH  . TYR B 1 14  ? 7.950   -9.976  -12.310 1.00 59.12  ? 15  TYR B OH  1 
ATOM   2643 N  N   . MET B 1 15  ? 6.066   -6.200  -17.098 1.00 52.94  ? 16  MET B N   1 
ATOM   2644 C  CA  . MET B 1 15  ? 5.676   -5.201  -16.092 1.00 52.63  ? 16  MET B CA  1 
ATOM   2645 C  C   . MET B 1 15  ? 6.008   -3.739  -16.406 1.00 51.29  ? 16  MET B C   1 
ATOM   2646 O  O   . MET B 1 15  ? 6.055   -2.909  -15.489 1.00 52.09  ? 16  MET B O   1 
ATOM   2647 C  CB  . MET B 1 15  ? 6.283   -5.567  -14.739 1.00 54.85  ? 16  MET B CB  1 
ATOM   2648 C  CG  . MET B 1 15  ? 5.639   -6.746  -14.064 1.00 58.77  ? 16  MET B CG  1 
ATOM   2649 S  SD  . MET B 1 15  ? 6.023   -6.657  -12.318 1.00 63.49  ? 16  MET B SD  1 
ATOM   2650 C  CE  . MET B 1 15  ? 5.185   -8.147  -11.782 1.00 65.49  ? 16  MET B CE  1 
ATOM   2651 N  N   . ASP B 1 16  ? 6.235   -3.425  -17.683 1.00 48.63  ? 17  ASP B N   1 
ATOM   2652 C  CA  . ASP B 1 16  ? 6.757   -2.115  -18.106 1.00 47.79  ? 17  ASP B CA  1 
ATOM   2653 C  C   . ASP B 1 16  ? 8.162   -1.803  -17.585 1.00 47.34  ? 17  ASP B C   1 
ATOM   2654 O  O   . ASP B 1 16  ? 8.668   -0.700  -17.800 1.00 46.11  ? 17  ASP B O   1 
ATOM   2655 C  CB  . ASP B 1 16  ? 5.783   -0.973  -17.758 1.00 49.71  ? 17  ASP B CB  1 
ATOM   2656 C  CG  . ASP B 1 16  ? 4.743   -0.726  -18.841 1.00 51.57  ? 17  ASP B CG  1 
ATOM   2657 O  OD1 . ASP B 1 16  ? 4.662   -1.503  -19.825 1.00 51.45  ? 17  ASP B OD1 1 
ATOM   2658 O  OD2 . ASP B 1 16  ? 4.000   0.270   -18.699 1.00 53.20  ? 17  ASP B OD2 1 
ATOM   2659 N  N   . THR B 1 17  ? 8.794   -2.771  -16.922 1.00 49.18  ? 18  THR B N   1 
ATOM   2660 C  CA  . THR B 1 17  ? 10.137  -2.575  -16.360 1.00 51.20  ? 18  THR B CA  1 
ATOM   2661 C  C   . THR B 1 17  ? 11.238  -3.354  -17.081 1.00 50.63  ? 18  THR B C   1 
ATOM   2662 O  O   . THR B 1 17  ? 12.398  -2.961  -17.037 1.00 52.78  ? 18  THR B O   1 
ATOM   2663 C  CB  . THR B 1 17  ? 10.205  -2.901  -14.853 1.00 53.09  ? 18  THR B CB  1 
ATOM   2664 O  OG1 . THR B 1 17  ? 9.804   -4.260  -14.630 1.00 54.50  ? 18  THR B OG1 1 
ATOM   2665 C  CG2 . THR B 1 17  ? 9.326   -1.952  -14.052 1.00 53.94  ? 18  THR B CG2 1 
ATOM   2666 N  N   . GLN B 1 18  ? 10.883  -4.459  -17.723 1.00 48.95  ? 19  GLN B N   1 
ATOM   2667 C  CA  . GLN B 1 18  ? 11.871  -5.298  -18.387 1.00 48.46  ? 19  GLN B CA  1 
ATOM   2668 C  C   . GLN B 1 18  ? 11.412  -5.630  -19.797 1.00 48.48  ? 19  GLN B C   1 
ATOM   2669 O  O   . GLN B 1 18  ? 10.322  -6.177  -19.997 1.00 50.31  ? 19  GLN B O   1 
ATOM   2670 C  CB  . GLN B 1 18  ? 12.134  -6.581  -17.587 1.00 49.40  ? 19  GLN B CB  1 
ATOM   2671 C  CG  . GLN B 1 18  ? 12.799  -6.360  -16.236 1.00 50.07  ? 19  GLN B CG  1 
ATOM   2672 C  CD  . GLN B 1 18  ? 12.848  -7.612  -15.375 1.00 52.47  ? 19  GLN B CD  1 
ATOM   2673 O  OE1 . GLN B 1 18  ? 13.202  -8.705  -15.842 1.00 52.57  ? 19  GLN B OE1 1 
ATOM   2674 N  NE2 . GLN B 1 18  ? 12.505  -7.456  -14.100 1.00 51.93  ? 19  GLN B NE2 1 
ATOM   2675 N  N   . TYR B 1 19  ? 12.253  -5.283  -20.764 1.00 47.56  ? 20  TYR B N   1 
ATOM   2676 C  CA  . TYR B 1 19  ? 12.015  -5.573  -22.169 1.00 46.74  ? 20  TYR B CA  1 
ATOM   2677 C  C   . TYR B 1 19  ? 13.158  -6.423  -22.674 1.00 47.54  ? 20  TYR B C   1 
ATOM   2678 O  O   . TYR B 1 19  ? 14.326  -6.025  -22.582 1.00 49.23  ? 20  TYR B O   1 
ATOM   2679 C  CB  . TYR B 1 19  ? 11.902  -4.279  -22.974 1.00 46.60  ? 20  TYR B CB  1 
ATOM   2680 C  CG  . TYR B 1 19  ? 10.688  -3.454  -22.625 1.00 47.03  ? 20  TYR B CG  1 
ATOM   2681 C  CD1 . TYR B 1 19  ? 10.700  -2.587  -21.526 1.00 45.88  ? 20  TYR B CD1 1 
ATOM   2682 C  CD2 . TYR B 1 19  ? 9.516   -3.545  -23.386 1.00 47.67  ? 20  TYR B CD2 1 
ATOM   2683 C  CE1 . TYR B 1 19  ? 9.584   -1.841  -21.194 1.00 46.40  ? 20  TYR B CE1 1 
ATOM   2684 C  CE2 . TYR B 1 19  ? 8.400   -2.787  -23.064 1.00 46.98  ? 20  TYR B CE2 1 
ATOM   2685 C  CZ  . TYR B 1 19  ? 8.444   -1.943  -21.968 1.00 47.06  ? 20  TYR B CZ  1 
ATOM   2686 O  OH  . TYR B 1 19  ? 7.347   -1.200  -21.635 1.00 51.24  ? 20  TYR B OH  1 
ATOM   2687 N  N   . TYR B 1 20  ? 12.821  -7.603  -23.185 1.00 47.06  ? 21  TYR B N   1 
ATOM   2688 C  CA  . TYR B 1 20  ? 13.829  -8.587  -23.577 1.00 48.02  ? 21  TYR B CA  1 
ATOM   2689 C  C   . TYR B 1 20  ? 13.358  -9.456  -24.729 1.00 49.90  ? 21  TYR B C   1 
ATOM   2690 O  O   . TYR B 1 20  ? 12.176  -9.802  -24.827 1.00 53.56  ? 21  TYR B O   1 
ATOM   2691 C  CB  . TYR B 1 20  ? 14.244  -9.457  -22.385 1.00 48.54  ? 21  TYR B CB  1 
ATOM   2692 C  CG  . TYR B 1 20  ? 13.088  -10.046 -21.596 1.00 49.86  ? 21  TYR B CG  1 
ATOM   2693 C  CD1 . TYR B 1 20  ? 12.540  -11.291 -21.939 1.00 51.00  ? 21  TYR B CD1 1 
ATOM   2694 C  CD2 . TYR B 1 20  ? 12.546  -9.362  -20.495 1.00 48.80  ? 21  TYR B CD2 1 
ATOM   2695 C  CE1 . TYR B 1 20  ? 11.482  -11.832 -21.220 1.00 52.00  ? 21  TYR B CE1 1 
ATOM   2696 C  CE2 . TYR B 1 20  ? 11.488  -9.897  -19.772 1.00 50.60  ? 21  TYR B CE2 1 
ATOM   2697 C  CZ  . TYR B 1 20  ? 10.963  -11.128 -20.142 1.00 51.82  ? 21  TYR B CZ  1 
ATOM   2698 O  OH  . TYR B 1 20  ? 9.924   -11.656 -19.435 1.00 54.77  ? 21  TYR B OH  1 
ATOM   2699 N  N   . GLY B 1 21  ? 14.294  -9.805  -25.600 1.00 50.06  ? 22  GLY B N   1 
ATOM   2700 C  CA  . GLY B 1 21  ? 14.016  -10.668 -26.737 1.00 50.62  ? 22  GLY B CA  1 
ATOM   2701 C  C   . GLY B 1 21  ? 14.957  -11.841 -26.748 1.00 53.55  ? 22  GLY B C   1 
ATOM   2702 O  O   . GLY B 1 21  ? 15.695  -12.062 -25.787 1.00 54.03  ? 22  GLY B O   1 
ATOM   2703 N  N   . GLU B 1 22  ? 14.946  -12.582 -27.850 1.00 57.33  ? 23  GLU B N   1 
ATOM   2704 C  CA  . GLU B 1 22  ? 15.697  -13.830 -27.940 1.00 60.67  ? 23  GLU B CA  1 
ATOM   2705 C  C   . GLU B 1 22  ? 16.866  -13.756 -28.903 1.00 59.15  ? 23  GLU B C   1 
ATOM   2706 O  O   . GLU B 1 22  ? 16.747  -13.218 -30.008 1.00 59.46  ? 23  GLU B O   1 
ATOM   2707 C  CB  . GLU B 1 22  ? 14.782  -14.991 -28.325 1.00 66.44  ? 23  GLU B CB  1 
ATOM   2708 C  CG  . GLU B 1 22  ? 13.560  -15.149 -27.436 1.00 72.83  ? 23  GLU B CG  1 
ATOM   2709 C  CD  . GLU B 1 22  ? 12.435  -15.884 -28.136 1.00 81.62  ? 23  GLU B CD  1 
ATOM   2710 O  OE1 . GLU B 1 22  ? 12.695  -16.990 -28.668 1.00 86.16  ? 23  GLU B OE1 1 
ATOM   2711 O  OE2 . GLU B 1 22  ? 11.294  -15.363 -28.150 1.00 81.94  ? 23  GLU B OE2 1 
ATOM   2712 N  N   . ILE B 1 23  ? 17.997  -14.283 -28.447 1.00 57.26  ? 24  ILE B N   1 
ATOM   2713 C  CA  . ILE B 1 23  ? 19.146  -14.577 -29.296 1.00 55.18  ? 24  ILE B CA  1 
ATOM   2714 C  C   . ILE B 1 23  ? 19.474  -16.069 -29.162 1.00 57.33  ? 24  ILE B C   1 
ATOM   2715 O  O   . ILE B 1 23  ? 19.175  -16.687 -28.133 1.00 57.34  ? 24  ILE B O   1 
ATOM   2716 C  CB  . ILE B 1 23  ? 20.387  -13.699 -28.970 1.00 55.12  ? 24  ILE B CB  1 
ATOM   2717 C  CG1 . ILE B 1 23  ? 20.825  -13.853 -27.501 1.00 56.68  ? 24  ILE B CG1 1 
ATOM   2718 C  CG2 . ILE B 1 23  ? 20.126  -12.235 -29.317 1.00 53.97  ? 24  ILE B CG2 1 
ATOM   2719 C  CD1 . ILE B 1 23  ? 22.281  -13.530 -27.231 1.00 57.22  ? 24  ILE B CD1 1 
ATOM   2720 N  N   . GLY B 1 24  ? 20.057  -16.647 -30.211 1.00 57.51  ? 25  GLY B N   1 
ATOM   2721 C  CA  . GLY B 1 24  ? 20.605  -17.999 -30.147 1.00 59.33  ? 25  GLY B CA  1 
ATOM   2722 C  C   . GLY B 1 24  ? 22.116  -17.930 -30.045 1.00 61.37  ? 25  GLY B C   1 
ATOM   2723 O  O   . GLY B 1 24  ? 22.726  -17.038 -30.631 1.00 60.65  ? 25  GLY B O   1 
ATOM   2724 N  N   . ILE B 1 25  ? 22.717  -18.843 -29.277 1.00 63.37  ? 26  ILE B N   1 
ATOM   2725 C  CA  . ILE B 1 25  ? 24.185  -18.979 -29.211 1.00 64.57  ? 26  ILE B CA  1 
ATOM   2726 C  C   . ILE B 1 25  ? 24.607  -20.434 -29.484 1.00 67.71  ? 26  ILE B C   1 
ATOM   2727 O  O   . ILE B 1 25  ? 24.207  -21.362 -28.763 1.00 69.41  ? 26  ILE B O   1 
ATOM   2728 C  CB  . ILE B 1 25  ? 24.791  -18.456 -27.872 1.00 64.96  ? 26  ILE B CB  1 
ATOM   2729 C  CG1 . ILE B 1 25  ? 24.270  -17.046 -27.540 1.00 63.65  ? 26  ILE B CG1 1 
ATOM   2730 C  CG2 . ILE B 1 25  ? 26.318  -18.436 -27.943 1.00 64.65  ? 26  ILE B CG2 1 
ATOM   2731 C  CD1 . ILE B 1 25  ? 24.683  -16.506 -26.188 1.00 63.36  ? 26  ILE B CD1 1 
ATOM   2732 N  N   . GLY B 1 26  ? 25.394  -20.620 -30.542 1.00 66.98  ? 27  GLY B N   1 
ATOM   2733 C  CA  . GLY B 1 26  ? 25.960  -21.922 -30.866 1.00 69.15  ? 27  GLY B CA  1 
ATOM   2734 C  C   . GLY B 1 26  ? 25.345  -22.669 -32.031 1.00 71.23  ? 27  GLY B C   1 
ATOM   2735 O  O   . GLY B 1 26  ? 24.385  -22.198 -32.652 1.00 70.10  ? 27  GLY B O   1 
ATOM   2736 N  N   . THR B 1 27  ? 25.928  -23.835 -32.319 1.00 73.30  ? 28  THR B N   1 
ATOM   2737 C  CA  . THR B 1 27  ? 25.430  -24.781 -33.309 1.00 74.54  ? 28  THR B CA  1 
ATOM   2738 C  C   . THR B 1 27  ? 25.299  -26.145 -32.602 1.00 79.50  ? 28  THR B C   1 
ATOM   2739 O  O   . THR B 1 27  ? 26.323  -26.766 -32.296 1.00 82.76  ? 28  THR B O   1 
ATOM   2740 C  CB  . THR B 1 27  ? 26.376  -24.873 -34.532 1.00 75.02  ? 28  THR B CB  1 
ATOM   2741 O  OG1 . THR B 1 27  ? 26.596  -23.566 -35.072 1.00 71.26  ? 28  THR B OG1 1 
ATOM   2742 C  CG2 . THR B 1 27  ? 25.800  -25.772 -35.627 1.00 76.02  ? 28  THR B CG2 1 
ATOM   2743 N  N   . PRO B 1 28  ? 24.072  -26.611 -32.315 1.00 81.23  ? 29  PRO B N   1 
ATOM   2744 C  CA  . PRO B 1 28  ? 22.810  -25.894 -32.598 1.00 78.62  ? 29  PRO B CA  1 
ATOM   2745 C  C   . PRO B 1 28  ? 22.575  -24.695 -31.664 1.00 76.80  ? 29  PRO B C   1 
ATOM   2746 O  O   . PRO B 1 28  ? 23.167  -24.655 -30.577 1.00 78.01  ? 29  PRO B O   1 
ATOM   2747 C  CB  . PRO B 1 28  ? 21.737  -26.969 -32.364 1.00 79.93  ? 29  PRO B CB  1 
ATOM   2748 C  CG  . PRO B 1 28  ? 22.384  -27.985 -31.483 1.00 82.55  ? 29  PRO B CG  1 
ATOM   2749 C  CD  . PRO B 1 28  ? 23.826  -28.004 -31.889 1.00 82.92  ? 29  PRO B CD  1 
ATOM   2750 N  N   . PRO B 1 29  ? 21.731  -23.719 -32.085 1.00 74.22  ? 30  PRO B N   1 
ATOM   2751 C  CA  . PRO B 1 29  ? 21.448  -22.538 -31.254 1.00 71.06  ? 30  PRO B CA  1 
ATOM   2752 C  C   . PRO B 1 29  ? 20.813  -22.854 -29.899 1.00 71.12  ? 30  PRO B C   1 
ATOM   2753 O  O   . PRO B 1 29  ? 19.871  -23.651 -29.819 1.00 70.53  ? 30  PRO B O   1 
ATOM   2754 C  CB  . PRO B 1 29  ? 20.471  -21.724 -32.113 1.00 69.01  ? 30  PRO B CB  1 
ATOM   2755 C  CG  . PRO B 1 29  ? 20.730  -22.168 -33.507 1.00 70.43  ? 30  PRO B CG  1 
ATOM   2756 C  CD  . PRO B 1 29  ? 21.063  -23.623 -33.399 1.00 73.32  ? 30  PRO B CD  1 
ATOM   2757 N  N   . GLN B 1 30  ? 21.363  -22.239 -28.853 1.00 69.92  ? 31  GLN B N   1 
ATOM   2758 C  CA  . GLN B 1 30  ? 20.776  -22.248 -27.514 1.00 69.86  ? 31  GLN B CA  1 
ATOM   2759 C  C   . GLN B 1 30  ? 20.134  -20.889 -27.273 1.00 67.27  ? 31  GLN B C   1 
ATOM   2760 O  O   . GLN B 1 30  ? 20.802  -19.862 -27.402 1.00 66.92  ? 31  GLN B O   1 
ATOM   2761 C  CB  . GLN B 1 30  ? 21.848  -22.512 -26.463 1.00 71.35  ? 31  GLN B CB  1 
ATOM   2762 C  CG  . GLN B 1 30  ? 22.382  -23.935 -26.455 1.00 73.94  ? 31  GLN B CG  1 
ATOM   2763 C  CD  . GLN B 1 30  ? 23.651  -24.080 -25.643 1.00 75.34  ? 31  GLN B CD  1 
ATOM   2764 O  OE1 . GLN B 1 30  ? 24.609  -24.710 -26.085 1.00 78.24  ? 31  GLN B OE1 1 
ATOM   2765 N  NE2 . GLN B 1 30  ? 23.665  -23.500 -24.451 1.00 74.63  ? 31  GLN B NE2 1 
ATOM   2766 N  N   . THR B 1 31  ? 18.845  -20.889 -26.925 1.00 66.83  ? 32  THR B N   1 
ATOM   2767 C  CA  . THR B 1 31  ? 18.035  -19.666 -26.903 1.00 62.78  ? 32  THR B CA  1 
ATOM   2768 C  C   . THR B 1 31  ? 18.002  -18.999 -25.528 1.00 61.53  ? 32  THR B C   1 
ATOM   2769 O  O   . THR B 1 31  ? 17.570  -19.603 -24.549 1.00 64.28  ? 32  THR B O   1 
ATOM   2770 C  CB  . THR B 1 31  ? 16.615  -19.932 -27.472 1.00 63.77  ? 32  THR B CB  1 
ATOM   2771 O  OG1 . THR B 1 31  ? 16.709  -20.104 -28.889 1.00 65.59  ? 32  THR B OG1 1 
ATOM   2772 C  CG2 . THR B 1 31  ? 15.628  -18.776 -27.194 1.00 62.04  ? 32  THR B CG2 1 
ATOM   2773 N  N   . PHE B 1 32  ? 18.444  -17.743 -25.484 1.00 58.02  ? 33  PHE B N   1 
ATOM   2774 C  CA  . PHE B 1 32  ? 18.409  -16.928 -24.267 1.00 57.23  ? 33  PHE B CA  1 
ATOM   2775 C  C   . PHE B 1 32  ? 17.533  -15.705 -24.427 1.00 55.96  ? 33  PHE B C   1 
ATOM   2776 O  O   . PHE B 1 32  ? 17.492  -15.096 -25.499 1.00 55.60  ? 33  PHE B O   1 
ATOM   2777 C  CB  . PHE B 1 32  ? 19.820  -16.485 -23.878 1.00 56.70  ? 33  PHE B CB  1 
ATOM   2778 C  CG  . PHE B 1 32  ? 20.763  -17.623 -23.717 1.00 58.89  ? 33  PHE B CG  1 
ATOM   2779 C  CD1 . PHE B 1 32  ? 20.822  -18.325 -22.518 1.00 60.21  ? 33  PHE B CD1 1 
ATOM   2780 C  CD2 . PHE B 1 32  ? 21.567  -18.027 -24.784 1.00 59.08  ? 33  PHE B CD2 1 
ATOM   2781 C  CE1 . PHE B 1 32  ? 21.676  -19.403 -22.386 1.00 63.29  ? 33  PHE B CE1 1 
ATOM   2782 C  CE2 . PHE B 1 32  ? 22.426  -19.098 -24.657 1.00 60.90  ? 33  PHE B CE2 1 
ATOM   2783 C  CZ  . PHE B 1 32  ? 22.472  -19.789 -23.459 1.00 63.70  ? 33  PHE B CZ  1 
ATOM   2784 N  N   . LYS B 1 33  ? 16.833  -15.357 -23.352 1.00 56.06  ? 34  LYS B N   1 
ATOM   2785 C  CA  . LYS B 1 33  ? 16.118  -14.091 -23.267 1.00 55.90  ? 34  LYS B CA  1 
ATOM   2786 C  C   . LYS B 1 33  ? 17.139  -13.026 -22.877 1.00 55.13  ? 34  LYS B C   1 
ATOM   2787 O  O   . LYS B 1 33  ? 17.838  -13.186 -21.875 1.00 57.87  ? 34  LYS B O   1 
ATOM   2788 C  CB  . LYS B 1 33  ? 14.986  -14.171 -22.237 1.00 56.49  ? 34  LYS B CB  1 
ATOM   2789 C  CG  . LYS B 1 33  ? 14.000  -15.304 -22.471 1.00 57.80  ? 34  LYS B CG  1 
ATOM   2790 C  CD  . LYS B 1 33  ? 13.074  -15.480 -21.278 1.00 60.28  ? 34  LYS B CD  1 
ATOM   2791 C  CE  . LYS B 1 33  ? 12.385  -16.833 -21.311 1.00 61.97  ? 34  LYS B CE  1 
ATOM   2792 N  NZ  . LYS B 1 33  ? 11.264  -16.876 -20.333 1.00 64.69  ? 34  LYS B NZ  1 
ATOM   2793 N  N   . VAL B 1 34  ? 17.250  -11.965 -23.679 1.00 52.90  ? 35  VAL B N   1 
ATOM   2794 C  CA  . VAL B 1 34  ? 18.251  -10.903 -23.443 1.00 52.67  ? 35  VAL B CA  1 
ATOM   2795 C  C   . VAL B 1 34  ? 17.681  -9.489  -23.490 1.00 51.48  ? 35  VAL B C   1 
ATOM   2796 O  O   . VAL B 1 34  ? 16.792  -9.193  -24.291 1.00 53.12  ? 35  VAL B O   1 
ATOM   2797 C  CB  . VAL B 1 34  ? 19.468  -10.969 -24.411 1.00 53.33  ? 35  VAL B CB  1 
ATOM   2798 C  CG1 . VAL B 1 34  ? 20.304  -12.214 -24.167 1.00 54.23  ? 35  VAL B CG1 1 
ATOM   2799 C  CG2 . VAL B 1 34  ? 19.033  -10.869 -25.874 1.00 54.78  ? 35  VAL B CG2 1 
ATOM   2800 N  N   . VAL B 1 35  ? 18.206  -8.622  -22.629 1.00 49.33  ? 36  VAL B N   1 
ATOM   2801 C  CA  . VAL B 1 35  ? 17.938  -7.193  -22.715 1.00 47.35  ? 36  VAL B CA  1 
ATOM   2802 C  C   . VAL B 1 35  ? 18.888  -6.601  -23.744 1.00 47.39  ? 36  VAL B C   1 
ATOM   2803 O  O   . VAL B 1 35  ? 20.106  -6.839  -23.689 1.00 47.78  ? 36  VAL B O   1 
ATOM   2804 C  CB  . VAL B 1 35  ? 18.152  -6.473  -21.365 1.00 47.29  ? 36  VAL B CB  1 
ATOM   2805 C  CG1 . VAL B 1 35  ? 18.016  -4.961  -21.514 1.00 44.58  ? 36  VAL B CG1 1 
ATOM   2806 C  CG2 . VAL B 1 35  ? 17.169  -6.980  -20.337 1.00 47.84  ? 36  VAL B CG2 1 
ATOM   2807 N  N   . PHE B 1 36  ? 18.327  -5.832  -24.670 1.00 45.48  ? 37  PHE B N   1 
ATOM   2808 C  CA  . PHE B 1 36  ? 19.124  -5.081  -25.625 1.00 46.51  ? 37  PHE B CA  1 
ATOM   2809 C  C   . PHE B 1 36  ? 19.387  -3.690  -25.036 1.00 48.45  ? 37  PHE B C   1 
ATOM   2810 O  O   . PHE B 1 36  ? 18.477  -2.858  -24.935 1.00 47.67  ? 37  PHE B O   1 
ATOM   2811 C  CB  . PHE B 1 36  ? 18.428  -5.047  -26.987 1.00 45.21  ? 37  PHE B CB  1 
ATOM   2812 C  CG  . PHE B 1 36  ? 18.300  -6.401  -27.633 1.00 46.09  ? 37  PHE B CG  1 
ATOM   2813 C  CD1 . PHE B 1 36  ? 17.199  -7.222  -27.364 1.00 45.59  ? 37  PHE B CD1 1 
ATOM   2814 C  CD2 . PHE B 1 36  ? 19.284  -6.864  -28.513 1.00 46.37  ? 37  PHE B CD2 1 
ATOM   2815 C  CE1 . PHE B 1 36  ? 17.082  -8.473  -27.959 1.00 46.56  ? 37  PHE B CE1 1 
ATOM   2816 C  CE2 . PHE B 1 36  ? 19.170  -8.114  -29.114 1.00 46.85  ? 37  PHE B CE2 1 
ATOM   2817 C  CZ  . PHE B 1 36  ? 18.067  -8.918  -28.837 1.00 47.58  ? 37  PHE B CZ  1 
ATOM   2818 N  N   . ASP B 1 37  ? 20.643  -3.460  -24.643 1.00 50.24  ? 38  ASP B N   1 
ATOM   2819 C  CA  . ASP B 1 37  ? 21.012  -2.373  -23.729 1.00 49.48  ? 38  ASP B CA  1 
ATOM   2820 C  C   . ASP B 1 37  ? 21.998  -1.371  -24.336 1.00 49.95  ? 38  ASP B C   1 
ATOM   2821 O  O   . ASP B 1 37  ? 23.193  -1.662  -24.471 1.00 52.74  ? 38  ASP B O   1 
ATOM   2822 C  CB  . ASP B 1 37  ? 21.556  -2.989  -22.424 1.00 51.44  ? 38  ASP B CB  1 
ATOM   2823 C  CG  . ASP B 1 37  ? 22.086  -1.955  -21.428 1.00 52.85  ? 38  ASP B CG  1 
ATOM   2824 O  OD1 . ASP B 1 37  ? 21.570  -0.814  -21.374 1.00 51.42  ? 38  ASP B OD1 1 
ATOM   2825 O  OD2 . ASP B 1 37  ? 23.024  -2.308  -20.674 1.00 53.37  ? 38  ASP B OD2 1 
ATOM   2826 N  N   . THR B 1 38  ? 21.488  -0.185  -24.671 1.00 47.06  ? 39  THR B N   1 
ATOM   2827 C  CA  . THR B 1 38  ? 22.310  0.911   -25.204 1.00 46.66  ? 39  THR B CA  1 
ATOM   2828 C  C   . THR B 1 38  ? 23.273  1.514   -24.174 1.00 49.13  ? 39  THR B C   1 
ATOM   2829 O  O   . THR B 1 38  ? 24.237  2.197   -24.543 1.00 52.19  ? 39  THR B O   1 
ATOM   2830 C  CB  . THR B 1 38  ? 21.461  2.029   -25.838 1.00 45.65  ? 39  THR B CB  1 
ATOM   2831 O  OG1 . THR B 1 38  ? 20.404  2.405   -24.947 1.00 45.26  ? 39  THR B OG1 1 
ATOM   2832 C  CG2 . THR B 1 38  ? 20.874  1.562   -27.171 1.00 44.68  ? 39  THR B CG2 1 
ATOM   2833 N  N   . GLY B 1 39  ? 23.013  1.245   -22.895 1.00 49.27  ? 40  GLY B N   1 
ATOM   2834 C  CA  . GLY B 1 39  ? 23.855  1.697   -21.789 1.00 49.00  ? 40  GLY B CA  1 
ATOM   2835 C  C   . GLY B 1 39  ? 25.144  0.924   -21.581 1.00 50.61  ? 40  GLY B C   1 
ATOM   2836 O  O   . GLY B 1 39  ? 25.968  1.324   -20.761 1.00 52.70  ? 40  GLY B O   1 
ATOM   2837 N  N   . SER B 1 40  ? 25.321  -0.181  -22.307 1.00 51.16  ? 41  SER B N   1 
ATOM   2838 C  CA  . SER B 1 40  ? 26.547  -0.996  -22.221 1.00 54.25  ? 41  SER B CA  1 
ATOM   2839 C  C   . SER B 1 40  ? 26.919  -1.631  -23.567 1.00 54.76  ? 41  SER B C   1 
ATOM   2840 O  O   . SER B 1 40  ? 26.140  -1.573  -24.520 1.00 53.99  ? 41  SER B O   1 
ATOM   2841 C  CB  . SER B 1 40  ? 26.405  -2.065  -21.141 1.00 53.88  ? 41  SER B CB  1 
ATOM   2842 O  OG  . SER B 1 40  ? 25.338  -2.938  -21.454 1.00 54.67  ? 41  SER B OG  1 
ATOM   2843 N  N   . SER B 1 41  ? 28.095  -2.252  -23.638 1.00 57.10  ? 42  SER B N   1 
ATOM   2844 C  CA  . SER B 1 41  ? 28.639  -2.694  -24.924 1.00 57.75  ? 42  SER B CA  1 
ATOM   2845 C  C   . SER B 1 41  ? 29.093  -4.147  -24.997 1.00 58.03  ? 42  SER B C   1 
ATOM   2846 O  O   . SER B 1 41  ? 29.700  -4.556  -25.985 1.00 60.95  ? 42  SER B O   1 
ATOM   2847 C  CB  . SER B 1 41  ? 29.769  -1.763  -25.349 1.00 58.21  ? 42  SER B CB  1 
ATOM   2848 O  OG  . SER B 1 41  ? 29.383  -0.409  -25.187 1.00 59.08  ? 42  SER B OG  1 
ATOM   2849 N  N   . ASN B 1 42  ? 28.782  -4.922  -23.964 1.00 58.70  ? 43  ASN B N   1 
ATOM   2850 C  CA  . ASN B 1 42  ? 29.127  -6.342  -23.925 1.00 58.91  ? 43  ASN B CA  1 
ATOM   2851 C  C   . ASN B 1 42  ? 27.925  -7.255  -24.086 1.00 59.13  ? 43  ASN B C   1 
ATOM   2852 O  O   . ASN B 1 42  ? 26.808  -6.908  -23.671 1.00 58.42  ? 43  ASN B O   1 
ATOM   2853 C  CB  . ASN B 1 42  ? 29.848  -6.675  -22.627 1.00 59.70  ? 43  ASN B CB  1 
ATOM   2854 C  CG  . ASN B 1 42  ? 31.211  -6.034  -22.550 1.00 61.71  ? 43  ASN B CG  1 
ATOM   2855 O  OD1 . ASN B 1 42  ? 31.336  -4.859  -22.216 1.00 61.37  ? 43  ASN B OD1 1 
ATOM   2856 N  ND2 . ASN B 1 42  ? 32.244  -6.806  -22.861 1.00 63.33  ? 43  ASN B ND2 1 
ATOM   2857 N  N   . VAL B 1 43  ? 28.159  -8.409  -24.710 1.00 59.69  ? 44  VAL B N   1 
ATOM   2858 C  CA  . VAL B 1 43  ? 27.187  -9.505  -24.705 1.00 59.43  ? 44  VAL B CA  1 
ATOM   2859 C  C   . VAL B 1 43  ? 27.596  -10.444 -23.580 1.00 61.85  ? 44  VAL B C   1 
ATOM   2860 O  O   . VAL B 1 43  ? 28.760  -10.863 -23.508 1.00 63.54  ? 44  VAL B O   1 
ATOM   2861 C  CB  . VAL B 1 43  ? 27.129  -10.292 -26.042 1.00 59.08  ? 44  VAL B CB  1 
ATOM   2862 C  CG1 . VAL B 1 43  ? 26.054  -11.376 -25.990 1.00 58.32  ? 44  VAL B CG1 1 
ATOM   2863 C  CG2 . VAL B 1 43  ? 26.878  -9.369  -27.228 1.00 57.11  ? 44  VAL B CG2 1 
ATOM   2864 N  N   . TRP B 1 44  ? 26.656  -10.746 -22.687 1.00 60.89  ? 45  TRP B N   1 
ATOM   2865 C  CA  . TRP B 1 44  ? 26.874  -11.796 -21.697 1.00 63.97  ? 45  TRP B CA  1 
ATOM   2866 C  C   . TRP B 1 44  ? 25.633  -12.642 -21.434 1.00 64.49  ? 45  TRP B C   1 
ATOM   2867 O  O   . TRP B 1 44  ? 24.510  -12.134 -21.414 1.00 63.92  ? 45  TRP B O   1 
ATOM   2868 C  CB  . TRP B 1 44  ? 27.491  -11.261 -20.388 1.00 65.15  ? 45  TRP B CB  1 
ATOM   2869 C  CG  . TRP B 1 44  ? 26.598  -10.378 -19.556 1.00 64.92  ? 45  TRP B CG  1 
ATOM   2870 C  CD1 . TRP B 1 44  ? 26.607  -9.013  -19.520 1.00 63.62  ? 45  TRP B CD1 1 
ATOM   2871 C  CD2 . TRP B 1 44  ? 25.587  -10.796 -18.621 1.00 64.94  ? 45  TRP B CD2 1 
ATOM   2872 N  NE1 . TRP B 1 44  ? 25.654  -8.551  -18.641 1.00 63.44  ? 45  TRP B NE1 1 
ATOM   2873 C  CE2 . TRP B 1 44  ? 25.014  -9.620  -18.071 1.00 64.11  ? 45  TRP B CE2 1 
ATOM   2874 C  CE3 . TRP B 1 44  ? 25.096  -12.047 -18.205 1.00 65.15  ? 45  TRP B CE3 1 
ATOM   2875 C  CZ2 . TRP B 1 44  ? 23.979  -9.656  -17.118 1.00 63.36  ? 45  TRP B CZ2 1 
ATOM   2876 C  CZ3 . TRP B 1 44  ? 24.068  -12.086 -17.257 1.00 65.85  ? 45  TRP B CZ3 1 
ATOM   2877 C  CH2 . TRP B 1 44  ? 23.520  -10.894 -16.727 1.00 65.29  ? 45  TRP B CH2 1 
ATOM   2878 N  N   . VAL B 1 45  ? 25.863  -13.939 -21.249 1.00 64.92  ? 46  VAL B N   1 
ATOM   2879 C  CA  . VAL B 1 45  ? 24.837  -14.884 -20.804 1.00 63.99  ? 46  VAL B CA  1 
ATOM   2880 C  C   . VAL B 1 45  ? 25.372  -15.668 -19.602 1.00 65.38  ? 46  VAL B C   1 
ATOM   2881 O  O   . VAL B 1 45  ? 26.594  -15.737 -19.424 1.00 68.20  ? 46  VAL B O   1 
ATOM   2882 C  CB  . VAL B 1 45  ? 24.353  -15.838 -21.941 1.00 63.96  ? 46  VAL B CB  1 
ATOM   2883 C  CG1 . VAL B 1 45  ? 23.604  -15.054 -23.015 1.00 62.01  ? 46  VAL B CG1 1 
ATOM   2884 C  CG2 . VAL B 1 45  ? 25.496  -16.662 -22.536 1.00 64.13  ? 46  VAL B CG2 1 
ATOM   2885 N  N   . PRO B 1 46  ? 24.472  -16.233 -18.762 1.00 64.70  ? 47  PRO B N   1 
ATOM   2886 C  CA  . PRO B 1 46  ? 24.927  -17.150 -17.714 1.00 67.06  ? 47  PRO B CA  1 
ATOM   2887 C  C   . PRO B 1 46  ? 25.553  -18.422 -18.296 1.00 69.16  ? 47  PRO B C   1 
ATOM   2888 O  O   . PRO B 1 46  ? 25.127  -18.906 -19.354 1.00 68.48  ? 47  PRO B O   1 
ATOM   2889 C  CB  . PRO B 1 46  ? 23.644  -17.496 -16.955 1.00 66.67  ? 47  PRO B CB  1 
ATOM   2890 C  CG  . PRO B 1 46  ? 22.680  -16.423 -17.286 1.00 63.76  ? 47  PRO B CG  1 
ATOM   2891 C  CD  . PRO B 1 46  ? 23.023  -15.973 -18.666 1.00 63.24  ? 47  PRO B CD  1 
ATOM   2892 N  N   . SER B 1 47  ? 26.561  -18.939 -17.601 1.00 71.68  ? 48  SER B N   1 
ATOM   2893 C  CA  . SER B 1 47  ? 27.308  -20.117 -18.036 1.00 73.59  ? 48  SER B CA  1 
ATOM   2894 C  C   . SER B 1 47  ? 26.805  -21.395 -17.364 1.00 75.69  ? 48  SER B C   1 
ATOM   2895 O  O   . SER B 1 47  ? 26.211  -21.342 -16.290 1.00 76.40  ? 48  SER B O   1 
ATOM   2896 C  CB  . SER B 1 47  ? 28.795  -19.916 -17.740 1.00 74.85  ? 48  SER B CB  1 
ATOM   2897 O  OG  . SER B 1 47  ? 29.536  -21.090 -18.012 1.00 77.54  ? 48  SER B OG  1 
ATOM   2898 N  N   . SER B 1 48  ? 27.043  -22.535 -18.013 1.00 77.27  ? 49  SER B N   1 
ATOM   2899 C  CA  . SER B 1 48  ? 26.841  -23.858 -17.409 1.00 80.17  ? 49  SER B CA  1 
ATOM   2900 C  C   . SER B 1 48  ? 27.905  -24.141 -16.346 1.00 83.51  ? 49  SER B C   1 
ATOM   2901 O  O   . SER B 1 48  ? 27.670  -24.914 -15.416 1.00 84.87  ? 49  SER B O   1 
ATOM   2902 C  CB  . SER B 1 48  ? 26.866  -24.955 -18.474 1.00 81.27  ? 49  SER B CB  1 
ATOM   2903 O  OG  . SER B 1 48  ? 28.106  -24.974 -19.163 1.00 81.97  ? 49  SER B OG  1 
ATOM   2904 N  N   . LYS B 1 49  ? 29.072  -23.511 -16.506 1.00 84.67  ? 50  LYS B N   1 
ATOM   2905 C  CA  . LYS B 1 49  ? 30.138  -23.524 -15.504 1.00 89.89  ? 50  LYS B CA  1 
ATOM   2906 C  C   . LYS B 1 49  ? 29.855  -22.580 -14.311 1.00 91.96  ? 50  LYS B C   1 
ATOM   2907 O  O   . LYS B 1 49  ? 30.713  -22.406 -13.441 1.00 95.01  ? 50  LYS B O   1 
ATOM   2908 C  CB  . LYS B 1 49  ? 31.502  -23.231 -16.156 1.00 88.33  ? 50  LYS B CB  1 
ATOM   2909 N  N   . CYS B 1 50  ? 28.657  -21.983 -14.278 1.00 93.57  ? 51  CYS B N   1 
ATOM   2910 C  CA  . CYS B 1 50  ? 28.157  -21.235 -13.111 1.00 97.38  ? 51  CYS B CA  1 
ATOM   2911 C  C   . CYS B 1 50  ? 27.902  -22.185 -11.946 1.00 103.08 ? 51  CYS B C   1 
ATOM   2912 O  O   . CYS B 1 50  ? 27.516  -23.342 -12.153 1.00 106.21 ? 51  CYS B O   1 
ATOM   2913 C  CB  . CYS B 1 50  ? 26.858  -20.487 -13.440 1.00 95.83  ? 51  CYS B CB  1 
ATOM   2914 S  SG  . CYS B 1 50  ? 26.272  -19.375 -12.131 1.00 100.39 ? 51  CYS B SG  1 
ATOM   2915 N  N   . SER B 1 51  ? 28.129  -21.689 -10.729 1.00 105.40 ? 52  SER B N   1 
ATOM   2916 C  CA  . SER B 1 51  ? 27.780  -22.412 -9.506  1.00 107.59 ? 52  SER B CA  1 
ATOM   2917 C  C   . SER B 1 51  ? 26.267  -22.622 -9.428  1.00 107.50 ? 52  SER B C   1 
ATOM   2918 O  O   . SER B 1 51  ? 25.482  -21.738 -9.804  1.00 102.63 ? 52  SER B O   1 
ATOM   2919 C  CB  . SER B 1 51  ? 28.275  -21.654 -8.272  1.00 108.65 ? 52  SER B CB  1 
ATOM   2920 O  OG  . SER B 1 51  ? 27.789  -22.231 -7.068  1.00 109.62 ? 52  SER B OG  1 
ATOM   2921 N  N   . ARG B 1 52  ? 25.876  -23.805 -8.957  1.00 110.84 ? 53  ARG B N   1 
ATOM   2922 C  CA  . ARG B 1 52  ? 24.468  -24.145 -8.744  1.00 110.63 ? 53  ARG B CA  1 
ATOM   2923 C  C   . ARG B 1 52  ? 23.899  -23.411 -7.524  1.00 110.41 ? 53  ARG B C   1 
ATOM   2924 O  O   . ARG B 1 52  ? 22.685  -23.196 -7.433  1.00 107.77 ? 53  ARG B O   1 
ATOM   2925 C  CB  . ARG B 1 52  ? 24.300  -25.662 -8.591  1.00 113.30 ? 53  ARG B CB  1 
ATOM   2926 N  N   . LEU B 1 53  ? 24.792  -23.018 -6.610  1.00 111.58 ? 54  LEU B N   1 
ATOM   2927 C  CA  . LEU B 1 53  ? 24.433  -22.410 -5.322  1.00 111.69 ? 54  LEU B CA  1 
ATOM   2928 C  C   . LEU B 1 53  ? 23.915  -20.967 -5.413  1.00 108.90 ? 54  LEU B C   1 
ATOM   2929 O  O   . LEU B 1 53  ? 23.327  -20.455 -4.451  1.00 109.10 ? 54  LEU B O   1 
ATOM   2930 C  CB  . LEU B 1 53  ? 25.595  -22.542 -4.327  1.00 114.24 ? 54  LEU B CB  1 
ATOM   2931 C  CG  . LEU B 1 53  ? 25.766  -23.937 -3.707  1.00 117.85 ? 54  LEU B CG  1 
ATOM   2932 C  CD1 . LEU B 1 53  ? 27.234  -24.311 -3.585  1.00 120.75 ? 54  LEU B CD1 1 
ATOM   2933 C  CD2 . LEU B 1 53  ? 25.059  -24.055 -2.360  1.00 120.27 ? 54  LEU B CD2 1 
ATOM   2934 N  N   . TYR B 1 54  ? 24.145  -20.323 -6.560  1.00 105.32 ? 55  TYR B N   1 
ATOM   2935 C  CA  . TYR B 1 54  ? 23.449  -19.094 -6.929  1.00 101.91 ? 55  TYR B CA  1 
ATOM   2936 C  C   . TYR B 1 54  ? 22.077  -19.484 -7.470  1.00 101.07 ? 55  TYR B C   1 
ATOM   2937 O  O   . TYR B 1 54  ? 21.980  -20.110 -8.534  1.00 99.90  ? 55  TYR B O   1 
ATOM   2938 C  CB  . TYR B 1 54  ? 24.214  -18.313 -8.005  1.00 98.76  ? 55  TYR B CB  1 
ATOM   2939 C  CG  . TYR B 1 54  ? 25.512  -17.674 -7.561  1.00 100.88 ? 55  TYR B CG  1 
ATOM   2940 C  CD1 . TYR B 1 54  ? 25.514  -16.482 -6.823  1.00 99.60  ? 55  TYR B CD1 1 
ATOM   2941 C  CD2 . TYR B 1 54  ? 26.747  -18.241 -7.910  1.00 103.87 ? 55  TYR B CD2 1 
ATOM   2942 C  CE1 . TYR B 1 54  ? 26.706  -15.882 -6.429  1.00 101.53 ? 55  TYR B CE1 1 
ATOM   2943 C  CE2 . TYR B 1 54  ? 27.946  -17.649 -7.519  1.00 105.97 ? 55  TYR B CE2 1 
ATOM   2944 C  CZ  . TYR B 1 54  ? 27.920  -16.470 -6.781  1.00 104.85 ? 55  TYR B CZ  1 
ATOM   2945 O  OH  . TYR B 1 54  ? 29.099  -15.880 -6.388  1.00 105.92 ? 55  TYR B OH  1 
ATOM   2946 N  N   . THR B 1 55  ? 21.026  -19.109 -6.736  1.00 101.76 ? 56  THR B N   1 
ATOM   2947 C  CA  . THR B 1 55  ? 19.628  -19.409 -7.098  1.00 100.67 ? 56  THR B CA  1 
ATOM   2948 C  C   . THR B 1 55  ? 19.277  -18.940 -8.517  1.00 98.48  ? 56  THR B C   1 
ATOM   2949 O  O   . THR B 1 55  ? 18.470  -19.577 -9.202  1.00 98.93  ? 56  THR B O   1 
ATOM   2950 C  CB  . THR B 1 55  ? 18.619  -18.796 -6.096  1.00 99.56  ? 56  THR B CB  1 
ATOM   2951 O  OG1 . THR B 1 55  ? 19.224  -18.658 -4.805  1.00 101.66 ? 56  THR B OG1 1 
ATOM   2952 C  CG2 . THR B 1 55  ? 17.375  -19.672 -5.974  1.00 100.18 ? 56  THR B CG2 1 
ATOM   2953 N  N   . ALA B 1 56  ? 19.902  -17.839 -8.943  1.00 97.39  ? 57  ALA B N   1 
ATOM   2954 C  CA  . ALA B 1 56  ? 19.733  -17.280 -10.288 1.00 94.25  ? 57  ALA B CA  1 
ATOM   2955 C  C   . ALA B 1 56  ? 20.221  -18.216 -11.399 1.00 95.23  ? 57  ALA B C   1 
ATOM   2956 O  O   . ALA B 1 56  ? 19.640  -18.237 -12.485 1.00 93.42  ? 57  ALA B O   1 
ATOM   2957 C  CB  . ALA B 1 56  ? 20.413  -15.922 -10.384 1.00 90.77  ? 57  ALA B CB  1 
ATOM   2958 N  N   . CYS B 1 57  ? 21.269  -18.994 -11.114 1.00 98.81  ? 58  CYS B N   1 
ATOM   2959 C  CA  . CYS B 1 57  ? 21.815  -19.968 -12.071 1.00 99.78  ? 58  CYS B CA  1 
ATOM   2960 C  C   . CYS B 1 57  ? 21.052  -21.308 -12.073 1.00 103.14 ? 58  CYS B C   1 
ATOM   2961 O  O   . CYS B 1 57  ? 21.540  -22.314 -12.606 1.00 105.68 ? 58  CYS B O   1 
ATOM   2962 C  CB  . CYS B 1 57  ? 23.332  -20.151 -11.866 1.00 100.11 ? 58  CYS B CB  1 
ATOM   2963 S  SG  . CYS B 1 57  ? 24.363  -18.865 -12.638 1.00 95.41  ? 58  CYS B SG  1 
ATOM   2964 N  N   . VAL B 1 58  ? 19.855  -21.301 -11.478 1.00 105.89 ? 59  VAL B N   1 
ATOM   2965 C  CA  . VAL B 1 58  ? 18.919  -22.441 -11.495 1.00 108.71 ? 59  VAL B CA  1 
ATOM   2966 C  C   . VAL B 1 58  ? 17.636  -22.049 -12.245 1.00 107.04 ? 59  VAL B C   1 
ATOM   2967 O  O   . VAL B 1 58  ? 17.130  -22.825 -13.060 1.00 105.61 ? 59  VAL B O   1 
ATOM   2968 C  CB  . VAL B 1 58  ? 18.570  -22.965 -10.071 1.00 110.70 ? 59  VAL B CB  1 
ATOM   2969 C  CG1 . VAL B 1 58  ? 17.823  -24.292 -10.146 1.00 113.03 ? 59  VAL B CG1 1 
ATOM   2970 C  CG2 . VAL B 1 58  ? 19.821  -23.139 -9.220  1.00 113.19 ? 59  VAL B CG2 1 
ATOM   2971 N  N   . TYR B 1 59  ? 17.129  -20.844 -11.971 1.00 108.78 ? 60  TYR B N   1 
ATOM   2972 C  CA  . TYR B 1 59  ? 15.907  -20.331 -12.615 1.00 109.28 ? 60  TYR B CA  1 
ATOM   2973 C  C   . TYR B 1 59  ? 16.185  -19.489 -13.878 1.00 103.15 ? 60  TYR B C   1 
ATOM   2974 O  O   . TYR B 1 59  ? 15.355  -18.675 -14.299 1.00 103.13 ? 60  TYR B O   1 
ATOM   2975 C  CB  . TYR B 1 59  ? 15.001  -19.599 -11.597 1.00 112.10 ? 60  TYR B CB  1 
ATOM   2976 C  CG  . TYR B 1 59  ? 14.600  -20.434 -10.378 1.00 119.58 ? 60  TYR B CG  1 
ATOM   2977 C  CD1 . TYR B 1 59  ? 14.015  -21.709 -10.524 1.00 122.78 ? 60  TYR B CD1 1 
ATOM   2978 C  CD2 . TYR B 1 59  ? 14.790  -19.943 -9.077  1.00 120.48 ? 60  TYR B CD2 1 
ATOM   2979 C  CE1 . TYR B 1 59  ? 13.652  -22.467 -9.414  1.00 126.74 ? 60  TYR B CE1 1 
ATOM   2980 C  CE2 . TYR B 1 59  ? 14.425  -20.693 -7.962  1.00 124.85 ? 60  TYR B CE2 1 
ATOM   2981 C  CZ  . TYR B 1 59  ? 13.859  -21.951 -8.134  1.00 128.59 ? 60  TYR B CZ  1 
ATOM   2982 O  OH  . TYR B 1 59  ? 13.499  -22.693 -7.031  1.00 131.46 ? 60  TYR B OH  1 
ATOM   2983 N  N   . HIS B 1 60  ? 17.358  -19.706 -14.472 1.00 98.85  ? 61  HIS B N   1 
ATOM   2984 C  CA  . HIS B 1 60  ? 17.710  -19.147 -15.778 1.00 93.84  ? 61  HIS B CA  1 
ATOM   2985 C  C   . HIS B 1 60  ? 18.334  -20.217 -16.662 1.00 91.64  ? 61  HIS B C   1 
ATOM   2986 O  O   . HIS B 1 60  ? 18.906  -21.196 -16.163 1.00 92.72  ? 61  HIS B O   1 
ATOM   2987 C  CB  . HIS B 1 60  ? 18.680  -17.973 -15.630 1.00 94.39  ? 61  HIS B CB  1 
ATOM   2988 C  CG  . HIS B 1 60  ? 18.042  -16.725 -15.109 1.00 93.71  ? 61  HIS B CG  1 
ATOM   2989 N  ND1 . HIS B 1 60  ? 17.894  -16.470 -13.762 1.00 95.99  ? 61  HIS B ND1 1 
ATOM   2990 C  CD2 . HIS B 1 60  ? 17.508  -15.664 -15.754 1.00 91.11  ? 61  HIS B CD2 1 
ATOM   2991 C  CE1 . HIS B 1 60  ? 17.297  -15.303 -13.602 1.00 94.50  ? 61  HIS B CE1 1 
ATOM   2992 N  NE2 . HIS B 1 60  ? 17.055  -14.791 -14.796 1.00 91.50  ? 61  HIS B NE2 1 
ATOM   2993 N  N   . LYS B 1 61  ? 18.209  -20.029 -17.974 1.00 85.93  ? 62  LYS B N   1 
ATOM   2994 C  CA  . LYS B 1 61  ? 18.890  -20.882 -18.940 1.00 83.62  ? 62  LYS B CA  1 
ATOM   2995 C  C   . LYS B 1 61  ? 20.387  -20.558 -18.925 1.00 80.65  ? 62  LYS B C   1 
ATOM   2996 O  O   . LYS B 1 61  ? 20.777  -19.392 -18.852 1.00 80.20  ? 62  LYS B O   1 
ATOM   2997 C  CB  . LYS B 1 61  ? 18.302  -20.706 -20.346 1.00 80.39  ? 62  LYS B CB  1 
ATOM   2998 C  CG  . LYS B 1 61  ? 18.095  -22.027 -21.067 1.00 82.74  ? 62  LYS B CG  1 
ATOM   2999 C  CD  . LYS B 1 61  ? 18.155  -21.881 -22.573 1.00 81.73  ? 62  LYS B CD  1 
ATOM   3000 C  CE  . LYS B 1 61  ? 18.461  -23.215 -23.240 1.00 87.92  ? 62  LYS B CE  1 
ATOM   3001 N  NZ  . LYS B 1 61  ? 18.883  -23.069 -24.663 1.00 86.98  ? 62  LYS B NZ  1 
ATOM   3002 N  N   . LEU B 1 62  ? 21.214  -21.594 -18.974 1.00 78.38  ? 63  LEU B N   1 
ATOM   3003 C  CA  . LEU B 1 62  ? 22.658  -21.421 -18.952 1.00 75.95  ? 63  LEU B CA  1 
ATOM   3004 C  C   . LEU B 1 62  ? 23.250  -21.886 -20.272 1.00 74.86  ? 63  LEU B C   1 
ATOM   3005 O  O   . LEU B 1 62  ? 22.807  -22.892 -20.827 1.00 76.62  ? 63  LEU B O   1 
ATOM   3006 C  CB  . LEU B 1 62  ? 23.280  -22.199 -17.784 1.00 78.72  ? 63  LEU B CB  1 
ATOM   3007 C  CG  . LEU B 1 62  ? 22.610  -22.226 -16.399 1.00 78.90  ? 63  LEU B CG  1 
ATOM   3008 C  CD1 . LEU B 1 62  ? 23.373  -23.123 -15.436 1.00 79.69  ? 63  LEU B CD1 1 
ATOM   3009 C  CD2 . LEU B 1 62  ? 22.434  -20.833 -15.811 1.00 76.83  ? 63  LEU B CD2 1 
ATOM   3010 N  N   . PHE B 1 63  ? 24.236  -21.141 -20.775 1.00 72.13  ? 64  PHE B N   1 
ATOM   3011 C  CA  . PHE B 1 63  ? 24.990  -21.547 -21.962 1.00 70.81  ? 64  PHE B CA  1 
ATOM   3012 C  C   . PHE B 1 63  ? 25.938  -22.696 -21.648 1.00 73.90  ? 64  PHE B C   1 
ATOM   3013 O  O   . PHE B 1 63  ? 26.716  -22.634 -20.696 1.00 74.32  ? 64  PHE B O   1 
ATOM   3014 C  CB  . PHE B 1 63  ? 25.751  -20.366 -22.577 1.00 68.43  ? 64  PHE B CB  1 
ATOM   3015 C  CG  . PHE B 1 63  ? 26.602  -20.735 -23.765 1.00 68.22  ? 64  PHE B CG  1 
ATOM   3016 C  CD1 . PHE B 1 63  ? 26.019  -21.038 -25.000 1.00 67.30  ? 64  PHE B CD1 1 
ATOM   3017 C  CD2 . PHE B 1 63  ? 27.991  -20.777 -23.652 1.00 69.41  ? 64  PHE B CD2 1 
ATOM   3018 C  CE1 . PHE B 1 63  ? 26.808  -21.386 -26.095 1.00 67.80  ? 64  PHE B CE1 1 
ATOM   3019 C  CE2 . PHE B 1 63  ? 28.783  -21.118 -24.744 1.00 70.83  ? 64  PHE B CE2 1 
ATOM   3020 C  CZ  . PHE B 1 63  ? 28.191  -21.422 -25.967 1.00 69.66  ? 64  PHE B CZ  1 
ATOM   3021 N  N   . ASP B 1 64  ? 25.855  -23.735 -22.470 1.00 76.44  ? 65  ASP B N   1 
ATOM   3022 C  CA  . ASP B 1 64  ? 26.678  -24.928 -22.334 1.00 80.57  ? 65  ASP B CA  1 
ATOM   3023 C  C   . ASP B 1 64  ? 27.570  -25.061 -23.567 1.00 80.92  ? 65  ASP B C   1 
ATOM   3024 O  O   . ASP B 1 64  ? 27.119  -25.511 -24.629 1.00 81.45  ? 65  ASP B O   1 
ATOM   3025 C  CB  . ASP B 1 64  ? 25.786  -26.159 -22.136 1.00 82.01  ? 65  ASP B CB  1 
ATOM   3026 C  CG  . ASP B 1 64  ? 26.574  -27.407 -21.828 1.00 85.13  ? 65  ASP B CG  1 
ATOM   3027 O  OD1 . ASP B 1 64  ? 27.203  -27.954 -22.755 1.00 86.88  ? 65  ASP B OD1 1 
ATOM   3028 O  OD2 . ASP B 1 64  ? 26.556  -27.848 -20.662 1.00 87.05  ? 65  ASP B OD2 1 
ATOM   3029 N  N   . ALA B 1 65  ? 28.832  -24.662 -23.407 1.00 81.40  ? 66  ALA B N   1 
ATOM   3030 C  CA  . ALA B 1 65  ? 29.809  -24.599 -24.500 1.00 80.59  ? 66  ALA B CA  1 
ATOM   3031 C  C   . ALA B 1 65  ? 30.072  -25.943 -25.199 1.00 82.78  ? 66  ALA B C   1 
ATOM   3032 O  O   . ALA B 1 65  ? 30.273  -25.979 -26.415 1.00 82.36  ? 66  ALA B O   1 
ATOM   3033 C  CB  . ALA B 1 65  ? 31.108  -23.979 -24.005 1.00 80.61  ? 66  ALA B CB  1 
ATOM   3034 N  N   . SER B 1 66  ? 30.041  -27.034 -24.433 1.00 85.30  ? 67  SER B N   1 
ATOM   3035 C  CA  . SER B 1 66  ? 30.307  -28.381 -24.956 1.00 87.93  ? 67  SER B CA  1 
ATOM   3036 C  C   . SER B 1 66  ? 29.242  -28.896 -25.935 1.00 87.83  ? 67  SER B C   1 
ATOM   3037 O  O   . SER B 1 66  ? 29.511  -29.814 -26.715 1.00 89.63  ? 67  SER B O   1 
ATOM   3038 C  CB  . SER B 1 66  ? 30.517  -29.374 -23.811 1.00 90.30  ? 67  SER B CB  1 
ATOM   3039 O  OG  . SER B 1 66  ? 29.358  -29.495 -23.012 1.00 89.39  ? 67  SER B OG  1 
ATOM   3040 N  N   . ASP B 1 67  ? 28.052  -28.294 -25.896 1.00 86.45  ? 68  ASP B N   1 
ATOM   3041 C  CA  . ASP B 1 67  ? 26.966  -28.601 -26.835 1.00 86.67  ? 68  ASP B CA  1 
ATOM   3042 C  C   . ASP B 1 67  ? 26.973  -27.716 -28.094 1.00 84.62  ? 68  ASP B C   1 
ATOM   3043 O  O   . ASP B 1 67  ? 25.945  -27.584 -28.769 1.00 85.60  ? 68  ASP B O   1 
ATOM   3044 C  CB  . ASP B 1 67  ? 25.602  -28.486 -26.134 1.00 86.89  ? 68  ASP B CB  1 
ATOM   3045 C  CG  . ASP B 1 67  ? 25.426  -29.476 -24.997 1.00 90.58  ? 68  ASP B CG  1 
ATOM   3046 O  OD1 . ASP B 1 67  ? 26.035  -30.572 -25.025 1.00 95.41  ? 68  ASP B OD1 1 
ATOM   3047 O  OD2 . ASP B 1 67  ? 24.655  -29.153 -24.069 1.00 90.03  ? 68  ASP B OD2 1 
ATOM   3048 N  N   . SER B 1 68  ? 28.117  -27.112 -28.410 1.00 83.23  ? 69  SER B N   1 
ATOM   3049 C  CA  . SER B 1 68  ? 28.223  -26.237 -29.578 1.00 80.38  ? 69  SER B CA  1 
ATOM   3050 C  C   . SER B 1 68  ? 29.465  -26.519 -30.418 1.00 81.62  ? 69  SER B C   1 
ATOM   3051 O  O   . SER B 1 68  ? 30.597  -26.282 -29.983 1.00 82.05  ? 69  SER B O   1 
ATOM   3052 C  CB  . SER B 1 68  ? 28.160  -24.764 -29.168 1.00 77.77  ? 69  SER B CB  1 
ATOM   3053 O  OG  . SER B 1 68  ? 28.440  -23.913 -30.269 1.00 75.85  ? 69  SER B OG  1 
ATOM   3054 N  N   . SER B 1 69  ? 29.230  -27.003 -31.636 1.00 82.14  ? 70  SER B N   1 
ATOM   3055 C  CA  . SER B 1 69  ? 30.300  -27.322 -32.584 1.00 84.13  ? 70  SER B CA  1 
ATOM   3056 C  C   . SER B 1 69  ? 30.989  -26.074 -33.173 1.00 82.90  ? 70  SER B C   1 
ATOM   3057 O  O   . SER B 1 69  ? 31.984  -26.197 -33.899 1.00 83.18  ? 70  SER B O   1 
ATOM   3058 C  CB  . SER B 1 69  ? 29.773  -28.244 -33.693 1.00 84.78  ? 70  SER B CB  1 
ATOM   3059 O  OG  . SER B 1 69  ? 28.708  -27.639 -34.404 1.00 82.62  ? 70  SER B OG  1 
ATOM   3060 N  N   . SER B 1 70  ? 30.465  -24.889 -32.842 1.00 79.64  ? 71  SER B N   1 
ATOM   3061 C  CA  . SER B 1 70  ? 31.026  -23.608 -33.294 1.00 78.36  ? 71  SER B CA  1 
ATOM   3062 C  C   . SER B 1 70  ? 31.651  -22.749 -32.176 1.00 77.55  ? 71  SER B C   1 
ATOM   3063 O  O   . SER B 1 70  ? 32.123  -21.637 -32.435 1.00 75.69  ? 71  SER B O   1 
ATOM   3064 C  CB  . SER B 1 70  ? 29.976  -22.811 -34.078 1.00 76.34  ? 71  SER B CB  1 
ATOM   3065 O  OG  . SER B 1 70  ? 28.769  -22.685 -33.344 1.00 76.48  ? 71  SER B OG  1 
ATOM   3066 N  N   . TYR B 1 71  ? 31.655  -23.269 -30.949 1.00 79.42  ? 72  TYR B N   1 
ATOM   3067 C  CA  . TYR B 1 71  ? 32.330  -22.626 -29.815 1.00 81.21  ? 72  TYR B CA  1 
ATOM   3068 C  C   . TYR B 1 71  ? 33.851  -22.641 -29.979 1.00 84.34  ? 72  TYR B C   1 
ATOM   3069 O  O   . TYR B 1 71  ? 34.436  -23.673 -30.313 1.00 86.42  ? 72  TYR B O   1 
ATOM   3070 C  CB  . TYR B 1 71  ? 31.918  -23.292 -28.489 1.00 83.19  ? 72  TYR B CB  1 
ATOM   3071 C  CG  . TYR B 1 71  ? 32.765  -22.934 -27.269 1.00 85.14  ? 72  TYR B CG  1 
ATOM   3072 C  CD1 . TYR B 1 71  ? 32.674  -21.667 -26.667 1.00 83.57  ? 72  TYR B CD1 1 
ATOM   3073 C  CD2 . TYR B 1 71  ? 33.642  -23.873 -26.701 1.00 87.89  ? 72  TYR B CD2 1 
ATOM   3074 C  CE1 . TYR B 1 71  ? 33.439  -21.345 -25.550 1.00 84.90  ? 72  TYR B CE1 1 
ATOM   3075 C  CE2 . TYR B 1 71  ? 34.410  -23.559 -25.581 1.00 89.73  ? 72  TYR B CE2 1 
ATOM   3076 C  CZ  . TYR B 1 71  ? 34.303  -22.297 -25.009 1.00 88.55  ? 72  TYR B CZ  1 
ATOM   3077 O  OH  . TYR B 1 71  ? 35.059  -21.972 -23.904 1.00 90.66  ? 72  TYR B OH  1 
ATOM   3078 N  N   . LYS B 1 72  ? 34.462  -21.476 -29.760 1.00 84.91  ? 73  LYS B N   1 
ATOM   3079 C  CA  . LYS B 1 72  ? 35.916  -21.318 -29.679 1.00 87.91  ? 73  LYS B CA  1 
ATOM   3080 C  C   . LYS B 1 72  ? 36.265  -20.756 -28.301 1.00 89.66  ? 73  LYS B C   1 
ATOM   3081 O  O   . LYS B 1 72  ? 35.726  -19.718 -27.888 1.00 87.68  ? 73  LYS B O   1 
ATOM   3082 C  CB  . LYS B 1 72  ? 36.451  -20.405 -30.798 1.00 86.86  ? 73  LYS B CB  1 
ATOM   3083 C  CG  . LYS B 1 72  ? 36.433  -21.012 -32.199 1.00 88.12  ? 73  LYS B CG  1 
ATOM   3084 C  CD  . LYS B 1 72  ? 37.698  -21.804 -32.499 1.00 93.10  ? 73  LYS B CD  1 
ATOM   3085 C  CE  . LYS B 1 72  ? 37.440  -22.945 -33.472 1.00 94.41  ? 73  LYS B CE  1 
ATOM   3086 N  NZ  . LYS B 1 72  ? 38.562  -23.930 -33.456 1.00 97.58  ? 73  LYS B NZ  1 
ATOM   3087 N  N   . HIS B 1 73  ? 37.147  -21.465 -27.594 1.00 93.61  ? 74  HIS B N   1 
ATOM   3088 C  CA  . HIS B 1 73  ? 37.572  -21.109 -26.238 1.00 94.82  ? 74  HIS B CA  1 
ATOM   3089 C  C   . HIS B 1 73  ? 38.381  -19.809 -26.214 1.00 94.92  ? 74  HIS B C   1 
ATOM   3090 O  O   . HIS B 1 73  ? 39.177  -19.553 -27.120 1.00 94.70  ? 74  HIS B O   1 
ATOM   3091 C  CB  . HIS B 1 73  ? 38.390  -22.259 -25.628 1.00 97.91  ? 74  HIS B CB  1 
ATOM   3092 C  CG  . HIS B 1 73  ? 38.923  -21.966 -24.258 1.00 99.94  ? 74  HIS B CG  1 
ATOM   3093 N  ND1 . HIS B 1 73  ? 38.145  -22.045 -23.123 1.00 99.91  ? 74  HIS B ND1 1 
ATOM   3094 C  CD2 . HIS B 1 73  ? 40.154  -21.580 -23.844 1.00 102.50 ? 74  HIS B CD2 1 
ATOM   3095 C  CE1 . HIS B 1 73  ? 38.874  -21.727 -22.068 1.00 101.64 ? 74  HIS B CE1 1 
ATOM   3096 N  NE2 . HIS B 1 73  ? 40.096  -21.440 -22.478 1.00 103.87 ? 74  HIS B NE2 1 
ATOM   3097 N  N   . ASN B 1 74  ? 38.154  -18.990 -25.188 1.00 95.80  ? 75  ASN B N   1 
ATOM   3098 C  CA  . ASN B 1 74  ? 39.044  -17.866 -24.887 1.00 99.40  ? 75  ASN B CA  1 
ATOM   3099 C  C   . ASN B 1 74  ? 39.463  -17.840 -23.414 1.00 99.12  ? 75  ASN B C   1 
ATOM   3100 O  O   . ASN B 1 74  ? 40.654  -17.913 -23.112 1.00 101.81 ? 75  ASN B O   1 
ATOM   3101 C  CB  . ASN B 1 74  ? 38.455  -16.528 -25.356 1.00 100.23 ? 75  ASN B CB  1 
ATOM   3102 C  CG  . ASN B 1 74  ? 39.443  -15.381 -25.235 1.00 108.12 ? 75  ASN B CG  1 
ATOM   3103 O  OD1 . ASN B 1 74  ? 39.550  -14.758 -24.180 1.00 105.59 ? 75  ASN B OD1 1 
ATOM   3104 N  ND2 . ASN B 1 74  ? 40.166  -15.095 -26.324 1.00 118.20 ? 75  ASN B ND2 1 
ATOM   3105 N  N   . GLY B 1 75  ? 38.485  -17.741 -22.515 1.00 96.76  ? 76  GLY B N   1 
ATOM   3106 C  CA  . GLY B 1 75  ? 38.715  -17.884 -21.073 1.00 97.41  ? 76  GLY B CA  1 
ATOM   3107 C  C   . GLY B 1 75  ? 39.178  -16.666 -20.288 1.00 96.82  ? 76  GLY B C   1 
ATOM   3108 O  O   . GLY B 1 75  ? 39.342  -16.758 -19.069 1.00 97.69  ? 76  GLY B O   1 
ATOM   3109 N  N   . THR B 1 76  ? 39.388  -15.539 -20.975 1.00 95.18  ? 77  THR B N   1 
ATOM   3110 C  CA  . THR B 1 76  ? 39.807  -14.269 -20.354 1.00 96.03  ? 77  THR B CA  1 
ATOM   3111 C  C   . THR B 1 76  ? 38.781  -13.798 -19.316 1.00 95.87  ? 77  THR B C   1 
ATOM   3112 O  O   . THR B 1 76  ? 37.589  -13.695 -19.620 1.00 92.67  ? 77  THR B O   1 
ATOM   3113 C  CB  . THR B 1 76  ? 40.066  -13.175 -21.429 1.00 93.66  ? 77  THR B CB  1 
ATOM   3114 O  OG1 . THR B 1 76  ? 41.232  -13.522 -22.189 1.00 96.87  ? 77  THR B OG1 1 
ATOM   3115 C  CG2 . THR B 1 76  ? 40.267  -11.781 -20.821 1.00 91.42  ? 77  THR B CG2 1 
ATOM   3116 N  N   . GLU B 1 77  ? 39.263  -13.540 -18.098 1.00 100.29 ? 78  GLU B N   1 
ATOM   3117 C  CA  . GLU B 1 77  ? 38.446  -13.028 -16.993 1.00 101.15 ? 78  GLU B CA  1 
ATOM   3118 C  C   . GLU B 1 77  ? 37.945  -11.619 -17.316 1.00 99.24  ? 78  GLU B C   1 
ATOM   3119 O  O   . GLU B 1 77  ? 38.680  -10.805 -17.883 1.00 99.92  ? 78  GLU B O   1 
ATOM   3120 C  CB  . GLU B 1 77  ? 39.262  -12.998 -15.697 1.00 106.26 ? 78  GLU B CB  1 
ATOM   3121 C  CG  . GLU B 1 77  ? 38.514  -13.470 -14.457 1.00 108.60 ? 78  GLU B CG  1 
ATOM   3122 C  CD  . GLU B 1 77  ? 38.826  -14.916 -14.089 1.00 113.94 ? 78  GLU B CD  1 
ATOM   3123 O  OE1 . GLU B 1 77  ? 39.980  -15.212 -13.700 1.00 117.98 ? 78  GLU B OE1 1 
ATOM   3124 O  OE2 . GLU B 1 77  ? 37.910  -15.762 -14.171 1.00 114.09 ? 78  GLU B OE2 1 
ATOM   3125 N  N   . LEU B 1 78  ? 36.687  -11.350 -16.976 1.00 98.23  ? 79  LEU B N   1 
ATOM   3126 C  CA  . LEU B 1 78  ? 36.084  -10.034 -17.179 1.00 95.90  ? 79  LEU B CA  1 
ATOM   3127 C  C   . LEU B 1 78  ? 35.002  -9.753  -16.141 1.00 95.09  ? 79  LEU B C   1 
ATOM   3128 O  O   . LEU B 1 78  ? 34.285  -10.665 -15.711 1.00 93.87  ? 79  LEU B O   1 
ATOM   3129 C  CB  . LEU B 1 78  ? 35.544  -9.880  -18.617 1.00 95.20  ? 79  LEU B CB  1 
ATOM   3130 C  CG  . LEU B 1 78  ? 34.141  -10.300 -19.094 1.00 94.29  ? 79  LEU B CG  1 
ATOM   3131 C  CD1 . LEU B 1 78  ? 33.869  -9.739  -20.481 1.00 92.74  ? 79  LEU B CD1 1 
ATOM   3132 C  CD2 . LEU B 1 78  ? 33.936  -11.807 -19.095 1.00 96.95  ? 79  LEU B CD2 1 
ATOM   3133 N  N   . THR B 1 79  ? 34.905  -8.485  -15.744 1.00 94.67  ? 80  THR B N   1 
ATOM   3134 C  CA  . THR B 1 79  ? 33.898  -8.031  -14.786 1.00 94.16  ? 80  THR B CA  1 
ATOM   3135 C  C   . THR B 1 79  ? 33.051  -6.920  -15.411 1.00 90.88  ? 80  THR B C   1 
ATOM   3136 O  O   . THR B 1 79  ? 33.572  -5.859  -15.769 1.00 88.52  ? 80  THR B O   1 
ATOM   3137 C  CB  . THR B 1 79  ? 34.533  -7.560  -13.451 1.00 97.51  ? 80  THR B CB  1 
ATOM   3138 O  OG1 . THR B 1 79  ? 35.571  -8.468  -13.048 1.00 98.84  ? 80  THR B OG1 1 
ATOM   3139 C  CG2 . THR B 1 79  ? 33.477  -7.466  -12.342 1.00 96.28  ? 80  THR B CG2 1 
ATOM   3140 N  N   . LEU B 1 80  ? 31.752  -7.194  -15.556 1.00 91.59  ? 81  LEU B N   1 
ATOM   3141 C  CA  . LEU B 1 80  ? 30.763  -6.220  -16.040 1.00 89.39  ? 81  LEU B CA  1 
ATOM   3142 C  C   . LEU B 1 80  ? 29.916  -5.717  -14.869 1.00 91.75  ? 81  LEU B C   1 
ATOM   3143 O  O   . LEU B 1 80  ? 29.393  -6.515  -14.087 1.00 92.49  ? 81  LEU B O   1 
ATOM   3144 C  CB  . LEU B 1 80  ? 29.853  -6.823  -17.132 1.00 86.48  ? 81  LEU B CB  1 
ATOM   3145 C  CG  . LEU B 1 80  ? 30.305  -7.600  -18.391 1.00 85.55  ? 81  LEU B CG  1 
ATOM   3146 C  CD1 . LEU B 1 80  ? 31.522  -6.993  -19.076 1.00 85.25  ? 81  LEU B CD1 1 
ATOM   3147 C  CD2 . LEU B 1 80  ? 30.543  -9.081  -18.120 1.00 86.97  ? 81  LEU B CD2 1 
ATOM   3148 N  N   . ARG B 1 81  ? 29.796  -4.395  -14.749 0.80 95.15  ? 82  ARG B N   1 
ATOM   3149 C  CA  . ARG B 1 81  ? 29.053  -3.764  -13.653 0.80 97.36  ? 82  ARG B CA  1 
ATOM   3150 C  C   . ARG B 1 81  ? 27.854  -2.974  -14.179 0.80 96.04  ? 82  ARG B C   1 
ATOM   3151 O  O   . ARG B 1 81  ? 26.955  -2.596  -13.394 0.80 98.18  ? 82  ARG B O   1 
ATOM   3152 C  CB  . ARG B 1 81  ? 29.978  -2.863  -12.828 0.80 97.21  ? 82  ARG B CB  1 
ATOM   3153 N  N   . THR B 1 86  ? 26.364  -5.943  -10.986 1.00 90.96  ? 87  THR B N   1 
ATOM   3154 C  CA  . THR B 1 86  ? 27.753  -6.416  -10.912 1.00 95.56  ? 87  THR B CA  1 
ATOM   3155 C  C   . THR B 1 86  ? 27.863  -7.932  -11.157 1.00 94.77  ? 87  THR B C   1 
ATOM   3156 O  O   . THR B 1 86  ? 27.212  -8.745  -10.486 1.00 93.40  ? 87  THR B O   1 
ATOM   3157 C  CB  . THR B 1 86  ? 28.430  -5.981  -9.591  1.00 98.24  ? 87  THR B CB  1 
ATOM   3158 O  OG1 . THR B 1 86  ? 28.328  -4.555  -9.469  1.00 98.31  ? 87  THR B OG1 1 
ATOM   3159 C  CG2 . THR B 1 86  ? 29.913  -6.388  -9.550  1.00 98.51  ? 87  THR B CG2 1 
ATOM   3160 N  N   . VAL B 1 87  ? 28.708  -8.282  -12.126 1.00 93.10  ? 88  VAL B N   1 
ATOM   3161 C  CA  . VAL B 1 87  ? 28.762  -9.622  -12.707 1.00 91.67  ? 88  VAL B CA  1 
ATOM   3162 C  C   . VAL B 1 87  ? 30.171  -9.958  -13.211 1.00 90.94  ? 88  VAL B C   1 
ATOM   3163 O  O   . VAL B 1 87  ? 30.843  -9.126  -13.827 1.00 89.41  ? 88  VAL B O   1 
ATOM   3164 C  CB  . VAL B 1 87  ? 27.651  -9.778  -13.793 1.00 90.22  ? 88  VAL B CB  1 
ATOM   3165 C  CG1 . VAL B 1 87  ? 28.175  -10.252 -15.147 1.00 90.16  ? 88  VAL B CG1 1 
ATOM   3166 C  CG2 . VAL B 1 87  ? 26.535  -10.672 -13.282 1.00 90.53  ? 88  VAL B CG2 1 
ATOM   3167 N  N   . SER B 1 88  ? 30.608  -11.180 -12.927 1.00 90.92  ? 89  SER B N   1 
ATOM   3168 C  CA  . SER B 1 88  ? 31.916  -11.654 -13.355 1.00 90.27  ? 89  SER B CA  1 
ATOM   3169 C  C   . SER B 1 88  ? 31.789  -12.965 -14.112 1.00 88.87  ? 89  SER B C   1 
ATOM   3170 O  O   . SER B 1 88  ? 30.880  -13.761 -13.852 1.00 87.91  ? 89  SER B O   1 
ATOM   3171 C  CB  . SER B 1 88  ? 32.844  -11.826 -12.154 1.00 95.05  ? 89  SER B CB  1 
ATOM   3172 O  OG  . SER B 1 88  ? 32.852  -10.664 -11.342 1.00 97.29  ? 89  SER B OG  1 
ATOM   3173 N  N   . GLY B 1 89  ? 32.705  -13.170 -15.055 1.00 88.22  ? 90  GLY B N   1 
ATOM   3174 C  CA  . GLY B 1 89  ? 32.801  -14.419 -15.796 1.00 87.60  ? 90  GLY B CA  1 
ATOM   3175 C  C   . GLY B 1 89  ? 34.002  -14.464 -16.713 1.00 87.86  ? 90  GLY B C   1 
ATOM   3176 O  O   . GLY B 1 89  ? 34.990  -13.758 -16.493 1.00 91.11  ? 90  GLY B O   1 
ATOM   3177 N  N   . PHE B 1 90  ? 33.911  -15.301 -17.744 1.00 85.54  ? 91  PHE B N   1 
ATOM   3178 C  CA  . PHE B 1 90  ? 34.986  -15.470 -18.721 1.00 84.63  ? 91  PHE B CA  1 
ATOM   3179 C  C   . PHE B 1 90  ? 34.512  -15.226 -20.158 1.00 81.59  ? 91  PHE B C   1 
ATOM   3180 O  O   . PHE B 1 90  ? 33.313  -15.302 -20.450 1.00 78.24  ? 91  PHE B O   1 
ATOM   3181 C  CB  . PHE B 1 90  ? 35.696  -16.830 -18.561 1.00 86.16  ? 91  PHE B CB  1 
ATOM   3182 C  CG  . PHE B 1 90  ? 34.817  -18.030 -18.809 1.00 85.24  ? 91  PHE B CG  1 
ATOM   3183 C  CD1 . PHE B 1 90  ? 34.074  -18.602 -17.770 1.00 85.18  ? 91  PHE B CD1 1 
ATOM   3184 C  CD2 . PHE B 1 90  ? 34.761  -18.620 -20.076 1.00 84.44  ? 91  PHE B CD2 1 
ATOM   3185 C  CE1 . PHE B 1 90  ? 33.273  -19.719 -17.995 1.00 85.22  ? 91  PHE B CE1 1 
ATOM   3186 C  CE2 . PHE B 1 90  ? 33.964  -19.741 -20.304 1.00 85.13  ? 91  PHE B CE2 1 
ATOM   3187 C  CZ  . PHE B 1 90  ? 33.223  -20.294 -19.261 1.00 84.79  ? 91  PHE B CZ  1 
ATOM   3188 N  N   . LEU B 1 91  ? 35.467  -14.937 -21.040 1.00 80.96  ? 92  LEU B N   1 
ATOM   3189 C  CA  . LEU B 1 91  ? 35.192  -14.604 -22.436 1.00 76.56  ? 92  LEU B CA  1 
ATOM   3190 C  C   . LEU B 1 91  ? 35.138  -15.850 -23.317 1.00 75.76  ? 92  LEU B C   1 
ATOM   3191 O  O   . LEU B 1 91  ? 35.988  -16.730 -23.209 1.00 79.33  ? 92  LEU B O   1 
ATOM   3192 C  CB  . LEU B 1 91  ? 36.251  -13.623 -22.950 1.00 76.49  ? 92  LEU B CB  1 
ATOM   3193 C  CG  . LEU B 1 91  ? 35.950  -12.707 -24.137 1.00 74.44  ? 92  LEU B CG  1 
ATOM   3194 C  CD1 . LEU B 1 91  ? 34.906  -11.642 -23.809 1.00 72.51  ? 92  LEU B CD1 1 
ATOM   3195 C  CD2 . LEU B 1 91  ? 37.232  -12.053 -24.622 1.00 75.05  ? 92  LEU B CD2 1 
ATOM   3196 N  N   . SER B 1 92  ? 34.124  -15.904 -24.178 1.00 72.20  ? 93  SER B N   1 
ATOM   3197 C  CA  . SER B 1 92  ? 33.892  -17.010 -25.107 1.00 71.88  ? 93  SER B CA  1 
ATOM   3198 C  C   . SER B 1 92  ? 33.535  -16.491 -26.495 1.00 70.76  ? 93  SER B C   1 
ATOM   3199 O  O   . SER B 1 92  ? 33.095  -15.345 -26.640 1.00 68.48  ? 93  SER B O   1 
ATOM   3200 C  CB  . SER B 1 92  ? 32.756  -17.891 -24.600 1.00 71.03  ? 93  SER B CB  1 
ATOM   3201 O  OG  . SER B 1 92  ? 33.137  -18.583 -23.430 1.00 74.42  ? 93  SER B OG  1 
ATOM   3202 N  N   . GLN B 1 93  ? 33.724  -17.339 -27.508 1.00 71.82  ? 94  GLN B N   1 
ATOM   3203 C  CA  . GLN B 1 93  ? 33.339  -17.016 -28.888 1.00 69.87  ? 94  GLN B CA  1 
ATOM   3204 C  C   . GLN B 1 93  ? 32.425  -18.076 -29.504 1.00 69.62  ? 94  GLN B C   1 
ATOM   3205 O  O   . GLN B 1 93  ? 32.711  -19.280 -29.425 1.00 72.47  ? 94  GLN B O   1 
ATOM   3206 C  CB  . GLN B 1 93  ? 34.572  -16.805 -29.778 1.00 70.75  ? 94  GLN B CB  1 
ATOM   3207 C  CG  . GLN B 1 93  ? 34.233  -16.228 -31.146 1.00 69.05  ? 94  GLN B CG  1 
ATOM   3208 C  CD  . GLN B 1 93  ? 35.435  -16.062 -32.047 1.00 70.30  ? 94  GLN B CD  1 
ATOM   3209 O  OE1 . GLN B 1 93  ? 35.661  -16.874 -32.941 1.00 72.51  ? 94  GLN B OE1 1 
ATOM   3210 N  NE2 . GLN B 1 93  ? 36.206  -15.000 -31.828 1.00 69.33  ? 94  GLN B NE2 1 
ATOM   3211 N  N   . ASP B 1 94  ? 31.335  -17.613 -30.118 1.00 66.16  ? 95  ASP B N   1 
ATOM   3212 C  CA  . ASP B 1 94  ? 30.399  -18.477 -30.836 1.00 66.03  ? 95  ASP B CA  1 
ATOM   3213 C  C   . ASP B 1 94  ? 29.567  -17.696 -31.852 1.00 65.09  ? 95  ASP B C   1 
ATOM   3214 O  O   . ASP B 1 94  ? 29.653  -16.462 -31.932 1.00 62.56  ? 95  ASP B O   1 
ATOM   3215 C  CB  . ASP B 1 94  ? 29.477  -19.211 -29.851 1.00 66.05  ? 95  ASP B CB  1 
ATOM   3216 C  CG  . ASP B 1 94  ? 29.206  -20.649 -30.261 1.00 68.70  ? 95  ASP B CG  1 
ATOM   3217 O  OD1 . ASP B 1 94  ? 29.066  -20.912 -31.472 1.00 69.41  ? 95  ASP B OD1 1 
ATOM   3218 O  OD2 . ASP B 1 94  ? 29.120  -21.525 -29.370 1.00 70.02  ? 95  ASP B OD2 1 
ATOM   3219 N  N   . ILE B 1 95  ? 28.765  -18.429 -32.626 1.00 67.22  ? 96  ILE B N   1 
ATOM   3220 C  CA  . ILE B 1 95  ? 27.799  -17.837 -33.554 1.00 67.03  ? 96  ILE B CA  1 
ATOM   3221 C  C   . ILE B 1 95  ? 26.514  -17.462 -32.796 1.00 65.81  ? 96  ILE B C   1 
ATOM   3222 O  O   . ILE B 1 95  ? 25.896  -18.311 -32.142 1.00 67.50  ? 96  ILE B O   1 
ATOM   3223 C  CB  . ILE B 1 95  ? 27.514  -18.766 -34.769 1.00 68.54  ? 96  ILE B CB  1 
ATOM   3224 C  CG1 . ILE B 1 95  ? 28.813  -19.039 -35.553 1.00 70.85  ? 96  ILE B CG1 1 
ATOM   3225 C  CG2 . ILE B 1 95  ? 26.467  -18.147 -35.693 1.00 66.07  ? 96  ILE B CG2 1 
ATOM   3226 C  CD1 . ILE B 1 95  ? 28.772  -20.239 -36.486 1.00 73.45  ? 96  ILE B CD1 1 
ATOM   3227 N  N   . ILE B 1 96  ? 26.141  -16.184 -32.882 1.00 64.01  ? 97  ILE B N   1 
ATOM   3228 C  CA  . ILE B 1 96  ? 24.919  -15.664 -32.259 1.00 62.55  ? 97  ILE B CA  1 
ATOM   3229 C  C   . ILE B 1 96  ? 23.851  -15.330 -33.315 1.00 63.09  ? 97  ILE B C   1 
ATOM   3230 O  O   . ILE B 1 96  ? 24.129  -14.603 -34.273 1.00 63.61  ? 97  ILE B O   1 
ATOM   3231 C  CB  . ILE B 1 96  ? 25.209  -14.460 -31.317 1.00 60.33  ? 97  ILE B CB  1 
ATOM   3232 C  CG1 . ILE B 1 96  ? 26.074  -14.921 -30.125 1.00 62.58  ? 97  ILE B CG1 1 
ATOM   3233 C  CG2 . ILE B 1 96  ? 23.912  -13.804 -30.843 1.00 57.74  ? 97  ILE B CG2 1 
ATOM   3234 C  CD1 . ILE B 1 96  ? 26.392  -13.865 -29.077 1.00 59.79  ? 97  ILE B CD1 1 
ATOM   3235 N  N   . THR B 1 97  ? 22.646  -15.879 -33.132 1.00 63.60  ? 98  THR B N   1 
ATOM   3236 C  CA  . THR B 1 97  ? 21.495  -15.587 -33.999 1.00 64.46  ? 98  THR B CA  1 
ATOM   3237 C  C   . THR B 1 97  ? 20.631  -14.470 -33.404 1.00 62.57  ? 98  THR B C   1 
ATOM   3238 O  O   . THR B 1 97  ? 20.118  -14.599 -32.295 1.00 63.29  ? 98  THR B O   1 
ATOM   3239 C  CB  . THR B 1 97  ? 20.630  -16.839 -34.262 1.00 65.82  ? 98  THR B CB  1 
ATOM   3240 O  OG1 . THR B 1 97  ? 21.464  -17.908 -34.717 1.00 71.62  ? 98  THR B OG1 1 
ATOM   3241 C  CG2 . THR B 1 97  ? 19.569  -16.559 -35.318 1.00 65.69  ? 98  THR B CG2 1 
ATOM   3242 N  N   . VAL B 1 98  ? 20.498  -13.376 -34.149 1.00 60.70  ? 99  VAL B N   1 
ATOM   3243 C  CA  . VAL B 1 98  ? 19.661  -12.244 -33.763 1.00 60.41  ? 99  VAL B CA  1 
ATOM   3244 C  C   . VAL B 1 98  ? 18.750  -11.978 -34.954 1.00 61.94  ? 99  VAL B C   1 
ATOM   3245 O  O   . VAL B 1 98  ? 19.202  -11.468 -35.989 1.00 66.79  ? 99  VAL B O   1 
ATOM   3246 C  CB  . VAL B 1 98  ? 20.487  -10.967 -33.442 1.00 60.66  ? 99  VAL B CB  1 
ATOM   3247 C  CG1 . VAL B 1 98  ? 19.658  -9.974  -32.639 1.00 58.86  ? 99  VAL B CG1 1 
ATOM   3248 C  CG2 . VAL B 1 98  ? 21.766  -11.290 -32.683 1.00 62.04  ? 99  VAL B CG2 1 
ATOM   3249 N  N   . GLY B 1 99  ? 17.475  -12.339 -34.817 1.00 60.20  ? 100 GLY B N   1 
ATOM   3250 C  CA  . GLY B 1 99  ? 16.528  -12.238 -35.922 1.00 60.06  ? 100 GLY B CA  1 
ATOM   3251 C  C   . GLY B 1 99  ? 16.921  -13.185 -37.037 1.00 64.12  ? 100 GLY B C   1 
ATOM   3252 O  O   . GLY B 1 99  ? 16.975  -14.405 -36.835 1.00 68.11  ? 100 GLY B O   1 
ATOM   3253 N  N   . GLY B 1 100 ? 17.221  -12.628 -38.206 1.00 64.50  ? 101 GLY B N   1 
ATOM   3254 C  CA  . GLY B 1 100 ? 17.637  -13.444 -39.356 1.00 68.26  ? 101 GLY B CA  1 
ATOM   3255 C  C   . GLY B 1 100 ? 19.121  -13.371 -39.668 1.00 68.76  ? 101 GLY B C   1 
ATOM   3256 O  O   . GLY B 1 100 ? 19.535  -13.623 -40.807 1.00 69.40  ? 101 GLY B O   1 
ATOM   3257 N  N   . ILE B 1 101 ? 19.915  -13.035 -38.650 1.00 67.98  ? 102 ILE B N   1 
ATOM   3258 C  CA  . ILE B 1 101 ? 21.344  -12.766 -38.809 1.00 67.71  ? 102 ILE B CA  1 
ATOM   3259 C  C   . ILE B 1 101 ? 22.191  -13.608 -37.859 1.00 66.73  ? 102 ILE B C   1 
ATOM   3260 O  O   . ILE B 1 101 ? 21.931  -13.657 -36.659 1.00 65.97  ? 102 ILE B O   1 
ATOM   3261 C  CB  . ILE B 1 101 ? 21.647  -11.253 -38.653 1.00 66.44  ? 102 ILE B CB  1 
ATOM   3262 C  CG1 . ILE B 1 101 ? 21.219  -10.511 -39.923 1.00 67.43  ? 102 ILE B CG1 1 
ATOM   3263 C  CG2 . ILE B 1 101 ? 23.127  -10.992 -38.366 1.00 65.55  ? 102 ILE B CG2 1 
ATOM   3264 C  CD1 . ILE B 1 101 ? 21.000  -9.027  -39.734 1.00 68.75  ? 102 ILE B CD1 1 
ATOM   3265 N  N   . THR B 1 102 ? 23.197  -14.269 -38.426 1.00 67.45  ? 103 THR B N   1 
ATOM   3266 C  CA  . THR B 1 102 ? 24.200  -15.000 -37.658 1.00 67.78  ? 103 THR B CA  1 
ATOM   3267 C  C   . THR B 1 102 ? 25.515  -14.220 -37.659 1.00 66.77  ? 103 THR B C   1 
ATOM   3268 O  O   . THR B 1 102 ? 25.991  -13.795 -38.712 1.00 68.02  ? 103 THR B O   1 
ATOM   3269 C  CB  . THR B 1 102 ? 24.423  -16.419 -38.213 1.00 70.58  ? 103 THR B CB  1 
ATOM   3270 O  OG1 . THR B 1 102 ? 24.881  -16.344 -39.571 1.00 74.57  ? 103 THR B OG1 1 
ATOM   3271 C  CG2 . THR B 1 102 ? 23.133  -17.244 -38.147 1.00 70.50  ? 103 THR B CG2 1 
ATOM   3272 N  N   . VAL B 1 103 ? 26.083  -14.022 -36.473 1.00 65.38  ? 104 VAL B N   1 
ATOM   3273 C  CA  . VAL B 1 103 ? 27.348  -13.300 -36.330 1.00 64.94  ? 104 VAL B CA  1 
ATOM   3274 C  C   . VAL B 1 103 ? 28.284  -14.014 -35.360 1.00 67.60  ? 104 VAL B C   1 
ATOM   3275 O  O   . VAL B 1 103 ? 27.866  -14.421 -34.268 1.00 68.44  ? 104 VAL B O   1 
ATOM   3276 C  CB  . VAL B 1 103 ? 27.134  -11.811 -35.934 1.00 62.60  ? 104 VAL B CB  1 
ATOM   3277 C  CG1 . VAL B 1 103 ? 26.436  -11.676 -34.583 1.00 60.70  ? 104 VAL B CG1 1 
ATOM   3278 C  CG2 . VAL B 1 103 ? 28.446  -11.035 -35.957 1.00 60.30  ? 104 VAL B CG2 1 
ATOM   3279 N  N   . THR B 1 104 ? 29.539  -14.181 -35.784 1.00 68.65  ? 105 THR B N   1 
ATOM   3280 C  CA  . THR B 1 104 ? 30.603  -14.645 -34.902 1.00 68.47  ? 105 THR B CA  1 
ATOM   3281 C  C   . THR B 1 104 ? 30.898  -13.517 -33.907 1.00 67.17  ? 105 THR B C   1 
ATOM   3282 O  O   . THR B 1 104 ? 31.323  -12.418 -34.288 1.00 65.50  ? 105 THR B O   1 
ATOM   3283 C  CB  . THR B 1 104 ? 31.848  -15.103 -35.694 1.00 70.26  ? 105 THR B CB  1 
ATOM   3284 O  OG1 . THR B 1 104 ? 31.485  -16.194 -36.546 1.00 71.15  ? 105 THR B OG1 1 
ATOM   3285 C  CG2 . THR B 1 104 ? 32.959  -15.567 -34.763 1.00 71.60  ? 105 THR B CG2 1 
ATOM   3286 N  N   . GLN B 1 105 ? 30.626  -13.811 -32.637 1.00 66.94  ? 106 GLN B N   1 
ATOM   3287 C  CA  . GLN B 1 105 ? 30.656  -12.827 -31.566 1.00 65.45  ? 106 GLN B CA  1 
ATOM   3288 C  C   . GLN B 1 105 ? 31.455  -13.323 -30.371 1.00 67.87  ? 106 GLN B C   1 
ATOM   3289 O  O   . GLN B 1 105 ? 31.382  -14.494 -30.002 1.00 71.02  ? 106 GLN B O   1 
ATOM   3290 C  CB  . GLN B 1 105 ? 29.219  -12.477 -31.140 1.00 63.19  ? 106 GLN B CB  1 
ATOM   3291 C  CG  . GLN B 1 105 ? 29.071  -11.400 -30.064 1.00 61.74  ? 106 GLN B CG  1 
ATOM   3292 C  CD  . GLN B 1 105 ? 29.724  -10.074 -30.424 1.00 62.56  ? 106 GLN B CD  1 
ATOM   3293 O  OE1 . GLN B 1 105 ? 29.722  -9.653  -31.584 1.00 62.89  ? 106 GLN B OE1 1 
ATOM   3294 N  NE2 . GLN B 1 105 ? 30.288  -9.406  -29.421 1.00 62.39  ? 106 GLN B NE2 1 
ATOM   3295 N  N   . MET B 1 106 ? 32.223  -12.412 -29.785 1.00 68.63  ? 107 MET B N   1 
ATOM   3296 C  CA  . MET B 1 106 ? 32.856  -12.633 -28.504 1.00 69.91  ? 107 MET B CA  1 
ATOM   3297 C  C   . MET B 1 106 ? 31.881  -12.177 -27.418 1.00 66.91  ? 107 MET B C   1 
ATOM   3298 O  O   . MET B 1 106 ? 31.367  -11.052 -27.452 1.00 65.64  ? 107 MET B O   1 
ATOM   3299 C  CB  . MET B 1 106 ? 34.149  -11.838 -28.424 1.00 75.14  ? 107 MET B CB  1 
ATOM   3300 C  CG  . MET B 1 106 ? 35.309  -12.577 -27.794 1.00 83.35  ? 107 MET B CG  1 
ATOM   3301 S  SD  . MET B 1 106 ? 36.631  -12.865 -28.981 1.00 92.20  ? 107 MET B SD  1 
ATOM   3302 C  CE  . MET B 1 106 ? 37.361  -11.230 -29.113 1.00 89.97  ? 107 MET B CE  1 
ATOM   3303 N  N   . PHE B 1 107 ? 31.615  -13.060 -26.465 1.00 65.73  ? 108 PHE B N   1 
ATOM   3304 C  CA  . PHE B 1 107 ? 30.665  -12.778 -25.390 1.00 63.44  ? 108 PHE B CA  1 
ATOM   3305 C  C   . PHE B 1 107 ? 31.192  -13.256 -24.033 1.00 65.63  ? 108 PHE B C   1 
ATOM   3306 O  O   . PHE B 1 107 ? 32.132  -14.059 -23.967 1.00 67.27  ? 108 PHE B O   1 
ATOM   3307 C  CB  . PHE B 1 107 ? 29.278  -13.386 -25.709 1.00 60.72  ? 108 PHE B CB  1 
ATOM   3308 C  CG  . PHE B 1 107 ? 29.249  -14.897 -25.714 1.00 61.16  ? 108 PHE B CG  1 
ATOM   3309 C  CD1 . PHE B 1 107 ? 29.652  -15.620 -26.844 1.00 61.47  ? 108 PHE B CD1 1 
ATOM   3310 C  CD2 . PHE B 1 107 ? 28.814  -15.601 -24.589 1.00 61.34  ? 108 PHE B CD2 1 
ATOM   3311 C  CE1 . PHE B 1 107 ? 29.631  -17.011 -26.845 1.00 63.37  ? 108 PHE B CE1 1 
ATOM   3312 C  CE2 . PHE B 1 107 ? 28.797  -16.991 -24.583 1.00 63.63  ? 108 PHE B CE2 1 
ATOM   3313 C  CZ  . PHE B 1 107 ? 29.205  -17.697 -25.713 1.00 64.56  ? 108 PHE B CZ  1 
ATOM   3314 N  N   . GLY B 1 108 ? 30.581  -12.754 -22.961 1.00 64.59  ? 109 GLY B N   1 
ATOM   3315 C  CA  . GLY B 1 108 ? 30.895  -13.188 -21.610 1.00 66.91  ? 109 GLY B CA  1 
ATOM   3316 C  C   . GLY B 1 108 ? 30.039  -14.362 -21.185 1.00 68.58  ? 109 GLY B C   1 
ATOM   3317 O  O   . GLY B 1 108 ? 28.817  -14.326 -21.326 1.00 67.46  ? 109 GLY B O   1 
ATOM   3318 N  N   . GLU B 1 109 ? 30.689  -15.417 -20.699 1.00 71.96  ? 110 GLU B N   1 
ATOM   3319 C  CA  . GLU B 1 109 ? 30.012  -16.490 -19.981 1.00 73.68  ? 110 GLU B CA  1 
ATOM   3320 C  C   . GLU B 1 109 ? 30.068  -16.127 -18.508 1.00 74.70  ? 110 GLU B C   1 
ATOM   3321 O  O   . GLU B 1 109 ? 31.148  -15.904 -17.972 1.00 77.67  ? 110 GLU B O   1 
ATOM   3322 C  CB  . GLU B 1 109 ? 30.693  -17.838 -20.231 1.00 77.28  ? 110 GLU B CB  1 
ATOM   3323 C  CG  . GLU B 1 109 ? 30.287  -18.518 -21.531 1.00 77.23  ? 110 GLU B CG  1 
ATOM   3324 C  CD  . GLU B 1 109 ? 30.673  -19.988 -21.581 1.00 80.11  ? 110 GLU B CD  1 
ATOM   3325 O  OE1 . GLU B 1 109 ? 31.497  -20.356 -22.444 1.00 81.28  ? 110 GLU B OE1 1 
ATOM   3326 O  OE2 . GLU B 1 109 ? 30.155  -20.781 -20.763 1.00 81.57  ? 110 GLU B OE2 1 
ATOM   3327 N  N   . VAL B 1 110 ? 28.909  -16.064 -17.858 1.00 74.06  ? 111 VAL B N   1 
ATOM   3328 C  CA  . VAL B 1 110 ? 28.830  -15.555 -16.485 1.00 75.26  ? 111 VAL B CA  1 
ATOM   3329 C  C   . VAL B 1 110 ? 28.697  -16.666 -15.446 1.00 80.22  ? 111 VAL B C   1 
ATOM   3330 O  O   . VAL B 1 110 ? 27.843  -17.549 -15.564 1.00 80.97  ? 111 VAL B O   1 
ATOM   3331 C  CB  . VAL B 1 110 ? 27.741  -14.465 -16.355 1.00 71.79  ? 111 VAL B CB  1 
ATOM   3332 C  CG1 . VAL B 1 110 ? 27.510  -14.052 -14.907 1.00 72.14  ? 111 VAL B CG1 1 
ATOM   3333 C  CG2 . VAL B 1 110 ? 28.148  -13.252 -17.175 1.00 70.37  ? 111 VAL B CG2 1 
ATOM   3334 N  N   . THR B 1 111 ? 29.573  -16.610 -14.444 1.00 84.01  ? 112 THR B N   1 
ATOM   3335 C  CA  . THR B 1 111 ? 29.658  -17.616 -13.380 1.00 88.13  ? 112 THR B CA  1 
ATOM   3336 C  C   . THR B 1 111 ? 29.288  -17.040 -12.011 1.00 89.97  ? 112 THR B C   1 
ATOM   3337 O  O   . THR B 1 111 ? 29.040  -17.787 -11.058 1.00 92.32  ? 112 THR B O   1 
ATOM   3338 C  CB  . THR B 1 111 ? 31.075  -18.220 -13.302 1.00 90.92  ? 112 THR B CB  1 
ATOM   3339 O  OG1 . THR B 1 111 ? 32.043  -17.166 -13.354 1.00 90.94  ? 112 THR B OG1 1 
ATOM   3340 C  CG2 . THR B 1 111 ? 31.321  -19.174 -14.460 1.00 91.67  ? 112 THR B CG2 1 
ATOM   3341 N  N   . GLU B 1 112 ? 29.247  -15.710 -11.932 1.00 90.35  ? 113 GLU B N   1 
ATOM   3342 C  CA  . GLU B 1 112 ? 28.998  -14.988 -10.688 1.00 93.88  ? 113 GLU B CA  1 
ATOM   3343 C  C   . GLU B 1 112 ? 27.733  -14.138 -10.828 1.00 90.97  ? 113 GLU B C   1 
ATOM   3344 O  O   . GLU B 1 112 ? 27.785  -12.985 -11.261 1.00 88.98  ? 113 GLU B O   1 
ATOM   3345 C  CB  . GLU B 1 112 ? 30.218  -14.129 -10.345 1.00 96.76  ? 113 GLU B CB  1 
ATOM   3346 C  CG  . GLU B 1 112 ? 30.597  -14.117 -8.874  1.00 102.37 ? 113 GLU B CG  1 
ATOM   3347 C  CD  . GLU B 1 112 ? 32.105  -14.152 -8.650  1.00 107.51 ? 113 GLU B CD  1 
ATOM   3348 O  OE1 . GLU B 1 112 ? 32.870  -13.742 -9.550  1.00 108.08 ? 113 GLU B OE1 1 
ATOM   3349 O  OE2 . GLU B 1 112 ? 32.534  -14.596 -7.563  1.00 111.27 ? 113 GLU B OE2 1 
ATOM   3350 N  N   . MET B 1 113 ? 26.598  -14.730 -10.462 1.00 92.57  ? 114 MET B N   1 
ATOM   3351 C  CA  . MET B 1 113 ? 25.291  -14.110 -10.643 1.00 91.99  ? 114 MET B CA  1 
ATOM   3352 C  C   . MET B 1 113 ? 24.473  -14.044 -9.335  1.00 92.89  ? 114 MET B C   1 
ATOM   3353 O  O   . MET B 1 113 ? 23.679  -14.950 -9.052  1.00 92.50  ? 114 MET B O   1 
ATOM   3354 C  CB  . MET B 1 113 ? 24.526  -14.820 -11.768 1.00 93.65  ? 114 MET B CB  1 
ATOM   3355 C  CG  . MET B 1 113 ? 23.415  -13.970 -12.372 1.00 97.27  ? 114 MET B CG  1 
ATOM   3356 S  SD  . MET B 1 113 ? 22.828  -14.448 -14.011 1.00 98.22  ? 114 MET B SD  1 
ATOM   3357 C  CE  . MET B 1 113 ? 22.174  -16.088 -13.690 1.00 102.22 ? 114 MET B CE  1 
ATOM   3358 N  N   . PRO B 1 114 ? 24.651  -12.955 -8.544  1.00 93.66  ? 115 PRO B N   1 
ATOM   3359 C  CA  . PRO B 1 114 ? 24.015  -12.865 -7.217  1.00 93.98  ? 115 PRO B CA  1 
ATOM   3360 C  C   . PRO B 1 114 ? 22.504  -12.596 -7.271  1.00 90.61  ? 115 PRO B C   1 
ATOM   3361 O  O   . PRO B 1 114 ? 22.015  -12.014 -8.249  1.00 86.14  ? 115 PRO B O   1 
ATOM   3362 C  CB  . PRO B 1 114 ? 24.753  -11.696 -6.555  1.00 94.94  ? 115 PRO B CB  1 
ATOM   3363 C  CG  . PRO B 1 114 ? 25.190  -10.828 -7.687  1.00 92.56  ? 115 PRO B CG  1 
ATOM   3364 C  CD  . PRO B 1 114 ? 25.373  -11.710 -8.893  1.00 91.63  ? 115 PRO B CD  1 
ATOM   3365 N  N   . ALA B 1 115 ? 21.797  -13.019 -6.218  1.00 91.52  ? 116 ALA B N   1 
ATOM   3366 C  CA  . ALA B 1 115 ? 20.338  -12.865 -6.085  1.00 90.77  ? 116 ALA B CA  1 
ATOM   3367 C  C   . ALA B 1 115 ? 19.846  -11.433 -6.341  1.00 89.49  ? 116 ALA B C   1 
ATOM   3368 O  O   . ALA B 1 115 ? 18.875  -11.234 -7.076  1.00 85.42  ? 116 ALA B O   1 
ATOM   3369 C  CB  . ALA B 1 115 ? 19.865  -13.370 -4.729  1.00 91.11  ? 116 ALA B CB  1 
ATOM   3370 N  N   . LEU B 1 116 ? 20.522  -10.450 -5.743  1.00 92.17  ? 117 LEU B N   1 
ATOM   3371 C  CA  . LEU B 1 116 ? 20.322  -9.041  -6.095  1.00 92.17  ? 117 LEU B CA  1 
ATOM   3372 C  C   . LEU B 1 116 ? 21.417  -8.650  -7.104  1.00 90.34  ? 117 LEU B C   1 
ATOM   3373 O  O   . LEU B 1 116 ? 22.602  -8.749  -6.780  1.00 94.69  ? 117 LEU B O   1 
ATOM   3374 C  CB  . LEU B 1 116 ? 20.390  -8.149  -4.844  1.00 93.28  ? 117 LEU B CB  1 
ATOM   3375 C  CG  . LEU B 1 116 ? 19.252  -7.195  -4.439  1.00 91.67  ? 117 LEU B CG  1 
ATOM   3376 C  CD1 . LEU B 1 116 ? 19.703  -6.364  -3.246  1.00 93.11  ? 117 LEU B CD1 1 
ATOM   3377 C  CD2 . LEU B 1 116 ? 18.741  -6.282  -5.551  1.00 87.68  ? 117 LEU B CD2 1 
ATOM   3378 N  N   . PRO B 1 117 ? 21.050  -8.233  -8.320  1.00 88.69  ? 118 PRO B N   1 
ATOM   3379 C  CA  . PRO B 1 117 ? 19.657  -8.058  -8.744  1.00 87.46  ? 118 PRO B CA  1 
ATOM   3380 C  C   . PRO B 1 117 ? 19.081  -9.177  -9.631  1.00 85.62  ? 118 PRO B C   1 
ATOM   3381 O  O   . PRO B 1 117 ? 17.937  -9.070  -10.066 1.00 82.65  ? 118 PRO B O   1 
ATOM   3382 C  CB  . PRO B 1 117 ? 19.711  -6.742  -9.537  1.00 85.06  ? 118 PRO B CB  1 
ATOM   3383 C  CG  . PRO B 1 117 ? 21.099  -6.690  -10.095 1.00 84.61  ? 118 PRO B CG  1 
ATOM   3384 C  CD  . PRO B 1 117 ? 21.991  -7.523  -9.211  1.00 88.07  ? 118 PRO B CD  1 
ATOM   3385 N  N   . PHE B 1 118 ? 19.840  -10.242 -9.875  1.00 86.40  ? 119 PHE B N   1 
ATOM   3386 C  CA  . PHE B 1 118 ? 19.489  -11.186 -10.950 1.00 84.46  ? 119 PHE B CA  1 
ATOM   3387 C  C   . PHE B 1 118 ? 18.380  -12.210 -10.679 1.00 83.23  ? 119 PHE B C   1 
ATOM   3388 O  O   . PHE B 1 118 ? 17.997  -12.951 -11.585 1.00 84.77  ? 119 PHE B O   1 
ATOM   3389 C  CB  . PHE B 1 118 ? 20.750  -11.789 -11.584 1.00 85.91  ? 119 PHE B CB  1 
ATOM   3390 C  CG  . PHE B 1 118 ? 21.662  -10.753 -12.186 0.50 85.42  ? 119 PHE B CG  1 
ATOM   3391 C  CD1 . PHE B 1 118 ? 21.393  -10.209 -13.434 0.50 83.34  ? 119 PHE B CD1 1 
ATOM   3392 C  CD2 . PHE B 1 118 ? 22.765  -10.294 -11.487 0.50 86.64  ? 119 PHE B CD2 1 
ATOM   3393 C  CE1 . PHE B 1 118 ? 22.217  -9.240  -13.975 0.50 82.87  ? 119 PHE B CE1 1 
ATOM   3394 C  CE2 . PHE B 1 118 ? 23.589  -9.324  -12.022 0.50 85.16  ? 119 PHE B CE2 1 
ATOM   3395 C  CZ  . PHE B 1 118 ? 23.319  -8.800  -13.269 0.50 83.60  ? 119 PHE B CZ  1 
ATOM   3396 N  N   . MET B 1 119 ? 17.854  -12.242 -9.456  1.00 82.58  ? 120 MET B N   1 
ATOM   3397 C  CA  . MET B 1 119 ? 16.593  -12.943 -9.179  1.00 81.78  ? 120 MET B CA  1 
ATOM   3398 C  C   . MET B 1 119 ? 15.367  -12.075 -9.515  1.00 79.03  ? 120 MET B C   1 
ATOM   3399 O  O   . MET B 1 119 ? 14.236  -12.570 -9.524  1.00 77.76  ? 120 MET B O   1 
ATOM   3400 C  CB  . MET B 1 119 ? 16.535  -13.453 -7.734  1.00 85.30  ? 120 MET B CB  1 
ATOM   3401 C  CG  . MET B 1 119 ? 17.287  -14.755 -7.484  1.00 88.41  ? 120 MET B CG  1 
ATOM   3402 S  SD  . MET B 1 119 ? 16.727  -16.180 -8.448  1.00 88.42  ? 120 MET B SD  1 
ATOM   3403 C  CE  . MET B 1 119 ? 15.063  -16.441 -7.829  1.00 90.97  ? 120 MET B CE  1 
ATOM   3404 N  N   . LEU B 1 120 ? 15.608  -10.784 -9.764  1.00 77.35  ? 121 LEU B N   1 
ATOM   3405 C  CA  . LEU B 1 120 ? 14.629  -9.860  -10.360 1.00 76.89  ? 121 LEU B CA  1 
ATOM   3406 C  C   . LEU B 1 120 ? 14.523  -10.052 -11.870 1.00 72.34  ? 121 LEU B C   1 
ATOM   3407 O  O   . LEU B 1 120 ? 13.477  -9.772  -12.461 1.00 70.28  ? 121 LEU B O   1 
ATOM   3408 C  CB  . LEU B 1 120 ? 15.033  -8.396  -10.107 1.00 78.26  ? 121 LEU B CB  1 
ATOM   3409 C  CG  . LEU B 1 120 ? 14.474  -7.449  -9.037  1.00 79.27  ? 121 LEU B CG  1 
ATOM   3410 C  CD1 . LEU B 1 120 ? 14.216  -8.127  -7.709  1.00 79.90  ? 121 LEU B CD1 1 
ATOM   3411 C  CD2 . LEU B 1 120 ? 15.423  -6.273  -8.848  1.00 79.41  ? 121 LEU B CD2 1 
ATOM   3412 N  N   . ALA B 1 121 ? 15.620  -10.502 -12.481 1.00 69.80  ? 122 ALA B N   1 
ATOM   3413 C  CA  . ALA B 1 121 ? 15.732  -10.628 -13.928 1.00 65.49  ? 122 ALA B CA  1 
ATOM   3414 C  C   . ALA B 1 121 ? 14.876  -11.774 -14.479 1.00 65.49  ? 122 ALA B C   1 
ATOM   3415 O  O   . ALA B 1 121 ? 15.087  -12.945 -14.132 1.00 67.73  ? 122 ALA B O   1 
ATOM   3416 C  CB  . ALA B 1 121 ? 17.192  -10.794 -14.326 1.00 64.39  ? 122 ALA B CB  1 
ATOM   3417 N  N   . GLU B 1 122 ? 13.899  -11.415 -15.316 1.00 61.26  ? 123 GLU B N   1 
ATOM   3418 C  CA  . GLU B 1 122 ? 13.083  -12.389 -16.051 1.00 61.00  ? 123 GLU B CA  1 
ATOM   3419 C  C   . GLU B 1 122 ? 13.804  -12.844 -17.317 1.00 59.49  ? 123 GLU B C   1 
ATOM   3420 O  O   . GLU B 1 122 ? 13.473  -13.877 -17.916 1.00 61.54  ? 123 GLU B O   1 
ATOM   3421 C  CB  . GLU B 1 122 ? 11.712  -11.804 -16.400 1.00 60.10  ? 123 GLU B CB  1 
ATOM   3422 C  CG  . GLU B 1 122 ? 10.858  -11.415 -15.198 1.00 63.19  ? 123 GLU B CG  1 
ATOM   3423 C  CD  . GLU B 1 122 ? 10.491  -12.576 -14.273 1.00 68.83  ? 123 GLU B CD  1 
ATOM   3424 O  OE1 . GLU B 1 122 ? 10.384  -13.737 -14.738 1.00 70.10  ? 123 GLU B OE1 1 
ATOM   3425 O  OE2 . GLU B 1 122 ? 10.295  -12.316 -13.063 1.00 70.98  ? 123 GLU B OE2 1 
ATOM   3426 N  N   . PHE B 1 123 ? 14.789  -12.043 -17.702 1.00 57.58  ? 124 PHE B N   1 
ATOM   3427 C  CA  . PHE B 1 123 ? 15.693  -12.314 -18.806 1.00 57.85  ? 124 PHE B CA  1 
ATOM   3428 C  C   . PHE B 1 123 ? 16.926  -13.019 -18.269 1.00 59.40  ? 124 PHE B C   1 
ATOM   3429 O  O   . PHE B 1 123 ? 17.194  -12.989 -17.063 1.00 61.14  ? 124 PHE B O   1 
ATOM   3430 C  CB  . PHE B 1 123 ? 16.087  -10.997 -19.489 1.00 55.70  ? 124 PHE B CB  1 
ATOM   3431 C  CG  . PHE B 1 123 ? 16.619  -9.956  -18.542 1.00 56.08  ? 124 PHE B CG  1 
ATOM   3432 C  CD1 . PHE B 1 123 ? 17.995  -9.871  -18.273 1.00 56.61  ? 124 PHE B CD1 1 
ATOM   3433 C  CD2 . PHE B 1 123 ? 15.751  -9.051  -17.912 1.00 55.58  ? 124 PHE B CD2 1 
ATOM   3434 C  CE1 . PHE B 1 123 ? 18.487  -8.912  -17.396 1.00 57.72  ? 124 PHE B CE1 1 
ATOM   3435 C  CE2 . PHE B 1 123 ? 16.242  -8.086  -17.033 1.00 56.01  ? 124 PHE B CE2 1 
ATOM   3436 C  CZ  . PHE B 1 123 ? 17.611  -8.017  -16.779 1.00 57.36  ? 124 PHE B CZ  1 
ATOM   3437 N  N   . ASP B 1 124 ? 17.678  -13.634 -19.174 1.00 59.62  ? 125 ASP B N   1 
ATOM   3438 C  CA  . ASP B 1 124 ? 18.878  -14.363 -18.817 1.00 60.62  ? 125 ASP B CA  1 
ATOM   3439 C  C   . ASP B 1 124 ? 20.093  -13.462 -18.852 1.00 60.43  ? 125 ASP B C   1 
ATOM   3440 O  O   . ASP B 1 124 ? 20.867  -13.441 -17.900 1.00 63.49  ? 125 ASP B O   1 
ATOM   3441 C  CB  . ASP B 1 124 ? 19.074  -15.560 -19.747 1.00 62.75  ? 125 ASP B CB  1 
ATOM   3442 C  CG  . ASP B 1 124 ? 17.880  -16.497 -19.757 1.00 65.07  ? 125 ASP B CG  1 
ATOM   3443 O  OD1 . ASP B 1 124 ? 17.511  -17.029 -18.683 1.00 68.42  ? 125 ASP B OD1 1 
ATOM   3444 O  OD2 . ASP B 1 124 ? 17.316  -16.708 -20.852 1.00 65.26  ? 125 ASP B OD2 1 
ATOM   3445 N  N   . GLY B 1 125 ? 20.246  -12.704 -19.937 1.00 58.82  ? 126 GLY B N   1 
ATOM   3446 C  CA  . GLY B 1 125 ? 21.462  -11.934 -20.173 1.00 57.70  ? 126 GLY B CA  1 
ATOM   3447 C  C   . GLY B 1 125 ? 21.285  -10.602 -20.872 1.00 55.77  ? 126 GLY B C   1 
ATOM   3448 O  O   . GLY B 1 125 ? 20.171  -10.105 -21.024 1.00 56.54  ? 126 GLY B O   1 
ATOM   3449 N  N   . VAL B 1 126 ? 22.409  -10.026 -21.284 1.00 54.92  ? 127 VAL B N   1 
ATOM   3450 C  CA  . VAL B 1 126 ? 22.457  -8.683  -21.845 1.00 53.48  ? 127 VAL B CA  1 
ATOM   3451 C  C   . VAL B 1 126 ? 23.185  -8.727  -23.180 1.00 52.85  ? 127 VAL B C   1 
ATOM   3452 O  O   . VAL B 1 126 ? 24.197  -9.408  -23.320 1.00 55.68  ? 127 VAL B O   1 
ATOM   3453 C  CB  . VAL B 1 126 ? 23.141  -7.682  -20.870 1.00 54.53  ? 127 VAL B CB  1 
ATOM   3454 C  CG1 . VAL B 1 126 ? 23.369  -6.318  -21.518 1.00 51.62  ? 127 VAL B CG1 1 
ATOM   3455 C  CG2 . VAL B 1 126 ? 22.321  -7.528  -19.589 1.00 54.27  ? 127 VAL B CG2 1 
ATOM   3456 N  N   . VAL B 1 127 ? 22.624  -8.020  -24.155 1.00 50.99  ? 128 VAL B N   1 
ATOM   3457 C  CA  . VAL B 1 127 ? 23.255  -7.764  -25.438 1.00 50.27  ? 128 VAL B CA  1 
ATOM   3458 C  C   . VAL B 1 127 ? 23.473  -6.258  -25.487 1.00 49.24  ? 128 VAL B C   1 
ATOM   3459 O  O   . VAL B 1 127 ? 22.533  -5.481  -25.706 1.00 48.74  ? 128 VAL B O   1 
ATOM   3460 C  CB  . VAL B 1 127 ? 22.399  -8.295  -26.614 1.00 50.29  ? 128 VAL B CB  1 
ATOM   3461 C  CG1 . VAL B 1 127 ? 22.836  -7.703  -27.945 1.00 49.59  ? 128 VAL B CG1 1 
ATOM   3462 C  CG2 . VAL B 1 127 ? 22.474  -9.813  -26.673 1.00 51.39  ? 128 VAL B CG2 1 
ATOM   3463 N  N   . GLY B 1 128 ? 24.718  -5.861  -25.234 1.00 50.29  ? 129 GLY B N   1 
ATOM   3464 C  CA  . GLY B 1 128 ? 25.100  -4.458  -25.164 1.00 49.85  ? 129 GLY B CA  1 
ATOM   3465 C  C   . GLY B 1 128 ? 25.067  -3.816  -26.528 1.00 49.51  ? 129 GLY B C   1 
ATOM   3466 O  O   . GLY B 1 128 ? 25.658  -4.331  -27.478 1.00 49.51  ? 129 GLY B O   1 
ATOM   3467 N  N   . MET B 1 129 ? 24.359  -2.693  -26.617 1.00 49.53  ? 130 MET B N   1 
ATOM   3468 C  CA  . MET B 1 129 ? 24.144  -1.990  -27.885 1.00 48.75  ? 130 MET B CA  1 
ATOM   3469 C  C   . MET B 1 129 ? 24.965  -0.705  -27.998 1.00 49.57  ? 130 MET B C   1 
ATOM   3470 O  O   . MET B 1 129 ? 24.850  0.028   -28.986 1.00 50.88  ? 130 MET B O   1 
ATOM   3471 C  CB  . MET B 1 129 ? 22.648  -1.719  -28.090 1.00 48.21  ? 130 MET B CB  1 
ATOM   3472 C  CG  . MET B 1 129 ? 21.802  -2.972  -28.277 1.00 48.68  ? 130 MET B CG  1 
ATOM   3473 S  SD  . MET B 1 129 ? 22.365  -4.049  -29.621 1.00 51.77  ? 130 MET B SD  1 
ATOM   3474 C  CE  . MET B 1 129 ? 21.863  -3.100  -31.060 1.00 50.04  ? 130 MET B CE  1 
ATOM   3475 N  N   . GLY B 1 130 ? 25.799  -0.450  -26.989 1.00 49.93  ? 131 GLY B N   1 
ATOM   3476 C  CA  . GLY B 1 130 ? 26.685  0.708   -26.958 1.00 49.79  ? 131 GLY B CA  1 
ATOM   3477 C  C   . GLY B 1 130 ? 27.939  0.540   -27.796 1.00 51.67  ? 131 GLY B C   1 
ATOM   3478 O  O   . GLY B 1 130 ? 28.107  -0.455  -28.500 1.00 52.25  ? 131 GLY B O   1 
ATOM   3479 N  N   . PHE B 1 131 ? 28.824  1.527   -27.688 1.00 53.65  ? 132 PHE B N   1 
ATOM   3480 C  CA  . PHE B 1 131 ? 30.042  1.641   -28.489 1.00 53.86  ? 132 PHE B CA  1 
ATOM   3481 C  C   . PHE B 1 131 ? 31.202  0.857   -27.881 1.00 56.79  ? 132 PHE B C   1 
ATOM   3482 O  O   . PHE B 1 131 ? 31.249  0.663   -26.659 1.00 57.30  ? 132 PHE B O   1 
ATOM   3483 C  CB  . PHE B 1 131 ? 30.476  3.107   -28.536 1.00 54.73  ? 132 PHE B CB  1 
ATOM   3484 C  CG  . PHE B 1 131 ? 29.573  4.011   -29.328 1.00 53.24  ? 132 PHE B CG  1 
ATOM   3485 C  CD1 . PHE B 1 131 ? 28.324  4.409   -28.828 1.00 51.48  ? 132 PHE B CD1 1 
ATOM   3486 C  CD2 . PHE B 1 131 ? 30.000  4.527   -30.558 1.00 53.24  ? 132 PHE B CD2 1 
ATOM   3487 C  CE1 . PHE B 1 131 ? 27.502  5.262   -29.561 1.00 50.22  ? 132 PHE B CE1 1 
ATOM   3488 C  CE2 . PHE B 1 131 ? 29.187  5.384   -31.289 1.00 51.92  ? 132 PHE B CE2 1 
ATOM   3489 C  CZ  . PHE B 1 131 ? 27.933  5.747   -30.790 1.00 50.54  ? 132 PHE B CZ  1 
ATOM   3490 N  N   . ILE B 1 132 ? 32.166  0.476   -28.728 1.00 56.93  ? 133 ILE B N   1 
ATOM   3491 C  CA  . ILE B 1 132 ? 33.371  -0.262  -28.310 1.00 59.11  ? 133 ILE B CA  1 
ATOM   3492 C  C   . ILE B 1 132 ? 34.132  0.395   -27.142 1.00 62.25  ? 133 ILE B C   1 
ATOM   3493 O  O   . ILE B 1 132 ? 34.639  -0.303  -26.266 1.00 65.89  ? 133 ILE B O   1 
ATOM   3494 C  CB  . ILE B 1 132 ? 34.299  -0.624  -29.522 1.00 59.67  ? 133 ILE B CB  1 
ATOM   3495 C  CG1 . ILE B 1 132 ? 35.338  -1.700  -29.122 1.00 59.96  ? 133 ILE B CG1 1 
ATOM   3496 C  CG2 . ILE B 1 132 ? 34.928  0.621   -30.160 1.00 60.94  ? 133 ILE B CG2 1 
ATOM   3497 C  CD1 . ILE B 1 132 ? 36.011  -2.439  -30.266 1.00 58.65  ? 133 ILE B CD1 1 
ATOM   3498 N  N   . GLU B 1 133 ? 34.162  1.727   -27.117 1.00 62.99  ? 134 GLU B N   1 
ATOM   3499 C  CA  . GLU B 1 133 ? 34.854  2.508   -26.081 1.00 66.27  ? 134 GLU B CA  1 
ATOM   3500 C  C   . GLU B 1 133 ? 34.409  2.199   -24.647 1.00 66.98  ? 134 GLU B C   1 
ATOM   3501 O  O   . GLU B 1 133 ? 35.151  2.455   -23.696 1.00 70.33  ? 134 GLU B O   1 
ATOM   3502 C  CB  . GLU B 1 133 ? 34.711  4.016   -26.347 1.00 67.46  ? 134 GLU B CB  1 
ATOM   3503 C  CG  . GLU B 1 133 ? 35.423  4.528   -27.593 1.00 68.13  ? 134 GLU B CG  1 
ATOM   3504 C  CD  . GLU B 1 133 ? 34.505  4.669   -28.796 1.00 67.79  ? 134 GLU B CD  1 
ATOM   3505 O  OE1 . GLU B 1 133 ? 33.698  3.751   -29.079 1.00 66.07  ? 134 GLU B OE1 1 
ATOM   3506 O  OE2 . GLU B 1 133 ? 34.600  5.713   -29.474 1.00 70.24  ? 134 GLU B OE2 1 
ATOM   3507 N  N   . GLN B 1 134 ? 33.204  1.654   -24.501 1.00 67.69  ? 135 GLN B N   1 
ATOM   3508 C  CA  . GLN B 1 134 ? 32.646  1.308   -23.190 1.00 68.46  ? 135 GLN B CA  1 
ATOM   3509 C  C   . GLN B 1 134 ? 32.538  -0.199  -22.948 1.00 68.41  ? 135 GLN B C   1 
ATOM   3510 O  O   . GLN B 1 134 ? 32.059  -0.636  -21.896 1.00 67.27  ? 135 GLN B O   1 
ATOM   3511 C  CB  . GLN B 1 134 ? 31.292  1.983   -22.999 1.00 68.12  ? 135 GLN B CB  1 
ATOM   3512 C  CG  . GLN B 1 134 ? 31.385  3.485   -22.791 1.00 70.68  ? 135 GLN B CG  1 
ATOM   3513 C  CD  . GLN B 1 134 ? 30.154  4.056   -22.119 1.00 73.17  ? 135 GLN B CD  1 
ATOM   3514 O  OE1 . GLN B 1 134 ? 30.255  4.695   -21.068 1.00 75.08  ? 135 GLN B OE1 1 
ATOM   3515 N  NE2 . GLN B 1 134 ? 28.978  3.824   -22.714 1.00 71.33  ? 135 GLN B NE2 1 
ATOM   3516 N  N   . ALA B 1 135 ? 32.993  -0.982  -23.926 1.00 68.56  ? 136 ALA B N   1 
ATOM   3517 C  CA  . ALA B 1 135 ? 33.071  -2.424  -23.797 1.00 68.26  ? 136 ALA B CA  1 
ATOM   3518 C  C   . ALA B 1 135 ? 34.214  -2.789  -22.863 1.00 73.59  ? 136 ALA B C   1 
ATOM   3519 O  O   . ALA B 1 135 ? 35.353  -2.346  -23.061 1.00 76.99  ? 136 ALA B O   1 
ATOM   3520 C  CB  . ALA B 1 135 ? 33.262  -3.064  -25.158 1.00 67.63  ? 136 ALA B CB  1 
ATOM   3521 N  N   . ILE B 1 136 ? 33.897  -3.572  -21.832 1.00 73.96  ? 137 ILE B N   1 
ATOM   3522 C  CA  . ILE B 1 136 ? 34.907  -4.065  -20.896 1.00 76.18  ? 137 ILE B CA  1 
ATOM   3523 C  C   . ILE B 1 136 ? 35.761  -5.100  -21.619 1.00 76.88  ? 137 ILE B C   1 
ATOM   3524 O  O   . ILE B 1 136 ? 35.234  -6.056  -22.192 1.00 74.02  ? 137 ILE B O   1 
ATOM   3525 C  CB  . ILE B 1 136 ? 34.287  -4.614  -19.581 1.00 76.49  ? 137 ILE B CB  1 
ATOM   3526 C  CG1 . ILE B 1 136 ? 33.732  -3.471  -18.719 1.00 76.44  ? 137 ILE B CG1 1 
ATOM   3527 C  CG2 . ILE B 1 136 ? 35.308  -5.379  -18.749 1.00 77.50  ? 137 ILE B CG2 1 
ATOM   3528 C  CD1 . ILE B 1 136 ? 32.245  -3.217  -18.881 1.00 75.95  ? 137 ILE B CD1 1 
ATOM   3529 N  N   . GLY B 1 137 ? 37.074  -4.867  -21.602 1.00 80.85  ? 138 GLY B N   1 
ATOM   3530 C  CA  . GLY B 1 137 ? 38.061  -5.723  -22.266 1.00 83.19  ? 138 GLY B CA  1 
ATOM   3531 C  C   . GLY B 1 137 ? 38.163  -5.509  -23.765 1.00 83.48  ? 138 GLY B C   1 
ATOM   3532 O  O   . GLY B 1 137 ? 38.526  -6.432  -24.493 1.00 83.60  ? 138 GLY B O   1 
ATOM   3533 N  N   . ARG B 1 138 ? 37.832  -4.294  -24.215 1.00 84.73  ? 139 ARG B N   1 
ATOM   3534 C  CA  . ARG B 1 138 ? 37.898  -3.849  -25.631 1.00 86.24  ? 139 ARG B CA  1 
ATOM   3535 C  C   . ARG B 1 138 ? 37.345  -4.822  -26.705 1.00 83.35  ? 139 ARG B C   1 
ATOM   3536 O  O   . ARG B 1 138 ? 37.710  -4.745  -27.887 1.00 83.53  ? 139 ARG B O   1 
ATOM   3537 C  CB  . ARG B 1 138 ? 39.307  -3.298  -25.983 1.00 92.86  ? 139 ARG B CB  1 
ATOM   3538 C  CG  . ARG B 1 138 ? 40.415  -4.332  -26.179 1.00 99.97  ? 139 ARG B CG  1 
ATOM   3539 C  CD  . ARG B 1 138 ? 41.748  -3.678  -26.505 1.00 106.76 ? 139 ARG B CD  1 
ATOM   3540 N  NE  . ARG B 1 138 ? 42.532  -4.487  -27.442 1.00 111.30 ? 139 ARG B NE  1 
ATOM   3541 C  CZ  . ARG B 1 138 ? 42.657  -4.241  -28.748 1.00 110.44 ? 139 ARG B CZ  1 
ATOM   3542 N  NH1 . ARG B 1 138 ? 42.062  -3.191  -29.307 1.00 107.34 ? 139 ARG B NH1 1 
ATOM   3543 N  NH2 . ARG B 1 138 ? 43.395  -5.048  -29.501 1.00 112.64 ? 139 ARG B NH2 1 
ATOM   3544 N  N   . VAL B 1 139 ? 36.457  -5.723  -26.279 1.00 79.98  ? 140 VAL B N   1 
ATOM   3545 C  CA  . VAL B 1 139 ? 35.798  -6.679  -27.179 1.00 74.48  ? 140 VAL B CA  1 
ATOM   3546 C  C   . VAL B 1 139 ? 34.762  -5.959  -28.035 1.00 70.59  ? 140 VAL B C   1 
ATOM   3547 O  O   . VAL B 1 139 ? 33.939  -5.197  -27.526 1.00 70.76  ? 140 VAL B O   1 
ATOM   3548 C  CB  . VAL B 1 139 ? 35.219  -7.928  -26.434 1.00 73.12  ? 140 VAL B CB  1 
ATOM   3549 C  CG1 . VAL B 1 139 ? 34.801  -7.602  -25.012 1.00 72.36  ? 140 VAL B CG1 1 
ATOM   3550 C  CG2 . VAL B 1 139 ? 34.065  -8.571  -27.193 1.00 68.04  ? 140 VAL B CG2 1 
ATOM   3551 N  N   . THR B 1 140 ? 34.850  -6.203  -29.341 1.00 69.60  ? 141 THR B N   1 
ATOM   3552 C  CA  . THR B 1 140 ? 33.940  -5.662  -30.350 1.00 64.87  ? 141 THR B CA  1 
ATOM   3553 C  C   . THR B 1 140 ? 32.474  -5.970  -30.024 1.00 62.74  ? 141 THR B C   1 
ATOM   3554 O  O   . THR B 1 140 ? 32.108  -7.142  -29.907 1.00 63.78  ? 141 THR B O   1 
ATOM   3555 C  CB  . THR B 1 140 ? 34.309  -6.210  -31.745 1.00 64.35  ? 141 THR B CB  1 
ATOM   3556 O  OG1 . THR B 1 140 ? 35.694  -5.956  -31.995 1.00 65.75  ? 141 THR B OG1 1 
ATOM   3557 C  CG2 . THR B 1 140 ? 33.488  -5.550  -32.839 1.00 62.88  ? 141 THR B CG2 1 
ATOM   3558 N  N   . PRO B 1 141 ? 31.634  -4.916  -29.867 1.00 61.14  ? 142 PRO B N   1 
ATOM   3559 C  CA  . PRO B 1 141 ? 30.195  -5.122  -29.634 1.00 57.47  ? 142 PRO B CA  1 
ATOM   3560 C  C   . PRO B 1 141 ? 29.509  -5.774  -30.831 1.00 56.93  ? 142 PRO B C   1 
ATOM   3561 O  O   . PRO B 1 141 ? 30.011  -5.684  -31.958 1.00 58.19  ? 142 PRO B O   1 
ATOM   3562 C  CB  . PRO B 1 141 ? 29.652  -3.705  -29.419 1.00 55.55  ? 142 PRO B CB  1 
ATOM   3563 C  CG  . PRO B 1 141 ? 30.840  -2.838  -29.186 1.00 56.32  ? 142 PRO B CG  1 
ATOM   3564 C  CD  . PRO B 1 141 ? 31.974  -3.481  -29.924 1.00 59.08  ? 142 PRO B CD  1 
ATOM   3565 N  N   . ILE B 1 142 ? 28.373  -6.420  -30.575 1.00 56.14  ? 143 ILE B N   1 
ATOM   3566 C  CA  . ILE B 1 142 ? 27.664  -7.218  -31.583 1.00 56.22  ? 143 ILE B CA  1 
ATOM   3567 C  C   . ILE B 1 142 ? 27.174  -6.421  -32.811 1.00 57.05  ? 143 ILE B C   1 
ATOM   3568 O  O   . ILE B 1 142 ? 27.185  -6.945  -33.931 1.00 59.36  ? 143 ILE B O   1 
ATOM   3569 C  CB  . ILE B 1 142 ? 26.539  -8.087  -30.947 1.00 55.03  ? 143 ILE B CB  1 
ATOM   3570 C  CG1 . ILE B 1 142 ? 26.067  -9.178  -31.923 1.00 54.30  ? 143 ILE B CG1 1 
ATOM   3571 C  CG2 . ILE B 1 142 ? 25.388  -7.226  -30.414 1.00 52.46  ? 143 ILE B CG2 1 
ATOM   3572 C  CD1 . ILE B 1 142 ? 25.212  -10.269 -31.308 1.00 53.67  ? 143 ILE B CD1 1 
ATOM   3573 N  N   . PHE B 1 143 ? 26.765  -5.168  -32.609 1.00 55.38  ? 144 PHE B N   1 
ATOM   3574 C  CA  . PHE B 1 143 ? 26.282  -4.356  -33.727 1.00 55.18  ? 144 PHE B CA  1 
ATOM   3575 C  C   . PHE B 1 143 ? 27.422  -3.996  -34.683 1.00 57.15  ? 144 PHE B C   1 
ATOM   3576 O  O   . PHE B 1 143 ? 27.240  -4.025  -35.902 1.00 57.91  ? 144 PHE B O   1 
ATOM   3577 C  CB  . PHE B 1 143 ? 25.512  -3.116  -33.255 1.00 51.70  ? 144 PHE B CB  1 
ATOM   3578 C  CG  . PHE B 1 143 ? 24.755  -2.418  -34.354 1.00 49.86  ? 144 PHE B CG  1 
ATOM   3579 C  CD1 . PHE B 1 143 ? 23.601  -2.986  -34.901 1.00 49.00  ? 144 PHE B CD1 1 
ATOM   3580 C  CD2 . PHE B 1 143 ? 25.193  -1.184  -34.848 1.00 48.65  ? 144 PHE B CD2 1 
ATOM   3581 C  CE1 . PHE B 1 143 ? 22.900  -2.335  -35.915 1.00 48.68  ? 144 PHE B CE1 1 
ATOM   3582 C  CE2 . PHE B 1 143 ? 24.498  -0.537  -35.861 1.00 47.37  ? 144 PHE B CE2 1 
ATOM   3583 C  CZ  . PHE B 1 143 ? 23.352  -1.113  -36.397 1.00 47.40  ? 144 PHE B CZ  1 
ATOM   3584 N  N   . ASP B 1 144 ? 28.592  -3.693  -34.123 1.00 57.70  ? 145 ASP B N   1 
ATOM   3585 C  CA  . ASP B 1 144 ? 29.796  -3.410  -34.917 1.00 59.91  ? 145 ASP B CA  1 
ATOM   3586 C  C   . ASP B 1 144 ? 30.219  -4.606  -35.765 1.00 59.78  ? 145 ASP B C   1 
ATOM   3587 O  O   . ASP B 1 144 ? 30.594  -4.440  -36.927 1.00 60.52  ? 145 ASP B O   1 
ATOM   3588 C  CB  . ASP B 1 144 ? 30.946  -2.945  -34.021 1.00 60.71  ? 145 ASP B CB  1 
ATOM   3589 C  CG  . ASP B 1 144 ? 30.584  -1.730  -33.184 1.00 60.66  ? 145 ASP B CG  1 
ATOM   3590 O  OD1 . ASP B 1 144 ? 29.432  -1.643  -32.688 1.00 61.89  ? 145 ASP B OD1 1 
ATOM   3591 O  OD2 . ASP B 1 144 ? 31.459  -0.865  -33.011 1.00 60.11  ? 145 ASP B OD2 1 
ATOM   3592 N  N   . ASN B 1 145 ? 30.131  -5.803  -35.185 1.00 59.87  ? 146 ASN B N   1 
ATOM   3593 C  CA  . ASN B 1 145 ? 30.379  -7.048  -35.912 1.00 59.96  ? 146 ASN B CA  1 
ATOM   3594 C  C   . ASN B 1 145 ? 29.359  -7.298  -37.012 1.00 59.37  ? 146 ASN B C   1 
ATOM   3595 O  O   . ASN B 1 145 ? 29.721  -7.760  -38.092 1.00 60.42  ? 146 ASN B O   1 
ATOM   3596 C  CB  . ASN B 1 145 ? 30.416  -8.232  -34.951 1.00 61.92  ? 146 ASN B CB  1 
ATOM   3597 C  CG  . ASN B 1 145 ? 31.797  -8.482  -34.376 1.00 64.75  ? 146 ASN B CG  1 
ATOM   3598 O  OD1 . ASN B 1 145 ? 32.811  -8.309  -35.054 1.00 66.09  ? 146 ASN B OD1 1 
ATOM   3599 N  ND2 . ASN B 1 145 ? 31.841  -8.911  -33.117 1.00 65.38  ? 146 ASN B ND2 1 
ATOM   3600 N  N   . ILE B 1 146 ? 28.092  -6.986  -36.726 1.00 59.13  ? 147 ILE B N   1 
ATOM   3601 C  CA  . ILE B 1 146 ? 26.990  -7.095  -37.696 1.00 59.04  ? 147 ILE B CA  1 
ATOM   3602 C  C   . ILE B 1 146 ? 27.137  -6.067  -38.835 1.00 60.06  ? 147 ILE B C   1 
ATOM   3603 O  O   . ILE B 1 146 ? 26.842  -6.372  -39.992 1.00 62.55  ? 147 ILE B O   1 
ATOM   3604 C  CB  . ILE B 1 146 ? 25.606  -7.010  -36.995 1.00 58.15  ? 147 ILE B CB  1 
ATOM   3605 C  CG1 . ILE B 1 146 ? 25.258  -8.344  -36.311 1.00 57.85  ? 147 ILE B CG1 1 
ATOM   3606 C  CG2 . ILE B 1 146 ? 24.493  -6.649  -37.973 1.00 58.05  ? 147 ILE B CG2 1 
ATOM   3607 C  CD1 . ILE B 1 146 ? 24.281  -8.218  -35.151 1.00 54.62  ? 147 ILE B CD1 1 
ATOM   3608 N  N   . ILE B 1 147 ? 27.604  -4.866  -38.506 1.00 59.08  ? 148 ILE B N   1 
ATOM   3609 C  CA  . ILE B 1 147 ? 27.855  -3.831  -39.507 1.00 60.84  ? 148 ILE B CA  1 
ATOM   3610 C  C   . ILE B 1 147 ? 28.981  -4.252  -40.450 1.00 64.14  ? 148 ILE B C   1 
ATOM   3611 O  O   . ILE B 1 147 ? 28.853  -4.074  -41.669 1.00 66.57  ? 148 ILE B O   1 
ATOM   3612 C  CB  . ILE B 1 147 ? 28.070  -2.432  -38.854 1.00 62.35  ? 148 ILE B CB  1 
ATOM   3613 C  CG1 . ILE B 1 147 ? 26.733  -1.873  -38.329 1.00 61.07  ? 148 ILE B CG1 1 
ATOM   3614 C  CG2 . ILE B 1 147 ? 28.736  -1.428  -39.795 1.00 62.42  ? 148 ILE B CG2 1 
ATOM   3615 C  CD1 . ILE B 1 147 ? 25.573  -1.864  -39.320 1.00 61.79  ? 148 ILE B CD1 1 
ATOM   3616 N  N   . SER B 1 148 ? 30.047  -4.837  -39.888 1.00 65.03  ? 149 SER B N   1 
ATOM   3617 C  CA  . SER B 1 148 ? 31.171  -5.403  -40.663 1.00 65.44  ? 149 SER B CA  1 
ATOM   3618 C  C   . SER B 1 148 ? 30.727  -6.367  -41.761 1.00 66.02  ? 149 SER B C   1 
ATOM   3619 O  O   . SER B 1 148 ? 31.393  -6.462  -42.794 1.00 66.56  ? 149 SER B O   1 
ATOM   3620 C  CB  . SER B 1 148 ? 32.159  -6.132  -39.751 1.00 66.27  ? 149 SER B CB  1 
ATOM   3621 O  OG  . SER B 1 148 ? 32.771  -5.245  -38.843 1.00 67.66  ? 149 SER B OG  1 
ATOM   3622 N  N   . GLN B 1 149 ? 29.608  -7.069  -41.524 1.00 64.11  ? 150 GLN B N   1 
ATOM   3623 C  CA  . GLN B 1 149 ? 29.033  -8.026  -42.482 1.00 65.76  ? 150 GLN B CA  1 
ATOM   3624 C  C   . GLN B 1 149 ? 28.509  -7.362  -43.754 1.00 64.86  ? 150 GLN B C   1 
ATOM   3625 O  O   . GLN B 1 149 ? 28.456  -8.000  -44.813 1.00 66.94  ? 150 GLN B O   1 
ATOM   3626 C  CB  . GLN B 1 149 ? 27.920  -8.857  -41.837 1.00 66.89  ? 150 GLN B CB  1 
ATOM   3627 C  CG  . GLN B 1 149 ? 28.399  -9.932  -40.868 1.00 69.93  ? 150 GLN B CG  1 
ATOM   3628 C  CD  . GLN B 1 149 ? 27.270  -10.776 -40.293 1.00 71.23  ? 150 GLN B CD  1 
ATOM   3629 O  OE1 . GLN B 1 149 ? 26.106  -10.655 -40.689 1.00 70.50  ? 150 GLN B OE1 1 
ATOM   3630 N  NE2 . GLN B 1 149 ? 27.615  -11.643 -39.348 1.00 72.04  ? 150 GLN B NE2 1 
ATOM   3631 N  N   . GLY B 1 150 ? 28.119  -6.092  -43.634 1.00 61.14  ? 151 GLY B N   1 
ATOM   3632 C  CA  . GLY B 1 150 ? 27.676  -5.274  -44.763 1.00 61.45  ? 151 GLY B CA  1 
ATOM   3633 C  C   . GLY B 1 150 ? 26.394  -5.743  -45.423 1.00 61.79  ? 151 GLY B C   1 
ATOM   3634 O  O   . GLY B 1 150 ? 26.287  -5.723  -46.652 1.00 63.15  ? 151 GLY B O   1 
ATOM   3635 N  N   . VAL B 1 151 ? 25.431  -6.171  -44.606 1.00 60.72  ? 152 VAL B N   1 
ATOM   3636 C  CA  . VAL B 1 151 ? 24.134  -6.662  -45.100 1.00 60.55  ? 152 VAL B CA  1 
ATOM   3637 C  C   . VAL B 1 151 ? 22.977  -5.731  -44.703 1.00 59.57  ? 152 VAL B C   1 
ATOM   3638 O  O   . VAL B 1 151 ? 21.954  -5.667  -45.401 1.00 60.61  ? 152 VAL B O   1 
ATOM   3639 C  CB  . VAL B 1 151 ? 23.849  -8.155  -44.721 1.00 59.48  ? 152 VAL B CB  1 
ATOM   3640 C  CG1 . VAL B 1 151 ? 24.798  -9.099  -45.457 1.00 58.33  ? 152 VAL B CG1 1 
ATOM   3641 C  CG2 . VAL B 1 151 ? 23.889  -8.394  -43.209 1.00 56.38  ? 152 VAL B CG2 1 
ATOM   3642 N  N   . LEU B 1 152 ? 23.159  -5.007  -43.597 1.00 57.88  ? 153 LEU B N   1 
ATOM   3643 C  CA  . LEU B 1 152 ? 22.162  -4.057  -43.090 1.00 57.24  ? 153 LEU B CA  1 
ATOM   3644 C  C   . LEU B 1 152 ? 21.946  -2.851  -44.004 1.00 58.19  ? 153 LEU B C   1 
ATOM   3645 O  O   . LEU B 1 152 ? 22.900  -2.273  -44.524 1.00 58.90  ? 153 LEU B O   1 
ATOM   3646 C  CB  . LEU B 1 152 ? 22.500  -3.602  -41.662 1.00 56.04  ? 153 LEU B CB  1 
ATOM   3647 C  CG  . LEU B 1 152 ? 22.400  -4.623  -40.515 1.00 55.88  ? 153 LEU B CG  1 
ATOM   3648 C  CD1 . LEU B 1 152 ? 22.504  -3.904  -39.179 1.00 56.09  ? 153 LEU B CD1 1 
ATOM   3649 C  CD2 . LEU B 1 152 ? 21.115  -5.439  -40.567 1.00 54.32  ? 153 LEU B CD2 1 
ATOM   3650 N  N   . LYS B 1 153 ? 20.677  -2.494  -44.193 1.00 60.95  ? 154 LYS B N   1 
ATOM   3651 C  CA  . LYS B 1 153 ? 20.276  -1.411  -45.088 1.00 63.26  ? 154 LYS B CA  1 
ATOM   3652 C  C   . LYS B 1 153 ? 20.824  -0.054  -44.612 1.00 63.26  ? 154 LYS B C   1 
ATOM   3653 O  O   . LYS B 1 153 ? 21.385  0.701   -45.413 1.00 63.63  ? 154 LYS B O   1 
ATOM   3654 C  CB  . LYS B 1 153 ? 18.750  -1.393  -45.259 1.00 64.88  ? 154 LYS B CB  1 
ATOM   3655 C  CG  . LYS B 1 153 ? 18.275  -0.665  -46.508 1.00 73.38  ? 154 LYS B CG  1 
ATOM   3656 C  CD  . LYS B 1 153 ? 16.824  -0.983  -46.847 1.00 77.70  ? 154 LYS B CD  1 
ATOM   3657 C  CE  . LYS B 1 153 ? 16.369  -0.265  -48.115 1.00 81.87  ? 154 LYS B CE  1 
ATOM   3658 N  NZ  . LYS B 1 153 ? 17.022  -0.772  -49.362 1.00 84.96  ? 154 LYS B NZ  1 
ATOM   3659 N  N   . GLU B 1 154 ? 20.672  0.236   -43.318 1.00 60.37  ? 155 GLU B N   1 
ATOM   3660 C  CA  . GLU B 1 154 ? 21.272  1.419   -42.710 1.00 60.21  ? 155 GLU B CA  1 
ATOM   3661 C  C   . GLU B 1 154 ? 22.056  1.051   -41.455 1.00 58.58  ? 155 GLU B C   1 
ATOM   3662 O  O   . GLU B 1 154 ? 21.774  0.035   -40.818 1.00 60.07  ? 155 GLU B O   1 
ATOM   3663 C  CB  . GLU B 1 154 ? 20.223  2.513   -42.423 1.00 61.18  ? 155 GLU B CB  1 
ATOM   3664 C  CG  . GLU B 1 154 ? 19.636  3.236   -43.647 1.00 67.97  ? 155 GLU B CG  1 
ATOM   3665 C  CD  . GLU B 1 154 ? 20.676  3.790   -44.637 1.00 74.84  ? 155 GLU B CD  1 
ATOM   3666 O  OE1 . GLU B 1 154 ? 21.755  4.273   -44.209 1.00 78.32  ? 155 GLU B OE1 1 
ATOM   3667 O  OE2 . GLU B 1 154 ? 20.411  3.751   -45.864 1.00 76.40  ? 155 GLU B OE2 1 
ATOM   3668 N  N   . ASP B 1 155 ? 23.049  1.874   -41.118 1.00 57.39  ? 156 ASP B N   1 
ATOM   3669 C  CA  . ASP B 1 155 ? 23.897  1.670   -39.944 1.00 57.14  ? 156 ASP B CA  1 
ATOM   3670 C  C   . ASP B 1 155 ? 23.161  2.207   -38.708 1.00 55.12  ? 156 ASP B C   1 
ATOM   3671 O  O   . ASP B 1 155 ? 23.557  3.202   -38.087 1.00 55.87  ? 156 ASP B O   1 
ATOM   3672 C  CB  . ASP B 1 155 ? 25.256  2.355   -40.165 1.00 60.63  ? 156 ASP B CB  1 
ATOM   3673 C  CG  . ASP B 1 155 ? 26.298  1.977   -39.121 1.00 63.96  ? 156 ASP B CG  1 
ATOM   3674 O  OD1 . ASP B 1 155 ? 25.971  1.231   -38.168 1.00 62.92  ? 156 ASP B OD1 1 
ATOM   3675 O  OD2 . ASP B 1 155 ? 27.459  2.441   -39.255 1.00 66.22  ? 156 ASP B OD2 1 
ATOM   3676 N  N   . VAL B 1 156 ? 22.088  1.510   -38.350 1.00 52.42  ? 157 VAL B N   1 
ATOM   3677 C  CA  . VAL B 1 156 ? 21.024  2.060   -37.521 1.00 50.16  ? 157 VAL B CA  1 
ATOM   3678 C  C   . VAL B 1 156 ? 20.300  0.925   -36.802 1.00 50.24  ? 157 VAL B C   1 
ATOM   3679 O  O   . VAL B 1 156 ? 20.174  -0.172  -37.343 1.00 52.36  ? 157 VAL B O   1 
ATOM   3680 C  CB  . VAL B 1 156 ? 20.060  2.886   -38.425 1.00 49.64  ? 157 VAL B CB  1 
ATOM   3681 C  CG1 . VAL B 1 156 ? 18.586  2.685   -38.097 1.00 46.11  ? 157 VAL B CG1 1 
ATOM   3682 C  CG2 . VAL B 1 156 ? 20.444  4.358   -38.416 1.00 48.88  ? 157 VAL B CG2 1 
ATOM   3683 N  N   . PHE B 1 157 ? 19.840  1.183   -35.582 1.00 48.14  ? 158 PHE B N   1 
ATOM   3684 C  CA  . PHE B 1 157 ? 18.925  0.269   -34.911 1.00 46.38  ? 158 PHE B CA  1 
ATOM   3685 C  C   . PHE B 1 157 ? 17.878  0.995   -34.093 1.00 47.35  ? 158 PHE B C   1 
ATOM   3686 O  O   . PHE B 1 157 ? 18.136  2.050   -33.515 1.00 47.19  ? 158 PHE B O   1 
ATOM   3687 C  CB  . PHE B 1 157 ? 19.652  -0.771  -34.066 1.00 47.00  ? 158 PHE B CB  1 
ATOM   3688 C  CG  . PHE B 1 157 ? 20.571  -0.191  -33.020 1.00 48.15  ? 158 PHE B CG  1 
ATOM   3689 C  CD1 . PHE B 1 157 ? 20.096  0.103   -31.734 1.00 45.47  ? 158 PHE B CD1 1 
ATOM   3690 C  CD2 . PHE B 1 157 ? 21.929  0.019   -33.306 1.00 46.90  ? 158 PHE B CD2 1 
ATOM   3691 C  CE1 . PHE B 1 157 ? 20.951  0.611   -30.766 1.00 46.50  ? 158 PHE B CE1 1 
ATOM   3692 C  CE2 . PHE B 1 157 ? 22.783  0.533   -32.341 1.00 47.96  ? 158 PHE B CE2 1 
ATOM   3693 C  CZ  . PHE B 1 157 ? 22.294  0.828   -31.068 1.00 47.85  ? 158 PHE B CZ  1 
ATOM   3694 N  N   . SER B 1 158 ? 16.695  0.402   -34.043 1.00 48.29  ? 159 SER B N   1 
ATOM   3695 C  CA  . SER B 1 158 ? 15.535  1.069   -33.505 1.00 47.16  ? 159 SER B CA  1 
ATOM   3696 C  C   . SER B 1 158 ? 14.840  0.241   -32.446 1.00 46.73  ? 159 SER B C   1 
ATOM   3697 O  O   . SER B 1 158 ? 14.785  -0.988  -32.547 1.00 46.80  ? 159 SER B O   1 
ATOM   3698 C  CB  . SER B 1 158 ? 14.573  1.396   -34.637 1.00 48.01  ? 159 SER B CB  1 
ATOM   3699 O  OG  . SER B 1 158 ? 15.134  2.357   -35.509 1.00 49.42  ? 159 SER B OG  1 
ATOM   3700 N  N   . PHE B 1 159 ? 14.307  0.945   -31.447 1.00 45.65  ? 160 PHE B N   1 
ATOM   3701 C  CA  . PHE B 1 159 ? 13.599  0.358   -30.315 1.00 44.99  ? 160 PHE B CA  1 
ATOM   3702 C  C   . PHE B 1 159 ? 12.157  0.823   -30.258 1.00 46.14  ? 160 PHE B C   1 
ATOM   3703 O  O   . PHE B 1 159 ? 11.888  2.031   -30.248 1.00 48.83  ? 160 PHE B O   1 
ATOM   3704 C  CB  . PHE B 1 159 ? 14.282  0.752   -29.009 1.00 43.16  ? 160 PHE B CB  1 
ATOM   3705 C  CG  . PHE B 1 159 ? 15.444  -0.111  -28.650 1.00 43.41  ? 160 PHE B CG  1 
ATOM   3706 C  CD1 . PHE B 1 159 ? 16.673  0.044   -29.292 1.00 43.53  ? 160 PHE B CD1 1 
ATOM   3707 C  CD2 . PHE B 1 159 ? 15.319  -1.078  -27.655 1.00 43.78  ? 160 PHE B CD2 1 
ATOM   3708 C  CE1 . PHE B 1 159 ? 17.750  -0.763  -28.953 1.00 44.48  ? 160 PHE B CE1 1 
ATOM   3709 C  CE2 . PHE B 1 159 ? 16.394  -1.889  -27.314 1.00 44.25  ? 160 PHE B CE2 1 
ATOM   3710 C  CZ  . PHE B 1 159 ? 17.612  -1.725  -27.957 1.00 43.94  ? 160 PHE B CZ  1 
ATOM   3711 N  N   . TYR B 1 160 ? 11.242  -0.144  -30.238 1.00 45.43  ? 161 TYR B N   1 
ATOM   3712 C  CA  . TYR B 1 160 ? 9.862   0.082   -29.831 1.00 43.69  ? 161 TYR B CA  1 
ATOM   3713 C  C   . TYR B 1 160 ? 9.624   -0.646  -28.515 1.00 44.21  ? 161 TYR B C   1 
ATOM   3714 O  O   . TYR B 1 160 ? 9.956   -1.835  -28.393 1.00 46.54  ? 161 TYR B O   1 
ATOM   3715 C  CB  . TYR B 1 160 ? 8.878   -0.403  -30.906 1.00 44.17  ? 161 TYR B CB  1 
ATOM   3716 C  CG  . TYR B 1 160 ? 7.423   -0.399  -30.461 1.00 45.00  ? 161 TYR B CG  1 
ATOM   3717 C  CD1 . TYR B 1 160 ? 6.798   0.790   -30.074 1.00 44.24  ? 161 TYR B CD1 1 
ATOM   3718 C  CD2 . TYR B 1 160 ? 6.664   -1.586  -30.433 1.00 45.20  ? 161 TYR B CD2 1 
ATOM   3719 C  CE1 . TYR B 1 160 ? 5.478   0.802   -29.653 1.00 45.52  ? 161 TYR B CE1 1 
ATOM   3720 C  CE2 . TYR B 1 160 ? 5.331   -1.581  -30.017 1.00 45.30  ? 161 TYR B CE2 1 
ATOM   3721 C  CZ  . TYR B 1 160 ? 4.747   -0.383  -29.623 1.00 45.61  ? 161 TYR B CZ  1 
ATOM   3722 O  OH  . TYR B 1 160 ? 3.441   -0.325  -29.202 1.00 46.12  ? 161 TYR B OH  1 
ATOM   3723 N  N   . TYR B 1 161 ? 9.078   0.076   -27.535 1.00 42.67  ? 162 TYR B N   1 
ATOM   3724 C  CA  . TYR B 1 161 ? 8.596   -0.504  -26.281 1.00 42.72  ? 162 TYR B CA  1 
ATOM   3725 C  C   . TYR B 1 161 ? 7.113   -0.186  -26.131 1.00 45.87  ? 162 TYR B C   1 
ATOM   3726 O  O   . TYR B 1 161 ? 6.724   0.985   -26.076 1.00 50.08  ? 162 TYR B O   1 
ATOM   3727 C  CB  . TYR B 1 161 ? 9.354   0.039   -25.056 1.00 41.93  ? 162 TYR B CB  1 
ATOM   3728 C  CG  . TYR B 1 161 ? 10.793  -0.438  -24.824 1.00 42.58  ? 162 TYR B CG  1 
ATOM   3729 C  CD1 . TYR B 1 161 ? 11.366  -1.481  -25.571 1.00 43.22  ? 162 TYR B CD1 1 
ATOM   3730 C  CD2 . TYR B 1 161 ? 11.580  0.153   -23.820 1.00 42.52  ? 162 TYR B CD2 1 
ATOM   3731 C  CE1 . TYR B 1 161 ? 12.681  -1.894  -25.345 1.00 42.13  ? 162 TYR B CE1 1 
ATOM   3732 C  CE2 . TYR B 1 161 ? 12.891  -0.262  -23.579 1.00 41.97  ? 162 TYR B CE2 1 
ATOM   3733 C  CZ  . TYR B 1 161 ? 13.432  -1.289  -24.341 1.00 42.37  ? 162 TYR B CZ  1 
ATOM   3734 O  OH  . TYR B 1 161 ? 14.725  -1.707  -24.114 1.00 41.81  ? 162 TYR B OH  1 
ATOM   3735 N  N   . ASN B 1 162 ? 6.285   -1.227  -26.079 1.00 47.42  ? 163 ASN B N   1 
ATOM   3736 C  CA  . ASN B 1 162 ? 4.846   -1.087  -25.854 1.00 48.29  ? 163 ASN B CA  1 
ATOM   3737 C  C   . ASN B 1 162 ? 4.549   -0.853  -24.369 1.00 50.00  ? 163 ASN B C   1 
ATOM   3738 O  O   . ASN B 1 162 ? 5.412   -1.061  -23.512 1.00 48.74  ? 163 ASN B O   1 
ATOM   3739 C  CB  . ASN B 1 162 ? 4.119   -2.347  -26.366 1.00 48.94  ? 163 ASN B CB  1 
ATOM   3740 C  CG  . ASN B 1 162 ? 2.637   -2.122  -26.703 1.00 49.73  ? 163 ASN B CG  1 
ATOM   3741 O  OD1 . ASN B 1 162 ? 1.938   -3.075  -27.065 1.00 51.57  ? 163 ASN B OD1 1 
ATOM   3742 N  ND2 . ASN B 1 162 ? 2.157   -0.882  -26.607 1.00 46.82  ? 163 ASN B ND2 1 
ATOM   3743 N  N   . ARG B 1 163 ? 3.331   -0.396  -24.092 1.00 53.99  ? 164 ARG B N   1 
ATOM   3744 C  CA  . ARG B 1 163 ? 2.766   -0.282  -22.750 1.00 57.97  ? 164 ARG B CA  1 
ATOM   3745 C  C   . ARG B 1 163 ? 2.078   -1.605  -22.388 1.00 62.59  ? 164 ARG B C   1 
ATOM   3746 O  O   . ARG B 1 163 ? 1.612   -2.327  -23.270 1.00 65.67  ? 164 ARG B O   1 
ATOM   3747 C  CB  . ARG B 1 163 ? 1.771   0.887   -22.713 1.00 60.22  ? 164 ARG B CB  1 
ATOM   3748 C  CG  . ARG B 1 163 ? 2.392   2.205   -23.163 1.00 61.35  ? 164 ARG B CG  1 
ATOM   3749 C  CD  . ARG B 1 163 ? 1.379   3.290   -23.501 1.00 63.74  ? 164 ARG B CD  1 
ATOM   3750 N  NE  . ARG B 1 163 ? 2.089   4.491   -23.955 1.00 64.24  ? 164 ARG B NE  1 
ATOM   3751 C  CZ  . ARG B 1 163 ? 2.016   5.029   -25.172 1.00 61.29  ? 164 ARG B CZ  1 
ATOM   3752 N  NH1 . ARG B 1 163 ? 2.731   6.106   -25.440 1.00 62.26  ? 164 ARG B NH1 1 
ATOM   3753 N  NH2 . ARG B 1 163 ? 1.233   4.520   -26.114 1.00 60.01  ? 164 ARG B NH2 1 
ATOM   3754 N  N   . ASP B 1 164 ? 2.021   -1.925  -21.098 1.00 68.48  ? 165 ASP B N   1 
ATOM   3755 C  CA  . ASP B 1 164 ? 1.466   -3.205  -20.643 1.00 76.28  ? 165 ASP B CA  1 
ATOM   3756 C  C   . ASP B 1 164 ? -0.056  -3.163  -20.459 1.00 81.38  ? 165 ASP B C   1 
ATOM   3757 O  O   . ASP B 1 164 ? -0.630  -2.102  -20.182 1.00 79.46  ? 165 ASP B O   1 
ATOM   3758 C  CB  . ASP B 1 164 ? 2.148   -3.647  -19.341 1.00 80.82  ? 165 ASP B CB  1 
ATOM   3759 C  CG  . ASP B 1 164 ? 2.182   -5.167  -19.169 1.00 86.61  ? 165 ASP B CG  1 
ATOM   3760 O  OD1 . ASP B 1 164 ? 1.582   -5.912  -19.981 1.00 87.74  ? 165 ASP B OD1 1 
ATOM   3761 O  OD2 . ASP B 1 164 ? 2.826   -5.623  -18.202 1.00 90.96  ? 165 ASP B OD2 1 
ATOM   3762 N  N   . SER B 1 165 ? -0.694  -4.327  -20.621 1.00 87.76  ? 166 SER B N   1 
ATOM   3763 C  CA  . SER B 1 165 ? -2.139  -4.501  -20.382 1.00 93.14  ? 166 SER B CA  1 
ATOM   3764 C  C   . SER B 1 165 ? -2.513  -5.933  -19.971 1.00 94.65  ? 166 SER B C   1 
ATOM   3765 O  O   . SER B 1 165 ? -1.993  -6.913  -20.510 1.00 89.69  ? 166 SER B O   1 
ATOM   3766 C  CB  . SER B 1 165 ? -2.967  -4.047  -21.596 1.00 94.25  ? 166 SER B CB  1 
ATOM   3767 O  OG  . SER B 1 165 ? -2.391  -4.490  -22.815 1.00 94.56  ? 166 SER B OG  1 
ATOM   3768 N  N   . GLN B 1 169 ? -3.018  -9.281  -24.991 1.00 75.58  ? 170 GLN B N   1 
ATOM   3769 C  CA  . GLN B 1 169 ? -1.858  -10.146 -25.217 1.00 77.80  ? 170 GLN B CA  1 
ATOM   3770 C  C   . GLN B 1 169 ? -0.925  -9.613  -26.323 1.00 77.86  ? 170 GLN B C   1 
ATOM   3771 O  O   . GLN B 1 169 ? -0.250  -10.394 -27.007 1.00 78.59  ? 170 GLN B O   1 
ATOM   3772 C  CB  . GLN B 1 169 ? -2.314  -11.583 -25.521 1.00 78.83  ? 170 GLN B CB  1 
ATOM   3773 N  N   . SER B 1 170 ? -0.876  -8.282  -26.460 1.00 76.60  ? 171 SER B N   1 
ATOM   3774 C  CA  . SER B 1 170 ? -0.137  -7.569  -27.523 1.00 75.66  ? 171 SER B CA  1 
ATOM   3775 C  C   . SER B 1 170 ? 1.386   -7.778  -27.510 1.00 73.97  ? 171 SER B C   1 
ATOM   3776 O  O   . SER B 1 170 ? 1.939   -8.284  -26.527 1.00 78.49  ? 171 SER B O   1 
ATOM   3777 C  CB  . SER B 1 170 ? -0.445  -6.071  -27.446 1.00 74.44  ? 171 SER B CB  1 
ATOM   3778 O  OG  . SER B 1 170 ? 0.049   -5.523  -26.239 1.00 71.82  ? 171 SER B OG  1 
ATOM   3779 N  N   . LEU B 1 171 ? 2.059   -7.387  -28.596 1.00 69.21  ? 172 LEU B N   1 
ATOM   3780 C  CA  . LEU B 1 171 ? 3.519   -7.487  -28.661 1.00 65.13  ? 172 LEU B CA  1 
ATOM   3781 C  C   . LEU B 1 171 ? 4.121   -6.523  -27.637 1.00 61.80  ? 172 LEU B C   1 
ATOM   3782 O  O   . LEU B 1 171 ? 3.638   -5.398  -27.476 1.00 63.18  ? 172 LEU B O   1 
ATOM   3783 C  CB  . LEU B 1 171 ? 4.056   -7.250  -30.087 1.00 64.83  ? 172 LEU B CB  1 
ATOM   3784 C  CG  . LEU B 1 171 ? 4.836   -5.993  -30.503 1.00 65.28  ? 172 LEU B CG  1 
ATOM   3785 C  CD1 . LEU B 1 171 ? 5.801   -6.296  -31.638 1.00 65.23  ? 172 LEU B CD1 1 
ATOM   3786 C  CD2 . LEU B 1 171 ? 3.905   -4.849  -30.874 1.00 65.46  ? 172 LEU B CD2 1 
ATOM   3787 N  N   . GLY B 1 172 ? 5.145   -6.982  -26.929 1.00 56.34  ? 173 GLY B N   1 
ATOM   3788 C  CA  . GLY B 1 172 ? 5.721   -6.206  -25.841 1.00 51.63  ? 173 GLY B CA  1 
ATOM   3789 C  C   . GLY B 1 172 ? 6.675   -5.137  -26.310 1.00 49.05  ? 173 GLY B C   1 
ATOM   3790 O  O   . GLY B 1 172 ? 6.888   -4.142  -25.622 1.00 46.43  ? 173 GLY B O   1 
ATOM   3791 N  N   . GLY B 1 173 ? 7.249   -5.355  -27.488 1.00 49.03  ? 174 GLY B N   1 
ATOM   3792 C  CA  . GLY B 1 173 ? 8.168   -4.417  -28.100 1.00 46.10  ? 174 GLY B CA  1 
ATOM   3793 C  C   . GLY B 1 173 ? 8.855   -5.025  -29.299 1.00 47.16  ? 174 GLY B C   1 
ATOM   3794 O  O   . GLY B 1 173 ? 8.614   -6.185  -29.650 1.00 45.92  ? 174 GLY B O   1 
ATOM   3795 N  N   . GLN B 1 174 ? 9.712   -4.228  -29.930 1.00 47.80  ? 175 GLN B N   1 
ATOM   3796 C  CA  . GLN B 1 174 ? 10.442  -4.649  -31.118 1.00 49.11  ? 175 GLN B CA  1 
ATOM   3797 C  C   . GLN B 1 174 ? 11.717  -3.833  -31.291 1.00 49.58  ? 175 GLN B C   1 
ATOM   3798 O  O   . GLN B 1 174 ? 11.701  -2.599  -31.187 1.00 47.13  ? 175 GLN B O   1 
ATOM   3799 C  CB  . GLN B 1 174 ? 9.556   -4.512  -32.358 1.00 49.48  ? 175 GLN B CB  1 
ATOM   3800 C  CG  . GLN B 1 174 ? 10.114  -5.125  -33.633 1.00 50.49  ? 175 GLN B CG  1 
ATOM   3801 C  CD  . GLN B 1 174 ? 9.431   -4.570  -34.871 1.00 52.55  ? 175 GLN B CD  1 
ATOM   3802 O  OE1 . GLN B 1 174 ? 9.308   -3.360  -35.034 1.00 54.60  ? 175 GLN B OE1 1 
ATOM   3803 N  NE2 . GLN B 1 174 ? 8.990   -5.452  -35.751 1.00 54.22  ? 175 GLN B NE2 1 
ATOM   3804 N  N   . ILE B 1 175 ? 12.817  -4.543  -31.528 1.00 49.90  ? 176 ILE B N   1 
ATOM   3805 C  CA  . ILE B 1 175 ? 14.056  -3.930  -32.005 1.00 49.99  ? 176 ILE B CA  1 
ATOM   3806 C  C   . ILE B 1 175 ? 14.230  -4.247  -33.496 1.00 50.24  ? 176 ILE B C   1 
ATOM   3807 O  O   . ILE B 1 175 ? 14.064  -5.394  -33.918 1.00 50.39  ? 176 ILE B O   1 
ATOM   3808 C  CB  . ILE B 1 175 ? 15.293  -4.315  -31.143 1.00 52.02  ? 176 ILE B CB  1 
ATOM   3809 C  CG1 . ILE B 1 175 ? 16.596  -3.793  -31.768 1.00 52.87  ? 176 ILE B CG1 1 
ATOM   3810 C  CG2 . ILE B 1 175 ? 15.362  -5.819  -30.900 1.00 56.23  ? 176 ILE B CG2 1 
ATOM   3811 C  CD1 . ILE B 1 175 ? 17.832  -3.933  -30.899 1.00 54.30  ? 176 ILE B CD1 1 
ATOM   3812 N  N   . VAL B 1 176 ? 14.502  -3.215  -34.292 1.00 48.27  ? 177 VAL B N   1 
ATOM   3813 C  CA  . VAL B 1 176 ? 14.835  -3.402  -35.700 1.00 47.03  ? 177 VAL B CA  1 
ATOM   3814 C  C   . VAL B 1 176 ? 16.303  -3.037  -35.870 1.00 47.37  ? 177 VAL B C   1 
ATOM   3815 O  O   . VAL B 1 176 ? 16.694  -1.904  -35.597 1.00 49.47  ? 177 VAL B O   1 
ATOM   3816 C  CB  . VAL B 1 176 ? 13.963  -2.537  -36.645 1.00 46.08  ? 177 VAL B CB  1 
ATOM   3817 C  CG1 . VAL B 1 176 ? 14.330  -2.796  -38.102 1.00 46.18  ? 177 VAL B CG1 1 
ATOM   3818 C  CG2 . VAL B 1 176 ? 12.482  -2.807  -36.435 1.00 46.31  ? 177 VAL B CG2 1 
ATOM   3819 N  N   . LEU B 1 177 ? 17.105  -4.011  -36.294 1.00 48.34  ? 178 LEU B N   1 
ATOM   3820 C  CA  . LEU B 1 177 ? 18.503  -3.792  -36.684 1.00 48.20  ? 178 LEU B CA  1 
ATOM   3821 C  C   . LEU B 1 177 ? 18.579  -3.480  -38.175 1.00 47.66  ? 178 LEU B C   1 
ATOM   3822 O  O   . LEU B 1 177 ? 18.101  -4.263  -39.003 1.00 45.96  ? 178 LEU B O   1 
ATOM   3823 C  CB  . LEU B 1 177 ? 19.359  -5.023  -36.367 1.00 50.69  ? 178 LEU B CB  1 
ATOM   3824 C  CG  . LEU B 1 177 ? 19.459  -5.566  -34.938 1.00 51.16  ? 178 LEU B CG  1 
ATOM   3825 C  CD1 . LEU B 1 177 ? 20.280  -6.845  -34.934 1.00 53.13  ? 178 LEU B CD1 1 
ATOM   3826 C  CD2 . LEU B 1 177 ? 20.068  -4.550  -33.985 1.00 51.23  ? 178 LEU B CD2 1 
ATOM   3827 N  N   . GLY B 1 178 ? 19.153  -2.325  -38.507 1.00 46.86  ? 179 GLY B N   1 
ATOM   3828 C  CA  . GLY B 1 178 ? 19.322  -1.906  -39.903 1.00 47.83  ? 179 GLY B CA  1 
ATOM   3829 C  C   . GLY B 1 178 ? 18.283  -0.934  -40.434 1.00 47.29  ? 179 GLY B C   1 
ATOM   3830 O  O   . GLY B 1 178 ? 18.356  -0.523  -41.588 1.00 47.76  ? 179 GLY B O   1 
ATOM   3831 N  N   . GLY B 1 179 ? 17.311  -0.574  -39.600 1.00 46.52  ? 180 GLY B N   1 
ATOM   3832 C  CA  . GLY B 1 179 ? 16.275  0.388   -39.982 1.00 46.70  ? 180 GLY B CA  1 
ATOM   3833 C  C   . GLY B 1 179 ? 15.288  0.677   -38.866 1.00 46.42  ? 180 GLY B C   1 
ATOM   3834 O  O   . GLY B 1 179 ? 15.611  0.543   -37.676 1.00 45.44  ? 180 GLY B O   1 
ATOM   3835 N  N   . SER B 1 180 ? 14.082  1.070   -39.263 1.00 47.50  ? 181 SER B N   1 
ATOM   3836 C  CA  . SER B 1 180 ? 12.988  1.342   -38.336 1.00 48.46  ? 181 SER B CA  1 
ATOM   3837 C  C   . SER B 1 180 ? 11.691  0.707   -38.836 1.00 49.78  ? 181 SER B C   1 
ATOM   3838 O  O   . SER B 1 180 ? 11.598  0.292   -39.994 1.00 52.05  ? 181 SER B O   1 
ATOM   3839 C  CB  . SER B 1 180 ? 12.806  2.850   -38.180 1.00 49.27  ? 181 SER B CB  1 
ATOM   3840 O  OG  . SER B 1 180 ? 12.181  3.398   -39.330 1.00 52.04  ? 181 SER B OG  1 
ATOM   3841 N  N   . ASP B 1 181 ? 10.688  0.637   -37.964 1.00 50.12  ? 182 ASP B N   1 
ATOM   3842 C  CA  . ASP B 1 181 ? 9.388   0.104   -38.348 1.00 49.77  ? 182 ASP B CA  1 
ATOM   3843 C  C   . ASP B 1 181 ? 8.315   1.196   -38.291 1.00 49.52  ? 182 ASP B C   1 
ATOM   3844 O  O   . ASP B 1 181 ? 7.847   1.552   -37.209 1.00 49.08  ? 182 ASP B O   1 
ATOM   3845 C  CB  . ASP B 1 181 ? 9.027   -1.105  -37.485 1.00 49.53  ? 182 ASP B CB  1 
ATOM   3846 C  CG  . ASP B 1 181 ? 7.762   -1.826  -37.955 1.00 52.27  ? 182 ASP B CG  1 
ATOM   3847 O  OD1 . ASP B 1 181 ? 7.019   -1.316  -38.828 1.00 52.41  ? 182 ASP B OD1 1 
ATOM   3848 O  OD2 . ASP B 1 181 ? 7.505   -2.928  -37.429 1.00 53.82  ? 182 ASP B OD2 1 
ATOM   3849 N  N   . PRO B 1 182 ? 7.915   1.723   -39.463 1.00 51.24  ? 183 PRO B N   1 
ATOM   3850 C  CA  . PRO B 1 182 ? 6.869   2.756   -39.558 1.00 53.81  ? 183 PRO B CA  1 
ATOM   3851 C  C   . PRO B 1 182 ? 5.545   2.406   -38.851 1.00 55.39  ? 183 PRO B C   1 
ATOM   3852 O  O   . PRO B 1 182 ? 4.877   3.308   -38.342 1.00 57.54  ? 183 PRO B O   1 
ATOM   3853 C  CB  . PRO B 1 182 ? 6.647   2.886   -41.066 1.00 54.47  ? 183 PRO B CB  1 
ATOM   3854 C  CG  . PRO B 1 182 ? 7.946   2.482   -41.662 1.00 53.31  ? 183 PRO B CG  1 
ATOM   3855 C  CD  . PRO B 1 182 ? 8.444   1.369   -40.793 1.00 51.13  ? 183 PRO B CD  1 
ATOM   3856 N  N   . GLN B 1 183 ? 5.183   1.122   -38.807 1.00 56.78  ? 184 GLN B N   1 
ATOM   3857 C  CA  . GLN B 1 183 ? 3.980   0.668   -38.090 1.00 59.71  ? 184 GLN B CA  1 
ATOM   3858 C  C   . GLN B 1 183 ? 3.969   1.030   -36.596 1.00 56.46  ? 184 GLN B C   1 
ATOM   3859 O  O   . GLN B 1 183 ? 2.900   1.065   -35.985 1.00 56.78  ? 184 GLN B O   1 
ATOM   3860 C  CB  . GLN B 1 183 ? 3.747   -0.846  -38.266 1.00 63.16  ? 184 GLN B CB  1 
ATOM   3861 C  CG  . GLN B 1 183 ? 3.337   -1.290  -39.672 1.00 71.40  ? 184 GLN B CG  1 
ATOM   3862 C  CD  . GLN B 1 183 ? 2.009   -0.698  -40.148 1.00 79.05  ? 184 GLN B CD  1 
ATOM   3863 O  OE1 . GLN B 1 183 ? 0.987   -0.774  -39.454 1.00 82.10  ? 184 GLN B OE1 1 
ATOM   3864 N  NE2 . GLN B 1 183 ? 2.021   -0.109  -41.346 1.00 79.97  ? 184 GLN B NE2 1 
ATOM   3865 N  N   . HIS B 1 184 ? 5.142   1.315   -36.023 1.00 52.51  ? 185 HIS B N   1 
ATOM   3866 C  CA  . HIS B 1 184 ? 5.249   1.626   -34.589 1.00 50.23  ? 185 HIS B CA  1 
ATOM   3867 C  C   . HIS B 1 184 ? 5.604   3.067   -34.214 1.00 49.83  ? 185 HIS B C   1 
ATOM   3868 O  O   . HIS B 1 184 ? 5.790   3.380   -33.034 1.00 51.35  ? 185 HIS B O   1 
ATOM   3869 C  CB  . HIS B 1 184 ? 6.133   0.596   -33.868 1.00 47.43  ? 185 HIS B CB  1 
ATOM   3870 C  CG  . HIS B 1 184 ? 5.528   -0.774  -33.830 1.00 48.36  ? 185 HIS B CG  1 
ATOM   3871 N  ND1 . HIS B 1 184 ? 4.301   -1.027  -33.251 1.00 49.82  ? 185 HIS B ND1 1 
ATOM   3872 C  CD2 . HIS B 1 184 ? 5.960   -1.956  -34.325 1.00 48.22  ? 185 HIS B CD2 1 
ATOM   3873 C  CE1 . HIS B 1 184 ? 4.005   -2.306  -33.390 1.00 50.36  ? 185 HIS B CE1 1 
ATOM   3874 N  NE2 . HIS B 1 184 ? 4.997   -2.893  -34.034 1.00 50.69  ? 185 HIS B NE2 1 
ATOM   3875 N  N   . TYR B 1 185 ? 5.670   3.953   -35.206 1.00 50.30  ? 186 TYR B N   1 
ATOM   3876 C  CA  . TYR B 1 185 ? 5.740   5.386   -34.934 1.00 48.67  ? 186 TYR B CA  1 
ATOM   3877 C  C   . TYR B 1 185 ? 4.850   6.241   -35.825 1.00 50.92  ? 186 TYR B C   1 
ATOM   3878 O  O   . TYR B 1 185 ? 4.300   5.781   -36.827 1.00 50.64  ? 186 TYR B O   1 
ATOM   3879 C  CB  . TYR B 1 185 ? 7.181   5.902   -34.920 1.00 47.25  ? 186 TYR B CB  1 
ATOM   3880 C  CG  . TYR B 1 185 ? 7.953   5.713   -36.192 1.00 48.27  ? 186 TYR B CG  1 
ATOM   3881 C  CD1 . TYR B 1 185 ? 8.757   4.581   -36.378 1.00 49.21  ? 186 TYR B CD1 1 
ATOM   3882 C  CD2 . TYR B 1 185 ? 7.926   6.689   -37.202 1.00 49.16  ? 186 TYR B CD2 1 
ATOM   3883 C  CE1 . TYR B 1 185 ? 9.496   4.416   -37.549 1.00 51.05  ? 186 TYR B CE1 1 
ATOM   3884 C  CE2 . TYR B 1 185 ? 8.657   6.534   -38.376 1.00 50.28  ? 186 TYR B CE2 1 
ATOM   3885 C  CZ  . TYR B 1 185 ? 9.439   5.399   -38.548 1.00 50.91  ? 186 TYR B CZ  1 
ATOM   3886 O  OH  . TYR B 1 185 ? 10.160  5.241   -39.709 1.00 50.56  ? 186 TYR B OH  1 
ATOM   3887 N  N   . GLU B 1 186 ? 4.727   7.499   -35.426 1.00 54.18  ? 187 GLU B N   1 
ATOM   3888 C  CA  . GLU B 1 186 ? 3.872   8.473   -36.071 1.00 56.18  ? 187 GLU B CA  1 
ATOM   3889 C  C   . GLU B 1 186 ? 4.755   9.569   -36.640 1.00 54.67  ? 187 GLU B C   1 
ATOM   3890 O  O   . GLU B 1 186 ? 5.615   10.105  -35.937 1.00 54.97  ? 187 GLU B O   1 
ATOM   3891 C  CB  . GLU B 1 186 ? 2.919   9.047   -35.033 1.00 59.41  ? 187 GLU B CB  1 
ATOM   3892 C  CG  . GLU B 1 186 ? 1.710   9.758   -35.603 1.00 68.26  ? 187 GLU B CG  1 
ATOM   3893 C  CD  . GLU B 1 186 ? 0.455   9.519   -34.784 1.00 72.84  ? 187 GLU B CD  1 
ATOM   3894 O  OE1 . GLU B 1 186 ? -0.591  10.102  -35.146 1.00 79.69  ? 187 GLU B OE1 1 
ATOM   3895 O  OE2 . GLU B 1 186 ? 0.506   8.746   -33.793 1.00 69.63  ? 187 GLU B OE2 1 
ATOM   3896 N  N   . GLY B 1 187 ? 4.546   9.883   -37.913 1.00 53.89  ? 188 GLY B N   1 
ATOM   3897 C  CA  . GLY B 1 187 ? 5.312   10.911  -38.594 1.00 54.46  ? 188 GLY B CA  1 
ATOM   3898 C  C   . GLY B 1 187 ? 6.761   10.539  -38.852 1.00 55.65  ? 188 GLY B C   1 
ATOM   3899 O  O   . GLY B 1 187 ? 7.090   9.370   -39.118 1.00 55.28  ? 188 GLY B O   1 
ATOM   3900 N  N   . ASN B 1 188 ? 7.622   11.551  -38.769 1.00 55.42  ? 189 ASN B N   1 
ATOM   3901 C  CA  . ASN B 1 188 ? 9.048   11.408  -39.068 1.00 52.86  ? 189 ASN B CA  1 
ATOM   3902 C  C   . ASN B 1 188 ? 9.907   11.673  -37.849 1.00 48.75  ? 189 ASN B C   1 
ATOM   3903 O  O   . ASN B 1 188 ? 9.496   12.390  -36.936 1.00 47.48  ? 189 ASN B O   1 
ATOM   3904 C  CB  . ASN B 1 188 ? 9.463   12.356  -40.192 1.00 54.00  ? 189 ASN B CB  1 
ATOM   3905 C  CG  . ASN B 1 188 ? 8.469   12.378  -41.335 1.00 58.13  ? 189 ASN B CG  1 
ATOM   3906 O  OD1 . ASN B 1 188 ? 7.651   13.293  -41.433 1.00 57.92  ? 189 ASN B OD1 1 
ATOM   3907 N  ND2 . ASN B 1 188 ? 8.531   11.370  -42.203 1.00 58.86  ? 189 ASN B ND2 1 
ATOM   3908 N  N   . PHE B 1 189 ? 11.101  11.091  -37.849 1.00 46.69  ? 190 PHE B N   1 
ATOM   3909 C  CA  . PHE B 1 189 ? 12.097  11.344  -36.814 1.00 46.25  ? 190 PHE B CA  1 
ATOM   3910 C  C   . PHE B 1 189 ? 12.637  12.780  -36.788 1.00 46.53  ? 190 PHE B C   1 
ATOM   3911 O  O   . PHE B 1 189 ? 12.828  13.420  -37.833 1.00 45.48  ? 190 PHE B O   1 
ATOM   3912 C  CB  . PHE B 1 189 ? 13.270  10.380  -36.965 1.00 46.34  ? 190 PHE B CB  1 
ATOM   3913 C  CG  . PHE B 1 189 ? 12.920  8.944   -36.717 1.00 47.20  ? 190 PHE B CG  1 
ATOM   3914 C  CD1 . PHE B 1 189 ? 12.508  8.515   -35.448 1.00 46.12  ? 190 PHE B CD1 1 
ATOM   3915 C  CD2 . PHE B 1 189 ? 13.034  8.002   -37.746 1.00 48.65  ? 190 PHE B CD2 1 
ATOM   3916 C  CE1 . PHE B 1 189 ? 12.194  7.177   -35.222 1.00 47.67  ? 190 PHE B CE1 1 
ATOM   3917 C  CE2 . PHE B 1 189 ? 12.724  6.663   -37.523 1.00 49.43  ? 190 PHE B CE2 1 
ATOM   3918 C  CZ  . PHE B 1 189 ? 12.305  6.250   -36.258 1.00 48.62  ? 190 PHE B CZ  1 
ATOM   3919 N  N   . HIS B 1 190 ? 12.835  13.279  -35.571 1.00 46.62  ? 191 HIS B N   1 
ATOM   3920 C  CA  . HIS B 1 190 ? 13.734  14.397  -35.305 1.00 49.31  ? 191 HIS B CA  1 
ATOM   3921 C  C   . HIS B 1 190 ? 14.951  13.835  -34.560 1.00 47.42  ? 191 HIS B C   1 
ATOM   3922 O  O   . HIS B 1 190 ? 14.811  13.025  -33.637 1.00 46.79  ? 191 HIS B O   1 
ATOM   3923 C  CB  . HIS B 1 190 ? 13.051  15.508  -34.502 1.00 51.03  ? 191 HIS B CB  1 
ATOM   3924 C  CG  . HIS B 1 190 ? 13.969  16.635  -34.138 1.00 57.09  ? 191 HIS B CG  1 
ATOM   3925 N  ND1 . HIS B 1 190 ? 14.334  17.621  -35.033 1.00 60.90  ? 191 HIS B ND1 1 
ATOM   3926 C  CD2 . HIS B 1 190 ? 14.612  16.925  -32.979 1.00 58.30  ? 191 HIS B CD2 1 
ATOM   3927 C  CE1 . HIS B 1 190 ? 15.157  18.470  -34.443 1.00 62.08  ? 191 HIS B CE1 1 
ATOM   3928 N  NE2 . HIS B 1 190 ? 15.342  18.071  -33.196 1.00 61.56  ? 191 HIS B NE2 1 
ATOM   3929 N  N   . TYR B 1 191 ? 16.136  14.265  -34.976 1.00 47.54  ? 192 TYR B N   1 
ATOM   3930 C  CA  . TYR B 1 191 ? 17.395  13.733  -34.461 1.00 47.77  ? 192 TYR B CA  1 
ATOM   3931 C  C   . TYR B 1 191 ? 18.111  14.706  -33.529 1.00 47.50  ? 192 TYR B C   1 
ATOM   3932 O  O   . TYR B 1 191 ? 18.019  15.923  -33.694 1.00 49.79  ? 192 TYR B O   1 
ATOM   3933 C  CB  . TYR B 1 191 ? 18.313  13.317  -35.621 1.00 48.33  ? 192 TYR B CB  1 
ATOM   3934 C  CG  . TYR B 1 191 ? 17.755  12.186  -36.460 1.00 48.80  ? 192 TYR B CG  1 
ATOM   3935 C  CD1 . TYR B 1 191 ? 18.048  10.861  -36.150 1.00 47.61  ? 192 TYR B CD1 1 
ATOM   3936 C  CD2 . TYR B 1 191 ? 16.917  12.436  -37.557 1.00 50.46  ? 192 TYR B CD2 1 
ATOM   3937 C  CE1 . TYR B 1 191 ? 17.532  9.818   -36.900 1.00 46.00  ? 192 TYR B CE1 1 
ATOM   3938 C  CE2 . TYR B 1 191 ? 16.403  11.390  -38.316 1.00 49.70  ? 192 TYR B CE2 1 
ATOM   3939 C  CZ  . TYR B 1 191 ? 16.717  10.083  -37.975 1.00 47.60  ? 192 TYR B CZ  1 
ATOM   3940 O  OH  . TYR B 1 191 ? 16.214  9.030   -38.701 1.00 47.75  ? 192 TYR B OH  1 
ATOM   3941 N  N   . ILE B 1 192 ? 18.798  14.149  -32.536 1.00 46.93  ? 193 ILE B N   1 
ATOM   3942 C  CA  . ILE B 1 192 ? 19.681  14.903  -31.640 1.00 46.30  ? 193 ILE B CA  1 
ATOM   3943 C  C   . ILE B 1 192 ? 21.035  14.224  -31.721 1.00 46.20  ? 193 ILE B C   1 
ATOM   3944 O  O   . ILE B 1 192 ? 21.143  13.018  -31.488 1.00 45.06  ? 193 ILE B O   1 
ATOM   3945 C  CB  . ILE B 1 192 ? 19.196  14.929  -30.160 1.00 45.12  ? 193 ILE B CB  1 
ATOM   3946 C  CG1 . ILE B 1 192 ? 17.755  15.447  -30.031 1.00 44.36  ? 193 ILE B CG1 1 
ATOM   3947 C  CG2 . ILE B 1 192 ? 20.112  15.801  -29.303 1.00 45.44  ? 193 ILE B CG2 1 
ATOM   3948 C  CD1 . ILE B 1 192 ? 16.697  14.371  -30.082 1.00 42.95  ? 193 ILE B CD1 1 
ATOM   3949 N  N   . ASN B 1 193 ? 22.055  15.002  -32.069 1.00 48.10  ? 194 ASN B N   1 
ATOM   3950 C  CA  . ASN B 1 193 ? 23.421  14.507  -32.144 1.00 49.59  ? 194 ASN B CA  1 
ATOM   3951 C  C   . ASN B 1 193 ? 23.963  14.197  -30.757 1.00 49.49  ? 194 ASN B C   1 
ATOM   3952 O  O   . ASN B 1 193 ? 23.564  14.836  -29.774 1.00 50.38  ? 194 ASN B O   1 
ATOM   3953 C  CB  . ASN B 1 193 ? 24.328  15.518  -32.854 1.00 51.47  ? 194 ASN B CB  1 
ATOM   3954 C  CG  . ASN B 1 193 ? 23.851  15.862  -34.256 1.00 51.88  ? 194 ASN B CG  1 
ATOM   3955 O  OD1 . ASN B 1 193 ? 23.995  17.000  -34.700 1.00 54.59  ? 194 ASN B OD1 1 
ATOM   3956 N  ND2 . ASN B 1 193 ? 23.292  14.885  -34.963 1.00 50.12  ? 194 ASN B ND2 1 
ATOM   3957 N  N   . LEU B 1 194 ? 24.849  13.204  -30.687 1.00 47.95  ? 195 LEU B N   1 
ATOM   3958 C  CA  . LEU B 1 194 ? 25.587  12.897  -29.468 1.00 47.63  ? 195 LEU B CA  1 
ATOM   3959 C  C   . LEU B 1 194 ? 26.592  14.015  -29.181 1.00 49.95  ? 195 LEU B C   1 
ATOM   3960 O  O   . LEU B 1 194 ? 27.086  14.657  -30.107 1.00 51.93  ? 195 LEU B O   1 
ATOM   3961 C  CB  . LEU B 1 194 ? 26.322  11.556  -29.595 1.00 46.29  ? 195 LEU B CB  1 
ATOM   3962 C  CG  . LEU B 1 194 ? 25.620  10.263  -30.029 1.00 44.21  ? 195 LEU B CG  1 
ATOM   3963 C  CD1 . LEU B 1 194 ? 26.589  9.094   -29.946 1.00 44.23  ? 195 LEU B CD1 1 
ATOM   3964 C  CD2 . LEU B 1 194 ? 24.356  9.970   -29.234 1.00 43.09  ? 195 LEU B CD2 1 
ATOM   3965 N  N   . ILE B 1 195 ? 26.867  14.245  -27.896 1.00 50.85  ? 196 ILE B N   1 
ATOM   3966 C  CA  . ILE B 1 195 ? 27.892  15.190  -27.431 1.00 53.77  ? 196 ILE B CA  1 
ATOM   3967 C  C   . ILE B 1 195 ? 29.278  14.750  -27.932 1.00 55.88  ? 196 ILE B C   1 
ATOM   3968 O  O   . ILE B 1 195 ? 30.082  15.575  -28.376 1.00 57.85  ? 196 ILE B O   1 
ATOM   3969 C  CB  . ILE B 1 195 ? 27.873  15.325  -25.880 1.00 54.10  ? 196 ILE B CB  1 
ATOM   3970 C  CG1 . ILE B 1 195 ? 26.465  15.700  -25.389 1.00 51.73  ? 196 ILE B CG1 1 
ATOM   3971 C  CG2 . ILE B 1 195 ? 28.906  16.343  -25.389 1.00 55.08  ? 196 ILE B CG2 1 
ATOM   3972 C  CD1 . ILE B 1 195 ? 26.169  15.290  -23.962 1.00 51.89  ? 196 ILE B CD1 1 
ATOM   3973 N  N   . LYS B 1 196 ? 29.528  13.444  -27.865 1.00 56.04  ? 197 LYS B N   1 
ATOM   3974 C  CA  . LYS B 1 196 ? 30.759  12.831  -28.362 1.00 58.55  ? 197 LYS B CA  1 
ATOM   3975 C  C   . LYS B 1 196 ? 30.513  11.369  -28.702 1.00 57.22  ? 197 LYS B C   1 
ATOM   3976 O  O   . LYS B 1 196 ? 29.548  10.762  -28.219 1.00 55.96  ? 197 LYS B O   1 
ATOM   3977 C  CB  . LYS B 1 196 ? 31.904  12.962  -27.340 1.00 63.13  ? 197 LYS B CB  1 
ATOM   3978 C  CG  . LYS B 1 196 ? 31.699  12.223  -26.022 1.00 64.08  ? 197 LYS B CG  1 
ATOM   3979 C  CD  . LYS B 1 196 ? 32.921  12.351  -25.125 1.00 68.11  ? 197 LYS B CD  1 
ATOM   3980 C  CE  . LYS B 1 196 ? 32.873  11.347  -23.984 1.00 68.79  ? 197 LYS B CE  1 
ATOM   3981 N  NZ  . LYS B 1 196 ? 31.848  11.696  -22.963 1.00 66.67  ? 197 LYS B NZ  1 
ATOM   3982 N  N   . THR B 1 197 ? 31.394  10.808  -29.525 1.00 58.36  ? 198 THR B N   1 
ATOM   3983 C  CA  . THR B 1 197 ? 31.334  9.389   -29.884 1.00 57.38  ? 198 THR B CA  1 
ATOM   3984 C  C   . THR B 1 197 ? 31.600  8.521   -28.642 1.00 57.53  ? 198 THR B C   1 
ATOM   3985 O  O   . THR B 1 197 ? 32.184  8.994   -27.660 1.00 60.19  ? 198 THR B O   1 
ATOM   3986 C  CB  . THR B 1 197 ? 32.302  9.057   -31.056 1.00 57.61  ? 198 THR B CB  1 
ATOM   3987 O  OG1 . THR B 1 197 ? 31.992  7.769   -31.592 1.00 57.27  ? 198 THR B OG1 1 
ATOM   3988 C  CG2 . THR B 1 197 ? 33.763  9.079   -30.622 1.00 59.21  ? 198 THR B CG2 1 
ATOM   3989 N  N   . GLY B 1 198 ? 31.147  7.273   -28.673 1.00 56.14  ? 199 GLY B N   1 
ATOM   3990 C  CA  . GLY B 1 198 ? 31.472  6.331   -27.604 1.00 58.58  ? 199 GLY B CA  1 
ATOM   3991 C  C   . GLY B 1 198 ? 30.416  6.070   -26.542 1.00 57.34  ? 199 GLY B C   1 
ATOM   3992 O  O   . GLY B 1 198 ? 30.562  5.139   -25.748 1.00 59.52  ? 199 GLY B O   1 
ATOM   3993 N  N   . VAL B 1 199 ? 29.363  6.885   -26.522 1.00 54.24  ? 200 VAL B N   1 
ATOM   3994 C  CA  . VAL B 1 199 ? 28.285  6.770   -25.535 1.00 51.86  ? 200 VAL B CA  1 
ATOM   3995 C  C   . VAL B 1 199 ? 26.996  7.395   -26.108 1.00 51.28  ? 200 VAL B C   1 
ATOM   3996 O  O   . VAL B 1 199 ? 27.033  8.491   -26.676 1.00 53.14  ? 200 VAL B O   1 
ATOM   3997 C  CB  . VAL B 1 199 ? 28.710  7.345   -24.139 1.00 51.58  ? 200 VAL B CB  1 
ATOM   3998 C  CG1 . VAL B 1 199 ? 29.168  8.797   -24.225 1.00 53.07  ? 200 VAL B CG1 1 
ATOM   3999 C  CG2 . VAL B 1 199 ? 27.620  7.190   -23.088 1.00 49.24  ? 200 VAL B CG2 1 
ATOM   4000 N  N   . TRP B 1 200 ? 25.875  6.681   -25.981 1.00 49.80  ? 201 TRP B N   1 
ATOM   4001 C  CA  . TRP B 1 200 ? 24.563  7.183   -26.408 1.00 48.00  ? 201 TRP B CA  1 
ATOM   4002 C  C   . TRP B 1 200 ? 24.030  8.247   -25.454 1.00 48.70  ? 201 TRP B C   1 
ATOM   4003 O  O   . TRP B 1 200 ? 23.007  8.062   -24.775 1.00 49.44  ? 201 TRP B O   1 
ATOM   4004 C  CB  . TRP B 1 200 ? 23.561  6.044   -26.553 1.00 45.29  ? 201 TRP B CB  1 
ATOM   4005 C  CG  . TRP B 1 200 ? 23.888  5.098   -27.648 1.00 45.69  ? 201 TRP B CG  1 
ATOM   4006 C  CD1 . TRP B 1 200 ? 24.283  3.800   -27.512 1.00 45.58  ? 201 TRP B CD1 1 
ATOM   4007 C  CD2 . TRP B 1 200 ? 23.840  5.361   -29.059 1.00 45.40  ? 201 TRP B CD2 1 
ATOM   4008 N  NE1 . TRP B 1 200 ? 24.491  3.236   -28.749 1.00 45.39  ? 201 TRP B NE1 1 
ATOM   4009 C  CE2 . TRP B 1 200 ? 24.229  4.169   -29.717 1.00 44.53  ? 201 TRP B CE2 1 
ATOM   4010 C  CE3 . TRP B 1 200 ? 23.517  6.491   -29.834 1.00 45.22  ? 201 TRP B CE3 1 
ATOM   4011 C  CZ2 . TRP B 1 200 ? 24.298  4.066   -31.113 1.00 44.87  ? 201 TRP B CZ2 1 
ATOM   4012 C  CZ3 . TRP B 1 200 ? 23.587  6.392   -31.232 1.00 44.79  ? 201 TRP B CZ3 1 
ATOM   4013 C  CH2 . TRP B 1 200 ? 23.977  5.184   -31.854 1.00 45.11  ? 201 TRP B CH2 1 
ATOM   4014 N  N   . GLN B 1 201 ? 24.732  9.372   -25.426 1.00 48.62  ? 202 GLN B N   1 
ATOM   4015 C  CA  . GLN B 1 201 ? 24.439  10.449  -24.504 1.00 48.82  ? 202 GLN B CA  1 
ATOM   4016 C  C   . GLN B 1 201 ? 24.251  11.736  -25.293 1.00 49.24  ? 202 GLN B C   1 
ATOM   4017 O  O   . GLN B 1 201 ? 25.044  12.056  -26.188 1.00 49.94  ? 202 GLN B O   1 
ATOM   4018 C  CB  . GLN B 1 201 ? 25.566  10.578  -23.478 1.00 49.72  ? 202 GLN B CB  1 
ATOM   4019 C  CG  . GLN B 1 201 ? 25.206  11.370  -22.232 1.00 51.64  ? 202 GLN B CG  1 
ATOM   4020 C  CD  . GLN B 1 201 ? 26.321  11.403  -21.199 1.00 54.83  ? 202 GLN B CD  1 
ATOM   4021 O  OE1 . GLN B 1 201 ? 27.481  11.700  -21.505 1.00 58.36  ? 202 GLN B OE1 1 
ATOM   4022 N  NE2 . GLN B 1 201 ? 25.968  11.112  -19.961 1.00 55.61  ? 202 GLN B NE2 1 
ATOM   4023 N  N   . ILE B 1 202 ? 23.182  12.457  -24.969 1.00 48.41  ? 203 ILE B N   1 
ATOM   4024 C  CA  . ILE B 1 202 ? 22.861  13.713  -25.648 1.00 48.16  ? 203 ILE B CA  1 
ATOM   4025 C  C   . ILE B 1 202 ? 22.763  14.873  -24.654 1.00 50.22  ? 203 ILE B C   1 
ATOM   4026 O  O   . ILE B 1 202 ? 22.532  14.656  -23.462 1.00 50.65  ? 203 ILE B O   1 
ATOM   4027 C  CB  . ILE B 1 202 ? 21.596  13.581  -26.539 1.00 45.93  ? 203 ILE B CB  1 
ATOM   4028 C  CG1 . ILE B 1 202 ? 20.369  13.114  -25.727 1.00 43.72  ? 203 ILE B CG1 1 
ATOM   4029 C  CG2 . ILE B 1 202 ? 21.881  12.638  -27.710 1.00 45.26  ? 203 ILE B CG2 1 
ATOM   4030 C  CD1 . ILE B 1 202 ? 19.039  13.208  -26.451 1.00 39.90  ? 203 ILE B CD1 1 
ATOM   4031 N  N   . GLN B 1 203 ? 22.991  16.091  -25.145 1.00 52.50  ? 204 GLN B N   1 
ATOM   4032 C  CA  . GLN B 1 203 ? 22.780  17.311  -24.367 1.00 54.64  ? 204 GLN B CA  1 
ATOM   4033 C  C   . GLN B 1 203 ? 21.285  17.483  -24.132 1.00 52.52  ? 204 GLN B C   1 
ATOM   4034 O  O   . GLN B 1 203 ? 20.485  17.264  -25.041 1.00 50.39  ? 204 GLN B O   1 
ATOM   4035 C  CB  . GLN B 1 203 ? 23.358  18.523  -25.107 1.00 58.27  ? 204 GLN B CB  1 
ATOM   4036 C  CG  . GLN B 1 203 ? 23.303  19.855  -24.358 1.00 64.13  ? 204 GLN B CG  1 
ATOM   4037 C  CD  . GLN B 1 203 ? 24.422  20.045  -23.335 1.00 69.68  ? 204 GLN B CD  1 
ATOM   4038 O  OE1 . GLN B 1 203 ? 25.488  19.430  -23.423 1.00 74.19  ? 204 GLN B OE1 1 
ATOM   4039 N  NE2 . GLN B 1 203 ? 24.185  20.922  -22.363 1.00 72.15  ? 204 GLN B NE2 1 
ATOM   4040 N  N   . MET B 1 204 ? 20.917  17.827  -22.900 1.00 53.64  ? 205 MET B N   1 
ATOM   4041 C  CA  . MET B 1 204 ? 19.543  18.199  -22.566 1.00 53.96  ? 205 MET B CA  1 
ATOM   4042 C  C   . MET B 1 204 ? 19.496  19.669  -22.147 1.00 56.97  ? 205 MET B C   1 
ATOM   4043 O  O   . MET B 1 204 ? 20.345  20.132  -21.382 1.00 57.97  ? 205 MET B O   1 
ATOM   4044 C  CB  . MET B 1 204 ? 18.971  17.283  -21.489 1.00 53.88  ? 205 MET B CB  1 
ATOM   4045 C  CG  . MET B 1 204 ? 17.491  17.503  -21.194 1.00 54.43  ? 205 MET B CG  1 
ATOM   4046 S  SD  . MET B 1 204 ? 16.643  15.990  -20.714 1.00 56.28  ? 205 MET B SD  1 
ATOM   4047 C  CE  . MET B 1 204 ? 17.406  15.633  -19.139 1.00 52.93  ? 205 MET B CE  1 
ATOM   4048 N  N   . LYS B 1 205 ? 18.505  20.390  -22.664 1.00 58.28  ? 206 LYS B N   1 
ATOM   4049 C  CA  . LYS B 1 205 ? 18.459  21.849  -22.565 1.00 62.64  ? 206 LYS B CA  1 
ATOM   4050 C  C   . LYS B 1 205 ? 17.463  22.366  -21.516 1.00 62.41  ? 206 LYS B C   1 
ATOM   4051 O  O   . LYS B 1 205 ? 17.319  23.577  -21.340 1.00 65.50  ? 206 LYS B O   1 
ATOM   4052 C  CB  . LYS B 1 205 ? 18.187  22.460  -23.947 1.00 65.57  ? 206 LYS B CB  1 
ATOM   4053 C  CG  . LYS B 1 205 ? 19.327  22.266  -24.944 1.00 71.49  ? 206 LYS B CG  1 
ATOM   4054 C  CD  . LYS B 1 205 ? 18.859  22.308  -26.399 1.00 76.01  ? 206 LYS B CD  1 
ATOM   4055 C  CE  . LYS B 1 205 ? 18.961  23.705  -27.000 1.00 79.39  ? 206 LYS B CE  1 
ATOM   4056 N  NZ  . LYS B 1 205 ? 18.466  23.741  -28.404 1.00 79.46  ? 206 LYS B NZ  1 
ATOM   4057 N  N   . GLY B 1 206 ? 16.802  21.447  -20.811 1.00 59.71  ? 207 GLY B N   1 
ATOM   4058 C  CA  . GLY B 1 206 ? 15.815  21.796  -19.786 1.00 58.05  ? 207 GLY B CA  1 
ATOM   4059 C  C   . GLY B 1 206 ? 14.891  20.643  -19.431 1.00 57.37  ? 207 GLY B C   1 
ATOM   4060 O  O   . GLY B 1 206 ? 14.565  19.803  -20.284 1.00 55.48  ? 207 GLY B O   1 
ATOM   4061 N  N   . VAL B 1 207 ? 14.485  20.587  -18.164 1.00 56.96  ? 208 VAL B N   1 
ATOM   4062 C  CA  . VAL B 1 207 ? 13.405  19.693  -17.744 1.00 55.97  ? 208 VAL B CA  1 
ATOM   4063 C  C   . VAL B 1 207 ? 12.267  20.528  -17.167 1.00 58.12  ? 208 VAL B C   1 
ATOM   4064 O  O   . VAL B 1 207 ? 12.432  21.217  -16.146 1.00 59.12  ? 208 VAL B O   1 
ATOM   4065 C  CB  . VAL B 1 207 ? 13.866  18.592  -16.759 1.00 55.61  ? 208 VAL B CB  1 
ATOM   4066 C  CG1 . VAL B 1 207 ? 12.680  17.763  -16.282 1.00 54.40  ? 208 VAL B CG1 1 
ATOM   4067 C  CG2 . VAL B 1 207 ? 14.890  17.677  -17.415 1.00 54.11  ? 208 VAL B CG2 1 
ATOM   4068 N  N   . SER B 1 208 ? 11.115  20.460  -17.834 1.00 57.90  ? 209 SER B N   1 
ATOM   4069 C  CA  . SER B 1 208 ? 9.969   21.291  -17.475 1.00 59.47  ? 209 SER B CA  1 
ATOM   4070 C  C   . SER B 1 208 ? 8.849   20.537  -16.788 1.00 59.46  ? 209 SER B C   1 
ATOM   4071 O  O   . SER B 1 208 ? 8.454   19.452  -17.218 1.00 60.13  ? 209 SER B O   1 
ATOM   4072 C  CB  . SER B 1 208 ? 9.442   22.043  -18.692 1.00 58.64  ? 209 SER B CB  1 
ATOM   4073 O  OG  . SER B 1 208 ? 10.409  22.980  -19.124 1.00 61.41  ? 209 SER B OG  1 
ATOM   4074 N  N   . VAL B 1 209 ? 8.372   21.125  -15.698 1.00 60.64  ? 210 VAL B N   1 
ATOM   4075 C  CA  . VAL B 1 209 ? 7.162   20.697  -15.018 1.00 61.66  ? 210 VAL B CA  1 
ATOM   4076 C  C   . VAL B 1 209 ? 6.111   21.754  -15.369 1.00 66.17  ? 210 VAL B C   1 
ATOM   4077 O  O   . VAL B 1 209 ? 6.215   22.919  -14.950 1.00 69.24  ? 210 VAL B O   1 
ATOM   4078 C  CB  . VAL B 1 209 ? 7.396   20.573  -13.498 1.00 61.11  ? 210 VAL B CB  1 
ATOM   4079 C  CG1 . VAL B 1 209 ? 6.105   20.273  -12.756 1.00 61.23  ? 210 VAL B CG1 1 
ATOM   4080 C  CG2 . VAL B 1 209 ? 8.411   19.484  -13.215 1.00 59.25  ? 210 VAL B CG2 1 
ATOM   4081 N  N   . GLY B 1 210 ? 5.118   21.344  -16.158 1.00 66.44  ? 211 GLY B N   1 
ATOM   4082 C  CA  . GLY B 1 210 ? 4.188   22.282  -16.793 1.00 71.33  ? 211 GLY B CA  1 
ATOM   4083 C  C   . GLY B 1 210 ? 4.934   23.176  -17.774 1.00 73.65  ? 211 GLY B C   1 
ATOM   4084 O  O   . GLY B 1 210 ? 5.791   22.697  -18.531 1.00 70.47  ? 211 GLY B O   1 
ATOM   4085 N  N   . SER B 1 211 ? 4.626   24.473  -17.740 1.00 77.57  ? 212 SER B N   1 
ATOM   4086 C  CA  . SER B 1 211 ? 5.263   25.461  -18.630 1.00 79.18  ? 212 SER B CA  1 
ATOM   4087 C  C   . SER B 1 211 ? 6.644   25.949  -18.146 1.00 79.15  ? 212 SER B C   1 
ATOM   4088 O  O   . SER B 1 211 ? 7.478   26.359  -18.961 1.00 79.09  ? 212 SER B O   1 
ATOM   4089 C  CB  . SER B 1 211 ? 4.325   26.649  -18.878 1.00 82.49  ? 212 SER B CB  1 
ATOM   4090 O  OG  . SER B 1 211 ? 4.080   27.377  -17.684 1.00 86.66  ? 212 SER B OG  1 
ATOM   4091 N  N   . SER B 1 212 ? 6.878   25.893  -16.832 1.00 78.82  ? 213 SER B N   1 
ATOM   4092 C  CA  . SER B 1 212 ? 8.111   26.410  -16.226 1.00 77.72  ? 213 SER B CA  1 
ATOM   4093 C  C   . SER B 1 212 ? 9.255   25.382  -16.184 1.00 74.75  ? 213 SER B C   1 
ATOM   4094 O  O   . SER B 1 212 ? 9.082   24.266  -15.674 1.00 71.06  ? 213 SER B O   1 
ATOM   4095 C  CB  . SER B 1 212 ? 7.829   26.991  -14.828 1.00 78.56  ? 213 SER B CB  1 
ATOM   4096 O  OG  . SER B 1 212 ? 7.633   25.972  -13.860 1.00 76.90  ? 213 SER B OG  1 
ATOM   4097 N  N   . THR B 1 213 ? 10.411  25.780  -16.726 1.00 73.71  ? 214 THR B N   1 
ATOM   4098 C  CA  . THR B 1 213 ? 11.643  24.978  -16.686 1.00 72.79  ? 214 THR B CA  1 
ATOM   4099 C  C   . THR B 1 213 ? 12.239  24.970  -15.274 1.00 74.64  ? 214 THR B C   1 
ATOM   4100 O  O   . THR B 1 213 ? 12.987  25.870  -14.875 1.00 78.76  ? 214 THR B O   1 
ATOM   4101 C  CB  . THR B 1 213 ? 12.675  25.430  -17.750 1.00 72.82  ? 214 THR B CB  1 
ATOM   4102 O  OG1 . THR B 1 213 ? 12.074  25.373  -19.048 1.00 73.17  ? 214 THR B OG1 1 
ATOM   4103 C  CG2 . THR B 1 213 ? 13.920  24.532  -17.751 1.00 70.75  ? 214 THR B CG2 1 
ATOM   4104 N  N   . LEU B 1 214 ? 11.882  23.925  -14.539 1.00 73.34  ? 215 LEU B N   1 
ATOM   4105 C  CA  . LEU B 1 214 ? 12.274  23.732  -13.156 1.00 73.86  ? 215 LEU B CA  1 
ATOM   4106 C  C   . LEU B 1 214 ? 13.738  23.298  -13.035 1.00 71.56  ? 215 LEU B C   1 
ATOM   4107 O  O   . LEU B 1 214 ? 14.493  23.835  -12.221 1.00 70.80  ? 215 LEU B O   1 
ATOM   4108 C  CB  . LEU B 1 214 ? 11.354  22.671  -12.547 1.00 75.25  ? 215 LEU B CB  1 
ATOM   4109 C  CG  . LEU B 1 214 ? 11.165  22.575  -11.039 1.00 78.95  ? 215 LEU B CG  1 
ATOM   4110 C  CD1 . LEU B 1 214 ? 9.940   23.361  -10.574 1.00 78.19  ? 215 LEU B CD1 1 
ATOM   4111 C  CD2 . LEU B 1 214 ? 11.044  21.096  -10.698 1.00 78.32  ? 215 LEU B CD2 1 
ATOM   4112 N  N   . LEU B 1 215 ? 14.123  22.323  -13.856 1.00 69.33  ? 216 LEU B N   1 
ATOM   4113 C  CA  . LEU B 1 215 ? 15.425  21.663  -13.757 1.00 68.54  ? 216 LEU B CA  1 
ATOM   4114 C  C   . LEU B 1 215 ? 16.182  21.768  -15.064 1.00 67.22  ? 216 LEU B C   1 
ATOM   4115 O  O   . LEU B 1 215 ? 15.579  22.061  -16.102 1.00 66.09  ? 216 LEU B O   1 
ATOM   4116 C  CB  . LEU B 1 215 ? 15.235  20.189  -13.374 1.00 66.91  ? 216 LEU B CB  1 
ATOM   4117 C  CG  . LEU B 1 215 ? 14.640  19.916  -11.987 1.00 68.91  ? 216 LEU B CG  1 
ATOM   4118 C  CD1 . LEU B 1 215 ? 13.966  18.558  -11.951 1.00 67.19  ? 216 LEU B CD1 1 
ATOM   4119 C  CD2 . LEU B 1 215 ? 15.686  20.041  -10.885 1.00 71.30  ? 216 LEU B CD2 1 
ATOM   4120 N  N   . CYS B 1 216 ? 17.498  21.541  -15.006 1.00 68.74  ? 217 CYS B N   1 
ATOM   4121 C  CA  . CYS B 1 216 ? 18.355  21.470  -16.199 1.00 72.06  ? 217 CYS B CA  1 
ATOM   4122 C  C   . CYS B 1 216 ? 18.459  22.811  -16.939 1.00 73.13  ? 217 CYS B C   1 
ATOM   4123 O  O   . CYS B 1 216 ? 18.643  22.852  -18.158 1.00 73.60  ? 217 CYS B O   1 
ATOM   4124 C  CB  . CYS B 1 216 ? 17.838  20.378  -17.149 1.00 73.81  ? 217 CYS B CB  1 
ATOM   4125 S  SG  . CYS B 1 216 ? 19.076  19.727  -18.273 1.00 77.46  ? 217 CYS B SG  1 
ATOM   4126 N  N   . GLU B 1 217 ? 18.356  23.899  -16.182 1.00 75.46  ? 218 GLU B N   1 
ATOM   4127 C  CA  . GLU B 1 217 ? 18.248  25.255  -16.724 1.00 77.58  ? 218 GLU B CA  1 
ATOM   4128 C  C   . GLU B 1 217 ? 19.473  25.671  -17.547 1.00 80.47  ? 218 GLU B C   1 
ATOM   4129 O  O   . GLU B 1 217 ? 19.338  26.380  -18.548 1.00 81.52  ? 218 GLU B O   1 
ATOM   4130 C  CB  . GLU B 1 217 ? 17.983  26.248  -15.588 1.00 79.88  ? 218 GLU B CB  1 
ATOM   4131 C  CG  . GLU B 1 217 ? 16.794  25.862  -14.707 1.00 80.56  ? 218 GLU B CG  1 
ATOM   4132 C  CD  . GLU B 1 217 ? 16.577  26.767  -13.500 1.00 84.75  ? 218 GLU B CD  1 
ATOM   4133 O  OE1 . GLU B 1 217 ? 17.445  27.614  -13.184 1.00 86.93  ? 218 GLU B OE1 1 
ATOM   4134 O  OE2 . GLU B 1 217 ? 15.519  26.622  -12.850 1.00 84.84  ? 218 GLU B OE2 1 
ATOM   4135 N  N   . ASP B 1 218 ? 20.652  25.205  -17.126 1.00 81.15  ? 219 ASP B N   1 
ATOM   4136 C  CA  . ASP B 1 218 ? 21.928  25.505  -17.787 1.00 79.42  ? 219 ASP B CA  1 
ATOM   4137 C  C   . ASP B 1 218 ? 22.453  24.352  -18.656 1.00 76.81  ? 219 ASP B C   1 
ATOM   4138 O  O   . ASP B 1 218 ? 23.579  24.415  -19.162 1.00 78.48  ? 219 ASP B O   1 
ATOM   4139 C  CB  . ASP B 1 218 ? 22.983  25.900  -16.745 1.00 81.31  ? 219 ASP B CB  1 
ATOM   4140 C  CG  . ASP B 1 218 ? 22.687  27.235  -16.078 1.00 84.49  ? 219 ASP B CG  1 
ATOM   4141 O  OD1 . ASP B 1 218 ? 22.447  28.232  -16.793 1.00 85.30  ? 219 ASP B OD1 1 
ATOM   4142 O  OD2 . ASP B 1 218 ? 22.712  27.290  -14.830 1.00 85.00  ? 219 ASP B OD2 1 
ATOM   4143 N  N   . GLY B 1 219 ? 21.638  23.313  -18.832 1.00 71.61  ? 220 GLY B N   1 
ATOM   4144 C  CA  . GLY B 1 219 ? 22.035  22.132  -19.598 1.00 70.19  ? 220 GLY B CA  1 
ATOM   4145 C  C   . GLY B 1 219 ? 22.449  20.928  -18.764 1.00 69.98  ? 220 GLY B C   1 
ATOM   4146 O  O   . GLY B 1 219 ? 23.014  21.081  -17.677 1.00 68.71  ? 220 GLY B O   1 
ATOM   4147 N  N   . CYS B 1 220 ? 22.153  19.735  -19.290 1.00 69.71  ? 221 CYS B N   1 
ATOM   4148 C  CA  . CYS B 1 220 ? 22.510  18.439  -18.690 1.00 69.83  ? 221 CYS B CA  1 
ATOM   4149 C  C   . CYS B 1 220 ? 22.940  17.445  -19.744 1.00 66.99  ? 221 CYS B C   1 
ATOM   4150 O  O   . CYS B 1 220 ? 23.010  17.755  -20.936 1.00 67.87  ? 221 CYS B O   1 
ATOM   4151 C  CB  . CYS B 1 220 ? 21.314  17.767  -18.017 1.00 72.33  ? 221 CYS B CB  1 
ATOM   4152 S  SG  . CYS B 1 220 ? 20.293  18.770  -16.964 1.00 83.31  ? 221 CYS B SG  1 
ATOM   4153 N  N   . LEU B 1 221 ? 23.175  16.225  -19.269 1.00 63.54  ? 222 LEU B N   1 
ATOM   4154 C  CA  . LEU B 1 221 ? 23.395  15.066  -20.101 1.00 60.97  ? 222 LEU B CA  1 
ATOM   4155 C  C   . LEU B 1 221 ? 22.189  14.156  -19.961 1.00 58.43  ? 222 LEU B C   1 
ATOM   4156 O  O   . LEU B 1 221 ? 21.559  14.096  -18.895 1.00 58.02  ? 222 LEU B O   1 
ATOM   4157 C  CB  . LEU B 1 221 ? 24.675  14.338  -19.679 1.00 63.55  ? 222 LEU B CB  1 
ATOM   4158 C  CG  . LEU B 1 221 ? 25.909  15.173  -19.281 1.00 67.51  ? 222 LEU B CG  1 
ATOM   4159 C  CD1 . LEU B 1 221 ? 27.026  14.264  -18.788 1.00 69.68  ? 222 LEU B CD1 1 
ATOM   4160 C  CD2 . LEU B 1 221 ? 26.413  16.090  -20.394 1.00 67.85  ? 222 LEU B CD2 1 
ATOM   4161 N  N   . ALA B 1 222 ? 21.853  13.480  -21.056 1.00 54.72  ? 223 ALA B N   1 
ATOM   4162 C  CA  . ALA B 1 222 ? 20.796  12.484  -21.066 1.00 50.64  ? 223 ALA B CA  1 
ATOM   4163 C  C   . ALA B 1 222 ? 21.312  11.261  -21.810 1.00 50.69  ? 223 ALA B C   1 
ATOM   4164 O  O   . ALA B 1 222 ? 21.631  11.322  -23.007 1.00 51.00  ? 223 ALA B O   1 
ATOM   4165 C  CB  . ALA B 1 222 ? 19.526  13.032  -21.699 1.00 48.27  ? 223 ALA B CB  1 
ATOM   4166 N  N   . LEU B 1 223 ? 21.446  10.170  -21.066 1.00 49.38  ? 224 LEU B N   1 
ATOM   4167 C  CA  . LEU B 1 223 ? 21.802  8.875   -21.605 1.00 48.43  ? 224 LEU B CA  1 
ATOM   4168 C  C   . LEU B 1 223 ? 20.516  8.250   -22.125 1.00 47.59  ? 224 LEU B C   1 
ATOM   4169 O  O   . LEU B 1 223 ? 19.574  8.051   -21.356 1.00 46.24  ? 224 LEU B O   1 
ATOM   4170 C  CB  . LEU B 1 223 ? 22.358  8.002   -20.484 1.00 48.18  ? 224 LEU B CB  1 
ATOM   4171 C  CG  . LEU B 1 223 ? 23.495  6.984   -20.606 1.00 50.57  ? 224 LEU B CG  1 
ATOM   4172 C  CD1 . LEU B 1 223 ? 23.168  5.817   -19.680 1.00 50.84  ? 224 LEU B CD1 1 
ATOM   4173 C  CD2 . LEU B 1 223 ? 23.801  6.482   -22.013 1.00 48.55  ? 224 LEU B CD2 1 
ATOM   4174 N  N   . VAL B 1 224 ? 20.456  7.958   -23.423 1.00 47.05  ? 225 VAL B N   1 
ATOM   4175 C  CA  . VAL B 1 224 ? 19.273  7.283   -23.963 1.00 46.25  ? 225 VAL B CA  1 
ATOM   4176 C  C   . VAL B 1 224 ? 19.483  5.780   -23.796 1.00 47.12  ? 225 VAL B C   1 
ATOM   4177 O  O   . VAL B 1 224 ? 20.140  5.119   -24.619 1.00 47.21  ? 225 VAL B O   1 
ATOM   4178 C  CB  . VAL B 1 224 ? 18.922  7.714   -25.403 1.00 46.17  ? 225 VAL B CB  1 
ATOM   4179 C  CG1 . VAL B 1 224 ? 17.623  7.047   -25.857 1.00 43.92  ? 225 VAL B CG1 1 
ATOM   4180 C  CG2 . VAL B 1 224 ? 18.792  9.235   -25.487 1.00 45.95  ? 225 VAL B CG2 1 
ATOM   4181 N  N   . ASP B 1 225 ? 18.910  5.268   -22.707 1.00 47.21  ? 226 ASP B N   1 
ATOM   4182 C  CA  . ASP B 1 225 ? 19.284  3.978   -22.145 1.00 48.54  ? 226 ASP B CA  1 
ATOM   4183 C  C   . ASP B 1 225 ? 18.164  2.948   -22.214 1.00 48.41  ? 226 ASP B C   1 
ATOM   4184 O  O   . ASP B 1 225 ? 17.283  2.905   -21.347 1.00 48.58  ? 226 ASP B O   1 
ATOM   4185 C  CB  . ASP B 1 225 ? 19.757  4.171   -20.697 1.00 50.22  ? 226 ASP B CB  1 
ATOM   4186 C  CG  . ASP B 1 225 ? 20.380  2.916   -20.100 1.00 51.97  ? 226 ASP B CG  1 
ATOM   4187 O  OD1 . ASP B 1 225 ? 20.439  1.860   -20.777 1.00 51.14  ? 226 ASP B OD1 1 
ATOM   4188 O  OD2 . ASP B 1 225 ? 20.822  3.001   -18.934 1.00 53.58  ? 226 ASP B OD2 1 
ATOM   4189 N  N   . THR B 1 226 ? 18.243  2.090   -23.227 1.00 46.48  ? 227 THR B N   1 
ATOM   4190 C  CA  . THR B 1 226 ? 17.232  1.068   -23.481 1.00 42.90  ? 227 THR B CA  1 
ATOM   4191 C  C   . THR B 1 226 ? 17.200  -0.047  -22.438 1.00 43.99  ? 227 THR B C   1 
ATOM   4192 O  O   . THR B 1 226 ? 16.172  -0.709  -22.274 1.00 44.59  ? 227 THR B O   1 
ATOM   4193 C  CB  . THR B 1 226 ? 17.394  0.448   -24.875 1.00 42.10  ? 227 THR B CB  1 
ATOM   4194 O  OG1 . THR B 1 226 ? 18.675  -0.178  -24.974 1.00 45.12  ? 227 THR B OG1 1 
ATOM   4195 C  CG2 . THR B 1 226 ? 17.269  1.501   -25.942 1.00 41.33  ? 227 THR B CG2 1 
ATOM   4196 N  N   . GLY B 1 227 ? 18.318  -0.251  -21.745 1.00 44.61  ? 228 GLY B N   1 
ATOM   4197 C  CA  . GLY B 1 227 ? 18.413  -1.255  -20.680 1.00 46.37  ? 228 GLY B CA  1 
ATOM   4198 C  C   . GLY B 1 227 ? 18.013  -0.796  -19.281 1.00 48.09  ? 228 GLY B C   1 
ATOM   4199 O  O   . GLY B 1 227 ? 18.174  -1.552  -18.312 1.00 49.80  ? 228 GLY B O   1 
ATOM   4200 N  N   . ALA B 1 228 ? 17.503  0.434   -19.178 1.00 46.15  ? 229 ALA B N   1 
ATOM   4201 C  CA  . ALA B 1 228 ? 17.033  1.015   -17.915 1.00 46.44  ? 229 ALA B CA  1 
ATOM   4202 C  C   . ALA B 1 228 ? 15.507  1.141   -17.913 1.00 46.56  ? 229 ALA B C   1 
ATOM   4203 O  O   . ALA B 1 228 ? 14.905  1.555   -18.912 1.00 44.65  ? 229 ALA B O   1 
ATOM   4204 C  CB  . ALA B 1 228 ? 17.684  2.369   -17.678 1.00 45.70  ? 229 ALA B CB  1 
ATOM   4205 N  N   . SER B 1 229 ? 14.892  0.782   -16.787 1.00 48.40  ? 230 SER B N   1 
ATOM   4206 C  CA  . SER B 1 229 ? 13.434  0.722   -16.678 1.00 49.44  ? 230 SER B CA  1 
ATOM   4207 C  C   . SER B 1 229 ? 12.770  2.098   -16.769 1.00 49.87  ? 230 SER B C   1 
ATOM   4208 O  O   . SER B 1 229 ? 11.726  2.247   -17.406 1.00 49.18  ? 230 SER B O   1 
ATOM   4209 C  CB  . SER B 1 229 ? 13.007  0.042   -15.372 1.00 50.83  ? 230 SER B CB  1 
ATOM   4210 O  OG  . SER B 1 229 ? 13.418  -1.315  -15.310 1.00 54.01  ? 230 SER B OG  1 
ATOM   4211 N  N   . TYR B 1 230 ? 13.395  3.097   -16.149 1.00 49.58  ? 231 TYR B N   1 
ATOM   4212 C  CA  . TYR B 1 230 ? 12.734  4.366   -15.880 1.00 48.94  ? 231 TYR B CA  1 
ATOM   4213 C  C   . TYR B 1 230 ? 13.429  5.569   -16.515 1.00 48.96  ? 231 TYR B C   1 
ATOM   4214 O  O   . TYR B 1 230 ? 14.469  5.431   -17.163 1.00 46.88  ? 231 TYR B O   1 
ATOM   4215 C  CB  . TYR B 1 230 ? 12.610  4.566   -14.364 1.00 50.21  ? 231 TYR B CB  1 
ATOM   4216 C  CG  . TYR B 1 230 ? 12.202  3.328   -13.587 1.00 51.02  ? 231 TYR B CG  1 
ATOM   4217 C  CD1 . TYR B 1 230 ? 10.886  2.840   -13.633 1.00 50.74  ? 231 TYR B CD1 1 
ATOM   4218 C  CD2 . TYR B 1 230 ? 13.134  2.647   -12.791 1.00 52.41  ? 231 TYR B CD2 1 
ATOM   4219 C  CE1 . TYR B 1 230 ? 10.516  1.704   -12.913 1.00 52.51  ? 231 TYR B CE1 1 
ATOM   4220 C  CE2 . TYR B 1 230 ? 12.776  1.514   -12.063 1.00 53.84  ? 231 TYR B CE2 1 
ATOM   4221 C  CZ  . TYR B 1 230 ? 11.470  1.044   -12.127 1.00 54.31  ? 231 TYR B CZ  1 
ATOM   4222 O  OH  . TYR B 1 230 ? 11.128  -0.082  -11.409 1.00 56.20  ? 231 TYR B OH  1 
ATOM   4223 N  N   . ILE B 1 231 ? 12.814  6.742   -16.363 1.00 49.75  ? 232 ILE B N   1 
ATOM   4224 C  CA  . ILE B 1 231 ? 13.529  8.001   -16.514 1.00 51.55  ? 232 ILE B CA  1 
ATOM   4225 C  C   . ILE B 1 231 ? 14.204  8.217   -15.161 1.00 54.19  ? 232 ILE B C   1 
ATOM   4226 O  O   . ILE B 1 231 ? 13.559  8.119   -14.109 1.00 54.76  ? 232 ILE B O   1 
ATOM   4227 C  CB  . ILE B 1 231 ? 12.608  9.190   -16.882 1.00 50.31  ? 232 ILE B CB  1 
ATOM   4228 C  CG1 . ILE B 1 231 ? 12.056  9.007   -18.298 1.00 50.82  ? 232 ILE B CG1 1 
ATOM   4229 C  CG2 . ILE B 1 231 ? 13.359  10.520  -16.784 1.00 48.30  ? 232 ILE B CG2 1 
ATOM   4230 C  CD1 . ILE B 1 231 ? 10.814  9.820   -18.597 1.00 51.79  ? 232 ILE B CD1 1 
ATOM   4231 N  N   . SER B 1 232 ? 15.506  8.462   -15.190 1.00 53.42  ? 233 SER B N   1 
ATOM   4232 C  CA  . SER B 1 232 ? 16.225  8.770   -13.970 1.00 56.31  ? 233 SER B CA  1 
ATOM   4233 C  C   . SER B 1 232 ? 16.998  10.075  -14.071 1.00 56.62  ? 233 SER B C   1 
ATOM   4234 O  O   . SER B 1 232 ? 17.348  10.522  -15.170 1.00 55.48  ? 233 SER B O   1 
ATOM   4235 C  CB  . SER B 1 232 ? 17.132  7.606   -13.567 1.00 57.62  ? 233 SER B CB  1 
ATOM   4236 O  OG  . SER B 1 232 ? 18.169  7.404   -14.509 1.00 60.74  ? 233 SER B OG  1 
ATOM   4237 N  N   . GLY B 1 233 ? 17.216  10.690  -12.913 1.00 57.76  ? 234 GLY B N   1 
ATOM   4238 C  CA  . GLY B 1 233 ? 18.144  11.806  -12.751 1.00 58.94  ? 234 GLY B CA  1 
ATOM   4239 C  C   . GLY B 1 233 ? 18.932  11.609  -11.471 1.00 61.77  ? 234 GLY B C   1 
ATOM   4240 O  O   . GLY B 1 233 ? 18.786  10.581  -10.795 1.00 63.49  ? 234 GLY B O   1 
ATOM   4241 N  N   . SER B 1 234 ? 19.766  12.591  -11.129 1.00 62.97  ? 235 SER B N   1 
ATOM   4242 C  CA  . SER B 1 234 ? 20.477  12.584  -9.851  1.00 63.48  ? 235 SER B CA  1 
ATOM   4243 C  C   . SER B 1 234 ? 19.479  12.694  -8.695  1.00 63.56  ? 235 SER B C   1 
ATOM   4244 O  O   . SER B 1 234 ? 18.370  13.207  -8.880  1.00 62.77  ? 235 SER B O   1 
ATOM   4245 C  CB  . SER B 1 234 ? 21.493  13.723  -9.797  1.00 64.75  ? 235 SER B CB  1 
ATOM   4246 O  OG  . SER B 1 234 ? 20.846  14.980  -9.819  1.00 64.19  ? 235 SER B OG  1 
ATOM   4247 N  N   . THR B 1 235 ? 19.873  12.201  -7.519  1.00 64.25  ? 236 THR B N   1 
ATOM   4248 C  CA  . THR B 1 235 ? 19.062  12.290  -6.295  1.00 63.46  ? 236 THR B CA  1 
ATOM   4249 C  C   . THR B 1 235 ? 18.453  13.683  -6.095  1.00 63.74  ? 236 THR B C   1 
ATOM   4250 O  O   . THR B 1 235 ? 17.239  13.795  -5.906  1.00 63.31  ? 236 THR B O   1 
ATOM   4251 C  CB  . THR B 1 235 ? 19.860  11.822  -5.053  1.00 65.48  ? 236 THR B CB  1 
ATOM   4252 O  OG1 . THR B 1 235 ? 20.224  10.451  -5.228  1.00 65.51  ? 236 THR B OG1 1 
ATOM   4253 C  CG2 . THR B 1 235 ? 19.043  11.937  -3.768  1.00 65.75  ? 236 THR B CG2 1 
ATOM   4254 N  N   . SER B 1 236 ? 19.284  14.726  -6.177  1.00 65.12  ? 237 SER B N   1 
ATOM   4255 C  CA  . SER B 1 236 ? 18.820  16.112  -6.026  1.00 66.85  ? 237 SER B CA  1 
ATOM   4256 C  C   . SER B 1 236 ? 17.843  16.512  -7.132  1.00 63.99  ? 237 SER B C   1 
ATOM   4257 O  O   . SER B 1 236 ? 16.796  17.090  -6.842  1.00 65.82  ? 237 SER B O   1 
ATOM   4258 C  CB  . SER B 1 236 ? 19.988  17.102  -5.941  1.00 68.67  ? 237 SER B CB  1 
ATOM   4259 O  OG  . SER B 1 236 ? 20.593  17.291  -7.208  1.00 70.14  ? 237 SER B OG  1 
ATOM   4260 N  N   . SER B 1 237 ? 18.174  16.190  -8.383  1.00 61.67  ? 238 SER B N   1 
ATOM   4261 C  CA  . SER B 1 237 ? 17.263  16.438  -9.510  1.00 60.16  ? 238 SER B CA  1 
ATOM   4262 C  C   . SER B 1 237 ? 15.872  15.856  -9.245  1.00 59.52  ? 238 SER B C   1 
ATOM   4263 O  O   . SER B 1 237 ? 14.867  16.575  -9.304  1.00 60.63  ? 238 SER B O   1 
ATOM   4264 C  CB  . SER B 1 237 ? 17.828  15.892  -10.824 1.00 57.35  ? 238 SER B CB  1 
ATOM   4265 O  OG  . SER B 1 237 ? 18.802  16.762  -11.356 1.00 57.99  ? 238 SER B OG  1 
ATOM   4266 N  N   . ILE B 1 238 ? 15.834  14.569  -8.907  1.00 58.14  ? 239 ILE B N   1 
ATOM   4267 C  CA  . ILE B 1 238 ? 14.580  13.862  -8.656  1.00 58.01  ? 239 ILE B CA  1 
ATOM   4268 C  C   . ILE B 1 238 ? 13.854  14.373  -7.406  1.00 60.09  ? 239 ILE B C   1 
ATOM   4269 O  O   . ILE B 1 238 ? 12.624  14.456  -7.415  1.00 60.13  ? 239 ILE B O   1 
ATOM   4270 C  CB  . ILE B 1 238 ? 14.768  12.319  -8.675  1.00 57.42  ? 239 ILE B CB  1 
ATOM   4271 C  CG1 . ILE B 1 238 ? 15.335  11.851  -10.031 1.00 55.23  ? 239 ILE B CG1 1 
ATOM   4272 C  CG2 . ILE B 1 238 ? 13.471  11.576  -8.353  1.00 57.43  ? 239 ILE B CG2 1 
ATOM   4273 C  CD1 . ILE B 1 238 ? 14.652  12.402  -11.273 1.00 52.32  ? 239 ILE B CD1 1 
ATOM   4274 N  N   . GLU B 1 239 ? 14.605  14.755  -6.369  1.00 62.65  ? 240 GLU B N   1 
ATOM   4275 C  CA  . GLU B 1 239 ? 14.008  15.357  -5.165  1.00 65.02  ? 240 GLU B CA  1 
ATOM   4276 C  C   . GLU B 1 239 ? 13.219  16.623  -5.491  1.00 63.13  ? 240 GLU B C   1 
ATOM   4277 O  O   . GLU B 1 239 ? 12.053  16.730  -5.124  1.00 62.50  ? 240 GLU B O   1 
ATOM   4278 C  CB  . GLU B 1 239 ? 15.060  15.643  -4.098  1.00 69.32  ? 240 GLU B CB  1 
ATOM   4279 C  CG  . GLU B 1 239 ? 15.371  14.460  -3.196  1.00 74.35  ? 240 GLU B CG  1 
ATOM   4280 C  CD  . GLU B 1 239 ? 16.502  14.735  -2.209  1.00 81.09  ? 240 GLU B CD  1 
ATOM   4281 O  OE1 . GLU B 1 239 ? 17.071  15.856  -2.217  1.00 82.28  ? 240 GLU B OE1 1 
ATOM   4282 O  OE2 . GLU B 1 239 ? 16.824  13.821  -1.413  1.00 83.74  ? 240 GLU B OE2 1 
ATOM   4283 N  N   . LYS B 1 240 ? 13.859  17.549  -6.211  1.00 63.32  ? 241 LYS B N   1 
ATOM   4284 C  CA  . LYS B 1 240 ? 13.248  18.821  -6.624  1.00 63.10  ? 241 LYS B CA  1 
ATOM   4285 C  C   . LYS B 1 240 ? 12.122  18.617  -7.639  1.00 60.26  ? 241 LYS B C   1 
ATOM   4286 O  O   . LYS B 1 240 ? 11.187  19.417  -7.695  1.00 60.68  ? 241 LYS B O   1 
ATOM   4287 C  CB  . LYS B 1 240 ? 14.306  19.803  -7.163  1.00 62.00  ? 241 LYS B CB  1 
ATOM   4288 N  N   . LEU B 1 241 ? 12.223  17.547  -8.431  1.00 58.42  ? 242 LEU B N   1 
ATOM   4289 C  CA  . LEU B 1 241 ? 11.156  17.135  -9.346  1.00 56.29  ? 242 LEU B CA  1 
ATOM   4290 C  C   . LEU B 1 241 ? 9.924   16.626  -8.591  1.00 56.96  ? 242 LEU B C   1 
ATOM   4291 O  O   . LEU B 1 241 ? 8.796   17.036  -8.877  1.00 58.02  ? 242 LEU B O   1 
ATOM   4292 C  CB  . LEU B 1 241 ? 11.656  16.066  -10.333 1.00 54.12  ? 242 LEU B CB  1 
ATOM   4293 C  CG  . LEU B 1 241 ? 10.640  15.522  -11.354 1.00 52.00  ? 242 LEU B CG  1 
ATOM   4294 C  CD1 . LEU B 1 241 ? 10.345  16.549  -12.435 1.00 51.07  ? 242 LEU B CD1 1 
ATOM   4295 C  CD2 . LEU B 1 241 ? 11.112  14.213  -11.969 1.00 49.41  ? 242 LEU B CD2 1 
ATOM   4296 N  N   . MET B 1 242 ? 10.153  15.734  -7.633  1.00 57.31  ? 243 MET B N   1 
ATOM   4297 C  CA  . MET B 1 242 ? 9.074   15.113  -6.877  1.00 58.56  ? 243 MET B CA  1 
ATOM   4298 C  C   . MET B 1 242 ? 8.401   16.095  -5.930  1.00 60.70  ? 243 MET B C   1 
ATOM   4299 O  O   . MET B 1 242 ? 7.210   15.968  -5.643  1.00 60.60  ? 243 MET B O   1 
ATOM   4300 C  CB  . MET B 1 242 ? 9.577   13.876  -6.121  1.00 58.92  ? 243 MET B CB  1 
ATOM   4301 C  CG  . MET B 1 242 ? 10.024  12.733  -7.022  1.00 57.38  ? 243 MET B CG  1 
ATOM   4302 S  SD  . MET B 1 242 ? 8.717   12.044  -8.056  1.00 56.01  ? 243 MET B SD  1 
ATOM   4303 C  CE  . MET B 1 242 ? 9.634   10.880  -9.060  1.00 54.39  ? 243 MET B CE  1 
ATOM   4304 N  N   . GLU B 1 243 ? 9.172   17.071  -5.459  1.00 63.99  ? 244 GLU B N   1 
ATOM   4305 C  CA  . GLU B 1 243 ? 8.654   18.153  -4.633  1.00 68.77  ? 244 GLU B CA  1 
ATOM   4306 C  C   . GLU B 1 243 ? 7.649   18.980  -5.440  1.00 66.91  ? 244 GLU B C   1 
ATOM   4307 O  O   . GLU B 1 243 ? 6.575   19.313  -4.938  1.00 67.99  ? 244 GLU B O   1 
ATOM   4308 C  CB  . GLU B 1 243 ? 9.805   19.020  -4.116  1.00 74.92  ? 244 GLU B CB  1 
ATOM   4309 C  CG  . GLU B 1 243 ? 9.495   19.776  -2.834  1.00 84.71  ? 244 GLU B CG  1 
ATOM   4310 C  CD  . GLU B 1 243 ? 10.743  20.143  -2.043  1.00 91.81  ? 244 GLU B CD  1 
ATOM   4311 O  OE1 . GLU B 1 243 ? 11.528  19.226  -1.691  1.00 92.75  ? 244 GLU B OE1 1 
ATOM   4312 O  OE2 . GLU B 1 243 ? 10.929  21.350  -1.759  1.00 93.64  ? 244 GLU B OE2 1 
ATOM   4313 N  N   . ALA B 1 244 ? 8.002   19.269  -6.695  1.00 64.45  ? 245 ALA B N   1 
ATOM   4314 C  CA  . ALA B 1 244 ? 7.147   20.000  -7.634  1.00 63.96  ? 245 ALA B CA  1 
ATOM   4315 C  C   . ALA B 1 244 ? 5.905   19.213  -8.038  1.00 63.46  ? 245 ALA B C   1 
ATOM   4316 O  O   . ALA B 1 244 ? 4.850   19.795  -8.286  1.00 65.07  ? 245 ALA B O   1 
ATOM   4317 C  CB  . ALA B 1 244 ? 7.938   20.386  -8.868  1.00 61.80  ? 245 ALA B CB  1 
ATOM   4318 N  N   . LEU B 1 245 ? 6.047   17.893  -8.105  1.00 62.17  ? 246 LEU B N   1 
ATOM   4319 C  CA  . LEU B 1 245 ? 4.945   16.993  -8.416  1.00 61.27  ? 246 LEU B CA  1 
ATOM   4320 C  C   . LEU B 1 245 ? 3.994   16.729  -7.237  1.00 63.49  ? 246 LEU B C   1 
ATOM   4321 O  O   . LEU B 1 245 ? 2.863   16.295  -7.447  1.00 65.26  ? 246 LEU B O   1 
ATOM   4322 C  CB  . LEU B 1 245 ? 5.505   15.681  -8.977  1.00 59.39  ? 246 LEU B CB  1 
ATOM   4323 C  CG  . LEU B 1 245 ? 5.601   15.432  -10.497 1.00 57.54  ? 246 LEU B CG  1 
ATOM   4324 C  CD1 . LEU B 1 245 ? 5.860   16.667  -11.355 1.00 58.03  ? 246 LEU B CD1 1 
ATOM   4325 C  CD2 . LEU B 1 245 ? 6.656   14.369  -10.778 1.00 55.70  ? 246 LEU B CD2 1 
ATOM   4326 N  N   . GLY B 1 246 ? 4.444   17.007  -6.011  1.00 64.73  ? 247 GLY B N   1 
ATOM   4327 C  CA  . GLY B 1 246 ? 3.688   16.685  -4.793  1.00 64.22  ? 247 GLY B CA  1 
ATOM   4328 C  C   . GLY B 1 246 ? 3.841   15.233  -4.353  1.00 65.17  ? 247 GLY B C   1 
ATOM   4329 O  O   . GLY B 1 246 ? 3.106   14.761  -3.471  1.00 66.42  ? 247 GLY B O   1 
ATOM   4330 N  N   . ALA B 1 247 ? 4.799   14.533  -4.971  1.00 63.74  ? 248 ALA B N   1 
ATOM   4331 C  CA  . ALA B 1 247 ? 5.107   13.129  -4.687  1.00 64.56  ? 248 ALA B CA  1 
ATOM   4332 C  C   . ALA B 1 247 ? 6.073   12.957  -3.508  1.00 68.74  ? 248 ALA B C   1 
ATOM   4333 O  O   . ALA B 1 247 ? 6.974   13.786  -3.294  1.00 69.31  ? 248 ALA B O   1 
ATOM   4334 C  CB  . ALA B 1 247 ? 5.658   12.448  -5.928  1.00 60.96  ? 248 ALA B CB  1 
ATOM   4335 N  N   . LYS B 1 248 ? 5.874   11.866  -2.764  1.00 71.19  ? 249 LYS B N   1 
ATOM   4336 C  CA  . LYS B 1 248 ? 6.593   11.597  -1.517  1.00 74.83  ? 249 LYS B CA  1 
ATOM   4337 C  C   . LYS B 1 248 ? 7.287   10.234  -1.511  1.00 75.41  ? 249 LYS B C   1 
ATOM   4338 O  O   . LYS B 1 248 ? 6.807   9.288   -2.139  1.00 72.30  ? 249 LYS B O   1 
ATOM   4339 C  CB  . LYS B 1 248 ? 5.637   11.707  -0.327  1.00 76.80  ? 249 LYS B CB  1 
ATOM   4340 C  CG  . LYS B 1 248 ? 5.186   13.130  -0.040  1.00 81.66  ? 249 LYS B CG  1 
ATOM   4341 C  CD  . LYS B 1 248 ? 4.115   13.178  1.034   1.00 87.25  ? 249 LYS B CD  1 
ATOM   4342 C  CE  . LYS B 1 248 ? 3.628   14.600  1.261   1.00 89.42  ? 249 LYS B CE  1 
ATOM   4343 N  NZ  . LYS B 1 248 ? 2.649   14.653  2.380   1.00 93.95  ? 249 LYS B NZ  1 
ATOM   4344 N  N   . LYS B 1 249 ? 8.419   10.161  -0.806  1.00 79.43  ? 250 LYS B N   1 
ATOM   4345 C  CA  . LYS B 1 249 ? 9.157   8.919   -0.580  1.00 82.34  ? 250 LYS B CA  1 
ATOM   4346 C  C   . LYS B 1 249 ? 8.431   8.050   0.431   1.00 86.54  ? 250 LYS B C   1 
ATOM   4347 O  O   . LYS B 1 249 ? 8.368   8.381   1.625   1.00 90.48  ? 250 LYS B O   1 
ATOM   4348 C  CB  . LYS B 1 249 ? 10.584  9.198   -0.091  1.00 86.28  ? 250 LYS B CB  1 
ATOM   4349 C  CG  . LYS B 1 249 ? 11.662  9.130   -1.162  1.00 86.59  ? 250 LYS B CG  1 
ATOM   4350 C  CD  . LYS B 1 249 ? 12.151  7.706   -1.413  1.00 87.96  ? 250 LYS B CD  1 
ATOM   4351 C  CE  . LYS B 1 249 ? 13.359  7.684   -2.341  1.00 88.42  ? 250 LYS B CE  1 
ATOM   4352 N  NZ  . LYS B 1 249 ? 14.603  8.170   -1.672  1.00 91.62  ? 250 LYS B NZ  1 
ATOM   4353 N  N   . ARG B 1 250 ? 7.890   6.940   -0.071  1.00 86.67  ? 251 ARG B N   1 
ATOM   4354 C  CA  . ARG B 1 250 ? 7.140   5.953   0.708   1.00 91.51  ? 251 ARG B CA  1 
ATOM   4355 C  C   . ARG B 1 250 ? 8.034   5.344   1.803   1.00 96.78  ? 251 ARG B C   1 
ATOM   4356 O  O   . ARG B 1 250 ? 7.970   5.740   2.979   1.00 98.51  ? 251 ARG B O   1 
ATOM   4357 C  CB  . ARG B 1 250 ? 6.625   4.872   -0.254  1.00 87.87  ? 251 ARG B CB  1 
ATOM   4358 C  CG  . ARG B 1 250 ? 5.396   4.089   0.181   1.00 86.91  ? 251 ARG B CG  1 
ATOM   4359 C  CD  . ARG B 1 250 ? 5.237   2.927   -0.780  1.00 84.27  ? 251 ARG B CD  1 
ATOM   4360 N  NE  . ARG B 1 250 ? 3.851   2.597   -1.109  1.00 82.67  ? 251 ARG B NE  1 
ATOM   4361 C  CZ  . ARG B 1 250 ? 3.466   2.002   -2.240  1.00 79.77  ? 251 ARG B CZ  1 
ATOM   4362 N  NH1 . ARG B 1 250 ? 2.181   1.748   -2.443  1.00 79.29  ? 251 ARG B NH1 1 
ATOM   4363 N  NH2 . ARG B 1 250 ? 4.352   1.666   -3.176  1.00 75.86  ? 251 ARG B NH2 1 
ATOM   4364 N  N   . LEU B 1 251 ? 8.864   4.389   1.382   1.00 97.42  ? 252 LEU B N   1 
ATOM   4365 C  CA  . LEU B 1 251 ? 9.914   3.777   2.188   1.00 98.81  ? 252 LEU B CA  1 
ATOM   4366 C  C   . LEU B 1 251 ? 11.030  3.346   1.234   1.00 96.02  ? 252 LEU B C   1 
ATOM   4367 O  O   . LEU B 1 251 ? 12.180  3.179   1.650   1.00 100.80 ? 252 LEU B O   1 
ATOM   4368 C  CB  . LEU B 1 251 ? 9.375   2.581   2.984   1.00 99.91  ? 252 LEU B CB  1 
ATOM   4369 N  N   . PHE B 1 252 ? 10.672  3.179   -0.042  1.00 89.48  ? 253 PHE B N   1 
ATOM   4370 C  CA  . PHE B 1 252 ? 11.614  2.829   -1.108  1.00 86.46  ? 253 PHE B CA  1 
ATOM   4371 C  C   . PHE B 1 252 ? 11.470  3.741   -2.326  1.00 82.22  ? 253 PHE B C   1 
ATOM   4372 O  O   . PHE B 1 252 ? 12.472  4.183   -2.897  1.00 80.36  ? 253 PHE B O   1 
ATOM   4373 C  CB  . PHE B 1 252 ? 11.435  1.367   -1.555  1.00 86.27  ? 253 PHE B CB  1 
ATOM   4374 C  CG  . PHE B 1 252 ? 11.579  0.352   -0.448  1.00 88.80  ? 253 PHE B CG  1 
ATOM   4375 C  CD1 . PHE B 1 252 ? 12.846  -0.056  -0.006  1.00 90.16  ? 253 PHE B CD1 1 
ATOM   4376 C  CD2 . PHE B 1 252 ? 10.449  -0.224  0.136   1.00 88.05  ? 253 PHE B CD2 1 
ATOM   4377 C  CE1 . PHE B 1 252 ? 12.978  -1.002  1.008   1.00 92.76  ? 253 PHE B CE1 1 
ATOM   4378 C  CE2 . PHE B 1 252 ? 10.576  -1.173  1.145   1.00 91.98  ? 253 PHE B CE2 1 
ATOM   4379 C  CZ  . PHE B 1 252 ? 11.842  -1.561  1.583   1.00 94.28  ? 253 PHE B CZ  1 
ATOM   4380 N  N   . ASP B 1 253 ? 10.219  4.010   -2.710  1.00 79.43  ? 254 ASP B N   1 
ATOM   4381 C  CA  . ASP B 1 253 ? 9.883   4.705   -3.958  1.00 74.17  ? 254 ASP B CA  1 
ATOM   4382 C  C   . ASP B 1 253 ? 9.087   5.994   -3.741  1.00 72.17  ? 254 ASP B C   1 
ATOM   4383 O  O   . ASP B 1 253 ? 8.530   6.214   -2.663  1.00 75.81  ? 254 ASP B O   1 
ATOM   4384 C  CB  . ASP B 1 253 ? 9.082   3.764   -4.861  1.00 73.54  ? 254 ASP B CB  1 
ATOM   4385 C  CG  . ASP B 1 253 ? 9.958   2.779   -5.595  1.00 74.05  ? 254 ASP B CG  1 
ATOM   4386 O  OD1 . ASP B 1 253 ? 10.503  3.154   -6.651  1.00 72.75  ? 254 ASP B OD1 1 
ATOM   4387 O  OD2 . ASP B 1 253 ? 10.101  1.631   -5.120  1.00 75.76  ? 254 ASP B OD2 1 
ATOM   4388 N  N   . TYR B 1 254 ? 9.040   6.832   -4.775  1.00 66.09  ? 255 TYR B N   1 
ATOM   4389 C  CA  . TYR B 1 254 ? 8.179   8.010   -4.791  1.00 63.48  ? 255 TYR B CA  1 
ATOM   4390 C  C   . TYR B 1 254 ? 6.756   7.649   -5.197  1.00 62.40  ? 255 TYR B C   1 
ATOM   4391 O  O   . TYR B 1 254 ? 6.557   6.941   -6.198  1.00 62.03  ? 255 TYR B O   1 
ATOM   4392 C  CB  . TYR B 1 254 ? 8.736   9.078   -5.734  1.00 60.86  ? 255 TYR B CB  1 
ATOM   4393 C  CG  . TYR B 1 254 ? 9.917   9.822   -5.173  1.00 60.84  ? 255 TYR B CG  1 
ATOM   4394 C  CD1 . TYR B 1 254 ? 9.744   10.801  -4.186  1.00 63.21  ? 255 TYR B CD1 1 
ATOM   4395 C  CD2 . TYR B 1 254 ? 11.213  9.549   -5.618  1.00 59.91  ? 255 TYR B CD2 1 
ATOM   4396 C  CE1 . TYR B 1 254 ? 10.829  11.496  -3.667  1.00 64.86  ? 255 TYR B CE1 1 
ATOM   4397 C  CE2 . TYR B 1 254 ? 12.307  10.233  -5.099  1.00 62.09  ? 255 TYR B CE2 1 
ATOM   4398 C  CZ  . TYR B 1 254 ? 12.110  11.207  -4.128  1.00 63.74  ? 255 TYR B CZ  1 
ATOM   4399 O  OH  . TYR B 1 254 ? 13.182  11.892  -3.614  1.00 64.91  ? 255 TYR B OH  1 
ATOM   4400 N  N   . VAL B 1 255 ? 5.778   8.141   -4.426  1.00 61.36  ? 256 VAL B N   1 
ATOM   4401 C  CA  . VAL B 1 255 ? 4.350   7.840   -4.670  1.00 60.44  ? 256 VAL B CA  1 
ATOM   4402 C  C   . VAL B 1 255 ? 3.404   9.046   -4.710  1.00 60.83  ? 256 VAL B C   1 
ATOM   4403 O  O   . VAL B 1 255 ? 3.686   10.101  -4.135  1.00 62.73  ? 256 VAL B O   1 
ATOM   4404 C  CB  . VAL B 1 255 ? 3.760   6.771   -3.697  1.00 61.25  ? 256 VAL B CB  1 
ATOM   4405 C  CG1 . VAL B 1 255 ? 4.222   5.373   -4.076  1.00 59.19  ? 256 VAL B CG1 1 
ATOM   4406 C  CG2 . VAL B 1 255 ? 4.045   7.086   -2.229  1.00 62.22  ? 256 VAL B CG2 1 
ATOM   4407 N  N   . VAL B 1 256 ? 2.284   8.859   -5.408  1.00 59.47  ? 257 VAL B N   1 
ATOM   4408 C  CA  . VAL B 1 256 ? 1.129   9.770   -5.362  1.00 60.14  ? 257 VAL B CA  1 
ATOM   4409 C  C   . VAL B 1 256 ? -0.144  8.989   -5.022  1.00 60.64  ? 257 VAL B C   1 
ATOM   4410 O  O   . VAL B 1 256 ? -0.209  7.771   -5.244  1.00 58.98  ? 257 VAL B O   1 
ATOM   4411 C  CB  . VAL B 1 256 ? 0.915   10.560  -6.690  1.00 57.96  ? 257 VAL B CB  1 
ATOM   4412 C  CG1 . VAL B 1 256 ? 2.044   11.551  -6.931  1.00 57.52  ? 257 VAL B CG1 1 
ATOM   4413 C  CG2 . VAL B 1 256 ? 0.751   9.631   -7.887  1.00 55.68  ? 257 VAL B CG2 1 
ATOM   4414 N  N   . LYS B 1 257 ? -1.143  9.689   -4.479  1.00 62.48  ? 258 LYS B N   1 
ATOM   4415 C  CA  . LYS B 1 257 ? -2.502  9.156   -4.391  1.00 64.81  ? 258 LYS B CA  1 
ATOM   4416 C  C   . LYS B 1 257 ? -2.970  8.867   -5.815  1.00 64.53  ? 258 LYS B C   1 
ATOM   4417 O  O   . LYS B 1 257 ? -2.851  9.735   -6.697  1.00 64.01  ? 258 LYS B O   1 
ATOM   4418 C  CB  . LYS B 1 257 ? -3.436  10.154  -3.718  1.00 67.08  ? 258 LYS B CB  1 
ATOM   4419 C  CG  . LYS B 1 257 ? -3.515  10.027  -2.204  1.00 70.25  ? 258 LYS B CG  1 
ATOM   4420 C  CD  . LYS B 1 257 ? -4.930  10.284  -1.686  1.00 73.31  ? 258 LYS B CD  1 
ATOM   4421 C  CE  . LYS B 1 257 ? -5.286  11.763  -1.644  1.00 73.87  ? 258 LYS B CE  1 
ATOM   4422 N  NZ  . LYS B 1 257 ? -6.710  11.974  -1.268  1.00 77.86  ? 258 LYS B NZ  1 
ATOM   4423 N  N   . CYS B 1 258 ? -3.455  7.642   -6.046  1.00 64.89  ? 259 CYS B N   1 
ATOM   4424 C  CA  . CYS B 1 258 ? -3.760  7.155   -7.408  1.00 62.22  ? 259 CYS B CA  1 
ATOM   4425 C  C   . CYS B 1 258 ? -4.730  8.054   -8.173  1.00 61.30  ? 259 CYS B C   1 
ATOM   4426 O  O   . CYS B 1 258 ? -4.527  8.306   -9.359  1.00 59.56  ? 259 CYS B O   1 
ATOM   4427 C  CB  . CYS B 1 258 ? -4.261  5.710   -7.387  1.00 62.87  ? 259 CYS B CB  1 
ATOM   4428 S  SG  . CYS B 1 258 ? -2.992  4.497   -6.972  1.00 62.93  ? 259 CYS B SG  1 
ATOM   4429 N  N   . ASN B 1 259 ? -5.760  8.541   -7.481  1.00 62.81  ? 260 ASN B N   1 
ATOM   4430 C  CA  . ASN B 1 259 ? -6.714  9.500   -8.041  1.00 64.14  ? 260 ASN B CA  1 
ATOM   4431 C  C   . ASN B 1 259 ? -6.093  10.824  -8.472  1.00 63.80  ? 260 ASN B C   1 
ATOM   4432 O  O   . ASN B 1 259 ? -6.580  11.440  -9.406  1.00 65.82  ? 260 ASN B O   1 
ATOM   4433 C  CB  . ASN B 1 259 ? -7.860  9.765   -7.055  1.00 67.10  ? 260 ASN B CB  1 
ATOM   4434 C  CG  . ASN B 1 259 ? -7.403  10.485  -5.798  1.00 67.54  ? 260 ASN B CG  1 
ATOM   4435 O  OD1 . ASN B 1 259 ? -6.361  10.165  -5.227  1.00 66.57  ? 260 ASN B OD1 1 
ATOM   4436 N  ND2 . ASN B 1 259 ? -8.180  11.470  -5.369  1.00 68.72  ? 260 ASN B ND2 1 
ATOM   4437 N  N   . GLU B 1 260 ? -5.029  11.251  -7.793  1.00 64.63  ? 261 GLU B N   1 
ATOM   4438 C  CA  . GLU B 1 260 ? -4.377  12.538  -8.069  1.00 65.77  ? 261 GLU B CA  1 
ATOM   4439 C  C   . GLU B 1 260 ? -3.401  12.472  -9.250  1.00 63.02  ? 261 GLU B C   1 
ATOM   4440 O  O   . GLU B 1 260 ? -2.949  13.508  -9.744  1.00 61.11  ? 261 GLU B O   1 
ATOM   4441 C  CB  . GLU B 1 260 ? -3.701  13.109  -6.805  1.00 69.41  ? 261 GLU B CB  1 
ATOM   4442 C  CG  . GLU B 1 260 ? -4.683  13.558  -5.717  1.00 74.70  ? 261 GLU B CG  1 
ATOM   4443 C  CD  . GLU B 1 260 ? -4.032  14.171  -4.478  1.00 78.79  ? 261 GLU B CD  1 
ATOM   4444 O  OE1 . GLU B 1 260 ? -2.802  14.041  -4.290  1.00 79.95  ? 261 GLU B OE1 1 
ATOM   4445 O  OE2 . GLU B 1 260 ? -4.763  14.786  -3.669  1.00 80.29  ? 261 GLU B OE2 1 
ATOM   4446 N  N   . GLY B 1 261 ? -3.091  11.256  -9.697  1.00 61.90  ? 262 GLY B N   1 
ATOM   4447 C  CA  . GLY B 1 261 ? -2.283  11.030  -10.903 1.00 61.05  ? 262 GLY B CA  1 
ATOM   4448 C  C   . GLY B 1 261 ? -2.670  11.903  -12.098 1.00 60.76  ? 262 GLY B C   1 
ATOM   4449 O  O   . GLY B 1 261 ? -1.823  12.635  -12.610 1.00 59.34  ? 262 GLY B O   1 
ATOM   4450 N  N   . PRO B 1 262 ? -3.954  11.847  -12.537 1.00 61.56  ? 263 PRO B N   1 
ATOM   4451 C  CA  . PRO B 1 262 ? -4.454  12.699  -13.634 1.00 60.83  ? 263 PRO B CA  1 
ATOM   4452 C  C   . PRO B 1 262 ? -4.425  14.222  -13.400 1.00 61.88  ? 263 PRO B C   1 
ATOM   4453 O  O   . PRO B 1 262 ? -4.781  14.971  -14.311 1.00 62.94  ? 263 PRO B O   1 
ATOM   4454 C  CB  . PRO B 1 262 ? -5.910  12.236  -13.797 1.00 62.75  ? 263 PRO B CB  1 
ATOM   4455 C  CG  . PRO B 1 262 ? -5.922  10.839  -13.296 1.00 61.84  ? 263 PRO B CG  1 
ATOM   4456 C  CD  . PRO B 1 262 ? -4.956  10.828  -12.155 1.00 61.09  ? 263 PRO B CD  1 
ATOM   4457 N  N   . THR B 1 263 ? -4.032  14.675  -12.205 1.00 62.70  ? 264 THR B N   1 
ATOM   4458 C  CA  . THR B 1 263 ? -3.909  16.121  -11.914 1.00 62.52  ? 264 THR B CA  1 
ATOM   4459 C  C   . THR B 1 263 ? -2.475  16.627  -12.036 1.00 61.77  ? 264 THR B C   1 
ATOM   4460 O  O   . THR B 1 263 ? -2.236  17.839  -12.117 1.00 63.56  ? 264 THR B O   1 
ATOM   4461 C  CB  . THR B 1 263 ? -4.455  16.519  -10.521 1.00 63.66  ? 264 THR B CB  1 
ATOM   4462 O  OG1 . THR B 1 263 ? -3.528  16.146  -9.494  1.00 62.19  ? 264 THR B OG1 1 
ATOM   4463 C  CG2 . THR B 1 263 ? -5.801  15.885  -10.258 1.00 65.18  ? 264 THR B CG2 1 
ATOM   4464 N  N   . LEU B 1 264 ? -1.529  15.692  -12.034 1.00 60.58  ? 265 LEU B N   1 
ATOM   4465 C  CA  . LEU B 1 264 ? -0.113  16.011  -12.139 1.00 60.45  ? 265 LEU B CA  1 
ATOM   4466 C  C   . LEU B 1 264 ? 0.196   16.610  -13.512 1.00 59.74  ? 265 LEU B C   1 
ATOM   4467 O  O   . LEU B 1 264 ? -0.442  16.237  -14.500 1.00 59.97  ? 265 LEU B O   1 
ATOM   4468 C  CB  . LEU B 1 264 ? 0.745   14.768  -11.863 1.00 59.68  ? 265 LEU B CB  1 
ATOM   4469 C  CG  . LEU B 1 264 ? 0.600   14.003  -10.534 1.00 60.59  ? 265 LEU B CG  1 
ATOM   4470 C  CD1 . LEU B 1 264 ? 1.754   13.023  -10.383 1.00 60.54  ? 265 LEU B CD1 1 
ATOM   4471 C  CD2 . LEU B 1 264 ? 0.524   14.908  -9.311  1.00 61.31  ? 265 LEU B CD2 1 
ATOM   4472 N  N   . PRO B 1 265 ? 1.149   17.559  -13.574 1.00 59.67  ? 266 PRO B N   1 
ATOM   4473 C  CA  . PRO B 1 265 ? 1.401   18.223  -14.854 1.00 58.59  ? 266 PRO B CA  1 
ATOM   4474 C  C   . PRO B 1 265 ? 2.316   17.428  -15.786 1.00 55.79  ? 266 PRO B C   1 
ATOM   4475 O  O   . PRO B 1 265 ? 3.026   16.528  -15.341 1.00 54.74  ? 266 PRO B O   1 
ATOM   4476 C  CB  . PRO B 1 265 ? 2.064   19.538  -14.438 1.00 58.89  ? 266 PRO B CB  1 
ATOM   4477 C  CG  . PRO B 1 265 ? 2.737   19.231  -13.145 1.00 59.83  ? 266 PRO B CG  1 
ATOM   4478 C  CD  . PRO B 1 265 ? 1.996   18.104  -12.491 1.00 60.27  ? 266 PRO B CD  1 
ATOM   4479 N  N   . ASP B 1 266 ? 2.280   17.777  -17.070 1.00 55.29  ? 267 ASP B N   1 
ATOM   4480 C  CA  . ASP B 1 266 ? 3.190   17.238  -18.074 1.00 52.88  ? 267 ASP B CA  1 
ATOM   4481 C  C   . ASP B 1 266 ? 4.636   17.512  -17.683 1.00 52.38  ? 267 ASP B C   1 
ATOM   4482 O  O   . ASP B 1 266 ? 4.947   18.584  -17.155 1.00 53.88  ? 267 ASP B O   1 
ATOM   4483 C  CB  . ASP B 1 266 ? 2.935   17.895  -19.435 1.00 54.86  ? 267 ASP B CB  1 
ATOM   4484 C  CG  . ASP B 1 266 ? 1.532   17.646  -19.982 1.00 54.80  ? 267 ASP B CG  1 
ATOM   4485 O  OD1 . ASP B 1 266 ? 0.782   16.811  -19.436 1.00 54.80  ? 267 ASP B OD1 1 
ATOM   4486 O  OD2 . ASP B 1 266 ? 1.188   18.302  -20.988 1.00 55.42  ? 267 ASP B OD2 1 
ATOM   4487 N  N   . ILE B 1 267 ? 5.503   16.532  -17.930 1.00 49.51  ? 268 ILE B N   1 
ATOM   4488 C  CA  . ILE B 1 267 ? 6.949   16.707  -17.787 1.00 49.82  ? 268 ILE B CA  1 
ATOM   4489 C  C   . ILE B 1 267 ? 7.575   16.761  -19.191 1.00 49.21  ? 268 ILE B C   1 
ATOM   4490 O  O   . ILE B 1 267 ? 7.374   15.852  -20.010 1.00 50.55  ? 268 ILE B O   1 
ATOM   4491 C  CB  . ILE B 1 267 ? 7.590   15.623  -16.867 1.00 48.55  ? 268 ILE B CB  1 
ATOM   4492 C  CG1 . ILE B 1 267 ? 6.965   15.686  -15.460 1.00 49.81  ? 268 ILE B CG1 1 
ATOM   4493 C  CG2 . ILE B 1 267 ? 9.104   15.806  -16.773 1.00 47.87  ? 268 ILE B CG2 1 
ATOM   4494 C  CD1 . ILE B 1 267 ? 7.387   14.601  -14.492 1.00 47.09  ? 268 ILE B CD1 1 
ATOM   4495 N  N   . SER B 1 268 ? 8.303   17.840  -19.467 1.00 48.39  ? 269 SER B N   1 
ATOM   4496 C  CA  . SER B 1 268 ? 8.936   18.050  -20.773 1.00 47.95  ? 269 SER B CA  1 
ATOM   4497 C  C   . SER B 1 268 ? 10.454  17.992  -20.713 1.00 48.28  ? 269 SER B C   1 
ATOM   4498 O  O   . SER B 1 268 ? 11.071  18.565  -19.816 1.00 52.36  ? 269 SER B O   1 
ATOM   4499 C  CB  . SER B 1 268 ? 8.498   19.382  -21.374 1.00 48.83  ? 269 SER B CB  1 
ATOM   4500 O  OG  . SER B 1 268 ? 7.155   19.316  -21.802 1.00 48.31  ? 269 SER B OG  1 
ATOM   4501 N  N   . PHE B 1 269 ? 11.047  17.305  -21.682 1.00 47.56  ? 270 PHE B N   1 
ATOM   4502 C  CA  . PHE B 1 269 ? 12.497  17.219  -21.809 1.00 47.51  ? 270 PHE B CA  1 
ATOM   4503 C  C   . PHE B 1 269 ? 12.898  17.942  -23.078 1.00 48.78  ? 270 PHE B C   1 
ATOM   4504 O  O   . PHE B 1 269 ? 12.507  17.539  -24.175 1.00 48.42  ? 270 PHE B O   1 
ATOM   4505 C  CB  . PHE B 1 269 ? 12.962  15.754  -21.830 1.00 45.37  ? 270 PHE B CB  1 
ATOM   4506 C  CG  . PHE B 1 269 ? 12.537  14.966  -20.620 1.00 46.46  ? 270 PHE B CG  1 
ATOM   4507 C  CD1 . PHE B 1 269 ? 11.283  14.338  -20.575 1.00 44.21  ? 270 PHE B CD1 1 
ATOM   4508 C  CD2 . PHE B 1 269 ? 13.382  14.859  -19.502 1.00 46.85  ? 270 PHE B CD2 1 
ATOM   4509 C  CE1 . PHE B 1 269 ? 10.889  13.616  -19.451 1.00 44.04  ? 270 PHE B CE1 1 
ATOM   4510 C  CE2 . PHE B 1 269 ? 12.983  14.141  -18.372 1.00 45.86  ? 270 PHE B CE2 1 
ATOM   4511 C  CZ  . PHE B 1 269 ? 11.738  13.517  -18.349 1.00 44.22  ? 270 PHE B CZ  1 
ATOM   4512 N  N   . HIS B 1 270 ? 13.650  19.030  -22.921 1.00 53.02  ? 271 HIS B N   1 
ATOM   4513 C  CA  . HIS B 1 270 ? 14.120  19.821  -24.063 1.00 56.12  ? 271 HIS B CA  1 
ATOM   4514 C  C   . HIS B 1 270 ? 15.343  19.168  -24.721 1.00 54.63  ? 271 HIS B C   1 
ATOM   4515 O  O   . HIS B 1 270 ? 16.451  19.200  -24.183 1.00 55.09  ? 271 HIS B O   1 
ATOM   4516 C  CB  . HIS B 1 270 ? 14.393  21.271  -23.646 1.00 59.41  ? 271 HIS B CB  1 
ATOM   4517 C  CG  . HIS B 1 270 ? 14.420  22.242  -24.788 1.00 63.01  ? 271 HIS B CG  1 
ATOM   4518 N  ND1 . HIS B 1 270 ? 14.846  23.544  -24.640 1.00 66.16  ? 271 HIS B ND1 1 
ATOM   4519 C  CD2 . HIS B 1 270 ? 14.086  22.104  -26.093 1.00 64.49  ? 271 HIS B CD2 1 
ATOM   4520 C  CE1 . HIS B 1 270 ? 14.761  24.169  -25.801 1.00 67.19  ? 271 HIS B CE1 1 
ATOM   4521 N  NE2 . HIS B 1 270 ? 14.302  23.318  -26.699 1.00 66.80  ? 271 HIS B NE2 1 
ATOM   4522 N  N   . LEU B 1 271 ? 15.116  18.557  -25.881 1.00 53.74  ? 272 LEU B N   1 
ATOM   4523 C  CA  . LEU B 1 271 ? 16.154  17.818  -26.591 1.00 53.93  ? 272 LEU B CA  1 
ATOM   4524 C  C   . LEU B 1 271 ? 16.228  18.257  -28.038 1.00 54.18  ? 272 LEU B C   1 
ATOM   4525 O  O   . LEU B 1 271 ? 15.243  18.155  -28.773 1.00 53.97  ? 272 LEU B O   1 
ATOM   4526 C  CB  . LEU B 1 271 ? 15.900  16.304  -26.517 1.00 52.89  ? 272 LEU B CB  1 
ATOM   4527 C  CG  . LEU B 1 271 ? 15.749  15.614  -25.156 1.00 51.51  ? 272 LEU B CG  1 
ATOM   4528 C  CD1 . LEU B 1 271 ? 15.200  14.207  -25.344 1.00 48.01  ? 272 LEU B CD1 1 
ATOM   4529 C  CD2 . LEU B 1 271 ? 17.073  15.599  -24.395 1.00 51.54  ? 272 LEU B CD2 1 
ATOM   4530 N  N   . GLY B 1 272 ? 17.401  18.753  -28.427 1.00 55.07  ? 273 GLY B N   1 
ATOM   4531 C  CA  . GLY B 1 272 ? 17.677  19.205  -29.790 1.00 56.54  ? 273 GLY B CA  1 
ATOM   4532 C  C   . GLY B 1 272 ? 16.686  20.206  -30.352 1.00 58.74  ? 273 GLY B C   1 
ATOM   4533 O  O   . GLY B 1 272 ? 16.276  20.090  -31.512 1.00 59.43  ? 273 GLY B O   1 
ATOM   4534 N  N   . GLY B 1 273 ? 16.289  21.175  -29.527 1.00 60.49  ? 274 GLY B N   1 
ATOM   4535 C  CA  . GLY B 1 273 ? 15.364  22.226  -29.955 1.00 65.74  ? 274 GLY B CA  1 
ATOM   4536 C  C   . GLY B 1 273 ? 13.899  21.905  -29.726 1.00 68.14  ? 274 GLY B C   1 
ATOM   4537 O  O   . GLY B 1 273 ? 13.134  22.787  -29.316 1.00 74.96  ? 274 GLY B O   1 
ATOM   4538 N  N   . LYS B 1 274 ? 13.507  20.656  -30.002 1.00 64.22  ? 275 LYS B N   1 
ATOM   4539 C  CA  . LYS B 1 274 ? 12.156  20.161  -29.719 1.00 60.20  ? 275 LYS B CA  1 
ATOM   4540 C  C   . LYS B 1 274 ? 11.934  19.838  -28.231 1.00 58.70  ? 275 LYS B C   1 
ATOM   4541 O  O   . LYS B 1 274 ? 12.883  19.557  -27.491 1.00 56.90  ? 275 LYS B O   1 
ATOM   4542 C  CB  . LYS B 1 274 ? 11.823  18.949  -30.597 1.00 56.88  ? 275 LYS B CB  1 
ATOM   4543 N  N   . GLU B 1 275 ? 10.669  19.902  -27.814 1.00 58.81  ? 276 GLU B N   1 
ATOM   4544 C  CA  . GLU B 1 275 ? 10.237  19.563  -26.457 1.00 57.49  ? 276 GLU B CA  1 
ATOM   4545 C  C   . GLU B 1 275 ? 9.582   18.181  -26.418 1.00 54.59  ? 276 GLU B C   1 
ATOM   4546 O  O   . GLU B 1 275 ? 8.568   17.954  -27.071 1.00 55.98  ? 276 GLU B O   1 
ATOM   4547 C  CB  . GLU B 1 275 ? 9.258   20.618  -25.927 1.00 58.50  ? 276 GLU B CB  1 
ATOM   4548 C  CG  . GLU B 1 275 ? 9.887   21.953  -25.553 1.00 60.52  ? 276 GLU B CG  1 
ATOM   4549 C  CD  . GLU B 1 275 ? 10.579  21.967  -24.193 1.00 62.03  ? 276 GLU B CD  1 
ATOM   4550 O  OE1 . GLU B 1 275 ? 10.550  20.956  -23.451 1.00 59.87  ? 276 GLU B OE1 1 
ATOM   4551 O  OE2 . GLU B 1 275 ? 11.159  23.021  -23.858 1.00 66.08  ? 276 GLU B OE2 1 
ATOM   4552 N  N   . TYR B 1 276 ? 10.169  17.267  -25.651 1.00 52.72  ? 277 TYR B N   1 
ATOM   4553 C  CA  . TYR B 1 276 ? 9.652   15.903  -25.521 1.00 51.98  ? 277 TYR B CA  1 
ATOM   4554 C  C   . TYR B 1 276 ? 8.811   15.755  -24.255 1.00 53.17  ? 277 TYR B C   1 
ATOM   4555 O  O   . TYR B 1 276 ? 9.334   15.729  -23.137 1.00 53.81  ? 277 TYR B O   1 
ATOM   4556 C  CB  . TYR B 1 276 ? 10.788  14.871  -25.646 1.00 49.08  ? 277 TYR B CB  1 
ATOM   4557 C  CG  . TYR B 1 276 ? 11.321  14.834  -27.065 1.00 48.32  ? 277 TYR B CG  1 
ATOM   4558 C  CD1 . TYR B 1 276 ? 12.370  15.672  -27.463 1.00 48.34  ? 277 TYR B CD1 1 
ATOM   4559 C  CD2 . TYR B 1 276 ? 10.730  14.012  -28.032 1.00 47.35  ? 277 TYR B CD2 1 
ATOM   4560 C  CE1 . TYR B 1 276 ? 12.836  15.669  -28.772 1.00 47.89  ? 277 TYR B CE1 1 
ATOM   4561 C  CE2 . TYR B 1 276 ? 11.181  14.012  -29.344 1.00 46.98  ? 277 TYR B CE2 1 
ATOM   4562 C  CZ  . TYR B 1 276 ? 12.236  14.837  -29.706 1.00 47.95  ? 277 TYR B CZ  1 
ATOM   4563 O  OH  . TYR B 1 276 ? 12.690  14.837  -31.003 1.00 50.72  ? 277 TYR B OH  1 
ATOM   4564 N  N   . THR B 1 277 ? 7.497   15.681  -24.458 1.00 52.70  ? 278 THR B N   1 
ATOM   4565 C  CA  . THR B 1 277 ? 6.521   15.836  -23.385 1.00 52.20  ? 278 THR B CA  1 
ATOM   4566 C  C   . THR B 1 277 ? 5.868   14.508  -23.009 1.00 51.72  ? 278 THR B C   1 
ATOM   4567 O  O   . THR B 1 277 ? 5.260   13.846  -23.855 1.00 51.62  ? 278 THR B O   1 
ATOM   4568 C  CB  . THR B 1 277 ? 5.450   16.883  -23.780 1.00 52.89  ? 278 THR B CB  1 
ATOM   4569 O  OG1 . THR B 1 277 ? 6.080   18.157  -23.968 1.00 52.86  ? 278 THR B OG1 1 
ATOM   4570 C  CG2 . THR B 1 277 ? 4.346   17.013  -22.721 1.00 51.49  ? 278 THR B CG2 1 
ATOM   4571 N  N   . LEU B 1 278 ? 6.013   14.132  -21.738 1.00 50.16  ? 279 LEU B N   1 
ATOM   4572 C  CA  . LEU B 1 278 ? 5.275   13.010  -21.158 1.00 48.96  ? 279 LEU B CA  1 
ATOM   4573 C  C   . LEU B 1 278 ? 4.157   13.544  -20.275 1.00 49.29  ? 279 LEU B C   1 
ATOM   4574 O  O   . LEU B 1 278 ? 4.399   14.405  -19.425 1.00 48.98  ? 279 LEU B O   1 
ATOM   4575 C  CB  . LEU B 1 278 ? 6.198   12.093  -20.344 1.00 47.27  ? 279 LEU B CB  1 
ATOM   4576 C  CG  . LEU B 1 278 ? 6.919   10.948  -21.066 1.00 46.59  ? 279 LEU B CG  1 
ATOM   4577 C  CD1 . LEU B 1 278 ? 8.134   11.411  -21.866 1.00 45.22  ? 279 LEU B CD1 1 
ATOM   4578 C  CD2 . LEU B 1 278 ? 7.335   9.897   -20.053 1.00 45.03  ? 279 LEU B CD2 1 
ATOM   4579 N  N   . THR B 1 279 ? 2.937   13.045  -20.498 1.00 49.79  ? 280 THR B N   1 
ATOM   4580 C  CA  . THR B 1 279 ? 1.784   13.362  -19.641 1.00 51.59  ? 280 THR B CA  1 
ATOM   4581 C  C   . THR B 1 279 ? 1.821   12.440  -18.436 1.00 51.51  ? 280 THR B C   1 
ATOM   4582 O  O   . THR B 1 279 ? 2.521   11.430  -18.460 1.00 50.05  ? 280 THR B O   1 
ATOM   4583 C  CB  . THR B 1 279 ? 0.420   13.206  -20.366 1.00 51.92  ? 280 THR B CB  1 
ATOM   4584 O  OG1 . THR B 1 279 ? 0.158   11.820  -20.614 1.00 52.61  ? 280 THR B OG1 1 
ATOM   4585 C  CG2 . THR B 1 279 ? 0.377   13.991  -21.686 1.00 50.64  ? 280 THR B CG2 1 
ATOM   4586 N  N   . SER B 1 280 ? 1.065   12.788  -17.394 1.00 53.89  ? 281 SER B N   1 
ATOM   4587 C  CA  . SER B 1 280 ? 0.955   11.977  -16.172 1.00 54.26  ? 281 SER B CA  1 
ATOM   4588 C  C   . SER B 1 280 ? 0.644   10.500  -16.444 1.00 52.91  ? 281 SER B C   1 
ATOM   4589 O  O   . SER B 1 280 ? 1.185   9.624   -15.771 1.00 54.68  ? 281 SER B O   1 
ATOM   4590 C  CB  . SER B 1 280 ? -0.088  12.576  -15.233 1.00 57.39  ? 281 SER B CB  1 
ATOM   4591 O  OG  . SER B 1 280 ? -1.399  12.374  -15.741 1.00 59.68  ? 281 SER B OG  1 
ATOM   4592 N  N   . ALA B 1 281 ? -0.210  10.234  -17.435 1.00 51.59  ? 282 ALA B N   1 
ATOM   4593 C  CA  . ALA B 1 281 ? -0.489  8.866   -17.895 1.00 50.66  ? 282 ALA B CA  1 
ATOM   4594 C  C   . ALA B 1 281 ? 0.783   8.126   -18.338 1.00 50.52  ? 282 ALA B C   1 
ATOM   4595 O  O   . ALA B 1 281 ? 0.914   6.925   -18.103 1.00 51.41  ? 282 ALA B O   1 
ATOM   4596 C  CB  . ALA B 1 281 ? -1.523  8.875   -19.013 1.00 48.09  ? 282 ALA B CB  1 
ATOM   4597 N  N   . ASP B 1 282 ? 1.713   8.859   -18.956 1.00 49.37  ? 283 ASP B N   1 
ATOM   4598 C  CA  . ASP B 1 282 ? 2.977   8.314   -19.444 1.00 47.57  ? 283 ASP B CA  1 
ATOM   4599 C  C   . ASP B 1 282 ? 4.013   8.034   -18.355 1.00 47.01  ? 283 ASP B C   1 
ATOM   4600 O  O   . ASP B 1 282 ? 4.971   7.291   -18.609 1.00 46.23  ? 283 ASP B O   1 
ATOM   4601 C  CB  . ASP B 1 282 ? 3.607   9.256   -20.482 1.00 47.68  ? 283 ASP B CB  1 
ATOM   4602 C  CG  . ASP B 1 282 ? 2.704   9.528   -21.664 1.00 48.85  ? 283 ASP B CG  1 
ATOM   4603 O  OD1 . ASP B 1 282 ? 2.132   8.574   -22.235 1.00 50.40  ? 283 ASP B OD1 1 
ATOM   4604 O  OD2 . ASP B 1 282 ? 2.579   10.711  -22.036 1.00 50.68  ? 283 ASP B OD2 1 
ATOM   4605 N  N   . TYR B 1 283 ? 3.852   8.638   -17.173 1.00 46.48  ? 284 TYR B N   1 
ATOM   4606 C  CA  . TYR B 1 283 ? 4.850   8.486   -16.100 1.00 47.46  ? 284 TYR B CA  1 
ATOM   4607 C  C   . TYR B 1 283 ? 4.342   8.030   -14.721 1.00 49.69  ? 284 TYR B C   1 
ATOM   4608 O  O   . TYR B 1 283 ? 5.147   7.692   -13.850 1.00 50.62  ? 284 TYR B O   1 
ATOM   4609 C  CB  . TYR B 1 283 ? 5.765   9.724   -15.987 1.00 46.25  ? 284 TYR B CB  1 
ATOM   4610 C  CG  . TYR B 1 283 ? 5.139   10.997  -15.423 1.00 46.52  ? 284 TYR B CG  1 
ATOM   4611 C  CD1 . TYR B 1 283 ? 4.973   11.167  -14.035 1.00 46.08  ? 284 TYR B CD1 1 
ATOM   4612 C  CD2 . TYR B 1 283 ? 4.767   12.059  -16.272 1.00 44.57  ? 284 TYR B CD2 1 
ATOM   4613 C  CE1 . TYR B 1 283 ? 4.422   12.332  -13.517 1.00 46.84  ? 284 TYR B CE1 1 
ATOM   4614 C  CE2 . TYR B 1 283 ? 4.220   13.234  -15.759 1.00 45.46  ? 284 TYR B CE2 1 
ATOM   4615 C  CZ  . TYR B 1 283 ? 4.050   13.360  -14.382 1.00 47.36  ? 284 TYR B CZ  1 
ATOM   4616 O  OH  . TYR B 1 283 ? 3.514   14.506  -13.849 1.00 49.11  ? 284 TYR B OH  1 
ATOM   4617 N  N   . VAL B 1 284 ? 3.029   8.027   -14.518 1.00 49.26  ? 285 VAL B N   1 
ATOM   4618 C  CA  . VAL B 1 284 ? 2.466   7.438   -13.308 1.00 51.11  ? 285 VAL B CA  1 
ATOM   4619 C  C   . VAL B 1 284 ? 2.006   6.019   -13.651 1.00 52.60  ? 285 VAL B C   1 
ATOM   4620 O  O   . VAL B 1 284 ? 1.315   5.808   -14.656 1.00 52.27  ? 285 VAL B O   1 
ATOM   4621 C  CB  . VAL B 1 284 ? 1.313   8.289   -12.703 1.00 51.06  ? 285 VAL B CB  1 
ATOM   4622 C  CG1 . VAL B 1 284 ? 0.764   7.650   -11.438 1.00 51.34  ? 285 VAL B CG1 1 
ATOM   4623 C  CG2 . VAL B 1 284 ? 1.785   9.699   -12.386 1.00 50.03  ? 285 VAL B CG2 1 
ATOM   4624 N  N   . PHE B 1 285 ? 2.416   5.052   -12.827 1.00 54.31  ? 286 PHE B N   1 
ATOM   4625 C  CA  . PHE B 1 285 ? 1.919   3.683   -12.936 1.00 54.39  ? 286 PHE B CA  1 
ATOM   4626 C  C   . PHE B 1 285 ? 0.518   3.641   -12.354 1.00 56.92  ? 286 PHE B C   1 
ATOM   4627 O  O   . PHE B 1 285 ? 0.330   3.414   -11.154 1.00 58.25  ? 286 PHE B O   1 
ATOM   4628 C  CB  . PHE B 1 285 ? 2.834   2.681   -12.219 1.00 53.72  ? 286 PHE B CB  1 
ATOM   4629 C  CG  . PHE B 1 285 ? 4.133   2.410   -12.925 1.00 51.86  ? 286 PHE B CG  1 
ATOM   4630 C  CD1 . PHE B 1 285 ? 4.157   2.035   -14.277 1.00 49.64  ? 286 PHE B CD1 1 
ATOM   4631 C  CD2 . PHE B 1 285 ? 5.344   2.483   -12.222 1.00 52.36  ? 286 PHE B CD2 1 
ATOM   4632 C  CE1 . PHE B 1 285 ? 5.361   1.773   -14.917 1.00 49.12  ? 286 PHE B CE1 1 
ATOM   4633 C  CE2 . PHE B 1 285 ? 6.555   2.216   -12.856 1.00 50.78  ? 286 PHE B CE2 1 
ATOM   4634 C  CZ  . PHE B 1 285 ? 6.561   1.861   -14.205 1.00 50.24  ? 286 PHE B CZ  1 
ATOM   4635 N  N   . GLN B 1 286 ? -0.467  3.870   -13.216 1.00 58.84  ? 287 GLN B N   1 
ATOM   4636 C  CA  . GLN B 1 286 ? -1.859  3.930   -12.787 1.00 60.99  ? 287 GLN B CA  1 
ATOM   4637 C  C   . GLN B 1 286 ? -2.446  2.525   -12.631 1.00 64.39  ? 287 GLN B C   1 
ATOM   4638 O  O   . GLN B 1 286 ? -3.368  2.143   -13.355 1.00 67.13  ? 287 GLN B O   1 
ATOM   4639 C  CB  . GLN B 1 286 ? -2.691  4.803   -13.740 1.00 60.09  ? 287 GLN B CB  1 
ATOM   4640 C  CG  . GLN B 1 286 ? -2.233  6.259   -13.865 1.00 58.93  ? 287 GLN B CG  1 
ATOM   4641 C  CD  . GLN B 1 286 ? -2.759  7.211   -12.779 1.00 61.49  ? 287 GLN B CD  1 
ATOM   4642 O  OE1 . GLN B 1 286 ? -2.658  8.431   -12.931 1.00 61.89  ? 287 GLN B OE1 1 
ATOM   4643 N  NE2 . GLN B 1 286 ? -3.305  6.668   -11.685 1.00 60.88  ? 287 GLN B NE2 1 
ATOM   4644 N  N   . GLU B 1 287 ? -1.899  1.773   -11.670 1.00 67.67  ? 288 GLU B N   1 
ATOM   4645 C  CA  . GLU B 1 287 ? -2.363  0.417   -11.296 1.00 73.16  ? 288 GLU B CA  1 
ATOM   4646 C  C   . GLU B 1 287 ? -3.796  0.420   -10.759 1.00 73.29  ? 288 GLU B C   1 
ATOM   4647 O  O   . GLU B 1 287 ? -4.392  -0.643  -10.545 1.00 73.46  ? 288 GLU B O   1 
ATOM   4648 C  CB  . GLU B 1 287 ? -1.437  -0.201  -10.230 1.00 77.52  ? 288 GLU B CB  1 
ATOM   4649 C  CG  . GLU B 1 287 ? 0.019   -0.402  -10.648 1.00 82.50  ? 288 GLU B CG  1 
ATOM   4650 C  CD  . GLU B 1 287 ? 0.343   -1.826  -11.077 1.00 84.95  ? 288 GLU B CD  1 
ATOM   4651 O  OE1 . GLU B 1 287 ? 0.957   -1.989  -12.155 1.00 85.12  ? 288 GLU B OE1 1 
ATOM   4652 O  OE2 . GLU B 1 287 ? 0.004   -2.780  -10.336 1.00 87.49  ? 288 GLU B OE2 1 
ATOM   4653 N  N   . SER B 1 288 ? -4.320  1.634   -10.559 1.00 73.70  ? 289 SER B N   1 
ATOM   4654 C  CA  . SER B 1 288 ? -5.574  1.935   -9.859  1.00 74.19  ? 289 SER B CA  1 
ATOM   4655 C  C   . SER B 1 288 ? -5.856  3.435   -10.058 1.00 73.68  ? 289 SER B C   1 
ATOM   4656 O  O   . SER B 1 288 ? -4.965  4.180   -10.475 1.00 73.27  ? 289 SER B O   1 
ATOM   4657 C  CB  . SER B 1 288 ? -5.419  1.593   -8.370  1.00 73.04  ? 289 SER B CB  1 
ATOM   4658 O  OG  . SER B 1 288 ? -6.471  2.111   -7.591  1.00 75.54  ? 289 SER B OG  1 
ATOM   4659 N  N   . TYR B 1 289 ? -7.086  3.873   -9.793  1.00 74.84  ? 290 TYR B N   1 
ATOM   4660 C  CA  . TYR B 1 289 ? -7.433  5.310   -9.812  1.00 73.44  ? 290 TYR B CA  1 
ATOM   4661 C  C   . TYR B 1 289 ? -8.116  5.738   -8.511  1.00 71.55  ? 290 TYR B C   1 
ATOM   4662 O  O   . TYR B 1 289 ? -8.715  6.810   -8.420  1.00 69.21  ? 290 TYR B O   1 
ATOM   4663 C  CB  . TYR B 1 289 ? -8.288  5.653   -11.040 1.00 78.48  ? 290 TYR B CB  1 
ATOM   4664 C  CG  . TYR B 1 289 ? -7.482  5.771   -12.312 1.00 80.52  ? 290 TYR B CG  1 
ATOM   4665 C  CD1 . TYR B 1 289 ? -6.985  4.627   -12.955 1.00 81.07  ? 290 TYR B CD1 1 
ATOM   4666 C  CD2 . TYR B 1 289 ? -7.208  7.026   -12.881 1.00 81.46  ? 290 TYR B CD2 1 
ATOM   4667 C  CE1 . TYR B 1 289 ? -6.227  4.722   -14.112 1.00 82.79  ? 290 TYR B CE1 1 
ATOM   4668 C  CE2 . TYR B 1 289 ? -6.454  7.131   -14.050 1.00 82.31  ? 290 TYR B CE2 1 
ATOM   4669 C  CZ  . TYR B 1 289 ? -5.969  5.973   -14.662 1.00 82.80  ? 290 TYR B CZ  1 
ATOM   4670 O  OH  . TYR B 1 289 ? -5.221  6.036   -15.817 1.00 84.69  ? 290 TYR B OH  1 
ATOM   4671 N  N   . SER B 1 290 ? -7.977  4.874   -7.509  1.00 70.86  ? 291 SER B N   1 
ATOM   4672 C  CA  . SER B 1 290 ? -8.604  4.992   -6.200  1.00 70.13  ? 291 SER B CA  1 
ATOM   4673 C  C   . SER B 1 290 ? -8.038  6.126   -5.353  1.00 68.89  ? 291 SER B C   1 
ATOM   4674 O  O   . SER B 1 290 ? -6.826  6.344   -5.320  1.00 67.51  ? 291 SER B O   1 
ATOM   4675 C  CB  . SER B 1 290 ? -8.429  3.677   -5.453  1.00 70.05  ? 291 SER B CB  1 
ATOM   4676 O  OG  . SER B 1 290 ? -9.366  3.572   -4.408  1.00 76.24  ? 291 SER B OG  1 
ATOM   4677 N  N   . SER B 1 291 ? -8.933  6.838   -4.669  1.00 69.52  ? 292 SER B N   1 
ATOM   4678 C  CA  . SER B 1 291 ? -8.566  7.806   -3.630  1.00 68.80  ? 292 SER B CA  1 
ATOM   4679 C  C   . SER B 1 291 ? -8.015  7.086   -2.385  1.00 68.95  ? 292 SER B C   1 
ATOM   4680 O  O   . SER B 1 291 ? -7.448  7.716   -1.485  1.00 69.33  ? 292 SER B O   1 
ATOM   4681 C  CB  . SER B 1 291 ? -9.776  8.688   -3.268  1.00 71.11  ? 292 SER B CB  1 
ATOM   4682 O  OG  . SER B 1 291 ? -10.863 7.930   -2.746  1.00 72.69  ? 292 SER B OG  1 
ATOM   4683 N  N   . LYS B 1 292 ? -8.174  5.762   -2.373  1.00 68.04  ? 293 LYS B N   1 
ATOM   4684 C  CA  . LYS B 1 292 ? -7.810  4.891   -1.258  1.00 69.56  ? 293 LYS B CA  1 
ATOM   4685 C  C   . LYS B 1 292 ? -6.462  4.168   -1.451  1.00 67.84  ? 293 LYS B C   1 
ATOM   4686 O  O   . LYS B 1 292 ? -5.997  3.481   -0.538  1.00 69.58  ? 293 LYS B O   1 
ATOM   4687 C  CB  . LYS B 1 292 ? -8.928  3.855   -1.013  1.00 71.62  ? 293 LYS B CB  1 
ATOM   4688 C  CG  . LYS B 1 292 ? -10.321 4.413   -0.712  1.00 73.48  ? 293 LYS B CG  1 
ATOM   4689 C  CD  . LYS B 1 292 ? -11.211 4.400   -1.948  1.00 72.74  ? 293 LYS B CD  1 
ATOM   4690 C  CE  . LYS B 1 292 ? -12.683 4.219   -1.613  1.00 75.81  ? 293 LYS B CE  1 
ATOM   4691 N  NZ  . LYS B 1 292 ? -13.333 5.499   -1.237  1.00 77.29  ? 293 LYS B NZ  1 
ATOM   4692 N  N   . LYS B 1 293 ? -5.846  4.332   -2.622  1.00 65.20  ? 294 LYS B N   1 
ATOM   4693 C  CA  . LYS B 1 293 ? -4.619  3.615   -2.993  1.00 65.76  ? 294 LYS B CA  1 
ATOM   4694 C  C   . LYS B 1 293 ? -3.474  4.534   -3.459  1.00 64.01  ? 294 LYS B C   1 
ATOM   4695 O  O   . LYS B 1 293 ? -3.711  5.618   -4.012  1.00 62.78  ? 294 LYS B O   1 
ATOM   4696 C  CB  . LYS B 1 293 ? -4.921  2.568   -4.082  1.00 66.15  ? 294 LYS B CB  1 
ATOM   4697 C  CG  . LYS B 1 293 ? -4.881  1.115   -3.630  1.00 68.96  ? 294 LYS B CG  1 
ATOM   4698 C  CD  . LYS B 1 293 ? -6.248  0.599   -3.207  1.00 74.05  ? 294 LYS B CD  1 
ATOM   4699 C  CE  . LYS B 1 293 ? -6.195  -0.840  -2.700  1.00 77.89  ? 294 LYS B CE  1 
ATOM   4700 N  NZ  . LYS B 1 293 ? -6.015  -1.841  -3.795  1.00 78.47  ? 294 LYS B NZ  1 
ATOM   4701 N  N   . LEU B 1 294 ? -2.237  4.080   -3.244  1.00 63.43  ? 295 LEU B N   1 
ATOM   4702 C  CA  . LEU B 1 294 ? -1.030  4.803   -3.677  1.00 61.79  ? 295 LEU B CA  1 
ATOM   4703 C  C   . LEU B 1 294 ? -0.454  4.248   -4.975  1.00 60.01  ? 295 LEU B C   1 
ATOM   4704 O  O   . LEU B 1 294 ? -0.447  3.038   -5.197  1.00 60.05  ? 295 LEU B O   1 
ATOM   4705 C  CB  . LEU B 1 294 ? 0.056   4.774   -2.596  1.00 61.94  ? 295 LEU B CB  1 
ATOM   4706 C  CG  . LEU B 1 294 ? -0.214  5.338   -1.202  1.00 64.79  ? 295 LEU B CG  1 
ATOM   4707 C  CD1 . LEU B 1 294 ? 0.912   4.916   -0.269  1.00 66.09  ? 295 LEU B CD1 1 
ATOM   4708 C  CD2 . LEU B 1 294 ? -0.363  6.854   -1.238  1.00 64.69  ? 295 LEU B CD2 1 
ATOM   4709 N  N   . CYS B 1 295 ? 0.030   5.151   -5.824  1.00 59.48  ? 296 CYS B N   1 
ATOM   4710 C  CA  . CYS B 1 295 ? 0.566   4.799   -7.135  1.00 58.29  ? 296 CYS B CA  1 
ATOM   4711 C  C   . CYS B 1 295 ? 2.018   5.262   -7.275  1.00 57.63  ? 296 CYS B C   1 
ATOM   4712 O  O   . CYS B 1 295 ? 2.361   6.382   -6.892  1.00 58.16  ? 296 CYS B O   1 
ATOM   4713 C  CB  . CYS B 1 295 ? -0.319  5.386   -8.239  1.00 57.93  ? 296 CYS B CB  1 
ATOM   4714 S  SG  . CYS B 1 295 ? -1.805  4.412   -8.624  1.00 62.41  ? 296 CYS B SG  1 
ATOM   4715 N  N   . THR B 1 296 ? 2.870   4.382   -7.801  1.00 56.78  ? 297 THR B N   1 
ATOM   4716 C  CA  . THR B 1 296 ? 4.291   4.679   -7.969  1.00 55.28  ? 297 THR B CA  1 
ATOM   4717 C  C   . THR B 1 296 ? 4.535   5.383   -9.303  1.00 54.68  ? 297 THR B C   1 
ATOM   4718 O  O   . THR B 1 296 ? 3.774   5.201   -10.263 1.00 53.27  ? 297 THR B O   1 
ATOM   4719 C  CB  . THR B 1 296 ? 5.168   3.413   -7.890  1.00 54.94  ? 297 THR B CB  1 
ATOM   4720 O  OG1 . THR B 1 296 ? 4.804   2.514   -8.940  1.00 56.31  ? 297 THR B OG1 1 
ATOM   4721 C  CG2 . THR B 1 296 ? 5.020   2.700   -6.544  1.00 55.98  ? 297 THR B CG2 1 
ATOM   4722 N  N   . LEU B 1 297 ? 5.594   6.189   -9.360  1.00 54.02  ? 298 LEU B N   1 
ATOM   4723 C  CA  . LEU B 1 297 ? 5.959   6.870   -10.596 1.00 51.17  ? 298 LEU B CA  1 
ATOM   4724 C  C   . LEU B 1 297 ? 7.016   6.068   -11.352 1.00 50.42  ? 298 LEU B C   1 
ATOM   4725 O  O   . LEU B 1 297 ? 7.718   5.237   -10.769 1.00 54.51  ? 298 LEU B O   1 
ATOM   4726 C  CB  . LEU B 1 297 ? 6.425   8.306   -10.327 1.00 52.18  ? 298 LEU B CB  1 
ATOM   4727 C  CG  . LEU B 1 297 ? 5.626   9.315   -9.476  1.00 54.06  ? 298 LEU B CG  1 
ATOM   4728 C  CD1 . LEU B 1 297 ? 5.906   10.724  -9.970  1.00 53.86  ? 298 LEU B CD1 1 
ATOM   4729 C  CD2 . LEU B 1 297 ? 4.123   9.094   -9.476  1.00 55.83  ? 298 LEU B CD2 1 
ATOM   4730 N  N   . ALA B 1 298 ? 7.105   6.304   -12.656 1.00 47.37  ? 299 ALA B N   1 
ATOM   4731 C  CA  . ALA B 1 298 ? 8.093   5.651   -13.507 1.00 47.52  ? 299 ALA B CA  1 
ATOM   4732 C  C   . ALA B 1 298 ? 9.338   6.528   -13.678 1.00 48.04  ? 299 ALA B C   1 
ATOM   4733 O  O   . ALA B 1 298 ? 9.978   6.528   -14.734 1.00 48.58  ? 299 ALA B O   1 
ATOM   4734 C  CB  . ALA B 1 298 ? 7.478   5.291   -14.852 1.00 46.77  ? 299 ALA B CB  1 
ATOM   4735 N  N   . ILE B 1 299 ? 9.647   7.281   -12.622 1.00 49.10  ? 300 ILE B N   1 
ATOM   4736 C  CA  . ILE B 1 299 ? 10.831  8.124   -12.524 1.00 50.70  ? 300 ILE B CA  1 
ATOM   4737 C  C   . ILE B 1 299 ? 11.523  7.795   -11.197 1.00 54.13  ? 300 ILE B C   1 
ATOM   4738 O  O   . ILE B 1 299 ? 10.888  7.795   -10.134 1.00 54.97  ? 300 ILE B O   1 
ATOM   4739 C  CB  . ILE B 1 299 ? 10.500  9.643   -12.615 1.00 51.37  ? 300 ILE B CB  1 
ATOM   4740 C  CG1 . ILE B 1 299 ? 9.682   9.975   -13.878 1.00 49.74  ? 300 ILE B CG1 1 
ATOM   4741 C  CG2 . ILE B 1 299 ? 11.774  10.486  -12.593 1.00 50.60  ? 300 ILE B CG2 1 
ATOM   4742 C  CD1 . ILE B 1 299 ? 8.978   11.318  -13.837 1.00 48.54  ? 300 ILE B CD1 1 
ATOM   4743 N  N   . HIS B 1 300 ? 12.820  7.504   -11.282 1.00 57.74  ? 301 HIS B N   1 
ATOM   4744 C  CA  . HIS B 1 300 ? 13.641  7.126   -10.133 1.00 63.21  ? 301 HIS B CA  1 
ATOM   4745 C  C   . HIS B 1 300 ? 14.876  8.016   -10.002 1.00 64.84  ? 301 HIS B C   1 
ATOM   4746 O  O   . HIS B 1 300 ? 15.342  8.585   -10.983 1.00 64.30  ? 301 HIS B O   1 
ATOM   4747 C  CB  . HIS B 1 300 ? 14.084  5.670   -10.275 1.00 64.65  ? 301 HIS B CB  1 
ATOM   4748 C  CG  . HIS B 1 300 ? 13.067  4.677   -9.811  1.00 69.82  ? 301 HIS B CG  1 
ATOM   4749 N  ND1 . HIS B 1 300 ? 11.790  4.615   -10.329 1.00 70.78  ? 301 HIS B ND1 1 
ATOM   4750 C  CD2 . HIS B 1 300 ? 13.146  3.688   -8.887  1.00 73.33  ? 301 HIS B CD2 1 
ATOM   4751 C  CE1 . HIS B 1 300 ? 11.123  3.640   -9.738  1.00 71.98  ? 301 HIS B CE1 1 
ATOM   4752 N  NE2 . HIS B 1 300 ? 11.923  3.062   -8.859  1.00 74.39  ? 301 HIS B NE2 1 
ATOM   4753 N  N   . ALA B 1 301 ? 15.397  8.140   -8.785  1.00 67.82  ? 302 ALA B N   1 
ATOM   4754 C  CA  . ALA B 1 301 ? 16.727  8.703   -8.583  1.00 68.37  ? 302 ALA B CA  1 
ATOM   4755 C  C   . ALA B 1 301 ? 17.738  7.631   -8.960  1.00 68.91  ? 302 ALA B C   1 
ATOM   4756 O  O   . ALA B 1 301 ? 17.606  6.477   -8.551  1.00 72.77  ? 302 ALA B O   1 
ATOM   4757 C  CB  . ALA B 1 301 ? 16.916  9.141   -7.138  1.00 69.89  ? 302 ALA B CB  1 
ATOM   4758 N  N   . MET B 1 302 ? 18.718  7.998   -9.777  1.00 68.43  ? 303 MET B N   1 
ATOM   4759 C  CA  . MET B 1 302 ? 19.860  7.128   -10.041 1.00 69.31  ? 303 MET B CA  1 
ATOM   4760 C  C   . MET B 1 302 ? 21.115  7.964   -10.227 1.00 68.32  ? 303 MET B C   1 
ATOM   4761 O  O   . MET B 1 302 ? 21.224  8.731   -11.178 1.00 65.94  ? 303 MET B O   1 
ATOM   4762 C  CB  . MET B 1 302 ? 19.616  6.210   -11.243 1.00 69.34  ? 303 MET B CB  1 
ATOM   4763 C  CG  . MET B 1 302 ? 20.557  5.016   -11.304 1.00 74.36  ? 303 MET B CG  1 
ATOM   4764 S  SD  . MET B 1 302 ? 20.121  3.854   -12.609 1.00 79.31  ? 303 MET B SD  1 
ATOM   4765 C  CE  . MET B 1 302 ? 21.571  2.792   -12.613 1.00 80.39  ? 303 MET B CE  1 
ATOM   4766 N  N   . ASP B 1 303 ? 22.047  7.824   -9.291  1.00 70.54  ? 304 ASP B N   1 
ATOM   4767 C  CA  . ASP B 1 303 ? 23.329  8.510   -9.385  1.00 71.19  ? 304 ASP B CA  1 
ATOM   4768 C  C   . ASP B 1 303 ? 24.332  7.656   -10.159 1.00 70.43  ? 304 ASP B C   1 
ATOM   4769 O  O   . ASP B 1 303 ? 24.957  6.744   -9.610  1.00 71.38  ? 304 ASP B O   1 
ATOM   4770 C  CB  . ASP B 1 303 ? 23.830  8.922   -7.998  1.00 72.14  ? 304 ASP B CB  1 
ATOM   4771 C  CG  . ASP B 1 303 ? 23.026  10.072  -7.411  1.00 73.57  ? 304 ASP B CG  1 
ATOM   4772 O  OD1 . ASP B 1 303 ? 22.948  11.147  -8.049  1.00 73.09  ? 304 ASP B OD1 1 
ATOM   4773 O  OD2 . ASP B 1 303 ? 22.473  9.908   -6.306  1.00 74.75  ? 304 ASP B OD2 1 
ATOM   4774 N  N   . ILE B 1 304 ? 24.430  7.946   -11.456 1.00 68.84  ? 305 ILE B N   1 
ATOM   4775 C  CA  . ILE B 1 304 ? 25.372  7.291   -12.369 1.00 68.81  ? 305 ILE B CA  1 
ATOM   4776 C  C   . ILE B 1 304 ? 26.750  7.961   -12.194 1.00 72.08  ? 305 ILE B C   1 
ATOM   4777 O  O   . ILE B 1 304 ? 26.840  9.192   -12.268 1.00 72.91  ? 305 ILE B O   1 
ATOM   4778 C  CB  . ILE B 1 304 ? 24.854  7.342   -13.834 1.00 65.84  ? 305 ILE B CB  1 
ATOM   4779 C  CG1 . ILE B 1 304 ? 23.513  6.586   -13.950 1.00 63.45  ? 305 ILE B CG1 1 
ATOM   4780 C  CG2 . ILE B 1 304 ? 25.879  6.767   -14.815 1.00 66.51  ? 305 ILE B CG2 1 
ATOM   4781 C  CD1 . ILE B 1 304 ? 22.629  6.982   -15.117 1.00 58.31  ? 305 ILE B CD1 1 
ATOM   4782 N  N   . PRO B 1 305 ? 27.818  7.162   -11.930 1.00 74.62  ? 306 PRO B N   1 
ATOM   4783 C  CA  . PRO B 1 305 ? 29.132  7.770   -11.657 1.00 78.23  ? 306 PRO B CA  1 
ATOM   4784 C  C   . PRO B 1 305 ? 29.880  8.236   -12.929 1.00 78.67  ? 306 PRO B C   1 
ATOM   4785 O  O   . PRO B 1 305 ? 29.529  7.797   -14.030 1.00 73.67  ? 306 PRO B O   1 
ATOM   4786 C  CB  . PRO B 1 305 ? 29.898  6.646   -10.940 1.00 78.75  ? 306 PRO B CB  1 
ATOM   4787 C  CG  . PRO B 1 305 ? 29.286  5.380   -11.436 1.00 77.11  ? 306 PRO B CG  1 
ATOM   4788 C  CD  . PRO B 1 305 ? 27.872  5.684   -11.861 1.00 74.77  ? 306 PRO B CD  1 
ATOM   4789 N  N   . PRO B 1 306 ? 30.889  9.135   -12.779 1.00 84.25  ? 307 PRO B N   1 
ATOM   4790 C  CA  . PRO B 1 306 ? 31.795  9.488   -13.888 1.00 85.07  ? 307 PRO B CA  1 
ATOM   4791 C  C   . PRO B 1 306 ? 32.530  8.263   -14.469 1.00 85.82  ? 307 PRO B C   1 
ATOM   4792 O  O   . PRO B 1 306 ? 32.787  7.314   -13.720 1.00 87.55  ? 307 PRO B O   1 
ATOM   4793 C  CB  . PRO B 1 306 ? 32.786  10.453  -13.231 1.00 88.05  ? 307 PRO B CB  1 
ATOM   4794 C  CG  . PRO B 1 306 ? 31.995  11.102  -12.152 1.00 88.18  ? 307 PRO B CG  1 
ATOM   4795 C  CD  . PRO B 1 306 ? 31.135  9.997   -11.602 1.00 87.30  ? 307 PRO B CD  1 
ATOM   4796 N  N   . PRO B 1 307 ? 32.871  8.270   -15.766 1.00 84.66  ? 308 PRO B N   1 
ATOM   4797 C  CA  . PRO B 1 307 ? 32.718  9.440   -16.644 1.00 82.72  ? 308 PRO B CA  1 
ATOM   4798 C  C   . PRO B 1 307 ? 31.341  9.619   -17.331 1.00 78.28  ? 308 PRO B C   1 
ATOM   4799 O  O   . PRO B 1 307 ? 31.044  10.730  -17.781 1.00 76.92  ? 308 PRO B O   1 
ATOM   4800 C  CB  . PRO B 1 307 ? 33.838  9.242   -17.678 1.00 83.20  ? 308 PRO B CB  1 
ATOM   4801 C  CG  . PRO B 1 307 ? 34.079  7.760   -17.714 1.00 83.07  ? 308 PRO B CG  1 
ATOM   4802 C  CD  . PRO B 1 307 ? 33.467  7.127   -16.489 1.00 83.06  ? 308 PRO B CD  1 
ATOM   4803 N  N   . THR B 1 308 ? 30.521  8.562   -17.400 1.00 73.66  ? 309 THR B N   1 
ATOM   4804 C  CA  . THR B 1 308 ? 29.173  8.646   -18.004 1.00 70.06  ? 309 THR B CA  1 
ATOM   4805 C  C   . THR B 1 308 ? 28.281  9.682   -17.289 1.00 69.34  ? 309 THR B C   1 
ATOM   4806 O  O   . THR B 1 308 ? 27.545  10.419  -17.948 1.00 65.39  ? 309 THR B O   1 
ATOM   4807 C  CB  . THR B 1 308 ? 28.459  7.264   -18.092 1.00 68.15  ? 309 THR B CB  1 
ATOM   4808 O  OG1 . THR B 1 308 ? 29.263  6.334   -18.830 1.00 66.03  ? 309 THR B OG1 1 
ATOM   4809 C  CG2 . THR B 1 308 ? 27.105  7.377   -18.802 1.00 65.76  ? 309 THR B CG2 1 
ATOM   4810 N  N   . GLY B 1 309 ? 28.380  9.743   -15.957 1.00 71.56  ? 310 GLY B N   1 
ATOM   4811 C  CA  . GLY B 1 309 ? 27.565  10.642  -15.132 1.00 70.28  ? 310 GLY B CA  1 
ATOM   4812 C  C   . GLY B 1 309 ? 28.328  11.745  -14.411 1.00 74.87  ? 310 GLY B C   1 
ATOM   4813 O  O   . GLY B 1 309 ? 29.534  11.885  -14.631 1.00 81.35  ? 310 GLY B O   1 
ATOM   4814 N  N   . PRO B 1 310 ? 27.664  12.540  -13.555 1.00 74.39  ? 311 PRO B N   1 
ATOM   4815 C  CA  . PRO B 1 310 ? 26.215  12.464  -13.291 1.00 69.92  ? 311 PRO B CA  1 
ATOM   4816 C  C   . PRO B 1 310 ? 25.413  12.837  -14.523 1.00 66.12  ? 311 PRO B C   1 
ATOM   4817 O  O   . PRO B 1 310 ? 25.840  13.701  -15.297 1.00 66.65  ? 311 PRO B O   1 
ATOM   4818 C  CB  . PRO B 1 310 ? 25.991  13.518  -12.196 1.00 71.62  ? 311 PRO B CB  1 
ATOM   4819 C  CG  . PRO B 1 310 ? 27.339  13.771  -11.605 1.00 75.50  ? 311 PRO B CG  1 
ATOM   4820 C  CD  . PRO B 1 310 ? 28.321  13.560  -12.716 1.00 74.93  ? 311 PRO B CD  1 
ATOM   4821 N  N   . THR B 1 311 ? 24.271  12.175  -14.698 1.00 61.76  ? 312 THR B N   1 
ATOM   4822 C  CA  . THR B 1 311 ? 23.474  12.289  -15.916 1.00 58.20  ? 312 THR B CA  1 
ATOM   4823 C  C   . THR B 1 311 ? 22.037  11.830  -15.726 1.00 57.18  ? 312 THR B C   1 
ATOM   4824 O  O   . THR B 1 311 ? 21.748  10.967  -14.895 1.00 57.95  ? 312 THR B O   1 
ATOM   4825 C  CB  . THR B 1 311 ? 24.084  11.479  -17.093 1.00 57.17  ? 312 THR B CB  1 
ATOM   4826 O  OG1 . THR B 1 311 ? 23.267  11.640  -18.257 1.00 55.33  ? 312 THR B OG1 1 
ATOM   4827 C  CG2 . THR B 1 311 ? 24.198  9.968   -16.771 1.00 55.50  ? 312 THR B CG2 1 
ATOM   4828 N  N   . TRP B 1 312 ? 21.145  12.393  -16.532 1.00 54.96  ? 313 TRP B N   1 
ATOM   4829 C  CA  . TRP B 1 312 ? 19.820  11.824  -16.685 1.00 52.74  ? 313 TRP B CA  1 
ATOM   4830 C  C   . TRP B 1 312 ? 19.928  10.584  -17.553 1.00 49.85  ? 313 TRP B C   1 
ATOM   4831 O  O   . TRP B 1 312 ? 20.785  10.509  -18.432 1.00 47.20  ? 313 TRP B O   1 
ATOM   4832 C  CB  . TRP B 1 312 ? 18.855  12.829  -17.300 1.00 51.72  ? 313 TRP B CB  1 
ATOM   4833 C  CG  . TRP B 1 312 ? 18.542  13.972  -16.391 1.00 54.11  ? 313 TRP B CG  1 
ATOM   4834 C  CD1 . TRP B 1 312 ? 19.374  15.001  -16.051 1.00 55.69  ? 313 TRP B CD1 1 
ATOM   4835 C  CD2 . TRP B 1 312 ? 17.302  14.218  -15.716 1.00 54.48  ? 313 TRP B CD2 1 
ATOM   4836 N  NE1 . TRP B 1 312 ? 18.736  15.866  -15.200 1.00 57.33  ? 313 TRP B NE1 1 
ATOM   4837 C  CE2 . TRP B 1 312 ? 17.462  15.414  -14.976 1.00 55.60  ? 313 TRP B CE2 1 
ATOM   4838 C  CE3 . TRP B 1 312 ? 16.070  13.543  -15.658 1.00 54.58  ? 313 TRP B CE3 1 
ATOM   4839 C  CZ2 . TRP B 1 312 ? 16.437  15.955  -14.186 1.00 56.45  ? 313 TRP B CZ2 1 
ATOM   4840 C  CZ3 . TRP B 1 312 ? 15.045  14.082  -14.871 1.00 55.18  ? 313 TRP B CZ3 1 
ATOM   4841 C  CH2 . TRP B 1 312 ? 15.241  15.278  -14.145 1.00 56.92  ? 313 TRP B CH2 1 
ATOM   4842 N  N   . ALA B 1 313 ? 19.092  9.597   -17.257 1.00 49.80  ? 314 ALA B N   1 
ATOM   4843 C  CA  . ALA B 1 313 ? 18.923  8.450   -18.134 1.00 50.12  ? 314 ALA B CA  1 
ATOM   4844 C  C   . ALA B 1 313 ? 17.487  8.449   -18.613 1.00 49.05  ? 314 ALA B C   1 
ATOM   4845 O  O   . ALA B 1 313 ? 16.555  8.655   -17.828 1.00 51.18  ? 314 ALA B O   1 
ATOM   4846 C  CB  . ALA B 1 313 ? 19.270  7.146   -17.427 1.00 50.29  ? 314 ALA B CB  1 
ATOM   4847 N  N   . LEU B 1 314 ? 17.327  8.263   -19.915 1.00 47.67  ? 315 LEU B N   1 
ATOM   4848 C  CA  . LEU B 1 314 ? 16.024  8.173   -20.535 1.00 46.54  ? 315 LEU B CA  1 
ATOM   4849 C  C   . LEU B 1 314 ? 15.815  6.715   -20.905 1.00 46.48  ? 315 LEU B C   1 
ATOM   4850 O  O   . LEU B 1 314 ? 16.330  6.233   -21.916 1.00 48.68  ? 315 LEU B O   1 
ATOM   4851 C  CB  . LEU B 1 314 ? 15.935  9.109   -21.751 1.00 45.69  ? 315 LEU B CB  1 
ATOM   4852 C  CG  . LEU B 1 314 ? 16.054  10.620  -21.488 1.00 46.20  ? 315 LEU B CG  1 
ATOM   4853 C  CD1 . LEU B 1 314 ? 16.094  11.388  -22.802 1.00 45.51  ? 315 LEU B CD1 1 
ATOM   4854 C  CD2 . LEU B 1 314 ? 14.938  11.152  -20.591 1.00 45.95  ? 315 LEU B CD2 1 
ATOM   4855 N  N   . GLY B 1 315 ? 15.091  6.006   -20.049 1.00 46.38  ? 316 GLY B N   1 
ATOM   4856 C  CA  . GLY B 1 315 ? 14.899  4.574   -20.213 1.00 46.16  ? 316 GLY B CA  1 
ATOM   4857 C  C   . GLY B 1 315 ? 13.549  4.240   -20.785 1.00 46.50  ? 316 GLY B C   1 
ATOM   4858 O  O   . GLY B 1 315 ? 12.966  5.044   -21.518 1.00 47.62  ? 316 GLY B O   1 
ATOM   4859 N  N   . ALA B 1 316 ? 13.047  3.060   -20.418 1.00 46.26  ? 317 ALA B N   1 
ATOM   4860 C  CA  . ALA B 1 316 ? 11.796  2.517   -20.948 1.00 44.97  ? 317 ALA B CA  1 
ATOM   4861 C  C   . ALA B 1 316 ? 10.600  3.469   -20.856 1.00 45.21  ? 317 ALA B C   1 
ATOM   4862 O  O   . ALA B 1 316 ? 9.792   3.514   -21.787 1.00 45.38  ? 317 ALA B O   1 
ATOM   4863 C  CB  . ALA B 1 316 ? 11.480  1.180   -20.304 1.00 44.86  ? 317 ALA B CB  1 
ATOM   4864 N  N   . THR B 1 317 ? 10.505  4.228   -19.755 1.00 45.79  ? 318 THR B N   1 
ATOM   4865 C  CA  . THR B 1 317 ? 9.463   5.264   -19.576 1.00 45.78  ? 318 THR B CA  1 
ATOM   4866 C  C   . THR B 1 317 ? 9.432   6.242   -20.757 1.00 44.43  ? 318 THR B C   1 
ATOM   4867 O  O   . THR B 1 317 ? 8.360   6.525   -21.297 1.00 44.64  ? 318 THR B O   1 
ATOM   4868 C  CB  . THR B 1 317 ? 9.641   6.065   -18.265 1.00 46.12  ? 318 THR B CB  1 
ATOM   4869 O  OG1 . THR B 1 317 ? 9.808   5.168   -17.161 1.00 46.69  ? 318 THR B OG1 1 
ATOM   4870 C  CG2 . THR B 1 317 ? 8.432   6.947   -18.004 1.00 46.36  ? 318 THR B CG2 1 
ATOM   4871 N  N   . PHE B 1 318 ? 10.611  6.727   -21.150 1.00 43.07  ? 319 PHE B N   1 
ATOM   4872 C  CA  . PHE B 1 318 ? 10.760  7.639   -22.283 1.00 42.04  ? 319 PHE B CA  1 
ATOM   4873 C  C   . PHE B 1 318 ? 10.514  6.963   -23.626 1.00 40.99  ? 319 PHE B C   1 
ATOM   4874 O  O   . PHE B 1 318 ? 9.789   7.508   -24.454 1.00 43.46  ? 319 PHE B O   1 
ATOM   4875 C  CB  . PHE B 1 318 ? 12.135  8.321   -22.272 1.00 41.94  ? 319 PHE B CB  1 
ATOM   4876 C  CG  . PHE B 1 318 ? 12.208  9.544   -23.138 1.00 42.96  ? 319 PHE B CG  1 
ATOM   4877 C  CD1 . PHE B 1 318 ? 11.758  10.782  -22.664 1.00 43.86  ? 319 PHE B CD1 1 
ATOM   4878 C  CD2 . PHE B 1 318 ? 12.725  9.471   -24.435 1.00 43.27  ? 319 PHE B CD2 1 
ATOM   4879 C  CE1 . PHE B 1 318 ? 11.820  11.912  -23.471 1.00 44.17  ? 319 PHE B CE1 1 
ATOM   4880 C  CE2 . PHE B 1 318 ? 12.788  10.600  -25.246 1.00 42.34  ? 319 PHE B CE2 1 
ATOM   4881 C  CZ  . PHE B 1 318 ? 12.340  11.819  -24.762 1.00 44.28  ? 319 PHE B CZ  1 
ATOM   4882 N  N   . ILE B 1 319 ? 11.104  5.782   -23.826 1.00 40.36  ? 320 ILE B N   1 
ATOM   4883 C  CA  . ILE B 1 319 ? 11.010  5.036   -25.093 1.00 40.15  ? 320 ILE B CA  1 
ATOM   4884 C  C   . ILE B 1 319 ? 9.563   4.615   -25.402 1.00 40.42  ? 320 ILE B C   1 
ATOM   4885 O  O   . ILE B 1 319 ? 9.125   4.650   -26.555 1.00 39.41  ? 320 ILE B O   1 
ATOM   4886 C  CB  . ILE B 1 319 ? 11.982  3.828   -25.123 1.00 40.98  ? 320 ILE B CB  1 
ATOM   4887 C  CG1 . ILE B 1 319 ? 13.424  4.310   -24.942 1.00 42.07  ? 320 ILE B CG1 1 
ATOM   4888 C  CG2 . ILE B 1 319 ? 11.871  3.053   -26.438 1.00 40.18  ? 320 ILE B CG2 1 
ATOM   4889 C  CD1 . ILE B 1 319 ? 14.339  3.300   -24.294 1.00 43.88  ? 320 ILE B CD1 1 
ATOM   4890 N  N   . ARG B 1 320 ? 8.822   4.245   -24.361 1.00 40.66  ? 321 ARG B N   1 
ATOM   4891 C  CA  . ARG B 1 320 ? 7.412   3.921   -24.499 1.00 41.82  ? 321 ARG B CA  1 
ATOM   4892 C  C   . ARG B 1 320 ? 6.635   5.015   -25.207 1.00 42.24  ? 321 ARG B C   1 
ATOM   4893 O  O   . ARG B 1 320 ? 5.793   4.722   -26.054 1.00 46.00  ? 321 ARG B O   1 
ATOM   4894 C  CB  . ARG B 1 320 ? 6.790   3.629   -23.143 1.00 43.09  ? 321 ARG B CB  1 
ATOM   4895 C  CG  . ARG B 1 320 ? 6.876   2.171   -22.749 1.00 43.58  ? 321 ARG B CG  1 
ATOM   4896 C  CD  . ARG B 1 320 ? 5.869   1.841   -21.664 1.00 45.06  ? 321 ARG B CD  1 
ATOM   4897 N  NE  . ARG B 1 320 ? 6.108   2.564   -20.415 1.00 46.34  ? 321 ARG B NE  1 
ATOM   4898 C  CZ  . ARG B 1 320 ? 7.009   2.226   -19.493 1.00 48.90  ? 321 ARG B CZ  1 
ATOM   4899 N  NH1 . ARG B 1 320 ? 7.810   1.176   -19.671 1.00 47.26  ? 321 ARG B NH1 1 
ATOM   4900 N  NH2 . ARG B 1 320 ? 7.119   2.954   -18.385 1.00 50.00  ? 321 ARG B NH2 1 
ATOM   4901 N  N   . LYS B 1 321 ? 6.942   6.263   -24.873 1.00 41.72  ? 322 LYS B N   1 
ATOM   4902 C  CA  . LYS B 1 321 ? 6.309   7.414   -25.493 1.00 43.83  ? 322 LYS B CA  1 
ATOM   4903 C  C   . LYS B 1 321 ? 6.951   7.693   -26.857 1.00 45.67  ? 322 LYS B C   1 
ATOM   4904 O  O   . LYS B 1 321 ? 6.254   7.931   -27.851 1.00 44.83  ? 322 LYS B O   1 
ATOM   4905 C  CB  . LYS B 1 321 ? 6.417   8.628   -24.558 1.00 43.99  ? 322 LYS B CB  1 
ATOM   4906 C  CG  . LYS B 1 321 ? 5.751   9.902   -25.053 1.00 45.24  ? 322 LYS B CG  1 
ATOM   4907 C  CD  . LYS B 1 321 ? 4.251   9.920   -24.822 1.00 47.11  ? 322 LYS B CD  1 
ATOM   4908 C  CE  . LYS B 1 321 ? 3.689   11.297  -25.126 1.00 48.14  ? 322 LYS B CE  1 
ATOM   4909 N  NZ  . LYS B 1 321 ? 2.275   11.436  -24.697 1.00 51.97  ? 322 LYS B NZ  1 
ATOM   4910 N  N   . PHE B 1 322 ? 8.281   7.653   -26.898 1.00 45.58  ? 323 PHE B N   1 
ATOM   4911 C  CA  . PHE B 1 322 ? 9.009   7.969   -28.117 1.00 46.94  ? 323 PHE B CA  1 
ATOM   4912 C  C   . PHE B 1 322 ? 9.788   6.778   -28.689 1.00 47.36  ? 323 PHE B C   1 
ATOM   4913 O  O   . PHE B 1 322 ? 10.793  6.341   -28.117 1.00 49.40  ? 323 PHE B O   1 
ATOM   4914 C  CB  . PHE B 1 322 ? 9.909   9.193   -27.895 1.00 47.32  ? 323 PHE B CB  1 
ATOM   4915 C  CG  . PHE B 1 322 ? 9.152   10.412  -27.462 1.00 49.03  ? 323 PHE B CG  1 
ATOM   4916 C  CD1 . PHE B 1 322 ? 8.359   11.125  -28.379 1.00 49.76  ? 323 PHE B CD1 1 
ATOM   4917 C  CD2 . PHE B 1 322 ? 9.196   10.838  -26.133 1.00 49.46  ? 323 PHE B CD2 1 
ATOM   4918 C  CE1 . PHE B 1 322 ? 7.628   12.237  -27.972 1.00 50.70  ? 323 PHE B CE1 1 
ATOM   4919 C  CE2 . PHE B 1 322 ? 8.475   11.961  -25.724 1.00 52.12  ? 323 PHE B CE2 1 
ATOM   4920 C  CZ  . PHE B 1 322 ? 7.689   12.658  -26.642 1.00 51.88  ? 323 PHE B CZ  1 
ATOM   4921 N  N   . TYR B 1 323 ? 9.293   6.252   -29.808 1.00 44.29  ? 324 TYR B N   1 
ATOM   4922 C  CA  . TYR B 1 323 ? 10.041  5.323   -30.640 1.00 45.01  ? 324 TYR B CA  1 
ATOM   4923 C  C   . TYR B 1 323 ? 11.426  5.923   -30.910 1.00 47.04  ? 324 TYR B C   1 
ATOM   4924 O  O   . TYR B 1 323 ? 11.535  7.080   -31.338 1.00 51.27  ? 324 TYR B O   1 
ATOM   4925 C  CB  . TYR B 1 323 ? 9.300   5.098   -31.960 1.00 44.27  ? 324 TYR B CB  1 
ATOM   4926 C  CG  . TYR B 1 323 ? 9.867   3.990   -32.820 1.00 43.67  ? 324 TYR B CG  1 
ATOM   4927 C  CD1 . TYR B 1 323 ? 11.034  4.180   -33.576 1.00 42.89  ? 324 TYR B CD1 1 
ATOM   4928 C  CD2 . TYR B 1 323 ? 9.230   2.747   -32.887 1.00 43.22  ? 324 TYR B CD2 1 
ATOM   4929 C  CE1 . TYR B 1 323 ? 11.547  3.161   -34.365 1.00 42.83  ? 324 TYR B CE1 1 
ATOM   4930 C  CE2 . TYR B 1 323 ? 9.739   1.723   -33.667 1.00 42.96  ? 324 TYR B CE2 1 
ATOM   4931 C  CZ  . TYR B 1 323 ? 10.893  1.930   -34.404 1.00 43.24  ? 324 TYR B CZ  1 
ATOM   4932 O  OH  . TYR B 1 323 ? 11.381  0.905   -35.177 1.00 42.76  ? 324 TYR B OH  1 
ATOM   4933 N  N   . THR B 1 324 ? 12.467  5.136   -30.656 1.00 44.88  ? 325 THR B N   1 
ATOM   4934 C  CA  . THR B 1 324 ? 13.847  5.617   -30.714 1.00 44.12  ? 325 THR B CA  1 
ATOM   4935 C  C   . THR B 1 324 ? 14.666  4.910   -31.795 1.00 43.55  ? 325 THR B C   1 
ATOM   4936 O  O   . THR B 1 324 ? 14.621  3.690   -31.911 1.00 43.28  ? 325 THR B O   1 
ATOM   4937 C  CB  . THR B 1 324 ? 14.540  5.437   -29.348 1.00 43.55  ? 325 THR B CB  1 
ATOM   4938 O  OG1 . THR B 1 324 ? 13.702  5.971   -28.320 1.00 44.29  ? 325 THR B OG1 1 
ATOM   4939 C  CG2 . THR B 1 324 ? 15.872  6.143   -29.314 1.00 41.03  ? 325 THR B CG2 1 
ATOM   4940 N  N   . GLU B 1 325 ? 15.402  5.687   -32.582 1.00 43.78  ? 326 GLU B N   1 
ATOM   4941 C  CA  . GLU B 1 325 ? 16.357  5.136   -33.540 1.00 45.91  ? 326 GLU B CA  1 
ATOM   4942 C  C   . GLU B 1 325 ? 17.770  5.588   -33.169 1.00 46.20  ? 326 GLU B C   1 
ATOM   4943 O  O   . GLU B 1 325 ? 18.026  6.776   -32.969 1.00 48.87  ? 326 GLU B O   1 
ATOM   4944 C  CB  . GLU B 1 325 ? 15.995  5.535   -34.975 1.00 48.14  ? 326 GLU B CB  1 
ATOM   4945 C  CG  . GLU B 1 325 ? 17.051  5.202   -36.020 1.00 49.11  ? 326 GLU B CG  1 
ATOM   4946 C  CD  . GLU B 1 325 ? 16.688  5.723   -37.396 1.00 52.58  ? 326 GLU B CD  1 
ATOM   4947 O  OE1 . GLU B 1 325 ? 15.921  5.046   -38.115 1.00 55.45  ? 326 GLU B OE1 1 
ATOM   4948 O  OE2 . GLU B 1 325 ? 17.173  6.808   -37.765 1.00 52.76  ? 326 GLU B OE2 1 
ATOM   4949 N  N   . PHE B 1 326 ? 18.672  4.622   -33.070 1.00 44.95  ? 327 PHE B N   1 
ATOM   4950 C  CA  . PHE B 1 326 ? 20.066  4.880   -32.755 1.00 43.83  ? 327 PHE B CA  1 
ATOM   4951 C  C   . PHE B 1 326 ? 20.859  4.803   -34.041 1.00 43.81  ? 327 PHE B C   1 
ATOM   4952 O  O   . PHE B 1 326 ? 20.930  3.745   -34.674 1.00 43.91  ? 327 PHE B O   1 
ATOM   4953 C  CB  . PHE B 1 326 ? 20.578  3.885   -31.716 1.00 42.37  ? 327 PHE B CB  1 
ATOM   4954 C  CG  . PHE B 1 326 ? 19.878  3.989   -30.387 1.00 40.96  ? 327 PHE B CG  1 
ATOM   4955 C  CD1 . PHE B 1 326 ? 18.683  3.301   -30.154 1.00 39.15  ? 327 PHE B CD1 1 
ATOM   4956 C  CD2 . PHE B 1 326 ? 20.408  4.789   -29.365 1.00 40.35  ? 327 PHE B CD2 1 
ATOM   4957 C  CE1 . PHE B 1 326 ? 18.037  3.408   -28.926 1.00 40.16  ? 327 PHE B CE1 1 
ATOM   4958 C  CE2 . PHE B 1 326 ? 19.765  4.900   -28.134 1.00 39.22  ? 327 PHE B CE2 1 
ATOM   4959 C  CZ  . PHE B 1 326 ? 18.576  4.213   -27.917 1.00 39.29  ? 327 PHE B CZ  1 
ATOM   4960 N  N   . ASP B 1 327 ? 21.425  5.948   -34.419 1.00 43.42  ? 328 ASP B N   1 
ATOM   4961 C  CA  . ASP B 1 327 ? 22.092  6.134   -35.700 1.00 45.97  ? 328 ASP B CA  1 
ATOM   4962 C  C   . ASP B 1 327 ? 23.617  6.150   -35.523 1.00 47.25  ? 328 ASP B C   1 
ATOM   4963 O  O   . ASP B 1 327 ? 24.210  7.175   -35.147 1.00 50.46  ? 328 ASP B O   1 
ATOM   4964 C  CB  . ASP B 1 327 ? 21.558  7.418   -36.366 1.00 46.41  ? 328 ASP B CB  1 
ATOM   4965 C  CG  . ASP B 1 327 ? 22.035  7.615   -37.804 1.00 48.32  ? 328 ASP B CG  1 
ATOM   4966 O  OD1 . ASP B 1 327 ? 22.960  6.925   -38.287 1.00 50.43  ? 328 ASP B OD1 1 
ATOM   4967 O  OD2 . ASP B 1 327 ? 21.466  8.508   -38.468 1.00 49.88  ? 328 ASP B OD2 1 
ATOM   4968 N  N   . ARG B 1 328 ? 24.236  5.003   -35.802 1.00 45.53  ? 329 ARG B N   1 
ATOM   4969 C  CA  . ARG B 1 328 ? 25.697  4.854   -35.749 1.00 46.89  ? 329 ARG B CA  1 
ATOM   4970 C  C   . ARG B 1 328 ? 26.453  5.539   -36.907 1.00 47.51  ? 329 ARG B C   1 
ATOM   4971 O  O   . ARG B 1 328 ? 27.605  5.941   -36.743 1.00 46.77  ? 329 ARG B O   1 
ATOM   4972 C  CB  . ARG B 1 328 ? 26.089  3.371   -35.653 1.00 46.70  ? 329 ARG B CB  1 
ATOM   4973 C  CG  . ARG B 1 328 ? 25.942  2.740   -34.271 1.00 46.04  ? 329 ARG B CG  1 
ATOM   4974 C  CD  . ARG B 1 328 ? 26.928  3.294   -33.242 1.00 47.88  ? 329 ARG B CD  1 
ATOM   4975 N  NE  . ARG B 1 328 ? 28.332  3.216   -33.656 1.00 50.72  ? 329 ARG B NE  1 
ATOM   4976 C  CZ  . ARG B 1 328 ? 29.133  2.170   -33.445 1.00 53.56  ? 329 ARG B CZ  1 
ATOM   4977 N  NH1 . ARG B 1 328 ? 28.683  1.080   -32.825 1.00 52.54  ? 329 ARG B NH1 1 
ATOM   4978 N  NH2 . ARG B 1 328 ? 30.394  2.207   -33.867 1.00 55.54  ? 329 ARG B NH2 1 
ATOM   4979 N  N   . ARG B 1 329 ? 25.803  5.668   -38.066 1.00 47.88  ? 330 ARG B N   1 
ATOM   4980 C  CA  . ARG B 1 329 ? 26.392  6.364   -39.211 1.00 50.39  ? 330 ARG B CA  1 
ATOM   4981 C  C   . ARG B 1 329 ? 26.627  7.845   -38.901 1.00 51.84  ? 330 ARG B C   1 
ATOM   4982 O  O   . ARG B 1 329 ? 27.668  8.412   -39.267 1.00 50.80  ? 330 ARG B O   1 
ATOM   4983 C  CB  . ARG B 1 329 ? 25.517  6.194   -40.471 1.00 50.45  ? 330 ARG B CB  1 
ATOM   4984 C  CG  . ARG B 1 329 ? 25.947  7.005   -41.707 1.00 50.77  ? 330 ARG B CG  1 
ATOM   4985 C  CD  . ARG B 1 329 ? 27.352  6.663   -42.185 1.00 51.60  ? 330 ARG B CD  1 
ATOM   4986 N  NE  . ARG B 1 329 ? 27.845  7.583   -43.218 1.00 54.07  ? 330 ARG B NE  1 
ATOM   4987 C  CZ  . ARG B 1 329 ? 28.487  8.731   -42.983 1.00 55.05  ? 330 ARG B CZ  1 
ATOM   4988 N  NH1 . ARG B 1 329 ? 28.724  9.141   -41.738 1.00 53.79  ? 330 ARG B NH1 1 
ATOM   4989 N  NH2 . ARG B 1 329 ? 28.891  9.481   -44.002 1.00 55.77  ? 330 ARG B NH2 1 
ATOM   4990 N  N   . ASN B 1 330 ? 25.656  8.442   -38.207 1.00 51.93  ? 331 ASN B N   1 
ATOM   4991 C  CA  . ASN B 1 330 ? 25.636  9.869   -37.938 1.00 52.51  ? 331 ASN B CA  1 
ATOM   4992 C  C   . ASN B 1 330 ? 25.825  10.284  -36.474 1.00 53.66  ? 331 ASN B C   1 
ATOM   4993 O  O   . ASN B 1 330 ? 25.728  11.477  -36.165 1.00 56.50  ? 331 ASN B O   1 
ATOM   4994 C  CB  . ASN B 1 330 ? 24.334  10.454  -38.472 1.00 51.84  ? 331 ASN B CB  1 
ATOM   4995 C  CG  . ASN B 1 330 ? 24.232  10.383  -39.975 1.00 53.75  ? 331 ASN B CG  1 
ATOM   4996 O  OD1 . ASN B 1 330 ? 25.226  10.528  -40.696 1.00 56.10  ? 331 ASN B OD1 1 
ATOM   4997 N  ND2 . ASN B 1 330 ? 23.015  10.186  -40.464 1.00 53.12  ? 331 ASN B ND2 1 
ATOM   4998 N  N   . ASN B 1 331 ? 26.106  9.319   -35.589 1.00 52.72  ? 332 ASN B N   1 
ATOM   4999 C  CA  . ASN B 1 331 ? 26.239  9.560   -34.133 1.00 52.30  ? 332 ASN B CA  1 
ATOM   5000 C  C   . ASN B 1 331 ? 25.149  10.457  -33.589 1.00 50.63  ? 332 ASN B C   1 
ATOM   5001 O  O   . ASN B 1 331 ? 25.413  11.564  -33.103 1.00 50.12  ? 332 ASN B O   1 
ATOM   5002 C  CB  . ASN B 1 331 ? 27.627  10.094  -33.749 1.00 53.18  ? 332 ASN B CB  1 
ATOM   5003 C  CG  . ASN B 1 331 ? 28.620  8.989   -33.476 1.00 54.02  ? 332 ASN B CG  1 
ATOM   5004 O  OD1 . ASN B 1 331 ? 28.240  7.861   -33.185 1.00 52.85  ? 332 ASN B OD1 1 
ATOM   5005 N  ND2 . ASN B 1 331 ? 29.904  9.308   -33.577 1.00 57.88  ? 332 ASN B ND2 1 
ATOM   5006 N  N   . ARG B 1 332 ? 23.919  9.968   -33.709 1.00 48.37  ? 333 ARG B N   1 
ATOM   5007 C  CA  . ARG B 1 332 ? 22.735  10.716  -33.312 1.00 46.72  ? 333 ARG B CA  1 
ATOM   5008 C  C   . ARG B 1 332 ? 21.601  9.778   -32.919 1.00 46.54  ? 333 ARG B C   1 
ATOM   5009 O  O   . ARG B 1 332 ? 21.647  8.577   -33.194 1.00 45.84  ? 333 ARG B O   1 
ATOM   5010 C  CB  . ARG B 1 332 ? 22.300  11.686  -34.423 1.00 44.38  ? 333 ARG B CB  1 
ATOM   5011 C  CG  . ARG B 1 332 ? 21.951  11.031  -35.750 1.00 42.57  ? 333 ARG B CG  1 
ATOM   5012 C  CD  . ARG B 1 332 ? 21.545  12.035  -36.810 1.00 41.94  ? 333 ARG B CD  1 
ATOM   5013 N  NE  . ARG B 1 332 ? 20.835  11.365  -37.889 1.00 41.67  ? 333 ARG B NE  1 
ATOM   5014 C  CZ  . ARG B 1 332 ? 20.186  11.968  -38.880 1.00 43.61  ? 333 ARG B CZ  1 
ATOM   5015 N  NH1 . ARG B 1 332 ? 19.569  11.233  -39.797 1.00 43.63  ? 333 ARG B NH1 1 
ATOM   5016 N  NH2 . ARG B 1 332 ? 20.149  13.295  -38.968 1.00 46.15  ? 333 ARG B NH2 1 
ATOM   5017 N  N   . ILE B 1 333 ? 20.589  10.343  -32.264 1.00 48.58  ? 334 ILE B N   1 
ATOM   5018 C  CA  . ILE B 1 333 ? 19.406  9.602   -31.844 1.00 47.65  ? 334 ILE B CA  1 
ATOM   5019 C  C   . ILE B 1 333 ? 18.134  10.265  -32.398 1.00 49.30  ? 334 ILE B C   1 
ATOM   5020 O  O   . ILE B 1 333 ? 17.893  11.465  -32.184 1.00 49.59  ? 334 ILE B O   1 
ATOM   5021 C  CB  . ILE B 1 333 ? 19.368  9.442   -30.308 1.00 47.06  ? 334 ILE B CB  1 
ATOM   5022 C  CG1 . ILE B 1 333 ? 20.597  8.647   -29.834 1.00 46.43  ? 334 ILE B CG1 1 
ATOM   5023 C  CG2 . ILE B 1 333 ? 18.084  8.753   -29.869 1.00 45.90  ? 334 ILE B CG2 1 
ATOM   5024 C  CD1 . ILE B 1 333 ? 20.937  8.778   -28.368 1.00 46.06  ? 334 ILE B CD1 1 
ATOM   5025 N  N   . GLY B 1 334 ? 17.347  9.471   -33.130 1.00 48.30  ? 335 GLY B N   1 
ATOM   5026 C  CA  . GLY B 1 334 ? 16.041  9.893   -33.640 1.00 46.11  ? 335 GLY B CA  1 
ATOM   5027 C  C   . GLY B 1 334 ? 14.905  9.501   -32.719 1.00 44.87  ? 335 GLY B C   1 
ATOM   5028 O  O   . GLY B 1 334 ? 14.861  8.374   -32.212 1.00 44.19  ? 335 GLY B O   1 
ATOM   5029 N  N   . PHE B 1 335 ? 14.001  10.446  -32.493 1.00 43.26  ? 336 PHE B N   1 
ATOM   5030 C  CA  . PHE B 1 335 ? 12.768  10.190  -31.772 1.00 42.50  ? 336 PHE B CA  1 
ATOM   5031 C  C   . PHE B 1 335 ? 11.560  10.507  -32.651 1.00 44.23  ? 336 PHE B C   1 
ATOM   5032 O  O   . PHE B 1 335 ? 11.586  11.438  -33.462 1.00 46.51  ? 336 PHE B O   1 
ATOM   5033 C  CB  . PHE B 1 335 ? 12.694  11.032  -30.499 1.00 41.33  ? 336 PHE B CB  1 
ATOM   5034 C  CG  . PHE B 1 335 ? 13.717  10.681  -29.452 1.00 41.65  ? 336 PHE B CG  1 
ATOM   5035 C  CD1 . PHE B 1 335 ? 13.699  9.442   -28.804 1.00 41.77  ? 336 PHE B CD1 1 
ATOM   5036 C  CD2 . PHE B 1 335 ? 14.670  11.621  -29.063 1.00 43.17  ? 336 PHE B CD2 1 
ATOM   5037 C  CE1 . PHE B 1 335 ? 14.634  9.144   -27.812 1.00 41.59  ? 336 PHE B CE1 1 
ATOM   5038 C  CE2 . PHE B 1 335 ? 15.608  11.329  -28.075 1.00 42.33  ? 336 PHE B CE2 1 
ATOM   5039 C  CZ  . PHE B 1 335 ? 15.586  10.088  -27.446 1.00 42.08  ? 336 PHE B CZ  1 
ATOM   5040 N  N   . ALA B 1 336 ? 10.508  9.714   -32.491 1.00 44.53  ? 337 ALA B N   1 
ATOM   5041 C  CA  . ALA B 1 336 ? 9.181   10.008  -33.051 1.00 44.77  ? 337 ALA B CA  1 
ATOM   5042 C  C   . ALA B 1 336 ? 8.150   9.383   -32.130 1.00 44.78  ? 337 ALA B C   1 
ATOM   5043 O  O   . ALA B 1 336 ? 8.449   8.404   -31.432 1.00 44.97  ? 337 ALA B O   1 
ATOM   5044 C  CB  . ALA B 1 336 ? 9.039   9.469   -34.468 1.00 44.04  ? 337 ALA B CB  1 
ATOM   5045 N  N   . LEU B 1 337 ? 6.948   9.956   -32.117 1.00 46.71  ? 338 LEU B N   1 
ATOM   5046 C  CA  . LEU B 1 337 ? 5.875   9.507   -31.231 1.00 47.24  ? 338 LEU B CA  1 
ATOM   5047 C  C   . LEU B 1 337 ? 5.529   8.051   -31.536 1.00 48.08  ? 338 LEU B C   1 
ATOM   5048 O  O   . LEU B 1 337 ? 5.221   7.704   -32.684 1.00 47.97  ? 338 LEU B O   1 
ATOM   5049 C  CB  . LEU B 1 337 ? 4.663   10.429  -31.370 1.00 49.33  ? 338 LEU B CB  1 
ATOM   5050 C  CG  . LEU B 1 337 ? 3.506   10.462  -30.364 1.00 53.03  ? 338 LEU B CG  1 
ATOM   5051 C  CD1 . LEU B 1 337 ? 3.926   10.719  -28.917 1.00 49.80  ? 338 LEU B CD1 1 
ATOM   5052 C  CD2 . LEU B 1 337 ? 2.537   11.540  -30.835 1.00 56.51  ? 338 LEU B CD2 1 
ATOM   5053 N  N   . ALA B 1 338 ? 5.650   7.203   -30.513 1.00 47.52  ? 339 ALA B N   1 
ATOM   5054 C  CA  . ALA B 1 338 ? 5.399   5.765   -30.643 1.00 47.93  ? 339 ALA B CA  1 
ATOM   5055 C  C   . ALA B 1 338 ? 3.917   5.448   -30.800 1.00 50.66  ? 339 ALA B C   1 
ATOM   5056 O  O   . ALA B 1 338 ? 3.054   6.198   -30.329 1.00 51.41  ? 339 ALA B O   1 
ATOM   5057 C  CB  . ALA B 1 338 ? 5.963   5.016   -29.448 1.00 46.23  ? 339 ALA B CB  1 
ATOM   5058 N  N   . ARG B 1 339 ? 3.644   4.338   -31.483 1.00 52.50  ? 340 ARG B N   1 
ATOM   5059 C  CA  . ARG B 1 339 ? 2.319   3.716   -31.537 1.00 55.36  ? 340 ARG B CA  1 
ATOM   5060 C  C   . ARG B 1 339 ? 2.513   2.203   -31.695 1.00 57.59  ? 340 ARG B C   1 
ATOM   5061 O  O   . ARG B 1 339 ? 1.564   1.425   -31.624 1.00 62.19  ? 340 ARG B O   1 
ATOM   5062 C  CB  . ARG B 1 339 ? 1.460   4.309   -32.672 1.00 55.15  ? 340 ARG B CB  1 
ATOM   5063 C  CG  . ARG B 1 339 ? 2.000   4.097   -34.076 1.00 54.89  ? 340 ARG B CG  1 
ATOM   5064 C  CD  . ARG B 1 339 ? 1.123   4.738   -35.132 1.00 59.42  ? 340 ARG B CD  1 
ATOM   5065 N  NE  . ARG B 1 339 ? 1.751   4.628   -36.450 1.00 62.07  ? 340 ARG B NE  1 
ATOM   5066 C  CZ  . ARG B 1 339 ? 1.315   3.868   -37.452 1.00 63.07  ? 340 ARG B CZ  1 
ATOM   5067 N  NH1 . ARG B 1 339 ? 0.208   3.140   -37.334 1.00 65.39  ? 340 ARG B NH1 1 
ATOM   5068 N  NH2 . ARG B 1 339 ? 1.991   3.847   -38.589 1.00 62.33  ? 340 ARG B NH2 1 
HETATM 5069 C  C1  . NAG C 2 .   ? -23.584 -34.150 -56.966 1.00 61.98  ? 401 NAG A C1  1 
HETATM 5070 C  C2  . NAG C 2 .   ? -24.562 -34.643 -58.053 1.00 67.87  ? 401 NAG A C2  1 
HETATM 5071 C  C3  . NAG C 2 .   ? -24.144 -36.001 -58.644 1.00 71.52  ? 401 NAG A C3  1 
HETATM 5072 C  C4  . NAG C 2 .   ? -22.671 -36.038 -59.060 1.00 70.52  ? 401 NAG A C4  1 
HETATM 5073 C  C5  . NAG C 2 .   ? -21.796 -35.556 -57.890 1.00 69.40  ? 401 NAG A C5  1 
HETATM 5074 C  C6  . NAG C 2 .   ? -20.306 -35.558 -58.238 1.00 70.29  ? 401 NAG A C6  1 
HETATM 5075 C  C7  . NAG C 2 .   ? -26.916 -33.895 -57.897 1.00 61.99  ? 401 NAG A C7  1 
HETATM 5076 C  C8  . NAG C 2 .   ? -28.269 -34.278 -57.372 1.00 58.39  ? 401 NAG A C8  1 
HETATM 5077 N  N2  . NAG C 2 .   ? -25.948 -34.773 -57.620 1.00 61.52  ? 401 NAG A N2  1 
HETATM 5078 O  O3  . NAG C 2 .   ? -24.968 -36.322 -59.775 1.00 72.50  ? 401 NAG A O3  1 
HETATM 5079 O  O4  . NAG C 2 .   ? -22.345 -37.370 -59.487 1.00 71.47  ? 401 NAG A O4  1 
HETATM 5080 O  O5  . NAG C 2 .   ? -22.223 -34.243 -57.449 1.00 68.09  ? 401 NAG A O5  1 
HETATM 5081 O  O6  . NAG C 2 .   ? -19.960 -34.419 -59.038 1.00 73.77  ? 401 NAG A O6  1 
HETATM 5082 O  O7  . NAG C 2 .   ? -26.738 -32.851 -58.514 1.00 60.65  ? 401 NAG A O7  1 
HETATM 5083 C  C1  . PG6 D 3 .   ? -16.953 -24.401 -23.324 1.00 81.08  ? 402 PG6 A C1  1 
HETATM 5084 O  O1  . PG6 D 3 .   ? -16.294 -25.243 -24.273 1.00 87.09  ? 402 PG6 A O1  1 
HETATM 5085 C  C2  . PG6 D 3 .   ? -14.921 -24.893 -24.477 1.00 81.21  ? 402 PG6 A C2  1 
HETATM 5086 C  C3  . PG6 D 3 .   ? -14.409 -25.526 -25.772 1.00 77.94  ? 402 PG6 A C3  1 
HETATM 5087 O  O2  . PG6 D 3 .   ? -13.764 -24.546 -26.591 1.00 77.09  ? 402 PG6 A O2  1 
HETATM 5088 C  C4  . PG6 D 3 .   ? -14.422 -24.352 -27.847 1.00 74.89  ? 402 PG6 A C4  1 
HETATM 5089 C  C5  . PG6 D 3 .   ? -13.853 -23.135 -28.577 1.00 71.27  ? 402 PG6 A C5  1 
HETATM 5090 O  O3  . PG6 D 3 .   ? -14.745 -22.750 -29.628 1.00 69.46  ? 402 PG6 A O3  1 
HETATM 5091 C  C6  . PG6 D 3 .   ? -14.110 -22.001 -30.669 1.00 61.34  ? 402 PG6 A C6  1 
HETATM 5092 C  C7  . PG6 D 3 .   ? -14.805 -22.247 -32.009 1.00 55.53  ? 402 PG6 A C7  1 
HETATM 5093 O  O4  . PG6 D 3 .   ? -14.658 -23.623 -32.365 1.00 56.42  ? 402 PG6 A O4  1 
HETATM 5094 C  C8  . PG6 D 3 .   ? -15.221 -23.978 -33.629 1.00 52.65  ? 402 PG6 A C8  1 
HETATM 5095 C  C9  . PG6 D 3 .   ? -14.110 -24.575 -34.485 1.00 57.77  ? 402 PG6 A C9  1 
HETATM 5096 O  O5  . PG6 D 3 .   ? -14.586 -25.629 -35.330 1.00 59.90  ? 402 PG6 A O5  1 
HETATM 5097 C  C10 . PG6 D 3 .   ? -14.025 -25.620 -36.650 1.00 57.15  ? 402 PG6 A C10 1 
HETATM 5098 C  C11 . PG6 D 3 .   ? -12.561 -26.074 -36.658 1.00 60.66  ? 402 PG6 A C11 1 
HETATM 5099 O  O6  . PG6 D 3 .   ? -11.835 -25.419 -37.701 1.00 64.29  ? 402 PG6 A O6  1 
HETATM 5100 C  C12 . PG6 D 3 .   ? -11.005 -24.360 -37.220 1.00 60.54  ? 402 PG6 A C12 1 
HETATM 5101 S  S   . DMS E 4 .   ? -8.191  -20.972 -36.220 1.00 59.16  ? 403 DMS A S   1 
HETATM 5102 O  O   . DMS E 4 .   ? -8.433  -19.575 -36.654 1.00 58.03  ? 403 DMS A O   1 
HETATM 5103 C  C1  . DMS E 4 .   ? -6.715  -21.047 -35.367 1.00 56.96  ? 403 DMS A C1  1 
HETATM 5104 C  C2  . DMS E 4 .   ? -9.322  -21.402 -35.012 1.00 56.96  ? 403 DMS A C2  1 
HETATM 5105 S  S   . DMS F 4 .   ? 0.754   -16.489 -26.272 1.00 75.76  ? 404 DMS A S   1 
HETATM 5106 O  O   . DMS F 4 .   ? 0.763   -16.921 -27.687 1.00 76.03  ? 404 DMS A O   1 
HETATM 5107 C  C1  . DMS F 4 .   ? 0.869   -14.785 -26.199 1.00 73.45  ? 404 DMS A C1  1 
HETATM 5108 C  C2  . DMS F 4 .   ? -0.822  -16.701 -25.665 1.00 72.79  ? 404 DMS A C2  1 
HETATM 5109 C  C1  . NAG G 2 .   ? 41.157  -14.041 -26.391 1.00 92.67  ? 401 NAG B C1  1 
HETATM 5110 C  C2  . NAG G 2 .   ? 42.651  -14.304 -26.609 1.00 100.95 ? 401 NAG B C2  1 
HETATM 5111 C  C3  . NAG G 2 .   ? 43.456  -13.059 -26.224 1.00 101.71 ? 401 NAG B C3  1 
HETATM 5112 C  C4  . NAG G 2 .   ? 42.953  -11.792 -26.931 1.00 105.87 ? 401 NAG B C4  1 
HETATM 5113 C  C5  . NAG G 2 .   ? 41.417  -11.671 -27.003 1.00 105.32 ? 401 NAG B C5  1 
HETATM 5114 C  C6  . NAG G 2 .   ? 41.008  -10.729 -28.136 1.00 105.54 ? 401 NAG B C6  1 
HETATM 5115 C  C7  . NAG G 2 .   ? 43.092  -16.732 -26.368 1.00 107.53 ? 401 NAG B C7  1 
HETATM 5116 C  C8  . NAG G 2 .   ? 43.618  -17.779 -25.430 1.00 106.28 ? 401 NAG B C8  1 
HETATM 5117 N  N2  . NAG G 2 .   ? 43.107  -15.482 -25.881 1.00 104.92 ? 401 NAG B N2  1 
HETATM 5118 O  O3  . NAG G 2 .   ? 44.839  -13.251 -26.546 1.00 97.35  ? 401 NAG B O3  1 
HETATM 5119 O  O4  . NAG G 2 .   ? 43.480  -10.646 -26.250 1.00 109.02 ? 401 NAG B O4  1 
HETATM 5120 O  O5  . NAG G 2 .   ? 40.749  -12.935 -27.218 1.00 100.21 ? 401 NAG B O5  1 
HETATM 5121 O  O6  . NAG G 2 .   ? 41.352  -9.366  -27.821 1.00 106.38 ? 401 NAG B O6  1 
HETATM 5122 O  O7  . NAG G 2 .   ? 42.684  -17.031 -27.485 1.00 105.31 ? 401 NAG B O7  1 
HETATM 5123 C  C5  . 77O H 5 .   ? 15.848  -4.836  -14.200 0.80 67.48  ? 402 77O B C5  1 
HETATM 5124 C  C6  . 77O H 5 .   ? 16.917  -4.765  -15.111 0.80 67.46  ? 402 77O B C6  1 
HETATM 5125 C  C8  . 77O H 5 .   ? 15.723  -3.135  -16.619 0.80 54.36  ? 402 77O B C8  1 
HETATM 5126 C  C10 . 77O H 5 .   ? 15.449  -4.232  -18.906 0.80 47.14  ? 402 77O B C10 1 
HETATM 5127 CL CL1 . 77O H 5 .   ? 19.555  -7.139  -13.448 0.80 80.52  ? 402 77O B CL1 1 
HETATM 5128 C  C2  . 77O H 5 .   ? 18.112  -6.228  -13.758 0.80 72.26  ? 402 77O B C2  1 
HETATM 5129 C  C3  . 77O H 5 .   ? 17.050  -6.291  -12.866 0.80 68.90  ? 402 77O B C3  1 
HETATM 5130 N  N4  . 77O H 5 .   ? 15.948  -5.592  -13.113 0.80 67.66  ? 402 77O B N4  1 
HETATM 5131 N  N7  . 77O H 5 .   ? 16.867  -3.990  -16.275 0.80 63.83  ? 402 77O B N7  1 
HETATM 5132 C  C9  . 77O H 5 .   ? 15.382  -3.168  -18.090 0.80 50.55  ? 402 77O B C9  1 
HETATM 5133 C  C11 . 77O H 5 .   ? 15.023  -3.797  -20.182 0.80 45.17  ? 402 77O B C11 1 
HETATM 5134 C  C12 . 77O H 5 .   ? 14.715  -2.496  -20.078 0.80 45.04  ? 402 77O B C12 1 
HETATM 5135 O  O13 . 77O H 5 .   ? 14.934  -2.121  -18.809 0.80 49.69  ? 402 77O B O13 1 
HETATM 5136 N  N14 . 77O H 5 .   ? 18.023  -5.467  -14.851 0.80 72.39  ? 402 77O B N14 1 
HETATM 5137 C  C1  . PGE I 6 .   ? 31.656  8.651   -37.159 1.00 67.68  ? 403 PGE B C1  1 
HETATM 5138 O  O1  . PGE I 6 .   ? 32.154  8.606   -35.816 1.00 67.63  ? 403 PGE B O1  1 
HETATM 5139 C  C2  . PGE I 6 .   ? 30.259  9.276   -37.203 1.00 68.40  ? 403 PGE B C2  1 
HETATM 5140 O  O2  . PGE I 6 .   ? 30.170  10.438  -36.374 1.00 68.27  ? 403 PGE B O2  1 
HETATM 5141 C  C3  . PGE I 6 .   ? 29.911  11.636  -37.110 1.00 65.47  ? 403 PGE B C3  1 
HETATM 5142 C  C4  . PGE I 6 .   ? 28.713  12.369  -36.514 1.00 62.77  ? 403 PGE B C4  1 
HETATM 5143 O  O4  . PGE I 6 .   ? 29.527  13.851  -32.433 1.00 55.83  ? 403 PGE B O4  1 
HETATM 5144 C  C6  . PGE I 6 .   ? 29.057  14.584  -33.573 1.00 62.08  ? 403 PGE B C6  1 
HETATM 5145 C  C5  . PGE I 6 .   ? 28.321  13.670  -34.552 1.00 59.13  ? 403 PGE B C5  1 
HETATM 5146 O  O3  . PGE I 6 .   ? 29.118  13.487  -35.725 1.00 64.70  ? 403 PGE B O3  1 
HETATM 5147 O  O   . HOH J 7 .   ? -16.320 -34.028 -34.400 1.00 41.38  ? 501 HOH A O   1 
HETATM 5148 O  O   . HOH J 7 .   ? -13.260 -28.457 -43.666 1.00 39.64  ? 502 HOH A O   1 
HETATM 5149 O  O   . HOH J 7 .   ? -11.950 -32.016 -44.659 1.00 48.15  ? 503 HOH A O   1 
HETATM 5150 O  O   . HOH J 7 .   ? -28.822 -30.894 -58.835 1.00 54.73  ? 504 HOH A O   1 
HETATM 5151 O  O   . HOH J 7 .   ? -11.529 -11.284 -52.818 1.00 62.72  ? 505 HOH A O   1 
HETATM 5152 O  O   . HOH J 7 .   ? -11.418 -27.641 -33.821 1.00 57.58  ? 506 HOH A O   1 
HETATM 5153 O  O   . HOH J 7 .   ? 3.194   -15.815 -38.387 1.00 42.64  ? 507 HOH A O   1 
HETATM 5154 O  O   . HOH J 7 .   ? -29.594 -24.728 -51.209 1.00 39.78  ? 508 HOH A O   1 
HETATM 5155 O  O   . HOH J 7 .   ? -18.632 -32.515 -60.407 1.00 58.64  ? 509 HOH A O   1 
HETATM 5156 O  O   . HOH J 7 .   ? 10.337  -19.447 -21.278 1.00 48.17  ? 510 HOH A O   1 
HETATM 5157 O  O   . HOH J 7 .   ? -32.185 -20.266 -31.154 1.00 44.55  ? 511 HOH A O   1 
HETATM 5158 O  O   . HOH J 7 .   ? 1.492   -14.637 -45.455 1.00 50.61  ? 512 HOH A O   1 
HETATM 5159 O  O   . HOH J 7 .   ? -22.607 -10.306 -47.713 1.00 40.82  ? 513 HOH A O   1 
HETATM 5160 O  O   . HOH J 7 .   ? -3.594  -31.884 -43.498 1.00 54.71  ? 514 HOH A O   1 
HETATM 5161 O  O   . HOH J 7 .   ? -4.232  -25.346 -21.922 1.00 46.94  ? 515 HOH A O   1 
HETATM 5162 O  O   . HOH J 7 .   ? -29.597 -21.594 -49.071 1.00 35.25  ? 516 HOH A O   1 
HETATM 5163 O  O   . HOH J 7 .   ? -3.183  -21.026 -60.403 1.00 52.70  ? 517 HOH A O   1 
HETATM 5164 O  O   . HOH J 7 .   ? 10.312  -32.603 -50.768 1.00 58.52  ? 518 HOH A O   1 
HETATM 5165 O  O   . HOH J 7 .   ? 11.843  -33.708 -38.147 1.00 68.16  ? 519 HOH A O   1 
HETATM 5166 O  O   . HOH J 7 .   ? -27.579 -27.810 -53.222 1.00 38.04  ? 520 HOH A O   1 
HETATM 5167 O  O   . HOH J 7 .   ? -6.048  -27.928 -51.272 1.00 49.24  ? 521 HOH A O   1 
HETATM 5168 O  O   . HOH J 7 .   ? -36.984 -24.545 -37.773 1.00 56.45  ? 522 HOH A O   1 
HETATM 5169 O  O   . HOH J 7 .   ? -7.940  -25.898 -50.452 1.00 52.73  ? 523 HOH A O   1 
HETATM 5170 O  O   . HOH J 7 .   ? 8.202   -14.548 -34.617 1.00 53.74  ? 524 HOH A O   1 
HETATM 5171 O  O   . HOH J 7 .   ? -24.160 -30.938 -58.804 1.00 44.64  ? 525 HOH A O   1 
HETATM 5172 O  O   . HOH J 7 .   ? -27.601 -32.581 -42.717 1.00 58.06  ? 526 HOH A O   1 
HETATM 5173 O  O   . HOH J 7 .   ? -36.108 -21.854 -38.342 1.00 47.95  ? 527 HOH A O   1 
HETATM 5174 O  O   . HOH J 7 .   ? 18.333  -18.024 -41.606 1.00 63.58  ? 528 HOH A O   1 
HETATM 5175 O  O   . HOH J 7 .   ? -18.932 -20.642 -37.117 1.00 50.65  ? 529 HOH A O   1 
HETATM 5176 O  O   . HOH J 7 .   ? -14.994 -27.757 -55.674 1.00 44.95  ? 530 HOH A O   1 
HETATM 5177 O  O   . HOH J 7 .   ? -20.446 -36.906 -44.773 1.00 53.13  ? 531 HOH A O   1 
HETATM 5178 O  O   . HOH J 7 .   ? -3.268  -19.370 -29.265 1.00 51.31  ? 532 HOH A O   1 
HETATM 5179 O  O   . HOH J 7 .   ? -27.196 -14.147 -42.548 1.00 51.71  ? 533 HOH A O   1 
HETATM 5180 O  O   . HOH J 7 .   ? -11.453 -26.544 -49.541 1.00 42.09  ? 534 HOH A O   1 
HETATM 5181 O  O   . HOH J 7 .   ? -14.304 -9.268  -32.309 1.00 61.03  ? 535 HOH A O   1 
HETATM 5182 O  O   . HOH J 7 .   ? 14.223  -23.093 -20.651 1.00 53.62  ? 536 HOH A O   1 
HETATM 5183 O  O   . HOH J 7 .   ? 2.553   -17.712 -30.026 1.00 41.50  ? 537 HOH A O   1 
HETATM 5184 O  O   . HOH J 7 .   ? -7.147  -18.923 -40.987 1.00 41.00  ? 538 HOH A O   1 
HETATM 5185 O  O   . HOH J 7 .   ? -31.868 -27.483 -39.577 1.00 44.64  ? 539 HOH A O   1 
HETATM 5186 O  O   . HOH J 7 .   ? -26.714 -23.548 -32.393 1.00 41.19  ? 540 HOH A O   1 
HETATM 5187 O  O   . HOH J 7 .   ? -33.655 -20.197 -47.455 1.00 52.46  ? 541 HOH A O   1 
HETATM 5188 O  O   . HOH J 7 .   ? -28.353 -14.987 -39.753 1.00 50.54  ? 542 HOH A O   1 
HETATM 5189 O  O   . HOH J 7 .   ? -5.277  -32.737 -45.736 1.00 55.84  ? 543 HOH A O   1 
HETATM 5190 O  O   . HOH J 7 .   ? -13.429 -29.633 -50.845 1.00 44.06  ? 544 HOH A O   1 
HETATM 5191 O  O   . HOH J 7 .   ? -4.808  -16.544 -19.080 1.00 51.52  ? 545 HOH A O   1 
HETATM 5192 O  O   . HOH J 7 .   ? -0.894  -22.335 -61.041 1.00 51.86  ? 546 HOH A O   1 
HETATM 5193 O  O   . HOH J 7 .   ? -21.734 -22.701 -59.823 1.00 51.14  ? 547 HOH A O   1 
HETATM 5194 O  O   . HOH J 7 .   ? -27.055 -26.633 -30.412 1.00 50.62  ? 548 HOH A O   1 
HETATM 5195 O  O   . HOH J 7 .   ? 14.003  -18.162 -40.224 1.00 52.69  ? 549 HOH A O   1 
HETATM 5196 O  O   . HOH J 7 .   ? -9.542  -33.511 -41.783 1.00 49.72  ? 550 HOH A O   1 
HETATM 5197 O  O   . HOH J 7 .   ? -18.726 -14.347 -55.142 1.00 59.49  ? 551 HOH A O   1 
HETATM 5198 O  O   . HOH J 7 .   ? 2.685   -38.508 -32.600 1.00 61.06  ? 552 HOH A O   1 
HETATM 5199 O  O   . HOH J 7 .   ? -21.215 -16.168 -32.429 1.00 53.65  ? 553 HOH A O   1 
HETATM 5200 O  O   . HOH J 7 .   ? 10.990  -11.004 -35.457 1.00 57.89  ? 554 HOH A O   1 
HETATM 5201 O  O   . HOH J 7 .   ? -25.320 -10.029 -51.132 1.00 48.83  ? 555 HOH A O   1 
HETATM 5202 O  O   . HOH J 7 .   ? -6.702  -8.247  -35.760 1.00 39.34  ? 556 HOH A O   1 
HETATM 5203 O  O   . HOH J 7 .   ? -34.795 -17.570 -48.757 1.00 58.33  ? 557 HOH A O   1 
HETATM 5204 O  O   . HOH J 7 .   ? -24.226 -36.520 -43.801 1.00 53.00  ? 558 HOH A O   1 
HETATM 5205 O  O   . HOH J 7 .   ? -11.308 -32.293 -39.715 1.00 64.49  ? 559 HOH A O   1 
HETATM 5206 O  O   . HOH J 7 .   ? -20.278 -34.399 -62.030 1.00 66.32  ? 560 HOH A O   1 
HETATM 5207 O  O   . HOH J 7 .   ? -13.277 -24.589 -60.682 1.00 49.87  ? 561 HOH A O   1 
HETATM 5208 O  O   . HOH J 7 .   ? -27.012 -35.110 -39.521 1.00 53.26  ? 562 HOH A O   1 
HETATM 5209 O  O   . HOH J 7 .   ? -20.860 -12.213 -57.937 1.00 56.74  ? 563 HOH A O   1 
HETATM 5210 O  O   . HOH J 7 .   ? -24.628 -27.509 -28.487 1.00 52.60  ? 564 HOH A O   1 
HETATM 5211 O  O   . HOH J 7 .   ? -28.851 -24.243 -30.417 1.00 42.65  ? 565 HOH A O   1 
HETATM 5212 O  O   . HOH J 7 .   ? 8.882   -40.050 -25.514 1.00 64.16  ? 566 HOH A O   1 
HETATM 5213 O  O   . HOH J 7 .   ? 1.449   -27.528 -67.457 1.00 60.09  ? 567 HOH A O   1 
HETATM 5214 O  O   . HOH J 7 .   ? -13.427 -33.816 -41.485 1.00 41.55  ? 568 HOH A O   1 
HETATM 5215 O  O   . HOH J 7 .   ? 6.066   -38.989 -25.677 1.00 60.73  ? 569 HOH A O   1 
HETATM 5216 O  O   . HOH J 7 .   ? -11.376 -32.855 -27.771 1.00 54.16  ? 570 HOH A O   1 
HETATM 5217 O  O   . HOH J 7 .   ? -18.336 -34.112 -55.935 1.00 60.59  ? 571 HOH A O   1 
HETATM 5218 O  O   . HOH J 7 .   ? 16.920  -26.696 -27.214 1.00 59.27  ? 572 HOH A O   1 
HETATM 5219 O  O   . HOH J 7 .   ? 16.507  -28.095 -19.107 1.00 55.68  ? 573 HOH A O   1 
HETATM 5220 O  O   . HOH J 7 .   ? -11.497 -8.963  -33.064 1.00 46.25  ? 574 HOH A O   1 
HETATM 5221 O  O   . HOH J 7 .   ? 9.927   -14.231 -32.559 1.00 46.13  ? 575 HOH A O   1 
HETATM 5222 O  O   . HOH J 7 .   ? -25.369 -10.248 -48.212 1.00 44.48  ? 576 HOH A O   1 
HETATM 5223 O  O   . HOH K 7 .   ? 31.738  1.142   -31.321 1.00 69.18  ? 501 HOH B O   1 
HETATM 5224 O  O   . HOH K 7 .   ? 11.089  -1.361  -33.834 1.00 45.21  ? 502 HOH B O   1 
HETATM 5225 O  O   . HOH K 7 .   ? 8.677   -13.919 -20.057 1.00 60.37  ? 503 HOH B O   1 
HETATM 5226 O  O   . HOH K 7 .   ? 8.330   2.733   -28.237 1.00 39.28  ? 504 HOH B O   1 
HETATM 5227 O  O   . HOH K 7 .   ? 12.123  6.709   -40.781 1.00 54.39  ? 505 HOH B O   1 
HETATM 5228 O  O   . HOH K 7 .   ? 12.688  -1.357  -9.622  1.00 64.58  ? 506 HOH B O   1 
HETATM 5229 O  O   . HOH K 7 .   ? 20.024  9.199   -13.732 1.00 44.33  ? 507 HOH B O   1 
HETATM 5230 O  O   . HOH K 7 .   ? 10.707  13.971  -32.631 1.00 49.30  ? 508 HOH B O   1 
HETATM 5231 O  O   . HOH K 7 .   ? 8.849   1.816   -16.609 1.00 43.81  ? 509 HOH B O   1 
HETATM 5232 O  O   . HOH K 7 .   ? 21.649  17.715  -32.130 1.00 40.55  ? 510 HOH B O   1 
HETATM 5233 O  O   . HOH K 7 .   ? 19.762  19.079  -27.056 1.00 47.74  ? 511 HOH B O   1 
HETATM 5234 O  O   . HOH K 7 .   ? 26.299  -3.936  -30.169 1.00 55.90  ? 512 HOH B O   1 
HETATM 5235 O  O   . HOH K 7 .   ? 12.681  -12.555 -29.474 1.00 44.55  ? 513 HOH B O   1 
HETATM 5236 O  O   . HOH K 7 .   ? 19.296  22.713  -30.862 1.00 62.81  ? 514 HOH B O   1 
HETATM 5237 O  O   . HOH K 7 .   ? 5.628   5.645   -20.769 1.00 63.52  ? 515 HOH B O   1 
HETATM 5238 O  O   . HOH K 7 .   ? 21.747  0.200   -18.774 1.00 45.98  ? 516 HOH B O   1 
HETATM 5239 O  O   . HOH K 7 .   ? 29.348  5.680   -34.544 1.00 48.80  ? 517 HOH B O   1 
HETATM 5240 O  O   . HOH K 7 .   ? 21.770  -7.586  -47.744 1.00 62.54  ? 518 HOH B O   1 
HETATM 5241 O  O   . HOH K 7 .   ? 12.157  -5.019  -12.755 1.00 58.89  ? 519 HOH B O   1 
HETATM 5242 O  O   . HOH K 7 .   ? 3.429   7.552   -27.741 1.00 44.41  ? 520 HOH B O   1 
HETATM 5243 O  O   . HOH K 7 .   ? 31.231  11.754  -33.956 1.00 53.92  ? 521 HOH B O   1 
HETATM 5244 O  O   . HOH K 7 .   ? 20.295  14.709  -12.901 1.00 57.43  ? 522 HOH B O   1 
HETATM 5245 O  O   . HOH K 7 .   ? 5.346   -9.791  -26.860 1.00 44.18  ? 523 HOH B O   1 
HETATM 5246 O  O   . HOH K 7 .   ? 31.827  -2.034  -37.753 1.00 51.30  ? 524 HOH B O   1 
HETATM 5247 O  O   . HOH K 7 .   ? -0.185  15.387  -17.193 1.00 50.44  ? 525 HOH B O   1 
HETATM 5248 O  O   . HOH K 7 .   ? 30.796  -8.817  -25.651 1.00 52.55  ? 526 HOH B O   1 
HETATM 5249 O  O   . HOH K 7 .   ? 4.315   2.308   -26.755 1.00 58.63  ? 527 HOH B O   1 
HETATM 5250 O  O   . HOH K 7 .   ? 23.127  16.992  -27.990 1.00 43.89  ? 528 HOH B O   1 
HETATM 5251 O  O   . HOH K 7 .   ? 15.787  -4.431  -24.422 1.00 48.06  ? 529 HOH B O   1 
HETATM 5252 O  O   . HOH K 7 .   ? 15.820  3.168   -14.669 1.00 44.34  ? 530 HOH B O   1 
HETATM 5253 O  O   . HOH K 7 .   ? 17.043  -23.902 -26.670 1.00 62.37  ? 531 HOH B O   1 
HETATM 5254 O  O   . HOH K 7 .   ? 27.796  -6.222  -27.594 1.00 51.74  ? 532 HOH B O   1 
HETATM 5255 O  O   . HOH K 7 .   ? -0.334  12.602  -4.228  1.00 60.16  ? 533 HOH B O   1 
HETATM 5256 O  O   . HOH K 7 .   ? 5.110   -8.898  -24.044 1.00 48.54  ? 534 HOH B O   1 
HETATM 5257 O  O   . HOH K 7 .   ? 19.018  18.491  -32.924 1.00 51.68  ? 535 HOH B O   1 
HETATM 5258 O  O   . HOH K 7 .   ? 11.886  21.248  -20.869 1.00 48.23  ? 536 HOH B O   1 
HETATM 5259 O  O   . HOH K 7 .   ? 6.387   16.095  -27.242 1.00 45.24  ? 537 HOH B O   1 
HETATM 5260 O  O   . HOH K 7 .   ? -2.570  13.847  -17.911 1.00 47.74  ? 538 HOH B O   1 
HETATM 5261 O  O   . HOH K 7 .   ? -0.612  -0.165  -26.878 1.00 57.04  ? 539 HOH B O   1 
HETATM 5262 O  O   . HOH K 7 .   ? 13.088  12.332  -40.480 1.00 49.50  ? 540 HOH B O   1 
HETATM 5263 O  O   . HOH K 7 .   ? 15.375  -18.709 -21.775 1.00 65.93  ? 541 HOH B O   1 
HETATM 5264 O  O   . HOH K 7 .   ? 39.614  -16.717 -28.711 1.00 56.58  ? 542 HOH B O   1 
HETATM 5265 O  O   . HOH K 7 .   ? 11.783  -12.142 -32.926 1.00 50.84  ? 543 HOH B O   1 
HETATM 5266 O  O   . HOH K 7 .   ? 19.311  -26.409 -28.887 1.00 59.34  ? 544 HOH B O   1 
HETATM 5267 O  O   . HOH K 7 .   ? 11.221  9.197   -40.139 1.00 50.31  ? 545 HOH B O   1 
HETATM 5268 O  O   . HOH K 7 .   ? 26.088  19.469  -20.477 1.00 68.08  ? 546 HOH B O   1 
HETATM 5269 O  O   . HOH K 7 .   ? 20.020  -0.105  -16.425 1.00 54.50  ? 547 HOH B O   1 
HETATM 5270 O  O   . HOH K 7 .   ? 9.181   6.305   -8.135  1.00 64.40  ? 548 HOH B O   1 
HETATM 5271 O  O   . HOH K 7 .   ? 14.911  2.392   -2.784  1.00 53.19  ? 549 HOH B O   1 
HETATM 5272 O  O   . HOH K 7 .   ? 4.686   4.532   -17.389 1.00 48.45  ? 550 HOH B O   1 
HETATM 5273 O  O   . HOH K 7 .   ? 28.819  0.962   -19.789 1.00 62.04  ? 551 HOH B O   1 
HETATM 5274 O  O   . HOH K 7 .   ? 27.950  -15.289 -40.561 1.00 49.32  ? 552 HOH B O   1 
HETATM 5275 O  O   . HOH K 7 .   ? 33.881  12.643  -30.117 1.00 58.82  ? 553 HOH B O   1 
HETATM 5276 O  O   . HOH K 7 .   ? 14.051  6.513   -6.451  1.00 54.64  ? 554 HOH B O   1 
HETATM 5277 O  O   . HOH K 7 .   ? 29.376  -17.003 -38.741 1.00 65.56  ? 555 HOH B O   1 
HETATM 5278 O  O   . HOH K 7 .   ? 8.086   1.817   -1.956  1.00 50.87  ? 556 HOH B O   1 
HETATM 5279 O  O   . HOH K 7 .   ? 0.567   16.920  -23.771 1.00 56.39  ? 557 HOH B O   1 
HETATM 5280 O  O   . HOH K 7 .   ? -0.952  -2.719  -28.341 1.00 61.95  ? 558 HOH B O   1 
HETATM 5281 O  O   . HOH K 7 .   ? 29.804  2.115   -37.091 1.00 51.58  ? 559 HOH B O   1 
HETATM 5282 O  O   . HOH K 7 .   ? 30.234  -20.514 -5.798  1.00 58.05  ? 560 HOH B O   1 
HETATM 5283 O  O   . HOH K 7 .   ? 27.600  5.862   -46.006 1.00 50.63  ? 561 HOH B O   1 
HETATM 5284 O  O   . HOH K 7 .   ? 14.110  -2.943  -12.087 1.00 72.65  ? 562 HOH B O   1 
HETATM 5285 O  O   . HOH K 7 .   ? 27.715  -20.011 -4.457  1.00 70.61  ? 563 HOH B O   1 
HETATM 5286 O  O   . HOH K 7 .   ? 20.237  -4.488  -17.314 1.00 50.88  ? 564 HOH B O   1 
HETATM 5287 O  O   . HOH K 7 .   ? 7.264   15.309  -30.045 1.00 54.53  ? 565 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . THR A 1   ? 1.1504 1.8388 1.0427 -0.0130 0.1941  -0.2835 2   THR A N   
2    C CA  . THR A 1   ? 1.1752 1.8830 1.0348 -0.0454 0.1983  -0.2443 2   THR A CA  
3    C C   . THR A 1   ? 1.1538 1.8163 1.0156 -0.0569 0.1922  -0.2031 2   THR A C   
4    O O   . THR A 1   ? 1.1224 1.7153 0.9933 -0.0452 0.1807  -0.1934 2   THR A O   
5    C CB  . THR A 1   ? 1.1870 1.8822 1.0160 -0.0550 0.1934  -0.2370 2   THR A CB  
6    O OG1 . THR A 1   ? 1.1441 1.8606 0.9442 -0.0865 0.1955  -0.1990 2   THR A OG1 
7    C CG2 . THR A 1   ? 1.2129 1.8225 1.0449 -0.0412 0.1780  -0.2293 2   THR A CG2 
8    N N   . LEU A 2   ? 1.1455 1.8509 1.0000 -0.0802 0.1995  -0.1804 3   LEU A N   
9    C CA  . LEU A 2   ? 1.1156 1.7868 0.9737 -0.0931 0.1937  -0.1431 3   LEU A CA  
10   C C   . LEU A 2   ? 1.1339 1.8307 0.9659 -0.1274 0.1940  -0.1050 3   LEU A C   
11   O O   . LEU A 2   ? 1.1555 1.9231 0.9738 -0.1442 0.2043  -0.1084 3   LEU A O   
12   C CB  . LEU A 2   ? 1.0795 1.7720 0.9671 -0.0845 0.1992  -0.1538 3   LEU A CB  
13   C CG  . LEU A 2   ? 1.0613 1.7393 0.9814 -0.0524 0.1982  -0.1899 3   LEU A CG  
14   C CD1 . LEU A 2   ? 1.0420 1.7610 0.9869 -0.0516 0.2055  -0.1961 3   LEU A CD1 
15   C CD2 . LEU A 2   ? 1.0317 1.6250 0.9606 -0.0359 0.1836  -0.1826 3   LEU A CD2 
16   N N   . GLY A 3   ? 1.1220 1.7627 0.9487 -0.1380 0.1817  -0.0692 4   GLY A N   
17   C CA  . GLY A 3   ? 1.0809 1.7335 0.8879 -0.1703 0.1770  -0.0288 4   GLY A CA  
18   C C   . GLY A 3   ? 1.0573 1.7174 0.8790 -0.1835 0.1765  -0.0074 4   GLY A C   
19   O O   . GLY A 3   ? 1.0257 1.7224 0.8665 -0.1758 0.1866  -0.0265 4   GLY A O   
20   N N   . ASN A 4   ? 1.0581 1.6831 0.8729 -0.2030 0.1634  0.0313  5   ASN A N   
21   C CA  . ASN A 4   ? 1.0488 1.6749 0.8777 -0.2178 0.1597  0.0548  5   ASN A CA  
22   C C   . ASN A 4   ? 1.0041 1.5537 0.8426 -0.2157 0.1424  0.0782  5   ASN A C   
23   O O   . ASN A 4   ? 1.0005 1.5432 0.8536 -0.2248 0.1377  0.0946  5   ASN A O   
24   C CB  . ASN A 4   ? 1.0979 1.7857 0.9115 -0.2535 0.1619  0.0815  5   ASN A CB  
25   C CG  . ASN A 4   ? 1.1402 1.8798 0.9710 -0.2625 0.1716  0.0801  5   ASN A CG  
26   O OD1 . ASN A 4   ? 1.1697 1.9872 0.9941 -0.2748 0.1854  0.0707  5   ASN A OD1 
27   N ND2 . ASN A 4   ? 1.1226 1.8229 0.9758 -0.2567 0.1646  0.0882  5   ASN A ND2 
28   N N   . THR A 5   ? 0.9685 1.4638 0.7998 -0.2035 0.1331  0.0777  6   THR A N   
29   C CA  . THR A 5   ? 0.9574 1.3819 0.7983 -0.1976 0.1175  0.0934  6   THR A CA  
30   C C   . THR A 5   ? 0.9431 1.3406 0.8080 -0.1744 0.1199  0.0742  6   THR A C   
31   O O   . THR A 5   ? 0.9498 1.3591 0.8218 -0.1538 0.1301  0.0443  6   THR A O   
32   C CB  . THR A 5   ? 0.9570 1.3385 0.7848 -0.1887 0.1089  0.0931  6   THR A CB  
33   O OG1 . THR A 5   ? 0.9777 1.3856 0.7826 -0.2104 0.1057  0.1111  6   THR A OG1 
34   C CG2 . THR A 5   ? 0.9333 1.2471 0.7716 -0.1829 0.0927  0.1077  6   THR A CG2 
35   N N   . THR A 6   ? 0.9250 1.2878 0.8032 -0.1788 0.1091  0.0920  7   THR A N   
36   C CA  . THR A 6   ? 0.8603 1.1824 0.7576 -0.1578 0.1064  0.0792  7   THR A CA  
37   C C   . THR A 6   ? 0.8659 1.1281 0.7618 -0.1564 0.0906  0.0941  7   THR A C   
38   O O   . THR A 6   ? 0.8922 1.1470 0.7793 -0.1748 0.0800  0.1184  7   THR A O   
39   C CB  . THR A 6   ? 0.8435 1.1834 0.7598 -0.1630 0.1084  0.0825  7   THR A CB  
40   O OG1 . THR A 6   ? 0.8313 1.1471 0.7642 -0.1396 0.1100  0.0622  7   THR A OG1 
41   C CG2 . THR A 6   ? 0.8744 1.1928 0.7955 -0.1834 0.0937  0.1132  7   THR A CG2 
42   N N   . SER A 7   ? 0.8408 1.0626 0.7459 -0.1351 0.0881  0.0798  8   SER A N   
43   C CA  . SER A 7   ? 0.8274 0.9977 0.7325 -0.1317 0.0744  0.0894  8   SER A CA  
44   C C   . SER A 7   ? 0.7981 0.9331 0.7189 -0.1145 0.0710  0.0787  8   SER A C   
45   O O   . SER A 7   ? 0.8157 0.9518 0.7408 -0.0974 0.0787  0.0585  8   SER A O   
46   C CB  . SER A 7   ? 0.8325 0.9924 0.7217 -0.1261 0.0741  0.0844  8   SER A CB  
47   O OG  . SER A 7   ? 0.8841 0.9979 0.7762 -0.1213 0.0614  0.0913  8   SER A OG  
48   N N   . SER A 8   ? 0.7752 0.8792 0.7050 -0.1194 0.0580  0.0920  9   SER A N   
49   C CA  . SER A 8   ? 0.7458 0.8207 0.6896 -0.1053 0.0542  0.0823  9   SER A CA  
50   C C   . SER A 8   ? 0.7295 0.7649 0.6720 -0.0955 0.0453  0.0799  9   SER A C   
51   O O   . SER A 8   ? 0.7579 0.7799 0.6954 -0.1034 0.0360  0.0922  9   SER A O   
52   C CB  . SER A 8   ? 0.7526 0.8267 0.7116 -0.1153 0.0471  0.0928  9   SER A CB  
53   O OG  . SER A 8   ? 0.8001 0.8467 0.7640 -0.1251 0.0310  0.1088  9   SER A OG  
54   N N   . VAL A 9   ? 0.6917 0.7114 0.6393 -0.0789 0.0478  0.0643  10  VAL A N   
55   C CA  . VAL A 9   ? 0.6961 0.6835 0.6455 -0.0694 0.0403  0.0598  10  VAL A CA  
56   C C   . VAL A 9   ? 0.6764 0.6493 0.6409 -0.0659 0.0340  0.0568  10  VAL A C   
57   O O   . VAL A 9   ? 0.6519 0.6348 0.6219 -0.0606 0.0396  0.0488  10  VAL A O   
58   C CB  . VAL A 9   ? 0.6919 0.6755 0.6334 -0.0549 0.0474  0.0451  10  VAL A CB  
59   C CG1 . VAL A 9   ? 0.6909 0.6476 0.6332 -0.0479 0.0402  0.0422  10  VAL A CG1 
60   C CG2 . VAL A 9   ? 0.7068 0.7086 0.6346 -0.0576 0.0542  0.0444  10  VAL A CG2 
61   N N   . ILE A 10  ? 0.6777 0.6283 0.6501 -0.0688 0.0212  0.0623  11  ILE A N   
62   C CA  . ILE A 10  ? 0.6702 0.6071 0.6576 -0.0653 0.0136  0.0569  11  ILE A CA  
63   C C   . ILE A 10  ? 0.6384 0.5661 0.6243 -0.0500 0.0169  0.0408  11  ILE A C   
64   O O   . ILE A 10  ? 0.6461 0.5645 0.6260 -0.0444 0.0164  0.0373  11  ILE A O   
65   C CB  . ILE A 10  ? 0.7044 0.6205 0.7043 -0.0731 -0.0035 0.0663  11  ILE A CB  
66   C CG1 . ILE A 10  ? 0.7424 0.6675 0.7423 -0.0918 -0.0091 0.0871  11  ILE A CG1 
67   C CG2 . ILE A 10  ? 0.6980 0.6015 0.7147 -0.0688 -0.0122 0.0572  11  ILE A CG2 
68   C CD1 . ILE A 10  ? 0.7532 0.7014 0.7564 -0.1019 -0.0038 0.0933  11  ILE A CD1 
69   N N   . LEU A 11  ? 0.5968 0.5296 0.5881 -0.0446 0.0198  0.0321  12  LEU A N   
70   C CA  . LEU A 11  ? 0.5925 0.5207 0.5818 -0.0329 0.0221  0.0191  12  LEU A CA  
71   C C   . LEU A 11  ? 0.5906 0.5099 0.5912 -0.0300 0.0135  0.0106  12  LEU A C   
72   O O   . LEU A 11  ? 0.5980 0.5172 0.6096 -0.0350 0.0076  0.0121  12  LEU A O   
73   C CB  . LEU A 11  ? 0.5708 0.5132 0.5550 -0.0275 0.0317  0.0144  12  LEU A CB  
74   C CG  . LEU A 11  ? 0.5688 0.5236 0.5445 -0.0271 0.0405  0.0166  12  LEU A CG  
75   C CD1 . LEU A 11  ? 0.5522 0.5181 0.5304 -0.0206 0.0454  0.0104  12  LEU A CD1 
76   C CD2 . LEU A 11  ? 0.5567 0.5038 0.5215 -0.0237 0.0422  0.0156  12  LEU A CD2 
77   N N   . THR A 12  ? 0.6017 0.5160 0.6001 -0.0221 0.0128  0.0008  13  THR A N   
78   C CA  . THR A 12  ? 0.6101 0.5226 0.6176 -0.0176 0.0065  -0.0116 13  THR A CA  
79   C C   . THR A 12  ? 0.5966 0.5233 0.5976 -0.0135 0.0132  -0.0177 13  THR A C   
80   O O   . THR A 12  ? 0.5680 0.5002 0.5577 -0.0106 0.0206  -0.0160 13  THR A O   
81   C CB  . THR A 12  ? 0.6175 0.5224 0.6274 -0.0121 0.0018  -0.0196 13  THR A CB  
82   O OG1 . THR A 12  ? 0.6260 0.5161 0.6441 -0.0165 -0.0071 -0.0119 13  THR A OG1 
83   C CG2 . THR A 12  ? 0.6049 0.5142 0.6246 -0.0062 -0.0036 -0.0367 13  THR A CG2 
84   N N   . ASN A 13  ? 0.5994 0.5312 0.6084 -0.0143 0.0091  -0.0237 14  ASN A N   
85   C CA  . ASN A 13  ? 0.6009 0.5469 0.6048 -0.0118 0.0127  -0.0286 14  ASN A CA  
86   C C   . ASN A 13  ? 0.6251 0.5780 0.6288 -0.0074 0.0099  -0.0426 14  ASN A C   
87   O O   . ASN A 13  ? 0.6449 0.5972 0.6596 -0.0066 0.0022  -0.0539 14  ASN A O   
88   C CB  . ASN A 13  ? 0.5789 0.5305 0.5912 -0.0159 0.0097  -0.0272 14  ASN A CB  
89   C CG  . ASN A 13  ? 0.5740 0.5406 0.5813 -0.0141 0.0117  -0.0306 14  ASN A CG  
90   O OD1 . ASN A 13  ? 0.5752 0.5492 0.5732 -0.0111 0.0138  -0.0346 14  ASN A OD1 
91   N ND2 . ASN A 13  ? 0.5589 0.5317 0.5728 -0.0174 0.0101  -0.0274 14  ASN A ND2 
92   N N   . TYR A 14  ? 0.6353 0.5964 0.6272 -0.0050 0.0155  -0.0426 15  TYR A N   
93   C CA  . TYR A 14  ? 0.6501 0.6264 0.6393 -0.0026 0.0148  -0.0549 15  TYR A CA  
94   C C   . TYR A 14  ? 0.6121 0.6062 0.5936 -0.0053 0.0163  -0.0540 15  TYR A C   
95   O O   . TYR A 14  ? 0.6148 0.6109 0.5868 -0.0072 0.0201  -0.0426 15  TYR A O   
96   C CB  . TYR A 14  ? 0.6526 0.6302 0.6343 -0.0007 0.0189  -0.0540 15  TYR A CB  
97   C CG  . TYR A 14  ? 0.6661 0.6671 0.6426 -0.0003 0.0202  -0.0645 15  TYR A CG  
98   C CD1 . TYR A 14  ? 0.6610 0.6743 0.6473 0.0031  0.0158  -0.0834 15  TYR A CD1 
99   C CD2 . TYR A 14  ? 0.6896 0.7023 0.6524 -0.0041 0.0250  -0.0559 15  TYR A CD2 
100  C CE1 . TYR A 14  ? 0.6898 0.7320 0.6710 0.0027  0.0182  -0.0945 15  TYR A CE1 
101  C CE2 . TYR A 14  ? 0.6898 0.7290 0.6468 -0.0065 0.0264  -0.0633 15  TYR A CE2 
102  C CZ  . TYR A 14  ? 0.6939 0.7504 0.6592 -0.0032 0.0240  -0.0832 15  TYR A CZ  
103  O OH  . TYR A 14  ? 0.7155 0.8055 0.6747 -0.0063 0.0265  -0.0922 15  TYR A OH  
104  N N   . MET A 15  ? 0.6163 0.6222 0.6035 -0.0056 0.0115  -0.0660 16  MET A N   
105  C CA  A MET A 15  ? 0.6229 0.6504 0.6026 -0.0090 0.0111  -0.0675 16  MET A CA  
106  C CA  B MET A 15  ? 0.6261 0.6543 0.6048 -0.0090 0.0115  -0.0672 16  MET A CA  
107  C C   . MET A 15  ? 0.6251 0.6506 0.5994 -0.0124 0.0123  -0.0512 16  MET A C   
108  O O   . MET A 15  ? 0.6555 0.6967 0.6207 -0.0162 0.0117  -0.0464 16  MET A O   
109  C CB  A MET A 15  ? 0.6258 0.6771 0.5951 -0.0102 0.0137  -0.0745 16  MET A CB  
110  C CB  B MET A 15  ? 0.6349 0.6830 0.6020 -0.0102 0.0152  -0.0705 16  MET A CB  
111  C CG  A MET A 15  ? 0.6447 0.7154 0.6205 -0.0079 0.0100  -0.0972 16  MET A CG  
112  C CG  B MET A 15  ? 0.6590 0.7371 0.6152 -0.0160 0.0147  -0.0726 16  MET A CG  
113  S SD  A MET A 15  ? 0.6580 0.7587 0.6256 -0.0080 0.0147  -0.1083 16  MET A SD  
114  S SD  B MET A 15  ? 0.6626 0.7601 0.6036 -0.0215 0.0196  -0.0650 16  MET A SD  
115  C CE  A MET A 15  ? 0.6412 0.7436 0.5900 -0.0165 0.0200  -0.0820 16  MET A CE  
116  C CE  B MET A 15  ? 0.6766 0.7990 0.6233 -0.0174 0.0210  -0.0913 16  MET A CE  
117  N N   . ASP A 16  ? 0.6104 0.6182 0.5920 -0.0114 0.0130  -0.0429 17  ASP A N   
118  C CA  . ASP A 16  ? 0.5937 0.5997 0.5751 -0.0124 0.0140  -0.0302 17  ASP A CA  
119  C C   . ASP A 16  ? 0.5977 0.6019 0.5700 -0.0117 0.0168  -0.0197 17  ASP A C   
120  O O   . ASP A 16  ? 0.5892 0.5928 0.5639 -0.0112 0.0155  -0.0112 17  ASP A O   
121  C CB  . ASP A 16  ? 0.5952 0.6147 0.5793 -0.0153 0.0089  -0.0312 17  ASP A CB  
122  C CG  . ASP A 16  ? 0.6028 0.6176 0.6005 -0.0163 0.0063  -0.0328 17  ASP A CG  
123  O OD1 . ASP A 16  ? 0.5979 0.6001 0.6030 -0.0161 0.0071  -0.0342 17  ASP A OD1 
124  O OD2 . ASP A 16  ? 0.6381 0.6629 0.6394 -0.0184 0.0023  -0.0313 17  ASP A OD2 
125  N N   . THR A 17  ? 0.5656 0.5692 0.5301 -0.0115 0.0193  -0.0210 18  THR A N   
126  C CA  . THR A 17  ? 0.5770 0.5780 0.5337 -0.0122 0.0201  -0.0111 18  THR A CA  
127  C C   . THR A 17  ? 0.5862 0.5719 0.5424 -0.0090 0.0245  -0.0096 18  THR A C   
128  O O   . THR A 17  ? 0.5800 0.5580 0.5341 -0.0080 0.0245  -0.0019 18  THR A O   
129  C CB  . THR A 17  ? 0.5794 0.5983 0.5254 -0.0177 0.0183  -0.0106 18  THR A CB  
130  O OG1 . THR A 17  ? 0.5926 0.6200 0.5375 -0.0171 0.0211  -0.0232 18  THR A OG1 
131  C CG2 . THR A 17  ? 0.5767 0.6129 0.5203 -0.0226 0.0128  -0.0084 18  THR A CG2 
132  N N   . GLN A 18  ? 0.5888 0.5696 0.5481 -0.0073 0.0267  -0.0172 19  GLN A N   
133  C CA  . GLN A 18  ? 0.5816 0.5494 0.5396 -0.0052 0.0299  -0.0154 19  GLN A CA  
134  C C   . GLN A 18  ? 0.5788 0.5368 0.5447 -0.0043 0.0303  -0.0165 19  GLN A C   
135  O O   . GLN A 18  ? 0.5901 0.5483 0.5630 -0.0050 0.0270  -0.0230 19  GLN A O   
136  C CB  . GLN A 18  ? 0.5764 0.5489 0.5299 -0.0054 0.0304  -0.0209 19  GLN A CB  
137  C CG  . GLN A 18  ? 0.5634 0.5474 0.5077 -0.0091 0.0302  -0.0162 19  GLN A CG  
138  C CD  . GLN A 18  ? 0.5649 0.5607 0.5063 -0.0101 0.0314  -0.0231 19  GLN A CD  
139  O OE1 . GLN A 18  ? 0.5927 0.5800 0.5374 -0.0069 0.0327  -0.0271 19  GLN A OE1 
140  N NE2 . GLN A 18  ? 0.5576 0.5758 0.4932 -0.0152 0.0307  -0.0243 19  GLN A NE2 
141  N N   . TYR A 19  ? 0.5629 0.5139 0.5284 -0.0036 0.0334  -0.0103 20  TYR A N   
142  C CA  . TYR A 19  ? 0.5643 0.5105 0.5353 -0.0056 0.0343  -0.0081 20  TYR A CA  
143  C C   . TYR A 19  ? 0.5819 0.5203 0.5470 -0.0053 0.0369  -0.0053 20  TYR A C   
144  O O   . TYR A 19  ? 0.6134 0.5517 0.5733 -0.0031 0.0403  -0.0033 20  TYR A O   
145  C CB  . TYR A 19  ? 0.5416 0.4949 0.5179 -0.0061 0.0364  -0.0047 20  TYR A CB  
146  C CG  . TYR A 19  ? 0.5427 0.5040 0.5263 -0.0073 0.0329  -0.0066 20  TYR A CG  
147  C CD1 . TYR A 19  ? 0.5466 0.5142 0.5287 -0.0051 0.0308  -0.0072 20  TYR A CD1 
148  C CD2 . TYR A 19  ? 0.5451 0.5079 0.5378 -0.0119 0.0301  -0.0065 20  TYR A CD2 
149  C CE1 . TYR A 19  ? 0.5597 0.5362 0.5478 -0.0067 0.0269  -0.0088 20  TYR A CE1 
150  C CE2 . TYR A 19  ? 0.5448 0.5153 0.5447 -0.0134 0.0262  -0.0090 20  TYR A CE2 
151  C CZ  . TYR A 19  ? 0.5637 0.5417 0.5607 -0.0104 0.0250  -0.0107 20  TYR A CZ  
152  O OH  . TYR A 19  ? 0.5814 0.5684 0.5848 -0.0123 0.0205  -0.0130 20  TYR A OH  
153  N N   . TYR A 20  ? 0.5771 0.5084 0.5444 -0.0074 0.0337  -0.0056 21  TYR A N   
154  C CA  . TYR A 20  ? 0.5759 0.5002 0.5372 -0.0076 0.0347  -0.0027 21  TYR A CA  
155  C C   . TYR A 20  ? 0.6149 0.5334 0.5799 -0.0131 0.0310  0.0033  21  TYR A C   
156  O O   . TYR A 20  ? 0.6467 0.5626 0.6215 -0.0164 0.0252  0.0040  21  TYR A O   
157  C CB  . TYR A 20  ? 0.5690 0.4911 0.5280 -0.0043 0.0328  -0.0083 21  TYR A CB  
158  C CG  . TYR A 20  ? 0.5762 0.4980 0.5450 -0.0032 0.0264  -0.0161 21  TYR A CG  
159  C CD1 . TYR A 20  ? 0.5851 0.4969 0.5619 -0.0039 0.0197  -0.0162 21  TYR A CD1 
160  C CD2 . TYR A 20  ? 0.5716 0.5042 0.5428 -0.0014 0.0258  -0.0243 21  TYR A CD2 
161  C CE1 . TYR A 20  ? 0.6036 0.5143 0.5933 -0.0010 0.0120  -0.0264 21  TYR A CE1 
162  C CE2 . TYR A 20  ? 0.5896 0.5251 0.5713 0.0008  0.0199  -0.0356 21  TYR A CE2 
163  C CZ  . TYR A 20  ? 0.6322 0.5558 0.6246 0.0019  0.0126  -0.0378 21  TYR A CZ  
164  O OH  . TYR A 20  ? 0.6724 0.5978 0.6792 0.0059  0.0047  -0.0519 21  TYR A OH  
165  N N   . GLY A 21  ? 0.6163 0.5330 0.5736 -0.0150 0.0332  0.0085  22  GLY A N   
166  C CA  . GLY A 21  ? 0.6314 0.5439 0.5899 -0.0222 0.0285  0.0173  22  GLY A CA  
167  C C   . GLY A 21  ? 0.6728 0.5767 0.6267 -0.0213 0.0250  0.0185  22  GLY A C   
168  O O   . GLY A 21  ? 0.6841 0.5866 0.6338 -0.0152 0.0274  0.0120  22  GLY A O   
169  N N   . GLU A 22  ? 0.7076 0.6065 0.6629 -0.0286 0.0183  0.0283  23  GLU A N   
170  C CA  . GLU A 22  ? 0.7230 0.6133 0.6757 -0.0289 0.0127  0.0314  23  GLU A CA  
171  C C   . GLU A 22  ? 0.7082 0.6081 0.6454 -0.0338 0.0187  0.0379  23  GLU A C   
172  O O   . GLU A 22  ? 0.7400 0.6517 0.6724 -0.0420 0.0217  0.0456  23  GLU A O   
173  C CB  . GLU A 22  ? 0.8058 0.6835 0.7713 -0.0346 -0.0015 0.0397  23  GLU A CB  
174  C CG  . GLU A 22  ? 0.9006 0.7652 0.8763 -0.0282 -0.0114 0.0340  23  GLU A CG  
175  C CD  . GLU A 22  ? 0.9774 0.8385 0.9689 -0.0194 -0.0151 0.0191  23  GLU A CD  
176  O OE1 . GLU A 22  ? 0.9962 0.8673 0.9830 -0.0126 -0.0057 0.0078  23  GLU A OE1 
177  O OE2 . GLU A 22  ? 1.0282 0.8774 1.0376 -0.0198 -0.0287 0.0185  23  GLU A OE2 
178  N N   . ILE A 23  ? 0.6609 0.5586 0.5904 -0.0293 0.0206  0.0336  24  ILE A N   
179  C CA  . ILE A 23  ? 0.6367 0.5416 0.5522 -0.0339 0.0233  0.0385  24  ILE A CA  
180  C C   . ILE A 23  ? 0.6504 0.5444 0.5668 -0.0340 0.0143  0.0420  24  ILE A C   
181  O O   . ILE A 23  ? 0.6576 0.5413 0.5848 -0.0274 0.0093  0.0361  24  ILE A O   
182  C CB  . ILE A 23  ? 0.6373 0.5514 0.5430 -0.0282 0.0338  0.0285  24  ILE A CB  
183  C CG1 . ILE A 23  ? 0.6145 0.5193 0.5230 -0.0195 0.0337  0.0197  24  ILE A CG1 
184  C CG2 . ILE A 23  ? 0.6308 0.5575 0.5381 -0.0275 0.0413  0.0247  24  ILE A CG2 
185  C CD1 . ILE A 23  ? 0.6039 0.5118 0.5032 -0.0161 0.0386  0.0130  24  ILE A CD1 
186  N N   . GLY A 24  ? 0.6544 0.5534 0.5599 -0.0417 0.0120  0.0510  25  GLY A N   
187  C CA  . GLY A 24  ? 0.6485 0.5384 0.5543 -0.0422 0.0027  0.0553  25  GLY A CA  
188  C C   . GLY A 24  ? 0.6764 0.5743 0.5668 -0.0412 0.0088  0.0505  25  GLY A C   
189  O O   . GLY A 24  ? 0.6993 0.6124 0.5760 -0.0467 0.0153  0.0519  25  GLY A O   
190  N N   . ILE A 25  ? 0.6615 0.5515 0.5553 -0.0342 0.0066  0.0437  26  ILE A N   
191  C CA  . ILE A 25  ? 0.6758 0.5707 0.5571 -0.0334 0.0100  0.0390  26  ILE A CA  
192  C C   . ILE A 25  ? 0.6836 0.5730 0.5653 -0.0365 -0.0007 0.0461  26  ILE A C   
193  O O   . ILE A 25  ? 0.6608 0.5402 0.5574 -0.0321 -0.0088 0.0458  26  ILE A O   
194  C CB  . ILE A 25  ? 0.6661 0.5587 0.5500 -0.0246 0.0165  0.0260  26  ILE A CB  
195  C CG1 . ILE A 25  ? 0.6521 0.5487 0.5377 -0.0215 0.0247  0.0203  26  ILE A CG1 
196  C CG2 . ILE A 25  ? 0.6509 0.5468 0.5233 -0.0247 0.0185  0.0210  26  ILE A CG2 
197  C CD1 . ILE A 25  ? 0.6170 0.5098 0.5087 -0.0147 0.0277  0.0119  26  ILE A CD1 
198  N N   . GLY A 26  ? 0.6666 0.5650 0.5327 -0.0437 -0.0013 0.0513  27  GLY A N   
199  C CA  . GLY A 26  ? 0.6553 0.5503 0.5195 -0.0469 -0.0116 0.0577  27  GLY A CA  
200  C C   . GLY A 26  ? 0.6869 0.5804 0.5518 -0.0572 -0.0243 0.0757  27  GLY A C   
201  O O   . GLY A 26  ? 0.7124 0.6073 0.5798 -0.0631 -0.0256 0.0845  27  GLY A O   
202  N N   . THR A 27  ? 0.6812 0.5719 0.5448 -0.0602 -0.0351 0.0823  28  THR A N   
203  C CA  . THR A 27  ? 0.7070 0.5930 0.5741 -0.0702 -0.0516 0.1017  28  THR A CA  
204  C C   . THR A 27  ? 0.7068 0.5760 0.5959 -0.0623 -0.0661 0.1011  28  THR A C   
205  O O   . THR A 27  ? 0.6993 0.5703 0.5865 -0.0580 -0.0664 0.0944  28  THR A O   
206  C CB  . THR A 27  ? 0.7228 0.6262 0.5659 -0.0836 -0.0531 0.1125  28  THR A CB  
207  O OG1 . THR A 27  ? 0.7409 0.6648 0.5659 -0.0875 -0.0373 0.1060  28  THR A OG1 
208  C CG2 . THR A 27  ? 0.7039 0.6048 0.5485 -0.0980 -0.0708 0.1374  28  THR A CG2 
209  N N   . PRO A 28  ? 0.7078 0.5619 0.6197 -0.0597 -0.0784 0.1061  29  PRO A N   
210  C CA  . PRO A 28  ? 0.6983 0.5486 0.6154 -0.0641 -0.0785 0.1123  29  PRO A CA  
211  C C   . PRO A 28  ? 0.6686 0.5234 0.5864 -0.0549 -0.0610 0.0947  29  PRO A C   
212  O O   . PRO A 28  ? 0.6419 0.5000 0.5595 -0.0449 -0.0516 0.0790  29  PRO A O   
213  C CB  . PRO A 28  ? 0.6998 0.5295 0.6465 -0.0601 -0.0992 0.1171  29  PRO A CB  
214  C CG  . PRO A 28  ? 0.7081 0.5347 0.6690 -0.0464 -0.1015 0.1019  29  PRO A CG  
215  C CD  . PRO A 28  ? 0.7163 0.5565 0.6542 -0.0505 -0.0937 0.1027  29  PRO A CD  
216  N N   . PRO A 29  ? 0.6699 0.5257 0.5884 -0.0593 -0.0575 0.0986  30  PRO A N   
217  C CA  . PRO A 29  ? 0.6518 0.5127 0.5702 -0.0512 -0.0418 0.0831  30  PRO A CA  
218  C C   . PRO A 29  ? 0.6446 0.4962 0.5833 -0.0372 -0.0431 0.0673  30  PRO A C   
219  O O   . PRO A 29  ? 0.6425 0.4815 0.6024 -0.0339 -0.0570 0.0681  30  PRO A O   
220  C CB  . PRO A 29  ? 0.6472 0.5095 0.5673 -0.0596 -0.0424 0.0926  30  PRO A CB  
221  C CG  . PRO A 29  ? 0.6677 0.5338 0.5791 -0.0755 -0.0532 0.1142  30  PRO A CG  
222  C CD  . PRO A 29  ? 0.6646 0.5182 0.5843 -0.0732 -0.0681 0.1184  30  PRO A CD  
223  N N   . GLN A 30  ? 0.6389 0.4984 0.5718 -0.0296 -0.0299 0.0531  31  GLN A N   
224  C CA  . GLN A 30  ? 0.6309 0.4899 0.5787 -0.0187 -0.0268 0.0379  31  GLN A CA  
225  C C   . GLN A 30  ? 0.6354 0.4989 0.5791 -0.0189 -0.0164 0.0344  31  GLN A C   
226  O O   . GLN A 30  ? 0.6401 0.5117 0.5678 -0.0219 -0.0057 0.0349  31  GLN A O   
227  C CB  . GLN A 30  ? 0.6062 0.4728 0.5497 -0.0132 -0.0201 0.0280  31  GLN A CB  
228  C CG  . GLN A 30  ? 0.6021 0.4666 0.5505 -0.0127 -0.0300 0.0304  31  GLN A CG  
229  C CD  . GLN A 30  ? 0.6016 0.4752 0.5446 -0.0097 -0.0233 0.0223  31  GLN A CD  
230  O OE1 . GLN A 30  ? 0.5996 0.4810 0.5473 -0.0048 -0.0162 0.0118  31  GLN A OE1 
231  N NE2 . GLN A 30  ? 0.6164 0.4902 0.5491 -0.0141 -0.0264 0.0281  31  GLN A NE2 
232  N N   . THR A 31  ? 0.6572 0.5160 0.6170 -0.0152 -0.0208 0.0297  32  THR A N   
233  C CA  . THR A 31  ? 0.6339 0.4964 0.5919 -0.0163 -0.0134 0.0278  32  THR A CA  
234  C C   . THR A 31  ? 0.6132 0.4847 0.5711 -0.0088 -0.0033 0.0140  32  THR A C   
235  O O   . THR A 31  ? 0.5939 0.4688 0.5611 -0.0022 -0.0050 0.0038  32  THR A O   
236  C CB  . THR A 31  ? 0.6491 0.5016 0.6238 -0.0184 -0.0247 0.0314  32  THR A CB  
237  O OG1 . THR A 31  ? 0.6586 0.5063 0.6539 -0.0090 -0.0330 0.0184  32  THR A OG1 
238  C CG2 . THR A 31  ? 0.6325 0.4764 0.6067 -0.0293 -0.0366 0.0497  32  THR A CG2 
239  N N   . PHE A 32  ? 0.6031 0.4811 0.5511 -0.0106 0.0064  0.0141  33  PHE A N   
240  C CA  . PHE A 32  ? 0.5860 0.4723 0.5327 -0.0057 0.0145  0.0046  33  PHE A CA  
241  C C   . PHE A 32  ? 0.5952 0.4844 0.5433 -0.0067 0.0181  0.0043  33  PHE A C   
242  O O   . PHE A 32  ? 0.5880 0.4770 0.5318 -0.0119 0.0193  0.0119  33  PHE A O   
243  C CB  . PHE A 32  ? 0.5840 0.4745 0.5170 -0.0059 0.0217  0.0047  33  PHE A CB  
244  C CG  . PHE A 32  ? 0.5966 0.4861 0.5287 -0.0051 0.0184  0.0041  33  PHE A CG  
245  C CD1 . PHE A 32  ? 0.6246 0.5092 0.5506 -0.0090 0.0145  0.0112  33  PHE A CD1 
246  C CD2 . PHE A 32  ? 0.5972 0.4935 0.5348 -0.0015 0.0186  -0.0032 33  PHE A CD2 
247  C CE1 . PHE A 32  ? 0.6445 0.5283 0.5707 -0.0083 0.0103  0.0107  33  PHE A CE1 
248  C CE2 . PHE A 32  ? 0.5945 0.4921 0.5332 -0.0011 0.0153  -0.0039 33  PHE A CE2 
249  C CZ  . PHE A 32  ? 0.6187 0.5087 0.5522 -0.0040 0.0108  0.0027  33  PHE A CZ  
250  N N   . LYS A 33  ? 0.5931 0.4884 0.5473 -0.0025 0.0197  -0.0044 34  LYS A N   
251  C CA  . LYS A 33  ? 0.5985 0.4986 0.5535 -0.0030 0.0232  -0.0056 34  LYS A CA  
252  C C   . LYS A 33  ? 0.5893 0.4951 0.5330 -0.0029 0.0311  -0.0043 34  LYS A C   
253  O O   . LYS A 33  ? 0.5875 0.4971 0.5275 -0.0012 0.0327  -0.0072 34  LYS A O   
254  C CB  . LYS A 33  ? 0.6160 0.5225 0.5818 0.0007  0.0203  -0.0162 34  LYS A CB  
255  C CG  . LYS A 33  ? 0.6394 0.5390 0.6208 0.0029  0.0101  -0.0216 34  LYS A CG  
256  C CD  . LYS A 33  ? 0.6696 0.5804 0.6621 0.0082  0.0077  -0.0370 34  LYS A CD  
257  C CE  . LYS A 33  ? 0.7386 0.6487 0.7458 0.0139  -0.0005 -0.0471 34  LYS A CE  
258  N NZ  . LYS A 33  ? 0.8235 0.7361 0.8496 0.0191  -0.0089 -0.0624 34  LYS A NZ  
259  N N   . VAL A 34  ? 0.5911 0.4981 0.5312 -0.0050 0.0347  0.0000  35  VAL A N   
260  C CA  . VAL A 34  ? 0.6007 0.5110 0.5338 -0.0035 0.0398  -0.0001 35  VAL A CA  
261  C C   . VAL A 34  ? 0.6243 0.5406 0.5611 -0.0028 0.0422  -0.0005 35  VAL A C   
262  O O   . VAL A 34  ? 0.6535 0.5729 0.5952 -0.0054 0.0420  0.0014  35  VAL A O   
263  C CB  . VAL A 34  ? 0.5811 0.4900 0.5061 -0.0048 0.0421  0.0023  35  VAL A CB  
264  C CG1 . VAL A 34  ? 0.5729 0.4762 0.4934 -0.0049 0.0395  0.0024  35  VAL A CG1 
265  C CG2 . VAL A 34  ? 0.5744 0.4875 0.4992 -0.0098 0.0426  0.0074  35  VAL A CG2 
266  N N   . VAL A 35  ? 0.6176 0.5356 0.5533 -0.0001 0.0431  -0.0020 36  VAL A N   
267  C CA  . VAL A 35  ? 0.6175 0.5410 0.5581 0.0015  0.0441  -0.0024 36  VAL A CA  
268  C C   . VAL A 35  ? 0.6274 0.5528 0.5672 0.0038  0.0471  -0.0042 36  VAL A C   
269  O O   . VAL A 35  ? 0.6662 0.5863 0.6014 0.0057  0.0466  -0.0060 36  VAL A O   
270  C CB  . VAL A 35  ? 0.6313 0.5559 0.5732 0.0026  0.0407  -0.0018 36  VAL A CB  
271  C CG1 . VAL A 35  ? 0.6325 0.5606 0.5811 0.0055  0.0398  -0.0018 36  VAL A CG1 
272  C CG2 . VAL A 35  ? 0.6152 0.5456 0.5585 0.0001  0.0389  -0.0029 36  VAL A CG2 
273  N N   . PHE A 36  ? 0.6190 0.5543 0.5641 0.0036  0.0499  -0.0051 37  PHE A N   
274  C CA  . PHE A 36  ? 0.5843 0.5286 0.5311 0.0067  0.0535  -0.0102 37  PHE A CA  
275  C C   . PHE A 36  ? 0.5928 0.5381 0.5494 0.0132  0.0506  -0.0145 37  PHE A C   
276  O O   . PHE A 36  ? 0.5958 0.5476 0.5605 0.0132  0.0498  -0.0132 37  PHE A O   
277  C CB  . PHE A 36  ? 0.5653 0.5249 0.5130 0.0014  0.0582  -0.0084 37  PHE A CB  
278  C CG  . PHE A 36  ? 0.5639 0.5211 0.5026 -0.0059 0.0583  -0.0019 37  PHE A CG  
279  C CD1 . PHE A 36  ? 0.5617 0.5084 0.5013 -0.0104 0.0535  0.0046  37  PHE A CD1 
280  C CD2 . PHE A 36  ? 0.5607 0.5271 0.4914 -0.0083 0.0618  -0.0033 37  PHE A CD2 
281  C CE1 . PHE A 36  ? 0.5529 0.4953 0.4874 -0.0167 0.0507  0.0112  37  PHE A CE1 
282  C CE2 . PHE A 36  ? 0.5591 0.5231 0.4815 -0.0162 0.0599  0.0048  37  PHE A CE2 
283  C CZ  . PHE A 36  ? 0.5599 0.5104 0.4851 -0.0203 0.0537  0.0129  37  PHE A CZ  
284  N N   . ASP A 37  ? 0.6096 0.5473 0.5670 0.0184  0.0473  -0.0191 38  ASP A N   
285  C CA  . ASP A 37  ? 0.6217 0.5529 0.5892 0.0239  0.0399  -0.0203 38  ASP A CA  
286  C C   . ASP A 37  ? 0.6625 0.5980 0.6409 0.0325  0.0384  -0.0321 38  ASP A C   
287  O O   . ASP A 37  ? 0.6895 0.6189 0.6654 0.0353  0.0371  -0.0384 38  ASP A O   
288  C CB  . ASP A 37  ? 0.6152 0.5306 0.5768 0.0209  0.0333  -0.0135 38  ASP A CB  
289  C CG  . ASP A 37  ? 0.6693 0.5752 0.6410 0.0244  0.0226  -0.0116 38  ASP A CG  
290  O OD1 . ASP A 37  ? 0.6856 0.5962 0.6696 0.0288  0.0191  -0.0133 38  ASP A OD1 
291  O OD2 . ASP A 37  ? 0.6999 0.5935 0.6685 0.0219  0.0162  -0.0071 38  ASP A OD2 
292  N N   . THR A 38  ? 0.6407 0.5880 0.6330 0.0374  0.0380  -0.0366 39  THR A N   
293  C CA  . THR A 38  ? 0.6313 0.5864 0.6392 0.0477  0.0355  -0.0510 39  THR A CA  
294  C C   . THR A 38  ? 0.6324 0.5668 0.6514 0.0543  0.0216  -0.0524 39  THR A C   
295  O O   . THR A 38  ? 0.6819 0.6177 0.7156 0.0643  0.0169  -0.0667 39  THR A O   
296  C CB  . THR A 38  ? 0.6279 0.6047 0.6501 0.0512  0.0386  -0.0559 39  THR A CB  
297  O OG1 . THR A 38  ? 0.5939 0.5639 0.6197 0.0482  0.0329  -0.0444 39  THR A OG1 
298  C CG2 . THR A 38  ? 0.6164 0.6171 0.6303 0.0443  0.0514  -0.0565 39  THR A CG2 
299  N N   . GLY A 39  ? 0.6194 0.5363 0.6325 0.0481  0.0143  -0.0379 40  GLY A N   
300  C CA  . GLY A 39  ? 0.6287 0.5252 0.6515 0.0504  -0.0010 -0.0338 40  GLY A CA  
301  C C   . GLY A 39  ? 0.6365 0.5168 0.6528 0.0489  -0.0051 -0.0347 40  GLY A C   
302  O O   . GLY A 39  ? 0.6763 0.5383 0.7024 0.0501  -0.0196 -0.0314 40  GLY A O   
303  N N   . SER A 40  ? 0.6256 0.5122 0.6263 0.0453  0.0059  -0.0380 41  SER A N   
304  C CA  . SER A 40  ? 0.6339 0.5080 0.6276 0.0435  0.0031  -0.0403 41  SER A CA  
305  C C   . SER A 40  ? 0.6469 0.5355 0.6326 0.0460  0.0144  -0.0536 41  SER A C   
306  O O   . SER A 40  ? 0.6714 0.5802 0.6568 0.0475  0.0241  -0.0587 41  SER A O   
307  C CB  . SER A 40  ? 0.6074 0.4732 0.5865 0.0321  0.0025  -0.0241 41  SER A CB  
308  O OG  . SER A 40  ? 0.5706 0.4499 0.5364 0.0267  0.0145  -0.0201 41  SER A OG  
309  N N   . SER A 41  ? 0.6627 0.5431 0.6420 0.0452  0.0126  -0.0582 42  SER A N   
310  C CA  . SER A 41  ? 0.6773 0.5732 0.6496 0.0476  0.0212  -0.0722 42  SER A CA  
311  C C   . SER A 41  ? 0.6896 0.5823 0.6434 0.0396  0.0250  -0.0667 42  SER A C   
312  O O   . SER A 41  ? 0.7175 0.6238 0.6631 0.0397  0.0311  -0.0762 42  SER A O   
313  C CB  . SER A 41  ? 0.6790 0.5744 0.6670 0.0591  0.0140  -0.0929 42  SER A CB  
314  O OG  . SER A 41  ? 0.6818 0.5792 0.6907 0.0680  0.0082  -0.0992 42  SER A OG  
315  N N   . ASN A 42  ? 0.6689 0.5469 0.6167 0.0323  0.0210  -0.0519 43  ASN A N   
316  C CA  . ASN A 42  ? 0.6510 0.5266 0.5843 0.0253  0.0235  -0.0466 43  ASN A CA  
317  C C   . ASN A 42  ? 0.6486 0.5335 0.5717 0.0186  0.0316  -0.0357 43  ASN A C   
318  O O   . ASN A 42  ? 0.6747 0.5616 0.6014 0.0173  0.0327  -0.0285 43  ASN A O   
319  C CB  . ASN A 42  ? 0.6400 0.4967 0.5752 0.0211  0.0133  -0.0390 43  ASN A CB  
320  C CG  . ASN A 42  ? 0.6768 0.5205 0.6222 0.0265  0.0027  -0.0500 43  ASN A CG  
321  O OD1 . ASN A 42  ? 0.6818 0.5189 0.6427 0.0331  -0.0050 -0.0554 43  ASN A OD1 
322  N ND2 . ASN A 42  ? 0.6820 0.5210 0.6206 0.0241  0.0006  -0.0541 43  ASN A ND2 
323  N N   . VAL A 43  ? 0.6242 0.5145 0.5357 0.0145  0.0357  -0.0352 44  VAL A N   
324  C CA  . VAL A 43  ? 0.5858 0.4792 0.4904 0.0083  0.0392  -0.0247 44  VAL A CA  
325  C C   . VAL A 43  ? 0.5956 0.4782 0.4984 0.0046  0.0341  -0.0185 44  VAL A C   
326  O O   . VAL A 43  ? 0.5815 0.4576 0.4816 0.0041  0.0300  -0.0217 44  VAL A O   
327  C CB  . VAL A 43  ? 0.5943 0.4994 0.4888 0.0045  0.0440  -0.0248 44  VAL A CB  
328  C CG1 . VAL A 43  ? 0.5930 0.4982 0.4852 -0.0009 0.0445  -0.0138 44  VAL A CG1 
329  C CG2 . VAL A 43  ? 0.5951 0.5173 0.4905 0.0066  0.0496  -0.0320 44  VAL A CG2 
330  N N   . TRP A 44  ? 0.6044 0.4874 0.5094 0.0017  0.0341  -0.0109 45  TRP A N   
331  C CA  . TRP A 44  ? 0.6048 0.4856 0.5084 -0.0024 0.0311  -0.0059 45  TRP A CA  
332  C C   . TRP A 44  ? 0.6042 0.4923 0.5093 -0.0041 0.0334  -0.0024 45  TRP A C   
333  O O   . TRP A 44  ? 0.6360 0.5283 0.5446 -0.0028 0.0358  -0.0020 45  TRP A O   
334  C CB  . TRP A 44  ? 0.6141 0.4898 0.5221 -0.0048 0.0254  -0.0023 45  TRP A CB  
335  C CG  . TRP A 44  ? 0.6127 0.4930 0.5259 -0.0055 0.0252  0.0020  45  TRP A CG  
336  C CD1 . TRP A 44  ? 0.6151 0.4918 0.5339 -0.0025 0.0229  0.0015  45  TRP A CD1 
337  C CD2 . TRP A 44  ? 0.6057 0.4974 0.5195 -0.0094 0.0266  0.0063  45  TRP A CD2 
338  N NE1 . TRP A 44  ? 0.6230 0.5070 0.5443 -0.0053 0.0224  0.0073  45  TRP A NE1 
339  C CE2 . TRP A 44  ? 0.6141 0.5087 0.5318 -0.0097 0.0252  0.0095  45  TRP A CE2 
340  C CE3 . TRP A 44  ? 0.5915 0.4935 0.5045 -0.0121 0.0284  0.0062  45  TRP A CE3 
341  C CZ2 . TRP A 44  ? 0.6002 0.5091 0.5183 -0.0135 0.0262  0.0124  45  TRP A CZ2 
342  C CZ3 . TRP A 44  ? 0.5989 0.5160 0.5145 -0.0147 0.0296  0.0070  45  TRP A CZ3 
343  C CH2 . TRP A 44  ? 0.5909 0.5119 0.5078 -0.0159 0.0289  0.0101  45  TRP A CH2 
344  N N   . VAL A 45  ? 0.5988 0.4884 0.5031 -0.0064 0.0314  -0.0010 46  VAL A N   
345  C CA  . VAL A 45  ? 0.5772 0.4742 0.4871 -0.0066 0.0314  -0.0007 46  VAL A CA  
346  C C   . VAL A 45  ? 0.5641 0.4676 0.4764 -0.0094 0.0289  -0.0004 46  VAL A C   
347  O O   . VAL A 45  ? 0.5718 0.4707 0.4803 -0.0120 0.0266  0.0011  46  VAL A O   
348  C CB  . VAL A 45  ? 0.5806 0.4756 0.4908 -0.0059 0.0301  -0.0001 46  VAL A CB  
349  C CG1 . VAL A 45  ? 0.5522 0.4461 0.4612 -0.0055 0.0327  0.0012  46  VAL A CG1 
350  C CG2 . VAL A 45  ? 0.5738 0.4647 0.4776 -0.0078 0.0274  0.0012  46  VAL A CG2 
351  N N   . PRO A 46  ? 0.5629 0.4792 0.4824 -0.0092 0.0291  -0.0032 47  PRO A N   
352  C CA  . PRO A 46  ? 0.5511 0.4798 0.4737 -0.0127 0.0276  -0.0036 47  PRO A CA  
353  C C   . PRO A 46  ? 0.5699 0.4954 0.4941 -0.0117 0.0242  -0.0047 47  PRO A C   
354  O O   . PRO A 46  ? 0.5684 0.4866 0.4946 -0.0079 0.0223  -0.0060 47  PRO A O   
355  C CB  . PRO A 46  ? 0.5461 0.4940 0.4773 -0.0113 0.0293  -0.0100 47  PRO A CB  
356  C CG  . PRO A 46  ? 0.5610 0.5039 0.4917 -0.0086 0.0312  -0.0107 47  PRO A CG  
357  C CD  . PRO A 46  ? 0.5649 0.4882 0.4913 -0.0061 0.0304  -0.0075 47  PRO A CD  
358  N N   . SER A 47  ? 0.5669 0.4979 0.4905 -0.0164 0.0224  -0.0027 48  SER A N   
359  C CA  . SER A 47  ? 0.5743 0.5031 0.4991 -0.0165 0.0184  -0.0030 48  SER A CA  
360  C C   . SER A 47  ? 0.5822 0.5307 0.5199 -0.0149 0.0170  -0.0088 48  SER A C   
361  O O   . SER A 47  ? 0.5637 0.5327 0.5069 -0.0173 0.0198  -0.0118 48  SER A O   
362  C CB  . SER A 47  ? 0.5735 0.4968 0.4919 -0.0228 0.0159  0.0017  48  SER A CB  
363  O OG  . SER A 47  ? 0.6027 0.5220 0.5204 -0.0230 0.0116  0.0013  48  SER A OG  
364  N N   . SER A 48  ? 0.5877 0.5324 0.5309 -0.0112 0.0120  -0.0108 49  SER A N   
365  C CA  . SER A 48  ? 0.6003 0.5639 0.5588 -0.0087 0.0088  -0.0177 49  SER A CA  
366  C C   . SER A 48  ? 0.5804 0.5606 0.5385 -0.0164 0.0100  -0.0157 49  SER A C   
367  O O   . SER A 48  ? 0.5626 0.5679 0.5334 -0.0163 0.0101  -0.0222 49  SER A O   
368  C CB  . SER A 48  ? 0.5973 0.5500 0.5615 -0.0044 0.0005  -0.0173 49  SER A CB  
369  O OG  . SER A 48  ? 0.5913 0.5315 0.5428 -0.0096 -0.0016 -0.0095 49  SER A OG  
370  N N   . LYS A 49  ? 0.6083 0.5753 0.5531 -0.0234 0.0102  -0.0071 50  LYS A N   
371  C CA  . LYS A 49  ? 0.6123 0.5896 0.5562 -0.0329 0.0090  -0.0022 50  LYS A CA  
372  C C   . LYS A 49  ? 0.6164 0.6100 0.5594 -0.0403 0.0130  0.0013  50  LYS A C   
373  O O   . LYS A 49  ? 0.6233 0.6285 0.5664 -0.0508 0.0112  0.0079  50  LYS A O   
374  C CB  . LYS A 49  ? 0.6098 0.5635 0.5426 -0.0365 0.0044  0.0036  50  LYS A CB  
375  C CG  . LYS A 49  ? 0.6121 0.5574 0.5450 -0.0321 -0.0003 0.0013  50  LYS A CG  
376  C CD  . LYS A 49  ? 0.6531 0.5808 0.5752 -0.0362 -0.0050 0.0044  50  LYS A CD  
377  C CE  . LYS A 49  ? 0.6640 0.5860 0.5839 -0.0328 -0.0100 0.0030  50  LYS A CE  
378  N NZ  . LYS A 49  ? 0.6551 0.5676 0.5697 -0.0266 -0.0085 0.0027  50  LYS A NZ  
379  N N   . CYS A 50  ? 0.6262 0.6217 0.5685 -0.0361 0.0174  -0.0016 51  CYS A N   
380  C CA  . CYS A 50  ? 0.6273 0.6428 0.5686 -0.0430 0.0211  0.0012  51  CYS A CA  
381  C C   . CYS A 50  ? 0.6203 0.6750 0.5729 -0.0454 0.0240  -0.0060 51  CYS A C   
382  O O   . CYS A 50  ? 0.6391 0.7049 0.6031 -0.0356 0.0252  -0.0193 51  CYS A O   
383  C CB  . CYS A 50  ? 0.6272 0.6354 0.5655 -0.0368 0.0245  -0.0019 51  CYS A CB  
384  S SG  . CYS A 50  ? 0.6368 0.6708 0.5723 -0.0453 0.0282  0.0018  51  CYS A SG  
385  N N   . SER A 51  ? 0.5998 0.6763 0.5507 -0.0589 0.0239  0.0024  52  SER A N   
386  C CA  . SER A 51  ? 0.5901 0.7128 0.5505 -0.0643 0.0279  -0.0039 52  SER A CA  
387  C C   . SER A 51  ? 0.5840 0.7288 0.5491 -0.0569 0.0339  -0.0176 52  SER A C   
388  O O   . SER A 51  ? 0.5844 0.7200 0.5405 -0.0577 0.0353  -0.0136 52  SER A O   
389  C CB  . SER A 51  ? 0.6099 0.7520 0.5640 -0.0836 0.0265  0.0120  52  SER A CB  
390  O OG  . SER A 51  ? 0.6370 0.8313 0.5989 -0.0907 0.0317  0.0059  52  SER A OG  
391  N N   . ARG A 52  ? 0.5739 0.7480 0.5550 -0.0491 0.0363  -0.0352 53  ARG A N   
392  C CA  . ARG A 52  ? 0.5575 0.7569 0.5466 -0.0412 0.0409  -0.0526 53  ARG A CA  
393  C C   . ARG A 52  ? 0.5236 0.7636 0.5049 -0.0544 0.0469  -0.0498 53  ARG A C   
394  O O   . ARG A 52  ? 0.5146 0.7742 0.4985 -0.0496 0.0506  -0.0628 53  ARG A O   
395  C CB  . ARG A 52  ? 0.5685 0.7893 0.5807 -0.0279 0.0399  -0.0751 53  ARG A CB  
396  C CG  . ARG A 52  ? 0.5849 0.7661 0.6058 -0.0146 0.0319  -0.0778 53  ARG A CG  
397  C CD  . ARG A 52  ? 0.5844 0.7238 0.5965 -0.0083 0.0293  -0.0730 53  ARG A CD  
398  N NE  . ARG A 52  ? 0.6508 0.7518 0.6519 -0.0107 0.0248  -0.0573 53  ARG A NE  
399  C CZ  . ARG A 52  ? 0.6546 0.7303 0.6622 -0.0025 0.0175  -0.0579 53  ARG A CZ  
400  N NH1 . ARG A 52  ? 0.6546 0.7329 0.6817 0.0093  0.0119  -0.0722 53  ARG A NH1 
401  N NH2 . ARG A 52  ? 0.6650 0.7124 0.6596 -0.0068 0.0147  -0.0440 53  ARG A NH2 
402  N N   . LEU A 53  ? 0.5271 0.7786 0.4988 -0.0721 0.0463  -0.0314 54  LEU A N   
403  C CA  . LEU A 53  ? 0.5136 0.7976 0.4737 -0.0892 0.0494  -0.0204 54  LEU A CA  
404  C C   . LEU A 53  ? 0.5153 0.7694 0.4611 -0.0904 0.0471  -0.0091 54  LEU A C   
405  O O   . LEU A 53  ? 0.5204 0.8023 0.4581 -0.1002 0.0496  -0.0052 54  LEU A O   
406  C CB  . LEU A 53  ? 0.5040 0.8036 0.4595 -0.1094 0.0463  -0.0006 54  LEU A CB  
407  C CG  . LEU A 53  ? 0.5018 0.8524 0.4706 -0.1140 0.0506  -0.0108 54  LEU A CG  
408  C CD1 . LEU A 53  ? 0.5113 0.8572 0.4779 -0.1307 0.0445  0.0099  54  LEU A CD1 
409  C CD2 . LEU A 53  ? 0.4918 0.9084 0.4610 -0.1228 0.0589  -0.0202 54  LEU A CD2 
410  N N   . TYR A 54  ? 0.5161 0.7174 0.4590 -0.0810 0.0422  -0.0043 55  TYR A N   
411  C CA  . TYR A 54  ? 0.5314 0.7063 0.4669 -0.0752 0.0413  -0.0025 55  TYR A CA  
412  C C   . TYR A 54  ? 0.5391 0.7213 0.4842 -0.0594 0.0457  -0.0251 55  TYR A C   
413  O O   . TYR A 54  ? 0.5383 0.6979 0.4928 -0.0459 0.0441  -0.0353 55  TYR A O   
414  C CB  . TYR A 54  ? 0.5287 0.6510 0.4590 -0.0710 0.0352  0.0086  55  TYR A CB  
415  C CG  . TYR A 54  ? 0.5558 0.6665 0.4789 -0.0856 0.0283  0.0294  55  TYR A CG  
416  C CD1 . TYR A 54  ? 0.5618 0.6741 0.4764 -0.0974 0.0240  0.0450  55  TYR A CD1 
417  C CD2 . TYR A 54  ? 0.5648 0.6623 0.4909 -0.0881 0.0240  0.0339  55  TYR A CD2 
418  C CE1 . TYR A 54  ? 0.5798 0.6786 0.4912 -0.1111 0.0143  0.0648  55  TYR A CE1 
419  C CE2 . TYR A 54  ? 0.5802 0.6652 0.5024 -0.1016 0.0154  0.0521  55  TYR A CE2 
420  C CZ  . TYR A 54  ? 0.5951 0.6796 0.5108 -0.1130 0.0100  0.0676  55  TYR A CZ  
421  O OH  . TYR A 54  ? 0.6195 0.6882 0.5343 -0.1264 -0.0014 0.0861  55  TYR A OH  
422  N N   . THR A 55  ? 0.5335 0.7484 0.4765 -0.0624 0.0497  -0.0322 56  THR A N   
423  C CA  . THR A 55  ? 0.5394 0.7657 0.4931 -0.0487 0.0525  -0.0555 56  THR A CA  
424  C C   . THR A 55  ? 0.5487 0.7291 0.5028 -0.0367 0.0489  -0.0563 56  THR A C   
425  O O   . THR A 55  ? 0.5657 0.7402 0.5333 -0.0231 0.0476  -0.0738 56  THR A O   
426  C CB  . THR A 55  ? 0.5376 0.8106 0.4862 -0.0566 0.0572  -0.0621 56  THR A CB  
427  O OG1 . THR A 55  ? 0.5473 0.8674 0.4950 -0.0699 0.0609  -0.0599 56  THR A OG1 
428  C CG2 . THR A 55  ? 0.5133 0.8025 0.4759 -0.0418 0.0591  -0.0907 56  THR A CG2 
429  N N   . ALA A 56  ? 0.5541 0.7036 0.4955 -0.0420 0.0462  -0.0375 57  ALA A N   
430  C CA  . ALA A 56  ? 0.5555 0.6642 0.4963 -0.0327 0.0434  -0.0358 57  ALA A CA  
431  C C   . ALA A 56  ? 0.5730 0.6547 0.5222 -0.0230 0.0406  -0.0396 57  ALA A C   
432  O O   . ALA A 56  ? 0.6042 0.6633 0.5582 -0.0139 0.0385  -0.0445 57  ALA A O   
433  C CB  . ALA A 56  ? 0.5425 0.6286 0.4706 -0.0403 0.0406  -0.0164 57  ALA A CB  
434  N N   . CYS A 57  ? 0.5886 0.6742 0.5395 -0.0263 0.0398  -0.0361 58  CYS A N   
435  C CA  . CYS A 57  ? 0.6030 0.6674 0.5615 -0.0182 0.0362  -0.0394 58  CYS A CA  
436  C C   . CYS A 57  ? 0.6198 0.7000 0.5967 -0.0078 0.0347  -0.0587 58  CYS A C   
437  O O   . CYS A 57  ? 0.6753 0.7336 0.6607 0.0007  0.0294  -0.0621 58  CYS A O   
438  C CB  . CYS A 57  ? 0.6062 0.6669 0.5603 -0.0255 0.0345  -0.0287 58  CYS A CB  
439  S SG  . CYS A 57  ? 0.6606 0.6899 0.5986 -0.0329 0.0322  -0.0098 58  CYS A SG  
440  N N   . VAL A 58  ? 0.5772 0.6966 0.5611 -0.0088 0.0382  -0.0715 59  VAL A N   
441  C CA  . VAL A 58  ? 0.5697 0.7072 0.5745 0.0029  0.0359  -0.0944 59  VAL A CA  
442  C C   . VAL A 58  ? 0.5769 0.6940 0.5867 0.0116  0.0322  -0.1019 59  VAL A C   
443  O O   . VAL A 58  ? 0.6097 0.7170 0.6379 0.0230  0.0250  -0.1149 59  VAL A O   
444  C CB  . VAL A 58  ? 0.5708 0.7633 0.5819 -0.0009 0.0416  -0.1088 59  VAL A CB  
445  C CG1 . VAL A 58  ? 0.5565 0.7707 0.5913 0.0130  0.0388  -0.1374 59  VAL A CG1 
446  C CG2 . VAL A 58  ? 0.5462 0.7590 0.5574 -0.0089 0.0435  -0.1023 59  VAL A CG2 
447  N N   . TYR A 59  ? 0.5657 0.6747 0.5607 0.0059  0.0354  -0.0926 60  TYR A N   
448  C CA  . TYR A 59  ? 0.5725 0.6682 0.5718 0.0121  0.0325  -0.0997 60  TYR A CA  
449  C C   . TYR A 59  ? 0.5682 0.6209 0.5609 0.0128  0.0289  -0.0851 60  TYR A C   
450  O O   . TYR A 59  ? 0.5880 0.6300 0.5804 0.0144  0.0275  -0.0860 60  TYR A O   
451  C CB  . TYR A 59  ? 0.5642 0.6855 0.5532 0.0054  0.0379  -0.1015 60  TYR A CB  
452  C CG  . TYR A 59  ? 0.5763 0.7433 0.5757 0.0077  0.0404  -0.1239 60  TYR A CG  
453  C CD1 . TYR A 59  ? 0.5767 0.7826 0.5753 0.0013  0.0455  -0.1267 60  TYR A CD1 
454  C CD2 . TYR A 59  ? 0.5863 0.7616 0.5968 0.0155  0.0375  -0.1433 60  TYR A CD2 
455  C CE1 . TYR A 59  ? 0.5783 0.8338 0.5865 0.0030  0.0488  -0.1495 60  TYR A CE1 
456  C CE2 . TYR A 59  ? 0.5931 0.8150 0.6137 0.0184  0.0399  -0.1676 60  TYR A CE2 
457  C CZ  . TYR A 59  ? 0.5814 0.8452 0.6006 0.0123  0.0462  -0.1712 60  TYR A CZ  
458  O OH  . TYR A 59  ? 0.6120 0.9284 0.6414 0.0149  0.0495  -0.1973 60  TYR A OH  
459  N N   . HIS A 60  ? 0.5494 0.5810 0.5369 0.0110  0.0275  -0.0722 61  HIS A N   
460  C CA  . HIS A 60  ? 0.5364 0.5344 0.5161 0.0103  0.0253  -0.0588 61  HIS A CA  
461  C C   . HIS A 60  ? 0.5345 0.5142 0.5191 0.0131  0.0196  -0.0547 61  HIS A C   
462  O O   . HIS A 60  ? 0.5177 0.5084 0.5079 0.0140  0.0183  -0.0584 61  HIS A O   
463  C CB  . HIS A 60  ? 0.5488 0.5412 0.5103 0.0020  0.0306  -0.0438 61  HIS A CB  
464  C CG  . HIS A 60  ? 0.5747 0.5736 0.5309 -0.0005 0.0335  -0.0431 61  HIS A CG  
465  N ND1 . HIS A 60  ? 0.5661 0.5880 0.5155 -0.0073 0.0369  -0.0413 61  HIS A ND1 
466  C CD2 . HIS A 60  ? 0.5679 0.5550 0.5249 0.0016  0.0325  -0.0430 61  HIS A CD2 
467  C CE1 . HIS A 60  ? 0.5722 0.5950 0.5181 -0.0085 0.0376  -0.0402 61  HIS A CE1 
468  N NE2 . HIS A 60  ? 0.5525 0.5544 0.5034 -0.0026 0.0353  -0.0419 61  HIS A NE2 
469  N N   . LYS A 61  ? 0.5320 0.4865 0.5144 0.0135  0.0158  -0.0465 62  LYS A N   
470  C CA  . LYS A 61  ? 0.5852 0.5224 0.5679 0.0135  0.0101  -0.0389 62  LYS A CA  
471  C C   . LYS A 61  ? 0.5940 0.5307 0.5617 0.0079  0.0148  -0.0298 62  LYS A C   
472  O O   . LYS A 61  ? 0.5944 0.5306 0.5490 0.0033  0.0210  -0.0238 62  LYS A O   
473  C CB  . LYS A 61  ? 0.6383 0.5543 0.6191 0.0120  0.0059  -0.0303 62  LYS A CB  
474  C CG  . LYS A 61  ? 0.6914 0.5921 0.6751 0.0111  -0.0029 -0.0222 62  LYS A CG  
475  C CD  . LYS A 61  ? 0.7091 0.6076 0.7158 0.0176  -0.0154 -0.0307 62  LYS A CD  
476  C CE  . LYS A 61  ? 0.7467 0.6250 0.7565 0.0141  -0.0271 -0.0179 62  LYS A CE  
477  N NZ  . LYS A 61  ? 0.7827 0.6496 0.7911 0.0094  -0.0292 -0.0103 62  LYS A NZ  
478  N N   . LEU A 62  ? 0.5873 0.5238 0.5594 0.0088  0.0102  -0.0296 63  LEU A N   
479  C CA  . LEU A 62  ? 0.5866 0.5225 0.5469 0.0036  0.0126  -0.0225 63  LEU A CA  
480  C C   . LEU A 62  ? 0.5973 0.5155 0.5520 0.0022  0.0074  -0.0141 63  LEU A C   
481  O O   . LEU A 62  ? 0.6618 0.5747 0.6272 0.0054  -0.0009 -0.0146 63  LEU A O   
482  C CB  . LEU A 62  ? 0.5590 0.5156 0.5282 0.0039  0.0123  -0.0293 63  LEU A CB  
483  C CG  . LEU A 62  ? 0.5523 0.5360 0.5280 0.0038  0.0172  -0.0388 63  LEU A CG  
484  C CD1 . LEU A 62  ? 0.5415 0.5500 0.5273 0.0033  0.0166  -0.0455 63  LEU A CD1 
485  C CD2 . LEU A 62  ? 0.5633 0.5495 0.5243 -0.0035 0.0239  -0.0313 63  LEU A CD2 
486  N N   . PHE A 63  ? 0.5993 0.5092 0.5380 -0.0025 0.0111  -0.0068 64  PHE A N   
487  C CA  . PHE A 63  ? 0.6046 0.5035 0.5349 -0.0053 0.0070  0.0000  64  PHE A CA  
488  C C   . PHE A 63  ? 0.6230 0.5262 0.5561 -0.0061 0.0023  -0.0004 64  PHE A C   
489  O O   . PHE A 63  ? 0.6611 0.5717 0.5921 -0.0082 0.0053  -0.0026 64  PHE A O   
490  C CB  . PHE A 63  ? 0.5863 0.4789 0.5004 -0.0090 0.0123  0.0039  64  PHE A CB  
491  C CG  . PHE A 63  ? 0.5910 0.4786 0.4945 -0.0127 0.0090  0.0090  64  PHE A CG  
492  C CD1 . PHE A 63  ? 0.5892 0.4734 0.4915 -0.0150 0.0045  0.0158  64  PHE A CD1 
493  C CD2 . PHE A 63  ? 0.5990 0.4863 0.4938 -0.0150 0.0091  0.0076  64  PHE A CD2 
494  C CE1 . PHE A 63  ? 0.5852 0.4692 0.4757 -0.0203 0.0012  0.0216  64  PHE A CE1 
495  C CE2 . PHE A 63  ? 0.6001 0.4861 0.4840 -0.0188 0.0059  0.0107  64  PHE A CE2 
496  C CZ  . PHE A 63  ? 0.6086 0.4945 0.4893 -0.0217 0.0025  0.0180  64  PHE A CZ  
497  N N   . ASP A 64  ? 0.6343 0.5329 0.5730 -0.0053 -0.0063 0.0027  65  ASP A N   
498  C CA  . ASP A 64  ? 0.6744 0.5772 0.6173 -0.0058 -0.0124 0.0027  65  ASP A CA  
499  C C   . ASP A 64  ? 0.6777 0.5713 0.6054 -0.0113 -0.0162 0.0114  65  ASP A C   
500  O O   . ASP A 64  ? 0.6881 0.5747 0.6160 -0.0129 -0.0238 0.0188  65  ASP A O   
501  C CB  . ASP A 64  ? 0.7262 0.6339 0.6916 0.0005  -0.0218 -0.0021 65  ASP A CB  
502  C CG  . ASP A 64  ? 0.7532 0.6728 0.7280 0.0016  -0.0261 -0.0062 65  ASP A CG  
503  O OD1 . ASP A 64  ? 0.7804 0.6971 0.7437 -0.0037 -0.0274 -0.0003 65  ASP A OD1 
504  O OD2 . ASP A 64  ? 0.7598 0.6942 0.7549 0.0079  -0.0283 -0.0166 65  ASP A OD2 
505  N N   . ALA A 65  ? 0.6818 0.5766 0.5968 -0.0152 -0.0118 0.0106  66  ALA A N   
506  C CA  . ALA A 65  ? 0.6705 0.5612 0.5698 -0.0206 -0.0146 0.0153  66  ALA A CA  
507  C C   . ALA A 65  ? 0.6740 0.5649 0.5781 -0.0219 -0.0259 0.0208  66  ALA A C   
508  O O   . ALA A 65  ? 0.6977 0.5860 0.5903 -0.0270 -0.0306 0.0283  66  ALA A O   
509  C CB  . ALA A 65  ? 0.6598 0.5512 0.5506 -0.0231 -0.0106 0.0103  66  ALA A CB  
510  N N   . SER A 66  ? 0.6505 0.5476 0.5723 -0.0179 -0.0307 0.0171  67  SER A N   
511  C CA  . SER A 66  ? 0.6754 0.5735 0.6070 -0.0175 -0.0432 0.0212  67  SER A CA  
512  C C   . SER A 66  ? 0.6843 0.5739 0.6248 -0.0161 -0.0537 0.0290  67  SER A C   
513  O O   . SER A 66  ? 0.6856 0.5733 0.6345 -0.0165 -0.0669 0.0349  67  SER A O   
514  C CB  . SER A 66  ? 0.6695 0.5808 0.6211 -0.0126 -0.0449 0.0126  67  SER A CB  
515  O OG  . SER A 66  ? 0.6704 0.5889 0.6143 -0.0167 -0.0380 0.0088  67  SER A OG  
516  N N   . ASP A 67  ? 0.6649 0.5488 0.6050 -0.0152 -0.0496 0.0301  68  ASP A N   
517  C CA  . ASP A 67  ? 0.6738 0.5475 0.6221 -0.0161 -0.0606 0.0395  68  ASP A CA  
518  C C   . ASP A 67  ? 0.6684 0.5380 0.5948 -0.0260 -0.0582 0.0518  68  ASP A C   
519  O O   . ASP A 67  ? 0.6887 0.5506 0.6195 -0.0297 -0.0669 0.0624  68  ASP A O   
520  C CB  . ASP A 67  ? 0.6735 0.5452 0.6427 -0.0077 -0.0607 0.0310  68  ASP A CB  
521  C CG  . ASP A 67  ? 0.6941 0.5755 0.6885 0.0022  -0.0649 0.0173  68  ASP A CG  
522  O OD1 . ASP A 67  ? 0.6961 0.5801 0.6997 0.0035  -0.0749 0.0184  68  ASP A OD1 
523  O OD2 . ASP A 67  ? 0.6935 0.5829 0.6988 0.0087  -0.0583 0.0048  68  ASP A OD2 
524  N N   . SER A 68  ? 0.6487 0.5252 0.5532 -0.0306 -0.0471 0.0496  69  SER A N   
525  C CA  . SER A 68  ? 0.6383 0.5184 0.5220 -0.0395 -0.0427 0.0575  69  SER A CA  
526  C C   . SER A 68  ? 0.6532 0.5410 0.5182 -0.0477 -0.0461 0.0629  69  SER A C   
527  O O   . SER A 68  ? 0.6562 0.5485 0.5140 -0.0461 -0.0414 0.0537  69  SER A O   
528  C CB  . SER A 68  ? 0.6184 0.5029 0.4939 -0.0371 -0.0273 0.0477  69  SER A CB  
529  O OG  . SER A 68  ? 0.6365 0.5292 0.4946 -0.0449 -0.0227 0.0530  69  SER A OG  
530  N N   . SER A 69  ? 0.6621 0.5524 0.5193 -0.0577 -0.0553 0.0785  70  SER A N   
531  C CA  . SER A 69  ? 0.6754 0.5768 0.5128 -0.0674 -0.0596 0.0850  70  SER A CA  
532  C C   . SER A 69  ? 0.6720 0.5908 0.4850 -0.0726 -0.0461 0.0779  70  SER A C   
533  O O   . SER A 69  ? 0.6843 0.6163 0.4792 -0.0797 -0.0474 0.0782  70  SER A O   
534  C CB  . SER A 69  ? 0.6915 0.5912 0.5297 -0.0779 -0.0767 0.1066  70  SER A CB  
535  O OG  . SER A 69  ? 0.7344 0.6411 0.5634 -0.0876 -0.0745 0.1177  70  SER A OG  
536  N N   . SER A 70  ? 0.6595 0.5797 0.4736 -0.0685 -0.0338 0.0699  71  SER A N   
537  C CA  . SER A 70  ? 0.6595 0.5977 0.4557 -0.0713 -0.0213 0.0606  71  SER A CA  
538  C C   . SER A 70  ? 0.6558 0.5893 0.4562 -0.0601 -0.0106 0.0403  71  SER A C   
539  O O   . SER A 70  ? 0.6655 0.6113 0.4563 -0.0591 -0.0011 0.0285  71  SER A O   
540  C CB  . SER A 70  ? 0.6437 0.5908 0.4380 -0.0775 -0.0173 0.0693  71  SER A CB  
541  O OG  . SER A 70  ? 0.6431 0.5732 0.4572 -0.0700 -0.0170 0.0695  71  SER A OG  
542  N N   . TYR A 71  ? 0.6339 0.5511 0.4499 -0.0521 -0.0135 0.0366  72  TYR A N   
543  C CA  . TYR A 71  ? 0.6463 0.5575 0.4677 -0.0440 -0.0071 0.0218  72  TYR A CA  
544  C C   . TYR A 71  ? 0.6599 0.5775 0.4685 -0.0454 -0.0068 0.0110  72  TYR A C   
545  O O   . TYR A 71  ? 0.6900 0.6127 0.4900 -0.0510 -0.0139 0.0149  72  TYR A O   
546  C CB  . TYR A 71  ? 0.6385 0.5374 0.4780 -0.0386 -0.0119 0.0228  72  TYR A CB  
547  C CG  . TYR A 71  ? 0.6279 0.5220 0.4722 -0.0341 -0.0093 0.0120  72  TYR A CG  
548  C CD1 . TYR A 71  ? 0.6080 0.4982 0.4573 -0.0295 -0.0019 0.0049  72  TYR A CD1 
549  C CD2 . TYR A 71  ? 0.6452 0.5386 0.4901 -0.0358 -0.0158 0.0105  72  TYR A CD2 
550  C CE1 . TYR A 71  ? 0.6131 0.4980 0.4677 -0.0277 -0.0020 -0.0016 72  TYR A CE1 
551  C CE2 . TYR A 71  ? 0.6351 0.5241 0.4855 -0.0340 -0.0150 0.0029  72  TYR A CE2 
552  C CZ  . TYR A 71  ? 0.6185 0.5029 0.4737 -0.0305 -0.0085 -0.0022 72  TYR A CZ  
553  O OH  . TYR A 71  ? 0.6195 0.4988 0.4807 -0.0308 -0.0099 -0.0066 72  TYR A OH  
554  N N   . LYS A 72  ? 0.6648 0.5817 0.4734 -0.0401 0.0000  -0.0030 73  LYS A N   
555  C CA  . LYS A 72  ? 0.6913 0.6104 0.4927 -0.0394 -0.0012 -0.0168 73  LYS A CA  
556  C C   . LYS A 72  ? 0.6822 0.5855 0.4973 -0.0328 -0.0011 -0.0253 73  LYS A C   
557  O O   . LYS A 72  ? 0.6765 0.5757 0.4989 -0.0276 0.0042  -0.0295 73  LYS A O   
558  C CB  . LYS A 72  ? 0.7034 0.6418 0.4904 -0.0408 0.0044  -0.0280 73  LYS A CB  
559  C CG  . LYS A 72  ? 0.7350 0.6938 0.5050 -0.0511 0.0029  -0.0180 73  LYS A CG  
560  C CD  . LYS A 72  ? 0.7985 0.7816 0.5519 -0.0537 0.0063  -0.0335 73  LYS A CD  
561  C CE  . LYS A 72  ? 0.8003 0.8062 0.5342 -0.0668 0.0026  -0.0215 73  LYS A CE  
562  N NZ  . LYS A 72  ? 0.8109 0.8375 0.5380 -0.0738 0.0090  -0.0118 73  LYS A NZ  
563  N N   . HIS A 73  ? 0.6775 0.5728 0.4965 -0.0342 -0.0083 -0.0259 74  HIS A N   
564  C CA  . HIS A 73  ? 0.6718 0.5532 0.5039 -0.0315 -0.0109 -0.0299 74  HIS A CA  
565  C C   . HIS A 73  ? 0.6957 0.5720 0.5282 -0.0272 -0.0106 -0.0453 74  HIS A C   
566  O O   . HIS A 73  ? 0.7178 0.6031 0.5397 -0.0266 -0.0103 -0.0571 74  HIS A O   
567  C CB  . HIS A 73  ? 0.6700 0.5483 0.5051 -0.0361 -0.0195 -0.0269 74  HIS A CB  
568  C CG  . HIS A 73  ? 0.6852 0.5517 0.5321 -0.0366 -0.0240 -0.0297 74  HIS A CG  
569  N ND1 . HIS A 73  ? 0.6983 0.5570 0.5443 -0.0377 -0.0307 -0.0407 74  HIS A ND1 
570  C CD2 . HIS A 73  ? 0.6688 0.5313 0.5291 -0.0377 -0.0241 -0.0223 74  HIS A CD2 
571  C CE1 . HIS A 73  ? 0.6779 0.5258 0.5369 -0.0402 -0.0357 -0.0377 74  HIS A CE1 
572  N NE2 . HIS A 73  ? 0.6708 0.5229 0.5374 -0.0409 -0.0311 -0.0261 74  HIS A NE2 
573  N N   . ASN A 74  ? 0.7108 0.5745 0.5563 -0.0242 -0.0112 -0.0454 75  ASN A N   
574  C CA  . ASN A 74  ? 0.7443 0.5969 0.5966 -0.0204 -0.0162 -0.0587 75  ASN A CA  
575  C C   . ASN A 74  ? 0.7306 0.5674 0.5966 -0.0241 -0.0241 -0.0515 75  ASN A C   
576  O O   . ASN A 74  ? 0.7507 0.5783 0.6202 -0.0272 -0.0337 -0.0563 75  ASN A O   
577  C CB  . ASN A 74  ? 0.8030 0.6583 0.6581 -0.0128 -0.0103 -0.0673 75  ASN A CB  
578  C CG  . ASN A 74  ? 0.8675 0.7104 0.7332 -0.0071 -0.0180 -0.0835 75  ASN A CG  
579  O OD1 . ASN A 74  ? 0.8887 0.7156 0.7686 -0.0061 -0.0237 -0.0793 75  ASN A OD1 
580  N ND2 . ASN A 74  ? 0.9172 0.7684 0.7771 -0.0036 -0.0197 -0.1022 75  ASN A ND2 
581  N N   . GLY A 75  ? 0.6893 0.5253 0.5628 -0.0250 -0.0206 -0.0395 76  GLY A N   
582  C CA  . GLY A 75  ? 0.6735 0.5024 0.5578 -0.0316 -0.0268 -0.0291 76  GLY A CA  
583  C C   . GLY A 75  ? 0.7141 0.5266 0.6103 -0.0321 -0.0352 -0.0298 76  GLY A C   
584  O O   . GLY A 75  ? 0.7201 0.5287 0.6245 -0.0404 -0.0416 -0.0186 76  GLY A O   
585  N N   . THR A 76  ? 0.7228 0.5273 0.6212 -0.0240 -0.0365 -0.0423 77  THR A N   
586  C CA  . THR A 76  ? 0.7589 0.5456 0.6720 -0.0229 -0.0467 -0.0429 77  THR A CA  
587  C C   . THR A 76  ? 0.7590 0.5486 0.6769 -0.0264 -0.0435 -0.0270 77  THR A C   
588  O O   . THR A 76  ? 0.7267 0.5293 0.6387 -0.0223 -0.0318 -0.0254 77  THR A O   
589  C CB  . THR A 76  ? 0.7568 0.5385 0.6742 -0.0110 -0.0480 -0.0623 77  THR A CB  
590  O OG1 . THR A 76  ? 0.7940 0.5799 0.7042 -0.0078 -0.0489 -0.0792 77  THR A OG1 
591  C CG2 . THR A 76  ? 0.7584 0.5175 0.6950 -0.0095 -0.0633 -0.0641 77  THR A CG2 
592  N N   . GLU A 77  ? 0.7685 0.5471 0.6970 -0.0352 -0.0548 -0.0151 78  GLU A N   
593  C CA  . GLU A 77  ? 0.8001 0.5837 0.7325 -0.0410 -0.0539 0.0009  78  GLU A CA  
594  C C   . GLU A 77  ? 0.7840 0.5616 0.7220 -0.0316 -0.0532 -0.0041 78  GLU A C   
595  O O   . GLU A 77  ? 0.7910 0.5534 0.7375 -0.0234 -0.0608 -0.0173 78  GLU A O   
596  C CB  . GLU A 77  ? 0.8756 0.6503 0.8179 -0.0551 -0.0684 0.0166  78  GLU A CB  
597  C CG  . GLU A 77  ? 1.0080 0.7938 0.9469 -0.0666 -0.0690 0.0242  78  GLU A CG  
598  C CD  . GLU A 77  ? 1.1098 0.9247 1.0395 -0.0689 -0.0540 0.0297  78  GLU A CD  
599  O OE1 . GLU A 77  ? 1.1652 0.9898 1.0892 -0.0676 -0.0486 0.0240  78  GLU A OE1 
600  O OE2 . GLU A 77  ? 1.1744 1.0028 1.1037 -0.0717 -0.0485 0.0388  78  GLU A OE2 
601  N N   . LEU A 78  ? 0.7655 0.5569 0.6999 -0.0320 -0.0439 0.0041  79  LEU A N   
602  C CA  . LEU A 78  ? 0.7799 0.5666 0.7210 -0.0251 -0.0447 0.0024  79  LEU A CA  
603  C C   . LEU A 78  ? 0.7605 0.5586 0.7012 -0.0323 -0.0423 0.0186  79  LEU A C   
604  O O   . LEU A 78  ? 0.7407 0.5580 0.6725 -0.0374 -0.0326 0.0249  79  LEU A O   
605  C CB  . LEU A 78  ? 0.7723 0.5657 0.7090 -0.0120 -0.0339 -0.0142 79  LEU A CB  
606  C CG  . LEU A 78  ? 0.7642 0.5765 0.6916 -0.0091 -0.0188 -0.0132 79  LEU A CG  
607  C CD1 . LEU A 78  ? 0.7599 0.5756 0.6887 0.0021  -0.0136 -0.0281 79  LEU A CD1 
608  C CD2 . LEU A 78  ? 0.7707 0.5961 0.6861 -0.0134 -0.0104 -0.0106 79  LEU A CD2 
609  N N   . THR A 79  ? 0.7536 0.5400 0.7053 -0.0322 -0.0527 0.0241  80  THR A N   
610  C CA  . THR A 79  ? 0.7283 0.5248 0.6800 -0.0388 -0.0528 0.0389  80  THR A CA  
611  C C   . THR A 79  ? 0.7113 0.5060 0.6682 -0.0269 -0.0497 0.0306  80  THR A C   
612  O O   . THR A 79  ? 0.7309 0.5085 0.7001 -0.0177 -0.0584 0.0205  80  THR A O   
613  C CB  . THR A 79  ? 0.7299 0.5149 0.6909 -0.0524 -0.0710 0.0571  80  THR A CB  
614  O OG1 . THR A 79  ? 0.7247 0.5161 0.6808 -0.0646 -0.0724 0.0649  80  THR A OG1 
615  C CG2 . THR A 79  ? 0.7041 0.5021 0.6638 -0.0607 -0.0723 0.0737  80  THR A CG2 
616  N N   . LEU A 80  ? 0.6605 0.4743 0.6094 -0.0266 -0.0377 0.0332  81  LEU A N   
617  C CA  . LEU A 80  ? 0.6441 0.4604 0.5971 -0.0172 -0.0337 0.0272  81  LEU A CA  
618  C C   . LEU A 80  ? 0.6651 0.4887 0.6196 -0.0252 -0.0386 0.0428  81  LEU A C   
619  O O   . LEU A 80  ? 0.6554 0.4977 0.5999 -0.0343 -0.0324 0.0516  81  LEU A O   
620  C CB  . LEU A 80  ? 0.6123 0.4443 0.5555 -0.0105 -0.0168 0.0165  81  LEU A CB  
621  C CG  . LEU A 80  ? 0.6017 0.4316 0.5399 -0.0051 -0.0113 0.0034  81  LEU A CG  
622  C CD1 . LEU A 80  ? 0.5635 0.4094 0.4913 -0.0035 0.0025  0.0000  81  LEU A CD1 
623  C CD2 . LEU A 80  ? 0.6120 0.4317 0.5598 0.0053  -0.0156 -0.0109 81  LEU A CD2 
624  N N   . ARG A 81  ? 0.7164 0.5265 0.6843 -0.0219 -0.0510 0.0454  82  ARG A N   
625  C CA  . ARG A 81  ? 0.7607 0.5758 0.7310 -0.0305 -0.0593 0.0623  82  ARG A CA  
626  C C   . ARG A 81  ? 0.7616 0.5848 0.7349 -0.0212 -0.0531 0.0557  82  ARG A C   
627  O O   . ARG A 81  ? 0.8250 0.6372 0.8111 -0.0086 -0.0561 0.0436  82  ARG A O   
628  C CB  . ARG A 81  ? 0.7905 0.5826 0.7760 -0.0359 -0.0821 0.0743  82  ARG A CB  
629  C CG  . ARG A 81  ? 0.8362 0.6277 0.8169 -0.0530 -0.0904 0.0909  82  ARG A CG  
630  C CD  . ARG A 81  ? 0.9208 0.6820 0.9194 -0.0561 -0.1140 0.0975  82  ARG A CD  
631  N NE  . ARG A 81  ? 1.0191 0.7674 1.0324 -0.0588 -0.1331 0.1114  82  ARG A NE  
632  C CZ  . ARG A 81  ? 1.0622 0.7861 1.0918 -0.0673 -0.1585 0.1263  82  ARG A CZ  
633  N NH1 . ARG A 81  ? 1.0744 0.7838 1.1076 -0.0748 -0.1678 0.1293  82  ARG A NH1 
634  N NH2 . ARG A 81  ? 1.0583 0.7714 1.1018 -0.0691 -0.1763 0.1393  82  ARG A NH2 
635  N N   . TYR A 82  ? 0.7187 0.5636 0.6810 -0.0272 -0.0444 0.0621  83  TYR A N   
636  C CA  . TYR A 82  ? 0.6885 0.5431 0.6530 -0.0213 -0.0397 0.0586  83  TYR A CA  
637  C C   . TYR A 82  ? 0.6964 0.5569 0.6621 -0.0318 -0.0513 0.0766  83  TYR A C   
638  O O   . TYR A 82  ? 0.7071 0.5669 0.6702 -0.0449 -0.0615 0.0925  83  TYR A O   
639  C CB  . TYR A 82  ? 0.6629 0.5374 0.6151 -0.0193 -0.0218 0.0496  83  TYR A CB  
640  C CG  . TYR A 82  ? 0.6581 0.5283 0.6077 -0.0115 -0.0119 0.0354  83  TYR A CG  
641  C CD1 . TYR A 82  ? 0.6388 0.5094 0.5804 -0.0165 -0.0091 0.0358  83  TYR A CD1 
642  C CD2 . TYR A 82  ? 0.6395 0.5080 0.5946 -0.0003 -0.0059 0.0223  83  TYR A CD2 
643  C CE1 . TYR A 82  ? 0.6253 0.4924 0.5639 -0.0105 -0.0017 0.0244  83  TYR A CE1 
644  C CE2 . TYR A 82  ? 0.6370 0.5046 0.5878 0.0044  0.0021  0.0114  83  TYR A CE2 
645  C CZ  . TYR A 82  ? 0.6422 0.5080 0.5846 -0.0005 0.0037  0.0129  83  TYR A CZ  
646  O OH  . TYR A 82  ? 0.6453 0.5108 0.5828 0.0032  0.0104  0.0036  83  TYR A OH  
647  N N   . SER A 83  ? 0.7365 0.6045 0.7060 -0.0273 -0.0504 0.0752  84  SER A N   
648  C CA  . SER A 83  ? 0.7648 0.6411 0.7347 -0.0369 -0.0614 0.0919  84  SER A CA  
649  C C   . SER A 83  ? 0.7492 0.6510 0.7012 -0.0531 -0.0573 0.1038  84  SER A C   
650  O O   . SER A 83  ? 0.7425 0.6500 0.6924 -0.0671 -0.0700 0.1231  84  SER A O   
651  C CB  . SER A 83  ? 0.7619 0.6464 0.7371 -0.0283 -0.0573 0.0846  84  SER A CB  
652  O OG  . SER A 83  ? 0.8618 0.7288 0.8558 -0.0140 -0.0624 0.0740  84  SER A OG  
653  N N   . THR A 84  ? 0.7067 0.6256 0.6473 -0.0514 -0.0403 0.0918  85  THR A N   
654  C CA  . THR A 84  ? 0.7011 0.6508 0.6271 -0.0630 -0.0335 0.0956  85  THR A CA  
655  C C   . THR A 84  ? 0.7024 0.6599 0.6209 -0.0698 -0.0285 0.0957  85  THR A C   
656  O O   . THR A 84  ? 0.7356 0.7227 0.6436 -0.0798 -0.0230 0.0975  85  THR A O   
657  C CB  . THR A 84  ? 0.6962 0.6618 0.6183 -0.0552 -0.0198 0.0797  85  THR A CB  
658  O OG1 . THR A 84  ? 0.6904 0.6436 0.6158 -0.0430 -0.0097 0.0639  85  THR A OG1 
659  C CG2 . THR A 84  ? 0.6814 0.6448 0.6101 -0.0508 -0.0250 0.0810  85  THR A CG2 
660  N N   . GLY A 85  ? 0.6631 0.5971 0.5880 -0.0643 -0.0306 0.0924  86  GLY A N   
661  C CA  . GLY A 85  ? 0.6623 0.6018 0.5821 -0.0705 -0.0272 0.0928  86  GLY A CA  
662  C C   . GLY A 85  ? 0.6699 0.5831 0.5964 -0.0622 -0.0284 0.0853  86  GLY A C   
663  O O   . GLY A 85  ? 0.6600 0.5523 0.5951 -0.0499 -0.0299 0.0766  86  GLY A O   
664  N N   . THR A 86  ? 0.6670 0.5853 0.5895 -0.0693 -0.0273 0.0876  87  THR A N   
665  C CA  . THR A 86  ? 0.6731 0.5688 0.6010 -0.0646 -0.0307 0.0826  87  THR A CA  
666  C C   . THR A 86  ? 0.6771 0.5845 0.5986 -0.0618 -0.0182 0.0714  87  THR A C   
667  O O   . THR A 86  ? 0.6672 0.6015 0.5824 -0.0690 -0.0116 0.0728  87  THR A O   
668  C CB  . THR A 86  ? 0.6840 0.5694 0.6166 -0.0783 -0.0470 0.1002  87  THR A CB  
669  O OG1 . THR A 86  ? 0.6966 0.5707 0.6370 -0.0810 -0.0609 0.1121  87  THR A OG1 
670  C CG2 . THR A 86  ? 0.6776 0.5371 0.6175 -0.0733 -0.0531 0.0939  87  THR A CG2 
671  N N   . VAL A 87  ? 0.6886 0.5782 0.6127 -0.0511 -0.0154 0.0593  88  VAL A N   
672  C CA  . VAL A 87  ? 0.6794 0.5756 0.5991 -0.0495 -0.0075 0.0512  88  VAL A CA  
673  C C   . VAL A 87  ? 0.6873 0.5640 0.6104 -0.0503 -0.0152 0.0509  88  VAL A C   
674  O O   . VAL A 87  ? 0.7246 0.5793 0.6544 -0.0456 -0.0237 0.0491  88  VAL A O   
675  C CB  . VAL A 87  ? 0.6666 0.5655 0.5838 -0.0377 0.0040  0.0368  88  VAL A CB  
676  C CG1 . VAL A 87  ? 0.6504 0.5719 0.5651 -0.0384 0.0113  0.0352  88  VAL A CG1 
677  C CG2 . VAL A 87  ? 0.7097 0.5907 0.6305 -0.0271 0.0036  0.0294  88  VAL A CG2 
678  N N   . SER A 88  ? 0.6790 0.5654 0.5991 -0.0557 -0.0130 0.0511  89  SER A N   
679  C CA  . SER A 88  ? 0.6676 0.5379 0.5902 -0.0569 -0.0199 0.0497  89  SER A CA  
680  C C   . SER A 88  ? 0.6393 0.5175 0.5572 -0.0524 -0.0113 0.0397  89  SER A C   
681  O O   . SER A 88  ? 0.6205 0.5197 0.5356 -0.0521 -0.0025 0.0375  89  SER A O   
682  C CB  . SER A 88  ? 0.6857 0.5585 0.6118 -0.0728 -0.0312 0.0654  89  SER A CB  
683  O OG  . SER A 88  ? 0.6966 0.5483 0.6276 -0.0738 -0.0411 0.0639  89  SER A OG  
684  N N   . GLY A 89  ? 0.6294 0.4908 0.5477 -0.0483 -0.0151 0.0328  90  GLY A N   
685  C CA  . GLY A 89  ? 0.6038 0.4702 0.5176 -0.0448 -0.0096 0.0248  90  GLY A CA  
686  C C   . GLY A 89  ? 0.6294 0.4768 0.5424 -0.0405 -0.0151 0.0165  90  GLY A C   
687  O O   . GLY A 89  ? 0.6587 0.4909 0.5773 -0.0442 -0.0260 0.0185  90  GLY A O   
688  N N   . PHE A 90  ? 0.6273 0.4765 0.5340 -0.0333 -0.0088 0.0070  91  PHE A N   
689  C CA  . PHE A 90  ? 0.6474 0.4850 0.5510 -0.0299 -0.0129 -0.0025 91  PHE A CA  
690  C C   . PHE A 90  ? 0.6417 0.4827 0.5379 -0.0211 -0.0051 -0.0122 91  PHE A C   
691  O O   . PHE A 90  ? 0.6093 0.4606 0.5030 -0.0190 0.0026  -0.0097 91  PHE A O   
692  C CB  . PHE A 90  ? 0.6438 0.4849 0.5457 -0.0361 -0.0166 -0.0008 91  PHE A CB  
693  C CG  . PHE A 90  ? 0.6310 0.4887 0.5290 -0.0358 -0.0095 0.0010  91  PHE A CG  
694  C CD1 . PHE A 90  ? 0.6508 0.5103 0.5408 -0.0307 -0.0060 -0.0052 91  PHE A CD1 
695  C CD2 . PHE A 90  ? 0.6346 0.5080 0.5382 -0.0409 -0.0074 0.0087  91  PHE A CD2 
696  C CE1 . PHE A 90  ? 0.6544 0.5261 0.5441 -0.0302 -0.0025 -0.0024 91  PHE A CE1 
697  C CE2 . PHE A 90  ? 0.6328 0.5207 0.5370 -0.0387 -0.0028 0.0078  91  PHE A CE2 
698  C CZ  . PHE A 90  ? 0.6384 0.5230 0.5367 -0.0331 -0.0014 0.0029  91  PHE A CZ  
699  N N   . LEU A 91  ? 0.6626 0.4968 0.5559 -0.0170 -0.0079 -0.0237 92  LEU A N   
700  C CA  . LEU A 91  ? 0.6679 0.5106 0.5531 -0.0109 -0.0007 -0.0327 92  LEU A CA  
701  C C   . LEU A 91  ? 0.6703 0.5234 0.5446 -0.0139 0.0025  -0.0310 92  LEU A C   
702  O O   . LEU A 91  ? 0.7145 0.5656 0.5870 -0.0182 -0.0028 -0.0299 92  LEU A O   
703  C CB  . LEU A 91  ? 0.6932 0.5304 0.5806 -0.0048 -0.0046 -0.0485 92  LEU A CB  
704  C CG  . LEU A 91  ? 0.7262 0.5543 0.6267 0.0009  -0.0083 -0.0527 92  LEU A CG  
705  C CD1 . LEU A 91  ? 0.7477 0.5698 0.6545 0.0081  -0.0151 -0.0720 92  LEU A CD1 
706  C CD2 . LEU A 91  ? 0.7196 0.5595 0.6194 0.0046  0.0014  -0.0503 92  LEU A CD2 
707  N N   . SER A 92  ? 0.6483 0.5125 0.5164 -0.0123 0.0098  -0.0296 93  SER A N   
708  C CA  . SER A 92  ? 0.6515 0.5255 0.5091 -0.0156 0.0112  -0.0266 93  SER A CA  
709  C C   . SER A 92  ? 0.6645 0.5510 0.5139 -0.0141 0.0173  -0.0309 93  SER A C   
710  O O   . SER A 92  ? 0.6656 0.5540 0.5197 -0.0100 0.0218  -0.0345 93  SER A O   
711  C CB  . SER A 92  ? 0.6206 0.4968 0.4825 -0.0182 0.0113  -0.0147 93  SER A CB  
712  O OG  . SER A 92  ? 0.6412 0.5132 0.5097 -0.0208 0.0062  -0.0117 93  SER A OG  
713  N N   . GLN A 93  ? 0.6874 0.5847 0.5248 -0.0186 0.0170  -0.0299 94  GLN A N   
714  C CA  . GLN A 93  ? 0.7021 0.6171 0.5297 -0.0208 0.0226  -0.0306 94  GLN A CA  
715  C C   . GLN A 93  ? 0.7075 0.6271 0.5306 -0.0279 0.0208  -0.0145 94  GLN A C   
716  O O   . GLN A 93  ? 0.7018 0.6167 0.5233 -0.0315 0.0141  -0.0077 94  GLN A O   
717  C CB  . GLN A 93  ? 0.7279 0.6564 0.5438 -0.0216 0.0225  -0.0441 94  GLN A CB  
718  C CG  . GLN A 93  ? 0.7623 0.7170 0.5673 -0.0250 0.0295  -0.0473 94  GLN A CG  
719  C CD  . GLN A 93  ? 0.8052 0.7788 0.5964 -0.0273 0.0290  -0.0612 94  GLN A CD  
720  O OE1 . GLN A 93  ? 0.8182 0.7898 0.6140 -0.0200 0.0278  -0.0805 94  GLN A OE1 
721  N NE2 . GLN A 93  ? 0.8282 0.8205 0.6031 -0.0379 0.0286  -0.0514 94  GLN A NE2 
722  N N   . ASP A 94  ? 0.6978 0.6256 0.5213 -0.0299 0.0253  -0.0082 95  ASP A N   
723  C CA  . ASP A 94  ? 0.7069 0.6388 0.5274 -0.0379 0.0215  0.0078  95  ASP A CA  
724  C C   . ASP A 94  ? 0.7210 0.6694 0.5376 -0.0427 0.0272  0.0120  95  ASP A C   
725  O O   . ASP A 94  ? 0.7242 0.6816 0.5420 -0.0384 0.0351  0.0012  95  ASP A O   
726  C CB  . ASP A 94  ? 0.6770 0.5917 0.5125 -0.0352 0.0160  0.0163  95  ASP A CB  
727  C CG  . ASP A 94  ? 0.6716 0.5837 0.5073 -0.0414 0.0059  0.0299  95  ASP A CG  
728  O OD1 . ASP A 94  ? 0.6728 0.5955 0.4986 -0.0504 0.0031  0.0397  95  ASP A OD1 
729  O OD2 . ASP A 94  ? 0.6600 0.5609 0.5072 -0.0377 -0.0001 0.0310  95  ASP A OD2 
730  N N   . ILE A 95  ? 0.7442 0.6969 0.5574 -0.0523 0.0218  0.0283  96  ILE A N   
731  C CA  . ILE A 95  ? 0.7851 0.7516 0.5971 -0.0598 0.0247  0.0374  96  ILE A CA  
732  C C   . ILE A 95  ? 0.7793 0.7309 0.6086 -0.0536 0.0258  0.0383  96  ILE A C   
733  O O   . ILE A 95  ? 0.8167 0.7485 0.6582 -0.0492 0.0191  0.0416  96  ILE A O   
734  C CB  . ILE A 95  ? 0.8486 0.8205 0.6529 -0.0738 0.0146  0.0575  96  ILE A CB  
735  C CG1 . ILE A 95  ? 0.8874 0.8870 0.6703 -0.0829 0.0173  0.0558  96  ILE A CG1 
736  C CG2 . ILE A 95  ? 0.8831 0.8565 0.6945 -0.0820 0.0116  0.0730  96  ILE A CG2 
737  C CD1 . ILE A 95  ? 0.9438 0.9436 0.7173 -0.0941 0.0047  0.0724  96  ILE A CD1 
738  N N   . ILE A 96  ? 0.7570 0.7212 0.5881 -0.0527 0.0342  0.0333  97  ILE A N   
739  C CA  . ILE A 96  ? 0.7315 0.6853 0.5775 -0.0483 0.0353  0.0344  97  ILE A CA  
740  C C   . ILE A 96  ? 0.7283 0.6980 0.5740 -0.0586 0.0366  0.0452  97  ILE A C   
741  O O   . ILE A 96  ? 0.7500 0.7456 0.5862 -0.0635 0.0439  0.0419  97  ILE A O   
742  C CB  . ILE A 96  ? 0.7219 0.6724 0.5751 -0.0364 0.0427  0.0183  97  ILE A CB  
743  C CG1 . ILE A 96  ? 0.6979 0.6316 0.5532 -0.0288 0.0396  0.0110  97  ILE A CG1 
744  C CG2 . ILE A 96  ? 0.6844 0.6289 0.5510 -0.0336 0.0438  0.0203  97  ILE A CG2 
745  C CD1 . ILE A 96  ? 0.6851 0.6121 0.5486 -0.0192 0.0432  -0.0005 97  ILE A CD1 
746  N N   . THR A 97  ? 0.7291 0.6852 0.5862 -0.0621 0.0287  0.0572  98  THR A N   
747  C CA  . THR A 97  ? 0.7403 0.7079 0.6007 -0.0722 0.0283  0.0684  98  THR A CA  
748  C C   . THR A 97  ? 0.7347 0.6968 0.6090 -0.0643 0.0330  0.0604  98  THR A C   
749  O O   . THR A 97  ? 0.7314 0.6731 0.6167 -0.0545 0.0299  0.0543  98  THR A O   
750  C CB  . THR A 97  ? 0.7625 0.7194 0.6278 -0.0842 0.0135  0.0892  98  THR A CB  
751  O OG1 . THR A 97  ? 0.8028 0.7317 0.6812 -0.0757 0.0034  0.0876  98  THR A OG1 
752  C CG2 . THR A 97  ? 0.7907 0.7636 0.6394 -0.0977 0.0096  0.1018  98  THR A CG2 
753  N N   . VAL A 98  ? 0.7140 0.6982 0.5872 -0.0691 0.0405  0.0600  99  VAL A N   
754  C CA  . VAL A 98  ? 0.6843 0.6687 0.5699 -0.0634 0.0450  0.0536  99  VAL A CA  
755  C C   . VAL A 98  ? 0.7030 0.7124 0.5882 -0.0769 0.0473  0.0640  99  VAL A C   
756  O O   . VAL A 98  ? 0.7149 0.7542 0.5894 -0.0826 0.0552  0.0618  99  VAL A O   
757  C CB  . VAL A 98  ? 0.6679 0.6549 0.5544 -0.0491 0.0543  0.0343  99  VAL A CB  
758  C CG1 . VAL A 98  ? 0.6685 0.6770 0.5428 -0.0485 0.0616  0.0248  99  VAL A CG1 
759  C CG2 . VAL A 98  ? 0.6522 0.6450 0.5507 -0.0449 0.0587  0.0289  99  VAL A CG2 
760  N N   . GLY A 99  ? 0.7000 0.6988 0.5974 -0.0827 0.0397  0.0748  100 GLY A N   
761  C CA  . GLY A 99  ? 0.7039 0.7234 0.6034 -0.0987 0.0386  0.0891  100 GLY A CA  
762  C C   . GLY A 99  ? 0.7513 0.7895 0.6372 -0.1167 0.0349  0.1064  100 GLY A C   
763  O O   . GLY A 99  ? 0.7644 0.8367 0.6447 -0.1297 0.0408  0.1131  100 GLY A O   
764  N N   . GLY A 100 ? 0.7498 0.7694 0.6302 -0.1183 0.0249  0.1141  101 GLY A N   
765  C CA  . GLY A 100 ? 0.7990 0.8361 0.6647 -0.1359 0.0197  0.1319  101 GLY A CA  
766  C C   . GLY A 100 ? 0.8060 0.8791 0.6519 -0.1370 0.0335  0.1217  101 GLY A C   
767  O O   . GLY A 100 ? 0.8449 0.9434 0.6761 -0.1539 0.0318  0.1358  101 GLY A O   
768  N N   . ILE A 101 ? 0.7810 0.8573 0.6273 -0.1194 0.0459  0.0972  102 ILE A N   
769  C CA  . ILE A 101 ? 0.7829 0.8856 0.6138 -0.1157 0.0566  0.0820  102 ILE A CA  
770  C C   . ILE A 101 ? 0.7840 0.8586 0.6115 -0.1039 0.0519  0.0738  102 ILE A C   
771  O O   . ILE A 101 ? 0.7908 0.8344 0.6305 -0.0903 0.0491  0.0665  102 ILE A O   
772  C CB  . ILE A 101 ? 0.7775 0.9040 0.6140 -0.1046 0.0712  0.0594  102 ILE A CB  
773  C CG1 . ILE A 101 ? 0.7827 0.9505 0.6187 -0.1195 0.0773  0.0672  102 ILE A CG1 
774  C CG2 . ILE A 101 ? 0.7617 0.9031 0.5881 -0.0942 0.0791  0.0374  102 ILE A CG2 
775  C CD1 . ILE A 101 ? 0.7894 0.9720 0.6401 -0.1088 0.0874  0.0501  102 ILE A CD1 
776  N N   . THR A 102 ? 0.7829 0.8719 0.5932 -0.1107 0.0510  0.0759  103 THR A N   
777  C CA  . THR A 102 ? 0.7720 0.8407 0.5771 -0.1020 0.0466  0.0688  103 THR A CA  
778  C C   . THR A 102 ? 0.7689 0.8571 0.5663 -0.0917 0.0580  0.0439  103 THR A C   
779  O O   . THR A 102 ? 0.7754 0.9020 0.5603 -0.0992 0.0654  0.0386  103 THR A O   
780  C CB  . THR A 102 ? 0.8010 0.8712 0.5932 -0.1174 0.0350  0.0892  103 THR A CB  
781  O OG1 . THR A 102 ? 0.8107 0.8554 0.6156 -0.1237 0.0211  0.1099  103 THR A OG1 
782  C CG2 . THR A 102 ? 0.8208 0.8769 0.6060 -0.1098 0.0312  0.0810  103 THR A CG2 
783  N N   . VAL A 103 ? 0.7408 0.8040 0.5471 -0.0751 0.0585  0.0281  104 VAL A N   
784  C CA  . VAL A 103 ? 0.7398 0.8120 0.5422 -0.0642 0.0647  0.0047  104 VAL A CA  
785  C C   . VAL A 103 ? 0.7439 0.7880 0.5455 -0.0571 0.0575  0.0011  104 VAL A C   
786  O O   . VAL A 103 ? 0.7338 0.7476 0.5458 -0.0526 0.0512  0.0082  104 VAL A O   
787  C CB  . VAL A 103 ? 0.7335 0.8074 0.5506 -0.0503 0.0723  -0.0144 104 VAL A CB  
788  C CG1 . VAL A 103 ? 0.7762 0.8911 0.5919 -0.0552 0.0820  -0.0208 104 VAL A CG1 
789  C CG2 . VAL A 103 ? 0.7240 0.7681 0.5575 -0.0440 0.0688  -0.0077 104 VAL A CG2 
790  N N   . THR A 104 ? 0.7516 0.8091 0.5412 -0.0566 0.0585  -0.0110 105 THR A N   
791  C CA  . THR A 104 ? 0.7370 0.7716 0.5276 -0.0485 0.0529  -0.0195 105 THR A CA  
792  C C   . THR A 104 ? 0.7423 0.7629 0.5486 -0.0335 0.0558  -0.0374 105 THR A C   
793  O O   . THR A 104 ? 0.7578 0.7973 0.5670 -0.0277 0.0622  -0.0549 105 THR A O   
794  C CB  . THR A 104 ? 0.7242 0.7792 0.4975 -0.0533 0.0522  -0.0282 105 THR A CB  
795  O OG1 . THR A 104 ? 0.7089 0.7783 0.4675 -0.0693 0.0481  -0.0080 105 THR A OG1 
796  C CG2 . THR A 104 ? 0.7042 0.7346 0.4796 -0.0462 0.0451  -0.0356 105 THR A CG2 
797  N N   . GLN A 105 ? 0.7227 0.7122 0.5401 -0.0277 0.0503  -0.0325 106 GLN A N   
798  C CA  . GLN A 105 ? 0.7024 0.6762 0.5353 -0.0164 0.0509  -0.0425 106 GLN A CA  
799  C C   . GLN A 105 ? 0.7221 0.6699 0.5604 -0.0120 0.0434  -0.0435 106 GLN A C   
800  O O   . GLN A 105 ? 0.7114 0.6466 0.5488 -0.0161 0.0387  -0.0308 106 GLN A O   
801  C CB  . GLN A 105 ? 0.6883 0.6569 0.5315 -0.0165 0.0531  -0.0319 106 GLN A CB  
802  C CG  . GLN A 105 ? 0.6537 0.6092 0.5124 -0.0064 0.0532  -0.0396 106 GLN A CG  
803  C CD  . GLN A 105 ? 0.6487 0.6198 0.5132 0.0009  0.0573  -0.0575 106 GLN A CD  
804  O OE1 . GLN A 105 ? 0.6466 0.6452 0.5057 -0.0021 0.0637  -0.0628 106 GLN A OE1 
805  N NE2 . GLN A 105 ? 0.6437 0.5990 0.5207 0.0102  0.0528  -0.0670 106 GLN A NE2 
806  N N   . MET A 106 ? 0.7408 0.6820 0.5865 -0.0038 0.0414  -0.0589 107 MET A N   
807  C CA  . MET A 106 ? 0.7660 0.6825 0.6205 -0.0004 0.0339  -0.0583 107 MET A CA  
808  C C   . MET A 106 ? 0.7280 0.6327 0.5947 0.0018  0.0340  -0.0494 107 MET A C   
809  O O   . MET A 106 ? 0.7458 0.6570 0.6192 0.0058  0.0381  -0.0528 107 MET A O   
810  C CB  . MET A 106 ? 0.8498 0.7613 0.7106 0.0066  0.0289  -0.0767 107 MET A CB  
811  C CG  . MET A 106 ? 0.9746 0.8938 0.8241 0.0042  0.0261  -0.0864 107 MET A CG  
812  S SD  . MET A 106 ? 1.1028 0.9970 0.9547 0.0010  0.0149  -0.0808 107 MET A SD  
813  C CE  . MET A 106 ? 1.0819 0.9592 0.9515 0.0103  0.0055  -0.0987 107 MET A CE  
814  N N   . PHE A 107 ? 0.6780 0.5686 0.5475 -0.0010 0.0297  -0.0389 108 PHE A N   
815  C CA  . PHE A 107 ? 0.6430 0.5262 0.5218 -0.0003 0.0297  -0.0305 108 PHE A CA  
816  C C   . PHE A 107 ? 0.6288 0.4995 0.5121 -0.0028 0.0232  -0.0252 108 PHE A C   
817  O O   . PHE A 107 ? 0.6274 0.4949 0.5065 -0.0057 0.0191  -0.0259 108 PHE A O   
818  C CB  . PHE A 107 ? 0.6325 0.5233 0.5092 -0.0039 0.0341  -0.0205 108 PHE A CB  
819  C CG  . PHE A 107 ? 0.6227 0.5129 0.4941 -0.0089 0.0312  -0.0131 108 PHE A CG  
820  C CD1 . PHE A 107 ? 0.6127 0.5114 0.4736 -0.0130 0.0312  -0.0120 108 PHE A CD1 
821  C CD2 . PHE A 107 ? 0.6126 0.4968 0.4904 -0.0099 0.0278  -0.0074 108 PHE A CD2 
822  C CE1 . PHE A 107 ? 0.6128 0.5098 0.4710 -0.0174 0.0262  -0.0042 108 PHE A CE1 
823  C CE2 . PHE A 107 ? 0.6057 0.4905 0.4824 -0.0130 0.0240  -0.0023 108 PHE A CE2 
824  C CZ  . PHE A 107 ? 0.6067 0.4958 0.4742 -0.0165 0.0224  -0.0001 108 PHE A CZ  
825  N N   . GLY A 108 ? 0.6164 0.4829 0.5078 -0.0029 0.0221  -0.0194 109 GLY A N   
826  C CA  . GLY A 108 ? 0.6175 0.4784 0.5129 -0.0076 0.0167  -0.0127 109 GLY A CA  
827  C C   . GLY A 108 ? 0.6233 0.4930 0.5178 -0.0111 0.0194  -0.0059 109 GLY A C   
828  O O   . GLY A 108 ? 0.6212 0.4976 0.5172 -0.0096 0.0239  -0.0040 109 GLY A O   
829  N N   . GLU A 109 ? 0.6209 0.4912 0.5147 -0.0152 0.0158  -0.0038 110 GLU A N   
830  C CA  . GLU A 109 ? 0.6192 0.4999 0.5169 -0.0179 0.0165  0.0006  110 GLU A CA  
831  C C   . GLU A 109 ? 0.6121 0.4971 0.5154 -0.0230 0.0141  0.0056  110 GLU A C   
832  O O   . GLU A 109 ? 0.6275 0.5072 0.5316 -0.0281 0.0083  0.0084  110 GLU A O   
833  C CB  . GLU A 109 ? 0.6371 0.5197 0.5330 -0.0201 0.0132  0.0003  110 GLU A CB  
834  C CG  . GLU A 109 ? 0.6701 0.5523 0.5605 -0.0174 0.0141  -0.0009 110 GLU A CG  
835  C CD  . GLU A 109 ? 0.6962 0.5828 0.5884 -0.0193 0.0096  0.0006  110 GLU A CD  
836  O OE1 . GLU A 109 ? 0.6780 0.5736 0.5803 -0.0187 0.0088  0.0016  110 GLU A OE1 
837  O OE2 . GLU A 109 ? 0.6741 0.5572 0.5586 -0.0210 0.0063  -0.0001 110 GLU A OE2 
838  N N   . VAL A 110 ? 0.5815 0.4767 0.4884 -0.0227 0.0177  0.0074  111 VAL A N   
839  C CA  . VAL A 110 ? 0.5722 0.4759 0.4824 -0.0293 0.0157  0.0138  111 VAL A CA  
840  C C   . VAL A 110 ? 0.5834 0.5076 0.4974 -0.0349 0.0162  0.0151  111 VAL A C   
841  O O   . VAL A 110 ? 0.5768 0.5142 0.4947 -0.0310 0.0202  0.0092  111 VAL A O   
842  C CB  . VAL A 110 ? 0.5445 0.4519 0.4557 -0.0270 0.0188  0.0144  111 VAL A CB  
843  C CG1 . VAL A 110 ? 0.5447 0.4697 0.4579 -0.0351 0.0177  0.0211  111 VAL A CG1 
844  C CG2 . VAL A 110 ? 0.5425 0.4321 0.4530 -0.0232 0.0161  0.0141  111 VAL A CG2 
845  N N   . THR A 111 ? 0.5863 0.5137 0.5011 -0.0442 0.0109  0.0223  112 THR A N   
846  C CA  . THR A 111 ? 0.5744 0.5258 0.4936 -0.0514 0.0113  0.0241  112 THR A CA  
847  C C   . THR A 111 ? 0.5971 0.5699 0.5170 -0.0620 0.0111  0.0326  112 THR A C   
848  O O   . THR A 111 ? 0.5907 0.5924 0.5144 -0.0692 0.0130  0.0334  112 THR A O   
849  C CB  . THR A 111 ? 0.5725 0.5167 0.4924 -0.0570 0.0049  0.0273  112 THR A CB  
850  O OG1 . THR A 111 ? 0.6123 0.5343 0.5298 -0.0614 -0.0029 0.0341  112 THR A OG1 
851  C CG2 . THR A 111 ? 0.5788 0.5124 0.4977 -0.0485 0.0056  0.0189  112 THR A CG2 
852  N N   . GLU A 112 ? 0.6110 0.5723 0.5278 -0.0636 0.0082  0.0392  113 GLU A N   
853  C CA  . GLU A 112 ? 0.6322 0.6123 0.5478 -0.0752 0.0062  0.0501  113 GLU A CA  
854  C C   . GLU A 112 ? 0.6283 0.6054 0.5416 -0.0692 0.0090  0.0480  113 GLU A C   
855  O O   . GLU A 112 ? 0.5999 0.5512 0.5130 -0.0640 0.0048  0.0495  113 GLU A O   
856  C CB  . GLU A 112 ? 0.6747 0.6423 0.5910 -0.0880 -0.0057 0.0661  113 GLU A CB  
857  C CG  . GLU A 112 ? 0.7219 0.7007 0.6410 -0.0981 -0.0089 0.0705  113 GLU A CG  
858  C CD  . GLU A 112 ? 0.7956 0.7522 0.7177 -0.1088 -0.0233 0.0844  113 GLU A CD  
859  O OE1 . GLU A 112 ? 0.8410 0.7639 0.7651 -0.1003 -0.0292 0.0794  113 GLU A OE1 
860  O OE2 . GLU A 112 ? 0.8212 0.7955 0.7445 -0.1263 -0.0295 0.0999  113 GLU A OE2 
861  N N   . MET A 113 ? 0.6230 0.6289 0.5360 -0.0694 0.0160  0.0426  114 MET A N   
862  C CA  . MET A 113 ? 0.6171 0.6232 0.5289 -0.0621 0.0199  0.0366  114 MET A CA  
863  C C   . MET A 113 ? 0.6124 0.6547 0.5216 -0.0714 0.0223  0.0391  114 MET A C   
864  O O   . MET A 113 ? 0.6098 0.6806 0.5221 -0.0692 0.0289  0.0269  114 MET A O   
865  C CB  . MET A 113 ? 0.6268 0.6279 0.5429 -0.0484 0.0262  0.0208  114 MET A CB  
866  C CG  . MET A 113 ? 0.6664 0.6579 0.5829 -0.0397 0.0287  0.0149  114 MET A CG  
867  S SD  . MET A 113 ? 0.6941 0.6826 0.6179 -0.0274 0.0329  -0.0006 114 MET A SD  
868  C CE  . MET A 113 ? 0.6869 0.6693 0.6117 -0.0213 0.0347  -0.0049 114 MET A CE  
869  N N   . PRO A 114 ? 0.5962 0.6392 0.5005 -0.0818 0.0158  0.0542  115 PRO A N   
870  C CA  . PRO A 114 ? 0.6053 0.6855 0.5041 -0.0947 0.0163  0.0607  115 PRO A CA  
871  C C   . PRO A 114 ? 0.6064 0.7085 0.5051 -0.0868 0.0247  0.0446  115 PRO A C   
872  O O   . PRO A 114 ? 0.6094 0.6899 0.5104 -0.0749 0.0257  0.0372  115 PRO A O   
873  C CB  . PRO A 114 ? 0.6143 0.6774 0.5098 -0.1036 0.0048  0.0804  115 PRO A CB  
874  C CG  . PRO A 114 ? 0.6156 0.6365 0.5170 -0.0977 -0.0026 0.0842  115 PRO A CG  
875  C CD  . PRO A 114 ? 0.5964 0.6043 0.5015 -0.0813 0.0062  0.0653  115 PRO A CD  
876  N N   . ALA A 115 ? 0.6037 0.7505 0.5007 -0.0940 0.0300  0.0384  116 ALA A N   
877  C CA  . ALA A 115 ? 0.5938 0.7671 0.4924 -0.0871 0.0371  0.0198  116 ALA A CA  
878  C C   . ALA A 115 ? 0.5850 0.7523 0.4774 -0.0880 0.0339  0.0252  116 ALA A C   
879  O O   . ALA A 115 ? 0.5954 0.7544 0.4921 -0.0758 0.0367  0.0109  116 ALA A O   
880  C CB  . ALA A 115 ? 0.6038 0.8327 0.5016 -0.0966 0.0427  0.0121  116 ALA A CB  
881  N N   . LEU A 116 ? 0.5840 0.7544 0.4676 -0.1030 0.0264  0.0469  117 LEU A N   
882  C CA  . LEU A 116 ? 0.5838 0.7375 0.4639 -0.1028 0.0203  0.0557  117 LEU A CA  
883  C C   . LEU A 116 ? 0.5821 0.6872 0.4671 -0.0984 0.0117  0.0683  117 LEU A C   
884  O O   . LEU A 116 ? 0.6128 0.7101 0.4970 -0.1090 0.0038  0.0852  117 LEU A O   
885  C CB  . LEU A 116 ? 0.6059 0.7943 0.4748 -0.1218 0.0152  0.0716  117 LEU A CB  
886  C CG  . LEU A 116 ? 0.6237 0.8691 0.4863 -0.1281 0.0238  0.0579  117 LEU A CG  
887  C CD1 . LEU A 116 ? 0.6716 0.9518 0.5206 -0.1509 0.0172  0.0793  117 LEU A CD1 
888  C CD2 . LEU A 116 ? 0.6045 0.8546 0.4711 -0.1131 0.0303  0.0336  117 LEU A CD2 
889  N N   . PRO A 117 ? 0.5648 0.6392 0.4560 -0.0833 0.0127  0.0595  118 PRO A N   
890  C CA  . PRO A 117 ? 0.5589 0.6398 0.4519 -0.0732 0.0189  0.0435  118 PRO A CA  
891  C C   . PRO A 117 ? 0.5574 0.6323 0.4578 -0.0593 0.0273  0.0231  118 PRO A C   
892  O O   . PRO A 117 ? 0.5658 0.6450 0.4697 -0.0517 0.0307  0.0098  118 PRO A O   
893  C CB  . PRO A 117 ? 0.5538 0.6033 0.4509 -0.0671 0.0126  0.0502  118 PRO A CB  
894  C CG  . PRO A 117 ? 0.5372 0.5558 0.4390 -0.0642 0.0083  0.0566  118 PRO A CG  
895  C CD  . PRO A 117 ? 0.5544 0.5876 0.4517 -0.0773 0.0054  0.0670  118 PRO A CD  
896  N N   . PHE A 118 ? 0.5482 0.6120 0.4519 -0.0567 0.0287  0.0216  119 PHE A N   
897  C CA  . PHE A 118 ? 0.5598 0.6079 0.4713 -0.0437 0.0332  0.0071  119 PHE A CA  
898  C C   . PHE A 118 ? 0.5732 0.6443 0.4911 -0.0379 0.0383  -0.0118 119 PHE A C   
899  O O   . PHE A 118 ? 0.5615 0.6169 0.4875 -0.0274 0.0392  -0.0223 119 PHE A O   
900  C CB  . PHE A 118 ? 0.5526 0.5797 0.4655 -0.0423 0.0318  0.0117  119 PHE A CB  
901  C CG  . PHE A 118 ? 0.5469 0.5444 0.4582 -0.0421 0.0262  0.0232  119 PHE A CG  
902  C CD1 . PHE A 118 ? 0.5214 0.4962 0.4361 -0.0323 0.0271  0.0187  119 PHE A CD1 
903  C CD2 . PHE A 118 ? 0.5568 0.5514 0.4650 -0.0522 0.0190  0.0381  119 PHE A CD2 
904  C CE1 . PHE A 118 ? 0.5289 0.4812 0.4444 -0.0306 0.0221  0.0256  119 PHE A CE1 
905  C CE2 . PHE A 118 ? 0.5580 0.5249 0.4686 -0.0502 0.0119  0.0457  119 PHE A CE2 
906  C CZ  . PHE A 118 ? 0.5506 0.4979 0.4652 -0.0385 0.0141  0.0378  119 PHE A CZ  
907  N N   . MET A 119 ? 0.5915 0.7008 0.5069 -0.0451 0.0404  -0.0164 120 MET A N   
908  C CA  . MET A 119 ? 0.5987 0.7340 0.5220 -0.0388 0.0441  -0.0381 120 MET A CA  
909  C C   . MET A 119 ? 0.6017 0.7285 0.5274 -0.0327 0.0427  -0.0452 120 MET A C   
910  O O   . MET A 119 ? 0.6161 0.7469 0.5530 -0.0232 0.0430  -0.0642 120 MET A O   
911  C CB  . MET A 119 ? 0.6251 0.8102 0.5438 -0.0491 0.0473  -0.0424 120 MET A CB  
912  C CG  . MET A 119 ? 0.6600 0.8650 0.5826 -0.0525 0.0499  -0.0448 120 MET A CG  
913  S SD  . MET A 119 ? 0.7084 0.9028 0.6513 -0.0345 0.0506  -0.0682 120 MET A SD  
914  C CE  . MET A 119 ? 0.6667 0.9107 0.6195 -0.0297 0.0541  -0.0974 120 MET A CE  
915  N N   . LEU A 120 ? 0.5720 0.6866 0.4890 -0.0381 0.0398  -0.0302 121 LEU A N   
916  C CA  . LEU A 120 ? 0.5420 0.6506 0.4606 -0.0342 0.0380  -0.0345 121 LEU A CA  
917  C C   . LEU A 120 ? 0.5445 0.6144 0.4700 -0.0251 0.0363  -0.0325 121 LEU A C   
918  O O   . LEU A 120 ? 0.5687 0.6309 0.4970 -0.0221 0.0346  -0.0347 121 LEU A O   
919  C CB  . LEU A 120 ? 0.5329 0.6536 0.4401 -0.0452 0.0346  -0.0197 121 LEU A CB  
920  C CG  . LEU A 120 ? 0.5448 0.7107 0.4423 -0.0577 0.0354  -0.0195 121 LEU A CG  
921  C CD1 . LEU A 120 ? 0.5577 0.7260 0.4449 -0.0688 0.0289  0.0000  121 LEU A CD1 
922  C CD2 . LEU A 120 ? 0.5403 0.7381 0.4423 -0.0531 0.0392  -0.0441 121 LEU A CD2 
923  N N   . ALA A 121 ? 0.5289 0.5776 0.4567 -0.0217 0.0369  -0.0284 122 ALA A N   
924  C CA  . ALA A 121 ? 0.5329 0.5509 0.4664 -0.0144 0.0360  -0.0273 122 ALA A CA  
925  C C   . ALA A 121 ? 0.5480 0.5624 0.4932 -0.0067 0.0353  -0.0418 122 ALA A C   
926  O O   . ALA A 121 ? 0.5279 0.5516 0.4782 -0.0045 0.0356  -0.0501 122 ALA A O   
927  C CB  . ALA A 121 ? 0.5282 0.5269 0.4578 -0.0152 0.0359  -0.0163 122 ALA A CB  
928  N N   . GLU A 122 ? 0.5696 0.5711 0.5211 -0.0030 0.0331  -0.0445 123 GLU A N   
929  C CA  . GLU A 122 ? 0.6197 0.6082 0.5839 0.0030  0.0293  -0.0529 123 GLU A CA  
930  C C   . GLU A 122 ? 0.6204 0.5872 0.5833 0.0037  0.0291  -0.0434 123 GLU A C   
931  O O   . GLU A 122 ? 0.6620 0.6225 0.6330 0.0072  0.0255  -0.0481 123 GLU A O   
932  C CB  . GLU A 122 ? 0.6609 0.6423 0.6323 0.0042  0.0257  -0.0560 123 GLU A CB  
933  C CG  . GLU A 122 ? 0.7278 0.7238 0.7108 0.0078  0.0212  -0.0742 123 GLU A CG  
934  C CD  . GLU A 122 ? 0.7749 0.7625 0.7746 0.0142  0.0143  -0.0858 123 GLU A CD  
935  O OE1 . GLU A 122 ? 0.8064 0.7758 0.8075 0.0149  0.0126  -0.0775 123 GLU A OE1 
936  O OE2 . GLU A 122 ? 0.8148 0.8144 0.8272 0.0189  0.0092  -0.1043 123 GLU A OE2 
937  N N   . PHE A 123 ? 0.6036 0.5605 0.5571 0.0007  0.0322  -0.0310 124 PHE A N   
938  C CA  . PHE A 123 ? 0.5880 0.5289 0.5378 0.0007  0.0328  -0.0230 124 PHE A CA  
939  C C   . PHE A 123 ? 0.5736 0.5178 0.5189 0.0000  0.0337  -0.0223 124 PHE A C   
940  O O   . PHE A 123 ? 0.5861 0.5461 0.5292 -0.0022 0.0349  -0.0246 124 PHE A O   
941  C CB  . PHE A 123 ? 0.5796 0.5132 0.5232 -0.0009 0.0356  -0.0143 124 PHE A CB  
942  C CG  . PHE A 123 ? 0.5823 0.5224 0.5198 -0.0030 0.0366  -0.0101 124 PHE A CG  
943  C CD1 . PHE A 123 ? 0.5763 0.5267 0.5148 -0.0045 0.0357  -0.0104 124 PHE A CD1 
944  C CD2 . PHE A 123 ? 0.5733 0.5084 0.5048 -0.0044 0.0367  -0.0049 124 PHE A CD2 
945  C CE1 . PHE A 123 ? 0.5541 0.5093 0.4878 -0.0080 0.0341  -0.0037 124 PHE A CE1 
946  C CE2 . PHE A 123 ? 0.5617 0.4997 0.4899 -0.0076 0.0346  0.0009  124 PHE A CE2 
947  C CZ  . PHE A 123 ? 0.5566 0.5045 0.4860 -0.0096 0.0329  0.0025  124 PHE A CZ  
948  N N   . ASP A 124 ? 0.5525 0.4842 0.4962 0.0005  0.0329  -0.0182 125 ASP A N   
949  C CA  . ASP A 124 ? 0.5287 0.4612 0.4683 -0.0006 0.0330  -0.0166 125 ASP A CA  
950  C C   . ASP A 124 ? 0.5327 0.4582 0.4624 -0.0034 0.0351  -0.0087 125 ASP A C   
951  O O   . ASP A 124 ? 0.5052 0.4354 0.4313 -0.0064 0.0349  -0.0064 125 ASP A O   
952  C CB  . ASP A 124 ? 0.5428 0.4658 0.4867 0.0013  0.0291  -0.0169 125 ASP A CB  
953  C CG  . ASP A 124 ? 0.5337 0.4597 0.4918 0.0053  0.0237  -0.0255 125 ASP A CG  
954  O OD1 . ASP A 124 ? 0.5451 0.4865 0.5103 0.0077  0.0232  -0.0351 125 ASP A OD1 
955  O OD2 . ASP A 124 ? 0.5217 0.4359 0.4851 0.0056  0.0192  -0.0231 125 ASP A OD2 
956  N N   . GLY A 125 ? 0.5455 0.4610 0.4725 -0.0025 0.0363  -0.0054 126 GLY A N   
957  C CA  . GLY A 125 ? 0.5682 0.4766 0.4890 -0.0031 0.0370  -0.0018 126 GLY A CA  
958  C C   . GLY A 125 ? 0.5754 0.4817 0.4970 -0.0012 0.0387  -0.0013 126 GLY A C   
959  O O   . GLY A 125 ? 0.5857 0.4967 0.5119 -0.0007 0.0396  -0.0019 126 GLY A O   
960  N N   . VAL A 126 ? 0.5854 0.4860 0.5044 0.0001  0.0387  -0.0017 127 VAL A N   
961  C CA  . VAL A 126 ? 0.5932 0.4946 0.5159 0.0034  0.0398  -0.0037 127 VAL A CA  
962  C C   . VAL A 126 ? 0.5896 0.4918 0.5090 0.0051  0.0427  -0.0082 127 VAL A C   
963  O O   . VAL A 126 ? 0.6236 0.5213 0.5375 0.0046  0.0415  -0.0098 127 VAL A O   
964  C CB  . VAL A 126 ? 0.5938 0.4907 0.5210 0.0047  0.0346  -0.0024 127 VAL A CB  
965  C CG1 . VAL A 126 ? 0.5899 0.4885 0.5248 0.0099  0.0345  -0.0065 127 VAL A CG1 
966  C CG2 . VAL A 126 ? 0.5833 0.4851 0.5113 0.0005  0.0319  0.0033  127 VAL A CG2 
967  N N   . VAL A 127 ? 0.5822 0.4932 0.5046 0.0062  0.0465  -0.0103 128 VAL A N   
968  C CA  . VAL A 127 ? 0.5865 0.5061 0.5066 0.0077  0.0501  -0.0164 128 VAL A CA  
969  C C   . VAL A 127 ? 0.5904 0.5143 0.5206 0.0143  0.0496  -0.0238 128 VAL A C   
970  O O   . VAL A 127 ? 0.6017 0.5335 0.5392 0.0150  0.0512  -0.0229 128 VAL A O   
971  C CB  . VAL A 127 ? 0.5755 0.5073 0.4918 0.0018  0.0545  -0.0121 128 VAL A CB  
972  C CG1 . VAL A 127 ? 0.5637 0.5135 0.4783 0.0022  0.0597  -0.0190 128 VAL A CG1 
973  C CG2 . VAL A 127 ? 0.5685 0.4940 0.4770 -0.0036 0.0521  -0.0053 128 VAL A CG2 
974  N N   . GLY A 128 ? 0.5887 0.5062 0.5215 0.0195  0.0457  -0.0315 129 GLY A N   
975  C CA  . GLY A 128 ? 0.5881 0.5076 0.5346 0.0276  0.0423  -0.0407 129 GLY A CA  
976  C C   . GLY A 128 ? 0.5968 0.5390 0.5467 0.0307  0.0495  -0.0514 129 GLY A C   
977  O O   . GLY A 128 ? 0.6019 0.5554 0.5425 0.0284  0.0545  -0.0564 129 GLY A O   
978  N N   . MET A 129 ? 0.5846 0.5367 0.5473 0.0350  0.0499  -0.0545 130 MET A N   
979  C CA  . MET A 129 ? 0.5942 0.5740 0.5628 0.0377  0.0572  -0.0654 130 MET A CA  
980  C C   . MET A 129 ? 0.6038 0.5883 0.5914 0.0506  0.0522  -0.0831 130 MET A C   
981  O O   . MET A 129 ? 0.6097 0.6207 0.6073 0.0550  0.0575  -0.0951 130 MET A O   
982  C CB  . MET A 129 ? 0.5965 0.5893 0.5676 0.0321  0.0619  -0.0564 130 MET A CB  
983  C CG  . MET A 129 ? 0.6154 0.6038 0.5724 0.0203  0.0647  -0.0412 130 MET A CG  
984  S SD  . MET A 129 ? 0.6479 0.6511 0.5885 0.0114  0.0713  -0.0397 130 MET A SD  
985  C CE  . MET A 129 ? 0.5979 0.6406 0.5447 0.0087  0.0801  -0.0462 130 MET A CE  
986  N N   . GLY A 130 ? 0.6075 0.5672 0.6018 0.0562  0.0409  -0.0846 131 GLY A N   
987  C CA  . GLY A 130 ? 0.6231 0.5803 0.6383 0.0691  0.0318  -0.1016 131 GLY A CA  
988  C C   . GLY A 130 ? 0.6396 0.6090 0.6542 0.0747  0.0343  -0.1218 131 GLY A C   
989  O O   . GLY A 130 ? 0.6377 0.6184 0.6336 0.0672  0.0433  -0.1206 131 GLY A O   
990  N N   . PHE A 131 ? 0.6638 0.6312 0.7003 0.0881  0.0249  -0.1411 132 PHE A N   
991  C CA  . PHE A 131 ? 0.6927 0.6759 0.7326 0.0959  0.0263  -0.1660 132 PHE A CA  
992  C C   . PHE A 131 ? 0.7136 0.6695 0.7451 0.0937  0.0176  -0.1651 132 PHE A C   
993  O O   . PHE A 131 ? 0.7167 0.6408 0.7463 0.0885  0.0078  -0.1471 132 PHE A O   
994  C CB  . PHE A 131 ? 0.7053 0.6972 0.7767 0.1130  0.0177  -0.1905 132 PHE A CB  
995  C CG  . PHE A 131 ? 0.7019 0.7278 0.7843 0.1163  0.0270  -0.1960 132 PHE A CG  
996  C CD1 . PHE A 131 ? 0.6898 0.7066 0.7791 0.1137  0.0239  -0.1780 132 PHE A CD1 
997  C CD2 . PHE A 131 ? 0.7034 0.7741 0.7900 0.1215  0.0385  -0.2199 132 PHE A CD2 
998  C CE1 . PHE A 131 ? 0.6835 0.7321 0.7843 0.1163  0.0316  -0.1832 132 PHE A CE1 
999  C CE2 . PHE A 131 ? 0.7080 0.8138 0.8061 0.1235  0.0470  -0.2248 132 PHE A CE2 
1000 C CZ  . PHE A 131 ? 0.6923 0.7856 0.7982 0.1210  0.0433  -0.2061 132 PHE A CZ  
1001 N N   . ILE A 132 ? 0.7396 0.7110 0.7665 0.0970  0.0210  -0.1850 133 ILE A N   
1002 C CA  . ILE A 132 ? 0.7477 0.6955 0.7685 0.0958  0.0119  -0.1879 133 ILE A CA  
1003 C C   . ILE A 132 ? 0.7727 0.6838 0.8175 0.1042  -0.0094 -0.1907 133 ILE A C   
1004 O O   . ILE A 132 ? 0.7865 0.6685 0.8253 0.0977  -0.0189 -0.1782 133 ILE A O   
1005 C CB  . ILE A 132 ? 0.7546 0.7305 0.7663 0.0982  0.0192  -0.2116 133 ILE A CB  
1006 C CG1 . ILE A 132 ? 0.7616 0.7147 0.7604 0.0927  0.0121  -0.2087 133 ILE A CG1 
1007 C CG2 . ILE A 132 ? 0.7519 0.7505 0.7887 0.1152  0.0161  -0.2458 133 ILE A CG2 
1008 C CD1 . ILE A 132 ? 0.7665 0.7482 0.7492 0.0908  0.0204  -0.2263 133 ILE A CD1 
1009 N N   . GLU A 133 ? 0.7945 0.7075 0.8673 0.1177  -0.0178 -0.2052 134 GLU A N   
1010 C CA  . GLU A 133 ? 0.8226 0.7005 0.9227 0.1260  -0.0413 -0.2075 134 GLU A CA  
1011 C C   . GLU A 133 ? 0.8416 0.6858 0.9354 0.1135  -0.0510 -0.1741 134 GLU A C   
1012 O O   . GLU A 133 ? 0.8589 0.6705 0.9635 0.1124  -0.0698 -0.1686 134 GLU A O   
1013 C CB  . GLU A 133 ? 0.8220 0.7110 0.9546 0.1425  -0.0484 -0.2265 134 GLU A CB  
1014 C CG  . GLU A 133 ? 0.8576 0.7809 1.0036 0.1575  -0.0429 -0.2654 134 GLU A CG  
1015 C CD  . GLU A 133 ? 0.8616 0.8356 0.9936 0.1550  -0.0188 -0.2713 134 GLU A CD  
1016 O OE1 . GLU A 133 ? 0.8521 0.8359 0.9535 0.1390  -0.0031 -0.2494 134 GLU A OE1 
1017 O OE2 . GLU A 133 ? 0.8733 0.8791 1.0267 0.1688  -0.0162 -0.2985 134 GLU A OE2 
1018 N N   . GLN A 134 ? 0.8397 0.6940 0.9163 0.1031  -0.0385 -0.1524 135 GLN A N   
1019 C CA  . GLN A 134 ? 0.8530 0.6843 0.9207 0.0902  -0.0446 -0.1224 135 GLN A CA  
1020 C C   . GLN A 134 ? 0.8126 0.6401 0.8528 0.0760  -0.0365 -0.1074 135 GLN A C   
1021 O O   . GLN A 134 ? 0.7882 0.6022 0.8199 0.0646  -0.0401 -0.0845 135 GLN A O   
1022 C CB  . GLN A 134 ? 0.8738 0.7161 0.9419 0.0876  -0.0391 -0.1084 135 GLN A CB  
1023 C CG  . GLN A 134 ? 0.9201 0.7616 1.0179 0.1002  -0.0511 -0.1177 135 GLN A CG  
1024 C CD  . GLN A 134 ? 0.9695 0.7785 1.0920 0.1057  -0.0768 -0.1188 135 GLN A CD  
1025 O OE1 . GLN A 134 ? 1.0041 0.7879 1.1212 0.0945  -0.0885 -0.0975 135 GLN A OE1 
1026 N NE2 . GLN A 134 ? 0.9818 0.7927 1.1333 0.1227  -0.0869 -0.1439 135 GLN A NE2 
1027 N N   . ALA A 135 ? 0.7846 0.6264 0.8120 0.0765  -0.0264 -0.1209 136 ALA A N   
1028 C CA  . ALA A 135 ? 0.7525 0.5930 0.7557 0.0643  -0.0191 -0.1084 136 ALA A CA  
1029 C C   . ALA A 135 ? 0.7849 0.5984 0.7908 0.0600  -0.0338 -0.1040 136 ALA A C   
1030 O O   . ALA A 135 ? 0.8243 0.6277 0.8442 0.0679  -0.0450 -0.1216 136 ALA A O   
1031 C CB  . ALA A 135 ? 0.7124 0.5794 0.7002 0.0647  -0.0042 -0.1216 136 ALA A CB  
1032 N N   . ILE A 136 ? 0.7760 0.5800 0.7699 0.0473  -0.0340 -0.0814 137 ILE A N   
1033 C CA  . ILE A 136 ? 0.7890 0.5709 0.7837 0.0394  -0.0470 -0.0723 137 ILE A CA  
1034 C C   . ILE A 136 ? 0.7801 0.5677 0.7611 0.0376  -0.0413 -0.0820 137 ILE A C   
1035 O O   . ILE A 136 ? 0.7739 0.5800 0.7367 0.0337  -0.0265 -0.0792 137 ILE A O   
1036 C CB  . ILE A 136 ? 0.7884 0.5666 0.7747 0.0255  -0.0475 -0.0456 137 ILE A CB  
1037 C CG1 . ILE A 136 ? 0.7826 0.5586 0.7797 0.0260  -0.0528 -0.0348 137 ILE A CG1 
1038 C CG2 . ILE A 136 ? 0.7884 0.5493 0.7746 0.0149  -0.0597 -0.0347 137 ILE A CG2 
1039 C CD1 . ILE A 136 ? 0.7800 0.5333 0.8011 0.0303  -0.0740 -0.0358 137 ILE A CD1 
1040 N N   . GLY A 137 ? 0.7882 0.5590 0.7795 0.0401  -0.0550 -0.0930 138 GLY A N   
1041 C CA  . GLY A 137 ? 0.7907 0.5662 0.7710 0.0393  -0.0523 -0.1051 138 GLY A CA  
1042 C C   . GLY A 137 ? 0.8089 0.6059 0.7882 0.0509  -0.0440 -0.1317 138 GLY A C   
1043 O O   . GLY A 137 ? 0.8126 0.6215 0.7782 0.0494  -0.0383 -0.1415 138 GLY A O   
1044 N N   . ARG A 138 ? 0.8288 0.6340 0.8225 0.0618  -0.0432 -0.1434 139 ARG A N   
1045 C CA  . ARG A 138 ? 0.8548 0.6885 0.8492 0.0727  -0.0336 -0.1695 139 ARG A CA  
1046 C C   . ARG A 138 ? 0.8317 0.6964 0.7990 0.0654  -0.0140 -0.1661 139 ARG A C   
1047 O O   . ARG A 138 ? 0.8612 0.7511 0.8222 0.0694  -0.0071 -0.1862 139 ARG A O   
1048 C CB  . ARG A 138 ? 0.8713 0.6991 0.8818 0.0835  -0.0464 -0.1987 139 ARG A CB  
1049 C CG  . ARG A 138 ? 0.8615 0.6603 0.9043 0.0932  -0.0680 -0.2058 139 ARG A CG  
1050 N N   . VAL A 139 ? 0.7839 0.6475 0.7365 0.0543  -0.0064 -0.1408 140 VAL A N   
1051 C CA  . VAL A 139 ? 0.7518 0.6395 0.6817 0.0463  0.0087  -0.1332 140 VAL A CA  
1052 C C   . VAL A 139 ? 0.7303 0.6460 0.6611 0.0500  0.0204  -0.1387 140 VAL A C   
1053 O O   . VAL A 139 ? 0.7220 0.6338 0.6654 0.0537  0.0197  -0.1337 140 VAL A O   
1054 C CB  . VAL A 139 ? 0.7210 0.5972 0.6383 0.0343  0.0105  -0.1069 140 VAL A CB  
1055 C CG1 . VAL A 139 ? 0.7236 0.5821 0.6521 0.0333  0.0053  -0.0919 140 VAL A CG1 
1056 C CG2 . VAL A 139 ? 0.6991 0.5969 0.5993 0.0273  0.0235  -0.0972 140 VAL A CG2 
1057 N N   . THR A 140 ? 0.7182 0.6641 0.6356 0.0479  0.0304  -0.1485 141 THR A N   
1058 C CA  . THR A 140 ? 0.7124 0.6909 0.6287 0.0483  0.0423  -0.1522 141 THR A CA  
1059 C C   . THR A 140 ? 0.7094 0.6835 0.6214 0.0403  0.0475  -0.1273 141 THR A C   
1060 O O   . THR A 140 ? 0.7099 0.6759 0.6075 0.0301  0.0487  -0.1089 141 THR A O   
1061 C CB  . THR A 140 ? 0.7138 0.7283 0.6118 0.0425  0.0517  -0.1615 141 THR A CB  
1062 O OG1 . THR A 140 ? 0.6952 0.7109 0.5948 0.0488  0.0456  -0.1843 141 THR A OG1 
1063 C CG2 . THR A 140 ? 0.6777 0.7317 0.5786 0.0437  0.0630  -0.1705 141 THR A CG2 
1064 N N   . PRO A 141 ? 0.7011 0.6800 0.6276 0.0456  0.0492  -0.1280 142 PRO A N   
1065 C CA  . PRO A 141 ? 0.6808 0.6575 0.6044 0.0385  0.0536  -0.1073 142 PRO A CA  
1066 C C   . PRO A 141 ? 0.6801 0.6833 0.5875 0.0276  0.0642  -0.0990 142 PRO A C   
1067 O O   . PRO A 141 ? 0.6840 0.7160 0.5850 0.0266  0.0701  -0.1113 142 PRO A O   
1068 C CB  . PRO A 141 ? 0.6760 0.6585 0.6197 0.0476  0.0529  -0.1150 142 PRO A CB  
1069 C CG  . PRO A 141 ? 0.6879 0.6604 0.6481 0.0600  0.0430  -0.1350 142 PRO A CG  
1070 C CD  . PRO A 141 ? 0.7068 0.6919 0.6554 0.0592  0.0453  -0.1488 142 PRO A CD  
1071 N N   . ILE A 142 ? 0.6674 0.6619 0.5691 0.0191  0.0654  -0.0785 143 ILE A N   
1072 C CA  . ILE A 142 ? 0.6780 0.6914 0.5664 0.0069  0.0716  -0.0660 143 ILE A CA  
1073 C C   . ILE A 142 ? 0.6812 0.7315 0.5716 0.0046  0.0804  -0.0726 143 ILE A C   
1074 O O   . ILE A 142 ? 0.7093 0.7853 0.5865 -0.0046 0.0854  -0.0708 143 ILE A O   
1075 C CB  . ILE A 142 ? 0.6679 0.6615 0.5548 0.0000  0.0684  -0.0452 143 ILE A CB  
1076 C CG1 . ILE A 142 ? 0.6566 0.6619 0.5305 -0.0131 0.0701  -0.0308 143 ILE A CG1 
1077 C CG2 . ILE A 142 ? 0.6708 0.6598 0.5718 0.0038  0.0686  -0.0425 143 ILE A CG2 
1078 C CD1 . ILE A 142 ? 0.6447 0.6267 0.5174 -0.0180 0.0635  -0.0147 143 ILE A CD1 
1079 N N   . PHE A 143 ? 0.6661 0.7219 0.5732 0.0124  0.0818  -0.0801 144 PHE A N   
1080 C CA  . PHE A 143 ? 0.6546 0.7495 0.5662 0.0105  0.0905  -0.0876 144 PHE A CA  
1081 C C   . PHE A 143 ? 0.6778 0.8051 0.5870 0.0145  0.0955  -0.1100 144 PHE A C   
1082 O O   . PHE A 143 ? 0.7089 0.8756 0.6100 0.0054  0.1040  -0.1107 144 PHE A O   
1083 C CB  . PHE A 143 ? 0.6253 0.7201 0.5574 0.0186  0.0900  -0.0916 144 PHE A CB  
1084 C CG  . PHE A 143 ? 0.6220 0.7552 0.5579 0.0121  0.0988  -0.0911 144 PHE A CG  
1085 C CD1 . PHE A 143 ? 0.6219 0.7582 0.5500 -0.0027 0.1006  -0.0692 144 PHE A CD1 
1086 C CD2 . PHE A 143 ? 0.6244 0.7922 0.5736 0.0205  0.1042  -0.1130 144 PHE A CD2 
1087 C CE1 . PHE A 143 ? 0.6142 0.7872 0.5464 -0.0110 0.1078  -0.0667 144 PHE A CE1 
1088 C CE2 . PHE A 143 ? 0.6297 0.8382 0.5832 0.0132  0.1129  -0.1123 144 PHE A CE2 
1089 C CZ  . PHE A 143 ? 0.6231 0.8339 0.5673 -0.0035 0.1148  -0.0878 144 PHE A CZ  
1090 N N   . ASP A 144 ? 0.6972 0.8097 0.6136 0.0273  0.0895  -0.1283 145 ASP A N   
1091 C CA  . ASP A 144 ? 0.7192 0.8604 0.6340 0.0327  0.0926  -0.1535 145 ASP A CA  
1092 C C   . ASP A 144 ? 0.7448 0.9042 0.6338 0.0182  0.0972  -0.1452 145 ASP A C   
1093 O O   . ASP A 144 ? 0.7790 0.9828 0.6603 0.0139  0.1054  -0.1577 145 ASP A O   
1094 C CB  . ASP A 144 ? 0.7134 0.8270 0.6408 0.0475  0.0818  -0.1719 145 ASP A CB  
1095 C CG  . ASP A 144 ? 0.7281 0.8247 0.6827 0.0618  0.0745  -0.1805 145 ASP A CG  
1096 O OD1 . ASP A 144 ? 0.7375 0.8086 0.6961 0.0593  0.0708  -0.1609 145 ASP A OD1 
1097 O OD2 . ASP A 144 ? 0.7500 0.8588 0.7231 0.0757  0.0713  -0.2075 145 ASP A OD2 
1098 N N   . ASN A 145 ? 0.7309 0.8585 0.6071 0.0102  0.0914  -0.1240 146 ASN A N   
1099 C CA  . ASN A 145 ? 0.7282 0.8671 0.5810 -0.0045 0.0929  -0.1111 146 ASN A CA  
1100 C C   . ASN A 145 ? 0.7254 0.8957 0.5680 -0.0208 0.1000  -0.0938 146 ASN A C   
1101 O O   . ASN A 145 ? 0.7614 0.9647 0.5869 -0.0324 0.1042  -0.0926 146 ASN A O   
1102 C CB  . ASN A 145 ? 0.7196 0.8167 0.5658 -0.0073 0.0836  -0.0942 146 ASN A CB  
1103 C CG  . ASN A 145 ? 0.7309 0.8119 0.5767 0.0011  0.0771  -0.1101 146 ASN A CG  
1104 O OD1 . ASN A 145 ? 0.7257 0.8314 0.5652 0.0026  0.0795  -0.1287 146 ASN A OD1 
1105 N ND2 . ASN A 145 ? 0.7267 0.7683 0.5794 0.0056  0.0685  -0.1031 146 ASN A ND2 
1106 N N   . ILE A 146 ? 0.7086 0.8705 0.5619 -0.0227 0.1006  -0.0802 147 ILE A N   
1107 C CA  . ILE A 146 ? 0.7249 0.9162 0.5725 -0.0388 0.1059  -0.0635 147 ILE A CA  
1108 C C   . ILE A 146 ? 0.7661 1.0120 0.6160 -0.0392 0.1169  -0.0819 147 ILE A C   
1109 O O   . ILE A 146 ? 0.8068 1.0907 0.6432 -0.0560 0.1222  -0.0718 147 ILE A O   
1110 C CB  . ILE A 146 ? 0.7032 0.8715 0.5632 -0.0407 0.1026  -0.0458 147 ILE A CB  
1111 C CG1 . ILE A 146 ? 0.6826 0.8047 0.5400 -0.0415 0.0923  -0.0291 147 ILE A CG1 
1112 C CG2 . ILE A 146 ? 0.7018 0.9001 0.5573 -0.0588 0.1063  -0.0281 147 ILE A CG2 
1113 C CD1 . ILE A 146 ? 0.6605 0.7567 0.5324 -0.0385 0.0882  -0.0192 147 ILE A CD1 
1114 N N   . ILE A 147 ? 0.7881 1.0393 0.6557 -0.0213 0.1193  -0.1088 148 ILE A N   
1115 C CA  . ILE A 147 ? 0.8332 1.1387 0.7076 -0.0176 0.1295  -0.1330 148 ILE A CA  
1116 C C   . ILE A 147 ? 0.8800 1.2241 0.7353 -0.0242 0.1345  -0.1457 148 ILE A C   
1117 O O   . ILE A 147 ? 0.9290 1.3294 0.7772 -0.0352 0.1445  -0.1497 148 ILE A O   
1118 C CB  . ILE A 147 ? 0.8307 1.1284 0.7333 0.0054  0.1275  -0.1605 148 ILE A CB  
1119 C CG1 . ILE A 147 ? 0.8290 1.1144 0.7496 0.0074  0.1266  -0.1489 148 ILE A CG1 
1120 C CG2 . ILE A 147 ? 0.8230 1.1733 0.7343 0.0143  0.1354  -0.1947 148 ILE A CG2 
1121 C CD1 . ILE A 147 ? 0.8280 1.1564 0.7466 -0.0080 0.1361  -0.1367 148 ILE A CD1 
1122 N N   . SER A 148 ? 0.8730 1.1891 0.7194 -0.0190 0.1273  -0.1511 149 SER A N   
1123 C CA  . SER A 148 ? 0.8759 1.2228 0.7034 -0.0241 0.1299  -0.1645 149 SER A CA  
1124 C C   . SER A 148 ? 0.8865 1.2690 0.6879 -0.0495 0.1347  -0.1407 149 SER A C   
1125 O O   . SER A 148 ? 0.9086 1.3411 0.6951 -0.0570 0.1415  -0.1534 149 SER A O   
1126 C CB  . SER A 148 ? 0.8883 1.1903 0.7107 -0.0168 0.1191  -0.1670 149 SER A CB  
1127 O OG  . SER A 148 ? 0.8977 1.1761 0.7427 0.0049  0.1135  -0.1930 149 SER A OG  
1128 N N   . GLN A 149 ? 0.8790 1.2360 0.6759 -0.0628 0.1300  -0.1064 150 GLN A N   
1129 C CA  . GLN A 149 ? 0.8821 1.2619 0.6572 -0.0884 0.1298  -0.0772 150 GLN A CA  
1130 C C   . GLN A 149 ? 0.8547 1.2981 0.6268 -0.1030 0.1411  -0.0760 150 GLN A C   
1131 O O   . GLN A 149 ? 0.8656 1.3429 0.6169 -0.1259 0.1419  -0.0569 150 GLN A O   
1132 C CB  . GLN A 149 ? 0.8989 1.2291 0.6760 -0.0961 0.1188  -0.0437 150 GLN A CB  
1133 C CG  . GLN A 149 ? 0.9278 1.2022 0.7056 -0.0854 0.1079  -0.0418 150 GLN A CG  
1134 C CD  . GLN A 149 ? 0.9567 1.1904 0.7354 -0.0941 0.0968  -0.0108 150 GLN A CD  
1135 O OE1 . GLN A 149 ? 0.9864 1.2176 0.7738 -0.1011 0.0960  0.0052  150 GLN A OE1 
1136 N NE2 . GLN A 149 ? 0.9869 1.1893 0.7586 -0.0932 0.0873  -0.0038 150 GLN A NE2 
1137 N N   . GLY A 150 ? 0.8217 1.2826 0.6153 -0.0907 0.1488  -0.0953 151 GLY A N   
1138 C CA  . GLY A 150 ? 0.8330 1.3587 0.6281 -0.1027 0.1606  -0.0977 151 GLY A CA  
1139 C C   . GLY A 150 ? 0.8399 1.3694 0.6278 -0.1281 0.1577  -0.0582 151 GLY A C   
1140 O O   . GLY A 150 ? 0.8586 1.4426 0.6309 -0.1508 0.1634  -0.0462 151 GLY A O   
1141 N N   . VAL A 151 ? 0.8064 1.2787 0.6058 -0.1251 0.1477  -0.0382 152 VAL A N   
1142 C CA  . VAL A 151 ? 0.7974 1.2612 0.5942 -0.1470 0.1410  -0.0012 152 VAL A CA  
1143 C C   . VAL A 151 ? 0.8077 1.2642 0.6284 -0.1419 0.1426  0.0002  152 VAL A C   
1144 O O   . VAL A 151 ? 0.8398 1.3191 0.6613 -0.1616 0.1425  0.0219  152 VAL A O   
1145 C CB  . VAL A 151 ? 0.7818 1.1881 0.5697 -0.1528 0.1250  0.0254  152 VAL A CB  
1146 C CG1 . VAL A 151 ? 0.7762 1.2017 0.5378 -0.1679 0.1219  0.0349  152 VAL A CG1 
1147 C CG2 . VAL A 151 ? 0.7583 1.1041 0.5593 -0.1283 0.1189  0.0124  152 VAL A CG2 
1148 N N   . LEU A 152 ? 0.8061 1.2321 0.6464 -0.1168 0.1430  -0.0217 153 LEU A N   
1149 C CA  . LEU A 152 ? 0.7872 1.2061 0.6508 -0.1098 0.1440  -0.0231 153 LEU A CA  
1150 C C   . LEU A 152 ? 0.7993 1.2845 0.6723 -0.1136 0.1571  -0.0375 153 LEU A C   
1151 O O   . LEU A 152 ? 0.8054 1.3342 0.6757 -0.1072 0.1667  -0.0633 153 LEU A O   
1152 C CB  . LEU A 152 ? 0.7707 1.1434 0.6515 -0.0831 0.1399  -0.0423 153 LEU A CB  
1153 C CG  . LEU A 152 ? 0.7849 1.0931 0.6620 -0.0764 0.1278  -0.0314 153 LEU A CG  
1154 C CD1 . LEU A 152 ? 0.7632 1.0407 0.6584 -0.0522 0.1255  -0.0520 153 LEU A CD1 
1155 C CD2 . LEU A 152 ? 0.7826 1.0605 0.6599 -0.0898 0.1184  -0.0012 153 LEU A CD2 
1156 N N   . LYS A 153 ? 0.8043 1.2981 0.6895 -0.1238 0.1570  -0.0220 154 LYS A N   
1157 C CA  . LYS A 153 ? 0.8297 1.3876 0.7267 -0.1295 0.1688  -0.0321 154 LYS A CA  
1158 C C   . LYS A 153 ? 0.8111 1.3810 0.7315 -0.1019 0.1756  -0.0701 154 LYS A C   
1159 O O   . LYS A 153 ? 0.8147 1.4470 0.7419 -0.1002 0.1875  -0.0924 154 LYS A O   
1160 C CB  . LYS A 153 ? 0.8440 1.3990 0.7507 -0.1466 0.1642  -0.0047 154 LYS A CB  
1161 C CG  . LYS A 153 ? 0.8918 1.5204 0.8047 -0.1628 0.1755  -0.0048 154 LYS A CG  
1162 C CD  . LYS A 153 ? 0.9329 1.5569 0.8515 -0.1856 0.1683  0.0283  154 LYS A CD  
1163 C CE  . LYS A 153 ? 0.9765 1.6815 0.8975 -0.2069 0.1798  0.0317  154 LYS A CE  
1164 N NZ  . LYS A 153 ? 0.9851 1.6910 0.9083 -0.2356 0.1712  0.0688  154 LYS A NZ  
1165 N N   . GLU A 154 ? 0.7944 1.3060 0.7281 -0.0809 0.1670  -0.0772 155 GLU A N   
1166 C CA  . GLU A 154 ? 0.8034 1.3136 0.7616 -0.0541 0.1685  -0.1095 155 GLU A CA  
1167 C C   . GLU A 154 ? 0.7939 1.2435 0.7519 -0.0349 0.1584  -0.1179 155 GLU A C   
1168 O O   . GLU A 154 ? 0.7755 1.1766 0.7202 -0.0407 0.1497  -0.0962 155 GLU A O   
1169 C CB  . GLU A 154 ? 0.8366 1.3427 0.8190 -0.0504 0.1666  -0.1053 155 GLU A CB  
1170 C CG  . GLU A 154 ? 0.8984 1.4704 0.8898 -0.0643 0.1771  -0.1046 155 GLU A CG  
1171 C CD  . GLU A 154 ? 0.9387 1.4943 0.9430 -0.0726 0.1718  -0.0831 155 GLU A CD  
1172 O OE1 . GLU A 154 ? 0.9552 1.5338 0.9844 -0.0630 0.1748  -0.0973 155 GLU A OE1 
1173 O OE2 . GLU A 154 ? 0.9631 1.4824 0.9541 -0.0882 0.1636  -0.0531 155 GLU A OE2 
1174 N N   . ASP A 155 ? 0.7829 1.2365 0.7581 -0.0123 0.1586  -0.1498 156 ASP A N   
1175 C CA  . ASP A 155 ? 0.7621 1.1605 0.7426 0.0063  0.1476  -0.1590 156 ASP A CA  
1176 C C   . ASP A 155 ? 0.7348 1.0895 0.7334 0.0151  0.1382  -0.1492 156 ASP A C   
1177 O O   . ASP A 155 ? 0.7125 1.0508 0.7329 0.0348  0.1317  -0.1674 156 ASP A O   
1178 C CB  . ASP A 155 ? 0.7915 1.2123 0.7858 0.0259  0.1491  -0.1971 156 ASP A CB  
1179 C CG  . ASP A 155 ? 0.8190 1.1886 0.8122 0.0400  0.1375  -0.2052 156 ASP A CG  
1180 O OD1 . ASP A 155 ? 0.8211 1.1382 0.8051 0.0365  0.1289  -0.1827 156 ASP A OD1 
1181 O OD2 . ASP A 155 ? 0.8465 1.2304 0.8496 0.0548  0.1366  -0.2358 156 ASP A OD2 
1182 N N   . VAL A 156 ? 0.6975 1.0342 0.6875 -0.0001 0.1361  -0.1201 157 VAL A N   
1183 C CA  . VAL A 156 ? 0.6514 0.9515 0.6549 0.0047  0.1278  -0.1088 157 VAL A CA  
1184 C C   . VAL A 156 ? 0.6358 0.8920 0.6228 -0.0068 0.1207  -0.0813 157 VAL A C   
1185 O O   . VAL A 156 ? 0.6454 0.9053 0.6131 -0.0226 0.1225  -0.0659 157 VAL A O   
1186 C CB  . VAL A 156 ? 0.6414 0.9744 0.6632 0.0010  0.1322  -0.1076 157 VAL A CB  
1187 C CG1 . VAL A 156 ? 0.6486 1.0303 0.6910 0.0135  0.1391  -0.1370 157 VAL A CG1 
1188 C CG2 . VAL A 156 ? 0.6556 1.0116 0.6641 -0.0233 0.1373  -0.0841 157 VAL A CG2 
1189 N N   . PHE A 157 ? 0.5956 0.8120 0.5913 0.0012  0.1118  -0.0762 158 PHE A N   
1190 C CA  . PHE A 157 ? 0.5739 0.7565 0.5605 -0.0085 0.1054  -0.0533 158 PHE A CA  
1191 C C   . PHE A 157 ? 0.5889 0.7588 0.5919 -0.0041 0.1002  -0.0497 158 PHE A C   
1192 O O   . PHE A 157 ? 0.5793 0.7507 0.5993 0.0098  0.0980  -0.0637 158 PHE A O   
1193 C CB  . PHE A 157 ? 0.5468 0.6902 0.5193 -0.0057 0.0991  -0.0489 158 PHE A CB  
1194 C CG  . PHE A 157 ? 0.5362 0.6563 0.5174 0.0111  0.0933  -0.0627 158 PHE A CG  
1195 C CD1 . PHE A 157 ? 0.5148 0.6054 0.5040 0.0166  0.0852  -0.0571 158 PHE A CD1 
1196 C CD2 . PHE A 157 ? 0.5387 0.6670 0.5203 0.0206  0.0946  -0.0809 158 PHE A CD2 
1197 C CE1 . PHE A 157 ? 0.5092 0.5788 0.5065 0.0296  0.0779  -0.0664 158 PHE A CE1 
1198 C CE2 . PHE A 157 ? 0.5369 0.6407 0.5289 0.0350  0.0864  -0.0919 158 PHE A CE2 
1199 C CZ  . PHE A 157 ? 0.5165 0.5908 0.5162 0.0387  0.0777  -0.0830 158 PHE A CZ  
1200 N N   . SER A 158 ? 0.5995 0.7570 0.5986 -0.0162 0.0967  -0.0313 159 SER A N   
1201 C CA  . SER A 158 ? 0.6002 0.7509 0.6135 -0.0151 0.0920  -0.0270 159 SER A CA  
1202 C C   . SER A 158 ? 0.6032 0.7149 0.6099 -0.0176 0.0832  -0.0147 159 SER A C   
1203 O O   . SER A 158 ? 0.6146 0.7119 0.6080 -0.0261 0.0812  -0.0043 159 SER A O   
1204 C CB  . SER A 158 ? 0.5843 0.7680 0.6044 -0.0286 0.0964  -0.0194 159 SER A CB  
1205 O OG  . SER A 158 ? 0.5903 0.8170 0.6198 -0.0253 0.1052  -0.0334 159 SER A OG  
1206 N N   . PHE A 159 ? 0.5843 0.6819 0.6014 -0.0101 0.0774  -0.0167 160 PHE A N   
1207 C CA  . PHE A 159 ? 0.5721 0.6394 0.5848 -0.0116 0.0695  -0.0085 160 PHE A CA  
1208 C C   . PHE A 159 ? 0.5801 0.6519 0.6034 -0.0175 0.0657  -0.0027 160 PHE A C   
1209 O O   . PHE A 159 ? 0.5838 0.6729 0.6212 -0.0136 0.0663  -0.0077 160 PHE A O   
1210 C CB  . PHE A 159 ? 0.5723 0.6185 0.5848 0.0004  0.0645  -0.0147 160 PHE A CB  
1211 C CG  . PHE A 159 ? 0.5795 0.6088 0.5786 0.0033  0.0645  -0.0160 160 PHE A CG  
1212 C CD1 . PHE A 159 ? 0.5739 0.6143 0.5706 0.0073  0.0695  -0.0245 160 PHE A CD1 
1213 C CD2 . PHE A 159 ? 0.5697 0.5746 0.5597 0.0021  0.0593  -0.0105 160 PHE A CD2 
1214 C CE1 . PHE A 159 ? 0.5716 0.5960 0.5565 0.0094  0.0685  -0.0258 160 PHE A CE1 
1215 C CE2 . PHE A 159 ? 0.5502 0.5414 0.5293 0.0042  0.0590  -0.0115 160 PHE A CE2 
1216 C CZ  . PHE A 159 ? 0.5818 0.5812 0.5582 0.0076  0.0632  -0.0183 160 PHE A CZ  
1217 N N   . TYR A 160 ? 0.5731 0.6293 0.5914 -0.0267 0.0607  0.0069  161 TYR A N   
1218 C CA  . TYR A 160 ? 0.5536 0.6048 0.5807 -0.0308 0.0541  0.0106  161 TYR A CA  
1219 C C   . TYR A 160 ? 0.5588 0.5825 0.5792 -0.0271 0.0471  0.0096  161 TYR A C   
1220 O O   . TYR A 160 ? 0.5799 0.5887 0.5915 -0.0296 0.0453  0.0125  161 TYR A O   
1221 C CB  . TYR A 160 ? 0.5631 0.6229 0.5942 -0.0460 0.0522  0.0213  161 TYR A CB  
1222 C CG  . TYR A 160 ? 0.5532 0.6002 0.5925 -0.0510 0.0425  0.0246  161 TYR A CG  
1223 C CD1 . TYR A 160 ? 0.5346 0.5918 0.5858 -0.0487 0.0406  0.0206  161 TYR A CD1 
1224 C CD2 . TYR A 160 ? 0.5475 0.5726 0.5845 -0.0575 0.0340  0.0302  161 TYR A CD2 
1225 C CE1 . TYR A 160 ? 0.5354 0.5821 0.5939 -0.0531 0.0313  0.0215  161 TYR A CE1 
1226 C CE2 . TYR A 160 ? 0.5463 0.5599 0.5929 -0.0609 0.0239  0.0297  161 TYR A CE2 
1227 C CZ  . TYR A 160 ? 0.5363 0.5614 0.5927 -0.0589 0.0231  0.0251  161 TYR A CZ  
1228 O OH  . TYR A 160 ? 0.5342 0.5500 0.6001 -0.0623 0.0130  0.0228  161 TYR A OH  
1229 N N   . TYR A 161 ? 0.5626 0.5831 0.5878 -0.0214 0.0430  0.0051  162 TYR A N   
1230 C CA  . TYR A 161 ? 0.5686 0.5715 0.5887 -0.0198 0.0365  0.0030  162 TYR A CA  
1231 C C   . TYR A 161 ? 0.5933 0.5984 0.6229 -0.0249 0.0299  0.0027  162 TYR A C   
1232 O O   . TYR A 161 ? 0.6247 0.6423 0.6627 -0.0237 0.0289  0.0016  162 TYR A O   
1233 C CB  . TYR A 161 ? 0.5691 0.5680 0.5840 -0.0108 0.0358  -0.0011 162 TYR A CB  
1234 C CG  . TYR A 161 ? 0.5678 0.5586 0.5730 -0.0059 0.0394  -0.0018 162 TYR A CG  
1235 C CD1 . TYR A 161 ? 0.5641 0.5494 0.5625 -0.0089 0.0430  0.0000  162 TYR A CD1 
1236 C CD2 . TYR A 161 ? 0.5594 0.5471 0.5626 0.0008  0.0375  -0.0034 162 TYR A CD2 
1237 C CE1 . TYR A 161 ? 0.5550 0.5335 0.5447 -0.0046 0.0457  -0.0013 162 TYR A CE1 
1238 C CE2 . TYR A 161 ? 0.5475 0.5266 0.5431 0.0046  0.0393  -0.0041 162 TYR A CE2 
1239 C CZ  . TYR A 161 ? 0.5537 0.5287 0.5424 0.0021  0.0439  -0.0039 162 TYR A CZ  
1240 O OH  . TYR A 161 ? 0.5802 0.5469 0.5614 0.0055  0.0452  -0.0052 162 TYR A OH  
1241 N N   . ASN A 162 ? 0.5999 0.5926 0.6298 -0.0300 0.0241  0.0027  163 ASN A N   
1242 C CA  . ASN A 162 ? 0.5889 0.5804 0.6288 -0.0347 0.0157  0.0001  163 ASN A CA  
1243 C C   . ASN A 162 ? 0.6046 0.5946 0.6405 -0.0288 0.0118  -0.0094 163 ASN A C   
1244 O O   . ASN A 162 ? 0.5919 0.5807 0.6171 -0.0225 0.0152  -0.0117 163 ASN A O   
1245 C CB  . ASN A 162 ? 0.5914 0.5681 0.6360 -0.0418 0.0086  0.0028  163 ASN A CB  
1246 C CG  . ASN A 162 ? 0.5835 0.5584 0.6428 -0.0493 -0.0017 0.0020  163 ASN A CG  
1247 O OD1 . ASN A 162 ? 0.5696 0.5571 0.6355 -0.0506 -0.0024 0.0005  163 ASN A OD1 
1248 N ND2 . ASN A 162 ? 0.5772 0.5352 0.6436 -0.0542 -0.0115 0.0027  163 ASN A ND2 
1249 N N   . ARG A 163 ? 0.6907 0.6828 0.7351 -0.0320 0.0042  -0.0145 164 ARG A N   
1250 C CA  . ARG A 163 ? 0.7670 0.7590 0.8078 -0.0286 -0.0011 -0.0262 164 ARG A CA  
1251 C C   . ARG A 163 ? 0.8424 0.8197 0.8878 -0.0293 -0.0078 -0.0342 164 ARG A C   
1252 O O   . ARG A 163 ? 0.8667 0.8319 0.9169 -0.0329 -0.0089 -0.0276 164 ARG A O   
1253 C CB  . ARG A 163 ? 0.8097 0.8141 0.8579 -0.0312 -0.0065 -0.0294 164 ARG A CB  
1254 C CG  . ARG A 163 ? 0.8369 0.8550 0.8852 -0.0299 -0.0020 -0.0213 164 ARG A CG  
1255 C CD  . ARG A 163 ? 0.8523 0.8814 0.9144 -0.0351 -0.0069 -0.0200 164 ARG A CD  
1256 N NE  . ARG A 163 ? 0.8985 0.9412 0.9654 -0.0329 -0.0025 -0.0126 164 ARG A NE  
1257 C CZ  . ARG A 163 ? 0.9069 0.9572 0.9839 -0.0359 0.0019  -0.0062 164 ARG A CZ  
1258 N NH1 . ARG A 163 ? 0.8418 0.9071 0.9253 -0.0315 0.0052  -0.0034 164 ARG A NH1 
1259 N NH2 . ARG A 163 ? 0.9375 0.9825 1.0194 -0.0436 0.0022  -0.0027 164 ARG A NH2 
1260 N N   . ASP A 164 ? 0.9206 0.9005 0.9653 -0.0258 -0.0129 -0.0488 165 ASP A N   
1261 C CA  . ASP A 164 ? 0.9873 0.9541 1.0408 -0.0242 -0.0210 -0.0601 165 ASP A CA  
1262 C C   . ASP A 164 ? 1.0431 1.0175 1.1033 -0.0217 -0.0297 -0.0799 165 ASP A C   
1263 O O   . ASP A 164 ? 1.1479 1.1121 1.2198 -0.0188 -0.0385 -0.0931 165 ASP A O   
1264 C CB  . ASP A 164 ? 1.0152 0.9758 1.0601 -0.0189 -0.0160 -0.0604 165 ASP A CB  
1265 C CG  . ASP A 164 ? 1.0301 1.0069 1.0630 -0.0131 -0.0116 -0.0717 165 ASP A CG  
1266 O OD1 . ASP A 164 ? 1.0157 1.0078 1.0374 -0.0139 -0.0063 -0.0675 165 ASP A OD1 
1267 O OD2 . ASP A 164 ? 1.0216 0.9972 1.0573 -0.0084 -0.0143 -0.0841 165 ASP A OD2 
1268 N N   . SER A 168 ? 1.2576 1.1521 1.3889 -0.0308 -0.0796 -0.0866 169 SER A N   
1269 C CA  . SER A 168 ? 1.3059 1.2073 1.4231 -0.0215 -0.0693 -0.0917 169 SER A CA  
1270 C C   . SER A 168 ? 1.3314 1.2118 1.4552 -0.0215 -0.0750 -0.0829 169 SER A C   
1271 O O   . SER A 168 ? 1.3631 1.2478 1.4751 -0.0154 -0.0663 -0.0833 169 SER A O   
1272 C CB  . SER A 168 ? 1.3017 1.2189 1.4196 -0.0107 -0.0703 -0.1196 169 SER A CB  
1273 O OG  . SER A 168 ? 1.2789 1.1815 1.4210 -0.0055 -0.0875 -0.1384 169 SER A OG  
1274 N N   . GLN A 169 ? 1.3073 1.1651 1.4503 -0.0292 -0.0910 -0.0741 170 GLN A N   
1275 C CA  . GLN A 169 ? 1.2654 1.1034 1.4130 -0.0339 -0.0975 -0.0576 170 GLN A CA  
1276 C C   . GLN A 169 ? 1.2411 1.0790 1.3826 -0.0501 -0.0943 -0.0293 170 GLN A C   
1277 O O   . GLN A 169 ? 1.2717 1.0926 1.4291 -0.0618 -0.1097 -0.0157 170 GLN A O   
1278 C CB  . GLN A 169 ? 1.2752 1.0875 1.4516 -0.0309 -0.1213 -0.0686 170 GLN A CB  
1279 N N   . SER A 170 ? 1.1547 1.0140 1.2742 -0.0509 -0.0749 -0.0212 171 SER A N   
1280 C CA  . SER A 170 ? 1.0523 0.9219 1.1638 -0.0639 -0.0674 0.0010  171 SER A CA  
1281 C C   . SER A 170 ? 0.9884 0.8729 1.0772 -0.0602 -0.0489 0.0076  171 SER A C   
1282 O O   . SER A 170 ? 1.0039 0.8875 1.0839 -0.0492 -0.0436 -0.0027 171 SER A O   
1283 C CB  . SER A 170 ? 1.0641 0.9486 1.1790 -0.0681 -0.0649 -0.0007 171 SER A CB  
1284 O OG  . SER A 170 ? 1.0135 0.9169 1.1142 -0.0580 -0.0509 -0.0123 171 SER A OG  
1285 N N   . LEU A 171 ? 0.8794 0.7792 0.9601 -0.0694 -0.0397 0.0234  172 LEU A N   
1286 C CA  . LEU A 171 ? 0.7907 0.7047 0.8526 -0.0667 -0.0240 0.0290  172 LEU A CA  
1287 C C   . LEU A 171 ? 0.7250 0.6521 0.7757 -0.0543 -0.0115 0.0161  172 LEU A C   
1288 O O   . LEU A 171 ? 0.7111 0.6529 0.7632 -0.0545 -0.0069 0.0143  172 LEU A O   
1289 C CB  . LEU A 171 ? 0.7901 0.7220 0.8495 -0.0800 -0.0184 0.0463  172 LEU A CB  
1290 C CG  . LEU A 171 ? 0.7694 0.7180 0.8118 -0.0788 -0.0039 0.0515  172 LEU A CG  
1291 C CD1 . LEU A 171 ? 0.7816 0.7201 0.8182 -0.0849 -0.0084 0.0627  172 LEU A CD1 
1292 C CD2 . LEU A 171 ? 0.7554 0.7321 0.7982 -0.0872 0.0045  0.0592  172 LEU A CD2 
1293 N N   . GLY A 172 ? 0.6509 0.5732 0.6916 -0.0448 -0.0072 0.0087  173 GLY A N   
1294 C CA  . GLY A 172 ? 0.6085 0.5415 0.6386 -0.0350 0.0021  -0.0007 173 GLY A CA  
1295 C C   . GLY A 172 ? 0.6114 0.5595 0.6318 -0.0345 0.0139  0.0054  173 GLY A C   
1296 O O   . GLY A 172 ? 0.6263 0.5846 0.6438 -0.0293 0.0184  0.0006  173 GLY A O   
1297 N N   . GLY A 173 ? 0.5848 0.5358 0.6014 -0.0400 0.0176  0.0156  174 GLY A N   
1298 C CA  . GLY A 173 ? 0.5733 0.5416 0.5838 -0.0392 0.0280  0.0185  174 GLY A CA  
1299 C C   . GLY A 173 ? 0.5937 0.5674 0.5995 -0.0473 0.0307  0.0288  174 GLY A C   
1300 O O   . GLY A 173 ? 0.6133 0.5748 0.6206 -0.0543 0.0230  0.0360  174 GLY A O   
1301 N N   . GLN A 174 ? 0.5844 0.5777 0.5855 -0.0464 0.0403  0.0288  175 GLN A N   
1302 C CA  . GLN A 174 ? 0.6115 0.6183 0.6061 -0.0551 0.0445  0.0373  175 GLN A CA  
1303 C C   . GLN A 174 ? 0.6107 0.6365 0.5989 -0.0479 0.0555  0.0293  175 GLN A C   
1304 O O   . GLN A 174 ? 0.6237 0.6632 0.6194 -0.0415 0.0597  0.0215  175 GLN A O   
1305 C CB  . GLN A 174 ? 0.6235 0.6462 0.6266 -0.0702 0.0419  0.0490  175 GLN A CB  
1306 C CG  . GLN A 174 ? 0.6270 0.6666 0.6225 -0.0835 0.0442  0.0615  175 GLN A CG  
1307 C CD  . GLN A 174 ? 0.6553 0.7269 0.6581 -0.0969 0.0476  0.0696  175 GLN A CD  
1308 O OE1 . GLN A 174 ? 0.6548 0.7496 0.6635 -0.0913 0.0561  0.0602  175 GLN A OE1 
1309 N NE2 . GLN A 174 ? 0.6586 0.7326 0.6626 -0.1152 0.0399  0.0878  175 GLN A NE2 
1310 N N   . ILE A 175 ? 0.6186 0.6445 0.5948 -0.0485 0.0584  0.0303  176 ILE A N   
1311 C CA  . ILE A 175 ? 0.6280 0.6746 0.5988 -0.0434 0.0678  0.0218  176 ILE A CA  
1312 C C   . ILE A 175 ? 0.6415 0.7138 0.6060 -0.0570 0.0718  0.0303  176 ILE A C   
1313 O O   . ILE A 175 ? 0.6538 0.7170 0.6092 -0.0660 0.0671  0.0415  176 ILE A O   
1314 C CB  . ILE A 175 ? 0.6268 0.6565 0.5880 -0.0332 0.0681  0.0141  176 ILE A CB  
1315 C CG1 . ILE A 175 ? 0.6506 0.6620 0.6175 -0.0218 0.0647  0.0068  176 ILE A CG1 
1316 C CG2 . ILE A 175 ? 0.6346 0.6852 0.5913 -0.0284 0.0761  0.0035  176 ILE A CG2 
1317 C CD1 . ILE A 175 ? 0.6768 0.6646 0.6352 -0.0176 0.0607  0.0063  176 ILE A CD1 
1318 N N   . VAL A 176 ? 0.6224 0.7290 0.5925 -0.0588 0.0798  0.0252  177 VAL A N   
1319 C CA  . VAL A 176 ? 0.6365 0.7774 0.5988 -0.0715 0.0860  0.0305  177 VAL A CA  
1320 C C   . VAL A 176 ? 0.6344 0.7893 0.5890 -0.0607 0.0940  0.0136  177 VAL A C   
1321 O O   . VAL A 176 ? 0.6421 0.8029 0.6065 -0.0460 0.0979  -0.0038 177 VAL A O   
1322 C CB  . VAL A 176 ? 0.6399 0.8183 0.6135 -0.0816 0.0908  0.0338  177 VAL A CB  
1323 C CG1 . VAL A 176 ? 0.6467 0.8657 0.6101 -0.0979 0.0973  0.0414  177 VAL A CG1 
1324 C CG2 . VAL A 176 ? 0.6197 0.7814 0.6035 -0.0913 0.0812  0.0488  177 VAL A CG2 
1325 N N   . LEU A 177 ? 0.6286 0.7869 0.5671 -0.0679 0.0944  0.0188  178 LEU A N   
1326 C CA  . LEU A 177 ? 0.6190 0.7968 0.5492 -0.0607 0.1018  0.0027  178 LEU A CA  
1327 C C   . LEU A 177 ? 0.6390 0.8693 0.5651 -0.0738 0.1108  0.0032  178 LEU A C   
1328 O O   . LEU A 177 ? 0.6605 0.9029 0.5759 -0.0932 0.1087  0.0228  178 LEU A O   
1329 C CB  . LEU A 177 ? 0.6353 0.7880 0.5496 -0.0609 0.0967  0.0070  178 LEU A CB  
1330 C CG  . LEU A 177 ? 0.6507 0.7557 0.5671 -0.0513 0.0877  0.0091  178 LEU A CG  
1331 C CD1 . LEU A 177 ? 0.6507 0.7380 0.5524 -0.0562 0.0821  0.0177  178 LEU A CD1 
1332 C CD2 . LEU A 177 ? 0.6325 0.7248 0.5580 -0.0328 0.0888  -0.0094 178 LEU A CD2 
1333 N N   . GLY A 178 ? 0.6352 0.8986 0.5712 -0.0638 0.1198  -0.0181 179 GLY A N   
1334 C CA  . GLY A 178 ? 0.6515 0.9740 0.5846 -0.0746 0.1304  -0.0229 179 GLY A CA  
1335 C C   . GLY A 178 ? 0.6498 1.0050 0.6000 -0.0800 0.1350  -0.0218 179 GLY A C   
1336 O O   . GLY A 178 ? 0.6654 1.0759 0.6154 -0.0895 0.1447  -0.0266 179 GLY A O   
1337 N N   . GLY A 179 ? 0.6366 0.9609 0.6012 -0.0747 0.1283  -0.0158 180 GLY A N   
1338 C CA  . GLY A 179 ? 0.6378 0.9886 0.6208 -0.0785 0.1311  -0.0151 180 GLY A CA  
1339 C C   . GLY A 179 ? 0.6414 0.9502 0.6379 -0.0701 0.1218  -0.0104 180 GLY A C   
1340 O O   . GLY A 179 ? 0.6335 0.8995 0.6286 -0.0563 0.1153  -0.0151 180 GLY A O   
1341 N N   . SER A 180 ? 0.6553 0.9799 0.6648 -0.0797 0.1211  -0.0012 181 SER A N   
1342 C CA  . SER A 180 ? 0.6469 0.9363 0.6678 -0.0763 0.1115  0.0060  181 SER A CA  
1343 C C   . SER A 180 ? 0.6454 0.9336 0.6645 -0.0991 0.1052  0.0311  181 SER A C   
1344 O O   . SER A 180 ? 0.6565 0.9761 0.6678 -0.1177 0.1088  0.0432  181 SER A O   
1345 C CB  . SER A 180 ? 0.6506 0.9583 0.6942 -0.0630 0.1142  -0.0100 181 SER A CB  
1346 O OG  . SER A 180 ? 0.6865 1.0480 0.7404 -0.0740 0.1223  -0.0105 181 SER A OG  
1347 N N   . ASP A 181 ? 0.6424 0.8949 0.6689 -0.0985 0.0947  0.0391  182 ASP A N   
1348 C CA  . ASP A 181 ? 0.6401 0.8862 0.6697 -0.1187 0.0855  0.0610  182 ASP A CA  
1349 C C   . ASP A 181 ? 0.6222 0.8803 0.6721 -0.1201 0.0834  0.0602  182 ASP A C   
1350 O O   . ASP A 181 ? 0.5963 0.8262 0.6544 -0.1075 0.0775  0.0528  182 ASP A O   
1351 C CB  . ASP A 181 ? 0.6299 0.8242 0.6518 -0.1188 0.0725  0.0708  182 ASP A CB  
1352 C CG  . ASP A 181 ? 0.6489 0.8323 0.6752 -0.1398 0.0598  0.0934  182 ASP A CG  
1353 O OD1 . ASP A 181 ? 0.6666 0.8810 0.7008 -0.1570 0.0603  0.1050  182 ASP A OD1 
1354 O OD2 . ASP A 181 ? 0.6591 0.8020 0.6828 -0.1390 0.0479  0.0992  182 ASP A OD2 
1355 N N   . PRO A 182 ? 0.6137 0.9162 0.6715 -0.1369 0.0880  0.0686  183 PRO A N   
1356 C CA  . PRO A 182 ? 0.6238 0.9454 0.7023 -0.1396 0.0870  0.0676  183 PRO A CA  
1357 C C   . PRO A 182 ? 0.6291 0.9117 0.7155 -0.1457 0.0716  0.0795  183 PRO A C   
1358 O O   . PRO A 182 ? 0.6402 0.9273 0.7430 -0.1425 0.0690  0.0749  183 PRO A O   
1359 C CB  . PRO A 182 ? 0.6201 0.9980 0.7015 -0.1617 0.0942  0.0790  183 PRO A CB  
1360 C CG  . PRO A 182 ? 0.6309 1.0264 0.6927 -0.1657 0.1022  0.0794  183 PRO A CG  
1361 C CD  . PRO A 182 ? 0.6319 0.9711 0.6787 -0.1568 0.0935  0.0816  183 PRO A CD  
1362 N N   . GLN A 183 ? 0.6273 0.8726 0.7033 -0.1535 0.0607  0.0930  184 GLN A N   
1363 C CA  . GLN A 183 ? 0.6253 0.8306 0.7094 -0.1570 0.0445  0.1005  184 GLN A CA  
1364 C C   . GLN A 183 ? 0.5911 0.7646 0.6777 -0.1347 0.0418  0.0826  184 GLN A C   
1365 O O   . GLN A 183 ? 0.5698 0.7197 0.6660 -0.1356 0.0302  0.0834  184 GLN A O   
1366 C CB  . GLN A 183 ? 0.6382 0.8140 0.7135 -0.1701 0.0323  0.1180  184 GLN A CB  
1367 N N   . HIS A 184 ? 0.5692 0.7445 0.6478 -0.1162 0.0516  0.0667  185 HIS A N   
1368 C CA  . HIS A 184 ? 0.5612 0.7105 0.6401 -0.0969 0.0491  0.0520  185 HIS A CA  
1369 C C   . HIS A 184 ? 0.5465 0.7176 0.6355 -0.0832 0.0560  0.0377  185 HIS A C   
1370 O O   . HIS A 184 ? 0.5564 0.7083 0.6448 -0.0686 0.0532  0.0277  185 HIS A O   
1371 C CB  . HIS A 184 ? 0.5717 0.6919 0.6341 -0.0867 0.0490  0.0476  185 HIS A CB  
1372 C CG  . HIS A 184 ? 0.6020 0.6928 0.6592 -0.0958 0.0382  0.0584  185 HIS A CG  
1373 N ND1 . HIS A 184 ? 0.6214 0.7073 0.6665 -0.1019 0.0386  0.0667  185 HIS A ND1 
1374 C CD2 . HIS A 184 ? 0.6115 0.6772 0.6763 -0.0997 0.0251  0.0614  185 HIS A CD2 
1375 C CE1 . HIS A 184 ? 0.6398 0.6973 0.6866 -0.1087 0.0255  0.0752  185 HIS A CE1 
1376 N NE2 . HIS A 184 ? 0.6315 0.6764 0.6909 -0.1070 0.0172  0.0710  185 HIS A NE2 
1377 N N   . TYR A 185 ? 0.5281 0.7409 0.6274 -0.0882 0.0640  0.0369  186 TYR A N   
1378 C CA  . TYR A 185 ? 0.5150 0.7512 0.6293 -0.0753 0.0685  0.0229  186 TYR A CA  
1379 C C   . TYR A 185 ? 0.5227 0.7992 0.6552 -0.0872 0.0707  0.0270  186 TYR A C   
1380 O O   . TYR A 185 ? 0.5381 0.8326 0.6695 -0.1064 0.0718  0.0407  186 TYR A O   
1381 C CB  . TYR A 185 ? 0.5124 0.7621 0.6233 -0.0601 0.0779  0.0079  186 TYR A CB  
1382 C CG  . TYR A 185 ? 0.5252 0.8153 0.6332 -0.0682 0.0894  0.0072  186 TYR A CG  
1383 C CD1 . TYR A 185 ? 0.5218 0.8627 0.6467 -0.0724 0.0968  0.0020  186 TYR A CD1 
1384 C CD2 . TYR A 185 ? 0.5309 0.8126 0.6194 -0.0719 0.0929  0.0108  186 TYR A CD2 
1385 C CE1 . TYR A 185 ? 0.5276 0.9121 0.6489 -0.0809 0.1081  0.0001  186 TYR A CE1 
1386 C CE2 . TYR A 185 ? 0.5444 0.8671 0.6283 -0.0805 0.1033  0.0099  186 TYR A CE2 
1387 C CZ  . TYR A 185 ? 0.5539 0.9292 0.6536 -0.0853 0.1112  0.0043  186 TYR A CZ  
1388 O OH  . TYR A 185 ? 0.5951 1.0177 0.6893 -0.0949 0.1224  0.0023  186 TYR A OH  
1389 N N   . GLU A 186 ? 0.5269 0.8185 0.6769 -0.0766 0.0704  0.0163  187 GLU A N   
1390 C CA  . GLU A 186 ? 0.5429 0.8766 0.7133 -0.0860 0.0727  0.0181  187 GLU A CA  
1391 C C   . GLU A 186 ? 0.5412 0.9041 0.7302 -0.0684 0.0777  -0.0004 187 GLU A C   
1392 O O   . GLU A 186 ? 0.5294 0.8713 0.7171 -0.0492 0.0754  -0.0124 187 GLU A O   
1393 C CB  . GLU A 186 ? 0.5437 0.8611 0.7222 -0.0967 0.0607  0.0288  187 GLU A CB  
1394 C CG  . GLU A 186 ? 0.5400 0.8220 0.7187 -0.0822 0.0508  0.0217  187 GLU A CG  
1395 C CD  . GLU A 186 ? 0.5485 0.8112 0.7315 -0.0933 0.0382  0.0305  187 GLU A CD  
1396 O OE1 . GLU A 186 ? 0.5664 0.8331 0.7515 -0.1124 0.0349  0.0436  187 GLU A OE1 
1397 O OE2 . GLU A 186 ? 0.5428 0.7865 0.7276 -0.0834 0.0304  0.0242  187 GLU A OE2 
1398 N N   . GLY A 187 ? 0.5532 0.9653 0.7615 -0.0754 0.0834  -0.0024 188 GLY A N   
1399 C CA  . GLY A 187 ? 0.5614 1.0114 0.7909 -0.0591 0.0895  -0.0224 188 GLY A CA  
1400 C C   . GLY A 187 ? 0.5769 1.0416 0.7984 -0.0492 0.1000  -0.0363 188 GLY A C   
1401 O O   . GLY A 187 ? 0.5598 1.0150 0.7590 -0.0590 0.1045  -0.0279 188 GLY A O   
1402 N N   . ASN A 188 ? 0.6027 1.0898 0.8440 -0.0292 0.1024  -0.0583 189 ASN A N   
1403 C CA  . ASN A 188 ? 0.6278 1.1323 0.8664 -0.0171 0.1112  -0.0766 189 ASN A CA  
1404 C C   . ASN A 188 ? 0.6191 1.0716 0.8460 0.0000  0.1035  -0.0824 189 ASN A C   
1405 O O   . ASN A 188 ? 0.6204 1.0345 0.8508 0.0089  0.0913  -0.0789 189 ASN A O   
1406 C CB  . ASN A 188 ? 0.6365 1.1952 0.9067 -0.0031 0.1166  -0.1012 189 ASN A CB  
1407 C CG  . ASN A 188 ? 0.6538 1.2744 0.9362 -0.0211 0.1264  -0.0972 189 ASN A CG  
1408 O OD1 . ASN A 188 ? 0.6483 1.2874 0.9538 -0.0216 0.1223  -0.0968 189 ASN A OD1 
1409 N ND2 . ASN A 188 ? 0.6611 1.3157 0.9277 -0.0377 0.1388  -0.0926 189 ASN A ND2 
1410 N N   . PHE A 189 ? 0.6049 1.0588 0.8174 0.0033  0.1105  -0.0905 190 PHE A N   
1411 C CA  . PHE A 189 ? 0.5996 1.0160 0.8079 0.0222  0.1040  -0.1018 190 PHE A CA  
1412 C C   . PHE A 189 ? 0.6063 1.0409 0.8465 0.0448  0.0995  -0.1262 190 PHE A C   
1413 O O   . PHE A 189 ? 0.6049 1.0932 0.8657 0.0479  0.1075  -0.1427 190 PHE A O   
1414 C CB  . PHE A 189 ? 0.6029 1.0206 0.7899 0.0198  0.1122  -0.1060 190 PHE A CB  
1415 C CG  . PHE A 189 ? 0.6109 0.9908 0.7673 0.0043  0.1108  -0.0835 190 PHE A CG  
1416 C CD1 . PHE A 189 ? 0.6060 0.9301 0.7511 0.0105  0.1001  -0.0758 190 PHE A CD1 
1417 C CD2 . PHE A 189 ? 0.6294 1.0313 0.7695 -0.0168 0.1191  -0.0696 190 PHE A CD2 
1418 C CE1 . PHE A 189 ? 0.6036 0.8958 0.7237 -0.0021 0.0984  -0.0577 190 PHE A CE1 
1419 C CE2 . PHE A 189 ? 0.6158 0.9814 0.7313 -0.0298 0.1154  -0.0496 190 PHE A CE2 
1420 C CZ  . PHE A 189 ? 0.6079 0.9193 0.7145 -0.0213 0.1055  -0.0451 190 PHE A CZ  
1421 N N   . HIS A 190 ? 0.6125 1.0038 0.8581 0.0597  0.0855  -0.1277 191 HIS A N   
1422 C CA  . HIS A 190 ? 0.6187 1.0157 0.8946 0.0828  0.0768  -0.1500 191 HIS A CA  
1423 C C   . HIS A 190 ? 0.6256 0.9861 0.8918 0.0946  0.0707  -0.1575 191 HIS A C   
1424 O O   . HIS A 190 ? 0.6219 0.9343 0.8671 0.0905  0.0633  -0.1409 191 HIS A O   
1425 C CB  . HIS A 190 ? 0.6334 1.0148 0.9290 0.0886  0.0621  -0.1433 191 HIS A CB  
1426 C CG  . HIS A 190 ? 0.6637 1.0828 0.9712 0.0771  0.0674  -0.1373 191 HIS A CG  
1427 N ND1 . HIS A 190 ? 0.6705 1.1424 1.0100 0.0850  0.0715  -0.1561 191 HIS A ND1 
1428 C CD2 . HIS A 190 ? 0.6698 1.0833 0.9628 0.0579  0.0688  -0.1155 191 HIS A CD2 
1429 C CE1 . HIS A 190 ? 0.6841 1.1814 1.0276 0.0700  0.0754  -0.1443 191 HIS A CE1 
1430 N NE2 . HIS A 190 ? 0.6890 1.1497 1.0046 0.0534  0.0732  -0.1196 191 HIS A NE2 
1431 N N   . TYR A 191 ? 0.6345 1.0218 0.9166 0.1087  0.0743  -0.1837 192 TYR A N   
1432 C CA  . TYR A 191 ? 0.6214 0.9822 0.8945 0.1184  0.0707  -0.1941 192 TYR A CA  
1433 C C   . TYR A 191 ? 0.6303 0.9635 0.9309 0.1406  0.0514  -0.2077 192 TYR A C   
1434 O O   . TYR A 191 ? 0.6459 0.9998 0.9808 0.1541  0.0441  -0.2222 192 TYR A O   
1435 C CB  . TYR A 191 ? 0.6174 1.0245 0.8881 0.1188  0.0860  -0.2155 192 TYR A CB  
1436 C CG  . TYR A 191 ? 0.6143 1.0433 0.8541 0.0945  0.1025  -0.1983 192 TYR A CG  
1437 C CD1 . TYR A 191 ? 0.6158 1.0117 0.8218 0.0831  0.1045  -0.1822 192 TYR A CD1 
1438 C CD2 . TYR A 191 ? 0.6153 1.0987 0.8613 0.0822  0.1147  -0.1971 192 TYR A CD2 
1439 C CE1 . TYR A 191 ? 0.6240 1.0372 0.8040 0.0608  0.1166  -0.1651 192 TYR A CE1 
1440 C CE2 . TYR A 191 ? 0.6204 1.1221 0.8394 0.0580  0.1270  -0.1784 192 TYR A CE2 
1441 C CZ  . TYR A 191 ? 0.6390 1.1039 0.8255 0.0478  0.1271  -0.1623 192 TYR A CZ  
1442 O OH  . TYR A 191 ? 0.6634 1.1430 0.8250 0.0240  0.1363  -0.1425 192 TYR A OH  
1443 N N   . ILE A 192 ? 0.6395 0.9249 0.9255 0.1433  0.0418  -0.2013 193 ILE A N   
1444 C CA  . ILE A 192 ? 0.6558 0.9104 0.9654 0.1625  0.0218  -0.2132 193 ILE A CA  
1445 C C   . ILE A 192 ? 0.6654 0.9090 0.9639 0.1674  0.0238  -0.2272 193 ILE A C   
1446 O O   . ILE A 192 ? 0.6386 0.8637 0.9031 0.1534  0.0314  -0.2118 193 ILE A O   
1447 C CB  . ILE A 192 ? 0.6506 0.8531 0.9537 0.1585  0.0041  -0.1869 193 ILE A CB  
1448 C CG1 . ILE A 192 ? 0.6286 0.8411 0.9344 0.1496  0.0039  -0.1700 193 ILE A CG1 
1449 C CG2 . ILE A 192 ? 0.6681 0.8412 1.0003 0.1769  -0.0197 -0.1965 193 ILE A CG2 
1450 C CD1 . ILE A 192 ? 0.6086 0.8078 0.8778 0.1279  0.0134  -0.1437 193 ILE A CD1 
1451 N N   . ASN A 193 ? 0.6859 0.9424 1.0149 0.1877  0.0163  -0.2579 194 ASN A N   
1452 C CA  . ASN A 193 ? 0.7052 0.9487 1.0290 0.1949  0.0143  -0.2748 194 ASN A CA  
1453 C C   . ASN A 193 ? 0.7133 0.8932 1.0281 0.1941  -0.0043 -0.2563 194 ASN A C   
1454 O O   . ASN A 193 ? 0.7131 0.8629 1.0428 0.1975  -0.0224 -0.2425 194 ASN A O   
1455 C CB  . ASN A 193 ? 0.7252 0.9977 1.0893 0.2190  0.0079  -0.3156 194 ASN A CB  
1456 C CG  . ASN A 193 ? 0.7357 1.0796 1.1114 0.2203  0.0269  -0.3373 194 ASN A CG  
1457 O OD1 . ASN A 193 ? 0.7349 1.1077 1.0845 0.2011  0.0463  -0.3219 194 ASN A OD1 
1458 N ND2 . ASN A 193 ? 0.7630 1.1375 1.1801 0.2428  0.0204  -0.3738 194 ASN A ND2 
1459 N N   . LEU A 194 ? 0.7158 0.8783 1.0055 0.1882  0.0000  -0.2550 195 LEU A N   
1460 C CA  . LEU A 194 ? 0.7319 0.8393 1.0145 0.1876  -0.0173 -0.2417 195 LEU A CA  
1461 C C   . LEU A 194 ? 0.7636 0.8519 1.0861 0.2090  -0.0413 -0.2630 195 LEU A C   
1462 O O   . LEU A 194 ? 0.7411 0.8604 1.0905 0.2258  -0.0406 -0.2971 195 LEU A O   
1463 C CB  . LEU A 194 ? 0.7319 0.8321 0.9827 0.1781  -0.0068 -0.2406 195 LEU A CB  
1464 C CG  . LEU A 194 ? 0.7269 0.8384 0.9375 0.1569  0.0136  -0.2196 195 LEU A CG  
1465 C CD1 . LEU A 194 ? 0.7282 0.8350 0.9152 0.1517  0.0205  -0.2244 195 LEU A CD1 
1466 C CD2 . LEU A 194 ? 0.7209 0.8006 0.9140 0.1429  0.0093  -0.1858 195 LEU A CD2 
1467 N N   . ILE A 195 ? 0.7977 0.8364 1.1245 0.2076  -0.0632 -0.2428 196 ILE A N   
1468 C CA  . ILE A 195 ? 0.8588 0.8658 1.2200 0.2241  -0.0907 -0.2564 196 ILE A CA  
1469 C C   . ILE A 195 ? 0.8845 0.8969 1.2483 0.2336  -0.0883 -0.2859 196 ILE A C   
1470 O O   . ILE A 195 ? 0.9250 0.9508 1.3253 0.2544  -0.0981 -0.3199 196 ILE A O   
1471 C CB  . ILE A 195 ? 0.8740 0.8260 1.2270 0.2132  -0.1121 -0.2226 196 ILE A CB  
1472 C CG1 . ILE A 195 ? 0.8535 0.8022 1.2071 0.2052  -0.1175 -0.1960 196 ILE A CG1 
1473 C CG2 . ILE A 195 ? 0.8934 0.8076 1.2780 0.2267  -0.1418 -0.2337 196 ILE A CG2 
1474 C CD1 . ILE A 195 ? 0.8781 0.8346 1.2768 0.2227  -0.1356 -0.2089 196 ILE A CD1 
1475 N N   . LYS A 196 ? 0.9055 0.9091 1.2313 0.2185  -0.0754 -0.2737 197 LYS A N   
1476 C CA  . LYS A 196 ? 0.9404 0.9518 1.2597 0.2231  -0.0697 -0.2978 197 LYS A CA  
1477 C C   . LYS A 196 ? 0.9254 0.9522 1.1979 0.2032  -0.0446 -0.2821 197 LYS A C   
1478 O O   . LYS A 196 ? 0.9309 0.9430 1.1775 0.1860  -0.0390 -0.2493 197 LYS A O   
1479 C CB  . LYS A 196 ? 0.9798 0.9397 1.3122 0.2280  -0.0959 -0.2973 197 LYS A CB  
1480 C CG  . LYS A 196 ? 0.9793 0.9036 1.2757 0.2080  -0.0955 -0.2659 197 LYS A CG  
1481 C CD  . LYS A 196 ? 1.0129 0.8831 1.3234 0.2059  -0.1248 -0.2460 197 LYS A CD  
1482 C CE  . LYS A 196 ? 1.0158 0.8718 1.3111 0.1900  -0.1262 -0.2073 197 LYS A CE  
1483 N NZ  . LYS A 196 ? 1.0127 0.8261 1.2933 0.1748  -0.1408 -0.1780 197 LYS A NZ  
1484 N N   . THR A 197 ? 0.9124 0.9704 1.1757 0.2057  -0.0307 -0.3063 198 THR A N   
1485 C CA  . THR A 197 ? 0.8761 0.9415 1.0974 0.1878  -0.0122 -0.2927 198 THR A CA  
1486 C C   . THR A 197 ? 0.8631 0.8762 1.0692 0.1795  -0.0253 -0.2723 198 THR A C   
1487 O O   . THR A 197 ? 0.9028 0.8844 1.1308 0.1900  -0.0464 -0.2820 198 THR A O   
1488 C CB  . THR A 197 ? 0.8877 1.0002 1.1029 0.1919  0.0033  -0.3238 198 THR A CB  
1489 O OG1 . THR A 197 ? 0.8646 0.9789 1.0395 0.1737  0.0177  -0.3073 198 THR A OG1 
1490 C CG2 . THR A 197 ? 0.8998 1.0062 1.1434 0.2118  -0.0122 -0.3603 198 THR A CG2 
1491 N N   . GLY A 198 ? 0.8192 0.8237 0.9900 0.1605  -0.0140 -0.2441 199 GLY A N   
1492 C CA  . GLY A 198 ? 0.7975 0.7586 0.9529 0.1509  -0.0243 -0.2234 199 GLY A CA  
1493 C C   . GLY A 198 ? 0.7590 0.6980 0.9005 0.1371  -0.0259 -0.1885 199 GLY A C   
1494 O O   . GLY A 198 ? 0.7374 0.6567 0.8554 0.1239  -0.0245 -0.1685 199 GLY A O   
1495 N N   . VAL A 199 ? 0.7460 0.6911 0.9034 0.1405  -0.0291 -0.1829 200 VAL A N   
1496 C CA  . VAL A 199 ? 0.7356 0.6650 0.8824 0.1285  -0.0312 -0.1527 200 VAL A CA  
1497 C C   . VAL A 199 ? 0.7074 0.6687 0.8568 0.1281  -0.0189 -0.1521 200 VAL A C   
1498 O O   . VAL A 199 ? 0.7370 0.7207 0.9111 0.1410  -0.0200 -0.1721 200 VAL A O   
1499 C CB  . VAL A 199 ? 0.7579 0.6518 0.9257 0.1319  -0.0563 -0.1415 200 VAL A CB  
1500 C CG1 . VAL A 199 ? 0.7492 0.6279 0.8984 0.1159  -0.0576 -0.1092 200 VAL A CG1 
1501 C CG2 . VAL A 199 ? 0.7822 0.6465 0.9584 0.1358  -0.0727 -0.1481 200 VAL A CG2 
1502 N N   . TRP A 200 ? 0.6946 0.6587 0.8204 0.1135  -0.0082 -0.1303 201 TRP A N   
1503 C CA  . TRP A 200 ? 0.6783 0.6685 0.8056 0.1104  0.0014  -0.1258 201 TRP A CA  
1504 C C   . TRP A 200 ? 0.6865 0.6633 0.8326 0.1137  -0.0135 -0.1156 201 TRP A C   
1505 O O   . TRP A 200 ? 0.6871 0.6574 0.8210 0.1030  -0.0130 -0.0950 201 TRP A O   
1506 C CB  . TRP A 200 ? 0.6510 0.6472 0.7484 0.0939  0.0163  -0.1081 201 TRP A CB  
1507 C CG  . TRP A 200 ? 0.6467 0.6637 0.7272 0.0891  0.0315  -0.1162 201 TRP A CG  
1508 C CD1 . TRP A 200 ? 0.6555 0.6599 0.7126 0.0802  0.0357  -0.1082 201 TRP A CD1 
1509 C CD2 . TRP A 200 ? 0.6270 0.6841 0.7123 0.0917  0.0438  -0.1327 201 TRP A CD2 
1510 N NE1 . TRP A 200 ? 0.6493 0.6809 0.6957 0.0768  0.0487  -0.1173 201 TRP A NE1 
1511 C CE2 . TRP A 200 ? 0.6215 0.6871 0.6838 0.0828  0.0544  -0.1320 201 TRP A CE2 
1512 C CE3 . TRP A 200 ? 0.6178 0.7073 0.7250 0.0997  0.0468  -0.1476 201 TRP A CE3 
1513 C CZ2 . TRP A 200 ? 0.6174 0.7237 0.6760 0.0801  0.0676  -0.1440 201 TRP A CZ2 
1514 C CZ3 . TRP A 200 ? 0.6175 0.7502 0.7220 0.0976  0.0613  -0.1614 201 TRP A CZ3 
1515 C CH2 . TRP A 200 ? 0.6168 0.7577 0.6959 0.0871  0.0714  -0.1586 201 TRP A CH2 
1516 N N   . GLN A 201 ? 0.7014 0.6749 0.8782 0.1289  -0.0279 -0.1311 202 GLN A N   
1517 C CA  . GLN A 201 ? 0.7114 0.6687 0.9100 0.1334  -0.0469 -0.1219 202 GLN A CA  
1518 C C   . GLN A 201 ? 0.7223 0.7066 0.9540 0.1493  -0.0491 -0.1438 202 GLN A C   
1519 O O   . GLN A 201 ? 0.7723 0.7756 1.0186 0.1616  -0.0452 -0.1708 202 GLN A O   
1520 C CB  . GLN A 201 ? 0.7290 0.6472 0.9373 0.1362  -0.0692 -0.1164 202 GLN A CB  
1521 C CG  . GLN A 201 ? 0.7355 0.6318 0.9601 0.1354  -0.0914 -0.0983 202 GLN A CG  
1522 C CD  . GLN A 201 ? 0.7678 0.6250 0.9967 0.1325  -0.1134 -0.0866 202 GLN A CD  
1523 O OE1 . GLN A 201 ? 0.7765 0.6165 0.9873 0.1172  -0.1192 -0.0599 202 GLN A OE1 
1524 N NE2 . GLN A 201 ? 0.8143 0.6594 1.0678 0.1466  -0.1261 -0.1072 202 GLN A NE2 
1525 N N   . ILE A 202 ? 0.7132 0.7015 0.9568 0.1488  -0.0557 -0.1332 203 ILE A N   
1526 C CA  . ILE A 202 ? 0.7186 0.7354 0.9946 0.1627  -0.0579 -0.1513 203 ILE A CA  
1527 C C   . ILE A 202 ? 0.7381 0.7331 1.0407 0.1690  -0.0831 -0.1414 203 ILE A C   
1528 O O   . ILE A 202 ? 0.7201 0.6866 1.0086 0.1574  -0.0939 -0.1149 203 ILE A O   
1529 C CB  . ILE A 202 ? 0.7070 0.7618 0.9714 0.1539  -0.0373 -0.1484 203 ILE A CB  
1530 C CG1 . ILE A 202 ? 0.6936 0.7330 0.9292 0.1352  -0.0344 -0.1180 203 ILE A CG1 
1531 C CG2 . ILE A 202 ? 0.6979 0.7848 0.9486 0.1519  -0.0154 -0.1649 203 ILE A CG2 
1532 C CD1 . ILE A 202 ? 0.6641 0.7326 0.8977 0.1279  -0.0234 -0.1123 203 ILE A CD1 
1533 N N   . GLN A 203 ? 0.7704 0.7817 1.1123 0.1873  -0.0929 -0.1633 204 GLN A N   
1534 C CA  . GLN A 203 ? 0.8103 0.8082 1.1816 0.1941  -0.1167 -0.1549 204 GLN A CA  
1535 C C   . GLN A 203 ? 0.7986 0.8083 1.1539 0.1800  -0.1101 -0.1319 204 GLN A C   
1536 O O   . GLN A 203 ? 0.7854 0.8289 1.1274 0.1740  -0.0880 -0.1359 204 GLN A O   
1537 C CB  . GLN A 203 ? 0.8434 0.8650 1.2618 0.2179  -0.1252 -0.1875 204 GLN A CB  
1538 C CG  . GLN A 203 ? 0.8937 0.9032 1.3491 0.2277  -0.1522 -0.1818 204 GLN A CG  
1539 C CD  . GLN A 203 ? 0.9510 0.9142 1.4309 0.2365  -0.1850 -0.1786 204 GLN A CD  
1540 O OE1 . GLN A 203 ? 0.9856 0.9470 1.5115 0.2559  -0.2067 -0.1957 204 GLN A OE1 
1541 N NE2 . GLN A 203 ? 0.9556 0.8817 1.4075 0.2221  -0.1901 -0.1565 204 GLN A NE2 
1542 N N   . MET A 204 ? 0.8017 0.7838 1.1578 0.1733  -0.1302 -0.1070 205 MET A N   
1543 C CA  . MET A 204 ? 0.7876 0.7804 1.1359 0.1627  -0.1297 -0.0878 205 MET A CA  
1544 C C   . MET A 204 ? 0.8150 0.8008 1.2018 0.1740  -0.1567 -0.0858 205 MET A C   
1545 O O   . MET A 204 ? 0.8589 0.8116 1.2610 0.1780  -0.1819 -0.0780 205 MET A O   
1546 C CB  . MET A 204 ? 0.7787 0.7508 1.0871 0.1411  -0.1273 -0.0578 205 MET A CB  
1547 C CG  . MET A 204 ? 0.7732 0.7567 1.0715 0.1294  -0.1275 -0.0392 205 MET A CG  
1548 S SD  . MET A 204 ? 0.7634 0.7449 1.0118 0.1059  -0.1099 -0.0185 205 MET A SD  
1549 C CE  . MET A 204 ? 0.7632 0.7069 0.9984 0.0962  -0.1298 0.0046  205 MET A CE  
1550 N N   . LYS A 205 ? 0.8029 0.8196 1.2059 0.1781  -0.1527 -0.0918 206 LYS A N   
1551 C CA  . LYS A 205 ? 0.8175 0.8349 1.2627 0.1918  -0.1771 -0.0950 206 LYS A CA  
1552 C C   . LYS A 205 ? 0.8142 0.8153 1.2514 0.1785  -0.1949 -0.0631 206 LYS A C   
1553 O O   . LYS A 205 ? 0.8669 0.8585 1.3370 0.1876  -0.2212 -0.0592 206 LYS A O   
1554 C CB  . LYS A 205 ? 0.8249 0.8893 1.2973 0.2049  -0.1646 -0.1211 206 LYS A CB  
1555 C CG  . LYS A 205 ? 0.8465 0.9361 1.3322 0.2193  -0.1488 -0.1556 206 LYS A CG  
1556 C CD  . LYS A 205 ? 0.8592 1.0037 1.3637 0.2259  -0.1319 -0.1766 206 LYS A CD  
1557 C CE  . LYS A 205 ? 0.8516 1.0300 1.3643 0.2369  -0.1132 -0.2102 206 LYS A CE  
1558 N NZ  . LYS A 205 ? 0.8508 1.0863 1.3930 0.2466  -0.1026 -0.2334 206 LYS A NZ  
1559 N N   . GLY A 206 ? 0.7711 0.7703 1.1657 0.1573  -0.1817 -0.0413 207 GLY A N   
1560 C CA  . GLY A 206 ? 0.7589 0.7479 1.1406 0.1426  -0.1964 -0.0119 207 GLY A CA  
1561 C C   . GLY A 206 ? 0.7544 0.7502 1.0902 0.1212  -0.1772 0.0041  207 GLY A C   
1562 O O   . GLY A 206 ? 0.7443 0.7589 1.0623 0.1183  -0.1513 -0.0077 207 GLY A O   
1563 N N   . VAL A 207 ? 0.7547 0.7358 1.0721 0.1059  -0.1911 0.0311  208 VAL A N   
1564 C CA  . VAL A 207 ? 0.7404 0.7315 1.0184 0.0864  -0.1768 0.0454  208 VAL A CA  
1565 C C   . VAL A 207 ? 0.7573 0.7596 1.0397 0.0795  -0.1914 0.0608  208 VAL A C   
1566 O O   . VAL A 207 ? 0.7870 0.7746 1.0834 0.0787  -0.2177 0.0772  208 VAL A O   
1567 C CB  . VAL A 207 ? 0.7382 0.7082 0.9828 0.0715  -0.1759 0.0619  208 VAL A CB  
1568 C CG1 . VAL A 207 ? 0.7410 0.7249 0.9491 0.0528  -0.1637 0.0742  208 VAL A CG1 
1569 C CG2 . VAL A 207 ? 0.7178 0.6794 0.9557 0.0773  -0.1596 0.0462  208 VAL A CG2 
1570 N N   . SER A 208 ? 0.7571 0.7853 1.0287 0.0740  -0.1757 0.0559  209 SER A N   
1571 C CA  . SER A 208 ? 0.7740 0.8167 1.0475 0.0667  -0.1871 0.0682  209 SER A CA  
1572 C C   . SER A 208 ? 0.7814 0.8308 1.0152 0.0466  -0.1788 0.0816  209 SER A C   
1573 O O   . SER A 208 ? 0.7794 0.8338 0.9898 0.0411  -0.1569 0.0732  209 SER A O   
1574 C CB  . SER A 208 ? 0.7667 0.8372 1.0648 0.0766  -0.1790 0.0506  209 SER A CB  
1575 O OG  . SER A 208 ? 0.8241 0.8942 1.1646 0.0941  -0.1960 0.0425  209 SER A OG  
1576 N N   . VAL A 209 ? 0.8069 0.8577 1.0344 0.0358  -0.1975 0.1018  210 VAL A N   
1577 C CA  . VAL A 209 ? 0.8025 0.8688 0.9974 0.0179  -0.1920 0.1112  210 VAL A CA  
1578 C C   . VAL A 209 ? 0.8131 0.9009 1.0233 0.0183  -0.1999 0.1108  210 VAL A C   
1579 O O   . VAL A 209 ? 0.8196 0.9058 1.0492 0.0201  -0.2234 0.1236  210 VAL A O   
1580 C CB  . VAL A 209 ? 0.8219 0.8787 0.9923 0.0017  -0.2060 0.1355  210 VAL A CB  
1581 C CG1 . VAL A 209 ? 0.8394 0.9193 0.9807 -0.0159 -0.2046 0.1442  210 VAL A CG1 
1582 C CG2 . VAL A 209 ? 0.8103 0.8504 0.9626 -0.0003 -0.1942 0.1338  210 VAL A CG2 
1583 N N   . GLY A 210 ? 0.8120 0.9192 1.0156 0.0165  -0.1816 0.0964  211 GLY A N   
1584 C CA  . GLY A 210 ? 0.8499 0.9791 1.0693 0.0171  -0.1865 0.0931  211 GLY A CA  
1585 C C   . GLY A 210 ? 0.8589 0.9962 1.1156 0.0341  -0.1822 0.0762  211 GLY A C   
1586 O O   . GLY A 210 ? 0.8642 0.9900 1.1467 0.0478  -0.1915 0.0737  211 GLY A O   
1587 N N   . THR A 213 ? 1.0630 1.0950 1.4618 0.0984  -0.2846 0.0906  214 THR A N   
1588 C CA  . THR A 213 ? 1.0840 1.0954 1.4711 0.1010  -0.2738 0.0831  214 THR A CA  
1589 C C   . THR A 213 ? 1.1005 1.0790 1.4763 0.0896  -0.2974 0.1102  214 THR A C   
1590 O O   . THR A 213 ? 1.1249 1.0802 1.5331 0.0998  -0.3245 0.1144  214 THR A O   
1591 C CB  . THR A 213 ? 1.0919 1.1052 1.5178 0.1257  -0.2696 0.0527  214 THR A CB  
1592 O OG1 . THR A 213 ? 1.0663 1.1160 1.5038 0.1332  -0.2498 0.0312  214 THR A OG1 
1593 C CG2 . THR A 213 ? 1.0707 1.0679 1.4798 0.1271  -0.2536 0.0421  214 THR A CG2 
1594 N N   . LEU A 214 ? 1.0742 1.0527 1.4054 0.0680  -0.2878 0.1281  215 LEU A N   
1595 C CA  . LEU A 214 ? 1.0667 1.0224 1.3802 0.0515  -0.3078 0.1576  215 LEU A CA  
1596 C C   . LEU A 214 ? 1.0372 0.9633 1.3542 0.0561  -0.3102 0.1548  215 LEU A C   
1597 O O   . LEU A 214 ? 1.0555 0.9561 1.3815 0.0505  -0.3375 0.1760  215 LEU A O   
1598 C CB  . LEU A 214 ? 1.0587 1.0319 1.3239 0.0271  -0.2947 0.1741  215 LEU A CB  
1599 N N   . LEU A 215 ? 0.9936 0.9232 1.3042 0.0653  -0.2833 0.1299  216 LEU A N   
1600 C CA  . LEU A 215 ? 0.9644 0.8693 1.2711 0.0672  -0.2812 0.1261  216 LEU A CA  
1601 C C   . LEU A 215 ? 0.9412 0.8432 1.2768 0.0909  -0.2716 0.0934  216 LEU A C   
1602 O O   . LEU A 215 ? 0.9030 0.8293 1.2535 0.1036  -0.2576 0.0714  216 LEU A O   
1603 C CB  . LEU A 215 ? 0.9510 0.8629 1.2108 0.0495  -0.2575 0.1323  216 LEU A CB  
1604 C CG  . LEU A 215 ? 0.9745 0.8875 1.2037 0.0245  -0.2682 0.1644  216 LEU A CG  
1605 C CD1 . LEU A 215 ? 0.9627 0.9017 1.1518 0.0114  -0.2404 0.1613  216 LEU A CD1 
1606 C CD2 . LEU A 215 ? 1.0251 0.9099 1.2507 0.0156  -0.2846 0.1823  216 LEU A CD2 
1607 N N   . CYS A 216 ? 0.9697 0.8445 1.3132 0.0956  -0.2798 0.0905  217 CYS A N   
1608 C CA  . CYS A 216 ? 0.9908 0.8623 1.3592 0.1171  -0.2717 0.0585  217 CYS A CA  
1609 C C   . CYS A 216 ? 1.0118 0.8955 1.4282 0.1403  -0.2824 0.0360  217 CYS A C   
1610 O O   . CYS A 216 ? 0.9981 0.9037 1.4274 0.1558  -0.2634 0.0055  217 CYS A O   
1611 C CB  . CYS A 216 ? 0.9871 0.8789 1.3245 0.1143  -0.2348 0.0417  217 CYS A CB  
1612 S SG  . CYS A 216 ? 1.0060 0.9048 1.3640 0.1365  -0.2186 0.0022  217 CYS A SG  
1613 N N   . GLU A 217 ? 1.0515 0.9232 1.4950 0.1422  -0.3136 0.0515  218 GLU A N   
1614 C CA  . GLU A 217 ? 1.0798 0.9671 1.5695 0.1630  -0.3252 0.0327  218 GLU A CA  
1615 C C   . GLU A 217 ? 1.0863 0.9609 1.6239 0.1892  -0.3394 0.0034  218 GLU A C   
1616 O O   . GLU A 217 ? 1.0531 0.9479 1.6308 0.2095  -0.3437 -0.0203 218 GLU A O   
1617 C CB  . GLU A 217 ? 1.1234 1.0070 1.6244 0.1553  -0.3529 0.0599  218 GLU A CB  
1618 C CG  . GLU A 217 ? 1.1880 1.0338 1.6840 0.1399  -0.3852 0.0953  218 GLU A CG  
1619 C CD  . GLU A 217 ? 1.2168 1.0699 1.6979 0.1209  -0.4002 0.1286  218 GLU A CD  
1620 O OE1 . GLU A 217 ? 1.2024 1.0701 1.7118 0.1304  -0.4125 0.1255  218 GLU A OE1 
1621 O OE2 . GLU A 217 ? 1.2366 1.0834 1.6775 0.0961  -0.3997 0.1575  218 GLU A OE2 
1622 N N   . ASP A 218 ? 1.1158 0.9594 1.6497 0.1887  -0.3464 0.0035  219 ASP A N   
1623 C CA  . ASP A 218 ? 1.1490 0.9799 1.7243 0.2129  -0.3576 -0.0276 219 ASP A CA  
1624 C C   . ASP A 218 ? 1.1095 0.9591 1.6661 0.2184  -0.3239 -0.0568 219 ASP A C   
1625 O O   . ASP A 218 ? 1.1277 0.9763 1.7151 0.2391  -0.3271 -0.0888 219 ASP A O   
1626 C CB  . ASP A 218 ? 1.1863 0.9664 1.7777 0.2098  -0.3946 -0.0085 219 ASP A CB  
1627 C CG  . ASP A 218 ? 1.2250 0.9859 1.8562 0.2142  -0.4357 0.0091  219 ASP A CG  
1628 O OD1 . ASP A 218 ? 1.2070 0.9940 1.8527 0.2199  -0.4356 0.0068  219 ASP A OD1 
1629 O OD2 . ASP A 218 ? 1.2847 1.0030 1.9339 0.2113  -0.4700 0.0265  219 ASP A OD2 
1630 N N   . GLY A 219 ? 1.0554 0.9232 1.5629 0.2000  -0.2929 -0.0465 220 GLY A N   
1631 C CA  . GLY A 219 ? 0.9996 0.8823 1.4829 0.2004  -0.2621 -0.0669 220 GLY A CA  
1632 C C   . GLY A 219 ? 0.9954 0.8483 1.4427 0.1826  -0.2608 -0.0463 220 GLY A C   
1633 O O   . GLY A 219 ? 1.0390 0.8551 1.4949 0.1778  -0.2885 -0.0275 220 GLY A O   
1634 N N   . CYS A 220 ? 0.9525 0.8222 1.3607 0.1720  -0.2297 -0.0488 221 CYS A N   
1635 C CA  . CYS A 220 ? 0.9502 0.7982 1.3230 0.1554  -0.2242 -0.0322 221 CYS A CA  
1636 C C   . CYS A 220 ? 0.9104 0.7796 1.2580 0.1551  -0.1918 -0.0512 221 CYS A C   
1637 O O   . CYS A 220 ? 0.9021 0.8030 1.2599 0.1668  -0.1748 -0.0761 221 CYS A O   
1638 C CB  . CYS A 220 ? 0.9741 0.8164 1.3144 0.1315  -0.2265 0.0041  221 CYS A CB  
1639 S SG  . CYS A 220 ? 0.9873 0.8693 1.3004 0.1219  -0.1989 0.0070  221 CYS A SG  
1640 N N   . LEU A 221 ? 0.8692 0.7229 1.1848 0.1410  -0.1842 -0.0387 222 LEU A N   
1641 C CA  . LEU A 221 ? 0.8321 0.7019 1.1231 0.1393  -0.1565 -0.0536 222 LEU A CA  
1642 C C   . LEU A 221 ? 0.7889 0.6758 1.0407 0.1215  -0.1341 -0.0378 222 LEU A C   
1643 O O   . LEU A 221 ? 0.7907 0.6683 1.0250 0.1064  -0.1404 -0.0122 222 LEU A O   
1644 C CB  . LEU A 221 ? 0.8367 0.6794 1.1225 0.1384  -0.1627 -0.0559 222 LEU A CB  
1645 C CG  . LEU A 221 ? 0.8564 0.6784 1.1819 0.1565  -0.1863 -0.0746 222 LEU A CG  
1646 C CD1 . LEU A 221 ? 0.8552 0.6490 1.1707 0.1514  -0.1925 -0.0724 222 LEU A CD1 
1647 C CD2 . LEU A 221 ? 0.8520 0.7034 1.2038 0.1780  -0.1765 -0.1121 222 LEU A CD2 
1648 N N   . ALA A 222 ? 0.7393 0.6527 0.9787 0.1232  -0.1091 -0.0541 223 ALA A N   
1649 C CA  . ALA A 222 ? 0.6987 0.6268 0.9045 0.1082  -0.0885 -0.0430 223 ALA A CA  
1650 C C   . ALA A 222 ? 0.6798 0.6128 0.8646 0.1056  -0.0693 -0.0533 223 ALA A C   
1651 O O   . ALA A 222 ? 0.6606 0.6145 0.8535 0.1147  -0.0575 -0.0746 223 ALA A O   
1652 C CB  . ALA A 222 ? 0.6930 0.6512 0.9054 0.1094  -0.0789 -0.0472 223 ALA A CB  
1653 N N   . LEU A 223 ? 0.6814 0.5978 0.8398 0.0926  -0.0671 -0.0378 224 LEU A N   
1654 C CA  . LEU A 223 ? 0.6894 0.6091 0.8255 0.0880  -0.0503 -0.0435 224 LEU A CA  
1655 C C   . LEU A 223 ? 0.6797 0.6211 0.7961 0.0787  -0.0316 -0.0394 224 LEU A C   
1656 O O   . LEU A 223 ? 0.6947 0.6344 0.7983 0.0683  -0.0325 -0.0233 224 LEU A O   
1657 C CB  . LEU A 223 ? 0.7004 0.5943 0.8200 0.0783  -0.0574 -0.0290 224 LEU A CB  
1658 C CG  . LEU A 223 ? 0.7151 0.6078 0.8139 0.0741  -0.0439 -0.0341 224 LEU A CG  
1659 C CD1 . LEU A 223 ? 0.7189 0.6132 0.8317 0.0870  -0.0431 -0.0569 224 LEU A CD1 
1660 C CD2 . LEU A 223 ? 0.7174 0.5888 0.8005 0.0623  -0.0515 -0.0163 224 LEU A CD2 
1661 N N   . VAL A 224 ? 0.6645 0.6273 0.7793 0.0820  -0.0160 -0.0542 225 VAL A N   
1662 C CA  . VAL A 224 ? 0.6397 0.6211 0.7381 0.0723  -0.0004 -0.0496 225 VAL A CA  
1663 C C   . VAL A 224 ? 0.6440 0.6148 0.7163 0.0626  0.0076  -0.0428 225 VAL A C   
1664 O O   . VAL A 224 ? 0.6563 0.6327 0.7223 0.0638  0.0162  -0.0521 225 VAL A O   
1665 C CB  . VAL A 224 ? 0.6297 0.6432 0.7397 0.0772  0.0109  -0.0648 225 VAL A CB  
1666 C CG1 . VAL A 224 ? 0.6026 0.6314 0.6972 0.0649  0.0236  -0.0564 225 VAL A CG1 
1667 C CG2 . VAL A 224 ? 0.6069 0.6322 0.7464 0.0884  0.0015  -0.0731 225 VAL A CG2 
1668 N N   . ASP A 225 ? 0.6475 0.6057 0.7055 0.0530  0.0043  -0.0272 226 ASP A N   
1669 C CA  . ASP A 225 ? 0.6640 0.6083 0.7013 0.0452  0.0072  -0.0200 226 ASP A CA  
1670 C C   . ASP A 225 ? 0.6392 0.5914 0.6601 0.0354  0.0173  -0.0142 226 ASP A C   
1671 O O   . ASP A 225 ? 0.6245 0.5763 0.6400 0.0292  0.0143  -0.0052 226 ASP A O   
1672 C CB  . ASP A 225 ? 0.6886 0.6140 0.7246 0.0418  -0.0066 -0.0079 226 ASP A CB  
1673 C CG  . ASP A 225 ? 0.7159 0.6285 0.7355 0.0354  -0.0055 -0.0028 226 ASP A CG  
1674 O OD1 . ASP A 225 ? 0.7432 0.6603 0.7502 0.0327  0.0059  -0.0067 226 ASP A OD1 
1675 O OD2 . ASP A 225 ? 0.7342 0.6323 0.7544 0.0322  -0.0174 0.0064  226 ASP A OD2 
1676 N N   . THR A 226 ? 0.6160 0.5755 0.6295 0.0339  0.0280  -0.0197 227 THR A N   
1677 C CA  . THR A 226 ? 0.6056 0.5697 0.6070 0.0253  0.0352  -0.0149 227 THR A CA  
1678 C C   . THR A 226 ? 0.6031 0.5540 0.5903 0.0193  0.0332  -0.0075 227 THR A C   
1679 O O   . THR A 226 ? 0.6155 0.5688 0.5965 0.0134  0.0358  -0.0046 227 THR A O   
1680 C CB  . THR A 226 ? 0.5926 0.5675 0.5899 0.0234  0.0448  -0.0198 227 THR A CB  
1681 O OG1 . THR A 226 ? 0.6193 0.5863 0.6101 0.0261  0.0457  -0.0242 227 THR A OG1 
1682 C CG2 . THR A 226 ? 0.5736 0.5702 0.5844 0.0267  0.0487  -0.0270 227 THR A CG2 
1683 N N   . GLY A 227 ? 0.5872 0.5256 0.5717 0.0208  0.0276  -0.0056 228 GLY A N   
1684 C CA  . GLY A 227 ? 0.5702 0.5006 0.5428 0.0148  0.0254  0.0009  228 GLY A CA  
1685 C C   . GLY A 227 ? 0.5925 0.5233 0.5651 0.0108  0.0171  0.0094  228 GLY A C   
1686 O O   . GLY A 227 ? 0.5832 0.5147 0.5458 0.0044  0.0162  0.0144  228 GLY A O   
1687 N N   . ALA A 228 ? 0.5831 0.5163 0.5671 0.0139  0.0105  0.0111  229 ALA A N   
1688 C CA  . ALA A 228 ? 0.5854 0.5226 0.5689 0.0086  0.0019  0.0207  229 ALA A CA  
1689 C C   . ALA A 228 ? 0.5996 0.5516 0.5803 0.0051  0.0066  0.0188  229 ALA A C   
1690 O O   . ALA A 228 ? 0.6070 0.5647 0.5952 0.0089  0.0115  0.0123  229 ALA A O   
1691 C CB  . ALA A 228 ? 0.5773 0.5092 0.5765 0.0136  -0.0097 0.0240  229 ALA A CB  
1692 N N   . SER A 229 ? 0.6015 0.5619 0.5718 -0.0026 0.0047  0.0237  230 SER A N   
1693 C CA  . SER A 229 ? 0.5901 0.5647 0.5584 -0.0058 0.0073  0.0198  230 SER A CA  
1694 C C   . SER A 229 ? 0.6184 0.5999 0.5959 -0.0052 0.0003  0.0234  230 SER A C   
1695 O O   . SER A 229 ? 0.6552 0.6450 0.6374 -0.0048 0.0027  0.0179  230 SER A O   
1696 C CB  . SER A 229 ? 0.5598 0.5466 0.5151 -0.0137 0.0072  0.0208  230 SER A CB  
1697 O OG  . SER A 229 ? 0.5789 0.5620 0.5284 -0.0133 0.0138  0.0152  230 SER A OG  
1698 N N   . TYR A 230 ? 0.6326 0.6098 0.6141 -0.0058 -0.0099 0.0333  231 TYR A N   
1699 C CA  . TYR A 230 ? 0.6617 0.6465 0.6507 -0.0070 -0.0196 0.0395  231 TYR A CA  
1700 C C   . TYR A 230 ? 0.6592 0.6336 0.6676 0.0021  -0.0266 0.0400  231 TYR A C   
1701 O O   . TYR A 230 ? 0.6373 0.6002 0.6522 0.0093  -0.0232 0.0341  231 TYR A O   
1702 C CB  . TYR A 230 ? 0.6987 0.6916 0.6761 -0.0180 -0.0290 0.0529  231 TYR A CB  
1703 C CG  . TYR A 230 ? 0.7544 0.7615 0.7139 -0.0260 -0.0213 0.0492  231 TYR A CG  
1704 C CD1 . TYR A 230 ? 0.7589 0.7825 0.7140 -0.0276 -0.0155 0.0388  231 TYR A CD1 
1705 C CD2 . TYR A 230 ? 0.8115 0.8166 0.7608 -0.0314 -0.0206 0.0542  231 TYR A CD2 
1706 C CE1 . TYR A 230 ? 0.7847 0.8231 0.7271 -0.0329 -0.0094 0.0316  231 TYR A CE1 
1707 C CE2 . TYR A 230 ? 0.8452 0.8675 0.7808 -0.0376 -0.0134 0.0485  231 TYR A CE2 
1708 C CZ  . TYR A 230 ? 0.8591 0.8982 0.7919 -0.0375 -0.0078 0.0361  231 TYR A CZ  
1709 O OH  . TYR A 230 ? 0.8886 0.9463 0.8114 -0.0417 -0.0016 0.0269  231 TYR A OH  
1710 N N   . ILE A 231 ? 0.6632 0.6441 0.6819 0.0024  -0.0364 0.0451  232 ILE A N   
1711 C CA  . ILE A 231 ? 0.6752 0.6467 0.7144 0.0104  -0.0484 0.0479  232 ILE A CA  
1712 C C   . ILE A 231 ? 0.7052 0.6670 0.7394 0.0028  -0.0635 0.0647  232 ILE A C   
1713 O O   . ILE A 231 ? 0.7565 0.7294 0.7771 -0.0088 -0.0682 0.0761  232 ILE A O   
1714 C CB  . ILE A 231 ? 0.6613 0.6453 0.7163 0.0142  -0.0535 0.0462  232 ILE A CB  
1715 C CG1 . ILE A 231 ? 0.6286 0.6214 0.6929 0.0218  -0.0398 0.0305  232 ILE A CG1 
1716 C CG2 . ILE A 231 ? 0.6832 0.6580 0.7597 0.0204  -0.0718 0.0531  232 ILE A CG2 
1717 C CD1 . ILE A 231 ? 0.6427 0.6532 0.7159 0.0211  -0.0399 0.0282  232 ILE A CD1 
1718 N N   . SER A 232 ? 0.7174 0.6602 0.7620 0.0081  -0.0712 0.0661  233 SER A N   
1719 C CA  . SER A 232 ? 0.7321 0.6630 0.7764 0.0000  -0.0891 0.0845  233 SER A CA  
1720 C C   . SER A 232 ? 0.7413 0.6556 0.8138 0.0099  -0.1082 0.0867  233 SER A C   
1721 O O   . SER A 232 ? 0.7539 0.6634 0.8455 0.0248  -0.1049 0.0699  233 SER A O   
1722 C CB  . SER A 232 ? 0.7322 0.6529 0.7625 -0.0058 -0.0852 0.0874  233 SER A CB  
1723 O OG  . SER A 232 ? 0.7358 0.6436 0.7754 0.0062  -0.0778 0.0716  233 SER A OG  
1724 N N   . GLY A 233 ? 0.7369 0.6453 0.8127 0.0009  -0.1289 0.1072  234 GLY A N   
1725 C CA  . GLY A 233 ? 0.7402 0.6270 0.8443 0.0085  -0.1524 0.1128  234 GLY A CA  
1726 C C   . GLY A 233 ? 0.7748 0.6449 0.8723 -0.0053 -0.1694 0.1350  234 GLY A C   
1727 O O   . GLY A 233 ? 0.7693 0.6489 0.8403 -0.0200 -0.1603 0.1439  234 GLY A O   
1728 N N   . SER A 234 ? 0.8096 0.6557 0.9334 -0.0009 -0.1950 0.1435  235 SER A N   
1729 C CA  . SER A 234 ? 0.8406 0.6692 0.9625 -0.0166 -0.2173 0.1698  235 SER A CA  
1730 C C   . SER A 234 ? 0.8677 0.7170 0.9683 -0.0387 -0.2245 0.1972  235 SER A C   
1731 O O   . SER A 234 ? 0.8564 0.7266 0.9533 -0.0380 -0.2198 0.1956  235 SER A O   
1732 C CB  . SER A 234 ? 0.8538 0.6505 1.0138 -0.0056 -0.2468 0.1722  235 SER A CB  
1733 O OG  . SER A 234 ? 0.8623 0.6633 1.0411 -0.0012 -0.2623 0.1783  235 SER A OG  
1734 N N   . THR A 235 ? 0.8903 0.7363 0.9766 -0.0589 -0.2359 0.2219  236 THR A N   
1735 C CA  . THR A 235 ? 0.9061 0.7782 0.9680 -0.0833 -0.2415 0.2487  236 THR A CA  
1736 C C   . THR A 235 ? 0.9318 0.8069 1.0072 -0.0847 -0.2621 0.2629  236 THR A C   
1737 O O   . THR A 235 ? 0.9360 0.8416 0.9941 -0.0909 -0.2526 0.2635  236 THR A O   
1738 C CB  . THR A 235 ? 0.9211 0.7891 0.9704 -0.1063 -0.2546 0.2757  236 THR A CB  
1739 O OG1 . THR A 235 ? 0.8933 0.7712 0.9230 -0.1077 -0.2305 0.2621  236 THR A OG1 
1740 C CG2 . THR A 235 ? 0.9290 0.8272 0.9556 -0.1330 -0.2644 0.3060  236 THR A CG2 
1741 N N   . SER A 236 ? 0.9645 0.8079 1.0726 -0.0777 -0.2908 0.2723  237 SER A N   
1742 C CA  . SER A 236 ? 1.0154 0.8584 1.1409 -0.0781 -0.3143 0.2870  237 SER A CA  
1743 C C   . SER A 236 ? 0.9792 0.8361 1.1156 -0.0580 -0.2996 0.2610  237 SER A C   
1744 O O   . SER A 236 ? 0.9868 0.8619 1.1208 -0.0637 -0.3070 0.2714  237 SER A O   
1745 C CB  . SER A 236 ? 1.0556 0.8587 1.2179 -0.0746 -0.3518 0.3028  237 SER A CB  
1746 O OG  . SER A 236 ? 1.0831 0.8587 1.2758 -0.0488 -0.3498 0.2742  237 SER A OG  
1747 N N   . SER A 237 ? 0.9518 0.8030 1.0988 -0.0365 -0.2791 0.2285  238 SER A N   
1748 C CA  . SER A 237 ? 0.9427 0.8113 1.0979 -0.0196 -0.2618 0.2034  238 SER A CA  
1749 C C   . SER A 237 ? 0.9142 0.8186 1.0358 -0.0311 -0.2393 0.2020  238 SER A C   
1750 O O   . SER A 237 ? 0.9114 0.8333 1.0369 -0.0281 -0.2385 0.1986  238 SER A O   
1751 C CB  . SER A 237 ? 0.9336 0.7926 1.1044 0.0025  -0.2442 0.1708  238 SER A CB  
1752 O OG  . SER A 237 ? 0.9756 0.8173 1.1876 0.0221  -0.2617 0.1595  238 SER A OG  
1753 N N   . ILE A 238 ? 0.8832 0.7983 0.9740 -0.0437 -0.2222 0.2035  239 ILE A N   
1754 C CA  . ILE A 238 ? 0.8499 0.7985 0.9097 -0.0542 -0.2015 0.1996  239 ILE A CA  
1755 C C   . ILE A 238 ? 0.8850 0.8551 0.9290 -0.0750 -0.2167 0.2256  239 ILE A C   
1756 O O   . ILE A 238 ? 0.8801 0.8744 0.9159 -0.0768 -0.2108 0.2210  239 ILE A O   
1757 C CB  . ILE A 238 ? 0.8235 0.7778 0.8601 -0.0578 -0.1783 0.1884  239 ILE A CB  
1758 C CG1 . ILE A 238 ? 0.7930 0.7326 0.8438 -0.0372 -0.1617 0.1610  239 ILE A CG1 
1759 C CG2 . ILE A 238 ? 0.7954 0.7843 0.8022 -0.0694 -0.1605 0.1844  239 ILE A CG2 
1760 C CD1 . ILE A 238 ? 0.7556 0.7040 0.8204 -0.0222 -0.1520 0.1414  239 ILE A CD1 
1761 N N   . GLU A 239 ? 0.9245 0.8859 0.9653 -0.0912 -0.2376 0.2533  240 GLU A N   
1762 C CA  . GLU A 239 ? 0.9645 0.9455 0.9926 -0.1128 -0.2570 0.2827  240 GLU A CA  
1763 C C   . GLU A 239 ? 0.9458 0.9304 0.9916 -0.1059 -0.2709 0.2844  240 GLU A C   
1764 O O   . GLU A 239 ? 0.9440 0.9597 0.9710 -0.1193 -0.2716 0.2935  240 GLU A O   
1765 C CB  . GLU A 239 ? 1.0380 0.9998 1.0708 -0.1289 -0.2841 0.3147  240 GLU A CB  
1766 C CG  . GLU A 239 ? 1.0675 1.0459 1.0708 -0.1493 -0.2745 0.3257  240 GLU A CG  
1767 C CD  . GLU A 239 ? 1.1390 1.0952 1.1501 -0.1657 -0.3023 0.3579  240 GLU A CD  
1768 O OE1 . GLU A 239 ? 1.1575 1.1176 1.1533 -0.1771 -0.2943 0.3623  240 GLU A OE1 
1769 O OE2 . GLU A 239 ? 1.1702 1.1048 1.2040 -0.1677 -0.3334 0.3793  240 GLU A OE2 
1770 N N   . LYS A 240 ? 0.9289 0.8844 1.0114 -0.0847 -0.2816 0.2741  241 LYS A N   
1771 C CA  . LYS A 240 ? 0.9326 0.8900 1.0384 -0.0748 -0.2952 0.2728  241 LYS A CA  
1772 C C   . LYS A 240 ? 0.8942 0.8756 0.9943 -0.0637 -0.2694 0.2453  241 LYS A C   
1773 O O   . LYS A 240 ? 0.8966 0.8981 0.9957 -0.0673 -0.2747 0.2492  241 LYS A O   
1774 C CB  . LYS A 240 ? 0.9350 0.8564 1.0857 -0.0549 -0.3164 0.2687  241 LYS A CB  
1775 N N   . LEU A 241 ? 0.8648 0.8436 0.9616 -0.0515 -0.2432 0.2190  242 LEU A N   
1776 C CA  . LEU A 241 ? 0.8393 0.8395 0.9284 -0.0438 -0.2179 0.1943  242 LEU A CA  
1777 C C   . LEU A 241 ? 0.8379 0.8709 0.8932 -0.0622 -0.2095 0.2003  242 LEU A C   
1778 O O   . LEU A 241 ? 0.8543 0.9070 0.9091 -0.0614 -0.2061 0.1931  242 LEU A O   
1779 C CB  . LEU A 241 ? 0.8178 0.8089 0.9050 -0.0320 -0.1935 0.1704  242 LEU A CB  
1780 C CG  . LEU A 241 ? 0.8039 0.8105 0.8905 -0.0220 -0.1700 0.1449  242 LEU A CG  
1781 C CD1 . LEU A 241 ? 0.8192 0.8158 0.9398 -0.0016 -0.1707 0.1286  242 LEU A CD1 
1782 C CD2 . LEU A 241 ? 0.7731 0.7818 0.8382 -0.0236 -0.1464 0.1316  242 LEU A CD2 
1783 N N   . MET A 242 ? 0.8478 0.8884 0.8765 -0.0789 -0.2073 0.2129  243 MET A N   
1784 C CA  . MET A 242 ? 0.8405 0.9167 0.8361 -0.0962 -0.1972 0.2147  243 MET A CA  
1785 C C   . MET A 242 ? 0.8763 0.9751 0.8633 -0.1125 -0.2168 0.2367  243 MET A C   
1786 O O   . MET A 242 ? 0.8644 0.9948 0.8335 -0.1197 -0.2087 0.2293  243 MET A O   
1787 C CB  . MET A 242 ? 0.8217 0.9031 0.7941 -0.1083 -0.1879 0.2194  243 MET A CB  
1788 C CG  . MET A 242 ? 0.7942 0.8587 0.7707 -0.0936 -0.1666 0.1961  243 MET A CG  
1789 S SD  . MET A 242 ? 0.7668 0.8479 0.7382 -0.0823 -0.1407 0.1636  243 MET A SD  
1790 C CE  . MET A 242 ? 0.7769 0.8359 0.7522 -0.0692 -0.1213 0.1448  243 MET A CE  
1791 N N   . GLU A 243 ? 0.9157 0.9979 0.9166 -0.1185 -0.2439 0.2635  244 GLU A N   
1792 C CA  . GLU A 243 ? 0.9574 1.0556 0.9564 -0.1324 -0.2675 0.2875  244 GLU A CA  
1793 C C   . GLU A 243 ? 0.9364 1.0447 0.9488 -0.1204 -0.2652 0.2716  244 GLU A C   
1794 O O   . GLU A 243 ? 0.9473 1.0875 0.9414 -0.1331 -0.2673 0.2763  244 GLU A O   
1795 C CB  . GLU A 243 ? 1.0186 1.0866 1.0411 -0.1351 -0.2996 0.3161  244 GLU A CB  
1796 C CG  . GLU A 243 ? 1.0892 1.1736 1.1059 -0.1550 -0.3278 0.3486  244 GLU A CG  
1797 C CD  . GLU A 243 ? 1.1521 1.2033 1.1932 -0.1594 -0.3625 0.3793  244 GLU A CD  
1798 O OE1 . GLU A 243 ? 1.1769 1.2050 1.2209 -0.1612 -0.3646 0.3856  244 GLU A OE1 
1799 O OE2 . GLU A 243 ? 1.1861 1.2335 1.2448 -0.1614 -0.3896 0.3976  244 GLU A OE2 
1800 N N   . ALA A 244 ? 0.9141 0.9985 0.9574 -0.0968 -0.2602 0.2519  245 ALA A N   
1801 C CA  . ALA A 244 ? 0.9103 1.0034 0.9709 -0.0840 -0.2568 0.2351  245 ALA A CA  
1802 C C   . ALA A 244 ? 0.9045 1.0252 0.9432 -0.0857 -0.2313 0.2123  245 ALA A C   
1803 O O   . ALA A 244 ? 0.9111 1.0499 0.9531 -0.0851 -0.2326 0.2060  245 ALA A O   
1804 C CB  . ALA A 244 ? 0.8807 0.9464 0.9797 -0.0595 -0.2561 0.2187  245 ALA A CB  
1805 N N   . LEU A 245 ? 0.8797 1.0024 0.8983 -0.0875 -0.2100 0.1997  246 LEU A N   
1806 C CA  . LEU A 245 ? 0.8344 0.9803 0.8334 -0.0893 -0.1876 0.1775  246 LEU A CA  
1807 C C   . LEU A 245 ? 0.8409 1.0226 0.8070 -0.1102 -0.1889 0.1854  246 LEU A C   
1808 O O   . LEU A 245 ? 0.8410 1.0454 0.7935 -0.1120 -0.1753 0.1665  246 LEU A O   
1809 C CB  . LEU A 245 ? 0.8052 0.9373 0.8004 -0.0806 -0.1653 0.1589  246 LEU A CB  
1810 C CG  . LEU A 245 ? 0.7927 0.8951 0.8148 -0.0611 -0.1588 0.1469  246 LEU A CG  
1811 C CD1 . LEU A 245 ? 0.7664 0.8612 0.7766 -0.0580 -0.1385 0.1328  246 LEU A CD1 
1812 C CD2 . LEU A 245 ? 0.7949 0.8991 0.8391 -0.0482 -0.1547 0.1311  246 LEU A CD2 
1813 N N   . GLY A 246 ? 0.8537 1.0419 0.8080 -0.1265 -0.2063 0.2129  247 GLY A N   
1814 C CA  . GLY A 246 ? 0.8528 1.0806 0.7735 -0.1488 -0.2072 0.2221  247 GLY A CA  
1815 C C   . GLY A 246 ? 0.8455 1.0860 0.7443 -0.1531 -0.1861 0.2083  247 GLY A C   
1816 O O   . GLY A 246 ? 0.8419 1.1209 0.7155 -0.1650 -0.1775 0.1994  247 GLY A O   
1817 N N   . ALA A 247 ? 0.8248 1.0348 0.7347 -0.1427 -0.1785 0.2050  248 ALA A N   
1818 C CA  . ALA A 247 ? 0.8275 1.0447 0.7213 -0.1445 -0.1594 0.1921  248 ALA A CA  
1819 C C   . ALA A 247 ? 0.8585 1.0841 0.7366 -0.1632 -0.1687 0.2178  248 ALA A C   
1820 O O   . ALA A 247 ? 0.8805 1.0827 0.7711 -0.1666 -0.1881 0.2431  248 ALA A O   
1821 C CB  . ALA A 247 ? 0.7872 0.9692 0.7005 -0.1236 -0.1452 0.1731  248 ALA A CB  
1822 N N   . LYS A 248 ? 0.8686 1.1286 0.7214 -0.1752 -0.1556 0.2107  249 LYS A N   
1823 C CA  . LYS A 248 ? 0.9080 1.1843 0.7438 -0.1955 -0.1617 0.2338  249 LYS A CA  
1824 C C   . LYS A 248 ? 0.8819 1.1384 0.7213 -0.1880 -0.1479 0.2247  249 LYS A C   
1825 O O   . LYS A 248 ? 0.8441 1.0948 0.6875 -0.1722 -0.1281 0.1954  249 LYS A O   
1826 C CB  . LYS A 248 ? 0.9467 1.2832 0.7514 -0.2171 -0.1583 0.2346  249 LYS A CB  
1827 C CG  . LYS A 248 ? 1.0184 1.3764 0.8157 -0.2322 -0.1787 0.2564  249 LYS A CG  
1828 C CD  . LYS A 248 ? 1.0703 1.4938 0.8345 -0.2556 -0.1755 0.2576  249 LYS A CD  
1829 C CE  . LYS A 248 ? 1.0910 1.5384 0.8370 -0.2837 -0.1882 0.2931  249 LYS A CE  
1830 N NZ  . LYS A 248 ? 1.0698 1.5165 0.8121 -0.2852 -0.1745 0.2890  249 LYS A NZ  
1831 N N   . LYS A 249 ? 0.8887 1.1337 0.7279 -0.2003 -0.1604 0.2513  250 LYS A N   
1832 C CA  . LYS A 249 ? 0.8714 1.0946 0.7158 -0.1950 -0.1516 0.2475  250 LYS A CA  
1833 C C   . LYS A 249 ? 0.8532 1.1189 0.6735 -0.2078 -0.1352 0.2388  250 LYS A C   
1834 O O   . LYS A 249 ? 0.8727 1.1820 0.6715 -0.2309 -0.1404 0.2547  250 LYS A O   
1835 C CB  . LYS A 249 ? 0.9159 1.1078 0.7725 -0.2035 -0.1744 0.2796  250 LYS A CB  
1836 C CG  . LYS A 249 ? 0.9207 1.0791 0.7895 -0.1934 -0.1681 0.2737  250 LYS A CG  
1837 C CD  . LYS A 249 ? 0.9794 1.1066 0.8620 -0.2027 -0.1938 0.3051  250 LYS A CD  
1838 C CE  . LYS A 249 ? 1.0010 1.1031 0.8906 -0.1975 -0.1875 0.3004  250 LYS A CE  
1839 N NZ  . LYS A 249 ? 0.9949 1.1335 0.8605 -0.2177 -0.1776 0.3069  250 LYS A NZ  
1840 N N   . ARG A 250 ? 0.8086 1.0642 0.6334 -0.1928 -0.1156 0.2130  251 ARG A N   
1841 C CA  . ARG A 250 ? 0.8018 1.0899 0.6104 -0.2018 -0.1010 0.2044  251 ARG A CA  
1842 C C   . ARG A 250 ? 0.8320 1.0845 0.6523 -0.1972 -0.1013 0.2114  251 ARG A C   
1843 O O   . ARG A 250 ? 0.8526 1.0590 0.6921 -0.1877 -0.1133 0.2218  251 ARG A O   
1844 C CB  . ARG A 250 ? 0.7584 1.0684 0.5633 -0.1886 -0.0796 0.1670  251 ARG A CB  
1845 C CG  . ARG A 250 ? 0.7673 1.1119 0.5620 -0.1922 -0.0798 0.1566  251 ARG A CG  
1846 C CD  . ARG A 250 ? 0.7447 1.1219 0.5333 -0.1844 -0.0609 0.1204  251 ARG A CD  
1847 N NE  . ARG A 250 ? 0.7296 1.0723 0.5355 -0.1625 -0.0480 0.0968  251 ARG A NE  
1848 C CZ  . ARG A 250 ? 0.6994 1.0533 0.5087 -0.1501 -0.0345 0.0640  251 ARG A CZ  
1849 N NH1 . ARG A 250 ? 0.6449 0.9644 0.4701 -0.1325 -0.0258 0.0484  251 ARG A NH1 
1850 N NH2 . ARG A 250 ? 0.7222 1.1216 0.5202 -0.1555 -0.0310 0.0465  251 ARG A NH2 
1851 N N   . LEU A 251 ? 0.8484 1.1240 0.6584 -0.2038 -0.0891 0.2048  252 LEU A N   
1852 C CA  . LEU A 251 ? 0.8599 1.1077 0.6784 -0.2033 -0.0904 0.2137  252 LEU A CA  
1853 C C   . LEU A 251 ? 0.8631 1.0587 0.7033 -0.1776 -0.0851 0.1965  252 LEU A C   
1854 O O   . LEU A 251 ? 0.8900 1.0461 0.7445 -0.1745 -0.0973 0.2106  252 LEU A O   
1855 C CB  . LEU A 251 ? 0.8451 1.1337 0.6491 -0.2144 -0.0765 0.2063  252 LEU A CB  
1856 C CG  . LEU A 251 ? 0.8534 1.1262 0.6617 -0.2208 -0.0789 0.2193  252 LEU A CG  
1857 C CD1 . LEU A 251 ? 0.8491 1.0981 0.6622 -0.2371 -0.1035 0.2572  252 LEU A CD1 
1858 C CD2 . LEU A 251 ? 0.8474 1.1750 0.6397 -0.2347 -0.0654 0.2121  252 LEU A CD2 
1859 N N   . PHE A 252 ? 0.8508 1.0476 0.6939 -0.1601 -0.0683 0.1663  253 PHE A N   
1860 C CA  . PHE A 252 ? 0.8167 0.9718 0.6776 -0.1378 -0.0612 0.1492  253 PHE A CA  
1861 C C   . PHE A 252 ? 0.7872 0.9219 0.6610 -0.1226 -0.0629 0.1394  253 PHE A C   
1862 O O   . PHE A 252 ? 0.7834 0.8840 0.6728 -0.1063 -0.0601 0.1300  253 PHE A O   
1863 C CB  . PHE A 252 ? 0.7909 0.9578 0.6487 -0.1297 -0.0421 0.1243  253 PHE A CB  
1864 C CG  . PHE A 252 ? 0.8286 1.0178 0.6761 -0.1434 -0.0393 0.1316  253 PHE A CG  
1865 C CD1 . PHE A 252 ? 0.8520 1.0145 0.7057 -0.1465 -0.0465 0.1472  253 PHE A CD1 
1866 C CD2 . PHE A 252 ? 0.8498 1.0893 0.6828 -0.1534 -0.0300 0.1218  253 PHE A CD2 
1867 C CE1 . PHE A 252 ? 0.8546 1.0392 0.6999 -0.1605 -0.0443 0.1550  253 PHE A CE1 
1868 C CE2 . PHE A 252 ? 0.8807 1.1460 0.7054 -0.1668 -0.0268 0.1282  253 PHE A CE2 
1869 C CZ  . PHE A 252 ? 0.8933 1.1305 0.7239 -0.1709 -0.0340 0.1460  253 PHE A CZ  
1870 N N   . ASP A 253 ? 0.7923 0.9508 0.6593 -0.1287 -0.0673 0.1414  254 ASP A N   
1871 C CA  . ASP A 253 ? 0.7864 0.9319 0.6652 -0.1156 -0.0680 0.1306  254 ASP A CA  
1872 C C   . ASP A 253 ? 0.7820 0.9436 0.6569 -0.1263 -0.0829 0.1468  254 ASP A C   
1873 O O   . ASP A 253 ? 0.8048 0.9918 0.6650 -0.1454 -0.0921 0.1662  254 ASP A O   
1874 C CB  . ASP A 253 ? 0.7653 0.9233 0.6429 -0.1048 -0.0507 0.1008  254 ASP A CB  
1875 C CG  . ASP A 253 ? 0.7756 0.9812 0.6348 -0.1163 -0.0454 0.0917  254 ASP A CG  
1876 O OD1 . ASP A 253 ? 0.7725 1.0074 0.6165 -0.1343 -0.0528 0.1085  254 ASP A OD1 
1877 O OD2 . ASP A 253 ? 0.7769 0.9920 0.6375 -0.1075 -0.0343 0.0666  254 ASP A OD2 
1878 N N   . TYR A 254 ? 0.7566 0.9047 0.6450 -0.1149 -0.0858 0.1397  255 TYR A N   
1879 C CA  . TYR A 254 ? 0.7732 0.9406 0.6580 -0.1227 -0.0973 0.1486  255 TYR A CA  
1880 C C   . TYR A 254 ? 0.7481 0.9397 0.6266 -0.1184 -0.0848 0.1238  255 TYR A C   
1881 O O   . TYR A 254 ? 0.6967 0.8749 0.5843 -0.1038 -0.0716 0.1015  255 TYR A O   
1882 C CB  . TYR A 254 ? 0.7984 0.9352 0.7058 -0.1136 -0.1123 0.1593  255 TYR A CB  
1883 C CG  . TYR A 254 ? 0.8374 0.9544 0.7519 -0.1210 -0.1314 0.1866  255 TYR A CG  
1884 C CD1 . TYR A 254 ? 0.8377 0.9231 0.7642 -0.1129 -0.1306 0.1869  255 TYR A CD1 
1885 C CD2 . TYR A 254 ? 0.8695 0.9990 0.7795 -0.1369 -0.1522 0.2129  255 TYR A CD2 
1886 C CE1 . TYR A 254 ? 0.8707 0.9355 0.8064 -0.1198 -0.1506 0.2112  255 TYR A CE1 
1887 C CE2 . TYR A 254 ? 0.9051 1.0131 0.8245 -0.1446 -0.1733 0.2397  255 TYR A CE2 
1888 C CZ  . TYR A 254 ? 0.9139 0.9887 0.8471 -0.1355 -0.1726 0.2380  255 TYR A CZ  
1889 O OH  . TYR A 254 ? 0.9808 1.0321 0.9257 -0.1431 -0.1957 0.2636  255 TYR A OH  
1890 N N   . VAL A 255 ? 0.7613 0.9896 0.6241 -0.1323 -0.0904 0.1285  256 VAL A N   
1891 C CA  . VAL A 255 ? 0.7353 0.9893 0.5924 -0.1297 -0.0820 0.1050  256 VAL A CA  
1892 C C   . VAL A 255 ? 0.7548 1.0211 0.6121 -0.1354 -0.0958 0.1142  256 VAL A C   
1893 O O   . VAL A 255 ? 0.7801 1.0519 0.6326 -0.1483 -0.1121 0.1410  256 VAL A O   
1894 C CB  . VAL A 255 ? 0.7235 1.0224 0.5590 -0.1402 -0.0716 0.0910  256 VAL A CB  
1895 C CG1 . VAL A 255 ? 0.6885 0.9769 0.5280 -0.1301 -0.0557 0.0723  256 VAL A CG1 
1896 C CG2 . VAL A 255 ? 0.7305 1.0642 0.5451 -0.1633 -0.0814 0.1156  256 VAL A CG2 
1897 N N   . VAL A 256 ? 0.7349 1.0047 0.5989 -0.1262 -0.0903 0.0925  257 VAL A N   
1898 C CA  . VAL A 256 ? 0.7374 1.0269 0.5991 -0.1320 -0.1008 0.0947  257 VAL A CA  
1899 C C   . VAL A 256 ? 0.7311 1.0594 0.5778 -0.1358 -0.0911 0.0684  257 VAL A C   
1900 O O   . VAL A 256 ? 0.7171 1.0457 0.5636 -0.1286 -0.0768 0.0465  257 VAL A O   
1901 C CB  . VAL A 256 ? 0.7293 0.9865 0.6168 -0.1174 -0.1055 0.0929  257 VAL A CB  
1902 C CG1 . VAL A 256 ? 0.7175 0.9725 0.6142 -0.1058 -0.0936 0.0636  257 VAL A CG1 
1903 C CG2 . VAL A 256 ? 0.7872 1.0527 0.6770 -0.1253 -0.1247 0.1130  257 VAL A CG2 
1904 N N   . LYS A 257 ? 0.7479 1.1096 0.5826 -0.1469 -0.0999 0.0697  258 LYS A N   
1905 C CA  . LYS A 257 ? 0.7436 1.1425 0.5673 -0.1487 -0.0923 0.0406  258 LYS A CA  
1906 C C   . LYS A 257 ? 0.7159 1.0885 0.5614 -0.1312 -0.0867 0.0158  258 LYS A C   
1907 O O   . LYS A 257 ? 0.7177 1.0655 0.5799 -0.1252 -0.0944 0.0243  258 LYS A O   
1908 C CB  . LYS A 257 ? 0.7660 1.2085 0.5708 -0.1659 -0.1044 0.0491  258 LYS A CB  
1909 N N   . CYS A 258 ? 0.7100 1.0885 0.5573 -0.1235 -0.0744 -0.0139 259 CYS A N   
1910 C CA  . CYS A 258 ? 0.7040 1.0512 0.5741 -0.1074 -0.0691 -0.0349 259 CYS A CA  
1911 C C   . CYS A 258 ? 0.7222 1.0653 0.6042 -0.1055 -0.0781 -0.0392 259 CYS A C   
1912 O O   . CYS A 258 ? 0.7228 1.0322 0.6262 -0.0952 -0.0776 -0.0401 259 CYS A O   
1913 C CB  . CYS A 258 ? 0.6925 1.0512 0.5631 -0.1011 -0.0586 -0.0670 259 CYS A CB  
1914 S SG  . CYS A 258 ? 0.7049 1.0553 0.5716 -0.0979 -0.0465 -0.0648 259 CYS A SG  
1915 N N   . ASN A 259 ? 0.7316 1.1118 0.5994 -0.1167 -0.0864 -0.0412 260 ASN A N   
1916 C CA  . ASN A 259 ? 0.7529 1.1348 0.6299 -0.1171 -0.0965 -0.0442 260 ASN A CA  
1917 C C   . ASN A 259 ? 0.7764 1.1304 0.6685 -0.1149 -0.1056 -0.0172 260 ASN A C   
1918 O O   . ASN A 259 ? 0.7753 1.1126 0.6868 -0.1083 -0.1092 -0.0223 260 ASN A O   
1919 C CB  . ASN A 259 ? 0.7699 1.2020 0.6251 -0.1312 -0.1042 -0.0502 260 ASN A CB  
1920 C CG  . ASN A 259 ? 0.7745 1.2285 0.6095 -0.1469 -0.1130 -0.0183 260 ASN A CG  
1921 O OD1 . ASN A 259 ? 0.7789 1.2311 0.6048 -0.1509 -0.1088 -0.0028 260 ASN A OD1 
1922 N ND2 . ASN A 259 ? 0.7967 1.2711 0.6253 -0.1569 -0.1268 -0.0074 260 ASN A ND2 
1923 N N   . GLU A 260 ? 0.8105 1.1601 0.6955 -0.1204 -0.1102 0.0106  261 GLU A N   
1924 C CA  . GLU A 260 ? 0.8513 1.1776 0.7527 -0.1177 -0.1213 0.0348  261 GLU A CA  
1925 C C   . GLU A 260 ? 0.8281 1.1123 0.7518 -0.1028 -0.1133 0.0361  261 GLU A C   
1926 O O   . GLU A 260 ? 0.8263 1.0903 0.7680 -0.0973 -0.1207 0.0515  261 GLU A O   
1927 C CB  . GLU A 260 ? 0.9104 1.2516 0.7973 -0.1314 -0.1352 0.0650  261 GLU A CB  
1928 C CG  . GLU A 260 ? 0.9726 1.3088 0.8479 -0.1359 -0.1311 0.0793  261 GLU A CG  
1929 C CD  . GLU A 260 ? 1.0518 1.4202 0.9032 -0.1562 -0.1434 0.1032  261 GLU A CD  
1930 O OE1 . GLU A 260 ? 1.0582 1.4284 0.8980 -0.1629 -0.1402 0.1147  261 GLU A OE1 
1931 O OE2 . GLU A 260 ? 1.0831 1.4763 0.9269 -0.1668 -0.1567 0.1116  261 GLU A OE2 
1932 N N   . GLY A 261 ? 0.7976 1.0719 0.7208 -0.0962 -0.0988 0.0184  262 GLY A N   
1933 C CA  . GLY A 261 ? 0.7686 1.0077 0.7100 -0.0834 -0.0896 0.0162  262 GLY A CA  
1934 C C   . GLY A 261 ? 0.7751 0.9952 0.7418 -0.0744 -0.0912 0.0138  262 GLY A C   
1935 O O   . GLY A 261 ? 0.7985 0.9980 0.7800 -0.0677 -0.0923 0.0263  262 GLY A O   
1936 N N   . PRO A 262 ? 0.7769 1.0056 0.7502 -0.0746 -0.0918 -0.0031 263 PRO A N   
1937 C CA  . PRO A 262 ? 0.7684 0.9827 0.7667 -0.0682 -0.0934 -0.0042 263 PRO A CA  
1938 C C   . PRO A 262 ? 0.7983 1.0172 0.8081 -0.0689 -0.1060 0.0131  263 PRO A C   
1939 O O   . PRO A 262 ? 0.8459 1.0534 0.8785 -0.0621 -0.1060 0.0150  263 PRO A O   
1940 C CB  . PRO A 262 ? 0.7671 0.9919 0.7675 -0.0709 -0.0939 -0.0257 263 PRO A CB  
1941 C CG  . PRO A 262 ? 0.7534 0.9891 0.7348 -0.0737 -0.0882 -0.0408 263 PRO A CG  
1942 C CD  . PRO A 262 ? 0.7676 1.0178 0.7287 -0.0796 -0.0903 -0.0249 263 PRO A CD  
1943 N N   . THR A 263 ? 0.8144 1.0521 0.8095 -0.0774 -0.1171 0.0257  264 THR A N   
1944 C CA  . THR A 263 ? 0.8146 1.0577 0.8205 -0.0790 -0.1327 0.0438  264 THR A CA  
1945 C C   . THR A 263 ? 0.7803 1.0045 0.7952 -0.0735 -0.1375 0.0639  264 THR A C   
1946 O O   . THR A 263 ? 0.7888 1.0131 0.8177 -0.0724 -0.1520 0.0790  264 THR A O   
1947 C CB  . THR A 263 ? 0.8569 1.1310 0.8426 -0.0929 -0.1457 0.0502  264 THR A CB  
1948 O OG1 . THR A 263 ? 0.8448 1.1272 0.8070 -0.1014 -0.1469 0.0625  264 THR A OG1 
1949 C CG2 . THR A 263 ? 0.8692 1.1638 0.8459 -0.0979 -0.1421 0.0267  264 THR A CG2 
1950 N N   . LEU A 264 ? 0.7369 0.9449 0.7452 -0.0698 -0.1267 0.0631  265 LEU A N   
1951 C CA  . LEU A 264 ? 0.7243 0.9116 0.7419 -0.0638 -0.1306 0.0786  265 LEU A CA  
1952 C C   . LEU A 264 ? 0.7052 0.8763 0.7546 -0.0498 -0.1304 0.0761  265 LEU A C   
1953 O O   . LEU A 264 ? 0.6710 0.8401 0.7307 -0.0442 -0.1188 0.0604  265 LEU A O   
1954 C CB  . LEU A 264 ? 0.7046 0.8800 0.7078 -0.0632 -0.1177 0.0750  265 LEU A CB  
1955 C CG  . LEU A 264 ? 0.7296 0.9126 0.7091 -0.0746 -0.1220 0.0889  265 LEU A CG  
1956 C CD1 . LEU A 264 ? 0.7301 0.9427 0.6918 -0.0901 -0.1353 0.1006  265 LEU A CD1 
1957 C CD2 . LEU A 264 ? 0.7007 0.8837 0.6643 -0.0751 -0.1052 0.0748  265 LEU A CD2 
1958 N N   . PRO A 265 ? 0.7194 0.8808 0.7858 -0.0447 -0.1444 0.0913  266 PRO A N   
1959 C CA  . PRO A 265 ? 0.7032 0.8554 0.8025 -0.0305 -0.1452 0.0866  266 PRO A CA  
1960 C C   . PRO A 265 ? 0.6666 0.8028 0.7738 -0.0199 -0.1280 0.0737  266 PRO A C   
1961 O O   . PRO A 265 ? 0.6400 0.7667 0.7285 -0.0225 -0.1177 0.0714  266 PRO A O   
1962 C CB  . PRO A 265 ? 0.7160 0.8594 0.8299 -0.0276 -0.1662 0.1054  266 PRO A CB  
1963 C CG  . PRO A 265 ? 0.7282 0.8673 0.8155 -0.0394 -0.1713 0.1204  266 PRO A CG  
1964 C CD  . PRO A 265 ? 0.7348 0.8956 0.7930 -0.0525 -0.1622 0.1138  266 PRO A CD  
1965 N N   . ASP A 266 ? 0.6693 0.8063 0.8041 -0.0087 -0.1252 0.0653  267 ASP A N   
1966 C CA  . ASP A 266 ? 0.6651 0.7913 0.8109 0.0017  -0.1113 0.0543  267 ASP A CA  
1967 C C   . ASP A 266 ? 0.6755 0.7826 0.8278 0.0096  -0.1182 0.0611  267 ASP A C   
1968 O O   . ASP A 266 ? 0.6935 0.7965 0.8571 0.0114  -0.1371 0.0734  267 ASP A O   
1969 C CB  . ASP A 266 ? 0.6766 0.8172 0.8517 0.0100  -0.1078 0.0437  267 ASP A CB  
1970 C CG  . ASP A 266 ? 0.6877 0.8444 0.8586 0.0017  -0.0997 0.0360  267 ASP A CG  
1971 O OD1 . ASP A 266 ? 0.7120 0.8662 0.8584 -0.0083 -0.0948 0.0351  267 ASP A OD1 
1972 O OD2 . ASP A 266 ? 0.7165 0.8893 0.9105 0.0052  -0.0988 0.0300  267 ASP A OD2 
1973 N N   . ILE A 267 ? 0.6510 0.7454 0.7969 0.0136  -0.1047 0.0536  268 ILE A N   
1974 C CA  . ILE A 267 ? 0.6471 0.7226 0.8019 0.0224  -0.1098 0.0561  268 ILE A CA  
1975 C C   . ILE A 267 ? 0.6472 0.7250 0.8228 0.0356  -0.0982 0.0393  268 ILE A C   
1976 O O   . ILE A 267 ? 0.6430 0.7256 0.8090 0.0338  -0.0803 0.0292  268 ILE A O   
1977 C CB  . ILE A 267 ? 0.6513 0.7109 0.7790 0.0146  -0.1063 0.0633  268 ILE A CB  
1978 C CG1 . ILE A 267 ? 0.6736 0.7397 0.7789 -0.0003 -0.1159 0.0786  268 ILE A CG1 
1979 C CG2 . ILE A 267 ? 0.6589 0.6974 0.7985 0.0231  -0.1150 0.0668  268 ILE A CG2 
1980 C CD1 . ILE A 267 ? 0.6707 0.7292 0.7486 -0.0099 -0.1113 0.0851  268 ILE A CD1 
1981 N N   . SER A 268 ? 0.6671 0.7433 0.8721 0.0485  -0.1096 0.0362  269 SER A N   
1982 C CA  . SER A 268 ? 0.6708 0.7574 0.8995 0.0619  -0.0999 0.0178  269 SER A CA  
1983 C C   . SER A 268 ? 0.6987 0.7668 0.9386 0.0735  -0.1050 0.0124  269 SER A C   
1984 O O   . SER A 268 ? 0.7360 0.7861 0.9858 0.0770  -0.1251 0.0222  269 SER A O   
1985 C CB  . SER A 268 ? 0.6815 0.7905 0.9417 0.0696  -0.1076 0.0119  269 SER A CB  
1986 O OG  . SER A 268 ? 0.7086 0.8343 0.9587 0.0582  -0.1033 0.0163  269 SER A OG  
1987 N N   . PHE A 269 ? 0.6623 0.7350 0.9010 0.0786  -0.0881 -0.0026 270 PHE A N   
1988 C CA  . PHE A 269 ? 0.6594 0.7171 0.9076 0.0897  -0.0905 -0.0117 270 PHE A CA  
1989 C C   . PHE A 269 ? 0.6690 0.7509 0.9488 0.1051  -0.0854 -0.0341 270 PHE A C   
1990 O O   . PHE A 269 ? 0.6758 0.7838 0.9531 0.1026  -0.0672 -0.0441 270 PHE A O   
1991 C CB  . PHE A 269 ? 0.6398 0.6855 0.8579 0.0821  -0.0750 -0.0116 270 PHE A CB  
1992 C CG  . PHE A 269 ? 0.6371 0.6659 0.8245 0.0669  -0.0777 0.0074  270 PHE A CG  
1993 C CD1 . PHE A 269 ? 0.6142 0.6542 0.7806 0.0543  -0.0672 0.0126  270 PHE A CD1 
1994 C CD2 . PHE A 269 ? 0.6446 0.6483 0.8255 0.0647  -0.0915 0.0194  270 PHE A CD2 
1995 C CE1 . PHE A 269 ? 0.6161 0.6461 0.7561 0.0414  -0.0694 0.0265  270 PHE A CE1 
1996 C CE2 . PHE A 269 ? 0.6415 0.6367 0.7944 0.0497  -0.0930 0.0362  270 PHE A CE2 
1997 C CZ  . PHE A 269 ? 0.6346 0.6447 0.7672 0.0389  -0.0814 0.0383  270 PHE A CZ  
1998 N N   . HIS A 270 ? 0.6995 0.7744 1.0106 0.1204  -0.1027 -0.0418 271 HIS A N   
1999 C CA  . HIS A 270 ? 0.7310 0.8328 1.0782 0.1375  -0.1010 -0.0660 271 HIS A CA  
2000 C C   . HIS A 270 ? 0.7243 0.8269 1.0722 0.1463  -0.0899 -0.0857 271 HIS A C   
2001 O O   . HIS A 270 ? 0.7339 0.8129 1.0945 0.1567  -0.1040 -0.0910 271 HIS A O   
2002 C CB  . HIS A 270 ? 0.7652 0.8605 1.1506 0.1510  -0.1278 -0.0662 271 HIS A CB  
2003 C CG  . HIS A 270 ? 0.8087 0.9380 1.2358 0.1691  -0.1275 -0.0919 271 HIS A CG  
2004 N ND1 . HIS A 270 ? 0.8111 0.9809 1.2396 0.1699  -0.1039 -0.1104 271 HIS A ND1 
2005 C CD2 . HIS A 270 ? 0.8319 0.9633 1.3025 0.1867  -0.1491 -0.1020 271 HIS A CD2 
2006 C CE1 . HIS A 270 ? 0.8161 1.0150 1.2865 0.1872  -0.1091 -0.1323 271 HIS A CE1 
2007 N NE2 . HIS A 270 ? 0.8219 0.9972 1.3197 0.1989  -0.1368 -0.1288 271 HIS A NE2 
2008 N N   . LEU A 271 ? 0.6987 0.8283 1.0323 0.1408  -0.0659 -0.0955 272 LEU A N   
2009 C CA  . LEU A 271 ? 0.6964 0.8328 1.0253 0.1461  -0.0527 -0.1134 272 LEU A CA  
2010 C C   . LEU A 271 ? 0.6983 0.8827 1.0499 0.1553  -0.0391 -0.1388 272 LEU A C   
2011 O O   . LEU A 271 ? 0.6707 0.8865 1.0159 0.1452  -0.0243 -0.1367 272 LEU A O   
2012 C CB  . LEU A 271 ? 0.6820 0.8064 0.9690 0.1291  -0.0368 -0.1007 272 LEU A CB  
2013 C CG  . LEU A 271 ? 0.6908 0.7766 0.9503 0.1171  -0.0449 -0.0766 272 LEU A CG  
2014 C CD1 . LEU A 271 ? 0.6777 0.7638 0.9018 0.1011  -0.0268 -0.0678 272 LEU A CD1 
2015 C CD2 . LEU A 271 ? 0.7040 0.7568 0.9672 0.1244  -0.0600 -0.0764 272 LEU A CD2 
2016 N N   . GLY A 272 ? 0.7144 0.9055 1.0936 0.1739  -0.0453 -0.1632 273 GLY A N   
2017 C CA  . GLY A 272 ? 0.7280 0.9692 1.1306 0.1848  -0.0326 -0.1926 273 GLY A CA  
2018 C C   . GLY A 272 ? 0.7355 1.0212 1.1591 0.1844  -0.0269 -0.1972 273 GLY A C   
2019 O O   . GLY A 272 ? 0.7420 1.0729 1.1617 0.1782  -0.0067 -0.2072 273 GLY A O   
2020 N N   . GLY A 273 ? 0.7570 1.0317 1.2024 0.1895  -0.0453 -0.1885 274 GLY A N   
2021 C CA  . GLY A 273 ? 0.7779 1.0944 1.2480 0.1906  -0.0429 -0.1934 274 GLY A CA  
2022 C C   . GLY A 273 ? 0.7792 1.0918 1.2259 0.1701  -0.0391 -0.1660 274 GLY A C   
2023 O O   . GLY A 273 ? 0.7964 1.1167 1.2637 0.1721  -0.0506 -0.1605 274 GLY A O   
2024 N N   . LYS A 274 ? 0.7708 1.0720 1.1765 0.1510  -0.0241 -0.1501 275 LYS A N   
2025 C CA  . LYS A 274 ? 0.7411 1.0353 1.1224 0.1310  -0.0204 -0.1258 275 LYS A CA  
2026 C C   . LYS A 274 ? 0.7374 0.9822 1.1002 0.1262  -0.0369 -0.1038 275 LYS A C   
2027 O O   . LYS A 274 ? 0.7539 0.9664 1.1122 0.1331  -0.0467 -0.1030 275 LYS A O   
2028 C CB  . LYS A 274 ? 0.7133 1.0192 1.0629 0.1133  0.0011  -0.1201 275 LYS A CB  
2029 N N   . GLU A 275 ? 0.7482 0.9902 1.1009 0.1135  -0.0402 -0.0864 276 GLU A N   
2030 C CA  . GLU A 275 ? 0.7619 0.9659 1.0954 0.1064  -0.0546 -0.0656 276 GLU A CA  
2031 C C   . GLU A 275 ? 0.7194 0.9125 1.0146 0.0873  -0.0420 -0.0517 276 GLU A C   
2032 O O   . GLU A 275 ? 0.7245 0.9376 1.0160 0.0764  -0.0337 -0.0487 276 GLU A O   
2033 C CB  . GLU A 275 ? 0.7928 1.0029 1.1477 0.1086  -0.0719 -0.0586 276 GLU A CB  
2034 C CG  . GLU A 275 ? 0.8352 1.0102 1.1799 0.1059  -0.0925 -0.0396 276 GLU A CG  
2035 C CD  . GLU A 275 ? 0.8683 1.0224 1.2352 0.1216  -0.1116 -0.0433 276 GLU A CD  
2036 O OE1 . GLU A 275 ? 0.8698 1.0407 1.2750 0.1381  -0.1195 -0.0591 276 GLU A OE1 
2037 O OE2 . GLU A 275 ? 0.9001 1.0210 1.2478 0.1172  -0.1202 -0.0302 276 GLU A OE2 
2038 N N   . TYR A 276 ? 0.6910 0.8531 0.9605 0.0835  -0.0419 -0.0442 277 TYR A N   
2039 C CA  . TYR A 276 ? 0.6554 0.8055 0.8907 0.0680  -0.0306 -0.0343 277 TYR A CA  
2040 C C   . TYR A 276 ? 0.6433 0.7738 0.8602 0.0580  -0.0410 -0.0175 277 TYR A C   
2041 O O   . TYR A 276 ? 0.6426 0.7486 0.8481 0.0583  -0.0504 -0.0091 277 TYR A O   
2042 C CB  . TYR A 276 ? 0.6481 0.7816 0.8668 0.0696  -0.0223 -0.0382 277 TYR A CB  
2043 C CG  . TYR A 276 ? 0.6467 0.8046 0.8767 0.0757  -0.0090 -0.0549 277 TYR A CG  
2044 C CD1 . TYR A 276 ? 0.6497 0.8153 0.9049 0.0923  -0.0139 -0.0708 277 TYR A CD1 
2045 C CD2 . TYR A 276 ? 0.6221 0.7975 0.8389 0.0645  0.0074  -0.0552 277 TYR A CD2 
2046 C CE1 . TYR A 276 ? 0.6504 0.8450 0.9154 0.0977  -0.0008 -0.0887 277 TYR A CE1 
2047 C CE2 . TYR A 276 ? 0.6377 0.8410 0.8628 0.0677  0.0198  -0.0692 277 TYR A CE2 
2048 C CZ  . TYR A 276 ? 0.6497 0.8648 0.8979 0.0844  0.0167  -0.0869 277 TYR A CZ  
2049 O OH  . TYR A 276 ? 0.6657 0.9143 0.9213 0.0873  0.0298  -0.1031 277 TYR A OH  
2050 N N   . THR A 277 ? 0.6310 0.7750 0.8451 0.0481  -0.0392 -0.0131 278 THR A N   
2051 C CA  . THR A 277 ? 0.6422 0.7766 0.8437 0.0396  -0.0504 -0.0006 278 THR A CA  
2052 C C   . THR A 277 ? 0.6426 0.7648 0.8135 0.0269  -0.0425 0.0042  278 THR A C   
2053 O O   . THR A 277 ? 0.6340 0.7628 0.7993 0.0210  -0.0299 -0.0004 278 THR A O   
2054 C CB  . THR A 277 ? 0.6336 0.7905 0.8537 0.0378  -0.0569 -0.0003 278 THR A CB  
2055 O OG1 . THR A 277 ? 0.6566 0.8265 0.9085 0.0514  -0.0646 -0.0070 278 THR A OG1 
2056 C CG2 . THR A 277 ? 0.6339 0.7837 0.8417 0.0296  -0.0704 0.0118  278 THR A CG2 
2057 N N   . LEU A 278 ? 0.6334 0.7395 0.7861 0.0224  -0.0509 0.0137  279 LEU A N   
2058 C CA  . LEU A 278 ? 0.6156 0.7149 0.7423 0.0111  -0.0462 0.0164  279 LEU A CA  
2059 C C   . LEU A 278 ? 0.6126 0.7201 0.7341 0.0034  -0.0573 0.0226  279 LEU A C   
2060 O O   . LEU A 278 ? 0.6297 0.7370 0.7551 0.0047  -0.0710 0.0315  279 LEU A O   
2061 C CB  . LEU A 278 ? 0.6166 0.6964 0.7235 0.0105  -0.0444 0.0203  279 LEU A CB  
2062 C CG  . LEU A 278 ? 0.6303 0.6979 0.7368 0.0173  -0.0357 0.0156  279 LEU A CG  
2063 C CD1 . LEU A 278 ? 0.6166 0.6700 0.6982 0.0112  -0.0309 0.0183  279 LEU A CD1 
2064 C CD2 . LEU A 278 ? 0.6313 0.7093 0.7484 0.0202  -0.0230 0.0053  279 LEU A CD2 
2065 N N   . THR A 279 ? 0.6058 0.7208 0.7197 -0.0049 -0.0528 0.0179  280 THR A N   
2066 C CA  . THR A 279 ? 0.6087 0.7322 0.7122 -0.0135 -0.0620 0.0207  280 THR A CA  
2067 C C   . THR A 279 ? 0.6081 0.7234 0.6850 -0.0193 -0.0612 0.0227  280 THR A C   
2068 O O   . THR A 279 ? 0.5791 0.6812 0.6469 -0.0171 -0.0523 0.0206  280 THR A O   
2069 C CB  . THR A 279 ? 0.6136 0.7485 0.7223 -0.0199 -0.0594 0.0125  280 THR A CB  
2070 O OG1 . THR A 279 ? 0.6284 0.7536 0.7262 -0.0235 -0.0489 0.0049  280 THR A OG1 
2071 C CG2 . THR A 279 ? 0.5877 0.7353 0.7231 -0.0160 -0.0586 0.0108  280 THR A CG2 
2072 N N   . SER A 280 ? 0.5989 0.7255 0.6635 -0.0270 -0.0703 0.0262  281 SER A N   
2073 C CA  . SER A 280 ? 0.6077 0.7359 0.6473 -0.0341 -0.0693 0.0259  281 SER A CA  
2074 C C   . SER A 280 ? 0.6102 0.7317 0.6414 -0.0345 -0.0568 0.0121  281 SER A C   
2075 O O   . SER A 280 ? 0.6196 0.7352 0.6362 -0.0353 -0.0517 0.0117  281 SER A O   
2076 C CB  . SER A 280 ? 0.6222 0.7714 0.6506 -0.0436 -0.0801 0.0282  281 SER A CB  
2077 O OG  . SER A 280 ? 0.6348 0.7947 0.6738 -0.0452 -0.0823 0.0191  281 SER A OG  
2078 N N   . ALA A 281 ? 0.6202 0.7421 0.6628 -0.0343 -0.0531 0.0018  282 ALA A N   
2079 C CA  . ALA A 281 ? 0.6235 0.7355 0.6638 -0.0344 -0.0440 -0.0098 282 ALA A CA  
2080 C C   . ALA A 281 ? 0.6281 0.7228 0.6680 -0.0287 -0.0344 -0.0069 282 ALA A C   
2081 O O   . ALA A 281 ? 0.6535 0.7395 0.6856 -0.0290 -0.0284 -0.0140 282 ALA A O   
2082 C CB  . ALA A 281 ? 0.6333 0.7472 0.6896 -0.0367 -0.0448 -0.0170 282 ALA A CB  
2083 N N   . ASP A 282 ? 0.6232 0.7141 0.6728 -0.0230 -0.0339 0.0019  283 ASP A N   
2084 C CA  . ASP A 282 ? 0.6039 0.6806 0.6535 -0.0172 -0.0257 0.0038  283 ASP A CA  
2085 C C   . ASP A 282 ? 0.6006 0.6697 0.6351 -0.0163 -0.0267 0.0097  283 ASP A C   
2086 O O   . ASP A 282 ? 0.5828 0.6396 0.6138 -0.0128 -0.0198 0.0094  283 ASP A O   
2087 C CB  . ASP A 282 ? 0.6070 0.6858 0.6761 -0.0105 -0.0246 0.0068  283 ASP A CB  
2088 C CG  . ASP A 282 ? 0.6187 0.7089 0.7038 -0.0130 -0.0227 0.0025  283 ASP A CG  
2089 O OD1 . ASP A 282 ? 0.6260 0.7123 0.7092 -0.0175 -0.0165 -0.0020 283 ASP A OD1 
2090 O OD2 . ASP A 282 ? 0.6205 0.7238 0.7214 -0.0110 -0.0285 0.0045  283 ASP A OD2 
2091 N N   . TYR A 283 ? 0.5901 0.6681 0.6158 -0.0208 -0.0359 0.0163  284 TYR A N   
2092 C CA  . TYR A 283 ? 0.6004 0.6737 0.6124 -0.0227 -0.0386 0.0252  284 TYR A CA  
2093 C C   . TYR A 283 ? 0.6273 0.7156 0.6190 -0.0323 -0.0412 0.0252  284 TYR A C   
2094 O O   . TYR A 283 ? 0.6423 0.7300 0.6217 -0.0361 -0.0425 0.0330  284 TYR A O   
2095 C CB  . TYR A 283 ? 0.5843 0.6516 0.6071 -0.0189 -0.0491 0.0385  284 TYR A CB  
2096 C CG  . TYR A 283 ? 0.5795 0.6599 0.6068 -0.0230 -0.0632 0.0476  284 TYR A CG  
2097 C CD1 . TYR A 283 ? 0.6051 0.6969 0.6157 -0.0336 -0.0724 0.0583  284 TYR A CD1 
2098 C CD2 . TYR A 283 ? 0.5792 0.6635 0.6279 -0.0172 -0.0680 0.0463  284 TYR A CD2 
2099 C CE1 . TYR A 283 ? 0.6177 0.7225 0.6314 -0.0386 -0.0867 0.0685  284 TYR A CE1 
2100 C CE2 . TYR A 283 ? 0.5943 0.6906 0.6484 -0.0209 -0.0823 0.0552  284 TYR A CE2 
2101 C CZ  . TYR A 283 ? 0.6083 0.7136 0.6443 -0.0317 -0.0921 0.0669  284 TYR A CZ  
2102 O OH  . TYR A 283 ? 0.6164 0.7345 0.6566 -0.0366 -0.1076 0.0775  284 TYR A OH  
2103 N N   . VAL A 284 ? 0.6385 0.7423 0.6273 -0.0367 -0.0421 0.0156  285 VAL A N   
2104 C CA  . VAL A 284 ? 0.6384 0.7628 0.6086 -0.0453 -0.0433 0.0106  285 VAL A CA  
2105 C C   . VAL A 284 ? 0.6392 0.7620 0.6064 -0.0432 -0.0337 -0.0077 285 VAL A C   
2106 O O   . VAL A 284 ? 0.6540 0.7679 0.6338 -0.0390 -0.0310 -0.0180 285 VAL A O   
2107 C CB  . VAL A 284 ? 0.6205 0.7676 0.5884 -0.0521 -0.0529 0.0099  285 VAL A CB  
2108 C CG1 . VAL A 284 ? 0.6288 0.8032 0.5756 -0.0617 -0.0538 0.0043  285 VAL A CG1 
2109 C CG2 . VAL A 284 ? 0.6219 0.7689 0.5966 -0.0534 -0.0648 0.0285  285 VAL A CG2 
2110 N N   . PHE A 285 ? 0.6643 0.7963 0.6168 -0.0465 -0.0298 -0.0110 286 PHE A N   
2111 C CA  . PHE A 285 ? 0.6671 0.8047 0.6174 -0.0448 -0.0237 -0.0311 286 PHE A CA  
2112 C C   . PHE A 285 ? 0.6918 0.8564 0.6373 -0.0499 -0.0287 -0.0454 286 PHE A C   
2113 O O   . PHE A 285 ? 0.7067 0.8993 0.6366 -0.0567 -0.0292 -0.0489 286 PHE A O   
2114 C CB  . PHE A 285 ? 0.6738 0.8164 0.6118 -0.0462 -0.0178 -0.0309 286 PHE A CB  
2115 C CG  . PHE A 285 ? 0.6851 0.8007 0.6282 -0.0404 -0.0123 -0.0223 286 PHE A CG  
2116 C CD1 . PHE A 285 ? 0.6761 0.7748 0.6279 -0.0333 -0.0061 -0.0337 286 PHE A CD1 
2117 C CD2 . PHE A 285 ? 0.6955 0.8026 0.6355 -0.0423 -0.0150 -0.0030 286 PHE A CD2 
2118 C CE1 . PHE A 285 ? 0.6992 0.7758 0.6541 -0.0288 -0.0013 -0.0261 286 PHE A CE1 
2119 C CE2 . PHE A 285 ? 0.6946 0.7783 0.6395 -0.0365 -0.0105 0.0024  286 PHE A CE2 
2120 C CZ  . PHE A 285 ? 0.6932 0.7632 0.6443 -0.0300 -0.0028 -0.0092 286 PHE A CZ  
2121 N N   . GLN A 286 ? 0.7106 0.8696 0.6695 -0.0476 -0.0326 -0.0535 287 GLN A N   
2122 C CA  . GLN A 286 ? 0.7543 0.9361 0.7120 -0.0512 -0.0381 -0.0711 287 GLN A CA  
2123 C C   . GLN A 286 ? 0.7929 0.9803 0.7519 -0.0473 -0.0346 -0.0960 287 GLN A C   
2124 O O   . GLN A 286 ? 0.8402 1.0070 0.8156 -0.0413 -0.0349 -0.1074 287 GLN A O   
2125 C CB  . GLN A 286 ? 0.7276 0.8992 0.7021 -0.0501 -0.0444 -0.0727 287 GLN A CB  
2126 C CG  . GLN A 286 ? 0.7463 0.9209 0.7223 -0.0537 -0.0506 -0.0534 287 GLN A CG  
2127 C CD  . GLN A 286 ? 0.7489 0.9546 0.7085 -0.0626 -0.0580 -0.0494 287 GLN A CD  
2128 O OE1 . GLN A 286 ? 0.7383 0.9686 0.6873 -0.0669 -0.0594 -0.0657 287 GLN A OE1 
2129 N NE2 . GLN A 286 ? 0.7608 0.9668 0.7192 -0.0656 -0.0640 -0.0279 287 GLN A NE2 
2130 N N   . GLU A 287 ? 0.8266 1.0432 0.7697 -0.0513 -0.0322 -0.1040 288 GLU A N   
2131 C CA  . GLU A 287 ? 0.8751 1.1031 0.8214 -0.0464 -0.0295 -0.1311 288 GLU A CA  
2132 C C   . GLU A 287 ? 0.8804 1.1438 0.8223 -0.0499 -0.0350 -0.1539 288 GLU A C   
2133 O O   . GLU A 287 ? 0.9156 1.1889 0.8656 -0.0441 -0.0356 -0.1822 288 GLU A O   
2134 C CB  . GLU A 287 ? 0.9328 1.1715 0.8675 -0.0468 -0.0212 -0.1283 288 GLU A CB  
2135 C CG  . GLU A 287 ? 0.9877 1.1898 0.9320 -0.0397 -0.0159 -0.1182 288 GLU A CG  
2136 C CD  . GLU A 287 ? 1.0630 1.2715 0.9935 -0.0434 -0.0093 -0.1033 288 GLU A CD  
2137 O OE1 . GLU A 287 ? 1.0988 1.2805 1.0354 -0.0380 -0.0050 -0.0961 288 GLU A OE1 
2138 O OE2 . GLU A 287 ? 1.0840 1.3253 0.9972 -0.0529 -0.0092 -0.0979 288 GLU A OE2 
2139 N N   . SER A 288 ? 0.8416 1.1237 0.7721 -0.0590 -0.0403 -0.1421 289 SER A N   
2140 C CA  . SER A 288 ? 0.8224 1.1432 0.7445 -0.0650 -0.0461 -0.1599 289 SER A CA  
2141 C C   . SER A 288 ? 0.8030 1.1237 0.7223 -0.0723 -0.0547 -0.1411 289 SER A C   
2142 O O   . SER A 288 ? 0.7730 1.0701 0.6946 -0.0731 -0.0551 -0.1142 289 SER A O   
2143 C CB  . SER A 288 ? 0.8310 1.1981 0.7301 -0.0731 -0.0411 -0.1637 289 SER A CB  
2144 O OG  . SER A 288 ? 0.8507 1.2614 0.7366 -0.0819 -0.0466 -0.1757 289 SER A OG  
2145 N N   . TYR A 289 ? 0.8195 1.1669 0.7358 -0.0768 -0.0622 -0.1570 290 TYR A N   
2146 C CA  . TYR A 289 ? 0.8256 1.1806 0.7376 -0.0851 -0.0716 -0.1403 290 TYR A CA  
2147 C C   . TYR A 289 ? 0.8304 1.2368 0.7166 -0.0983 -0.0751 -0.1403 290 TYR A C   
2148 O O   . TYR A 289 ? 0.8367 1.2575 0.7172 -0.1065 -0.0847 -0.1302 290 TYR A O   
2149 C CB  . TYR A 289 ? 0.8458 1.1847 0.7785 -0.0807 -0.0797 -0.1546 290 TYR A CB  
2150 C CG  . TYR A 289 ? 0.8553 1.1468 0.8124 -0.0718 -0.0781 -0.1470 290 TYR A CG  
2151 C CD1 . TYR A 289 ? 0.8353 1.1045 0.7971 -0.0720 -0.0773 -0.1178 290 TYR A CD1 
2152 C CD2 . TYR A 289 ? 0.8517 1.1226 0.8283 -0.0638 -0.0786 -0.1694 290 TYR A CD2 
2153 C CE1 . TYR A 289 ? 0.8297 1.0627 0.8123 -0.0653 -0.0749 -0.1117 290 TYR A CE1 
2154 C CE2 . TYR A 289 ? 0.8468 1.0784 0.8440 -0.0585 -0.0777 -0.1600 290 TYR A CE2 
2155 C CZ  . TYR A 289 ? 0.8486 1.0638 0.8475 -0.0597 -0.0748 -0.1314 290 TYR A CZ  
2156 O OH  . TYR A 289 ? 0.8336 1.0166 0.8514 -0.0558 -0.0729 -0.1228 290 TYR A OH  
2157 N N   . SER A 290 ? 0.8338 1.2702 0.7048 -0.1012 -0.0676 -0.1507 291 SER A N   
2158 C CA  . SER A 290 ? 0.8462 1.3394 0.6906 -0.1156 -0.0691 -0.1525 291 SER A CA  
2159 C C   . SER A 290 ? 0.8488 1.3493 0.6751 -0.1298 -0.0735 -0.1124 291 SER A C   
2160 O O   . SER A 290 ? 0.8299 1.2972 0.6614 -0.1274 -0.0711 -0.0879 291 SER A O   
2161 C CB  . SER A 290 ? 0.8515 1.3763 0.6885 -0.1137 -0.0585 -0.1773 291 SER A CB  
2162 O OG  . SER A 290 ? 0.8845 1.4685 0.6937 -0.1299 -0.0579 -0.1743 291 SER A OG  
2163 N N   . SER A 291 ? 0.8723 1.4164 0.6782 -0.1451 -0.0815 -0.1061 292 SER A N   
2164 C CA  . SER A 291 ? 0.8875 1.4448 0.6746 -0.1617 -0.0889 -0.0676 292 SER A CA  
2165 C C   . SER A 291 ? 0.8927 1.4817 0.6599 -0.1722 -0.0809 -0.0606 292 SER A C   
2166 O O   . SER A 291 ? 0.9223 1.5039 0.6814 -0.1824 -0.0853 -0.0261 292 SER A O   
2167 C CB  . SER A 291 ? 0.9051 1.4986 0.6771 -0.1761 -0.1023 -0.0607 292 SER A CB  
2168 O OG  . SER A 291 ? 0.9241 1.5794 0.6745 -0.1863 -0.0989 -0.0844 292 SER A OG  
2169 N N   . LYS A 292 ? 0.9044 1.5283 0.6664 -0.1695 -0.0701 -0.0942 293 LYS A N   
2170 C CA  . LYS A 292 ? 0.9157 1.5796 0.6596 -0.1799 -0.0610 -0.0930 293 LYS A CA  
2171 C C   . LYS A 292 ? 0.8963 1.5247 0.6547 -0.1674 -0.0498 -0.0942 293 LYS A C   
2172 O O   . LYS A 292 ? 0.9204 1.5809 0.6680 -0.1734 -0.0409 -0.0982 293 LYS A O   
2173 C CB  . LYS A 292 ? 0.9225 1.6538 0.6524 -0.1847 -0.0556 -0.1300 293 LYS A CB  
2174 N N   . LYS A 293 ? 0.8641 1.4299 0.6467 -0.1511 -0.0505 -0.0902 294 LYS A N   
2175 C CA  . LYS A 293 ? 0.8254 1.3521 0.6221 -0.1395 -0.0417 -0.0876 294 LYS A CA  
2176 C C   . LYS A 293 ? 0.7950 1.2747 0.5981 -0.1400 -0.0481 -0.0503 294 LYS A C   
2177 O O   . LYS A 293 ? 0.8076 1.2710 0.6148 -0.1416 -0.0588 -0.0349 294 LYS A O   
2178 C CB  . LYS A 293 ? 0.8352 1.3300 0.6571 -0.1188 -0.0366 -0.1191 294 LYS A CB  
2179 C CG  . LYS A 293 ? 0.8756 1.4080 0.6996 -0.1135 -0.0322 -0.1615 294 LYS A CG  
2180 C CD  . LYS A 293 ? 0.8957 1.4346 0.7259 -0.1054 -0.0211 -0.1802 294 LYS A CD  
2181 C CE  . LYS A 293 ? 0.9477 1.5072 0.7919 -0.0935 -0.0199 -0.2268 294 LYS A CE  
2182 N NZ  . LYS A 293 ? 0.9851 1.5755 0.8309 -0.0890 -0.0101 -0.2501 294 LYS A NZ  
2183 N N   . LEU A 294 ? 0.7575 1.2165 0.5632 -0.1379 -0.0422 -0.0379 295 LEU A N   
2184 C CA  . LEU A 294 ? 0.7376 1.1517 0.5517 -0.1366 -0.0481 -0.0065 295 LEU A CA  
2185 C C   . LEU A 294 ? 0.7154 1.0786 0.5528 -0.1173 -0.0415 -0.0162 295 LEU A C   
2186 O O   . LEU A 294 ? 0.7048 1.0665 0.5483 -0.1082 -0.0312 -0.0385 295 LEU A O   
2187 C CB  . LEU A 294 ? 0.7392 1.1661 0.5385 -0.1512 -0.0497 0.0199  295 LEU A CB  
2188 C CG  . LEU A 294 ? 0.7682 1.2432 0.5431 -0.1746 -0.0590 0.0398  295 LEU A CG  
2189 C CD1 . LEU A 294 ? 0.7751 1.2738 0.5358 -0.1888 -0.0553 0.0544  295 LEU A CD1 
2190 C CD2 . LEU A 294 ? 0.7657 1.2226 0.5422 -0.1819 -0.0769 0.0707  295 LEU A CD2 
2191 N N   . CYS A 295 ? 0.6854 1.0100 0.5368 -0.1114 -0.0483 0.0002  296 CYS A N   
2192 C CA  . CYS A 295 ? 0.6780 0.9585 0.5504 -0.0953 -0.0429 -0.0064 296 CYS A CA  
2193 C C   . CYS A 295 ? 0.6844 0.9323 0.5629 -0.0935 -0.0455 0.0183  296 CYS A C   
2194 O O   . CYS A 295 ? 0.7055 0.9500 0.5829 -0.1001 -0.0568 0.0413  296 CYS A O   
2195 C CB  . CYS A 295 ? 0.6869 0.9542 0.5744 -0.0880 -0.0473 -0.0156 296 CYS A CB  
2196 S SG  . CYS A 295 ? 0.7003 0.9830 0.5935 -0.0819 -0.0426 -0.0527 296 CYS A SG  
2197 N N   . THR A 296 ? 0.6674 0.8914 0.5536 -0.0844 -0.0365 0.0126  297 THR A N   
2198 C CA  . THR A 296 ? 0.6792 0.8734 0.5715 -0.0817 -0.0382 0.0316  297 THR A CA  
2199 C C   . THR A 296 ? 0.6902 0.8519 0.6022 -0.0710 -0.0418 0.0359  297 THR A C   
2200 O O   . THR A 296 ? 0.7153 0.8688 0.6385 -0.0626 -0.0373 0.0205  297 THR A O   
2201 C CB  . THR A 296 ? 0.6703 0.8555 0.5618 -0.0771 -0.0273 0.0235  297 THR A CB  
2202 O OG1 . THR A 296 ? 0.7006 0.9200 0.5746 -0.0890 -0.0254 0.0240  297 THR A OG1 
2203 C CG2 . THR A 296 ? 0.6751 0.8272 0.5748 -0.0726 -0.0288 0.0392  297 THR A CG2 
2204 N N   . LEU A 297 ? 0.6996 0.8448 0.6171 -0.0719 -0.0509 0.0565  298 LEU A N   
2205 C CA  . LEU A 297 ? 0.6790 0.7961 0.6171 -0.0605 -0.0536 0.0591  298 LEU A CA  
2206 C C   . LEU A 297 ? 0.6789 0.7703 0.6240 -0.0519 -0.0460 0.0570  298 LEU A C   
2207 O O   . LEU A 297 ? 0.6955 0.7846 0.6318 -0.0564 -0.0455 0.0644  298 LEU A O   
2208 C CB  . LEU A 297 ? 0.6809 0.7946 0.6261 -0.0641 -0.0701 0.0794  298 LEU A CB  
2209 C CG  . LEU A 297 ? 0.6876 0.8282 0.6235 -0.0755 -0.0811 0.0873  298 LEU A CG  
2210 C CD1 . LEU A 297 ? 0.6935 0.8235 0.6411 -0.0771 -0.0994 0.1091  298 LEU A CD1 
2211 C CD2 . LEU A 297 ? 0.6834 0.8364 0.6233 -0.0718 -0.0765 0.0696  298 LEU A CD2 
2212 N N   . ALA A 298 ? 0.6637 0.7384 0.6244 -0.0405 -0.0403 0.0471  299 ALA A N   
2213 C CA  . ALA A 298 ? 0.6470 0.6997 0.6149 -0.0320 -0.0327 0.0433  299 ALA A CA  
2214 C C   . ALA A 298 ? 0.6659 0.7006 0.6468 -0.0267 -0.0413 0.0550  299 ALA A C   
2215 O O   . ALA A 298 ? 0.6608 0.6801 0.6540 -0.0170 -0.0365 0.0491  299 ALA A O   
2216 C CB  . ALA A 298 ? 0.6278 0.6756 0.6053 -0.0246 -0.0231 0.0283  299 ALA A CB  
2217 N N   . ILE A 299 ? 0.6958 0.7340 0.6748 -0.0336 -0.0552 0.0711  300 ILE A N   
2218 C CA  . ILE A 299 ? 0.7206 0.7404 0.7136 -0.0297 -0.0679 0.0832  300 ILE A CA  
2219 C C   . ILE A 299 ? 0.7597 0.7802 0.7389 -0.0421 -0.0767 0.1002  300 ILE A C   
2220 O O   . ILE A 299 ? 0.7814 0.8228 0.7458 -0.0552 -0.0816 0.1098  300 ILE A O   
2221 C CB  . ILE A 299 ? 0.7333 0.7551 0.7432 -0.0269 -0.0820 0.0900  300 ILE A CB  
2222 C CG1 . ILE A 299 ? 0.7167 0.7466 0.7376 -0.0188 -0.0732 0.0746  300 ILE A CG1 
2223 C CG2 . ILE A 299 ? 0.7363 0.7360 0.7674 -0.0187 -0.0956 0.0972  300 ILE A CG2 
2224 C CD1 . ILE A 299 ? 0.7132 0.7561 0.7429 -0.0209 -0.0851 0.0805  300 ILE A CD1 
2225 N N   . HIS A 300 ? 0.7983 0.7983 0.7824 -0.0390 -0.0788 0.1038  301 HIS A N   
2226 C CA  . HIS A 300 ? 0.8497 0.8491 0.8217 -0.0517 -0.0862 0.1200  301 HIS A CA  
2227 C C   . HIS A 300 ? 0.8627 0.8371 0.8517 -0.0503 -0.1057 0.1351  301 HIS A C   
2228 O O   . HIS A 300 ? 0.8334 0.7901 0.8449 -0.0362 -0.1108 0.1280  301 HIS A O   
2229 C CB  . HIS A 300 ? 0.8846 0.8830 0.8450 -0.0514 -0.0708 0.1097  301 HIS A CB  
2230 C CG  . HIS A 300 ? 0.9666 0.9917 0.9092 -0.0569 -0.0567 0.0990  301 HIS A CG  
2231 N ND1 . HIS A 300 ? 1.0005 1.0423 0.9261 -0.0680 -0.0519 0.1018  301 HIS A ND1 
2232 C CD2 . HIS A 300 ? 0.9862 1.0247 0.9277 -0.0525 -0.0475 0.0840  301 HIS A CD2 
2233 C CE1 . HIS A 300 ? 1.0078 1.0724 0.9238 -0.0686 -0.0404 0.0870  301 HIS A CE1 
2234 N NE2 . HIS A 300 ? 0.9981 1.0592 0.9235 -0.0595 -0.0382 0.0764  301 HIS A NE2 
2235 N N   . ALA A 301 ? 0.8931 0.8682 0.8729 -0.0654 -0.1177 0.1555  302 ALA A N   
2236 C CA  . ALA A 301 ? 0.9171 0.8644 0.9134 -0.0654 -0.1374 0.1700  302 ALA A CA  
2237 C C   . ALA A 301 ? 0.9240 0.8558 0.9186 -0.0621 -0.1290 0.1622  302 ALA A C   
2238 O O   . ALA A 301 ? 0.9120 0.8599 0.8863 -0.0718 -0.1167 0.1618  302 ALA A O   
2239 C CB  . ALA A 301 ? 0.9306 0.8864 0.9190 -0.0862 -0.1577 0.1998  302 ALA A CB  
2240 N N   . MET A 302 ? 0.9762 0.8791 0.9931 -0.0477 -0.1354 0.1538  303 MET A N   
2241 C CA  . MET A 302 ? 1.0541 0.9396 1.0719 -0.0444 -0.1310 0.1469  303 MET A CA  
2242 C C   . MET A 302 ? 1.0647 0.9179 1.1100 -0.0357 -0.1521 0.1494  303 MET A C   
2243 O O   . MET A 302 ? 1.0969 0.9405 1.1641 -0.0186 -0.1547 0.1346  303 MET A O   
2244 C CB  . MET A 302 ? 1.1143 1.0040 1.1284 -0.0307 -0.1073 0.1208  303 MET A CB  
2245 C CG  . MET A 302 ? 1.2194 1.1162 1.2142 -0.0375 -0.0930 0.1176  303 MET A CG  
2246 S SD  . MET A 302 ? 1.4003 1.3335 1.3703 -0.0475 -0.0760 0.1157  303 MET A SD  
2247 C CE  . MET A 302 ? 1.3757 1.3159 1.3287 -0.0573 -0.0668 0.1168  303 MET A CE  
2248 N N   . ASP A 303 ? 1.0807 0.9187 1.1267 -0.0477 -0.1683 0.1675  304 ASP A N   
2249 C CA  . ASP A 303 ? 1.0861 0.8899 1.1604 -0.0396 -0.1908 0.1687  304 ASP A CA  
2250 C C   . ASP A 303 ? 1.0902 0.8791 1.1681 -0.0288 -0.1808 0.1486  304 ASP A C   
2251 O O   . ASP A 303 ? 1.1393 0.9216 1.2077 -0.0399 -0.1827 0.1573  304 ASP A O   
2252 C CB  . ASP A 303 ? 1.0819 0.8738 1.1590 -0.0592 -0.2182 0.2010  304 ASP A CB  
2253 C CG  . ASP A 303 ? 1.0918 0.8919 1.1739 -0.0661 -0.2346 0.2198  304 ASP A CG  
2254 O OD1 . ASP A 303 ? 1.0647 0.8573 1.1692 -0.0492 -0.2403 0.2077  304 ASP A OD1 
2255 O OD2 . ASP A 303 ? 1.1054 0.9222 1.1693 -0.0891 -0.2421 0.2468  304 ASP A OD2 
2256 N N   . ILE A 304 ? 1.0844 0.8720 1.1752 -0.0080 -0.1695 0.1215  305 ILE A N   
2257 C CA  . ILE A 304 ? 1.0557 0.8326 1.1514 0.0043  -0.1598 0.0989  305 ILE A CA  
2258 C C   . ILE A 304 ? 1.0736 0.8170 1.1970 0.0096  -0.1860 0.0998  305 ILE A C   
2259 O O   . ILE A 304 ? 1.0387 0.7691 1.1887 0.0177  -0.2060 0.1008  305 ILE A O   
2260 C CB  . ILE A 304 ? 1.0476 0.8395 1.1481 0.0225  -0.1403 0.0715  305 ILE A CB  
2261 C CG1 . ILE A 304 ? 1.0058 0.8264 1.0793 0.0155  -0.1165 0.0716  305 ILE A CG1 
2262 C CG2 . ILE A 304 ? 1.0435 0.8266 1.1511 0.0355  -0.1329 0.0477  305 ILE A CG2 
2263 C CD1 . ILE A 304 ? 0.9847 0.8234 1.0647 0.0257  -0.1066 0.0593  305 ILE A CD1 
2264 N N   . PRO A 305 ? 1.0917 0.8206 1.2106 0.0048  -0.1879 0.0995  306 PRO A N   
2265 C CA  . PRO A 305 ? 1.1118 0.8064 1.2574 0.0077  -0.2153 0.1015  306 PRO A CA  
2266 C C   . PRO A 305 ? 1.1097 0.7914 1.2843 0.0329  -0.2186 0.0690  306 PRO A C   
2267 O O   . PRO A 305 ? 1.0633 0.7649 1.2307 0.0455  -0.1949 0.0444  306 PRO A O   
2268 C CB  . PRO A 305 ? 1.1125 0.8017 1.2404 -0.0064 -0.2120 0.1099  306 PRO A CB  
2269 C CG  . PRO A 305 ? 1.0629 0.7804 1.1631 -0.0050 -0.1793 0.0961  306 PRO A CG  
2270 C CD  . PRO A 305 ? 1.0587 0.8018 1.1494 -0.0041 -0.1665 0.0980  306 PRO A CD  
2271 N N   . PRO A 306 ? 1.1521 0.8025 1.3606 0.0398  -0.2489 0.0685  307 PRO A N   
2272 C CA  . PRO A 306 ? 1.1572 0.7937 1.3952 0.0629  -0.2552 0.0351  307 PRO A CA  
2273 C C   . PRO A 306 ? 1.1419 0.7833 1.3637 0.0657  -0.2361 0.0150  307 PRO A C   
2274 O O   . PRO A 306 ? 1.1126 0.7527 1.3099 0.0480  -0.2307 0.0323  307 PRO A O   
2275 C CB  . PRO A 306 ? 1.1903 0.7867 1.4613 0.0612  -0.2946 0.0476  307 PRO A CB  
2276 C CG  . PRO A 306 ? 1.2138 0.8104 1.4820 0.0456  -0.3088 0.0820  307 PRO A CG  
2277 C CD  . PRO A 306 ? 1.1833 0.8124 1.4072 0.0272  -0.2806 0.0988  307 PRO A CD  
2278 N N   . PRO A 307 ? 1.1332 0.7840 1.3678 0.0866  -0.2259 -0.0206 308 PRO A N   
2279 C CA  . PRO A 307 ? 1.1198 0.7771 1.3864 0.1084  -0.2320 -0.0443 308 PRO A CA  
2280 C C   . PRO A 307 ? 1.0821 0.7769 1.3360 0.1127  -0.2072 -0.0498 308 PRO A C   
2281 O O   . PRO A 307 ? 1.0606 0.7641 1.3412 0.1286  -0.2129 -0.0653 308 PRO A O   
2282 C CB  . PRO A 307 ? 1.1198 0.7752 1.4027 0.1264  -0.2308 -0.0814 308 PRO A CB  
2283 C CG  . PRO A 307 ? 1.1054 0.7705 1.3527 0.1148  -0.2091 -0.0799 308 PRO A CG  
2284 C CD  . PRO A 307 ? 1.1230 0.7818 1.3425 0.0900  -0.2082 -0.0413 308 PRO A CD  
2285 N N   . THR A 308 ? 1.0383 0.7547 1.2546 0.0990  -0.1817 -0.0380 309 THR A N   
2286 C CA  . THR A 308 ? 1.0279 0.7772 1.2300 0.0995  -0.1595 -0.0392 309 THR A CA  
2287 C C   . THR A 308 ? 1.0215 0.7690 1.2331 0.0946  -0.1733 -0.0182 309 THR A C   
2288 O O   . THR A 308 ? 0.9921 0.7583 1.2163 0.1047  -0.1688 -0.0282 309 THR A O   
2289 C CB  . THR A 308 ? 1.0250 0.7928 1.1873 0.0852  -0.1334 -0.0300 309 THR A CB  
2290 O OG1 . THR A 308 ? 1.0460 0.8121 1.1995 0.0875  -0.1246 -0.0453 309 THR A OG1 
2291 C CG2 . THR A 308 ? 1.0204 0.8212 1.1720 0.0879  -0.1109 -0.0370 309 THR A CG2 
2292 N N   . GLY A 309 ? 1.0277 0.7546 1.2335 0.0782  -0.1909 0.0111  310 GLY A N   
2293 C CA  . GLY A 309 ? 1.0229 0.7486 1.2337 0.0699  -0.2057 0.0352  310 GLY A CA  
2294 C C   . GLY A 309 ? 1.0521 0.7486 1.3001 0.0758  -0.2412 0.0418  310 GLY A C   
2295 O O   . GLY A 309 ? 1.0677 0.7407 1.3396 0.0863  -0.2565 0.0274  310 GLY A O   
2296 N N   . PRO A 310 ? 1.0568 0.7538 1.3116 0.0693  -0.2561 0.0630  311 PRO A N   
2297 C CA  . PRO A 310 ? 1.0275 0.7538 1.2556 0.0577  -0.2389 0.0772  311 PRO A CA  
2298 C C   . PRO A 310 ? 0.9803 0.7354 1.2112 0.0736  -0.2162 0.0513  311 PRO A C   
2299 O O   . PRO A 310 ? 0.9767 0.7310 1.2398 0.0934  -0.2232 0.0293  311 PRO A O   
2300 C CB  . PRO A 310 ? 1.0507 0.7658 1.2936 0.0492  -0.2676 0.1043  311 PRO A CB  
2301 C CG  . PRO A 310 ? 1.0940 0.7709 1.3615 0.0481  -0.2994 0.1139  311 PRO A CG  
2302 C CD  . PRO A 310 ? 1.0886 0.7555 1.3760 0.0695  -0.2939 0.0787  311 PRO A CD  
2303 N N   . THR A 311 ? 0.9253 0.7069 1.1240 0.0644  -0.1898 0.0535  312 THR A N   
2304 C CA  . THR A 311 ? 0.8777 0.6881 1.0748 0.0752  -0.1669 0.0325  312 THR A CA  
2305 C C   . THR A 311 ? 0.8538 0.6879 1.0221 0.0612  -0.1506 0.0459  312 THR A C   
2306 O O   . THR A 311 ? 0.8935 0.7273 1.0355 0.0442  -0.1477 0.0644  312 THR A O   
2307 C CB  . THR A 311 ? 0.8345 0.6523 1.0271 0.0853  -0.1468 0.0061  312 THR A CB  
2308 O OG1 . THR A 311 ? 0.7964 0.6445 0.9868 0.0924  -0.1256 -0.0104 312 THR A OG1 
2309 C CG2 . THR A 311 ? 0.8023 0.6158 0.9633 0.0714  -0.1344 0.0148  312 THR A CG2 
2310 N N   . TRP A 312 ? 0.8074 0.6639 0.9825 0.0687  -0.1407 0.0350  313 TRP A N   
2311 C CA  . TRP A 312 ? 0.7798 0.6599 0.9295 0.0584  -0.1221 0.0401  313 TRP A CA  
2312 C C   . TRP A 312 ? 0.7630 0.6528 0.8937 0.0587  -0.0976 0.0257  313 TRP A C   
2313 O O   . TRP A 312 ? 0.7880 0.6749 0.9294 0.0700  -0.0929 0.0076  313 TRP A O   
2314 C CB  . TRP A 312 ? 0.7737 0.6739 0.9391 0.0656  -0.1209 0.0335  313 TRP A CB  
2315 C CG  . TRP A 312 ? 0.7977 0.6918 0.9784 0.0631  -0.1445 0.0503  313 TRP A CG  
2316 C CD1 . TRP A 312 ? 0.8098 0.6854 1.0218 0.0727  -0.1691 0.0515  313 TRP A CD1 
2317 C CD2 . TRP A 312 ? 0.7931 0.7003 0.9601 0.0503  -0.1473 0.0677  313 TRP A CD2 
2318 N NE1 . TRP A 312 ? 0.8317 0.7072 1.0497 0.0657  -0.1878 0.0712  313 TRP A NE1 
2319 C CE2 . TRP A 312 ? 0.8147 0.7110 1.0042 0.0516  -0.1742 0.0814  313 TRP A CE2 
2320 C CE3 . TRP A 312 ? 0.7653 0.6926 0.9045 0.0380  -0.1312 0.0723  313 TRP A CE3 
2321 C CZ2 . TRP A 312 ? 0.8087 0.7156 0.9908 0.0398  -0.1844 0.1007  313 TRP A CZ2 
2322 C CZ3 . TRP A 312 ? 0.7686 0.7070 0.9013 0.0273  -0.1408 0.0888  313 TRP A CZ3 
2323 C CH2 . TRP A 312 ? 0.7985 0.7278 0.9512 0.0277  -0.1666 0.1033  313 TRP A CH2 
2324 N N   . ALA A 313 ? 0.7132 0.6150 0.8165 0.0462  -0.0835 0.0334  314 ALA A N   
2325 C CA  . ALA A 313 ? 0.6893 0.6018 0.7767 0.0461  -0.0617 0.0212  314 ALA A CA  
2326 C C   . ALA A 313 ? 0.6936 0.6285 0.7743 0.0431  -0.0492 0.0187  314 ALA A C   
2327 O O   . ALA A 313 ? 0.6862 0.6275 0.7566 0.0335  -0.0520 0.0307  314 ALA A O   
2328 C CB  . ALA A 313 ? 0.6632 0.5668 0.7270 0.0353  -0.0570 0.0295  314 ALA A CB  
2329 N N   . LEU A 314 ? 0.6584 0.6070 0.7462 0.0508  -0.0366 0.0029  315 LEU A N   
2330 C CA  . LEU A 314 ? 0.6399 0.6089 0.7234 0.0471  -0.0252 0.0003  315 LEU A CA  
2331 C C   . LEU A 314 ? 0.6222 0.5930 0.6842 0.0400  -0.0101 -0.0013 315 LEU A C   
2332 O O   . LEU A 314 ? 0.6318 0.6062 0.6933 0.0437  -0.0004 -0.0114 315 LEU A O   
2333 C CB  . LEU A 314 ? 0.6152 0.6025 0.7215 0.0575  -0.0222 -0.0134 315 LEU A CB  
2334 C CG  . LEU A 314 ? 0.6329 0.6206 0.7662 0.0670  -0.0382 -0.0146 315 LEU A CG  
2335 C CD1 . LEU A 314 ? 0.6286 0.6406 0.7845 0.0776  -0.0318 -0.0320 315 LEU A CD1 
2336 C CD2 . LEU A 314 ? 0.6262 0.6135 0.7582 0.0598  -0.0494 0.0007  315 LEU A CD2 
2337 N N   . GLY A 315 ? 0.6037 0.5734 0.6486 0.0297  -0.0093 0.0082  316 GLY A N   
2338 C CA  . GLY A 315 ? 0.5991 0.5683 0.6259 0.0233  0.0017  0.0071  316 GLY A CA  
2339 C C   . GLY A 315 ? 0.5902 0.5726 0.6141 0.0186  0.0095  0.0044  316 GLY A C   
2340 O O   . GLY A 315 ? 0.5792 0.5741 0.6160 0.0212  0.0108  0.0004  316 GLY A O   
2341 N N   . ALA A 316 ? 0.5952 0.5754 0.6043 0.0118  0.0135  0.0060  317 ALA A N   
2342 C CA  . ALA A 316 ? 0.6080 0.5961 0.6153 0.0070  0.0189  0.0027  317 ALA A CA  
2343 C C   . ALA A 316 ? 0.6125 0.6125 0.6283 0.0050  0.0140  0.0035  317 ALA A C   
2344 O O   . ALA A 316 ? 0.6259 0.6339 0.6486 0.0030  0.0173  0.0004  317 ALA A O   
2345 C CB  . ALA A 316 ? 0.6223 0.6054 0.6157 0.0018  0.0208  0.0023  317 ALA A CB  
2346 N N   . THR A 317 ? 0.5962 0.5980 0.6117 0.0044  0.0052  0.0090  318 THR A N   
2347 C CA  . THR A 317 ? 0.5918 0.6056 0.6157 0.0028  -0.0013 0.0108  318 THR A CA  
2348 C C   . THR A 317 ? 0.5911 0.6128 0.6343 0.0086  -0.0003 0.0074  318 THR A C   
2349 O O   . THR A 317 ? 0.5799 0.6133 0.6307 0.0060  0.0002  0.0050  318 THR A O   
2350 C CB  . THR A 317 ? 0.5928 0.6071 0.6136 0.0008  -0.0128 0.0203  318 THR A CB  
2351 O OG1 . THR A 317 ? 0.6080 0.6191 0.6111 -0.0050 -0.0125 0.0237  318 THR A OG1 
2352 C CG2 . THR A 317 ? 0.5711 0.5996 0.5959 -0.0031 -0.0200 0.0225  318 THR A CG2 
2353 N N   . PHE A 318 ? 0.5752 0.5925 0.6274 0.0165  -0.0002 0.0056  319 PHE A N   
2354 C CA  . PHE A 318 ? 0.5693 0.5992 0.6413 0.0233  0.0016  -0.0006 319 PHE A CA  
2355 C C   . PHE A 318 ? 0.5705 0.6103 0.6422 0.0205  0.0140  -0.0067 319 PHE A C   
2356 O O   . PHE A 318 ? 0.5669 0.6239 0.6500 0.0185  0.0165  -0.0090 319 PHE A O   
2357 C CB  . PHE A 318 ? 0.5615 0.5849 0.6455 0.0338  -0.0038 -0.0037 319 PHE A CB  
2358 C CG  . PHE A 318 ? 0.5573 0.5978 0.6661 0.0428  -0.0050 -0.0124 319 PHE A CG  
2359 C CD1 . PHE A 318 ? 0.5449 0.5910 0.6704 0.0462  -0.0171 -0.0092 319 PHE A CD1 
2360 C CD2 . PHE A 318 ? 0.5362 0.5907 0.6526 0.0474  0.0055  -0.0241 319 PHE A CD2 
2361 C CE1 . PHE A 318 ? 0.5438 0.6084 0.6953 0.0556  -0.0187 -0.0189 319 PHE A CE1 
2362 C CE2 . PHE A 318 ? 0.5424 0.6189 0.6835 0.0560  0.0052  -0.0345 319 PHE A CE2 
2363 C CZ  . PHE A 318 ? 0.5477 0.6289 0.7075 0.0608  -0.0069 -0.0326 319 PHE A CZ  
2364 N N   . ILE A 319 ? 0.5686 0.5984 0.6272 0.0191  0.0208  -0.0078 320 ILE A N   
2365 C CA  . ILE A 319 ? 0.5604 0.5983 0.6164 0.0149  0.0311  -0.0108 320 ILE A CA  
2366 C C   . ILE A 319 ? 0.5695 0.6119 0.6232 0.0047  0.0323  -0.0069 320 ILE A C   
2367 O O   . ILE A 319 ? 0.5992 0.6553 0.6582 -0.0003 0.0378  -0.0071 320 ILE A O   
2368 C CB  . ILE A 319 ? 0.5872 0.6113 0.6288 0.0154  0.0356  -0.0115 320 ILE A CB  
2369 C CG1 . ILE A 319 ? 0.6061 0.6274 0.6537 0.0255  0.0339  -0.0176 320 ILE A CG1 
2370 C CG2 . ILE A 319 ? 0.5897 0.6218 0.6265 0.0088  0.0444  -0.0116 320 ILE A CG2 
2371 C CD1 . ILE A 319 ? 0.6105 0.6117 0.6442 0.0262  0.0324  -0.0156 320 ILE A CD1 
2372 N N   . ARG A 320 ? 0.5633 0.5959 0.6099 0.0010  0.0264  -0.0039 321 ARG A N   
2373 C CA  . ARG A 320 ? 0.5671 0.6025 0.6152 -0.0074 0.0247  -0.0028 321 ARG A CA  
2374 C C   . ARG A 320 ? 0.5727 0.6273 0.6375 -0.0097 0.0239  -0.0027 321 ARG A C   
2375 O O   . ARG A 320 ? 0.5897 0.6512 0.6595 -0.0177 0.0259  -0.0008 321 ARG A O   
2376 C CB  . ARG A 320 ? 0.5495 0.5770 0.5894 -0.0093 0.0177  -0.0035 321 ARG A CB  
2377 C CG  . ARG A 320 ? 0.5466 0.5603 0.5736 -0.0116 0.0188  -0.0055 321 ARG A CG  
2378 C CD  . ARG A 320 ? 0.5432 0.5573 0.5655 -0.0143 0.0125  -0.0100 321 ARG A CD  
2379 N NE  . ARG A 320 ? 0.5342 0.5542 0.5504 -0.0122 0.0084  -0.0081 321 ARG A NE  
2380 C CZ  . ARG A 320 ? 0.5573 0.5731 0.5618 -0.0107 0.0087  -0.0061 321 ARG A CZ  
2381 N NH1 . ARG A 320 ? 0.5689 0.5744 0.5664 -0.0096 0.0137  -0.0076 321 ARG A NH1 
2382 N NH2 . ARG A 320 ? 0.5506 0.5734 0.5504 -0.0114 0.0030  -0.0012 321 ARG A NH2 
2383 N N   . LYS A 321 ? 0.5620 0.6256 0.6367 -0.0033 0.0197  -0.0038 322 LYS A N   
2384 C CA  . LYS A 321 ? 0.5673 0.6522 0.6604 -0.0042 0.0186  -0.0047 322 LYS A CA  
2385 C C   . LYS A 321 ? 0.5491 0.6529 0.6532 -0.0018 0.0273  -0.0084 322 LYS A C   
2386 O O   . LYS A 321 ? 0.5352 0.6600 0.6513 -0.0080 0.0302  -0.0079 322 LYS A O   
2387 C CB  . LYS A 321 ? 0.5621 0.6507 0.6639 0.0018  0.0091  -0.0044 322 LYS A CB  
2388 C CG  . LYS A 321 ? 0.5982 0.7097 0.7204 0.0007  0.0069  -0.0057 322 LYS A CG  
2389 C CD  . LYS A 321 ? 0.6338 0.7464 0.7584 -0.0015 -0.0040 -0.0027 322 LYS A CD  
2390 C CE  . LYS A 321 ? 0.6344 0.7713 0.7810 -0.0029 -0.0059 -0.0041 322 LYS A CE  
2391 N NZ  . LYS A 321 ? 0.7020 0.8416 0.8548 -0.0001 -0.0185 -0.0014 322 LYS A NZ  
2392 N N   . PHE A 322 ? 0.5294 0.6282 0.6295 0.0061  0.0311  -0.0125 323 PHE A N   
2393 C CA  . PHE A 322 ? 0.5350 0.6562 0.6459 0.0101  0.0391  -0.0196 323 PHE A CA  
2394 C C   . PHE A 322 ? 0.5429 0.6599 0.6395 0.0073  0.0476  -0.0202 323 PHE A C   
2395 O O   . PHE A 322 ? 0.5600 0.6582 0.6461 0.0133  0.0468  -0.0222 323 PHE A O   
2396 C CB  . PHE A 322 ? 0.5262 0.6539 0.6540 0.0245  0.0342  -0.0285 323 PHE A CB  
2397 C CG  . PHE A 322 ? 0.5221 0.6559 0.6656 0.0270  0.0245  -0.0269 323 PHE A CG  
2398 C CD1 . PHE A 322 ? 0.5260 0.6887 0.6869 0.0235  0.0267  -0.0289 323 PHE A CD1 
2399 C CD2 . PHE A 322 ? 0.5197 0.6327 0.6603 0.0313  0.0125  -0.0219 323 PHE A CD2 
2400 C CE1 . PHE A 322 ? 0.5252 0.6942 0.7012 0.0257  0.0168  -0.0272 323 PHE A CE1 
2401 C CE2 . PHE A 322 ? 0.5328 0.6525 0.6868 0.0325  0.0022  -0.0190 323 PHE A CE2 
2402 C CZ  . PHE A 322 ? 0.5255 0.6723 0.6976 0.0304  0.0043  -0.0223 323 PHE A CZ  
2403 N N   . TYR A 323 ? 0.5365 0.6720 0.6327 -0.0034 0.0548  -0.0169 324 TYR A N   
2404 C CA  . TYR A 323 ? 0.5395 0.6794 0.6238 -0.0080 0.0630  -0.0165 324 TYR A CA  
2405 C C   . TYR A 323 ? 0.5509 0.7041 0.6411 0.0046  0.0675  -0.0302 324 TYR A C   
2406 O O   . TYR A 323 ? 0.5684 0.7480 0.6775 0.0113  0.0690  -0.0400 324 TYR A O   
2407 C CB  . TYR A 323 ? 0.5292 0.6949 0.6165 -0.0231 0.0684  -0.0093 324 TYR A CB  
2408 C CG  . TYR A 323 ? 0.5369 0.7064 0.6093 -0.0321 0.0746  -0.0041 324 TYR A CG  
2409 C CD1 . TYR A 323 ? 0.5401 0.7379 0.6125 -0.0292 0.0840  -0.0131 324 TYR A CD1 
2410 C CD2 . TYR A 323 ? 0.5404 0.6870 0.6000 -0.0435 0.0700  0.0087  324 TYR A CD2 
2411 C CE1 . TYR A 323 ? 0.5438 0.7477 0.6009 -0.0389 0.0891  -0.0073 324 TYR A CE1 
2412 C CE2 . TYR A 323 ? 0.5472 0.6969 0.5937 -0.0526 0.0738  0.0155  324 TYR A CE2 
2413 C CZ  . TYR A 323 ? 0.5467 0.7256 0.5905 -0.0510 0.0836  0.0084  324 TYR A CZ  
2414 O OH  . TYR A 323 ? 0.5465 0.7311 0.5758 -0.0614 0.0868  0.0160  324 TYR A OH  
2415 N N   . THR A 324 ? 0.5492 0.6843 0.6252 0.0085  0.0686  -0.0323 325 THR A N   
2416 C CA  . THR A 324 ? 0.5544 0.6942 0.6360 0.0218  0.0698  -0.0467 325 THR A CA  
2417 C C   . THR A 324 ? 0.5616 0.7190 0.6328 0.0179  0.0796  -0.0517 325 THR A C   
2418 O O   . THR A 324 ? 0.5827 0.7256 0.6351 0.0091  0.0812  -0.0424 325 THR A O   
2419 C CB  . THR A 324 ? 0.5478 0.6517 0.6235 0.0305  0.0606  -0.0462 325 THR A CB  
2420 O OG1 . THR A 324 ? 0.5314 0.6230 0.6140 0.0316  0.0513  -0.0398 325 THR A OG1 
2421 C CG2 . THR A 324 ? 0.5602 0.6659 0.6468 0.0449  0.0582  -0.0615 325 THR A CG2 
2422 N N   . GLU A 325 ? 0.5668 0.7580 0.6515 0.0245  0.0855  -0.0673 326 GLU A N   
2423 C CA  . GLU A 325 ? 0.5987 0.8114 0.6739 0.0225  0.0946  -0.0757 326 GLU A CA  
2424 C C   . GLU A 325 ? 0.6075 0.8099 0.6889 0.0397  0.0908  -0.0942 326 GLU A C   
2425 O O   . GLU A 325 ? 0.6281 0.8340 0.7318 0.0541  0.0850  -0.1079 326 GLU A O   
2426 C CB  . GLU A 325 ? 0.6187 0.8850 0.7036 0.0159  0.1051  -0.0823 326 GLU A CB  
2427 C CG  . GLU A 325 ? 0.6566 0.9508 0.7269 0.0087  0.1152  -0.0873 326 GLU A CG  
2428 C CD  . GLU A 325 ? 0.6856 1.0411 0.7683 0.0059  0.1262  -0.1005 326 GLU A CD  
2429 O OE1 . GLU A 325 ? 0.7175 1.0940 0.8231 0.0223  0.1265  -0.1233 326 GLU A OE1 
2430 O OE2 . GLU A 325 ? 0.7095 1.0945 0.7803 -0.0132 0.1338  -0.0882 326 GLU A OE2 
2431 N N   . PHE A 326 ? 0.5947 0.7833 0.6579 0.0379  0.0923  -0.0942 327 PHE A N   
2432 C CA  . PHE A 326 ? 0.5874 0.7652 0.6553 0.0524  0.0880  -0.1115 327 PHE A CA  
2433 C C   . PHE A 326 ? 0.6153 0.8326 0.6814 0.0531  0.0982  -0.1293 327 PHE A C   
2434 O O   . PHE A 326 ? 0.6212 0.8443 0.6656 0.0416  0.1046  -0.1225 327 PHE A O   
2435 C CB  . PHE A 326 ? 0.5696 0.7039 0.6195 0.0504  0.0813  -0.1002 327 PHE A CB  
2436 C CG  . PHE A 326 ? 0.5453 0.6457 0.5967 0.0502  0.0713  -0.0856 327 PHE A CG  
2437 C CD1 . PHE A 326 ? 0.5352 0.6142 0.6014 0.0625  0.0593  -0.0909 327 PHE A CD1 
2438 C CD2 . PHE A 326 ? 0.5210 0.6119 0.5598 0.0372  0.0725  -0.0667 327 PHE A CD2 
2439 C CE1 . PHE A 326 ? 0.5385 0.5913 0.6039 0.0603  0.0502  -0.0763 327 PHE A CE1 
2440 C CE2 . PHE A 326 ? 0.5247 0.5897 0.5643 0.0370  0.0639  -0.0558 327 PHE A CE2 
2441 C CZ  . PHE A 326 ? 0.5201 0.5680 0.5714 0.0478  0.0534  -0.0600 327 PHE A CZ  
2442 N N   . ASP A 327 ? 0.6261 0.8730 0.7160 0.0665  0.0990  -0.1528 328 ASP A N   
2443 C CA  . ASP A 327 ? 0.6655 0.9598 0.7568 0.0683  0.1096  -0.1743 328 ASP A CA  
2444 C C   . ASP A 327 ? 0.6947 0.9768 0.7901 0.0835  0.1039  -0.1969 328 ASP A C   
2445 O O   . ASP A 327 ? 0.7205 0.9934 0.8420 0.1021  0.0938  -0.2157 328 ASP A O   
2446 C CB  . ASP A 327 ? 0.6666 1.0105 0.7835 0.0735  0.1154  -0.1900 328 ASP A CB  
2447 C CG  . ASP A 327 ? 0.7055 1.1111 0.8217 0.0714  0.1292  -0.2111 328 ASP A CG  
2448 O OD1 . ASP A 327 ? 0.7257 1.1350 0.8237 0.0688  0.1330  -0.2177 328 ASP A OD1 
2449 O OD2 . ASP A 327 ? 0.7327 1.1874 0.8671 0.0718  0.1365  -0.2221 328 ASP A OD2 
2450 N N   . ARG A 328 ? 0.6831 0.9656 0.7542 0.0752  0.1089  -0.1951 329 ARG A N   
2451 C CA  . ARG A 328 ? 0.7029 0.9778 0.7759 0.0877  0.1042  -0.2176 329 ARG A CA  
2452 C C   . ARG A 328 ? 0.7156 1.0456 0.8031 0.0976  0.1119  -0.2519 329 ARG A C   
2453 O O   . ARG A 328 ? 0.7348 1.0579 0.8406 0.1157  0.1034  -0.2785 329 ARG A O   
2454 C CB  . ARG A 328 ? 0.7121 0.9643 0.7546 0.0759  0.1049  -0.2032 329 ARG A CB  
2455 C CG  . ARG A 328 ? 0.7164 0.9097 0.7517 0.0742  0.0933  -0.1811 329 ARG A CG  
2456 C CD  . ARG A 328 ? 0.7597 0.9306 0.7727 0.0688  0.0912  -0.1760 329 ARG A CD  
2457 N NE  . ARG A 328 ? 0.8198 0.9932 0.8422 0.0825  0.0863  -0.2034 329 ARG A NE  
2458 C CZ  . ARG A 328 ? 0.8564 0.9973 0.8715 0.0850  0.0776  -0.2043 329 ARG A CZ  
2459 N NH1 . ARG A 328 ? 0.8738 1.0196 0.9005 0.0979  0.0723  -0.2318 329 ARG A NH1 
2460 N NH2 . ARG A 328 ? 0.8501 0.9551 0.8484 0.0750  0.0736  -0.1793 329 ARG A NH2 
2461 N N   . ARG A 329 ? 0.7053 1.0909 0.7859 0.0853  0.1270  -0.2519 330 ARG A N   
2462 C CA  . ARG A 329 ? 0.7212 1.1702 0.8141 0.0926  0.1367  -0.2855 330 ARG A CA  
2463 C C   . ARG A 329 ? 0.7106 1.1721 0.8449 0.1156  0.1301  -0.3137 330 ARG A C   
2464 O O   . ARG A 329 ? 0.7214 1.2083 0.8744 0.1326  0.1289  -0.3499 330 ARG A O   
2465 C CB  . ARG A 329 ? 0.7277 1.2381 0.8039 0.0711  0.1541  -0.2756 330 ARG A CB  
2466 C CG  . ARG A 329 ? 0.7332 1.3119 0.8092 0.0730  0.1660  -0.3075 330 ARG A CG  
2467 C CD  . ARG A 329 ? 0.7434 1.3917 0.8104 0.0523  0.1825  -0.2990 330 ARG A CD  
2468 N N   . ASN A 330 ? 0.6902 1.1334 0.8397 0.1165  0.1246  -0.2979 331 ASN A N   
2469 C CA  . ASN A 330 ? 0.6868 1.1409 0.8771 0.1370  0.1168  -0.3204 331 ASN A CA  
2470 C C   . ASN A 330 ? 0.6889 1.0776 0.8974 0.1515  0.0953  -0.3141 331 ASN A C   
2471 O O   . ASN A 330 ? 0.6826 1.0731 0.9248 0.1667  0.0859  -0.3260 331 ASN A O   
2472 C CB  . ASN A 330 ? 0.6741 1.1722 0.8734 0.1274  0.1270  -0.3117 331 ASN A CB  
2473 C CG  . ASN A 330 ? 0.6776 1.2491 0.8639 0.1129  0.1471  -0.3198 331 ASN A CG  
2474 O OD1 . ASN A 330 ? 0.6797 1.2658 0.8437 0.0894  0.1568  -0.2921 331 ASN A OD1 
2475 N ND2 . ASN A 330 ? 0.6702 1.2900 0.8714 0.1262  0.1525  -0.3581 331 ASN A ND2 
2476 N N   . ASN A 331 ? 0.6969 1.0309 0.8834 0.1458  0.0872  -0.2947 332 ASN A N   
2477 C CA  . ASN A 331 ? 0.7124 0.9841 0.9102 0.1550  0.0667  -0.2839 332 ASN A CA  
2478 C C   . ASN A 331 ? 0.6956 0.9532 0.9119 0.1570  0.0582  -0.2688 332 ASN A C   
2479 O O   . ASN A 331 ? 0.6950 0.9323 0.9416 0.1733  0.0410  -0.2786 332 ASN A O   
2480 C CB  . ASN A 331 ? 0.7550 1.0107 0.9764 0.1759  0.0518  -0.3135 332 ASN A CB  
2481 C CG  . ASN A 331 ? 0.7881 1.0377 0.9857 0.1714  0.0556  -0.3200 332 ASN A CG  
2482 O OD1 . ASN A 331 ? 0.8002 1.0109 0.9714 0.1591  0.0533  -0.2952 332 ASN A OD1 
2483 N ND2 . ASN A 331 ? 0.8045 1.0956 1.0120 0.1816  0.0614  -0.3548 332 ASN A ND2 
2484 N N   . ARG A 332 ? 0.6722 0.9403 0.8703 0.1393  0.0689  -0.2442 333 ARG A N   
2485 C CA  . ARG A 332 ? 0.6547 0.9170 0.8659 0.1376  0.0637  -0.2288 333 ARG A CA  
2486 C C   . ARG A 332 ? 0.6497 0.8838 0.8311 0.1179  0.0664  -0.1942 333 ARG A C   
2487 O O   . ARG A 332 ? 0.6644 0.8888 0.8168 0.1054  0.0734  -0.1827 333 ARG A O   
2488 C CB  . ARG A 332 ? 0.6373 0.9589 0.8666 0.1381  0.0752  -0.2421 333 ARG A CB  
2489 C CG  . ARG A 332 ? 0.6461 1.0190 0.8594 0.1281  0.0945  -0.2525 333 ARG A CG  
2490 C CD  . ARG A 332 ? 0.6209 1.0342 0.8253 0.1094  0.1087  -0.2373 333 ARG A CD  
2491 N NE  . ARG A 332 ? 0.6067 1.0712 0.8430 0.1178  0.1125  -0.2564 333 ARG A NE  
2492 C CZ  . ARG A 332 ? 0.5831 1.1050 0.8174 0.1039  0.1278  -0.2553 333 ARG A CZ  
2493 N NH1 . ARG A 332 ? 0.5703 1.1038 0.7723 0.0803  0.1394  -0.2347 333 ARG A NH1 
2494 N NH2 . ARG A 332 ? 0.5598 1.1285 0.8260 0.1128  0.1303  -0.2740 333 ARG A NH2 
2495 N N   . ILE A 333 ? 0.6388 0.8603 0.8292 0.1160  0.0594  -0.1792 334 ILE A N   
2496 C CA  . ILE A 333 ? 0.6032 0.8060 0.7706 0.0985  0.0619  -0.1505 334 ILE A CA  
2497 C C   . ILE A 333 ? 0.5979 0.8341 0.7778 0.0930  0.0674  -0.1470 334 ILE A C   
2498 O O   . ILE A 333 ? 0.5990 0.8489 0.8076 0.1050  0.0607  -0.1586 334 ILE A O   
2499 C CB  . ILE A 333 ? 0.6023 0.7544 0.7658 0.0998  0.0462  -0.1341 334 ILE A CB  
2500 C CG1 . ILE A 333 ? 0.6014 0.7224 0.7493 0.1011  0.0421  -0.1341 334 ILE A CG1 
2501 C CG2 . ILE A 333 ? 0.5923 0.7322 0.7384 0.0841  0.0480  -0.1093 334 ILE A CG2 
2502 C CD1 . ILE A 333 ? 0.5993 0.6780 0.7526 0.1066  0.0240  -0.1254 334 ILE A CD1 
2503 N N   . GLY A 334 ? 0.6009 0.8500 0.7610 0.0746  0.0784  -0.1311 335 GLY A N   
2504 C CA  . GLY A 334 ? 0.5984 0.8748 0.7674 0.0654  0.0826  -0.1233 335 GLY A CA  
2505 C C   . GLY A 334 ? 0.5891 0.8324 0.7466 0.0551  0.0756  -0.0999 335 GLY A C   
2506 O O   . GLY A 334 ? 0.6045 0.8172 0.7384 0.0467  0.0748  -0.0860 335 GLY A O   
2507 N N   . PHE A 335 ? 0.5815 0.8332 0.7572 0.0565  0.0702  -0.0972 336 PHE A N   
2508 C CA  . PHE A 335 ? 0.5669 0.7953 0.7338 0.0461  0.0640  -0.0777 336 PHE A CA  
2509 C C   . PHE A 335 ? 0.5393 0.7998 0.7139 0.0336  0.0697  -0.0716 336 PHE A C   
2510 O O   . PHE A 335 ? 0.5383 0.8359 0.7360 0.0386  0.0724  -0.0830 336 PHE A O   
2511 C CB  . PHE A 335 ? 0.5798 0.7827 0.7592 0.0571  0.0487  -0.0765 336 PHE A CB  
2512 C CG  . PHE A 335 ? 0.5941 0.7600 0.7640 0.0652  0.0404  -0.0764 336 PHE A CG  
2513 C CD1 . PHE A 335 ? 0.5985 0.7348 0.7413 0.0560  0.0410  -0.0634 336 PHE A CD1 
2514 C CD2 . PHE A 335 ? 0.6032 0.7641 0.7936 0.0819  0.0302  -0.0893 336 PHE A CD2 
2515 C CE1 . PHE A 335 ? 0.6124 0.7179 0.7473 0.0619  0.0332  -0.0623 336 PHE A CE1 
2516 C CE2 . PHE A 335 ? 0.6019 0.7280 0.7849 0.0874  0.0207  -0.0872 336 PHE A CE2 
2517 C CZ  . PHE A 335 ? 0.6171 0.7169 0.7715 0.0767  0.0228  -0.0731 336 PHE A CZ  
2518 N N   . ALA A 336 ? 0.5260 0.7729 0.6831 0.0173  0.0705  -0.0543 337 ALA A N   
2519 C CA  . ALA A 336 ? 0.5462 0.8142 0.7106 0.0036  0.0718  -0.0450 337 ALA A CA  
2520 C C   . ALA A 336 ? 0.5324 0.7658 0.6861 -0.0040 0.0623  -0.0304 337 ALA A C   
2521 O O   . ALA A 336 ? 0.5496 0.7482 0.6856 -0.0025 0.0584  -0.0260 337 ALA A O   
2522 C CB  . ALA A 336 ? 0.5412 0.8392 0.6981 -0.0123 0.0831  -0.0398 337 ALA A CB  
2523 N N   . LEU A 337 ? 0.5176 0.7634 0.6833 -0.0117 0.0585  -0.0247 338 LEU A N   
2524 C CA  . LEU A 337 ? 0.5232 0.7422 0.6813 -0.0196 0.0493  -0.0137 338 LEU A CA  
2525 C C   . LEU A 337 ? 0.5186 0.7188 0.6573 -0.0333 0.0507  -0.0029 338 LEU A C   
2526 O O   . LEU A 337 ? 0.5411 0.7604 0.6806 -0.0467 0.0559  0.0036  338 LEU A O   
2527 C CB  . LEU A 337 ? 0.5243 0.7661 0.7011 -0.0270 0.0455  -0.0108 338 LEU A CB  
2528 C CG  . LEU A 337 ? 0.5389 0.7671 0.7221 -0.0244 0.0333  -0.0093 338 LEU A CG  
2529 C CD1 . LEU A 337 ? 0.5277 0.7761 0.7242 -0.0382 0.0308  -0.0032 338 LEU A CD1 
2530 C CD2 . LEU A 337 ? 0.5313 0.7202 0.6945 -0.0242 0.0259  -0.0050 338 LEU A CD2 
2531 N N   . ALA A 338 ? 0.5115 0.6762 0.6342 -0.0305 0.0453  -0.0007 339 ALA A N   
2532 C CA  . ALA A 338 ? 0.5209 0.6649 0.6285 -0.0412 0.0441  0.0078  339 ALA A CA  
2533 C C   . ALA A 338 ? 0.5364 0.6778 0.6504 -0.0548 0.0365  0.0157  339 ALA A C   
2534 O O   . ALA A 338 ? 0.5278 0.6739 0.6529 -0.0539 0.0306  0.0136  339 ALA A O   
2535 C CB  . ALA A 338 ? 0.5074 0.6189 0.5989 -0.0333 0.0406  0.0054  339 ALA A CB  
2536 N N   . ARG A 339 ? 0.5679 0.7009 0.6761 -0.0676 0.0352  0.0251  340 ARG A N   
2537 C CA  . ARG A 339 ? 0.5963 0.7216 0.7122 -0.0813 0.0252  0.0329  340 ARG A CA  
2538 C C   . ARG A 339 ? 0.6241 0.7169 0.7301 -0.0863 0.0174  0.0375  340 ARG A C   
2539 O O   . ARG A 339 ? 0.6402 0.7249 0.7344 -0.0859 0.0214  0.0406  340 ARG A O   
2540 C CB  . ARG A 339 ? 0.5929 0.7502 0.7220 -0.0967 0.0278  0.0427  340 ARG A CB  
2541 C CG  . ARG A 339 ? 0.6009 0.7663 0.7232 -0.1103 0.0316  0.0551  340 ARG A CG  
2542 C CD  . ARG A 339 ? 0.6237 0.8345 0.7565 -0.1227 0.0394  0.0619  340 ARG A CD  
2543 N NE  . ARG A 339 ? 0.6905 0.9103 0.8395 -0.1388 0.0306  0.0720  340 ARG A NE  
2544 C CZ  . ARG A 339 ? 0.7371 0.9980 0.8978 -0.1538 0.0351  0.0806  340 ARG A CZ  
2545 N NH1 . ARG A 339 ? 0.7726 1.0733 0.9305 -0.1544 0.0492  0.0786  340 ARG A NH1 
2546 N NH2 . ARG A 339 ? 0.7287 0.9935 0.9048 -0.1688 0.0251  0.0902  340 ARG A NH2 
2547 N N   . LEU B 2   ? 0.8841 0.8803 0.9418 0.0576  0.2014  -0.0279 3   LEU B N   
2548 C CA  . LEU B 2   ? 0.9384 0.9245 0.9496 0.0593  0.1860  -0.0268 3   LEU B CA  
2549 C C   . LEU B 2   ? 0.9855 0.9601 0.9579 0.0658  0.1870  -0.0399 3   LEU B C   
2550 O O   . LEU B 2   ? 1.0072 0.9723 0.9592 0.0707  0.2081  -0.0445 3   LEU B O   
2551 C CB  . LEU B 2   ? 0.9539 0.9323 0.9387 0.0588  0.1928  -0.0131 3   LEU B CB  
2552 C CG  . LEU B 2   ? 0.9280 0.9114 0.9211 0.0535  0.1762  -0.0022 3   LEU B CG  
2553 C CD1 . LEU B 2   ? 0.8832 0.8827 0.9292 0.0455  0.1682  -0.0010 3   LEU B CD1 
2554 C CD2 . LEU B 2   ? 0.9318 0.9021 0.8986 0.0546  0.1899  0.0109  3   LEU B CD2 
2555 N N   . GLY B 3   ? 0.9768 0.9527 0.9400 0.0648  0.1647  -0.0470 4   GLY B N   
2556 C CA  . GLY B 3   ? 0.9804 0.9480 0.9089 0.0686  0.1607  -0.0623 4   GLY B CA  
2557 C C   . GLY B 3   ? 1.0080 0.9789 0.9091 0.0678  0.1376  -0.0634 4   GLY B C   
2558 O O   . GLY B 3   ? 0.9552 0.9282 0.8392 0.0695  0.1327  -0.0509 4   GLY B O   
2559 N N   . ASN B 4   ? 1.0318 1.0033 0.9325 0.0651  0.1240  -0.0788 5   ASN B N   
2560 C CA  . ASN B 4   ? 1.0479 1.0242 0.9187 0.0649  0.1046  -0.0866 5   ASN B CA  
2561 C C   . ASN B 4   ? 0.9896 0.9774 0.8868 0.0569  0.0830  -0.0863 5   ASN B C   
2562 O O   . ASN B 4   ? 0.9769 0.9741 0.8562 0.0567  0.0663  -0.0890 5   ASN B O   
2563 C CB  . ASN B 4   ? 1.1334 1.1017 0.9787 0.0664  0.1070  -0.1087 5   ASN B CB  
2564 C CG  . ASN B 4   ? 1.2203 1.1929 1.0160 0.0714  0.0946  -0.1161 5   ASN B CG  
2565 O OD1 . ASN B 4   ? 1.2685 1.2353 1.0366 0.0730  0.0958  -0.1349 5   ASN B OD1 
2566 N ND2 . ASN B 4   ? 1.2135 1.1965 0.9974 0.0747  0.0822  -0.1023 5   ASN B ND2 
2567 N N   . THR B 5   ? 0.9142 0.9020 0.8532 0.0512  0.0838  -0.0825 6   THR B N   
2568 C CA  . THR B 5   ? 0.8788 0.8721 0.8407 0.0431  0.0672  -0.0857 6   THR B CA  
2569 C C   . THR B 5   ? 0.8393 0.8416 0.8246 0.0395  0.0587  -0.0693 6   THR B C   
2570 O O   . THR B 5   ? 0.8277 0.8312 0.8239 0.0418  0.0665  -0.0556 6   THR B O   
2571 C CB  . THR B 5   ? 0.9004 0.8827 0.8873 0.0392  0.0718  -0.0968 6   THR B CB  
2572 O OG1 . THR B 5   ? 0.8893 0.8686 0.9059 0.0420  0.0828  -0.0859 6   THR B OG1 
2573 C CG2 . THR B 5   ? 0.9525 0.9236 0.9166 0.0415  0.0802  -0.1167 6   THR B CG2 
2574 N N   . THR B 6   ? 0.7953 0.8044 0.7880 0.0330  0.0432  -0.0723 7   THR B N   
2575 C CA  . THR B 6   ? 0.7125 0.7270 0.7302 0.0280  0.0356  -0.0605 7   THR B CA  
2576 C C   . THR B 6   ? 0.6959 0.7037 0.7365 0.0207  0.0319  -0.0675 7   THR B C   
2577 O O   . THR B 6   ? 0.7152 0.7152 0.7516 0.0184  0.0335  -0.0829 7   THR B O   
2578 C CB  . THR B 6   ? 0.6838 0.7114 0.6906 0.0274  0.0231  -0.0550 7   THR B CB  
2579 O OG1 . THR B 6   ? 0.6881 0.7229 0.6825 0.0248  0.0126  -0.0695 7   THR B OG1 
2580 C CG2 . THR B 6   ? 0.6971 0.7263 0.6820 0.0357  0.0285  -0.0444 7   THR B CG2 
2581 N N   . SER B 7   ? 0.6684 0.6767 0.7311 0.0173  0.0281  -0.0563 8   SER B N   
2582 C CA  . SER B 7   ? 0.6624 0.6613 0.7438 0.0111  0.0254  -0.0590 8   SER B CA  
2583 C C   . SER B 7   ? 0.6303 0.6361 0.7206 0.0058  0.0163  -0.0486 8   SER B C   
2584 O O   . SER B 7   ? 0.6054 0.6160 0.7017 0.0084  0.0155  -0.0353 8   SER B O   
2585 C CB  . SER B 7   ? 0.6743 0.6606 0.7745 0.0158  0.0345  -0.0551 8   SER B CB  
2586 O OG  . SER B 7   ? 0.7293 0.7004 0.8416 0.0115  0.0344  -0.0597 8   SER B OG  
2587 N N   . SER B 8   ? 0.6350 0.6417 0.7267 -0.0023 0.0103  -0.0560 9   SER B N   
2588 C CA  . SER B 8   ? 0.6219 0.6345 0.7212 -0.0079 0.0038  -0.0478 9   SER B CA  
2589 C C   . SER B 8   ? 0.6177 0.6140 0.7325 -0.0138 0.0065  -0.0453 9   SER B C   
2590 O O   . SER B 8   ? 0.6399 0.6218 0.7594 -0.0167 0.0117  -0.0550 9   SER B O   
2591 C CB  . SER B 8   ? 0.6282 0.6573 0.7200 -0.0126 -0.0041 -0.0568 9   SER B CB  
2592 O OG  . SER B 8   ? 0.6482 0.6734 0.7449 -0.0207 -0.0042 -0.0730 9   SER B OG  
2593 N N   . VAL B 9   ? 0.5985 0.5948 0.7189 -0.0150 0.0040  -0.0319 10  VAL B N   
2594 C CA  . VAL B 9   ? 0.5880 0.5673 0.7177 -0.0199 0.0069  -0.0266 10  VAL B CA  
2595 C C   . VAL B 9   ? 0.5738 0.5615 0.7032 -0.0279 0.0034  -0.0234 10  VAL B C   
2596 O O   . VAL B 9   ? 0.5701 0.5700 0.6946 -0.0252 -0.0010 -0.0150 10  VAL B O   
2597 C CB  . VAL B 9   ? 0.5906 0.5594 0.7252 -0.0116 0.0078  -0.0120 10  VAL B CB  
2598 C CG1 . VAL B 9   ? 0.5951 0.5438 0.7334 -0.0146 0.0105  -0.0039 10  VAL B CG1 
2599 C CG2 . VAL B 9   ? 0.5931 0.5561 0.7327 -0.0030 0.0127  -0.0158 10  VAL B CG2 
2600 N N   . ILE B 10  ? 0.5791 0.5601 0.7152 -0.0382 0.0070  -0.0316 11  ILE B N   
2601 C CA  . ILE B 10  ? 0.5753 0.5632 0.7153 -0.0472 0.0071  -0.0300 11  ILE B CA  
2602 C C   . ILE B 10  ? 0.5849 0.5570 0.7212 -0.0456 0.0103  -0.0126 11  ILE B C   
2603 O O   . ILE B 10  ? 0.6111 0.5602 0.7474 -0.0430 0.0152  -0.0061 11  ILE B O   
2604 C CB  . ILE B 10  ? 0.5856 0.5699 0.7379 -0.0606 0.0123  -0.0449 11  ILE B CB  
2605 C CG1 . ILE B 10  ? 0.6086 0.6075 0.7623 -0.0621 0.0075  -0.0647 11  ILE B CG1 
2606 C CG2 . ILE B 10  ? 0.5676 0.5616 0.7278 -0.0703 0.0145  -0.0436 11  ILE B CG2 
2607 C CD1 . ILE B 10  ? 0.6190 0.6499 0.7688 -0.0590 -0.0030 -0.0705 11  ILE B CD1 
2608 N N   . LEU B 11  ? 0.5592 0.5433 0.6909 -0.0461 0.0075  -0.0054 12  LEU B N   
2609 C CA  . LEU B 11  ? 0.5551 0.5267 0.6782 -0.0443 0.0093  0.0099  12  LEU B CA  
2610 C C   . LEU B 11  ? 0.5717 0.5378 0.6964 -0.0549 0.0173  0.0109  12  LEU B C   
2611 O O   . LEU B 11  ? 0.5585 0.5417 0.6926 -0.0624 0.0185  0.0008  12  LEU B O   
2612 C CB  . LEU B 11  ? 0.5384 0.5241 0.6527 -0.0370 0.0018  0.0173  12  LEU B CB  
2613 C CG  . LEU B 11  ? 0.5309 0.5250 0.6453 -0.0279 -0.0040 0.0162  12  LEU B CG  
2614 C CD1 . LEU B 11  ? 0.4953 0.5011 0.6026 -0.0239 -0.0090 0.0223  12  LEU B CD1 
2615 C CD2 . LEU B 11  ? 0.5342 0.5132 0.6517 -0.0213 -0.0035 0.0208  12  LEU B CD2 
2616 N N   . THR B 12  ? 0.5876 0.5299 0.7033 -0.0549 0.0233  0.0233  13  THR B N   
2617 C CA  . THR B 12  ? 0.5825 0.5156 0.6939 -0.0636 0.0332  0.0284  13  THR B CA  
2618 C C   . THR B 12  ? 0.5773 0.5202 0.6735 -0.0591 0.0287  0.0377  13  THR B C   
2619 O O   . THR B 12  ? 0.5624 0.5016 0.6455 -0.0491 0.0207  0.0472  13  THR B O   
2620 C CB  . THR B 12  ? 0.6081 0.5060 0.7117 -0.0644 0.0433  0.0390  13  THR B CB  
2621 O OG1 . THR B 12  ? 0.6195 0.5069 0.7389 -0.0701 0.0492  0.0279  13  THR B OG1 
2622 C CG2 . THR B 12  ? 0.6092 0.4938 0.7038 -0.0733 0.0564  0.0467  13  THR B CG2 
2623 N N   . ASN B 13  ? 0.5833 0.5402 0.6836 -0.0664 0.0338  0.0330  14  ASN B N   
2624 C CA  . ASN B 13  ? 0.5761 0.5379 0.6612 -0.0641 0.0336  0.0404  14  ASN B CA  
2625 C C   . ASN B 13  ? 0.6327 0.5710 0.7031 -0.0697 0.0467  0.0507  14  ASN B C   
2626 O O   . ASN B 13  ? 0.6332 0.5707 0.7147 -0.0808 0.0601  0.0458  14  ASN B O   
2627 C CB  . ASN B 13  ? 0.5567 0.5461 0.6549 -0.0671 0.0334  0.0298  14  ASN B CB  
2628 C CG  . ASN B 13  ? 0.5570 0.5501 0.6404 -0.0649 0.0354  0.0354  14  ASN B CG  
2629 O OD1 . ASN B 13  ? 0.5828 0.5579 0.6440 -0.0633 0.0379  0.0464  14  ASN B OD1 
2630 N ND2 . ASN B 13  ? 0.5211 0.5372 0.6154 -0.0639 0.0340  0.0275  14  ASN B ND2 
2631 N N   . TYR B 14  ? 0.6385 0.5585 0.6842 -0.0618 0.0430  0.0647  15  TYR B N   
2632 C CA  . TYR B 14  ? 0.6800 0.5774 0.7022 -0.0642 0.0542  0.0769  15  TYR B CA  
2633 C C   . TYR B 14  ? 0.6856 0.5935 0.6900 -0.0623 0.0523  0.0786  15  TYR B C   
2634 O O   . TYR B 14  ? 0.6981 0.6116 0.6894 -0.0533 0.0387  0.0816  15  TYR B O   
2635 C CB  . TYR B 14  ? 0.7060 0.5750 0.7082 -0.0553 0.0511  0.0919  15  TYR B CB  
2636 C CG  . TYR B 14  ? 0.7418 0.5844 0.7115 -0.0548 0.0613  0.1072  15  TYR B CG  
2637 C CD1 . TYR B 14  ? 0.7686 0.5862 0.7362 -0.0642 0.0816  0.1120  15  TYR B CD1 
2638 C CD2 . TYR B 14  ? 0.7509 0.5923 0.6904 -0.0453 0.0510  0.1167  15  TYR B CD2 
2639 C CE1 . TYR B 14  ? 0.8145 0.6044 0.7476 -0.0631 0.0930  0.1279  15  TYR B CE1 
2640 C CE2 . TYR B 14  ? 0.7985 0.6145 0.7023 -0.0437 0.0598  0.1311  15  TYR B CE2 
2641 C CZ  . TYR B 14  ? 0.8301 0.6192 0.7292 -0.0519 0.0815  0.1378  15  TYR B CZ  
2642 O OH  . TYR B 14  ? 0.8754 0.6362 0.7347 -0.0496 0.0921  0.1538  15  TYR B OH  
2643 N N   . MET B 15  ? 0.6973 0.6094 0.7048 -0.0715 0.0668  0.0747  16  MET B N   
2644 C CA  . MET B 15  ? 0.6988 0.6143 0.6866 -0.0712 0.0711  0.0766  16  MET B CA  
2645 C C   . MET B 15  ? 0.6734 0.6117 0.6634 -0.0649 0.0582  0.0691  16  MET B C   
2646 O O   . MET B 15  ? 0.6917 0.6279 0.6594 -0.0625 0.0587  0.0714  16  MET B O   
2647 C CB  . MET B 15  ? 0.7496 0.6370 0.6973 -0.0664 0.0730  0.0923  16  MET B CB  
2648 C CG  . MET B 15  ? 0.8120 0.6719 0.7489 -0.0735 0.0928  0.1018  16  MET B CG  
2649 S SD  . MET B 15  ? 0.8992 0.7319 0.7811 -0.0669 0.0966  0.1187  16  MET B SD  
2650 C CE  . MET B 15  ? 0.9389 0.7364 0.8130 -0.0765 0.1239  0.1303  16  MET B CE  
2651 N N   . ASP B 16  ? 0.6251 0.5828 0.6397 -0.0624 0.0479  0.0601  17  ASP B N   
2652 C CA  . ASP B 16  ? 0.6084 0.5827 0.6246 -0.0556 0.0359  0.0549  17  ASP B CA  
2653 C C   . ASP B 16  ? 0.6127 0.5782 0.6079 -0.0483 0.0232  0.0617  17  ASP B C   
2654 O O   . ASP B 16  ? 0.5934 0.5697 0.5889 -0.0443 0.0150  0.0573  17  ASP B O   
2655 C CB  . ASP B 16  ? 0.6284 0.6149 0.6453 -0.0571 0.0434  0.0488  17  ASP B CB  
2656 C CG  . ASP B 16  ? 0.6340 0.6436 0.6816 -0.0588 0.0463  0.0381  17  ASP B CG  
2657 O OD1 . ASP B 16  ? 0.6240 0.6400 0.6909 -0.0609 0.0433  0.0342  17  ASP B OD1 
2658 O OD2 . ASP B 16  ? 0.6492 0.6709 0.7011 -0.0572 0.0511  0.0330  17  ASP B OD2 
2659 N N   . THR B 17  ? 0.6479 0.5942 0.6264 -0.0463 0.0217  0.0721  18  THR B N   
2660 C CA  . THR B 17  ? 0.6811 0.6225 0.6417 -0.0385 0.0077  0.0783  18  THR B CA  
2661 C C   . THR B 17  ? 0.6698 0.6104 0.6434 -0.0321 -0.0025 0.0815  18  THR B C   
2662 O O   . THR B 17  ? 0.6952 0.6425 0.6674 -0.0256 -0.0160 0.0821  18  THR B O   
2663 C CB  . THR B 17  ? 0.7236 0.6449 0.6484 -0.0369 0.0103  0.0892  18  THR B CB  
2664 O OG1 . THR B 17  ? 0.7502 0.6505 0.6699 -0.0386 0.0212  0.0988  18  THR B OG1 
2665 C CG2 . THR B 17  ? 0.7394 0.6620 0.6478 -0.0419 0.0198  0.0848  18  THR B CG2 
2666 N N   . GLN B 18  ? 0.6464 0.5791 0.6342 -0.0343 0.0045  0.0824  19  GLN B N   
2667 C CA  . GLN B 18  ? 0.6376 0.5662 0.6373 -0.0277 -0.0025 0.0850  19  GLN B CA  
2668 C C   . GLN B 18  ? 0.6260 0.5632 0.6527 -0.0321 0.0022  0.0746  19  GLN B C   
2669 O O   . GLN B 18  ? 0.6484 0.5807 0.6822 -0.0404 0.0139  0.0709  19  GLN B O   
2670 C CB  . GLN B 18  ? 0.6641 0.5655 0.6470 -0.0234 0.0009  0.0988  19  GLN B CB  
2671 C CG  . GLN B 18  ? 0.6856 0.5788 0.6379 -0.0157 -0.0075 0.1102  19  GLN B CG  
2672 C CD  . GLN B 18  ? 0.7338 0.5960 0.6635 -0.0105 -0.0015 0.1262  19  GLN B CD  
2673 O OE1 . GLN B 18  ? 0.7363 0.5843 0.6767 -0.0058 0.0005  0.1310  19  GLN B OE1 
2674 N NE2 . GLN B 18  ? 0.7427 0.5916 0.6385 -0.0105 0.0021  0.1350  19  GLN B NE2 
2675 N N   . TYR B 19  ? 0.6047 0.5558 0.6464 -0.0270 -0.0066 0.0691  20  TYR B N   
2676 C CA  . TYR B 19  ? 0.5845 0.5439 0.6473 -0.0292 -0.0041 0.0589  20  TYR B CA  
2677 C C   . TYR B 19  ? 0.5944 0.5462 0.6653 -0.0215 -0.0082 0.0613  20  TYR B C   
2678 O O   . TYR B 19  ? 0.6135 0.5719 0.6850 -0.0136 -0.0174 0.0646  20  TYR B O   
2679 C CB  . TYR B 19  ? 0.5727 0.5545 0.6434 -0.0292 -0.0081 0.0500  20  TYR B CB  
2680 C CG  . TYR B 19  ? 0.5767 0.5668 0.6433 -0.0350 -0.0030 0.0465  20  TYR B CG  
2681 C CD1 . TYR B 19  ? 0.5676 0.5570 0.6186 -0.0348 -0.0041 0.0511  20  TYR B CD1 
2682 C CD2 . TYR B 19  ? 0.5772 0.5773 0.6567 -0.0404 0.0025  0.0374  20  TYR B CD2 
2683 C CE1 . TYR B 19  ? 0.5726 0.5689 0.6212 -0.0391 0.0022  0.0475  20  TYR B CE1 
2684 C CE2 . TYR B 19  ? 0.5648 0.5754 0.6446 -0.0441 0.0072  0.0341  20  TYR B CE2 
2685 C CZ  . TYR B 19  ? 0.5720 0.5795 0.6365 -0.0431 0.0081  0.0395  20  TYR B CZ  
2686 O OH  . TYR B 19  ? 0.6215 0.6383 0.6871 -0.0457 0.0144  0.0359  20  TYR B OH  
2687 N N   . TYR B 20  ? 0.5902 0.5285 0.6692 -0.0243 -0.0007 0.0585  21  TYR B N   
2688 C CA  . TYR B 20  ? 0.6040 0.5300 0.6903 -0.0162 -0.0019 0.0611  21  TYR B CA  
2689 C C   . TYR B 20  ? 0.6251 0.5452 0.7256 -0.0214 0.0060  0.0496  21  TYR B C   
2690 O O   . TYR B 20  ? 0.6720 0.5881 0.7748 -0.0322 0.0143  0.0432  21  TYR B O   
2691 C CB  . TYR B 20  ? 0.6236 0.5250 0.6957 -0.0101 -0.0010 0.0763  21  TYR B CB  
2692 C CG  . TYR B 20  ? 0.6512 0.5323 0.7107 -0.0191 0.0110  0.0811  21  TYR B CG  
2693 C CD1 . TYR B 20  ? 0.6708 0.5295 0.7374 -0.0250 0.0238  0.0786  21  TYR B CD1 
2694 C CD2 . TYR B 20  ? 0.6436 0.5263 0.6840 -0.0226 0.0114  0.0874  21  TYR B CD2 
2695 C CE1 . TYR B 20  ? 0.6929 0.5324 0.7504 -0.0349 0.0375  0.0827  21  TYR B CE1 
2696 C CE2 . TYR B 20  ? 0.6765 0.5404 0.7058 -0.0314 0.0253  0.0920  21  TYR B CE2 
2697 C CZ  . TYR B 20  ? 0.6957 0.5384 0.7347 -0.0379 0.0386  0.0899  21  TYR B CZ  
2698 O OH  . TYR B 20  ? 0.7422 0.5659 0.7728 -0.0481 0.0548  0.0941  21  TYR B OH  
2699 N N   . GLY B 21  ? 0.6233 0.5441 0.7344 -0.0141 0.0039  0.0456  22  GLY B N   
2700 C CA  . GLY B 21  ? 0.6291 0.5428 0.7514 -0.0178 0.0111  0.0330  22  GLY B CA  
2701 C C   . GLY B 21  ? 0.6721 0.5632 0.7994 -0.0088 0.0147  0.0378  22  GLY B C   
2702 O O   . GLY B 21  ? 0.6835 0.5641 0.8051 0.0005  0.0113  0.0524  22  GLY B O   
2703 N N   . GLU B 22  ? 0.7190 0.6031 0.8562 -0.0105 0.0211  0.0251  23  GLU B N   
2704 C CA  . GLU B 22  ? 0.7679 0.6260 0.9111 -0.0022 0.0276  0.0277  23  GLU B CA  
2705 C C   . GLU B 22  ? 0.7417 0.6098 0.8958 0.0087  0.0257  0.0219  23  GLU B C   
2706 O O   . GLU B 22  ? 0.7389 0.6248 0.8954 0.0051  0.0253  0.0085  23  GLU B O   
2707 C CB  . GLU B 22  ? 0.8478 0.6820 0.9945 -0.0135 0.0403  0.0168  23  GLU B CB  
2708 C CG  . GLU B 22  ? 0.9344 0.7583 1.0742 -0.0265 0.0459  0.0209  23  GLU B CG  
2709 C CD  . GLU B 22  ? 1.0454 0.8609 1.1947 -0.0428 0.0564  0.0027  23  GLU B CD  
2710 O OE1 . GLU B 22  ? 1.1087 0.9001 1.2648 -0.0426 0.0653  -0.0047 23  GLU B OE1 
2711 O OE2 . GLU B 22  ? 1.0427 0.8763 1.1941 -0.0558 0.0556  -0.0051 23  GLU B OE2 
2712 N N   . ILE B 23  ? 0.7197 0.5764 0.8796 0.0231  0.0249  0.0331  24  ILE B N   
2713 C CA  . ILE B 23  ? 0.6875 0.5470 0.8620 0.0347  0.0273  0.0278  24  ILE B CA  
2714 C C   . ILE B 23  ? 0.7245 0.5492 0.9044 0.0429  0.0370  0.0311  24  ILE B C   
2715 O O   . ILE B 23  ? 0.7352 0.5365 0.9067 0.0441  0.0384  0.0440  24  ILE B O   
2716 C CB  . ILE B 23  ? 0.6751 0.5600 0.8590 0.0469  0.0166  0.0368  24  ILE B CB  
2717 C CG1 . ILE B 23  ? 0.6983 0.5769 0.8783 0.0565  0.0076  0.0559  24  ILE B CG1 
2718 C CG2 . ILE B 23  ? 0.6519 0.5668 0.8317 0.0387  0.0105  0.0314  24  ILE B CG2 
2719 C CD1 . ILE B 23  ? 0.6929 0.5912 0.8900 0.0722  -0.0018 0.0629  24  ILE B CD1 
2720 N N   . GLY B 24  ? 0.7248 0.5435 0.9166 0.0485  0.0453  0.0195  25  GLY B N   
2721 C CA  . GLY B 24  ? 0.7560 0.5421 0.9561 0.0600  0.0551  0.0228  25  GLY B CA  
2722 C C   . GLY B 24  ? 0.7718 0.5705 0.9894 0.0807  0.0503  0.0315  25  GLY B C   
2723 O O   . GLY B 24  ? 0.7492 0.5790 0.9762 0.0827  0.0459  0.0258  25  GLY B O   
2724 N N   . ILE B 25  ? 0.8032 0.5785 1.0259 0.0965  0.0513  0.0461  26  ILE B N   
2725 C CA  . ILE B 25  ? 0.8073 0.5941 1.0520 0.1188  0.0472  0.0535  26  ILE B CA  
2726 C C   . ILE B 25  ? 0.8561 0.6055 1.1107 0.1324  0.0615  0.0532  26  ILE B C   
2727 O O   . ILE B 25  ? 0.8939 0.6060 1.1372 0.1357  0.0663  0.0645  26  ILE B O   
2728 C CB  . ILE B 25  ? 0.8062 0.6110 1.0508 0.1309  0.0290  0.0743  26  ILE B CB  
2729 C CG1 . ILE B 25  ? 0.7832 0.6192 1.0157 0.1159  0.0168  0.0735  26  ILE B CG1 
2730 C CG2 . ILE B 25  ? 0.7847 0.6124 1.0589 0.1523  0.0229  0.0780  26  ILE B CG2 
2731 C CD1 . ILE B 25  ? 0.7763 0.6278 1.0030 0.1243  -0.0011 0.0911  26  ILE B CD1 
2732 N N   . GLY B 26  ? 0.8376 0.5947 1.1123 0.1402  0.0702  0.0400  27  GLY B N   
2733 C CA  . GLY B 26  ? 0.8717 0.5960 1.1595 0.1558  0.0844  0.0384  27  GLY B CA  
2734 C C   . GLY B 26  ? 0.9094 0.6054 1.1916 0.1439  0.1039  0.0162  27  GLY B C   
2735 O O   . GLY B 26  ? 0.8977 0.6007 1.1647 0.1225  0.1055  0.0008  27  GLY B O   
2736 N N   . THR B 27  ? 0.9417 0.6063 1.2368 0.1591  0.1181  0.0141  28  THR B N   
2737 C CA  . THR B 27  ? 0.9709 0.6001 1.2612 0.1501  0.1381  -0.0071 28  THR B CA  
2738 C C   . THR B 27  ? 1.0524 0.6275 1.3407 0.1597  0.1488  0.0046  28  THR B C   
2739 O O   . THR B 27  ? 1.0921 0.6546 1.3978 0.1849  0.1519  0.0167  28  THR B O   
2740 C CB  . THR B 27  ? 0.9672 0.6076 1.2756 0.1603  0.1498  -0.0245 28  THR B CB  
2741 O OG1 . THR B 27  ? 0.9030 0.5919 1.2125 0.1535  0.1408  -0.0310 28  THR B OG1 
2742 C CG2 . THR B 27  ? 0.9946 0.6000 1.2936 0.1488  0.1698  -0.0502 28  THR B CG2 
2743 N N   . PRO B 28  ? 1.0914 0.6344 1.3603 0.1407  0.1549  0.0021  29  PRO B N   
2744 C CA  . PRO B 28  ? 1.0582 0.6188 1.3099 0.1120  0.1500  -0.0114 29  PRO B CA  
2745 C C   . PRO B 28  ? 1.0261 0.6232 1.2687 0.1082  0.1296  0.0060  29  PRO B C   
2746 O O   . PRO B 28  ? 1.0408 0.6382 1.2850 0.1251  0.1205  0.0303  29  PRO B O   
2747 C CB  . PRO B 28  ? 1.0952 0.6057 1.3360 0.0969  0.1650  -0.0159 29  PRO B CB  
2748 C CG  . PRO B 28  ? 1.1408 0.6095 1.3861 0.1189  0.1728  0.0063  29  PRO B CG  
2749 C CD  . PRO B 28  ? 1.1338 0.6172 1.3994 0.1454  0.1714  0.0084  29  PRO B CD  
2750 N N   . PRO B 29  ? 0.9866 0.6142 1.2190 0.0875  0.1221  -0.0064 30  PRO B N   
2751 C CA  . PRO B 29  ? 0.9385 0.5992 1.1619 0.0829  0.1045  0.0077  30  PRO B CA  
2752 C C   . PRO B 29  ? 0.9518 0.5889 1.1615 0.0802  0.1029  0.0275  30  PRO B C   
2753 O O   . PRO B 29  ? 0.9582 0.5613 1.1603 0.0667  0.1155  0.0225  30  PRO B O   
2754 C CB  . PRO B 29  ? 0.9070 0.5934 1.1217 0.0608  0.1017  -0.0125 30  PRO B CB  
2755 C CG  . PRO B 29  ? 0.9245 0.6059 1.1453 0.0601  0.1131  -0.0358 30  PRO B CG  
2756 C CD  . PRO B 29  ? 0.9743 0.6089 1.2026 0.0695  0.1288  -0.0349 30  PRO B CD  
2757 N N   . GLN B 30  ? 0.9317 0.5866 1.1382 0.0927  0.0883  0.0491  31  GLN B N   
2758 C CA  . GLN B 30  ? 0.9421 0.5823 1.1296 0.0902  0.0842  0.0689  31  GLN B CA  
2759 C C   . GLN B 30  ? 0.8998 0.5784 1.0775 0.0755  0.0711  0.0671  31  GLN B C   
2760 O O   . GLN B 30  ? 0.8802 0.5974 1.0649 0.0814  0.0574  0.0670  31  GLN B O   
2761 C CB  . GLN B 30  ? 0.9635 0.5967 1.1505 0.1160  0.0754  0.0940  31  GLN B CB  
2762 C CG  . GLN B 30  ? 1.0094 0.5972 1.2027 0.1332  0.0891  0.1011  31  GLN B CG  
2763 C CD  . GLN B 30  ? 1.0239 0.6157 1.2228 0.1632  0.0767  0.1235  31  GLN B CD  
2764 O OE1 . GLN B 30  ? 1.0563 0.6407 1.2755 0.1824  0.0811  0.1227  31  GLN B OE1 
2765 N NE2 . GLN B 30  ? 1.0164 0.6214 1.1977 0.1681  0.0609  0.1428  31  GLN B NE2 
2766 N N   . THR B 31  ? 0.9028 0.5701 1.0663 0.0564  0.0767  0.0651  32  THR B N   
2767 C CA  . THR B 31  ? 0.8424 0.5439 0.9989 0.0404  0.0677  0.0588  32  THR B CA  
2768 C C   . THR B 31  ? 0.8295 0.5394 0.9688 0.0444  0.0568  0.0793  32  THR B C   
2769 O O   . THR B 31  ? 0.8795 0.5595 1.0033 0.0441  0.0635  0.0937  32  THR B O   
2770 C CB  . THR B 31  ? 0.8579 0.5511 1.0140 0.0165  0.0793  0.0405  32  THR B CB  
2771 O OG1 . THR B 31  ? 0.8741 0.5748 1.0432 0.0125  0.0833  0.0178  32  THR B OG1 
2772 C CG2 . THR B 31  ? 0.8284 0.5520 0.9767 0.0016  0.0713  0.0378  32  THR B CG2 
2773 N N   . PHE B 32  ? 0.7715 0.5208 0.9121 0.0474  0.0412  0.0797  33  PHE B N   
2774 C CA  . PHE B 32  ? 0.7628 0.5251 0.8864 0.0496  0.0294  0.0950  33  PHE B CA  
2775 C C   . PHE B 32  ? 0.7384 0.5298 0.8578 0.0332  0.0251  0.0850  33  PHE B C   
2776 O O   . PHE B 32  ? 0.7218 0.5370 0.8537 0.0273  0.0235  0.0692  33  PHE B O   
2777 C CB  . PHE B 32  ? 0.7471 0.5300 0.8771 0.0692  0.0136  0.1054  33  PHE B CB  
2778 C CG  . PHE B 32  ? 0.7806 0.5392 0.9176 0.0889  0.0160  0.1160  33  PHE B CG  
2779 C CD1 . PHE B 32  ? 0.8136 0.5430 0.9310 0.1000  0.0156  0.1370  33  PHE B CD1 
2780 C CD2 . PHE B 32  ? 0.7734 0.5361 0.9352 0.0973  0.0201  0.1055  33  PHE B CD2 
2781 C CE1 . PHE B 32  ? 0.8587 0.5634 0.9824 0.1206  0.0181  0.1481  33  PHE B CE1 
2782 C CE2 . PHE B 32  ? 0.8012 0.5407 0.9719 0.1171  0.0234  0.1150  33  PHE B CE2 
2783 C CZ  . PHE B 32  ? 0.8525 0.5628 1.0047 0.1292  0.0220  0.1367  33  PHE B CZ  
2784 N N   . LYS B 33  ? 0.7474 0.5351 0.8473 0.0272  0.0241  0.0950  34  LYS B N   
2785 C CA  . LYS B 33  ? 0.7379 0.5535 0.8326 0.0154  0.0186  0.0887  34  LYS B CA  
2786 C C   . LYS B 33  ? 0.7193 0.5623 0.8128 0.0261  0.0018  0.0944  34  LYS B C   
2787 O O   . LYS B 33  ? 0.7601 0.5962 0.8423 0.0383  -0.0059 0.1095  34  LYS B O   
2788 C CB  . LYS B 33  ? 0.7571 0.5568 0.8321 0.0050  0.0265  0.0964  34  LYS B CB  
2789 C CG  . LYS B 33  ? 0.7823 0.5526 0.8608 -0.0069 0.0449  0.0915  34  LYS B CG  
2790 C CD  . LYS B 33  ? 0.8272 0.5778 0.8853 -0.0149 0.0551  0.1030  34  LYS B CD  
2791 C CE  . LYS B 33  ? 0.8603 0.5727 0.9214 -0.0241 0.0755  0.1026  34  LYS B CE  
2792 N NZ  . LYS B 33  ? 0.9045 0.6027 0.9504 -0.0366 0.0890  0.1096  34  LYS B NZ  
2793 N N   . VAL B 34  ? 0.6771 0.5505 0.7822 0.0218  -0.0037 0.0822  35  VAL B N   
2794 C CA  . VAL B 34  ? 0.6639 0.5642 0.7729 0.0295  -0.0178 0.0846  35  VAL B CA  
2795 C C   . VAL B 34  ? 0.6426 0.5663 0.7470 0.0191  -0.0215 0.0776  35  VAL B C   
2796 O O   . VAL B 34  ? 0.6606 0.5895 0.7680 0.0089  -0.0148 0.0666  35  VAL B O   
2797 C CB  . VAL B 34  ? 0.6599 0.5737 0.7927 0.0392  -0.0205 0.0785  35  VAL B CB  
2798 C CG1 . VAL B 34  ? 0.6756 0.5698 0.8148 0.0541  -0.0198 0.0876  35  VAL B CG1 
2799 C CG2 . VAL B 34  ? 0.6726 0.5925 0.8162 0.0310  -0.0113 0.0622  35  VAL B CG2 
2800 N N   . VAL B 35  ? 0.6131 0.5508 0.7102 0.0226  -0.0327 0.0834  36  VAL B N   
2801 C CA  . VAL B 35  ? 0.5813 0.5407 0.6770 0.0150  -0.0364 0.0764  36  VAL B CA  
2802 C C   . VAL B 35  ? 0.5677 0.5477 0.6850 0.0181  -0.0391 0.0681  36  VAL B C   
2803 O O   . VAL B 35  ? 0.5657 0.5527 0.6966 0.0279  -0.0456 0.0711  36  VAL B O   
2804 C CB  . VAL B 35  ? 0.5846 0.5492 0.6631 0.0163  -0.0466 0.0837  36  VAL B CB  
2805 C CG1 . VAL B 35  ? 0.5430 0.5280 0.6227 0.0090  -0.0492 0.0752  36  VAL B CG1 
2806 C CG2 . VAL B 35  ? 0.6071 0.5501 0.6604 0.0128  -0.0412 0.0923  36  VAL B CG2 
2807 N N   . PHE B 36  ? 0.5391 0.5291 0.6596 0.0105  -0.0336 0.0583  37  PHE B N   
2808 C CA  . PHE B 36  ? 0.5411 0.5486 0.6773 0.0121  -0.0335 0.0514  37  PHE B CA  
2809 C C   . PHE B 36  ? 0.5616 0.5840 0.6951 0.0086  -0.0399 0.0514  37  PHE B C   
2810 O O   . PHE B 36  ? 0.5554 0.5787 0.6768 0.0015  -0.0376 0.0490  37  PHE B O   
2811 C CB  . PHE B 36  ? 0.5244 0.5317 0.6617 0.0077  -0.0240 0.0418  37  PHE B CB  
2812 C CG  . PHE B 36  ? 0.5387 0.5317 0.6805 0.0102  -0.0176 0.0386  37  PHE B CG  
2813 C CD1 . PHE B 36  ? 0.5409 0.5178 0.6735 0.0048  -0.0137 0.0384  37  PHE B CD1 
2814 C CD2 . PHE B 36  ? 0.5370 0.5315 0.6934 0.0172  -0.0138 0.0346  37  PHE B CD2 
2815 C CE1 . PHE B 36  ? 0.5566 0.5178 0.6942 0.0056  -0.0067 0.0337  37  PHE B CE1 
2816 C CE2 . PHE B 36  ? 0.5472 0.5259 0.7069 0.0194  -0.0068 0.0300  37  PHE B CE2 
2817 C CZ  . PHE B 36  ? 0.5655 0.5267 0.7156 0.0132  -0.0035 0.0291  37  PHE B CZ  
2818 N N   . ASP B 37  ? 0.5757 0.6105 0.7224 0.0137  -0.0479 0.0530  38  ASP B N   
2819 C CA  . ASP B 37  ? 0.5631 0.6101 0.7068 0.0103  -0.0567 0.0529  38  ASP B CA  
2820 C C   . ASP B 37  ? 0.5556 0.6215 0.7207 0.0081  -0.0558 0.0457  38  ASP B C   
2821 O O   . ASP B 37  ? 0.5790 0.6578 0.7668 0.0140  -0.0597 0.0449  38  ASP B O   
2822 C CB  . ASP B 37  ? 0.5903 0.6360 0.7281 0.0175  -0.0697 0.0611  38  ASP B CB  
2823 C CG  . ASP B 37  ? 0.6041 0.6647 0.7389 0.0144  -0.0815 0.0588  38  ASP B CG  
2824 O OD1 . ASP B 37  ? 0.5882 0.6508 0.7147 0.0048  -0.0781 0.0529  38  ASP B OD1 
2825 O OD2 . ASP B 37  ? 0.6057 0.6759 0.7462 0.0222  -0.0949 0.0625  38  ASP B OD2 
2826 N N   . THR B 38  ? 0.5207 0.5877 0.6796 0.0000  -0.0496 0.0407  39  THR B N   
2827 C CA  . THR B 38  ? 0.5054 0.5857 0.6817 -0.0043 -0.0456 0.0342  39  THR B CA  
2828 C C   . THR B 38  ? 0.5277 0.6235 0.7155 -0.0071 -0.0571 0.0312  39  THR B C   
2829 O O   . THR B 38  ? 0.5540 0.6642 0.7648 -0.0107 -0.0545 0.0251  39  THR B O   
2830 C CB  . THR B 38  ? 0.4992 0.5720 0.6631 -0.0108 -0.0348 0.0312  39  THR B CB  
2831 O OG1 . THR B 38  ? 0.5045 0.5685 0.6463 -0.0144 -0.0382 0.0328  39  THR B OG1 
2832 C CG2 . THR B 38  ? 0.4911 0.5560 0.6504 -0.0073 -0.0241 0.0314  39  THR B CG2 
2833 N N   . GLY B 39  ? 0.5358 0.6289 0.7073 -0.0058 -0.0693 0.0350  40  GLY B N   
2834 C CA  . GLY B 39  ? 0.5252 0.6337 0.7026 -0.0074 -0.0839 0.0314  40  GLY B CA  
2835 C C   . GLY B 39  ? 0.5311 0.6584 0.7333 0.0017  -0.0957 0.0326  40  GLY B C   
2836 O O   . GLY B 39  ? 0.5481 0.6940 0.7603 0.0006  -0.1096 0.0278  40  GLY B O   
2837 N N   . SER B 40  ? 0.5357 0.6592 0.7487 0.0111  -0.0908 0.0381  41  SER B N   
2838 C CA  . SER B 40  ? 0.5600 0.7011 0.8000 0.0227  -0.1003 0.0400  41  SER B CA  
2839 C C   . SER B 40  ? 0.5590 0.6996 0.8217 0.0280  -0.0863 0.0393  41  SER B C   
2840 O O   . SER B 40  ? 0.5582 0.6827 0.8102 0.0235  -0.0710 0.0383  41  SER B O   
2841 C CB  . SER B 40  ? 0.5649 0.6966 0.7854 0.0345  -0.1140 0.0513  41  SER B CB  
2842 O OG  . SER B 40  ? 0.5920 0.6951 0.7901 0.0371  -0.1034 0.0593  41  SER B OG  
2843 N N   . SER B 41  ? 0.5724 0.7312 0.8658 0.0386  -0.0920 0.0393  42  SER B N   
2844 C CA  . SER B 41  ? 0.5710 0.7330 0.8899 0.0429  -0.0772 0.0360  42  SER B CA  
2845 C C   . SER B 41  ? 0.5723 0.7301 0.9024 0.0600  -0.0793 0.0427  42  SER B C   
2846 O O   . SER B 41  ? 0.5995 0.7624 0.9540 0.0652  -0.0675 0.0388  42  SER B O   
2847 C CB  . SER B 41  ? 0.5546 0.7458 0.9109 0.0366  -0.0734 0.0254  42  SER B CB  
2848 O OG  . SER B 41  ? 0.5691 0.7608 0.9148 0.0211  -0.0712 0.0195  42  SER B OG  
2849 N N   . ASN B 42  ? 0.5913 0.7371 0.9019 0.0691  -0.0926 0.0530  43  ASN B N   
2850 C CA  . ASN B 42  ? 0.5952 0.7306 0.9122 0.0867  -0.0942 0.0615  43  ASN B CA  
2851 C C   . ASN B 42  ? 0.6216 0.7186 0.9064 0.0871  -0.0844 0.0686  43  ASN B C   
2852 O O   . ASN B 42  ? 0.6286 0.7094 0.8816 0.0769  -0.0839 0.0709  43  ASN B O   
2853 C CB  . ASN B 42  ? 0.5991 0.7489 0.9203 0.1001  -0.1167 0.0696  43  ASN B CB  
2854 C CG  . ASN B 42  ? 0.5963 0.7888 0.9597 0.1022  -0.1273 0.0609  43  ASN B CG  
2855 O OD1 . ASN B 42  ? 0.5843 0.7964 0.9510 0.0892  -0.1336 0.0525  43  ASN B OD1 
2856 N ND2 . ASN B 42  ? 0.6001 0.8076 0.9985 0.1183  -0.1285 0.0619  43  ASN B ND2 
2857 N N   . VAL B 43  ? 0.6298 0.7128 0.9252 0.0984  -0.0754 0.0707  44  VAL B N   
2858 C CA  . VAL B 43  ? 0.6475 0.6933 0.9171 0.1008  -0.0674 0.0778  44  VAL B CA  
2859 C C   . VAL B 43  ? 0.6830 0.7191 0.9477 0.1181  -0.0802 0.0925  44  VAL B C   
2860 O O   . VAL B 43  ? 0.6899 0.7418 0.9822 0.1342  -0.0872 0.0950  44  VAL B O   
2861 C CB  . VAL B 43  ? 0.6447 0.6749 0.9250 0.1026  -0.0487 0.0704  44  VAL B CB  
2862 C CG1 . VAL B 43  ? 0.6566 0.6479 0.9113 0.1018  -0.0403 0.0754  44  VAL B CG1 
2863 C CG2 . VAL B 43  ? 0.6148 0.6561 0.8988 0.0886  -0.0367 0.0568  44  VAL B CG2 
2864 N N   . TRP B 44  ? 0.6910 0.7020 0.9206 0.1156  -0.0831 0.1028  45  TRP B N   
2865 C CA  . TRP B 44  ? 0.7407 0.7322 0.9575 0.1329  -0.0913 0.1193  45  TRP B CA  
2866 C C   . TRP B 44  ? 0.7729 0.7208 0.9563 0.1283  -0.0791 0.1278  45  TRP B C   
2867 O O   . TRP B 44  ? 0.7757 0.7152 0.9378 0.1111  -0.0725 0.1237  45  TRP B O   
2868 C CB  . TRP B 44  ? 0.7507 0.7643 0.9604 0.1408  -0.1146 0.1273  45  TRP B CB  
2869 C CG  . TRP B 44  ? 0.7598 0.7714 0.9355 0.1262  -0.1197 0.1279  45  TRP B CG  
2870 C CD1 . TRP B 44  ? 0.7329 0.7717 0.9124 0.1122  -0.1256 0.1163  45  TRP B CD1 
2871 C CD2 . TRP B 44  ? 0.7850 0.7642 0.9181 0.1246  -0.1175 0.1406  45  TRP B CD2 
2872 N NE1 . TRP B 44  ? 0.7473 0.7733 0.8896 0.1025  -0.1275 0.1202  45  TRP B NE1 
2873 C CE2 . TRP B 44  ? 0.7773 0.7679 0.8906 0.1096  -0.1224 0.1350  45  TRP B CE2 
2874 C CE3 . TRP B 44  ? 0.8086 0.7481 0.9184 0.1337  -0.1097 0.1560  45  TRP B CE3 
2875 C CZ2 . TRP B 44  ? 0.7898 0.7559 0.8614 0.1041  -0.1197 0.1439  45  TRP B CZ2 
2876 C CZ3 . TRP B 44  ? 0.8399 0.7541 0.9080 0.1272  -0.1063 0.1656  45  TRP B CZ3 
2877 C CH2 . TRP B 44  ? 0.8341 0.7629 0.8837 0.1127  -0.1113 0.1593  45  TRP B CH2 
2878 N N   . VAL B 45  ? 0.7881 0.7084 0.9698 0.1442  -0.0752 0.1394  46  VAL B N   
2879 C CA  . VAL B 45  ? 0.8016 0.6768 0.9525 0.1422  -0.0635 0.1503  46  VAL B CA  
2880 C C   . VAL B 45  ? 0.8306 0.6885 0.9649 0.1641  -0.0745 0.1719  46  VAL B C   
2881 O O   . VAL B 45  ? 0.8521 0.7318 1.0072 0.1832  -0.0891 0.1760  46  VAL B O   
2882 C CB  . VAL B 45  ? 0.8074 0.6541 0.9685 0.1373  -0.0416 0.1419  46  VAL B CB  
2883 C CG1 . VAL B 45  ? 0.7758 0.6368 0.9433 0.1154  -0.0321 0.1222  46  VAL B CG1 
2884 C CG2 . VAL B 45  ? 0.7999 0.6459 0.9908 0.1567  -0.0395 0.1417  46  VAL B CG2 
2885 N N   . PRO B 46  ? 0.8470 0.6671 0.9441 0.1621  -0.0676 0.1859  47  PRO B N   
2886 C CA  . PRO B 46  ? 0.8922 0.6869 0.9689 0.1850  -0.0745 0.2088  47  PRO B CA  
2887 C C   . PRO B 46  ? 0.9194 0.6904 1.0177 0.2032  -0.0652 0.2137  47  PRO B C   
2888 O O   . PRO B 46  ? 0.9113 0.6649 1.0254 0.1931  -0.0456 0.2017  47  PRO B O   
2889 C CB  . PRO B 46  ? 0.9151 0.6691 0.9489 0.1738  -0.0611 0.2200  47  PRO B CB  
2890 C CG  . PRO B 46  ? 0.8728 0.6453 0.9043 0.1472  -0.0559 0.2034  47  PRO B CG  
2891 C CD  . PRO B 46  ? 0.8431 0.6447 0.9149 0.1394  -0.0537 0.1821  47  PRO B CD  
2892 N N   . SER B 47  ? 0.9514 0.7223 1.0497 0.2307  -0.0799 0.2305  48  SER B N   
2893 C CA  . SER B 47  ? 0.9751 0.7254 1.0954 0.2530  -0.0732 0.2370  48  SER B CA  
2894 C C   . SER B 47  ? 1.0335 0.7223 1.1198 0.2644  -0.0598 0.2594  48  SER B C   
2895 O O   . SER B 47  ? 1.0630 0.7324 1.1073 0.2626  -0.0626 0.2748  48  SER B O   
2896 C CB  . SER B 47  ? 0.9685 0.7597 1.1158 0.2789  -0.0980 0.2415  48  SER B CB  
2897 O OG  . SER B 47  ? 1.0030 0.7730 1.1700 0.3045  -0.0925 0.2506  48  SER B OG  
2898 N N   . SER B 48  ? 1.0587 0.7148 1.1625 0.2758  -0.0433 0.2606  49  SER B N   
2899 C CA  . SER B 48  ? 1.1245 0.7198 1.2017 0.2925  -0.0303 0.2838  49  SER B CA  
2900 C C   . SER B 48  ? 1.1686 0.7692 1.2352 0.3280  -0.0533 0.3087  49  SER B C   
2901 O O   . SER B 48  ? 1.2137 0.7687 1.2422 0.3424  -0.0493 0.3338  49  SER B O   
2902 C CB  . SER B 48  ? 1.1418 0.7017 1.2442 0.2948  -0.0060 0.2753  49  SER B CB  
2903 O OG  . SER B 48  ? 1.1253 0.7176 1.2713 0.3137  -0.0150 0.2668  49  SER B OG  
2904 N N   . LYS B 49  ? 1.1529 0.8098 1.2540 0.3419  -0.0768 0.3014  50  LYS B N   
2905 C CA  . LYS B 49  ? 1.2133 0.8920 1.3098 0.3740  -0.1053 0.3206  50  LYS B CA  
2906 C C   . LYS B 49  ? 1.2456 0.9460 1.3023 0.3677  -0.1271 0.3282  50  LYS B C   
2907 O O   . LYS B 49  ? 1.2774 1.0042 1.3281 0.3915  -0.1549 0.3409  50  LYS B O   
2908 C CB  . LYS B 49  ? 1.1559 0.8897 1.3105 0.3901  -0.1211 0.3075  50  LYS B CB  
2909 N N   . CYS B 50  ? 1.2782 0.9684 1.3085 0.3363  -0.1147 0.3195  51  CYS B N   
2910 C CA  . CYS B 50  ? 1.3396 1.0364 1.3237 0.3286  -0.1282 0.3279  51  CYS B CA  
2911 C C   . CYS B 50  ? 1.4475 1.0908 1.3780 0.3488  -0.1255 0.3595  51  CYS B C   
2912 O O   . CYS B 50  ? 1.5085 1.0962 1.4306 0.3544  -0.1016 0.3716  51  CYS B O   
2913 C CB  . CYS B 50  ? 1.3251 1.0188 1.2969 0.2912  -0.1109 0.3111  51  CYS B CB  
2914 S SG  . CYS B 50  ? 1.3947 1.1034 1.3160 0.2793  -0.1262 0.3156  51  CYS B SG  
2915 N N   . SER B 51  ? 1.4844 1.1431 1.3773 0.3596  -0.1493 0.3725  52  SER B N   
2916 C CA  . SER B 51  ? 1.5496 1.1579 1.3805 0.3766  -0.1469 0.4033  52  SER B CA  
2917 C C   . SER B 51  ? 1.5773 1.1344 1.3726 0.3492  -0.1138 0.4055  52  SER B C   
2918 O O   . SER B 51  ? 1.5067 1.0834 1.3091 0.3176  -0.1056 0.3844  52  SER B O   
2919 C CB  . SER B 51  ? 1.5633 1.2053 1.3594 0.3898  -0.1804 0.4117  52  SER B CB  
2920 O OG  . SER B 51  ? 1.6152 1.2069 1.3426 0.4027  -0.1759 0.4409  52  SER B OG  
2921 N N   . ARG B 52  ? 1.6534 1.1450 1.4129 0.3620  -0.0940 0.4312  53  ARG B N   
2922 C CA  . ARG B 52  ? 1.6803 1.1186 1.4043 0.3382  -0.0608 0.4367  53  ARG B CA  
2923 C C   . ARG B 52  ? 1.6957 1.1363 1.3628 0.3309  -0.0681 0.4457  53  ARG B C   
2924 O O   . ARG B 52  ? 1.6757 1.0956 1.3234 0.3032  -0.0446 0.4404  53  ARG B O   
2925 C CB  . ARG B 52  ? 1.7456 1.1099 1.4495 0.3548  -0.0357 0.4622  53  ARG B CB  
2926 N N   . LEU B 53  ? 1.7094 1.1779 1.3520 0.3557  -0.1012 0.4576  54  LEU B N   
2927 C CA  . LEU B 53  ? 1.7315 1.1998 1.3123 0.3552  -0.1116 0.4687  54  LEU B CA  
2928 C C   . LEU B 53  ? 1.6775 1.1935 1.2664 0.3245  -0.1179 0.4411  54  LEU B C   
2929 O O   . LEU B 53  ? 1.6994 1.2084 1.2373 0.3169  -0.1176 0.4466  54  LEU B O   
2930 C CB  . LEU B 53  ? 1.7693 1.2513 1.3200 0.3940  -0.1468 0.4900  54  LEU B CB  
2931 C CG  . LEU B 53  ? 1.8503 1.2674 1.3598 0.4259  -0.1368 0.5274  54  LEU B CG  
2932 C CD1 . LEU B 53  ? 1.8724 1.3155 1.4000 0.4667  -0.1705 0.5390  54  LEU B CD1 
2933 C CD2 . LEU B 53  ? 1.9240 1.2962 1.3492 0.4291  -0.1282 0.5527  54  LEU B CD2 
2934 N N   . TYR B 54  ? 1.5961 1.1581 1.2471 0.3082  -0.1223 0.4122  55  TYR B N   
2935 C CA  . TYR B 54  ? 1.5366 1.1329 1.2026 0.2756  -0.1187 0.3853  55  TYR B CA  
2936 C C   . TYR B 54  ? 1.5386 1.0951 1.2063 0.2488  -0.0802 0.3806  55  TYR B C   
2937 O O   . TYR B 54  ? 1.5146 1.0587 1.2223 0.2432  -0.0637 0.3731  55  TYR B O   
2938 C CB  . TYR B 54  ? 1.4553 1.1112 1.1857 0.2693  -0.1356 0.3581  55  TYR B CB  
2939 C CG  . TYR B 54  ? 1.4620 1.1695 1.2015 0.2886  -0.1739 0.3551  55  TYR B CG  
2940 C CD1 . TYR B 54  ? 1.4418 1.1833 1.1589 0.2800  -0.1931 0.3452  55  TYR B CD1 
2941 C CD2 . TYR B 54  ? 1.4824 1.2069 1.2571 0.3149  -0.1907 0.3599  55  TYR B CD2 
2942 C CE1 . TYR B 54  ? 1.4457 1.2372 1.1748 0.2955  -0.2289 0.3394  55  TYR B CE1 
2943 C CE2 . TYR B 54  ? 1.4867 1.2637 1.2760 0.3317  -0.2266 0.3551  55  TYR B CE2 
2944 C CZ  . TYR B 54  ? 1.4686 1.2795 1.2354 0.3211  -0.2460 0.3443  55  TYR B CZ  
2945 O OH  . TYR B 54  ? 1.4586 1.3233 1.2422 0.3357  -0.2820 0.3371  55  TYR B OH  
2946 N N   . THR B 55  ? 1.5675 1.1059 1.1929 0.2323  -0.0660 0.3837  56  THR B N   
2947 C CA  . THR B 55  ? 1.5650 1.0692 1.1906 0.2054  -0.0295 0.3788  56  THR B CA  
2948 C C   . THR B 55  ? 1.5068 1.0420 1.1930 0.1814  -0.0218 0.3489  56  THR B C   
2949 O O   . THR B 55  ? 1.5154 1.0231 1.2202 0.1656  0.0051  0.3439  56  THR B O   
2950 C CB  . THR B 55  ? 1.5708 1.0646 1.1474 0.1903  -0.0186 0.3821  56  THR B CB  
2951 O OG1 . THR B 55  ? 1.6165 1.1076 1.1386 0.2128  -0.0394 0.4014  56  THR B OG1 
2952 C CG2 . THR B 55  ? 1.6037 1.0408 1.1617 0.1754  0.0208  0.3929  56  THR B CG2 
2953 N N   . ALA B 56  ? 1.4644 1.0559 1.1800 0.1789  -0.0458 0.3292  57  ALA B N   
2954 C CA  . ALA B 56  ? 1.3955 1.0202 1.1652 0.1597  -0.0424 0.3019  57  ALA B CA  
2955 C C   . ALA B 56  ? 1.3976 1.0122 1.2085 0.1670  -0.0356 0.2988  57  ALA B C   
2956 O O   . ALA B 56  ? 1.3627 0.9800 1.2066 0.1483  -0.0199 0.2810  57  ALA B O   
2957 C CB  . ALA B 56  ? 1.3264 1.0087 1.1137 0.1582  -0.0689 0.2847  57  ALA B CB  
2958 N N   . CYS B 57  ? 1.4479 1.0505 1.2556 0.1948  -0.0475 0.3158  58  CYS B N   
2959 C CA  . CYS B 57  ? 1.4527 1.0414 1.2968 0.2054  -0.0403 0.3147  58  CYS B CA  
2960 C C   . CYS B 57  ? 1.5220 1.0461 1.3506 0.2033  -0.0098 0.3284  58  CYS B C   
2961 O O   . CYS B 57  ? 1.5556 1.0558 1.4039 0.2170  -0.0025 0.3331  58  CYS B O   
2962 C CB  . CYS B 57  ? 1.4458 1.0558 1.3020 0.2371  -0.0669 0.3244  58  CYS B CB  
2963 S SG  . CYS B 57  ? 1.3438 1.0302 1.2508 0.2347  -0.0936 0.2985  58  CYS B SG  
2964 N N   . VAL B 58  ? 1.5772 1.0734 1.3725 0.1856  0.0092  0.3336  59  VAL B N   
2965 C CA  . VAL B 58  ? 1.6369 1.0733 1.4201 0.1759  0.0424  0.3427  59  VAL B CA  
2966 C C   . VAL B 58  ? 1.6056 1.0502 1.4110 0.1408  0.0629  0.3185  59  VAL B C   
2967 O O   . VAL B 58  ? 1.5879 1.0074 1.4174 0.1284  0.0847  0.3092  59  VAL B O   
2968 C CB  . VAL B 58  ? 1.6982 1.0867 1.4210 0.1864  0.0522  0.3730  59  VAL B CB  
2969 C CG1 . VAL B 58  ? 1.7525 1.0745 1.4676 0.1798  0.0876  0.3842  59  VAL B CG1 
2970 C CG2 . VAL B 58  ? 1.7386 1.1280 1.4342 0.2226  0.0260  0.3966  59  VAL B CG2 
2971 N N   . TYR B 59  ? 1.6179 1.0988 1.4161 0.1256  0.0550  0.3076  60  TYR B N   
2972 C CA  . TYR B 59  ? 1.6123 1.1079 1.4316 0.0945  0.0710  0.2849  60  TYR B CA  
2973 C C   . TYR B 59  ? 1.5020 1.0494 1.3675 0.0857  0.0571  0.2574  60  TYR B C   
2974 O O   . TYR B 59  ? 1.4884 1.0621 1.3679 0.0644  0.0609  0.2390  60  TYR B O   
2975 C CB  . TYR B 59  ? 1.6592 1.1570 1.4432 0.0820  0.0768  0.2894  60  TYR B CB  
2976 C CG  . TYR B 59  ? 1.7886 1.2317 1.5232 0.0883  0.0954  0.3166  60  TYR B CG  
2977 C CD1 . TYR B 59  ? 1.8463 1.2367 1.5820 0.0819  0.1249  0.3246  60  TYR B CD1 
2978 C CD2 . TYR B 59  ? 1.8169 1.2590 1.5017 0.1001  0.0847  0.3338  60  TYR B CD2 
2979 C CE1 . TYR B 59  ? 1.9300 1.2666 1.6187 0.0876  0.1446  0.3510  60  TYR B CE1 
2980 C CE2 . TYR B 59  ? 1.9064 1.2964 1.5408 0.1068  0.1029  0.3601  60  TYR B CE2 
2981 C CZ  . TYR B 59  ? 1.9709 1.3073 1.6073 0.1007  0.1336  0.3696  60  TYR B CZ  
2982 O OH  . TYR B 59  ? 2.0430 1.3240 1.6276 0.1073  0.1542  0.3971  60  TYR B OH  
2983 N N   . HIS B 60  ? 1.4356 0.9959 1.3241 0.1032  0.0420  0.2558  61  HIS B N   
2984 C CA  . HIS B 60  ? 1.3444 0.9448 1.2762 0.0968  0.0332  0.2317  61  HIS B CA  
2985 C C   . HIS B 60  ? 1.3143 0.8951 1.2724 0.1074  0.0397  0.2294  61  HIS B C   
2986 O O   . HIS B 60  ? 1.3438 0.8901 1.2887 0.1273  0.0420  0.2487  61  HIS B O   
2987 C CB  . HIS B 60  ? 1.3332 0.9825 1.2703 0.1072  0.0053  0.2280  61  HIS B CB  
2988 C CG  . HIS B 60  ? 1.3213 0.9967 1.2423 0.0929  -0.0004 0.2218  61  HIS B CG  
2989 N ND1 . HIS B 60  ? 1.3672 1.0330 1.2467 0.0979  -0.0052 0.2377  61  HIS B ND1 
2990 C CD2 . HIS B 60  ? 1.2713 0.9801 1.2104 0.0748  -0.0013 0.2016  61  HIS B CD2 
2991 C CE1 . HIS B 60  ? 1.3411 1.0334 1.2158 0.0828  -0.0080 0.2262  61  HIS B CE1 
2992 N NE2 . HIS B 60  ? 1.2823 1.0008 1.1935 0.0691  -0.0059 0.2049  61  HIS B NE2 
2993 N N   . LYS B 61  ? 1.2233 0.8249 1.2167 0.0950  0.0432  0.2058  62  LYS B N   
2994 C CA  . LYS B 61  ? 1.1888 0.7787 1.2094 0.1048  0.0481  0.1993  62  LYS B CA  
2995 C C   . LYS B 61  ? 1.1373 0.7561 1.1708 0.1293  0.0258  0.2047  62  LYS B C   
2996 O O   . LYS B 61  ? 1.1153 0.7783 1.1536 0.1289  0.0074  0.1991  62  LYS B O   
2997 C CB  . LYS B 61  ? 1.1329 0.7386 1.1828 0.0842  0.0575  0.1715  62  LYS B CB  
2998 C CG  . LYS B 61  ? 1.1718 0.7369 1.2349 0.0815  0.0783  0.1650  62  LYS B CG  
2999 C CD  . LYS B 61  ? 1.1412 0.7287 1.2352 0.0724  0.0800  0.1382  62  LYS B CD  
3000 C CE  . LYS B 61  ? 1.2281 0.7766 1.3358 0.0787  0.0962  0.1334  62  LYS B CE  
3001 N NZ  . LYS B 61  ? 1.1994 0.7712 1.3340 0.0768  0.0951  0.1097  62  LYS B NZ  
3002 N N   . LEU B 62  ? 1.1147 0.7080 1.1554 0.1506  0.0282  0.2153  63  LEU B N   
3003 C CA  . LEU B 62  ? 1.0689 0.6898 1.1270 0.1757  0.0080  0.2206  63  LEU B CA  
3004 C C   . LEU B 62  ? 1.0409 0.6659 1.1373 0.1799  0.0156  0.2043  63  LEU B C   
3005 O O   . LEU B 62  ? 1.0749 0.6608 1.1754 0.1752  0.0366  0.1997  63  LEU B O   
3006 C CB  . LEU B 62  ? 1.1217 0.7135 1.1556 0.2032  0.0013  0.2492  63  LEU B CB  
3007 C CG  . LEU B 62  ? 1.1489 0.7143 1.1343 0.2026  0.0017  0.2707  63  LEU B CG  
3008 C CD1 . LEU B 62  ? 1.1769 0.7112 1.1398 0.2344  -0.0047 0.2994  63  LEU B CD1 
3009 C CD2 . LEU B 62  ? 1.1131 0.7216 1.0842 0.1922  -0.0165 0.2663  63  LEU B CD2 
3010 N N   . PHE B 63  ? 0.9814 0.6532 1.1057 0.1875  0.0000  0.1944  64  PHE B N   
3011 C CA  . PHE B 63  ? 0.9504 0.6292 1.1109 0.1952  0.0064  0.1804  64  PHE B CA  
3012 C C   . PHE B 63  ? 0.9957 0.6481 1.1639 0.2252  0.0071  0.1969  64  PHE B C   
3013 O O   . PHE B 63  ? 0.9990 0.6627 1.1618 0.2469  -0.0111 0.2152  64  PHE B O   
3014 C CB  . PHE B 63  ? 0.8916 0.6281 1.0802 0.1934  -0.0078 0.1654  64  PHE B CB  
3015 C CG  . PHE B 63  ? 0.8737 0.6194 1.0988 0.2024  0.0000  0.1516  64  PHE B CG  
3016 C CD1 . PHE B 63  ? 0.8645 0.5957 1.0967 0.1867  0.0197  0.1317  64  PHE B CD1 
3017 C CD2 . PHE B 63  ? 0.8712 0.6420 1.1239 0.2269  -0.0122 0.1573  64  PHE B CD2 
3018 C CE1 . PHE B 63  ? 0.8586 0.5965 1.1209 0.1953  0.0287  0.1184  64  PHE B CE1 
3019 C CE2 . PHE B 63  ? 0.8747 0.6542 1.1621 0.2355  -0.0025 0.1442  64  PHE B CE2 
3020 C CZ  . PHE B 63  ? 0.8650 0.6265 1.1552 0.2197  0.0187  0.1249  64  PHE B CZ  
3021 N N   . ASP B 64  ? 1.0353 0.6527 1.2161 0.2265  0.0278  0.1892  65  ASP B N   
3022 C CA  . ASP B 64  ? 1.0951 0.6807 1.2855 0.2548  0.0332  0.2029  65  ASP B CA  
3023 C C   . ASP B 64  ? 1.0791 0.6846 1.3108 0.2630  0.0385  0.1845  65  ASP B C   
3024 O O   . ASP B 64  ? 1.0896 0.6749 1.3300 0.2493  0.0589  0.1655  65  ASP B O   
3025 C CB  . ASP B 64  ? 1.1440 0.6613 1.3106 0.2501  0.0570  0.2112  65  ASP B CB  
3026 C CG  . ASP B 64  ? 1.1955 0.6724 1.3662 0.2815  0.0632  0.2296  65  ASP B CG  
3027 O OD1 . ASP B 64  ? 1.2092 0.6818 1.4101 0.2916  0.0731  0.2175  65  ASP B OD1 
3028 O OD2 . ASP B 64  ? 1.2393 0.6869 1.3810 0.2969  0.0591  0.2565  65  ASP B OD2 
3029 N N   . ALA B 65  ? 1.0630 0.7095 1.3203 0.2850  0.0202  0.1893  66  ALA B N   
3030 C CA  . ALA B 65  ? 1.0288 0.7042 1.3288 0.2936  0.0238  0.1722  66  ALA B CA  
3031 C C   . ALA B 65  ? 1.0664 0.6978 1.3809 0.3075  0.0465  0.1685  66  ALA B C   
3032 O O   . ALA B 65  ? 1.0509 0.6899 1.3884 0.3011  0.0606  0.1466  66  ALA B O   
3033 C CB  . ALA B 65  ? 1.0027 0.7304 1.3296 0.3155  -0.0006 0.1802  66  ALA B CB  
3034 N N   . SER B 66  ? 1.1201 0.7027 1.4180 0.3263  0.0513  0.1898  67  SER B N   
3035 C CA  . SER B 66  ? 1.1657 0.6995 1.4755 0.3422  0.0736  0.1889  67  SER B CA  
3036 C C   . SER B 66  ? 1.1814 0.6746 1.4812 0.3150  0.1012  0.1670  67  SER B C   
3037 O O   . SER B 66  ? 1.2090 0.6714 1.5251 0.3229  0.1212  0.1564  67  SER B O   
3038 C CB  . SER B 66  ? 1.2171 0.7056 1.5080 0.3701  0.0717  0.2200  67  SER B CB  
3039 O OG  . SER B 66  ? 1.2327 0.6840 1.4796 0.3535  0.0759  0.2328  67  SER B OG  
3040 N N   . ASP B 67  ? 1.1715 0.6669 1.4461 0.2836  0.1016  0.1591  68  ASP B N   
3041 C CA  . ASP B 67  ? 1.1859 0.6543 1.4527 0.2545  0.1234  0.1353  68  ASP B CA  
3042 C C   . ASP B 67  ? 1.1392 0.6526 1.4233 0.2365  0.1228  0.1062  68  ASP B C   
3043 O O   . ASP B 67  ? 1.1574 0.6643 1.4304 0.2089  0.1329  0.0863  68  ASP B O   
3044 C CB  . ASP B 67  ? 1.2075 0.6538 1.4400 0.2303  0.1256  0.1417  68  ASP B CB  
3045 C CG  . ASP B 67  ? 1.2804 0.6713 1.4899 0.2445  0.1327  0.1692  68  ASP B CG  
3046 O OD1 . ASP B 67  ? 1.3519 0.7030 1.5701 0.2672  0.1448  0.1776  68  ASP B OD1 
3047 O OD2 . ASP B 67  ? 1.2848 0.6699 1.4659 0.2333  0.1277  0.1829  68  ASP B OD2 
3048 N N   . SER B 68  ? 1.0973 0.6566 1.4085 0.2522  0.1114  0.1039  69  SER B N   
3049 C CA  . SER B 68  ? 1.0426 0.6432 1.3680 0.2374  0.1121  0.0791  69  SER B CA  
3050 C C   . SER B 68  ? 1.0422 0.6567 1.4023 0.2575  0.1201  0.0693  69  SER B C   
3051 O O   . SER B 68  ? 1.0295 0.6737 1.4140 0.2806  0.1075  0.0817  69  SER B O   
3052 C CB  . SER B 68  ? 0.9933 0.6471 1.3144 0.2266  0.0903  0.0827  69  SER B CB  
3053 O OG  . SER B 68  ? 0.9510 0.6437 1.2871 0.2166  0.0919  0.0621  69  SER B OG  
3054 N N   . SER B 69  ? 1.0545 0.6493 1.4169 0.2478  0.1409  0.0455  70  SER B N   
3055 C CA  . SER B 69  ? 1.0668 0.6703 1.4593 0.2644  0.1536  0.0323  70  SER B CA  
3056 C C   . SER B 69  ? 1.0244 0.6890 1.4361 0.2616  0.1453  0.0227  70  SER B C   
3057 O O   . SER B 69  ? 1.0136 0.6931 1.4537 0.2760  0.1555  0.0132  70  SER B O   
3058 C CB  . SER B 69  ? 1.0924 0.6524 1.4762 0.2535  0.1795  0.0081  70  SER B CB  
3059 O OG  . SER B 69  ? 1.0700 0.6387 1.4303 0.2226  0.1809  -0.0118 70  SER B OG  
3060 N N   . SER B 70  ? 0.9769 0.6749 1.3739 0.2435  0.1286  0.0257  71  SER B N   
3061 C CA  . SER B 70  ? 0.9373 0.6903 1.3495 0.2384  0.1208  0.0186  71  SER B CA  
3062 C C   . SER B 70  ? 0.9085 0.7028 1.3353 0.2478  0.0965  0.0381  71  SER B C   
3063 O O   . SER B 70  ? 0.8650 0.7045 1.3061 0.2423  0.0896  0.0332  71  SER B O   
3064 C CB  . SER B 70  ? 0.9183 0.6789 1.3031 0.2091  0.1237  0.0014  71  SER B CB  
3065 O OG  . SER B 70  ? 0.9353 0.6802 1.2903 0.1927  0.1138  0.0092  71  SER B OG  
3066 N N   . TYR B 71  ? 0.9397 0.7167 1.3612 0.2616  0.0842  0.0596  72  TYR B N   
3067 C CA  . TYR B 71  ? 0.9458 0.7594 1.3803 0.2742  0.0597  0.0780  72  TYR B CA  
3068 C C   . TYR B 71  ? 0.9577 0.8067 1.4399 0.2989  0.0571  0.0782  72  TYR B C   
3069 O O   . TYR B 71  ? 0.9847 0.8123 1.4863 0.3192  0.0702  0.0777  72  TYR B O   
3070 C CB  . TYR B 71  ? 0.9897 0.7705 1.4005 0.2847  0.0487  0.1017  72  TYR B CB  
3071 C CG  . TYR B 71  ? 0.9995 0.8122 1.4230 0.3050  0.0229  0.1219  72  TYR B CG  
3072 C CD1 . TYR B 71  ? 0.9682 0.8219 1.3850 0.2925  0.0024  0.1243  72  TYR B CD1 
3073 C CD2 . TYR B 71  ? 1.0324 0.8334 1.4736 0.3375  0.0184  0.1382  72  TYR B CD2 
3074 C CE1 . TYR B 71  ? 0.9717 0.8556 1.3986 0.3102  -0.0226 0.1404  72  TYR B CE1 
3075 C CE2 . TYR B 71  ? 1.0417 0.8744 1.4931 0.3572  -0.0078 0.1560  72  TYR B CE2 
3076 C CZ  . TYR B 71  ? 1.0152 0.8900 1.4591 0.3427  -0.0287 0.1561  72  TYR B CZ  
3077 O OH  . TYR B 71  ? 1.0279 0.9359 1.4807 0.3611  -0.0561 0.1712  72  TYR B OH  
3078 N N   . LYS B 72  ? 0.9401 0.8431 1.4426 0.2960  0.0414  0.0777  73  LYS B N   
3079 C CA  . LYS B 72  ? 0.9469 0.8938 1.4992 0.3178  0.0339  0.0792  73  LYS B CA  
3080 C C   . LYS B 72  ? 0.9575 0.9359 1.5131 0.3261  0.0032  0.0966  73  LYS B C   
3081 O O   . LYS B 72  ? 0.9333 0.9296 1.4685 0.3060  -0.0095 0.0966  73  LYS B O   
3082 C CB  . LYS B 72  ? 0.9113 0.8978 1.4911 0.3053  0.0457  0.0589  73  LYS B CB  
3083 C CG  . LYS B 72  ? 0.9343 0.8963 1.5172 0.3033  0.0759  0.0408  73  LYS B CG  
3084 C CD  . LYS B 72  ? 0.9788 0.9497 1.6089 0.3318  0.0861  0.0393  73  LYS B CD  
3085 C CE  . LYS B 72  ? 1.0147 0.9373 1.6350 0.3363  0.1138  0.0275  73  LYS B CE  
3086 N NZ  . LYS B 72  ? 1.0413 0.9625 1.7036 0.3691  0.1212  0.0313  73  LYS B NZ  
3087 N N   . HIS B 73  ? 0.9978 0.9814 1.5773 0.3567  -0.0084 0.1111  74  HIS B N   
3088 C CA  . HIS B 73  ? 1.0029 1.0151 1.5844 0.3697  -0.0395 0.1284  74  HIS B CA  
3089 C C   . HIS B 73  ? 0.9693 1.0496 1.5874 0.3618  -0.0546 0.1179  74  HIS B C   
3090 O O   . HIS B 73  ? 0.9416 1.0528 1.6034 0.3622  -0.0423 0.1025  74  HIS B O   
3091 C CB  . HIS B 73  ? 1.0392 1.0407 1.6400 0.4079  -0.0473 0.1459  74  HIS B CB  
3092 C CG  . HIS B 73  ? 1.0536 1.0869 1.6566 0.4253  -0.0813 0.1636  74  HIS B CG  
3093 N ND1 . HIS B 73  ? 1.0794 1.0850 1.6315 0.4241  -0.0966 0.1824  74  HIS B ND1 
3094 C CD2 . HIS B 73  ? 1.0509 1.1430 1.7004 0.4438  -0.1032 0.1641  74  HIS B CD2 
3095 C CE1 . HIS B 73  ? 1.0848 1.1292 1.6478 0.4419  -0.1273 0.1940  74  HIS B CE1 
3096 N NE2 . HIS B 73  ? 1.0747 1.1735 1.6982 0.4539  -0.1330 0.1827  74  HIS B NE2 
3097 N N   . ASN B 74  ? 0.9796 1.0813 1.5790 0.3534  -0.0794 0.1254  75  ASN B N   
3098 C CA  . ASN B 74  ? 0.9911 1.1577 1.6277 0.3500  -0.0986 0.1176  75  ASN B CA  
3099 C C   . ASN B 74  ? 0.9816 1.1699 1.6143 0.3683  -0.1329 0.1343  75  ASN B C   
3100 O O   . ASN B 74  ? 0.9857 1.2174 1.6650 0.3900  -0.1488 0.1351  75  ASN B O   
3101 C CB  . ASN B 74  ? 1.0007 1.1827 1.6248 0.3150  -0.0925 0.1020  75  ASN B CB  
3102 C CG  . ASN B 74  ? 1.0640 1.3107 1.7332 0.3092  -0.1064 0.0906  75  ASN B CG  
3103 O OD1 . ASN B 74  ? 1.0255 1.2976 1.6887 0.3076  -0.1325 0.0955  75  ASN B OD1 
3104 N ND2 . ASN B 74  ? 1.1679 1.4409 1.8820 0.3051  -0.0877 0.0744  75  ASN B ND2 
3105 N N   . GLY B 75  ? 0.9799 1.1393 1.5573 0.3599  -0.1441 0.1469  76  GLY B N   
3106 C CA  . GLY B 75  ? 0.9915 1.1590 1.5506 0.3789  -0.1750 0.1656  76  GLY B CA  
3107 C C   . GLY B 75  ? 0.9618 1.1852 1.5317 0.3704  -0.2035 0.1593  76  GLY B C   
3108 O O   . GLY B 75  ? 0.9771 1.2077 1.5267 0.3859  -0.2307 0.1738  76  GLY B O   
3109 N N   . THR B 76  ? 0.9187 1.1795 1.5182 0.3460  -0.1969 0.1376  77  THR B N   
3110 C CA  . THR B 76  ? 0.9073 1.2204 1.5207 0.3327  -0.2203 0.1272  77  THR B CA  
3111 C C   . THR B 76  ? 0.9339 1.2241 1.4846 0.3193  -0.2341 0.1359  77  THR B C   
3112 O O   . THR B 76  ? 0.9215 1.1694 1.4299 0.2998  -0.2157 0.1365  77  THR B O   
3113 C CB  . THR B 76  ? 0.8539 1.1989 1.5057 0.3060  -0.2029 0.1030  77  THR B CB  
3114 O OG1 . THR B 76  ? 0.8624 1.2399 1.5782 0.3207  -0.1943 0.0945  77  THR B OG1 
3115 C CG2 . THR B 76  ? 0.8088 1.1972 1.4672 0.2862  -0.2224 0.0909  77  THR B CG2 
3116 N N   . GLU B 77  ? 0.9815 1.3014 1.5274 0.3310  -0.2666 0.1419  78  GLU B N   
3117 C CA  . GLU B 77  ? 1.0168 1.3216 1.5048 0.3203  -0.2824 0.1489  78  GLU B CA  
3118 C C   . GLU B 77  ? 0.9889 1.3078 1.4738 0.2845  -0.2747 0.1291  78  GLU B C   
3119 O O   . GLU B 77  ? 0.9661 1.3293 1.5008 0.2727  -0.2736 0.1098  78  GLU B O   
3120 C CB  . GLU B 77  ? 1.0688 1.4105 1.5581 0.3418  -0.3208 0.1562  78  GLU B CB  
3121 C CG  . GLU B 77  ? 1.1353 1.4372 1.5537 0.3530  -0.3347 0.1786  78  GLU B CG  
3122 C CD  . GLU B 77  ? 1.2152 1.4900 1.6237 0.3904  -0.3398 0.2036  78  GLU B CD  
3123 O OE1 . GLU B 77  ? 1.2412 1.5563 1.6849 0.4176  -0.3644 0.2069  78  GLU B OE1 
3124 O OE2 . GLU B 77  ? 1.2519 1.4646 1.6181 0.3931  -0.3191 0.2201  78  GLU B OE2 
3125 N N   . LEU B 78  ? 1.0084 1.2878 1.4359 0.2676  -0.2672 0.1341  79  LEU B N   
3126 C CA  . LEU B 78  ? 0.9800 1.2664 1.3974 0.2358  -0.2600 0.1178  79  LEU B CA  
3127 C C   . LEU B 78  ? 1.0010 1.2579 1.3540 0.2270  -0.2673 0.1267  79  LEU B C   
3128 O O   . LEU B 78  ? 1.0145 1.2274 1.3244 0.2379  -0.2629 0.1454  79  LEU B O   
3129 C CB  . LEU B 78  ? 0.9734 1.2403 1.4032 0.2173  -0.2268 0.1077  79  LEU B CB  
3130 C CG  . LEU B 78  ? 0.9951 1.2063 1.3810 0.2065  -0.2024 0.1146  79  LEU B CG  
3131 C CD1 . LEU B 78  ? 0.9689 1.1798 1.3747 0.1863  -0.1768 0.0989  79  LEU B CD1 
3132 C CD2 . LEU B 78  ? 1.0470 1.2187 1.4179 0.2279  -0.1950 0.1322  79  LEU B CD2 
3133 N N   . THR B 79  ? 0.9897 1.2699 1.3374 0.2069  -0.2765 0.1126  80  THR B N   
3134 C CA  . THR B 79  ? 1.0107 1.2669 1.2998 0.1960  -0.2818 0.1173  80  THR B CA  
3135 C C   . THR B 79  ? 0.9740 1.2219 1.2569 0.1656  -0.2618 0.1023  80  THR B C   
3136 O O   . THR B 79  ? 0.9216 1.2036 1.2382 0.1506  -0.2633 0.0837  80  THR B O   
3137 C CB  . THR B 79  ? 1.0460 1.3350 1.3240 0.2034  -0.3157 0.1154  80  THR B CB  
3138 O OG1 . THR B 79  ? 1.0493 1.3585 1.3476 0.2333  -0.3367 0.1264  80  THR B OG1 
3139 C CG2 . THR B 79  ? 1.0652 1.3199 1.2729 0.1995  -0.3201 0.1261  80  THR B CG2 
3140 N N   . LEU B 80  ? 1.0120 1.2141 1.2537 0.1575  -0.2425 0.1108  81  LEU B N   
3141 C CA  . LEU B 80  ? 0.9930 1.1822 1.2209 0.1318  -0.2244 0.0997  81  LEU B CA  
3142 C C   . LEU B 80  ? 1.0455 1.2190 1.2216 0.1241  -0.2322 0.1031  81  LEU B C   
3143 O O   . LEU B 80  ? 1.0780 1.2227 1.2135 0.1354  -0.2350 0.1198  81  LEU B O   
3144 C CB  . LEU B 80  ? 0.9697 1.1233 1.1927 0.1268  -0.1964 0.1038  81  LEU B CB  
3145 C CG  . LEU B 80  ? 0.9461 1.0981 1.2060 0.1345  -0.1813 0.1030  81  LEU B CG  
3146 C CD1 . LEU B 80  ? 0.9103 1.1050 1.2239 0.1330  -0.1840 0.0883  81  LEU B CD1 
3147 C CD2 . LEU B 80  ? 0.9729 1.1040 1.2273 0.1582  -0.1840 0.1200  81  LEU B CD2 
3148 N N   . ARG B 81  ? 1.0827 1.2730 1.2595 0.1051  -0.2339 0.0872  82  ARG B N   
3149 C CA  . ARG B 81  ? 1.1304 1.3085 1.2603 0.0965  -0.2404 0.0868  82  ARG B CA  
3150 C C   . ARG B 81  ? 1.1257 1.2824 1.2409 0.0755  -0.2176 0.0796  82  ARG B C   
3151 O O   . ARG B 81  ? 1.1731 1.3108 1.2462 0.0684  -0.2160 0.0812  82  ARG B O   
3152 C CB  . ARG B 81  ? 1.1123 1.3291 1.2520 0.0940  -0.2656 0.0731  82  ARG B CB  
3153 N N   . THR B 86  ? 1.1410 1.2065 1.1086 0.1188  -0.2312 0.1402  87  THR B N   
3154 C CA  . THR B 86  ? 1.1803 1.2741 1.1764 0.1382  -0.2534 0.1430  87  THR B CA  
3155 C C   . THR B 86  ? 1.1785 1.2465 1.1756 0.1588  -0.2472 0.1634  87  THR B C   
3156 O O   . THR B 86  ? 1.1885 1.2186 1.1415 0.1676  -0.2413 0.1822  87  THR B O   
3157 C CB  . THR B 86  ? 1.2144 1.3315 1.1866 0.1468  -0.2834 0.1416  87  THR B CB  
3158 O OG1 . THR B 86  ? 1.2070 1.3458 1.1826 0.1256  -0.2864 0.1199  87  THR B OG1 
3159 C CG2 . THR B 86  ? 1.1929 1.3476 1.2024 0.1672  -0.3089 0.1421  87  THR B CG2 
3160 N N   . VAL B 87  ? 1.1338 1.2215 1.1818 0.1660  -0.2469 0.1591  88  VAL B N   
3161 C CA  . VAL B 87  ? 1.1206 1.1827 1.1797 0.1815  -0.2346 0.1734  88  VAL B CA  
3162 C C   . VAL B 87  ? 1.0824 1.1789 1.1937 0.1986  -0.2478 0.1701  88  VAL B C   
3163 O O   . VAL B 87  ? 1.0355 1.1715 1.1902 0.1891  -0.2519 0.1516  88  VAL B O   
3164 C CB  . VAL B 87  ? 1.1110 1.1433 1.1735 0.1639  -0.2034 0.1692  88  VAL B CB  
3165 C CG1 . VAL B 87  ? 1.0917 1.1313 1.2027 0.1671  -0.1917 0.1627  88  VAL B CG1 
3166 C CG2 . VAL B 87  ? 1.1473 1.1289 1.1633 0.1658  -0.1884 0.1870  88  VAL B CG2 
3167 N N   . SER B 88  ? 1.0889 1.1692 1.1962 0.2242  -0.2530 0.1885  89  SER B N   
3168 C CA  . SER B 88  ? 1.0541 1.1645 1.2111 0.2443  -0.2644 0.1877  89  SER B CA  
3169 C C   . SER B 88  ? 1.0451 1.1193 1.2121 0.2574  -0.2439 0.1994  89  SER B C   
3170 O O   . SER B 88  ? 1.0631 1.0872 1.1899 0.2595  -0.2293 0.2152  89  SER B O   
3171 C CB  . SER B 88  ? 1.1097 1.2443 1.2571 0.2688  -0.2976 0.1980  89  SER B CB  
3172 O OG  . SER B 88  ? 1.1348 1.2973 1.2645 0.2559  -0.3165 0.1866  89  SER B OG  
3173 N N   . GLY B 89  ? 1.0101 1.1095 1.2321 0.2649  -0.2412 0.1905  90  GLY B N   
3174 C CA  . GLY B 89  ? 1.0069 1.0766 1.2447 0.2800  -0.2234 0.1992  90  GLY B CA  
3175 C C   . GLY B 89  ? 0.9760 1.0841 1.2780 0.2896  -0.2240 0.1871  90  GLY B C   
3176 O O   . GLY B 89  ? 0.9886 1.1489 1.3240 0.2930  -0.2446 0.1773  90  GLY B O   
3177 N N   . PHE B 90  ? 0.9493 1.0315 1.2691 0.2933  -0.2003 0.1865  91  PHE B N   
3178 C CA  . PHE B 90  ? 0.9078 1.0202 1.2873 0.3030  -0.1951 0.1751  91  PHE B CA  
3179 C C   . PHE B 90  ? 0.8672 0.9701 1.2625 0.2808  -0.1661 0.1575  91  PHE B C   
3180 O O   . PHE B 90  ? 0.8495 0.9135 1.2098 0.2634  -0.1486 0.1572  91  PHE B O   
3181 C CB  . PHE B 90  ? 0.9279 1.0246 1.3211 0.3375  -0.1977 0.1915  91  PHE B CB  
3182 C CG  . PHE B 90  ? 0.9492 0.9796 1.3099 0.3417  -0.1743 0.2043  91  PHE B CG  
3183 C CD1 . PHE B 90  ? 0.9810 0.9679 1.2874 0.3487  -0.1783 0.2258  91  PHE B CD1 
3184 C CD2 . PHE B 90  ? 0.9378 0.9482 1.3223 0.3389  -0.1473 0.1944  91  PHE B CD2 
3185 C CE1 . PHE B 90  ? 1.0112 0.9358 1.2909 0.3508  -0.1547 0.2368  91  PHE B CE1 
3186 C CE2 . PHE B 90  ? 0.9761 0.9252 1.3330 0.3413  -0.1256 0.2039  91  PHE B CE2 
3187 C CZ  . PHE B 90  ? 1.0030 0.9091 1.3094 0.3468  -0.1290 0.2251  91  PHE B CZ  
3188 N N   . LEU B 91  ? 0.8293 0.9692 1.2775 0.2822  -0.1613 0.1426  92  LEU B N   
3189 C CA  . LEU B 91  ? 0.7692 0.9062 1.2336 0.2629  -0.1353 0.1251  92  LEU B CA  
3190 C C   . LEU B 91  ? 0.7688 0.8695 1.2400 0.2748  -0.1124 0.1268  92  LEU B C   
3191 O O   . LEU B 91  ? 0.8047 0.9078 1.3014 0.3010  -0.1160 0.1343  92  LEU B O   
3192 C CB  . LEU B 91  ? 0.7322 0.9254 1.2484 0.2568  -0.1385 0.1079  92  LEU B CB  
3193 C CG  . LEU B 91  ? 0.7009 0.9013 1.2261 0.2309  -0.1173 0.0894  92  LEU B CG  
3194 C CD1 . LEU B 91  ? 0.6919 0.8849 1.1782 0.2055  -0.1201 0.0865  92  LEU B CD1 
3195 C CD2 . LEU B 91  ? 0.6714 0.9245 1.2552 0.2314  -0.1177 0.0754  92  LEU B CD2 
3196 N N   . SER B 92  ? 0.7424 0.8102 1.1906 0.2558  -0.0897 0.1189  93  SER B N   
3197 C CA  . SER B 92  ? 0.7507 0.7804 1.2000 0.2617  -0.0658 0.1164  93  SER B CA  
3198 C C   . SER B 92  ? 0.7340 0.7657 1.1889 0.2404  -0.0440 0.0962  93  SER B C   
3199 O O   . SER B 92  ? 0.7025 0.7521 1.1473 0.2190  -0.0458 0.0880  93  SER B O   
3200 C CB  . SER B 92  ? 0.7737 0.7481 1.1767 0.2609  -0.0605 0.1296  93  SER B CB  
3201 O OG  . SER B 92  ? 0.8229 0.7869 1.2178 0.2848  -0.0767 0.1503  93  SER B OG  
3202 N N   . GLN B 93  ? 0.7494 0.7611 1.2182 0.2474  -0.0230 0.0886  94  GLN B N   
3203 C CA  . GLN B 93  ? 0.7266 0.7341 1.1940 0.2295  -0.0010 0.0699  94  GLN B CA  
3204 C C   . GLN B 93  ? 0.7494 0.7053 1.1903 0.2260  0.0181  0.0661  94  GLN B C   
3205 O O   . GLN B 93  ? 0.7925 0.7207 1.2401 0.2445  0.0245  0.0720  94  GLN B O   
3206 C CB  . GLN B 93  ? 0.7110 0.7522 1.2250 0.2376  0.0091  0.0577  94  GLN B CB  
3207 C CG  . GLN B 93  ? 0.6912 0.7331 1.1992 0.2183  0.0302  0.0393  94  GLN B CG  
3208 C CD  . GLN B 93  ? 0.6824 0.7542 1.2342 0.2259  0.0443  0.0277  94  GLN B CD  
3209 O OE1 . GLN B 93  ? 0.7142 0.7672 1.2737 0.2342  0.0644  0.0192  94  GLN B OE1 
3210 N NE2 . GLN B 93  ? 0.6450 0.7627 1.2262 0.2222  0.0355  0.0259  94  GLN B NE2 
3211 N N   . ASP B 94  ? 0.7194 0.6628 1.1314 0.2025  0.0270  0.0555  95  ASP B N   
3212 C CA  . ASP B 94  ? 0.7400 0.6401 1.1284 0.1946  0.0449  0.0469  95  ASP B CA  
3213 C C   . ASP B 94  ? 0.7330 0.6379 1.1021 0.1709  0.0541  0.0303  95  ASP B C   
3214 O O   . ASP B 94  ? 0.6895 0.6271 1.0604 0.1608  0.0473  0.0277  95  ASP B O   
3215 C CB  . ASP B 94  ? 0.7626 0.6247 1.1221 0.1940  0.0396  0.0608  95  ASP B CB  
3216 C CG  . ASP B 94  ? 0.8138 0.6280 1.1684 0.2007  0.0575  0.0576  95  ASP B CG  
3217 O OD1 . ASP B 94  ? 0.8253 0.6298 1.1819 0.1937  0.0749  0.0390  95  ASP B OD1 
3218 O OD2 . ASP B 94  ? 0.8433 0.6272 1.1898 0.2129  0.0548  0.0736  95  ASP B OD2 
3219 N N   . ILE B 95  ? 0.7774 0.6488 1.1277 0.1628  0.0694  0.0187  96  ILE B N   
3220 C CA  . ILE B 95  ? 0.7827 0.6546 1.1092 0.1415  0.0760  0.0032  96  ILE B CA  
3221 C C   . ILE B 95  ? 0.7792 0.6435 1.0776 0.1255  0.0648  0.0098  96  ILE B C   
3222 O O   . ILE B 95  ? 0.8148 0.6483 1.1015 0.1254  0.0647  0.0168  96  ILE B O   
3223 C CB  . ILE B 95  ? 0.8139 0.6570 1.1332 0.1392  0.0960  -0.0152 96  ILE B CB  
3224 C CG1 . ILE B 95  ? 0.8306 0.6835 1.1779 0.1551  0.1094  -0.0226 96  ILE B CG1 
3225 C CG2 . ILE B 95  ? 0.7905 0.6369 1.0827 0.1184  0.0995  -0.0309 96  ILE B CG2 
3226 C CD1 . ILE B 95  ? 0.8759 0.6942 1.2205 0.1591  0.1295  -0.0385 96  ILE B CD1 
3227 N N   . ILE B 96  ? 0.7508 0.6418 1.0393 0.1126  0.0571  0.0080  97  ILE B N   
3228 C CA  . ILE B 96  ? 0.7412 0.6300 1.0051 0.0972  0.0477  0.0124  97  ILE B CA  
3229 C C   . ILE B 96  ? 0.7555 0.6424 0.9991 0.0803  0.0545  -0.0039 97  ILE B C   
3230 O O   . ILE B 96  ? 0.7556 0.6614 0.9996 0.0778  0.0589  -0.0135 97  ILE B O   
3231 C CB  . ILE B 96  ? 0.7022 0.6209 0.9690 0.0966  0.0315  0.0246  97  ILE B CB  
3232 C CG1 . ILE B 96  ? 0.7258 0.6445 1.0074 0.1134  0.0211  0.0411  97  ILE B CG1 
3233 C CG2 . ILE B 96  ? 0.6782 0.5961 0.9194 0.0803  0.0245  0.0265  97  ILE B CG2 
3234 C CD1 . ILE B 96  ? 0.6806 0.6271 0.9639 0.1133  0.0035  0.0518  97  ILE B CD1 
3235 N N   . THR B 97  ? 0.7753 0.6396 1.0016 0.0692  0.0558  -0.0070 98  THR B N   
3236 C CA  . THR B 97  ? 0.7918 0.6575 0.9997 0.0530  0.0587  -0.0226 98  THR B CA  
3237 C C   . THR B 97  ? 0.7659 0.6504 0.9611 0.0421  0.0468  -0.0162 98  THR B C   
3238 O O   . THR B 97  ? 0.7791 0.6552 0.9702 0.0389  0.0411  -0.0051 98  THR B O   
3239 C CB  . THR B 97  ? 0.8221 0.6553 1.0233 0.0452  0.0680  -0.0338 98  THR B CB  
3240 O OG1 . THR B 97  ? 0.8987 0.7104 1.1121 0.0568  0.0801  -0.0390 98  THR B OG1 
3241 C CG2 . THR B 97  ? 0.8233 0.6637 1.0088 0.0301  0.0693  -0.0533 98  THR B CG2 
3242 N N   . VAL B 98  ? 0.7368 0.6448 0.9244 0.0374  0.0445  -0.0228 99  VAL B N   
3243 C CA  . VAL B 98  ? 0.7314 0.6569 0.9069 0.0280  0.0349  -0.0187 99  VAL B CA  
3244 C C   . VAL B 98  ? 0.7540 0.6853 0.9140 0.0191  0.0373  -0.0347 99  VAL B C   
3245 O O   . VAL B 98  ? 0.8135 0.7557 0.9685 0.0225  0.0414  -0.0415 99  VAL B O   
3246 C CB  . VAL B 98  ? 0.7244 0.6743 0.9058 0.0332  0.0287  -0.0087 99  VAL B CB  
3247 C CG1 . VAL B 98  ? 0.7014 0.6626 0.8722 0.0251  0.0188  -0.0015 99  VAL B CG1 
3248 C CG2 . VAL B 98  ? 0.7351 0.6854 0.9366 0.0454  0.0268  0.0022  99  VAL B CG2 
3249 N N   . GLY B 99  ? 0.7368 0.6614 0.8891 0.0080  0.0351  -0.0410 100 GLY B N   
3250 C CA  . GLY B 99  ? 0.7370 0.6687 0.8761 0.0000  0.0349  -0.0580 100 GLY B CA  
3251 C C   . GLY B 99  ? 0.7937 0.7112 0.9312 0.0023  0.0447  -0.0740 100 GLY B C   
3252 O O   . GLY B 99  ? 0.8493 0.7428 0.9957 0.0011  0.0518  -0.0784 100 GLY B O   
3253 N N   . GLY B 100 ? 0.7988 0.7283 0.9234 0.0062  0.0467  -0.0824 101 GLY B N   
3254 C CA  . GLY B 100 ? 0.8527 0.7693 0.9716 0.0092  0.0572  -0.0991 101 GLY B CA  
3255 C C   . GLY B 100 ? 0.8570 0.7718 0.9834 0.0224  0.0676  -0.0938 101 GLY B C   
3256 O O   . GLY B 100 ? 0.8700 0.7806 0.9860 0.0264  0.0773  -0.1068 101 GLY B O   
3257 N N   . ILE B 101 ? 0.8395 0.7588 0.9845 0.0292  0.0658  -0.0757 102 ILE B N   
3258 C CA  . ILE B 101 ? 0.8294 0.7550 0.9882 0.0412  0.0738  -0.0692 102 ILE B CA  
3259 C C   . ILE B 101 ? 0.8123 0.7258 0.9974 0.0503  0.0758  -0.0594 102 ILE B C   
3260 O O   . ILE B 101 ? 0.8008 0.7122 0.9932 0.0489  0.0663  -0.0468 102 ILE B O   
3261 C CB  . ILE B 101 ? 0.8056 0.7561 0.9626 0.0418  0.0687  -0.0577 102 ILE B CB  
3262 C CG1 . ILE B 101 ? 0.8244 0.7829 0.9544 0.0389  0.0722  -0.0673 102 ILE B CG1 
3263 C CG2 . ILE B 101 ? 0.7828 0.7430 0.9647 0.0522  0.0745  -0.0484 102 ILE B CG2 
3264 C CD1 . ILE B 101 ? 0.8379 0.8148 0.9592 0.0364  0.0656  -0.0566 102 ILE B CD1 
3265 N N   . THR B 102 ? 0.8199 0.7252 1.0175 0.0607  0.0885  -0.0651 103 THR B N   
3266 C CA  . THR B 102 ? 0.8176 0.7148 1.0427 0.0736  0.0909  -0.0553 103 THR B CA  
3267 C C   . THR B 102 ? 0.7892 0.7119 1.0359 0.0837  0.0931  -0.0476 103 THR B C   
3268 O O   . THR B 102 ? 0.8027 0.7351 1.0465 0.0849  0.1044  -0.0564 103 THR B O   
3269 C CB  . THR B 102 ? 0.8613 0.7294 1.0909 0.0798  0.1049  -0.0675 103 THR B CB  
3270 O OG1 . THR B 102 ? 0.9129 0.7844 1.1359 0.0822  0.1190  -0.0829 103 THR B OG1 
3271 C CG2 . THR B 102 ? 0.8746 0.7166 1.0873 0.0677  0.1037  -0.0763 103 THR B CG2 
3272 N N   . VAL B 103 ? 0.7608 0.6948 1.0284 0.0903  0.0824  -0.0318 104 VAL B N   
3273 C CA  . VAL B 103 ? 0.7369 0.6988 1.0314 0.0987  0.0826  -0.0255 104 VAL B CA  
3274 C C   . VAL B 103 ? 0.7601 0.7231 1.0851 0.1144  0.0769  -0.0146 104 VAL B C   
3275 O O   . VAL B 103 ? 0.7760 0.7276 1.0967 0.1159  0.0646  -0.0036 104 VAL B O   
3276 C CB  . VAL B 103 ? 0.7010 0.6878 0.9894 0.0887  0.0720  -0.0185 104 VAL B CB  
3277 C CG1 . VAL B 103 ? 0.6803 0.6649 0.9609 0.0843  0.0540  -0.0063 104 VAL B CG1 
3278 C CG2 . VAL B 103 ? 0.6523 0.6681 0.9705 0.0943  0.0751  -0.0157 104 VAL B CG2 
3279 N N   . THR B 104 ? 0.7589 0.7352 1.1139 0.1270  0.0868  -0.0176 105 THR B N   
3280 C CA  . THR B 104 ? 0.7414 0.7288 1.1313 0.1443  0.0795  -0.0070 105 THR B CA  
3281 C C   . THR B 104 ? 0.7105 0.7300 1.1116 0.1406  0.0613  0.0039  105 THR B C   
3282 O O   . THR B 104 ? 0.6770 0.7234 1.0881 0.1334  0.0641  -0.0001 105 THR B O   
3283 C CB  . THR B 104 ? 0.7500 0.7465 1.1730 0.1588  0.0963  -0.0150 105 THR B CB  
3284 O OG1 . THR B 104 ? 0.7775 0.7398 1.1860 0.1616  0.1128  -0.0263 105 THR B OG1 
3285 C CG2 . THR B 104 ? 0.7483 0.7608 1.2111 0.1789  0.0864  -0.0038 105 THR B CG2 
3286 N N   . GLN B 105 ? 0.7112 0.7246 1.1075 0.1449  0.0438  0.0173  106 GLN B N   
3287 C CA  . GLN B 105 ? 0.6841 0.7214 1.0812 0.1398  0.0246  0.0268  106 GLN B CA  
3288 C C   . GLN B 105 ? 0.7042 0.7515 1.1231 0.1575  0.0082  0.0399  106 GLN B C   
3289 O O   . GLN B 105 ? 0.7540 0.7755 1.1689 0.1707  0.0078  0.0473  106 GLN B O   
3290 C CB  . GLN B 105 ? 0.6749 0.6939 1.0318 0.1240  0.0179  0.0301  106 GLN B CB  
3291 C CG  . GLN B 105 ? 0.6518 0.6911 1.0027 0.1166  0.0000  0.0382  106 GLN B CG  
3292 C CD  . GLN B 105 ? 0.6448 0.7179 1.0141 0.1090  0.0007  0.0317  106 GLN B CD  
3293 O OE1 . GLN B 105 ? 0.6482 0.7236 1.0174 0.1020  0.0161  0.0215  106 GLN B OE1 
3294 N NE2 . GLN B 105 ? 0.6295 0.7278 1.0130 0.1100  -0.0155 0.0373  106 GLN B NE2 
3295 N N   . MET B 106 ? 0.6938 0.7784 1.1353 0.1579  -0.0051 0.0422  107 MET B N   
3296 C CA  . MET B 106 ? 0.7000 0.7998 1.1561 0.1725  -0.0263 0.0546  107 MET B CA  
3297 C C   . MET B 106 ? 0.6779 0.7675 1.0968 0.1622  -0.0422 0.0638  107 MET B C   
3298 O O   . MET B 106 ? 0.6631 0.7627 1.0681 0.1441  -0.0435 0.0586  107 MET B O   
3299 C CB  . MET B 106 ? 0.7352 0.8836 1.2360 0.1759  -0.0336 0.0494  107 MET B CB  
3300 C CG  . MET B 106 ? 0.8205 0.9884 1.3577 0.2007  -0.0463 0.0566  107 MET B CG  
3301 S SD  . MET B 106 ? 0.9055 1.0985 1.4990 0.2121  -0.0267 0.0440  107 MET B SD  
3302 C CE  . MET B 106 ? 0.8487 1.0942 1.4755 0.1945  -0.0293 0.0318  107 MET B CE  
3303 N N   . PHE B 107 ? 0.6763 0.7433 1.0777 0.1745  -0.0524 0.0780  108 PHE B N   
3304 C CA  . PHE B 107 ? 0.6647 0.7176 1.0279 0.1663  -0.0649 0.0879  108 PHE B CA  
3305 C C   . PHE B 107 ? 0.6920 0.7482 1.0532 0.1852  -0.0858 0.1041  108 PHE B C   
3306 O O   . PHE B 107 ? 0.7028 0.7637 1.0893 0.2068  -0.0892 0.1096  108 PHE B O   
3307 C CB  . PHE B 107 ? 0.6571 0.6657 0.9840 0.1559  -0.0503 0.0887  108 PHE B CB  
3308 C CG  . PHE B 107 ? 0.6759 0.6481 0.9996 0.1713  -0.0420 0.0967  108 PHE B CG  
3309 C CD1 . PHE B 107 ? 0.6761 0.6388 1.0207 0.1777  -0.0249 0.0873  108 PHE B CD1 
3310 C CD2 . PHE B 107 ? 0.6961 0.6406 0.9937 0.1795  -0.0495 0.1137  108 PHE B CD2 
3311 C CE1 . PHE B 107 ? 0.7133 0.6391 1.0554 0.1919  -0.0158 0.0939  108 PHE B CE1 
3312 C CE2 . PHE B 107 ? 0.7389 0.6454 1.0332 0.1938  -0.0398 0.1221  108 PHE B CE2 
3313 C CZ  . PHE B 107 ? 0.7461 0.6429 1.0637 0.1999  -0.0231 0.1117  108 PHE B CZ  
3314 N N   . GLY B 108 ? 0.6904 0.7437 1.0201 0.1782  -0.0995 0.1118  109 GLY B N   
3315 C CA  . GLY B 108 ? 0.7250 0.7763 1.0408 0.1953  -0.1196 0.1285  109 GLY B CA  
3316 C C   . GLY B 108 ? 0.7752 0.7756 1.0548 0.2022  -0.1116 0.1439  109 GLY B C   
3317 O O   . GLY B 108 ? 0.7802 0.7527 1.0302 0.1852  -0.0987 0.1425  109 GLY B O   
3318 N N   . GLU B 109 ? 0.8203 0.8086 1.1049 0.2274  -0.1180 0.1584  110 GLU B N   
3319 C CA  . GLU B 109 ? 0.8711 0.8104 1.1179 0.2368  -0.1136 0.1773  110 GLU B CA  
3320 C C   . GLU B 109 ? 0.8913 0.8388 1.1081 0.2441  -0.1368 0.1918  110 GLU B C   
3321 O O   . GLU B 109 ? 0.9112 0.8933 1.1466 0.2610  -0.1589 0.1952  110 GLU B O   
3322 C CB  . GLU B 109 ? 0.9179 0.8351 1.1831 0.2625  -0.1071 0.1868  110 GLU B CB  
3323 C CG  . GLU B 109 ? 0.9225 0.8114 1.2003 0.2546  -0.0796 0.1751  110 GLU B CG  
3324 C CD  . GLU B 109 ? 0.9695 0.8209 1.2533 0.2789  -0.0699 0.1872  110 GLU B CD  
3325 O OE1 . GLU B 109 ? 0.9680 0.8303 1.2899 0.2902  -0.0624 0.1782  110 GLU B OE1 
3326 O OE2 . GLU B 109 ? 1.0134 0.8222 1.2634 0.2870  -0.0679 0.2059  110 GLU B OE2 
3327 N N   . VAL B 110 ? 0.9084 0.8259 1.0796 0.2314  -0.1318 0.1994  111 VAL B N   
3328 C CA  . VAL B 110 ? 0.9327 0.8577 1.0690 0.2344  -0.1518 0.2106  111 VAL B CA  
3329 C C   . VAL B 110 ? 1.0221 0.9057 1.1202 0.2553  -0.1542 0.2365  111 VAL B C   
3330 O O   . VAL B 110 ? 1.0551 0.8895 1.1316 0.2522  -0.1328 0.2453  111 VAL B O   
3331 C CB  . VAL B 110 ? 0.8960 0.8239 1.0077 0.2063  -0.1468 0.2002  111 VAL B CB  
3332 C CG1 . VAL B 110 ? 0.9153 0.8423 0.9834 0.2087  -0.1634 0.2118  111 VAL B CG1 
3333 C CG2 . VAL B 110 ? 0.8507 0.8240 0.9989 0.1910  -0.1501 0.1777  111 VAL B CG2 
3334 N N   . THR B 111 ? 1.0655 0.9699 1.1564 0.2768  -0.1805 0.2482  112 THR B N   
3335 C CA  . THR B 111 ? 1.1421 1.0112 1.1950 0.3022  -0.1871 0.2753  112 THR B CA  
3336 C C   . THR B 111 ? 1.1826 1.0523 1.1836 0.3006  -0.2036 0.2853  112 THR B C   
3337 O O   . THR B 111 ? 1.2402 1.0717 1.1955 0.3166  -0.2044 0.3091  112 THR B O   
3338 C CB  . THR B 111 ? 1.1595 1.0504 1.2444 0.3356  -0.2061 0.2839  112 THR B CB  
3339 O OG1 . THR B 111 ? 1.1254 1.0820 1.2477 0.3346  -0.2304 0.2670  112 THR B OG1 
3340 C CG2 . THR B 111 ? 1.1629 1.0340 1.2858 0.3431  -0.1848 0.2810  112 THR B CG2 
3341 N N   . GLU B 112 ? 1.1720 1.0824 1.1783 0.2813  -0.2151 0.2670  113 GLU B N   
3342 C CA  . GLU B 112 ? 1.2292 1.1475 1.1901 0.2782  -0.2324 0.2712  113 GLU B CA  
3343 C C   . GLU B 112 ? 1.2024 1.1106 1.1433 0.2458  -0.2143 0.2583  113 GLU B C   
3344 O O   . GLU B 112 ? 1.1568 1.1017 1.1220 0.2270  -0.2183 0.2366  113 GLU B O   
3345 C CB  . GLU B 112 ? 1.2365 1.2160 1.2239 0.2864  -0.2656 0.2595  113 GLU B CB  
3346 C CG  . GLU B 112 ? 1.3206 1.3055 1.2632 0.3057  -0.2936 0.2744  113 GLU B CG  
3347 C CD  . GLU B 112 ? 1.3575 1.3915 1.3358 0.3310  -0.3263 0.2733  113 GLU B CD  
3348 O OE1 . GLU B 112 ? 1.3297 1.4062 1.3706 0.3263  -0.3296 0.2544  113 GLU B OE1 
3349 O OE2 . GLU B 112 ? 1.4176 1.4486 1.3614 0.3566  -0.3489 0.2917  113 GLU B OE2 
3350 N N   . MET B 113 ? 1.2539 1.1114 1.1518 0.2402  -0.1933 0.2722  114 MET B N   
3351 C CA  . MET B 113 ? 1.2565 1.1004 1.1381 0.2113  -0.1726 0.2616  114 MET B CA  
3352 C C   . MET B 113 ? 1.2987 1.1140 1.1166 0.2093  -0.1703 0.2758  114 MET B C   
3353 O O   . MET B 113 ? 1.3204 1.0867 1.1075 0.2104  -0.1496 0.2924  114 MET B O   
3354 C CB  . MET B 113 ? 1.2806 1.0942 1.1832 0.1994  -0.1427 0.2580  114 MET B CB  
3355 C CG  . MET B 113 ? 1.3228 1.1417 1.2313 0.1693  -0.1257 0.2394  114 MET B CG  
3356 S SD  . MET B 113 ? 1.3252 1.1321 1.2743 0.1540  -0.0995 0.2251  114 MET B SD  
3357 C CE  . MET B 113 ? 1.4061 1.1493 1.3283 0.1620  -0.0772 0.2466  114 MET B CE  
3358 N N   . PRO B 114 ? 1.3054 1.1500 1.1033 0.2050  -0.1897 0.2680  115 PRO B N   
3359 C CA  . PRO B 114 ? 1.3392 1.1590 1.0726 0.2058  -0.1897 0.2812  115 PRO B CA  
3360 C C   . PRO B 114 ? 1.3127 1.1047 1.0253 0.1805  -0.1601 0.2768  115 PRO B C   
3361 O O   . PRO B 114 ? 1.2391 1.0461 0.9877 0.1597  -0.1475 0.2576  115 PRO B O   
3362 C CB  . PRO B 114 ? 1.3377 1.2034 1.0659 0.2068  -0.2200 0.2682  115 PRO B CB  
3363 C CG  . PRO B 114 ? 1.2726 1.1819 1.0622 0.1921  -0.2236 0.2424  115 PRO B CG  
3364 C CD  . PRO B 114 ? 1.2491 1.1490 1.0833 0.1964  -0.2092 0.2446  115 PRO B CD  
3365 N N   . ALA B 115 ? 1.3565 1.1093 1.0115 0.1837  -0.1494 0.2951  116 ALA B N   
3366 C CA  . ALA B 115 ? 1.3642 1.0887 0.9959 0.1617  -0.1200 0.2934  116 ALA B CA  
3367 C C   . ALA B 115 ? 1.3318 1.0898 0.9785 0.1384  -0.1199 0.2680  116 ALA B C   
3368 O O   . ALA B 115 ? 1.2744 1.0280 0.9430 0.1182  -0.0975 0.2567  116 ALA B O   
3369 C CB  . ALA B 115 ? 1.4054 1.0885 0.9679 0.1710  -0.1124 0.3167  116 ALA B CB  
3370 N N   . LEU B 116 ? 1.3583 1.1496 0.9939 0.1419  -0.1453 0.2586  117 LEU B N   
3371 C CA  . LEU B 116 ? 1.3395 1.1656 0.9970 0.1223  -0.1485 0.2330  117 LEU B CA  
3372 C C   . LEU B 116 ? 1.2827 1.1508 0.9989 0.1242  -0.1665 0.2176  117 LEU B C   
3373 O O   . LEU B 116 ? 1.3292 1.2185 1.0498 0.1413  -0.1923 0.2205  117 LEU B O   
3374 C CB  . LEU B 116 ? 1.3658 1.2014 0.9768 0.1223  -0.1633 0.2290  117 LEU B CB  
3375 C CG  . LEU B 116 ? 1.3558 1.1852 0.9421 0.1023  -0.1463 0.2173  117 LEU B CG  
3376 C CD1 . LEU B 116 ? 1.3832 1.2271 0.9272 0.1064  -0.1679 0.2113  117 LEU B CD1 
3377 C CD2 . LEU B 116 ? 1.2819 1.1327 0.9165 0.0812  -0.1343 0.1949  117 LEU B CD2 
3378 N N   . PRO B 117 ? 1.2426 1.1235 1.0035 0.1080  -0.1531 0.2017  118 PRO B N   
3379 C CA  . PRO B 117 ? 1.2336 1.0956 0.9937 0.0885  -0.1253 0.1964  118 PRO B CA  
3380 C C   . PRO B 117 ? 1.2124 1.0481 0.9927 0.0867  -0.1033 0.2038  118 PRO B C   
3381 O O   . PRO B 117 ? 1.1767 1.0013 0.9623 0.0704  -0.0816 0.1977  118 PRO B O   
3382 C CB  . PRO B 117 ? 1.1794 1.0767 0.9758 0.0731  -0.1284 0.1725  118 PRO B CB  
3383 C CG  . PRO B 117 ? 1.1507 1.0790 0.9850 0.0831  -0.1491 0.1668  118 PRO B CG  
3384 C CD  . PRO B 117 ? 1.2038 1.1265 1.0157 0.1054  -0.1676 0.1837  118 PRO B CD  
3385 N N   . PHE B 118 ? 1.2216 1.0476 1.0135 0.1033  -0.1087 0.2158  119 PHE B N   
3386 C CA  . PHE B 118 ? 1.1934 1.0008 1.0148 0.1003  -0.0901 0.2169  119 PHE B CA  
3387 C C   . PHE B 118 ? 1.2017 0.9623 0.9984 0.0957  -0.0642 0.2306  119 PHE B C   
3388 O O   . PHE B 118 ? 1.2179 0.9630 1.0397 0.0902  -0.0477 0.2283  119 PHE B O   
3389 C CB  . PHE B 118 ? 1.1966 1.0162 1.0512 0.1175  -0.1036 0.2190  119 PHE B CB  
3390 C CG  . PHE B 118 ? 1.1623 1.0295 1.0538 0.1157  -0.1217 0.2009  119 PHE B CG  
3391 C CD1 . PHE B 118 ? 1.1175 1.0023 1.0465 0.1003  -0.1120 0.1826  119 PHE B CD1 
3392 C CD2 . PHE B 118 ? 1.1699 1.0643 1.0577 0.1287  -0.1479 0.2017  119 PHE B CD2 
3393 C CE1 . PHE B 118 ? 1.0876 1.0124 1.0487 0.0978  -0.1255 0.1671  119 PHE B CE1 
3394 C CE2 . PHE B 118 ? 1.1245 1.0621 1.0489 0.1247  -0.1622 0.1840  119 PHE B CE2 
3395 C CZ  . PHE B 118 ? 1.0881 1.0391 1.0488 0.1091  -0.1497 0.1674  119 PHE B CZ  
3396 N N   . MET B 119 ? 1.2173 0.9551 0.9652 0.0967  -0.0592 0.2436  120 MET B N   
3397 C CA  . MET B 119 ? 1.2280 0.9249 0.9541 0.0861  -0.0301 0.2530  120 MET B CA  
3398 C C   . MET B 119 ? 1.1852 0.8950 0.9225 0.0616  -0.0140 0.2352  120 MET B C   
3399 O O   . MET B 119 ? 1.1790 0.8632 0.9121 0.0489  0.0115  0.2375  120 MET B O   
3400 C CB  . MET B 119 ? 1.3041 0.9662 0.9703 0.0986  -0.0279 0.2767  120 MET B CB  
3401 C CG  . MET B 119 ? 1.3586 0.9889 1.0115 0.1216  -0.0312 0.2996  120 MET B CG  
3402 S SD  . MET B 119 ? 1.3625 0.9523 1.0446 0.1157  -0.0019 0.3043  120 MET B SD  
3403 C CE  . MET B 119 ? 1.4188 0.9687 1.0688 0.0946  0.0342  0.3104  120 MET B CE  
3404 N N   . LEU B 120 ? 1.1455 0.8948 0.8983 0.0558  -0.0287 0.2177  121 LEU B N   
3405 C CA  . LEU B 120 ? 1.1261 0.8947 0.9006 0.0357  -0.0173 0.1986  121 LEU B CA  
3406 C C   . LEU B 120 ? 1.0474 0.8292 0.8719 0.0281  -0.0122 0.1853  121 LEU B C   
3407 O O   . LEU B 120 ? 1.0135 0.8005 0.8561 0.0124  0.0028  0.1735  121 LEU B O   
3408 C CB  . LEU B 120 ? 1.1328 0.9356 0.9051 0.0338  -0.0349 0.1852  121 LEU B CB  
3409 C CG  . LEU B 120 ? 1.1573 0.9611 0.8933 0.0277  -0.0327 0.1824  121 LEU B CG  
3410 C CD1 . LEU B 120 ? 1.1945 0.9642 0.8771 0.0350  -0.0253 0.2018  121 LEU B CD1 
3411 C CD2 . LEU B 120 ? 1.1478 0.9837 0.8856 0.0313  -0.0571 0.1706  121 LEU B CD2 
3412 N N   . ALA B 121 ? 1.0055 0.7946 0.8518 0.0402  -0.0255 0.1865  122 ALA B N   
3413 C CA  . ALA B 121 ? 0.9314 0.7348 0.8219 0.0354  -0.0232 0.1731  122 ALA B CA  
3414 C C   . ALA B 121 ? 0.9375 0.7123 0.8383 0.0276  -0.0011 0.1747  122 ALA B C   
3415 O O   . ALA B 121 ? 0.9808 0.7233 0.8692 0.0368  0.0051  0.1896  122 ALA B O   
3416 C CB  . ALA B 121 ? 0.9060 0.7248 0.8156 0.0514  -0.0421 0.1742  122 ALA B CB  
3417 N N   . GLU B 122 ? 0.8726 0.6591 0.7958 0.0110  0.0104  0.1589  123 GLU B N   
3418 C CA  . GLU B 122 ? 0.8696 0.6371 0.8109 0.0006  0.0294  0.1542  123 GLU B CA  
3419 C C   . GLU B 122 ? 0.8375 0.6124 0.8104 0.0056  0.0241  0.1454  123 GLU B C   
3420 O O   . GLU B 122 ? 0.8658 0.6199 0.8523 0.0012  0.0372  0.1426  123 GLU B O   
3421 C CB  . GLU B 122 ? 0.8496 0.6310 0.8028 -0.0183 0.0419  0.1398  123 GLU B CB  
3422 C CG  . GLU B 122 ? 0.9011 0.6738 0.8257 -0.0247 0.0520  0.1470  123 GLU B CG  
3423 C CD  . GLU B 122 ? 0.9954 0.7254 0.8942 -0.0246 0.0697  0.1643  123 GLU B CD  
3424 O OE1 . GLU B 122 ? 1.0153 0.7212 0.9268 -0.0269 0.0813  0.1661  123 GLU B OE1 
3425 O OE2 . GLU B 122 ? 1.0384 0.7566 0.9018 -0.0224 0.0734  0.1760  123 GLU B OE2 
3426 N N   . PHE B 123 ? 0.7998 0.6038 0.7841 0.0140  0.0060  0.1400  124 PHE B N   
3427 C CA  . PHE B 123 ? 0.7905 0.6050 0.8022 0.0213  -0.0002 0.1326  124 PHE B CA  
3428 C C   . PHE B 123 ? 0.8168 0.6181 0.8217 0.0412  -0.0098 0.1478  124 PHE B C   
3429 O O   . PHE B 123 ? 0.8508 0.6435 0.8285 0.0499  -0.0168 0.1626  124 PHE B O   
3430 C CB  . PHE B 123 ? 0.7447 0.5981 0.7734 0.0191  -0.0123 0.1190  124 PHE B CB  
3431 C CG  . PHE B 123 ? 0.7490 0.6199 0.7618 0.0241  -0.0270 0.1240  124 PHE B CG  
3432 C CD1 . PHE B 123 ? 0.7503 0.6330 0.7673 0.0389  -0.0433 0.1295  124 PHE B CD1 
3433 C CD2 . PHE B 123 ? 0.7462 0.6234 0.7418 0.0140  -0.0247 0.1218  124 PHE B CD2 
3434 C CE1 . PHE B 123 ? 0.7629 0.6634 0.7665 0.0419  -0.0579 0.1314  124 PHE B CE1 
3435 C CE2 . PHE B 123 ? 0.7523 0.6439 0.7319 0.0177  -0.0379 0.1242  124 PHE B CE2 
3436 C CZ  . PHE B 123 ? 0.7641 0.6676 0.7475 0.0309  -0.0550 0.1284  124 PHE B CZ  
3437 N N   . ASP B 124 ? 0.8118 0.6126 0.8407 0.0493  -0.0104 0.1436  125 ASP B N   
3438 C CA  . ASP B 124 ? 0.8278 0.6184 0.8571 0.0702  -0.0190 0.1568  125 ASP B CA  
3439 C C   . ASP B 124 ? 0.8079 0.6363 0.8516 0.0805  -0.0395 0.1536  125 ASP B C   
3440 O O   . ASP B 124 ? 0.8498 0.6817 0.8808 0.0951  -0.0540 0.1663  125 ASP B O   
3441 C CB  . ASP B 124 ? 0.8554 0.6237 0.9049 0.0745  -0.0068 0.1534  125 ASP B CB  
3442 C CG  . ASP B 124 ? 0.9009 0.6310 0.9403 0.0620  0.0146  0.1542  125 ASP B CG  
3443 O OD1 . ASP B 124 ? 0.9624 0.6624 0.9745 0.0647  0.0208  0.1710  125 ASP B OD1 
3444 O OD2 . ASP B 124 ? 0.8969 0.6270 0.9555 0.0491  0.0258  0.1373  125 ASP B OD2 
3445 N N   . GLY B 125 ? 0.7695 0.6263 0.8389 0.0726  -0.0405 0.1364  126 GLY B N   
3446 C CA  . GLY B 125 ? 0.7367 0.6284 0.8272 0.0808  -0.0559 0.1313  126 GLY B CA  
3447 C C   . GLY B 125 ? 0.6979 0.6199 0.8009 0.0672  -0.0572 0.1154  126 GLY B C   
3448 O O   . GLY B 125 ? 0.7121 0.6317 0.8042 0.0524  -0.0492 0.1092  126 GLY B O   
3449 N N   . VAL B 126 ? 0.6694 0.6202 0.7969 0.0731  -0.0666 0.1094  127 VAL B N   
3450 C CA  . VAL B 126 ? 0.6381 0.6167 0.7771 0.0622  -0.0683 0.0964  127 VAL B CA  
3451 C C   . VAL B 126 ? 0.6153 0.6073 0.7853 0.0646  -0.0621 0.0862  127 VAL B C   
3452 O O   . VAL B 126 ? 0.6437 0.6389 0.8330 0.0781  -0.0649 0.0891  127 VAL B O   
3453 C CB  . VAL B 126 ? 0.6441 0.6468 0.7807 0.0639  -0.0854 0.0979  127 VAL B CB  
3454 C CG1 . VAL B 126 ? 0.5930 0.6220 0.7461 0.0532  -0.0851 0.0843  127 VAL B CG1 
3455 C CG2 . VAL B 126 ? 0.6576 0.6460 0.7582 0.0601  -0.0895 0.1063  127 VAL B CG2 
3456 N N   . VAL B 127 ? 0.5887 0.5872 0.7614 0.0526  -0.0528 0.0747  128 VAL B N   
3457 C CA  . VAL B 127 ? 0.5669 0.5797 0.7631 0.0528  -0.0457 0.0643  128 VAL B CA  
3458 C C   . VAL B 127 ? 0.5444 0.5812 0.7451 0.0445  -0.0494 0.0583  128 VAL B C   
3459 O O   . VAL B 127 ? 0.5437 0.5786 0.7294 0.0335  -0.0450 0.0542  128 VAL B O   
3460 C CB  . VAL B 127 ? 0.5744 0.5708 0.7656 0.0470  -0.0308 0.0563  128 VAL B CB  
3461 C CG1 . VAL B 127 ? 0.5558 0.5671 0.7614 0.0448  -0.0227 0.0451  128 VAL B CG1 
3462 C CG2 . VAL B 127 ? 0.5954 0.5679 0.7890 0.0558  -0.0254 0.0599  128 VAL B CG2 
3463 N N   . GLY B 128 ? 0.5428 0.6019 0.7658 0.0501  -0.0577 0.0579  129 GLY B N   
3464 C CA  . GLY B 128 ? 0.5272 0.6084 0.7584 0.0417  -0.0611 0.0517  129 GLY B CA  
3465 C C   . GLY B 128 ? 0.5185 0.6039 0.7584 0.0349  -0.0463 0.0426  129 GLY B C   
3466 O O   . GLY B 128 ? 0.5120 0.5994 0.7695 0.0404  -0.0372 0.0391  129 GLY B O   
3467 N N   . MET B 129 ? 0.5241 0.6087 0.7492 0.0239  -0.0429 0.0393  130 MET B N   
3468 C CA  . MET B 129 ? 0.5142 0.5985 0.7392 0.0182  -0.0287 0.0329  130 MET B CA  
3469 C C   . MET B 129 ? 0.5133 0.6147 0.7552 0.0120  -0.0261 0.0281  130 MET B C   
3470 O O   . MET B 129 ? 0.5314 0.6306 0.7710 0.0074  -0.0132 0.0244  130 MET B O   
3471 C CB  . MET B 129 ? 0.5224 0.5907 0.7185 0.0122  -0.0247 0.0332  130 MET B CB  
3472 C CG  . MET B 129 ? 0.5380 0.5897 0.7217 0.0156  -0.0231 0.0348  130 MET B CG  
3473 S SD  . MET B 129 ? 0.5744 0.6216 0.7710 0.0229  -0.0123 0.0296  130 MET B SD  
3474 C CE  . MET B 129 ? 0.5561 0.6044 0.7406 0.0178  -0.0002 0.0224  130 MET B CE  
3475 N N   . GLY B 130 ? 0.5068 0.6249 0.7652 0.0119  -0.0382 0.0278  131 GLY B N   
3476 C CA  . GLY B 130 ? 0.4916 0.6281 0.7718 0.0042  -0.0368 0.0212  131 GLY B CA  
3477 C C   . GLY B 130 ? 0.4980 0.6515 0.8135 0.0075  -0.0277 0.0165  131 GLY B C   
3478 O O   . GLY B 130 ? 0.5049 0.6542 0.8260 0.0165  -0.0213 0.0181  131 GLY B O   
3479 N N   . PHE B 131 ? 0.5084 0.6809 0.8492 -0.0006 -0.0261 0.0095  132 PHE B N   
3480 C CA  . PHE B 131 ? 0.4922 0.6833 0.8707 -0.0009 -0.0139 0.0034  132 PHE B CA  
3481 C C   . PHE B 131 ? 0.5078 0.7268 0.9229 0.0084  -0.0277 0.0016  132 PHE B C   
3482 O O   . PHE B 131 ? 0.5116 0.7401 0.9251 0.0115  -0.0489 0.0032  132 PHE B O   
3483 C CB  . PHE B 131 ? 0.4956 0.6953 0.8886 -0.0160 -0.0055 -0.0041 132 PHE B CB  
3484 C CG  . PHE B 131 ? 0.4954 0.6688 0.8585 -0.0235 0.0117  -0.0019 132 PHE B CG  
3485 C CD1 . PHE B 131 ? 0.4922 0.6455 0.8183 -0.0261 0.0054  0.0022  132 PHE B CD1 
3486 C CD2 . PHE B 131 ? 0.4937 0.6629 0.8660 -0.0275 0.0352  -0.0038 132 PHE B CD2 
3487 C CE1 . PHE B 131 ? 0.4924 0.6231 0.7927 -0.0306 0.0204  0.0049  132 PHE B CE1 
3488 C CE2 . PHE B 131 ? 0.4955 0.6394 0.8377 -0.0321 0.0505  0.0000  132 PHE B CE2 
3489 C CZ  . PHE B 131 ? 0.4959 0.6213 0.8028 -0.0329 0.0421  0.0044  132 PHE B CZ  
3490 N N   . ILE B 132 ? 0.4938 0.7271 0.9422 0.0134  -0.0154 -0.0020 133 ILE B N   
3491 C CA  . ILE B 132 ? 0.4974 0.7608 0.9877 0.0245  -0.0263 -0.0044 133 ILE B CA  
3492 C C   . ILE B 132 ? 0.5173 0.8128 1.0347 0.0187  -0.0461 -0.0111 133 ILE B C   
3493 O O   . ILE B 132 ? 0.5523 0.8666 1.0844 0.0306  -0.0669 -0.0089 133 ILE B O   
3494 C CB  . ILE B 132 ? 0.4892 0.7638 1.0140 0.0294  -0.0053 -0.0092 133 ILE B CB  
3495 C CG1 . ILE B 132 ? 0.4711 0.7719 1.0349 0.0465  -0.0172 -0.0091 133 ILE B CG1 
3496 C CG2 . ILE B 132 ? 0.4927 0.7804 1.0421 0.0137  0.0133  -0.0185 133 ILE B CG2 
3497 C CD1 . ILE B 132 ? 0.4450 0.7488 1.0343 0.0564  0.0031  -0.0117 133 ILE B CD1 
3498 N N   . GLU B 133 ? 0.5242 0.8238 1.0452 0.0010  -0.0401 -0.0191 134 GLU B N   
3499 C CA  . GLU B 133 ? 0.5473 0.8767 1.0938 -0.0082 -0.0571 -0.0291 134 GLU B CA  
3500 C C   . GLU B 133 ? 0.5648 0.8945 1.0856 -0.0023 -0.0859 -0.0249 134 GLU B C   
3501 O O   . GLU B 133 ? 0.5892 0.9496 1.1334 -0.0039 -0.1060 -0.0328 134 GLU B O   
3502 C CB  . GLU B 133 ? 0.5653 0.8874 1.1103 -0.0296 -0.0421 -0.0379 134 GLU B CB  
3503 C CG  . GLU B 133 ? 0.5613 0.8888 1.1384 -0.0381 -0.0138 -0.0438 134 GLU B CG  
3504 C CD  . GLU B 133 ? 0.5825 0.8710 1.1221 -0.0386 0.0113  -0.0352 134 GLU B CD  
3505 O OE1 . GLU B 133 ? 0.5787 0.8459 1.0854 -0.0257 0.0097  -0.0249 134 GLU B OE1 
3506 O OE2 . GLU B 133 ? 0.6157 0.8945 1.1586 -0.0520 0.0330  -0.0390 134 GLU B OE2 
3507 N N   . GLN B 134 ? 0.6009 0.8972 1.0736 0.0042  -0.0874 -0.0130 135 GLN B N   
3508 C CA  . GLN B 134 ? 0.6234 0.9133 1.0643 0.0102  -0.1106 -0.0068 135 GLN B CA  
3509 C C   . GLN B 134 ? 0.6290 0.9108 1.0593 0.0308  -0.1201 0.0062  135 GLN B C   
3510 O O   . GLN B 134 ? 0.6277 0.9000 1.0281 0.0378  -0.1371 0.0141  135 GLN B O   
3511 C CB  . GLN B 134 ? 0.6454 0.9032 1.0394 -0.0003 -0.1047 -0.0041 135 GLN B CB  
3512 C CG  . GLN B 134 ? 0.6741 0.9380 1.0734 -0.0191 -0.1013 -0.0166 135 GLN B CG  
3513 C CD  . GLN B 134 ? 0.7296 0.9674 1.0831 -0.0258 -0.1036 -0.0143 135 GLN B CD  
3514 O OE1 . GLN B 134 ? 0.7530 0.9994 1.1003 -0.0329 -0.1177 -0.0219 135 GLN B OE1 
3515 N NE2 . GLN B 134 ? 0.7272 0.9340 1.0490 -0.0235 -0.0899 -0.0050 135 GLN B NE2 
3516 N N   . ALA B 135 ? 0.6227 0.9059 1.0760 0.0405  -0.1074 0.0085  136 ALA B N   
3517 C CA  . ALA B 135 ? 0.6223 0.8979 1.0731 0.0607  -0.1138 0.0195  136 ALA B CA  
3518 C C   . ALA B 135 ? 0.6680 0.9785 1.1495 0.0737  -0.1376 0.0191  136 ALA B C   
3519 O O   . ALA B 135 ? 0.6828 1.0303 1.2120 0.0714  -0.1391 0.0081  136 ALA B O   
3520 C CB  . ALA B 135 ? 0.6117 0.8786 1.0792 0.0664  -0.0917 0.0193  136 ALA B CB  
3521 N N   . ILE B 136 ? 0.6854 0.9848 1.1396 0.0875  -0.1561 0.0310  137 ILE B N   
3522 C CA  . ILE B 136 ? 0.6959 1.0259 1.1727 0.1044  -0.1815 0.0336  137 ILE B CA  
3523 C C   . ILE B 136 ? 0.6883 1.0286 1.2041 0.1229  -0.1747 0.0367  137 ILE B C   
3524 O O   . ILE B 136 ? 0.6685 0.9761 1.1676 0.1318  -0.1604 0.0462  137 ILE B O   
3525 C CB  . ILE B 136 ? 0.7222 1.0324 1.1515 0.1153  -0.2017 0.0478  137 ILE B CB  
3526 C CG1 . ILE B 136 ? 0.7315 1.0421 1.1306 0.0980  -0.2116 0.0412  137 ILE B CG1 
3527 C CG2 . ILE B 136 ? 0.7197 1.0563 1.1685 0.1389  -0.2271 0.0544  137 ILE B CG2 
3528 C CD1 . ILE B 136 ? 0.7555 1.0235 1.1065 0.0850  -0.1949 0.0458  137 ILE B CD1 
3529 N N   . GLY B 137 ? 0.7049 1.0919 1.2748 0.1274  -0.1841 0.0268  138 GLY B N   
3530 C CA  . GLY B 137 ? 0.7128 1.1182 1.3297 0.1453  -0.1778 0.0270  138 GLY B CA  
3531 C C   . GLY B 137 ? 0.7104 1.1107 1.3507 0.1348  -0.1457 0.0180  138 GLY B C   
3532 O O   . GLY B 137 ? 0.7072 1.1021 1.3670 0.1495  -0.1327 0.0211  138 GLY B O   
3533 N N   . ARG B 138 ? 0.7280 1.1275 1.3636 0.1103  -0.1323 0.0072  139 ARG B N   
3534 C CA  . ARG B 138 ? 0.7436 1.1375 1.3955 0.0977  -0.1009 -0.0014 139 ARG B CA  
3535 C C   . ARG B 138 ? 0.7260 1.0829 1.3579 0.1065  -0.0783 0.0055  139 ARG B C   
3536 O O   . ARG B 138 ? 0.7208 1.0792 1.3737 0.1031  -0.0539 -0.0014 139 ARG B O   
3537 C CB  . ARG B 138 ? 0.7886 1.2316 1.5077 0.0935  -0.0962 -0.0160 139 ARG B CB  
3538 C CG  . ARG B 138 ? 0.8532 1.3235 1.6214 0.1161  -0.0981 -0.0155 139 ARG B CG  
3539 C CD  . ARG B 138 ? 0.8989 1.4207 1.7365 0.1091  -0.0921 -0.0316 139 ARG B CD  
3540 N NE  . ARG B 138 ? 0.9392 1.4717 1.8176 0.1241  -0.0729 -0.0332 139 ARG B NE  
3541 C CZ  . ARG B 138 ? 0.9277 1.4509 1.8174 0.1147  -0.0389 -0.0397 139 ARG B CZ  
3542 N NH1 . ARG B 138 ? 0.9041 1.4066 1.7677 0.0909  -0.0203 -0.0441 139 ARG B NH1 
3543 N NH2 . ARG B 138 ? 0.9400 1.4736 1.8662 0.1303  -0.0226 -0.0416 139 ARG B NH2 
3544 N N   . VAL B 139 ? 0.7086 1.0315 1.2985 0.1171  -0.0858 0.0183  140 VAL B N   
3545 C CA  . VAL B 139 ? 0.6595 0.9442 1.2259 0.1237  -0.0667 0.0235  140 VAL B CA  
3546 C C   . VAL B 139 ? 0.6305 0.8888 1.1627 0.1044  -0.0474 0.0193  140 VAL B C   
3547 O O   . VAL B 139 ? 0.6463 0.8948 1.1475 0.0912  -0.0544 0.0208  140 VAL B O   
3548 C CB  . VAL B 139 ? 0.6621 0.9178 1.1983 0.1407  -0.0793 0.0382  140 VAL B CB  
3549 C CG1 . VAL B 139 ? 0.6609 0.9178 1.1705 0.1390  -0.1044 0.0461  140 VAL B CG1 
3550 C CG2 . VAL B 139 ? 0.6260 0.8357 1.1233 0.1377  -0.0611 0.0414  140 VAL B CG2 
3551 N N   . THR B 140 ? 0.6192 0.8674 1.1578 0.1041  -0.0232 0.0138  141 THR B N   
3552 C CA  . THR B 140 ? 0.5783 0.8015 1.0846 0.0897  -0.0037 0.0100  141 THR B CA  
3553 C C   . THR B 140 ? 0.5804 0.7681 1.0352 0.0863  -0.0096 0.0175  141 THR B C   
3554 O O   . THR B 140 ? 0.6050 0.7715 1.0468 0.0976  -0.0118 0.0232  141 THR B O   
3555 C CB  . THR B 140 ? 0.5706 0.7861 1.0881 0.0951  0.0213  0.0037  141 THR B CB  
3556 O OG1 . THR B 140 ? 0.5593 0.8099 1.1289 0.0984  0.0282  -0.0032 141 THR B OG1 
3557 C CG2 . THR B 140 ? 0.5704 0.7643 1.0545 0.0812  0.0405  -0.0005 141 THR B CG2 
3558 N N   . PRO B 141 ? 0.5715 0.7523 0.9990 0.0707  -0.0111 0.0172  142 PRO B N   
3559 C CA  . PRO B 141 ? 0.5502 0.7006 0.9325 0.0663  -0.0146 0.0228  142 PRO B CA  
3560 C C   . PRO B 141 ? 0.5587 0.6834 0.9207 0.0672  0.0025  0.0198  142 PRO B C   
3561 O O   . PRO B 141 ? 0.5694 0.6978 0.9437 0.0674  0.0195  0.0127  142 PRO B O   
3562 C CB  . PRO B 141 ? 0.5303 0.6839 0.8964 0.0504  -0.0161 0.0209  142 PRO B CB  
3563 C CG  . PRO B 141 ? 0.5174 0.7026 0.9199 0.0463  -0.0184 0.0153  142 PRO B CG  
3564 C CD  . PRO B 141 ? 0.5351 0.7351 0.9744 0.0564  -0.0078 0.0111  142 PRO B CD  
3565 N N   . ILE B 142 ? 0.5676 0.6666 0.8987 0.0670  -0.0014 0.0242  143 ILE B N   
3566 C CA  . ILE B 142 ? 0.5830 0.6576 0.8953 0.0679  0.0116  0.0196  143 ILE B CA  
3567 C C   . ILE B 142 ? 0.6002 0.6719 0.8955 0.0581  0.0258  0.0118  143 ILE B C   
3568 O O   . ILE B 142 ? 0.6343 0.6958 0.9252 0.0610  0.0398  0.0046  143 ILE B O   
3569 C CB  . ILE B 142 ? 0.5850 0.6341 0.8717 0.0680  0.0043  0.0252  143 ILE B CB  
3570 C CG1 . ILE B 142 ? 0.5870 0.6124 0.8636 0.0705  0.0171  0.0183  143 ILE B CG1 
3571 C CG2 . ILE B 142 ? 0.5624 0.6084 0.8224 0.0555  -0.0028 0.0280  143 ILE B CG2 
3572 C CD1 . ILE B 142 ? 0.5932 0.5921 0.8538 0.0717  0.0131  0.0231  143 ILE B CD1 
3573 N N   . PHE B 143 ? 0.5804 0.6593 0.8642 0.0478  0.0226  0.0132  144 PHE B N   
3574 C CA  . PHE B 143 ? 0.5859 0.6603 0.8504 0.0407  0.0353  0.0082  144 PHE B CA  
3575 C C   . PHE B 143 ? 0.6001 0.6862 0.8849 0.0428  0.0517  0.0032  144 PHE B C   
3576 O O   . PHE B 143 ? 0.6182 0.6945 0.8872 0.0431  0.0664  -0.0020 144 PHE B O   
3577 C CB  . PHE B 143 ? 0.5472 0.6229 0.7939 0.0308  0.0290  0.0120  144 PHE B CB  
3578 C CG  . PHE B 143 ? 0.5360 0.6023 0.7561 0.0265  0.0396  0.0091  144 PHE B CG  
3579 C CD1 . PHE B 143 ? 0.5389 0.5904 0.7325 0.0270  0.0393  0.0061  144 PHE B CD1 
3580 C CD2 . PHE B 143 ? 0.5182 0.5904 0.7397 0.0220  0.0500  0.0095  144 PHE B CD2 
3581 C CE1 . PHE B 143 ? 0.5454 0.5909 0.7132 0.0251  0.0465  0.0037  144 PHE B CE1 
3582 C CE2 . PHE B 143 ? 0.5150 0.5765 0.7083 0.0206  0.0595  0.0090  144 PHE B CE2 
3583 C CZ  . PHE B 143 ? 0.5287 0.5780 0.6944 0.0231  0.0565  0.0063  144 PHE B CZ  
3584 N N   . ASP B 144 ? 0.5882 0.6959 0.9079 0.0442  0.0493  0.0042  145 ASP B N   
3585 C CA  . ASP B 144 ? 0.6021 0.7245 0.9495 0.0457  0.0662  -0.0009 145 ASP B CA  
3586 C C   . ASP B 144 ? 0.6004 0.7157 0.9550 0.0567  0.0784  -0.0063 145 ASP B C   
3587 O O   . ASP B 144 ? 0.6110 0.7241 0.9641 0.0567  0.0985  -0.0119 145 ASP B O   
3588 C CB  . ASP B 144 ? 0.5885 0.7400 0.9778 0.0447  0.0583  -0.0005 145 ASP B CB  
3589 C CG  . ASP B 144 ? 0.5884 0.7456 0.9705 0.0328  0.0474  0.0022  145 ASP B CG  
3590 O OD1 . ASP B 144 ? 0.6202 0.7613 0.9700 0.0296  0.0366  0.0068  145 ASP B OD1 
3591 O OD2 . ASP B 144 ? 0.5650 0.7430 0.9757 0.0260  0.0506  -0.0011 145 ASP B OD2 
3592 N N   . ASN B 145 ? 0.6020 0.7108 0.9617 0.0662  0.0676  -0.0044 146 ASN B N   
3593 C CA  . ASN B 145 ? 0.6062 0.7024 0.9695 0.0771  0.0787  -0.0100 146 ASN B CA  
3594 C C   . ASN B 145 ? 0.6206 0.6912 0.9438 0.0733  0.0895  -0.0164 146 ASN B C   
3595 O O   . ASN B 145 ? 0.6365 0.7003 0.9587 0.0780  0.1068  -0.0248 146 ASN B O   
3596 C CB  . ASN B 145 ? 0.6295 0.7193 1.0038 0.0881  0.0645  -0.0047 146 ASN B CB  
3597 C CG  . ASN B 145 ? 0.6413 0.7566 1.0623 0.0998  0.0603  -0.0023 146 ASN B CG  
3598 O OD1 . ASN B 145 ? 0.6429 0.7754 1.0925 0.1032  0.0748  -0.0086 146 ASN B OD1 
3599 N ND2 . ASN B 145 ? 0.6454 0.7640 1.0744 0.1068  0.0406  0.0067  146 ASN B ND2 
3600 N N   . ILE B 146 ? 0.6323 0.6909 0.9234 0.0649  0.0788  -0.0134 147 ILE B N   
3601 C CA  . ILE B 146 ? 0.6503 0.6896 0.9031 0.0604  0.0848  -0.0201 147 ILE B CA  
3602 C C   . ILE B 146 ? 0.6672 0.7101 0.9045 0.0565  0.1000  -0.0234 147 ILE B C   
3603 O O   . ILE B 146 ? 0.7108 0.7412 0.9244 0.0580  0.1116  -0.0317 147 ILE B O   
3604 C CB  . ILE B 146 ? 0.6501 0.6801 0.8788 0.0531  0.0687  -0.0160 147 ILE B CB  
3605 C CG1 . ILE B 146 ? 0.6498 0.6651 0.8828 0.0571  0.0607  -0.0157 147 ILE B CG1 
3606 C CG2 . ILE B 146 ? 0.6643 0.6846 0.8567 0.0472  0.0722  -0.0223 147 ILE B CG2 
3607 C CD1 . ILE B 146 ? 0.6135 0.6253 0.8361 0.0508  0.0447  -0.0078 147 ILE B CD1 
3608 N N   . ILE B 147 ? 0.6457 0.7040 0.8948 0.0515  0.1006  -0.0170 148 ILE B N   
3609 C CA  . ILE B 147 ? 0.6721 0.7311 0.9082 0.0479  0.1175  -0.0176 148 ILE B CA  
3610 C C   . ILE B 147 ? 0.7075 0.7694 0.9600 0.0543  0.1391  -0.0245 148 ILE B C   
3611 O O   . ILE B 147 ? 0.7513 0.8016 0.9763 0.0551  0.1555  -0.0288 148 ILE B O   
3612 C CB  . ILE B 147 ? 0.6835 0.7550 0.9302 0.0395  0.1143  -0.0097 148 ILE B CB  
3613 C CG1 . ILE B 147 ? 0.6798 0.7428 0.8976 0.0339  0.0989  -0.0044 148 ILE B CG1 
3614 C CG2 . ILE B 147 ? 0.6844 0.7572 0.9298 0.0363  0.1366  -0.0095 148 ILE B CG2 
3615 C CD1 . ILE B 147 ? 0.7093 0.7549 0.8832 0.0351  0.1015  -0.0066 148 ILE B CD1 
3616 N N   . SER B 148 ? 0.6993 0.7765 0.9948 0.0599  0.1388  -0.0255 149 SER B N   
3617 C CA  . SER B 148 ? 0.6950 0.7773 1.0139 0.0679  0.1592  -0.0328 149 SER B CA  
3618 C C   . SER B 148 ? 0.7201 0.7795 1.0086 0.0740  0.1704  -0.0425 149 SER B C   
3619 O O   . SER B 148 ? 0.7275 0.7850 1.0164 0.0779  0.1930  -0.0493 149 SER B O   
3620 C CB  . SER B 148 ? 0.6826 0.7840 1.0513 0.0764  0.1513  -0.0323 149 SER B CB  
3621 O OG  . SER B 148 ? 0.6809 0.8079 1.0817 0.0708  0.1425  -0.0265 149 SER B OG  
3622 N N   . GLN B 149 ? 0.7102 0.7525 0.9731 0.0740  0.1554  -0.0441 150 GLN B N   
3623 C CA  . GLN B 149 ? 0.7486 0.7685 0.9815 0.0776  0.1626  -0.0558 150 GLN B CA  
3624 C C   . GLN B 149 ? 0.7553 0.7651 0.9437 0.0737  0.1747  -0.0604 150 GLN B C   
3625 O O   . GLN B 149 ? 0.7939 0.7893 0.9601 0.0779  0.1877  -0.0723 150 GLN B O   
3626 C CB  . GLN B 149 ? 0.7719 0.7775 0.9918 0.0759  0.1435  -0.0569 150 GLN B CB  
3627 C CG  . GLN B 149 ? 0.7994 0.8040 1.0534 0.0836  0.1361  -0.0545 150 GLN B CG  
3628 C CD  . GLN B 149 ? 0.8272 0.8129 1.0659 0.0805  0.1213  -0.0554 150 GLN B CD  
3629 O OE1 . GLN B 149 ? 0.8325 0.8081 1.0380 0.0722  0.1166  -0.0605 150 GLN B OE1 
3630 N NE2 . GLN B 149 ? 0.8305 0.8119 1.0945 0.0877  0.1144  -0.0500 150 GLN B NE2 
3631 N N   . GLY B 150 ? 0.7110 0.7270 0.8848 0.0667  0.1702  -0.0511 151 GLY B N   
3632 C CA  . GLY B 150 ? 0.7323 0.7392 0.8631 0.0648  0.1811  -0.0514 151 GLY B CA  
3633 C C   . GLY B 150 ? 0.7570 0.7481 0.8426 0.0651  0.1723  -0.0600 151 GLY B C   
3634 O O   . GLY B 150 ? 0.7896 0.7699 0.8397 0.0684  0.1853  -0.0669 151 GLY B O   
3635 N N   . VAL B 151 ? 0.7430 0.7339 0.8300 0.0614  0.1505  -0.0601 152 VAL B N   
3636 C CA  . VAL B 151 ? 0.7562 0.7366 0.8077 0.0597  0.1393  -0.0700 152 VAL B CA  
3637 C C   . VAL B 151 ? 0.7479 0.7343 0.7810 0.0545  0.1220  -0.0616 152 VAL B C   
3638 O O   . VAL B 151 ? 0.7741 0.7568 0.7719 0.0545  0.1152  -0.0679 152 VAL B O   
3639 C CB  . VAL B 151 ? 0.7409 0.7122 0.8066 0.0592  0.1321  -0.0815 152 VAL B CB  
3640 C CG1 . VAL B 151 ? 0.7274 0.6883 0.8003 0.0661  0.1511  -0.0933 152 VAL B CG1 
3641 C CG2 . VAL B 151 ? 0.6876 0.6649 0.7894 0.0564  0.1186  -0.0718 152 VAL B CG2 
3642 N N   . LEU B 152 ? 0.7150 0.7117 0.7724 0.0510  0.1150  -0.0483 153 LEU B N   
3643 C CA  . LEU B 152 ? 0.7092 0.7114 0.7541 0.0468  0.1006  -0.0395 153 LEU B CA  
3644 C C   . LEU B 152 ? 0.7333 0.7328 0.7446 0.0499  0.1081  -0.0336 153 LEU B C   
3645 O O   . LEU B 152 ? 0.7433 0.7401 0.7542 0.0524  0.1261  -0.0290 153 LEU B O   
3646 C CB  . LEU B 152 ? 0.6797 0.6917 0.7578 0.0423  0.0927  -0.0282 153 LEU B CB  
3647 C CG  . LEU B 152 ? 0.6686 0.6818 0.7728 0.0398  0.0805  -0.0296 153 LEU B CG  
3648 C CD1 . LEU B 152 ? 0.6611 0.6842 0.7856 0.0355  0.0707  -0.0181 153 LEU B CD1 
3649 C CD2 . LEU B 152 ? 0.6565 0.6629 0.7445 0.0370  0.0691  -0.0381 153 LEU B CD2 
3650 N N   . LYS B 153 ? 0.7771 0.7773 0.7611 0.0503  0.0949  -0.0336 154 LYS B N   
3651 C CA  . LYS B 153 ? 0.8204 0.8163 0.7669 0.0560  0.0991  -0.0272 154 LYS B CA  
3652 C C   . LYS B 153 ? 0.8174 0.8124 0.7738 0.0548  0.1076  -0.0111 154 LYS B C   
3653 O O   . LYS B 153 ? 0.8315 0.8170 0.7690 0.0590  0.1248  -0.0047 154 LYS B O   
3654 C CB  . LYS B 153 ? 0.8472 0.8486 0.7692 0.0578  0.0797  -0.0313 154 LYS B CB  
3655 C CG  . LYS B 153 ? 0.9723 0.9684 0.8472 0.0677  0.0824  -0.0288 154 LYS B CG  
3656 C CD  . LYS B 153 ? 1.0307 1.0372 0.8843 0.0703  0.0616  -0.0384 154 LYS B CD  
3657 C CE  . LYS B 153 ? 1.1016 1.1040 0.9049 0.0829  0.0620  -0.0351 154 LYS B CE  
3658 N NZ  . LYS B 153 ? 1.1549 1.1455 0.9276 0.0879  0.0764  -0.0441 154 LYS B NZ  
3659 N N   . GLU B 154 ? 0.7687 0.7716 0.7533 0.0485  0.0968  -0.0053 155 GLU B N   
3660 C CA  . GLU B 154 ? 0.7617 0.7642 0.7618 0.0449  0.1042  0.0066  155 GLU B CA  
3661 C C   . GLU B 154 ? 0.7227 0.7355 0.7673 0.0374  0.1006  0.0061  155 GLU B C   
3662 O O   . GLU B 154 ? 0.7346 0.7535 0.7941 0.0356  0.0880  0.0001  155 GLU B O   
3663 C CB  . GLU B 154 ? 0.7806 0.7808 0.7629 0.0463  0.0948  0.0157  155 GLU B CB  
3664 C CG  . GLU B 154 ? 0.8853 0.8742 0.8230 0.0564  0.1004  0.0209  155 GLU B CG  
3665 C CD  . GLU B 154 ? 0.9821 0.9566 0.9045 0.0596  0.1252  0.0265  155 GLU B CD  
3666 O OE1 . GLU B 154 ? 1.0180 0.9906 0.9670 0.0527  0.1396  0.0311  155 GLU B OE1 
3667 O OE2 . GLU B 154 ? 1.0181 0.9835 0.9011 0.0689  0.1310  0.0259  155 GLU B OE2 
3668 N N   . ASP B 155 ? 0.7001 0.7148 0.7654 0.0331  0.1119  0.0123  156 ASP B N   
3669 C CA  . ASP B 155 ? 0.6786 0.7063 0.7862 0.0268  0.1075  0.0118  156 ASP B CA  
3670 C C   . ASP B 155 ? 0.6502 0.6816 0.7623 0.0217  0.0907  0.0165  156 ASP B C   
3671 O O   . ASP B 155 ? 0.6544 0.6881 0.7801 0.0158  0.0930  0.0212  156 ASP B O   
3672 C CB  . ASP B 155 ? 0.7142 0.7453 0.8441 0.0231  0.1269  0.0139  156 ASP B CB  
3673 C CG  . ASP B 155 ? 0.7344 0.7843 0.9114 0.0185  0.1219  0.0107  156 ASP B CG  
3674 O OD1 . ASP B 155 ? 0.7150 0.7722 0.9034 0.0190  0.1034  0.0090  156 ASP B OD1 
3675 O OD2 . ASP B 155 ? 0.7517 0.8095 0.9546 0.0146  0.1368  0.0102  156 ASP B OD2 
3676 N N   . VAL B 156 ? 0.6195 0.6510 0.7209 0.0233  0.0750  0.0139  157 VAL B N   
3677 C CA  . VAL B 156 ? 0.5936 0.6251 0.6870 0.0206  0.0618  0.0181  157 VAL B CA  
3678 C C   . VAL B 156 ? 0.5916 0.6273 0.6900 0.0197  0.0466  0.0136  157 VAL B C   
3679 O O   . VAL B 156 ? 0.6202 0.6540 0.7150 0.0226  0.0462  0.0068  157 VAL B O   
3680 C CB  . VAL B 156 ? 0.6015 0.6238 0.6605 0.0258  0.0649  0.0218  157 VAL B CB  
3681 C CG1 . VAL B 156 ? 0.5603 0.5855 0.6059 0.0273  0.0494  0.0203  157 VAL B CG1 
3682 C CG2 . VAL B 156 ? 0.5954 0.6100 0.6517 0.0241  0.0759  0.0303  157 VAL B CG2 
3683 N N   . PHE B 157 ? 0.5614 0.6005 0.6672 0.0151  0.0357  0.0170  158 PHE B N   
3684 C CA  . PHE B 157 ? 0.5389 0.5788 0.6444 0.0136  0.0235  0.0143  158 PHE B CA  
3685 C C   . PHE B 157 ? 0.5535 0.5944 0.6512 0.0105  0.0157  0.0182  158 PHE B C   
3686 O O   . PHE B 157 ? 0.5503 0.5915 0.6510 0.0079  0.0167  0.0231  158 PHE B O   
3687 C CB  . PHE B 157 ? 0.5388 0.5806 0.6662 0.0125  0.0191  0.0137  158 PHE B CB  
3688 C CG  . PHE B 157 ? 0.5449 0.5936 0.6910 0.0097  0.0164  0.0188  158 PHE B CG  
3689 C CD1 . PHE B 157 ? 0.5107 0.5606 0.6563 0.0055  0.0063  0.0227  158 PHE B CD1 
3690 C CD2 . PHE B 157 ? 0.5203 0.5758 0.6857 0.0109  0.0241  0.0183  158 PHE B CD2 
3691 C CE1 . PHE B 157 ? 0.5162 0.5737 0.6770 0.0027  0.0020  0.0253  158 PHE B CE1 
3692 C CE2 . PHE B 157 ? 0.5235 0.5893 0.7092 0.0074  0.0197  0.0206  158 PHE B CE2 
3693 C CZ  . PHE B 157 ? 0.5230 0.5897 0.7051 0.0034  0.0076  0.0237  158 PHE B CZ  
3694 N N   . SER B 158 ? 0.5678 0.6094 0.6573 0.0100  0.0087  0.0146  159 SER B N   
3695 C CA  . SER B 158 ? 0.5553 0.5996 0.6369 0.0085  0.0032  0.0169  159 SER B CA  
3696 C C   . SER B 158 ? 0.5471 0.5924 0.6361 0.0032  -0.0040 0.0155  159 SER B C   
3697 O O   . SER B 158 ? 0.5471 0.5899 0.6412 0.0016  -0.0052 0.0106  159 SER B O   
3698 C CB  . SER B 158 ? 0.5709 0.6185 0.6346 0.0141  0.0030  0.0137  159 SER B CB  
3699 O OG  . SER B 158 ? 0.5944 0.6372 0.6460 0.0198  0.0113  0.0180  159 SER B OG  
3700 N N   . PHE B 159 ? 0.5332 0.5797 0.6214 0.0004  -0.0069 0.0196  160 PHE B N   
3701 C CA  . PHE B 159 ? 0.5238 0.5697 0.6159 -0.0049 -0.0112 0.0200  160 PHE B CA  
3702 C C   . PHE B 159 ? 0.5378 0.5906 0.6246 -0.0053 -0.0126 0.0179  160 PHE B C   
3703 O O   . PHE B 159 ? 0.5732 0.6281 0.6538 -0.0021 -0.0113 0.0207  160 PHE B O   
3704 C CB  . PHE B 159 ? 0.5010 0.5428 0.5960 -0.0077 -0.0129 0.0261  160 PHE B CB  
3705 C CG  . PHE B 159 ? 0.5022 0.5401 0.6068 -0.0075 -0.0149 0.0281  160 PHE B CG  
3706 C CD1 . PHE B 159 ? 0.5001 0.5404 0.6133 -0.0041 -0.0123 0.0277  160 PHE B CD1 
3707 C CD2 . PHE B 159 ? 0.5089 0.5402 0.6142 -0.0096 -0.0184 0.0311  160 PHE B CD2 
3708 C CE1 . PHE B 159 ? 0.5082 0.5479 0.6340 -0.0020 -0.0147 0.0294  160 PHE B CE1 
3709 C CE2 . PHE B 159 ? 0.5134 0.5407 0.6271 -0.0066 -0.0212 0.0343  160 PHE B CE2 
3710 C CZ  . PHE B 159 ? 0.5035 0.5367 0.6292 -0.0023 -0.0201 0.0331  160 PHE B CZ  
3711 N N   . TYR B 160 ? 0.5262 0.5823 0.6175 -0.0092 -0.0144 0.0124  161 TYR B N   
3712 C CA  . TYR B 160 ? 0.5005 0.5655 0.5939 -0.0117 -0.0152 0.0099  161 TYR B CA  
3713 C C   . TYR B 160 ? 0.5080 0.5654 0.6061 -0.0197 -0.0130 0.0124  161 TYR B C   
3714 O O   . TYR B 160 ? 0.5392 0.5875 0.6416 -0.0237 -0.0119 0.0115  161 TYR B O   
3715 C CB  . TYR B 160 ? 0.5008 0.5792 0.5981 -0.0111 -0.0184 -0.0001 161 TYR B CB  
3716 C CG  . TYR B 160 ? 0.5035 0.5953 0.6106 -0.0151 -0.0191 -0.0047 161 TYR B CG  
3717 C CD1 . TYR B 160 ? 0.4917 0.5915 0.5974 -0.0102 -0.0187 -0.0009 161 TYR B CD1 
3718 C CD2 . TYR B 160 ? 0.5001 0.5966 0.6206 -0.0241 -0.0187 -0.0138 161 TYR B CD2 
3719 C CE1 . TYR B 160 ? 0.4988 0.6133 0.6171 -0.0132 -0.0181 -0.0055 161 TYR B CE1 
3720 C CE2 . TYR B 160 ? 0.4918 0.6034 0.6260 -0.0289 -0.0177 -0.0191 161 TYR B CE2 
3721 C CZ  . TYR B 160 ? 0.4924 0.6143 0.6261 -0.0229 -0.0175 -0.0147 161 TYR B CZ  
3722 O OH  . TYR B 160 ? 0.4876 0.6268 0.6380 -0.0266 -0.0153 -0.0201 161 TYR B OH  
3723 N N   . TYR B 161 ? 0.4891 0.5476 0.5845 -0.0211 -0.0109 0.0161  162 TYR B N   
3724 C CA  . TYR B 161 ? 0.4920 0.5434 0.5877 -0.0283 -0.0068 0.0186  162 TYR B CA  
3725 C C   . TYR B 161 ? 0.5249 0.5897 0.6281 -0.0308 -0.0031 0.0137  162 TYR B C   
3726 O O   . TYR B 161 ? 0.5765 0.6490 0.6773 -0.0258 -0.0028 0.0142  162 TYR B O   
3727 C CB  . TYR B 161 ? 0.4899 0.5300 0.5733 -0.0281 -0.0065 0.0269  162 TYR B CB  
3728 C CG  . TYR B 161 ? 0.5030 0.5321 0.5826 -0.0264 -0.0108 0.0322  162 TYR B CG  
3729 C CD1 . TYR B 161 ? 0.5098 0.5354 0.5969 -0.0252 -0.0122 0.0308  162 TYR B CD1 
3730 C CD2 . TYR B 161 ? 0.5075 0.5310 0.5771 -0.0256 -0.0138 0.0376  162 TYR B CD2 
3731 C CE1 . TYR B 161 ? 0.4984 0.5165 0.5856 -0.0217 -0.0161 0.0358  162 TYR B CE1 
3732 C CE2 . TYR B 161 ? 0.5021 0.5204 0.5718 -0.0230 -0.0196 0.0419  162 TYR B CE2 
3733 C CZ  . TYR B 161 ? 0.5046 0.5207 0.5843 -0.0203 -0.0205 0.0415  162 TYR B CZ  
3734 O OH  . TYR B 161 ? 0.4971 0.5105 0.5807 -0.0159 -0.0261 0.0457  162 TYR B OH  
3735 N N   . ASN B 162 ? 0.5398 0.6074 0.6545 -0.0384 0.0006  0.0084  163 ASN B N   
3736 C CA  . ASN B 162 ? 0.5412 0.6244 0.6691 -0.0425 0.0054  0.0024  163 ASN B CA  
3737 C C   . ASN B 162 ? 0.5688 0.6420 0.6890 -0.0467 0.0148  0.0090  163 ASN B C   
3738 O O   . ASN B 162 ? 0.5649 0.6182 0.6687 -0.0477 0.0163  0.0176  163 ASN B O   
3739 C CB  . ASN B 162 ? 0.5411 0.6311 0.6872 -0.0515 0.0073  -0.0076 163 ASN B CB  
3740 C CG  . ASN B 162 ? 0.5346 0.6522 0.7025 -0.0539 0.0078  -0.0185 163 ASN B CG  
3741 O OD1 . ASN B 162 ? 0.5487 0.6752 0.7352 -0.0632 0.0095  -0.0291 163 ASN B OD1 
3742 N ND2 . ASN B 162 ? 0.4930 0.6249 0.6610 -0.0454 0.0063  -0.0169 163 ASN B ND2 
3743 N N   . ARG B 163 ? 0.6102 0.6989 0.7421 -0.0481 0.0206  0.0044  164 ARG B N   
3744 C CA  . ARG B 163 ? 0.6647 0.7463 0.7917 -0.0533 0.0328  0.0081  164 ARG B CA  
3745 C C   . ARG B 163 ? 0.7203 0.7981 0.8597 -0.0660 0.0431  0.0053  164 ARG B C   
3746 O O   . ARG B 163 ? 0.7480 0.8385 0.9083 -0.0708 0.0407  -0.0039 164 ARG B O   
3747 C CB  . ARG B 163 ? 0.6833 0.7845 0.8203 -0.0476 0.0358  0.0038  164 ARG B CB  
3748 C CG  . ARG B 163 ? 0.7013 0.8028 0.8269 -0.0351 0.0276  0.0066  164 ARG B CG  
3749 C CD  . ARG B 163 ? 0.7201 0.8422 0.8593 -0.0260 0.0286  0.0019  164 ARG B CD  
3750 N NE  . ARG B 163 ? 0.7333 0.8487 0.8586 -0.0145 0.0226  0.0062  164 ARG B NE  
3751 C CZ  . ARG B 163 ? 0.6903 0.8178 0.8207 -0.0037 0.0141  0.0049  164 ARG B CZ  
3752 N NH1 . ARG B 163 ? 0.7116 0.8268 0.8269 0.0050  0.0124  0.0103  164 ARG B NH1 
3753 N NH2 . ARG B 163 ? 0.6599 0.8109 0.8090 -0.0018 0.0078  -0.0019 164 ARG B NH2 
3754 N N   . ASP B 164 ? 0.8058 0.8649 0.9310 -0.0719 0.0553  0.0127  165 ASP B N   
3755 C CA  . ASP B 164 ? 0.9057 0.9538 1.0386 -0.0846 0.0685  0.0126  165 ASP B CA  
3756 C C   . ASP B 164 ? 0.9547 1.0235 1.1138 -0.0927 0.0818  0.0034  165 ASP B C   
3757 O O   . ASP B 164 ? 0.9240 1.0086 1.0865 -0.0875 0.0842  0.0012  165 ASP B O   
3758 C CB  . ASP B 164 ? 0.9848 0.9999 1.0860 -0.0860 0.0764  0.0268  165 ASP B CB  
3759 C CG  . ASP B 164 ? 1.0653 1.0581 1.1673 -0.0954 0.0857  0.0306  165 ASP B CG  
3760 O OD1 . ASP B 164 ? 1.0671 1.0697 1.1966 -0.1037 0.0883  0.0203  165 ASP B OD1 
3761 O OD2 . ASP B 164 ? 1.1393 1.1033 1.2132 -0.0941 0.0902  0.0440  165 ASP B OD2 
3762 N N   . SER B 165 ? 1.0285 1.0974 1.2084 -0.1056 0.0911  -0.0027 166 SER B N   
3763 C CA  . SER B 165 ? 1.0799 1.1687 1.2902 -0.1166 0.1064  -0.0125 166 SER B CA  
3764 C C   . SER B 165 ? 1.1026 1.1720 1.3215 -0.1336 0.1240  -0.0127 166 SER B C   
3765 O O   . SER B 165 ? 1.0446 1.0990 1.2640 -0.1381 0.1199  -0.0138 166 SER B O   
3766 C CB  . SER B 165 ? 1.0674 1.1990 1.3144 -0.1139 0.0947  -0.0291 166 SER B CB  
3767 O OG  . SER B 165 ? 1.0691 1.2041 1.3196 -0.1117 0.0782  -0.0352 166 SER B OG  
3768 N N   . GLN B 169 ? 0.8118 0.9291 1.1305 -0.1630 0.0880  -0.0780 170 GLN B N   
3769 C CA  . GLN B 169 ? 0.8600 0.9401 1.1559 -0.1618 0.0867  -0.0717 170 GLN B CA  
3770 C C   . GLN B 169 ? 0.8633 0.9518 1.1432 -0.1459 0.0644  -0.0732 170 GLN B C   
3771 O O   . GLN B 169 ? 0.8799 0.9517 1.1543 -0.1467 0.0605  -0.0778 170 GLN B O   
3772 C CB  . GLN B 169 ? 0.8692 0.9369 1.1887 -0.1815 0.0984  -0.0861 170 GLN B CB  
3773 N N   . SER B 170 ? 0.8424 0.9538 1.1139 -0.1313 0.0523  -0.0686 171 SER B N   
3774 C CA  . SER B 170 ? 0.8316 0.9543 1.0886 -0.1157 0.0331  -0.0695 171 SER B CA  
3775 C C   . SER B 170 ? 0.8312 0.9210 1.0583 -0.1070 0.0306  -0.0564 171 SER B C   
3776 O O   . SER B 170 ? 0.9032 0.9620 1.1168 -0.1095 0.0415  -0.0433 171 SER B O   
3777 C CB  . SER B 170 ? 0.8091 0.9565 1.0627 -0.1024 0.0253  -0.0645 171 SER B CB  
3778 O OG  . SER B 170 ? 0.7899 0.9164 1.0225 -0.0977 0.0337  -0.0468 171 SER B OG  
3779 N N   . LEU B 171 ? 0.7717 0.8692 0.9886 -0.0961 0.0166  -0.0596 172 LEU B N   
3780 C CA  . LEU B 171 ? 0.7365 0.8083 0.9297 -0.0870 0.0143  -0.0484 172 LEU B CA  
3781 C C   . LEU B 171 ? 0.7034 0.7663 0.8781 -0.0780 0.0154  -0.0303 172 LEU B C   
3782 O O   . LEU B 171 ? 0.7148 0.7963 0.8895 -0.0728 0.0121  -0.0285 172 LEU B O   
3783 C CB  . LEU B 171 ? 0.7313 0.8139 0.9178 -0.0780 0.0017  -0.0566 172 LEU B CB  
3784 C CG  . LEU B 171 ? 0.7410 0.8303 0.9089 -0.0622 -0.0073 -0.0478 172 LEU B CG  
3785 C CD1 . LEU B 171 ? 0.7465 0.8287 0.9031 -0.0559 -0.0123 -0.0521 172 LEU B CD1 
3786 C CD2 . LEU B 171 ? 0.7317 0.8511 0.9042 -0.0563 -0.0150 -0.0515 172 LEU B CD2 
3787 N N   . GLY B 172 ? 0.6488 0.6833 0.8083 -0.0760 0.0199  -0.0177 173 GLY B N   
3788 C CA  . GLY B 172 ? 0.5982 0.6235 0.7398 -0.0694 0.0205  -0.0023 173 GLY B CA  
3789 C C   . GLY B 172 ? 0.5669 0.5995 0.6970 -0.0570 0.0099  0.0018  173 GLY B C   
3790 O O   . GLY B 172 ? 0.5370 0.5711 0.6561 -0.0522 0.0086  0.0097  173 GLY B O   
3791 N N   . GLY B 173 ? 0.5650 0.6007 0.6972 -0.0527 0.0038  -0.0044 174 GLY B N   
3792 C CA  . GLY B 173 ? 0.5290 0.5705 0.6518 -0.0420 -0.0035 -0.0013 174 GLY B CA  
3793 C C   . GLY B 173 ? 0.5430 0.5818 0.6670 -0.0388 -0.0062 -0.0081 174 GLY B C   
3794 O O   . GLY B 173 ? 0.5270 0.5586 0.6588 -0.0449 -0.0030 -0.0161 174 GLY B O   
3795 N N   . GLN B 174 ? 0.5524 0.5953 0.6683 -0.0298 -0.0103 -0.0054 175 GLN B N   
3796 C CA  . GLN B 174 ? 0.5703 0.6110 0.6845 -0.0255 -0.0111 -0.0115 175 GLN B CA  
3797 C C   . GLN B 174 ? 0.5793 0.6181 0.6863 -0.0169 -0.0115 -0.0035 175 GLN B C   
3798 O O   . GLN B 174 ? 0.5477 0.5943 0.6487 -0.0132 -0.0132 0.0014  175 GLN B O   
3799 C CB  . GLN B 174 ? 0.5699 0.6272 0.6829 -0.0250 -0.0152 -0.0241 175 GLN B CB  
3800 C CG  . GLN B 174 ? 0.5854 0.6394 0.6935 -0.0220 -0.0149 -0.0335 175 GLN B CG  
3801 C CD  . GLN B 174 ? 0.6086 0.6810 0.7071 -0.0174 -0.0213 -0.0429 175 GLN B CD  
3802 O OE1 . GLN B 174 ? 0.6343 0.7165 0.7234 -0.0098 -0.0244 -0.0364 175 GLN B OE1 
3803 N NE2 . GLN B 174 ? 0.6283 0.7041 0.7276 -0.0212 -0.0235 -0.0583 175 GLN B NE2 
3804 N N   . ILE B 175 ? 0.5860 0.6138 0.6960 -0.0141 -0.0088 -0.0030 176 ILE B N   
3805 C CA  . ILE B 175 ? 0.5875 0.6163 0.6955 -0.0068 -0.0073 0.0008  176 ILE B CA  
3806 C C   . ILE B 175 ? 0.5919 0.6221 0.6948 -0.0032 -0.0041 -0.0088 176 ILE B C   
3807 O O   . ILE B 175 ? 0.5952 0.6183 0.7010 -0.0055 -0.0021 -0.0175 176 ILE B O   
3808 C CB  . ILE B 175 ? 0.6130 0.6330 0.7304 -0.0042 -0.0068 0.0091  176 ILE B CB  
3809 C CG1 . ILE B 175 ? 0.6209 0.6451 0.7426 0.0020  -0.0036 0.0104  176 ILE B CG1 
3810 C CG2 . ILE B 175 ? 0.6690 0.6742 0.7932 -0.0054 -0.0046 0.0073  176 ILE B CG2 
3811 C CD1 . ILE B 175 ? 0.6349 0.6580 0.7699 0.0053  -0.0055 0.0178  176 ILE B CD1 
3812 N N   . VAL B 176 ? 0.5680 0.6052 0.6607 0.0021  -0.0025 -0.0078 177 VAL B N   
3813 C CA  . VAL B 176 ? 0.5558 0.5926 0.6383 0.0070  0.0020  -0.0154 177 VAL B CA  
3814 C C   . VAL B 176 ? 0.5598 0.5927 0.6471 0.0118  0.0101  -0.0095 177 VAL B C   
3815 O O   . VAL B 176 ? 0.5855 0.6218 0.6723 0.0132  0.0117  -0.0013 177 VAL B O   
3816 C CB  . VAL B 176 ? 0.5469 0.5937 0.6101 0.0109  -0.0009 -0.0184 177 VAL B CB  
3817 C CG1 . VAL B 176 ? 0.5543 0.5987 0.6013 0.0165  0.0040  -0.0263 177 VAL B CG1 
3818 C CG2 . VAL B 176 ? 0.5461 0.6028 0.6105 0.0062  -0.0099 -0.0251 177 VAL B CG2 
3819 N N   . LEU B 177 ? 0.5722 0.5978 0.6666 0.0139  0.0160  -0.0147 178 LEU B N   
3820 C CA  . LEU B 177 ? 0.5681 0.5929 0.6702 0.0190  0.0258  -0.0119 178 LEU B CA  
3821 C C   . LEU B 177 ? 0.5684 0.5922 0.6501 0.0237  0.0344  -0.0179 178 LEU B C   
3822 O O   . LEU B 177 ? 0.5525 0.5721 0.6218 0.0244  0.0349  -0.0288 178 LEU B O   
3823 C CB  . LEU B 177 ? 0.5955 0.6131 0.7172 0.0211  0.0289  -0.0142 178 LEU B CB  
3824 C CG  . LEU B 177 ? 0.5967 0.6114 0.7356 0.0193  0.0212  -0.0072 178 LEU B CG  
3825 C CD1 . LEU B 177 ? 0.6197 0.6244 0.7743 0.0246  0.0259  -0.0099 178 LEU B CD1 
3826 C CD2 . LEU B 177 ? 0.5907 0.6157 0.7399 0.0189  0.0170  0.0032  178 LEU B CD2 
3827 N N   . GLY B 178 ? 0.5591 0.5857 0.6356 0.0264  0.0418  -0.0110 179 GLY B N   
3828 C CA  . GLY B 178 ? 0.5805 0.6034 0.6334 0.0319  0.0525  -0.0137 179 GLY B CA  
3829 C C   . GLY B 178 ? 0.5828 0.6069 0.6071 0.0348  0.0482  -0.0106 179 GLY B C   
3830 O O   . GLY B 178 ? 0.5988 0.6181 0.5977 0.0409  0.0564  -0.0109 179 GLY B O   
3831 N N   . GLY B 179 ? 0.5700 0.6001 0.5972 0.0316  0.0358  -0.0070 180 GLY B N   
3832 C CA  . GLY B 179 ? 0.5789 0.6121 0.5832 0.0362  0.0304  -0.0032 180 GLY B CA  
3833 C C   . GLY B 179 ? 0.5692 0.6101 0.5843 0.0321  0.0184  -0.0002 180 GLY B C   
3834 O O   . GLY B 179 ? 0.5494 0.5905 0.5866 0.0256  0.0167  0.0030  180 GLY B O   
3835 N N   . SER B 180 ? 0.5859 0.6340 0.5846 0.0368  0.0100  -0.0014 181 SER B N   
3836 C CA  . SER B 180 ? 0.5916 0.6494 0.6003 0.0340  -0.0002 -0.0001 181 SER B CA  
3837 C C   . SER B 180 ? 0.6052 0.6773 0.6086 0.0349  -0.0121 -0.0114 181 SER B C   
3838 O O   . SER B 180 ? 0.6391 0.7133 0.6252 0.0394  -0.0136 -0.0195 181 SER B O   
3839 C CB  . SER B 180 ? 0.6060 0.6605 0.6053 0.0402  0.0024  0.0117  181 SER B CB  
3840 O OG  . SER B 180 ? 0.6490 0.7061 0.6222 0.0519  0.0001  0.0127  181 SER B OG  
3841 N N   . ASP B 181 ? 0.6008 0.6838 0.6195 0.0301  -0.0201 -0.0132 182 ASP B N   
3842 C CA  . ASP B 181 ? 0.5899 0.6909 0.6103 0.0295  -0.0315 -0.0251 182 ASP B CA  
3843 C C   . ASP B 181 ? 0.5831 0.6984 0.5999 0.0379  -0.0385 -0.0201 182 ASP B C   
3844 O O   . ASP B 181 ? 0.5710 0.6898 0.6040 0.0342  -0.0386 -0.0157 182 ASP B O   
3845 C CB  . ASP B 181 ? 0.5779 0.6812 0.6228 0.0160  -0.0332 -0.0339 182 ASP B CB  
3846 C CG  . ASP B 181 ? 0.6039 0.7266 0.6555 0.0121  -0.0435 -0.0499 182 ASP B CG  
3847 O OD1 . ASP B 181 ? 0.6042 0.7437 0.6434 0.0209  -0.0526 -0.0541 182 ASP B OD1 
3848 O OD2 . ASP B 181 ? 0.6178 0.7389 0.6880 0.0000  -0.0424 -0.0586 182 ASP B OD2 
3849 N N   . PRO B 182 ? 0.6100 0.7330 0.6039 0.0506  -0.0443 -0.0207 183 PRO B N   
3850 C CA  . PRO B 182 ? 0.6393 0.7767 0.6285 0.0624  -0.0522 -0.0155 183 PRO B CA  
3851 C C   . PRO B 182 ? 0.6419 0.8037 0.6586 0.0566  -0.0620 -0.0245 183 PRO B C   
3852 O O   . PRO B 182 ? 0.6645 0.8337 0.6881 0.0631  -0.0635 -0.0174 183 PRO B O   
3853 C CB  . PRO B 182 ? 0.6555 0.7996 0.6145 0.0759  -0.0598 -0.0189 183 PRO B CB  
3854 C CG  . PRO B 182 ? 0.6537 0.7766 0.5952 0.0734  -0.0485 -0.0182 183 PRO B CG  
3855 C CD  . PRO B 182 ? 0.6188 0.7365 0.5873 0.0562  -0.0435 -0.0259 183 PRO B CD  
3856 N N   . GLN B 183 ? 0.6503 0.8231 0.6840 0.0441  -0.0668 -0.0401 184 GLN B N   
3857 C CA  . GLN B 183 ? 0.6699 0.8648 0.7337 0.0353  -0.0728 -0.0498 184 GLN B CA  
3858 C C   . GLN B 183 ? 0.6255 0.8119 0.7077 0.0287  -0.0632 -0.0401 184 GLN B C   
3859 O O   . GLN B 183 ? 0.6160 0.8209 0.7202 0.0255  -0.0659 -0.0443 184 GLN B O   
3860 C CB  . GLN B 183 ? 0.7064 0.9078 0.7853 0.0203  -0.0756 -0.0684 184 GLN B CB  
3861 C CG  . GLN B 183 ? 0.8094 1.0281 0.8752 0.0248  -0.0885 -0.0841 184 GLN B CG  
3862 C CD  . GLN B 183 ? 0.8928 1.1467 0.9640 0.0352  -0.1046 -0.0901 184 GLN B CD  
3863 O OE1 . GLN B 183 ? 0.9138 1.1893 1.0161 0.0290  -0.1078 -0.0956 184 GLN B OE1 
3864 N NE2 . GLN B 183 ? 0.9124 1.1728 0.9532 0.0521  -0.1144 -0.0886 184 GLN B NE2 
3865 N N   . HIS B 184 ? 0.5871 0.7472 0.6606 0.0269  -0.0522 -0.0282 185 HIS B N   
3866 C CA  . HIS B 184 ? 0.5575 0.7076 0.6434 0.0204  -0.0438 -0.0199 185 HIS B CA  
3867 C C   . HIS B 184 ? 0.5599 0.6988 0.6345 0.0299  -0.0384 -0.0059 185 HIS B C   
3868 O O   . HIS B 184 ? 0.5802 0.7092 0.6614 0.0245  -0.0316 -0.0001 185 HIS B O   
3869 C CB  . HIS B 184 ? 0.5259 0.6578 0.6181 0.0074  -0.0367 -0.0201 185 HIS B CB  
3870 C CG  . HIS B 184 ? 0.5296 0.6692 0.6385 -0.0042 -0.0387 -0.0332 185 HIS B CG  
3871 N ND1 . HIS B 184 ? 0.5359 0.6919 0.6652 -0.0111 -0.0397 -0.0397 185 HIS B ND1 
3872 C CD2 . HIS B 184 ? 0.5301 0.6623 0.6397 -0.0107 -0.0383 -0.0419 185 HIS B CD2 
3873 C CE1 . HIS B 184 ? 0.5378 0.6955 0.6800 -0.0225 -0.0396 -0.0518 185 HIS B CE1 
3874 N NE2 . HIS B 184 ? 0.5513 0.6934 0.6810 -0.0222 -0.0389 -0.0534 185 HIS B NE2 
3875 N N   . TYR B 185 ? 0.5721 0.7109 0.6279 0.0440  -0.0409 -0.0008 186 TYR B N   
3876 C CA  . TYR B 185 ? 0.5579 0.6865 0.6045 0.0541  -0.0353 0.0112  186 TYR B CA  
3877 C C   . TYR B 185 ? 0.5859 0.7272 0.6217 0.0718  -0.0423 0.0140  186 TYR B C   
3878 O O   . TYR B 185 ? 0.5779 0.7372 0.6088 0.0777  -0.0531 0.0066  186 TYR B O   
3879 C CB  . TYR B 185 ? 0.5538 0.6557 0.5858 0.0531  -0.0246 0.0208  186 TYR B CB  
3880 C CG  . TYR B 185 ? 0.5756 0.6702 0.5880 0.0582  -0.0236 0.0216  186 TYR B CG  
3881 C CD1 . TYR B 185 ? 0.5876 0.6788 0.6032 0.0488  -0.0224 0.0152  186 TYR B CD1 
3882 C CD2 . TYR B 185 ? 0.5968 0.6852 0.5856 0.0734  -0.0220 0.0297  186 TYR B CD2 
3883 C CE1 . TYR B 185 ? 0.6197 0.7034 0.6165 0.0536  -0.0192 0.0152  186 TYR B CE1 
3884 C CE2 . TYR B 185 ? 0.6213 0.7008 0.5881 0.0782  -0.0187 0.0310  186 TYR B CE2 
3885 C CZ  . TYR B 185 ? 0.6283 0.7063 0.5997 0.0679  -0.0170 0.0230  186 TYR B CZ  
3886 O OH  . TYR B 185 ? 0.6343 0.7033 0.5835 0.0728  -0.0118 0.0234  186 TYR B OH  
3887 N N   . GLU B 186 ? 0.6320 0.7631 0.6635 0.0809  -0.0361 0.0244  187 GLU B N   
3888 C CA  . GLU B 186 ? 0.6575 0.7972 0.6797 0.1004  -0.0412 0.0300  187 GLU B CA  
3889 C C   . GLU B 186 ? 0.6575 0.7680 0.6516 0.1110  -0.0313 0.0444  187 GLU B C   
3890 O O   . GLU B 186 ? 0.6696 0.7558 0.6629 0.1039  -0.0182 0.0505  187 GLU B O   
3891 C CB  . GLU B 186 ? 0.6884 0.8373 0.7315 0.1023  -0.0393 0.0301  187 GLU B CB  
3892 C CG  . GLU B 186 ? 0.7933 0.9623 0.8377 0.1228  -0.0481 0.0322  187 GLU B CG  
3893 C CD  . GLU B 186 ? 0.8307 1.0283 0.9084 0.1200  -0.0519 0.0228  187 GLU B CD  
3894 O OE1 . GLU B 186 ? 0.9082 1.1265 0.9931 0.1374  -0.0595 0.0237  187 GLU B OE1 
3895 O OE2 . GLU B 186 ? 0.7832 0.9828 0.8796 0.1012  -0.0468 0.0151  187 GLU B OE2 
3896 N N   . GLY B 187 ? 0.6547 0.7676 0.6252 0.1277  -0.0372 0.0491  188 GLY B N   
3897 C CA  . GLY B 187 ? 0.6818 0.7650 0.6221 0.1391  -0.0260 0.0640  188 GLY B CA  
3898 C C   . GLY B 187 ? 0.7079 0.7696 0.6368 0.1271  -0.0146 0.0652  188 GLY B C   
3899 O O   . GLY B 187 ? 0.6982 0.7707 0.6311 0.1168  -0.0197 0.0548  188 GLY B O   
3900 N N   . ASN B 188 ? 0.7193 0.7501 0.6362 0.1282  0.0019  0.0772  189 ASN B N   
3901 C CA  . ASN B 188 ? 0.6967 0.7069 0.6047 0.1183  0.0155  0.0796  189 ASN B CA  
3902 C C   . ASN B 188 ? 0.6419 0.6384 0.5718 0.1016  0.0268  0.0787  189 ASN B C   
3903 O O   . ASN B 188 ? 0.6236 0.6154 0.5647 0.1012  0.0290  0.0805  189 ASN B O   
3904 C CB  . ASN B 188 ? 0.7312 0.7160 0.6046 0.1329  0.0275  0.0941  189 ASN B CB  
3905 C CG  . ASN B 188 ? 0.7883 0.7853 0.6348 0.1540  0.0146  0.0976  189 ASN B CG  
3906 O OD1 . ASN B 188 ? 0.7900 0.7837 0.6268 0.1710  0.0121  0.1070  189 ASN B OD1 
3907 N ND2 . ASN B 188 ? 0.7968 0.8085 0.6310 0.1539  0.0059  0.0893  189 ASN B ND2 
3908 N N   . PHE B 189 ? 0.6156 0.6068 0.5516 0.0886  0.0336  0.0750  190 PHE B N   
3909 C CA  . PHE B 189 ? 0.6072 0.5871 0.5629 0.0733  0.0434  0.0736  190 PHE B CA  
3910 C C   . PHE B 189 ? 0.6228 0.5744 0.5704 0.0750  0.0606  0.0837  190 PHE B C   
3911 O O   . PHE B 189 ? 0.6234 0.5573 0.5471 0.0856  0.0712  0.0938  190 PHE B O   
3912 C CB  . PHE B 189 ? 0.6038 0.5874 0.5693 0.0617  0.0462  0.0675  190 PHE B CB  
3913 C CG  . PHE B 189 ? 0.6029 0.6089 0.5814 0.0563  0.0321  0.0566  190 PHE B CG  
3914 C CD1 . PHE B 189 ? 0.5786 0.5956 0.5779 0.0475  0.0235  0.0507  190 PHE B CD1 
3915 C CD2 . PHE B 189 ? 0.6223 0.6356 0.5906 0.0594  0.0290  0.0521  190 PHE B CD2 
3916 C CE1 . PHE B 189 ? 0.5890 0.6224 0.5996 0.0421  0.0130  0.0417  190 PHE B CE1 
3917 C CE2 . PHE B 189 ? 0.6222 0.6524 0.6033 0.0535  0.0178  0.0413  190 PHE B CE2 
3918 C CZ  . PHE B 189 ? 0.6016 0.6410 0.6045 0.0447  0.0103  0.0367  190 PHE B CZ  
3919 N N   . HIS B 190 ? 0.6198 0.5657 0.5856 0.0647  0.0638  0.0807  191 HIS B N   
3920 C CA  . HIS B 190 ? 0.6618 0.5820 0.6298 0.0580  0.0812  0.0848  191 HIS B CA  
3921 C C   . HIS B 190 ? 0.6269 0.5549 0.6199 0.0390  0.0819  0.0754  191 HIS B C   
3922 O O   . HIS B 190 ? 0.6072 0.5539 0.6164 0.0313  0.0690  0.0667  191 HIS B O   
3923 C CB  . HIS B 190 ? 0.6879 0.5944 0.6565 0.0612  0.0847  0.0869  191 HIS B CB  
3924 C CG  . HIS B 190 ? 0.7722 0.6513 0.7456 0.0516  0.1027  0.0882  191 HIS B CG  
3925 N ND1 . HIS B 190 ? 0.8360 0.6859 0.7918 0.0584  0.1211  0.0996  191 HIS B ND1 
3926 C CD2 . HIS B 190 ? 0.7818 0.6579 0.7753 0.0350  0.1056  0.0788  191 HIS B CD2 
3927 C CE1 . HIS B 190 ? 0.8536 0.6834 0.8218 0.0449  0.1356  0.0962  191 HIS B CE1 
3928 N NE2 . HIS B 190 ? 0.8336 0.6804 0.8250 0.0305  0.1253  0.0828  191 HIS B NE2 
3929 N N   . TYR B 191 ? 0.6321 0.5459 0.6281 0.0323  0.0973  0.0775  192 TYR B N   
3930 C CA  . TYR B 191 ? 0.6227 0.5473 0.6449 0.0162  0.0981  0.0687  192 TYR B CA  
3931 C C   . TYR B 191 ? 0.6173 0.5302 0.6572 0.0026  0.1070  0.0640  192 TYR B C   
3932 O O   . TYR B 191 ? 0.6579 0.5456 0.6880 0.0043  0.1213  0.0696  192 TYR B O   
3933 C CB  . TYR B 191 ? 0.6310 0.5548 0.6504 0.0168  0.1089  0.0715  192 TYR B CB  
3934 C CG  . TYR B 191 ? 0.6374 0.5751 0.6415 0.0275  0.0987  0.0720  192 TYR B CG  
3935 C CD1 . TYR B 191 ? 0.6093 0.5692 0.6305 0.0223  0.0867  0.0631  192 TYR B CD1 
3936 C CD2 . TYR B 191 ? 0.6724 0.6006 0.6443 0.0435  0.1004  0.0808  192 TYR B CD2 
3937 C CE1 . TYR B 191 ? 0.5896 0.5603 0.5979 0.0304  0.0782  0.0613  192 TYR B CE1 
3938 C CE2 . TYR B 191 ? 0.6624 0.6051 0.6207 0.0519  0.0898  0.0783  192 TYR B CE2 
3939 C CZ  . TYR B 191 ? 0.6225 0.5857 0.6001 0.0443  0.0794  0.0677  192 TYR B CZ  
3940 O OH  . TYR B 191 ? 0.6244 0.6000 0.5899 0.0508  0.0698  0.0631  192 TYR B OH  
3941 N N   . ILE B 192 ? 0.5957 0.5265 0.6608 -0.0104 0.0977  0.0533  193 ILE B N   
3942 C CA  . ILE B 192 ? 0.5821 0.5085 0.6683 -0.0258 0.1032  0.0451  193 ILE B CA  
3943 C C   . ILE B 192 ? 0.5659 0.5107 0.6786 -0.0357 0.1033  0.0388  193 ILE B C   
3944 O O   . ILE B 192 ? 0.5411 0.5083 0.6624 -0.0344 0.0888  0.0355  193 ILE B O   
3945 C CB  . ILE B 192 ? 0.5632 0.4969 0.6542 -0.0314 0.0889  0.0365  193 ILE B CB  
3946 C CG1 . ILE B 192 ? 0.5656 0.4858 0.6337 -0.0201 0.0880  0.0419  193 ILE B CG1 
3947 C CG2 . ILE B 192 ? 0.5625 0.4909 0.6728 -0.0477 0.0944  0.0260  193 ILE B CG2 
3948 C CD1 . ILE B 192 ? 0.5456 0.4828 0.6035 -0.0094 0.0731  0.0448  193 ILE B CD1 
3949 N N   . ASN B 193 ? 0.5886 0.5231 0.7158 -0.0452 0.1210  0.0372  194 ASN B N   
3950 C CA  . ASN B 193 ? 0.5905 0.5444 0.7491 -0.0553 0.1235  0.0301  194 ASN B CA  
3951 C C   . ASN B 193 ? 0.5723 0.5499 0.7581 -0.0667 0.1059  0.0167  194 ASN B C   
3952 O O   . ASN B 193 ? 0.5869 0.5580 0.7691 -0.0722 0.0999  0.0113  194 ASN B O   
3953 C CB  . ASN B 193 ? 0.6167 0.5530 0.7859 -0.0641 0.1497  0.0312  194 ASN B CB  
3954 C CG  . ASN B 193 ? 0.6413 0.5512 0.7783 -0.0514 0.1682  0.0462  194 ASN B CG  
3955 O OD1 . ASN B 193 ? 0.6878 0.5694 0.8170 -0.0544 0.1899  0.0516  194 ASN B OD1 
3956 N ND2 . ASN B 193 ? 0.6233 0.5410 0.7400 -0.0370 0.1602  0.0527  194 ASN B ND2 
3957 N N   . LEU B 194 ? 0.5356 0.5400 0.7464 -0.0688 0.0976  0.0117  195 LEU B N   
3958 C CA  . LEU B 194 ? 0.5136 0.5434 0.7526 -0.0784 0.0808  -0.0004 195 LEU B CA  
3959 C C   . LEU B 194 ? 0.5338 0.5633 0.8007 -0.0956 0.0922  -0.0112 195 LEU B C   
3960 O O   . LEU B 194 ? 0.5607 0.5772 0.8352 -0.1001 0.1150  -0.0088 195 LEU B O   
3961 C CB  . LEU B 194 ? 0.4803 0.5378 0.7405 -0.0735 0.0706  -0.0017 195 LEU B CB  
3962 C CG  . LEU B 194 ? 0.4596 0.5194 0.7006 -0.0585 0.0620  0.0066  195 LEU B CG  
3963 C CD1 . LEU B 194 ? 0.4416 0.5280 0.7107 -0.0558 0.0530  0.0029  195 LEU B CD1 
3964 C CD2 . LEU B 194 ? 0.4567 0.5100 0.6704 -0.0528 0.0463  0.0097  195 LEU B CD2 
3965 N N   . ILE B 195 ? 0.5360 0.5791 0.8167 -0.1054 0.0768  -0.0236 196 ILE B N   
3966 C CA  . ILE B 195 ? 0.5601 0.6099 0.8729 -0.1241 0.0828  -0.0384 196 ILE B CA  
3967 C C   . ILE B 195 ? 0.5631 0.6407 0.9190 -0.1296 0.0879  -0.0438 196 ILE B C   
3968 O O   . ILE B 195 ? 0.5809 0.6548 0.9623 -0.1430 0.1078  -0.0500 196 ILE B O   
3969 C CB  . ILE B 195 ? 0.5590 0.6223 0.8740 -0.1316 0.0603  -0.0520 196 ILE B CB  
3970 C CG1 . ILE B 195 ? 0.5520 0.5884 0.8249 -0.1251 0.0573  -0.0467 196 ILE B CG1 
3971 C CG2 . ILE B 195 ? 0.5575 0.6287 0.9065 -0.1526 0.0654  -0.0705 196 ILE B CG2 
3972 C CD1 . ILE B 195 ? 0.5528 0.6036 0.8151 -0.1249 0.0322  -0.0544 196 ILE B CD1 
3973 N N   . LYS B 196 ? 0.5535 0.6575 0.9181 -0.1189 0.0716  -0.0412 197 LYS B N   
3974 C CA  . LYS B 196 ? 0.5622 0.6949 0.9675 -0.1199 0.0752  -0.0450 197 LYS B CA  
3975 C C   . LYS B 196 ? 0.5452 0.6883 0.9404 -0.1018 0.0645  -0.0351 197 LYS B C   
3976 O O   . LYS B 196 ? 0.5419 0.6779 0.9061 -0.0913 0.0484  -0.0286 197 LYS B O   
3977 C CB  . LYS B 196 ? 0.5932 0.7620 1.0433 -0.1327 0.0599  -0.0628 197 LYS B CB  
3978 C CG  . LYS B 196 ? 0.6007 0.7903 1.0437 -0.1260 0.0269  -0.0665 197 LYS B CG  
3979 C CD  . LYS B 196 ? 0.6233 0.8524 1.1119 -0.1373 0.0106  -0.0846 197 LYS B CD  
3980 C CE  . LYS B 196 ? 0.6266 0.8792 1.1078 -0.1256 -0.0223 -0.0847 197 LYS B CE  
3981 N NZ  . LYS B 196 ? 0.6207 0.8533 1.0590 -0.1262 -0.0355 -0.0849 197 LYS B NZ  
3982 N N   . THR B 197 ? 0.5452 0.7041 0.9679 -0.0988 0.0751  -0.0348 198 THR B N   
3983 C CA  . THR B 197 ? 0.5306 0.6998 0.9496 -0.0823 0.0669  -0.0277 198 THR B CA  
3984 C C   . THR B 197 ? 0.5185 0.7155 0.9517 -0.0769 0.0371  -0.0323 198 THR B C   
3985 O O   . THR B 197 ? 0.5377 0.7549 0.9944 -0.0867 0.0242  -0.0433 198 THR B O   
3986 C CB  . THR B 197 ? 0.5208 0.7001 0.9679 -0.0806 0.0879  -0.0279 198 THR B CB  
3987 O OG1 . THR B 197 ? 0.5217 0.7000 0.9542 -0.0640 0.0844  -0.0202 198 THR B OG1 
3988 C CG2 . THR B 197 ? 0.5085 0.7267 1.0145 -0.0893 0.0846  -0.0413 198 THR B CG2 
3989 N N   . GLY B 198 ? 0.5066 0.7029 0.9233 -0.0614 0.0262  -0.0240 199 GLY B N   
3990 C CA  . GLY B 198 ? 0.5256 0.7454 0.9544 -0.0534 0.0002  -0.0255 199 GLY B CA  
3991 C C   . GLY B 198 ? 0.5266 0.7336 0.9182 -0.0490 -0.0194 -0.0205 199 GLY B C   
3992 O O   . GLY B 198 ? 0.5493 0.7694 0.9426 -0.0394 -0.0391 -0.0182 199 GLY B O   
3993 N N   . VAL B 199 ? 0.5073 0.6881 0.8654 -0.0551 -0.0128 -0.0181 200 VAL B N   
3994 C CA  . VAL B 199 ? 0.4935 0.6608 0.8161 -0.0524 -0.0276 -0.0140 200 VAL B CA  
3995 C C   . VAL B 199 ? 0.5083 0.6443 0.7957 -0.0538 -0.0132 -0.0081 200 VAL B C   
3996 O O   . VAL B 199 ? 0.5348 0.6598 0.8241 -0.0623 0.0030  -0.0109 200 VAL B O   
3997 C CB  . VAL B 199 ? 0.4822 0.6653 0.8123 -0.0609 -0.0455 -0.0242 200 VAL B CB  
3998 C CG1 . VAL B 199 ? 0.4953 0.6785 0.8423 -0.0778 -0.0339 -0.0360 200 VAL B CG1 
3999 C CG2 . VAL B 199 ? 0.4705 0.6389 0.7615 -0.0577 -0.0588 -0.0199 200 VAL B CG2 
4000 N N   . TRP B 200 ? 0.5044 0.6263 0.7614 -0.0449 -0.0186 0.0003  201 TRP B N   
4001 C CA  . TRP B 200 ? 0.5005 0.5975 0.7258 -0.0443 -0.0087 0.0055  201 TRP B CA  
4002 C C   . TRP B 200 ? 0.5174 0.6051 0.7278 -0.0523 -0.0118 0.0011  201 TRP B C   
4003 O O   . TRP B 200 ? 0.5380 0.6165 0.7237 -0.0493 -0.0189 0.0043  201 TRP B O   
4004 C CB  . TRP B 200 ? 0.4760 0.5648 0.6797 -0.0338 -0.0134 0.0136  201 TRP B CB  
4005 C CG  . TRP B 200 ? 0.4772 0.5687 0.6898 -0.0262 -0.0070 0.0167  201 TRP B CG  
4006 C CD1 . TRP B 200 ? 0.4696 0.5701 0.6922 -0.0188 -0.0153 0.0187  201 TRP B CD1 
4007 C CD2 . TRP B 200 ? 0.4773 0.5604 0.6872 -0.0244 0.0099  0.0182  201 TRP B CD2 
4008 N NE1 . TRP B 200 ? 0.4662 0.5645 0.6940 -0.0133 -0.0040 0.0196  201 TRP B NE1 
4009 C CE2 . TRP B 200 ? 0.4615 0.5499 0.6802 -0.0167 0.0110  0.0192  201 TRP B CE2 
4010 C CE3 . TRP B 200 ? 0.4834 0.5527 0.6818 -0.0275 0.0248  0.0193  201 TRP B CE3 
4011 C CZ2 . TRP B 200 ? 0.4694 0.5512 0.6842 -0.0128 0.0263  0.0199  201 TRP B CZ2 
4012 C CZ3 . TRP B 200 ? 0.4821 0.5445 0.6752 -0.0227 0.0395  0.0220  201 TRP B CZ3 
4013 C CH2 . TRP B 200 ? 0.4812 0.5506 0.6818 -0.0158 0.0399  0.0216  201 TRP B CH2 
4014 N N   . GLN B 201 ? 0.5103 0.5997 0.7371 -0.0631 -0.0045 -0.0069 202 GLN B N   
4015 C CA  . GLN B 201 ? 0.5190 0.5997 0.7360 -0.0724 -0.0065 -0.0143 202 GLN B CA  
4016 C C   . GLN B 201 ? 0.5324 0.5917 0.7467 -0.0783 0.0146  -0.0147 202 GLN B C   
4017 O O   . GLN B 201 ? 0.5339 0.5947 0.7687 -0.0822 0.0285  -0.0155 202 GLN B O   
4018 C CB  . GLN B 201 ? 0.5147 0.6185 0.7556 -0.0815 -0.0208 -0.0267 202 GLN B CB  
4019 C CG  . GLN B 201 ? 0.5466 0.6440 0.7712 -0.0896 -0.0289 -0.0359 202 GLN B CG  
4020 C CD  . GLN B 201 ? 0.5710 0.6950 0.8172 -0.0977 -0.0468 -0.0494 202 GLN B CD  
4021 O OE1 . GLN B 201 ? 0.5974 0.7399 0.8800 -0.1059 -0.0446 -0.0583 202 GLN B OE1 
4022 N NE2 . GLN B 201 ? 0.5874 0.7143 0.8112 -0.0954 -0.0645 -0.0516 202 GLN B NE2 
4023 N N   . ILE B 202 ? 0.5376 0.5757 0.7261 -0.0779 0.0186  -0.0134 203 ILE B N   
4024 C CA  . ILE B 202 ? 0.5453 0.5581 0.7265 -0.0809 0.0388  -0.0119 203 ILE B CA  
4025 C C   . ILE B 202 ? 0.5767 0.5773 0.7540 -0.0918 0.0400  -0.0229 203 ILE B C   
4026 O O   . ILE B 202 ? 0.5823 0.5907 0.7513 -0.0938 0.0247  -0.0294 203 ILE B O   
4027 C CB  . ILE B 202 ? 0.5319 0.5271 0.6861 -0.0668 0.0468  0.0014  203 ILE B CB  
4028 C CG1 . ILE B 202 ? 0.5115 0.5064 0.6431 -0.0598 0.0343  0.0035  203 ILE B CG1 
4029 C CG2 . ILE B 202 ? 0.5186 0.5228 0.6779 -0.0586 0.0496  0.0093  203 ILE B CG2 
4030 C CD1 . ILE B 202 ? 0.4755 0.4558 0.5844 -0.0473 0.0412  0.0136  203 ILE B CD1 
4031 N N   . GLN B 203 ? 0.6109 0.5906 0.7931 -0.0990 0.0592  -0.0253 204 GLN B N   
4032 C CA  . GLN B 203 ? 0.6465 0.6070 0.8225 -0.1088 0.0648  -0.0357 204 GLN B CA  
4033 C C   . GLN B 203 ? 0.6372 0.5783 0.7800 -0.0968 0.0654  -0.0283 204 GLN B C   
4034 O O   . GLN B 203 ? 0.6183 0.5499 0.7462 -0.0830 0.0722  -0.0143 204 GLN B O   
4035 C CB  . GLN B 203 ? 0.6956 0.6335 0.8848 -0.1184 0.0890  -0.0378 204 GLN B CB  
4036 C CG  . GLN B 203 ? 0.7781 0.6929 0.9654 -0.1310 0.0978  -0.0509 204 GLN B CG  
4037 C CD  . GLN B 203 ? 0.8323 0.7682 1.0470 -0.1507 0.0868  -0.0725 204 GLN B CD  
4038 O OE1 . GLN B 203 ? 0.8696 0.8356 1.1135 -0.1569 0.0783  -0.0774 204 GLN B OE1 
4039 N NE2 . GLN B 203 ? 0.8713 0.7922 1.0776 -0.1603 0.0867  -0.0867 204 GLN B NE2 
4040 N N   . MET B 204 ? 0.6559 0.5940 0.7879 -0.1019 0.0575  -0.0388 205 MET B N   
4041 C CA  . MET B 204 ? 0.6756 0.5943 0.7801 -0.0923 0.0613  -0.0347 205 MET B CA  
4042 C C   . MET B 204 ? 0.7243 0.6147 0.8253 -0.1013 0.0758  -0.0454 205 MET B C   
4043 O O   . MET B 204 ? 0.7317 0.6254 0.8452 -0.1174 0.0726  -0.0619 205 MET B O   
4044 C CB  . MET B 204 ? 0.6741 0.6094 0.7637 -0.0885 0.0428  -0.0365 205 MET B CB  
4045 C CG  . MET B 204 ? 0.6944 0.6144 0.7591 -0.0777 0.0476  -0.0317 205 MET B CG  
4046 S SD  . MET B 204 ? 0.7155 0.6564 0.7665 -0.0678 0.0317  -0.0238 205 MET B SD  
4047 C CE  . MET B 204 ? 0.6699 0.6248 0.7163 -0.0797 0.0144  -0.0375 205 MET B CE  
4048 N N   . LYS B 205 ? 0.7555 0.6185 0.8405 -0.0904 0.0914  -0.0365 206 LYS B N   
4049 C CA  . LYS B 205 ? 0.8229 0.6517 0.9053 -0.0963 0.1104  -0.0434 206 LYS B CA  
4050 C C   . LYS B 205 ? 0.8315 0.6458 0.8938 -0.0933 0.1108  -0.0511 206 LYS B C   
4051 O O   . LYS B 205 ? 0.8824 0.6655 0.9407 -0.0971 0.1271  -0.0578 206 LYS B O   
4052 C CB  . LYS B 205 ? 0.8698 0.6728 0.9486 -0.0852 0.1309  -0.0273 206 LYS B CB  
4053 C CG  . LYS B 205 ? 0.9361 0.7455 1.0345 -0.0918 0.1373  -0.0227 206 LYS B CG  
4054 C CD  . LYS B 205 ? 1.0026 0.7969 1.0883 -0.0745 0.1504  -0.0018 206 LYS B CD  
4055 C CE  . LYS B 205 ? 1.0613 0.8127 1.1424 -0.0752 0.1774  0.0027  206 LYS B CE  
4056 N NZ  . LYS B 205 ? 1.0735 0.8094 1.1361 -0.0559 0.1889  0.0244  206 LYS B NZ  
4057 N N   . GLY B 206 ? 0.7946 0.6296 0.8445 -0.0870 0.0948  -0.0505 207 GLY B N   
4058 C CA  . GLY B 206 ? 0.7838 0.6081 0.8137 -0.0834 0.0957  -0.0575 207 GLY B CA  
4059 C C   . GLY B 206 ? 0.7721 0.6183 0.7893 -0.0722 0.0827  -0.0497 207 GLY B C   
4060 O O   . GLY B 206 ? 0.7419 0.6028 0.7632 -0.0613 0.0783  -0.0351 207 GLY B O   
4061 N N   . VAL B 207 ? 0.7718 0.6193 0.7730 -0.0757 0.0774  -0.0603 208 VAL B N   
4062 C CA  . VAL B 207 ? 0.7593 0.6206 0.7466 -0.0652 0.0711  -0.0533 208 VAL B CA  
4063 C C   . VAL B 207 ? 0.7985 0.6391 0.7706 -0.0587 0.0852  -0.0582 208 VAL B C   
4064 O O   . VAL B 207 ? 0.8200 0.6463 0.7797 -0.0679 0.0888  -0.0740 208 VAL B O   
4065 C CB  . VAL B 207 ? 0.7499 0.6340 0.7288 -0.0726 0.0524  -0.0579 208 VAL B CB  
4066 C CG1 . VAL B 207 ? 0.7368 0.6295 0.7003 -0.0631 0.0507  -0.0509 208 VAL B CG1 
4067 C CG2 . VAL B 207 ? 0.7177 0.6235 0.7145 -0.0755 0.0392  -0.0514 208 VAL B CG2 
4068 N N   . SER B 208 ? 0.7951 0.6355 0.7690 -0.0423 0.0929  -0.0457 209 SER B N   
4069 C CA  . SER B 208 ? 0.8241 0.6463 0.7892 -0.0326 0.1081  -0.0486 209 SER B CA  
4070 C C   . SER B 208 ? 0.8217 0.6598 0.7777 -0.0259 0.1060  -0.0470 209 SER B C   
4071 O O   . SER B 208 ? 0.8200 0.6817 0.7829 -0.0202 0.0973  -0.0363 209 SER B O   
4072 C CB  . SER B 208 ? 0.8152 0.6223 0.7903 -0.0171 0.1209  -0.0369 209 SER B CB  
4073 O OG  . SER B 208 ? 0.8567 0.6400 0.8364 -0.0246 0.1289  -0.0403 209 SER B OG  
4074 N N   . VAL B 209 ? 0.8465 0.6703 0.7870 -0.0280 0.1155  -0.0591 210 VAL B N   
4075 C CA  . VAL B 209 ? 0.8591 0.6922 0.7914 -0.0207 0.1206  -0.0589 210 VAL B CA  
4076 C C   . VAL B 209 ? 0.9193 0.7357 0.8589 -0.0052 0.1391  -0.0578 210 VAL B C   
4077 O O   . VAL B 209 ? 0.9704 0.7585 0.9018 -0.0070 0.1520  -0.0689 210 VAL B O   
4078 C CB  . VAL B 209 ? 0.8624 0.6909 0.7684 -0.0332 0.1190  -0.0734 210 VAL B CB  
4079 C CG1 . VAL B 209 ? 0.8656 0.6991 0.7616 -0.0260 0.1295  -0.0738 210 VAL B CG1 
4080 C CG2 . VAL B 209 ? 0.8350 0.6815 0.7345 -0.0449 0.0991  -0.0719 210 VAL B CG2 
4081 N N   . GLY B 210 ? 0.9112 0.7454 0.8675 0.0102  0.1399  -0.0449 211 GLY B N   
4082 C CA  . GLY B 210 ? 0.9729 0.7960 0.9411 0.0290  0.1539  -0.0400 211 GLY B CA  
4083 C C   . GLY B 210 ? 1.0087 0.8086 0.9808 0.0320  0.1567  -0.0348 211 GLY B C   
4084 O O   . GLY B 210 ? 0.9643 0.7721 0.9409 0.0263  0.1452  -0.0277 211 GLY B O   
4085 N N   . SER B 211 ? 1.0692 0.8386 1.0393 0.0407  0.1739  -0.0385 212 SER B N   
4086 C CA  . SER B 211 ? 1.0989 0.8388 1.0707 0.0443  0.1815  -0.0329 212 SER B CA  
4087 C C   . SER B 211 ? 1.1097 0.8257 1.0718 0.0218  0.1832  -0.0463 212 SER B C   
4088 O O   . SER B 211 ? 1.1127 0.8132 1.0791 0.0185  0.1852  -0.0407 212 SER B O   
4089 C CB  . SER B 211 ? 1.1485 0.8625 1.1231 0.0653  0.2004  -0.0294 212 SER B CB  
4090 O OG  . SER B 211 ? 1.2121 0.9038 1.1765 0.0602  0.2149  -0.0465 212 SER B OG  
4091 N N   . SER B 212 ? 1.1103 0.8248 1.0595 0.0065  0.1825  -0.0642 213 SER B N   
4092 C CA  . SER B 212 ? 1.1056 0.8005 1.0466 -0.0152 0.1829  -0.0809 213 SER B CA  
4093 C C   . SER B 212 ? 1.0583 0.7799 1.0018 -0.0322 0.1619  -0.0820 213 SER B C   
4094 O O   . SER B 212 ? 1.0039 0.7542 0.9417 -0.0344 0.1477  -0.0810 213 SER B O   
4095 C CB  . SER B 212 ? 1.1283 0.8056 1.0508 -0.0226 0.1925  -0.1018 213 SER B CB  
4096 O OG  . SER B 212 ? 1.1028 0.8071 1.0120 -0.0288 0.1799  -0.1072 213 SER B OG  
4097 N N   . THR B 213 ? 1.0456 0.7562 0.9988 -0.0436 0.1617  -0.0837 214 THR B N   
4098 C CA  . THR B 213 ? 1.0239 0.7578 0.9838 -0.0601 0.1435  -0.0870 214 THR B CA  
4099 C C   . THR B 213 ? 1.0508 0.7878 0.9971 -0.0785 0.1349  -0.1091 214 THR B C   
4100 O O   . THR B 213 ? 1.1095 0.8263 1.0564 -0.0933 0.1408  -0.1263 214 THR B O   
4101 C CB  . THR B 213 ? 1.0220 0.7448 1.0000 -0.0664 0.1484  -0.0822 214 THR B CB  
4102 O OG1 . THR B 213 ? 1.0250 0.7455 1.0093 -0.0474 0.1550  -0.0608 214 THR B OG1 
4103 C CG2 . THR B 213 ? 0.9821 0.7340 0.9720 -0.0815 0.1296  -0.0852 214 THR B CG2 
4104 N N   . LEU B 214 ? 1.0304 0.7926 0.9634 -0.0771 0.1210  -0.1085 215 LEU B N   
4105 C CA  . LEU B 214 ? 1.0417 0.8099 0.9545 -0.0905 0.1106  -0.1263 215 LEU B CA  
4106 C C   . LEU B 214 ? 1.0031 0.7905 0.9252 -0.1069 0.0915  -0.1337 215 LEU B C   
4107 O O   . LEU B 214 ? 0.9979 0.7791 0.9131 -0.1225 0.0873  -0.1543 215 LEU B O   
4108 C CB  . LEU B 214 ? 1.0589 0.8462 0.9538 -0.0813 0.1042  -0.1186 215 LEU B CB  
4109 C CG  . LEU B 214 ? 1.1170 0.9024 0.9800 -0.0878 0.1012  -0.1338 215 LEU B CG  
4110 C CD1 . LEU B 214 ? 1.1198 0.8819 0.9690 -0.0789 0.1230  -0.1395 215 LEU B CD1 
4111 C CD2 . LEU B 214 ? 1.1031 0.9168 0.9558 -0.0848 0.0853  -0.1223 215 LEU B CD2 
4112 N N   . LEU B 215 ? 0.9610 0.7728 0.9001 -0.1029 0.0798  -0.1179 216 LEU B N   
4113 C CA  . LEU B 215 ? 0.9390 0.7756 0.8894 -0.1147 0.0599  -0.1220 216 LEU B CA  
4114 C C   . LEU B 215 ? 0.9110 0.7506 0.8924 -0.1162 0.0631  -0.1135 216 LEU B C   
4115 O O   . LEU B 215 ? 0.8986 0.7247 0.8876 -0.1049 0.0777  -0.0998 216 LEU B O   
4116 C CB  . LEU B 215 ? 0.9129 0.7773 0.8520 -0.1080 0.0421  -0.1112 216 LEU B CB  
4117 C CG  . LEU B 215 ? 0.9500 0.8134 0.8546 -0.1077 0.0377  -0.1187 216 LEU B CG  
4118 C CD1 . LEU B 215 ? 0.9257 0.8063 0.8206 -0.0962 0.0308  -0.1014 216 LEU B CD1 
4119 C CD2 . LEU B 215 ? 0.9819 0.8529 0.8740 -0.1223 0.0215  -0.1381 216 LEU B CD2 
4120 N N   . CYS B 216 ? 0.9182 0.7764 0.9170 -0.1295 0.0497  -0.1218 217 CYS B N   
4121 C CA  . CYS B 216 ? 0.9474 0.8134 0.9771 -0.1320 0.0522  -0.1140 217 CYS B CA  
4122 C C   . CYS B 216 ? 0.9674 0.8014 1.0097 -0.1368 0.0758  -0.1170 217 CYS B C   
4123 O O   . CYS B 216 ? 0.9694 0.7990 1.0280 -0.1320 0.0859  -0.1037 217 CYS B O   
4124 C CB  . CYS B 216 ? 0.9638 0.8441 0.9962 -0.1156 0.0494  -0.0910 217 CYS B CB  
4125 S SG  . CYS B 216 ? 0.9917 0.8947 1.0568 -0.1187 0.0436  -0.0831 217 CYS B SG  
4126 N N   . GLU B 217 ? 1.0083 0.8179 1.0409 -0.1463 0.0852  -0.1347 218 GLU B N   
4127 C CA  . GLU B 217 ? 1.0461 0.8167 1.0848 -0.1493 0.1107  -0.1377 218 GLU B CA  
4128 C C   . GLU B 217 ? 1.0727 0.8418 1.1430 -0.1631 0.1184  -0.1403 218 GLU B C   
4129 O O   . GLU B 217 ? 1.0932 0.8340 1.1700 -0.1586 0.1403  -0.1297 218 GLU B O   
4130 C CB  . GLU B 217 ? 1.0892 0.8350 1.1108 -0.1588 0.1178  -0.1599 218 GLU B CB  
4131 C CG  . GLU B 217 ? 1.1079 0.8550 1.0979 -0.1461 0.1127  -0.1586 218 GLU B CG  
4132 C CD  . GLU B 217 ? 1.1754 0.8994 1.1451 -0.1558 0.1191  -0.1827 218 GLU B CD  
4133 O OE1 . GLU B 217 ? 1.2039 0.9151 1.1838 -0.1751 0.1230  -0.2039 218 GLU B OE1 
4134 O OE2 . GLU B 217 ? 1.1869 0.9059 1.1307 -0.1446 0.1211  -0.1815 218 GLU B OE2 
4135 N N   . ASP B 218 ? 1.0643 0.8646 1.1541 -0.1789 0.1008  -0.1535 219 ASP B N   
4136 C CA  . ASP B 218 ? 1.0285 0.8350 1.1541 -0.1946 0.1068  -0.1590 219 ASP B CA  
4137 C C   . ASP B 218 ? 0.9784 0.8176 1.1225 -0.1873 0.0965  -0.1424 219 ASP B C   
4138 O O   . ASP B 218 ? 0.9844 0.8362 1.1610 -0.1998 0.0995  -0.1470 219 ASP B O   
4139 C CB  . ASP B 218 ? 1.0420 0.8632 1.1838 -0.2188 0.0951  -0.1889 219 ASP B CB  
4140 C CG  . ASP B 218 ? 1.0991 0.8821 1.2288 -0.2304 0.1108  -0.2089 219 ASP B CG  
4141 O OD1 . ASP B 218 ? 1.1216 0.8644 1.2549 -0.2308 0.1387  -0.2041 219 ASP B OD1 
4142 O OD2 . ASP B 218 ? 1.1077 0.8995 1.2225 -0.2387 0.0957  -0.2295 219 ASP B OD2 
4143 N N   . GLY B 219 ? 0.9143 0.7667 1.0395 -0.1679 0.0860  -0.1241 220 GLY B N   
4144 C CA  . GLY B 219 ? 0.8820 0.7637 1.0211 -0.1597 0.0758  -0.1091 220 GLY B CA  
4145 C C   . GLY B 219 ? 0.8657 0.7868 1.0061 -0.1597 0.0474  -0.1136 220 GLY B C   
4146 O O   . GLY B 219 ? 0.8444 0.7787 0.9875 -0.1723 0.0336  -0.1327 220 GLY B O   
4147 N N   . CYS B 220 ? 0.8578 0.7962 0.9946 -0.1448 0.0389  -0.0960 221 CYS B N   
4148 C CA  . CYS B 220 ? 0.8476 0.8202 0.9850 -0.1410 0.0140  -0.0951 221 CYS B CA  
4149 C C   . CYS B 220 ? 0.7992 0.7903 0.9554 -0.1326 0.0122  -0.0806 221 CYS B C   
4150 O O   . CYS B 220 ? 0.8106 0.7899 0.9782 -0.1306 0.0297  -0.0721 221 CYS B O   
4151 C CB  . CYS B 220 ? 0.8918 0.8615 0.9946 -0.1280 0.0053  -0.0869 221 CYS B CB  
4152 S SG  . CYS B 220 ? 1.0509 0.9926 1.1217 -0.1304 0.0128  -0.0977 221 CYS B SG  
4153 N N   . LEU B 221 ? 0.7470 0.7647 0.9024 -0.1265 -0.0083 -0.0773 222 LEU B N   
4154 C CA  . LEU B 221 ? 0.7052 0.7392 0.8722 -0.1158 -0.0121 -0.0633 222 LEU B CA  
4155 C C   . LEU B 221 ? 0.6846 0.7132 0.8221 -0.1011 -0.0171 -0.0496 222 LEU B C   
4156 O O   . LEU B 221 ? 0.6890 0.7133 0.8019 -0.1000 -0.0253 -0.0526 222 LEU B O   
4157 C CB  . LEU B 221 ? 0.7175 0.7860 0.9108 -0.1196 -0.0310 -0.0703 222 LEU B CB  
4158 C CG  . LEU B 221 ? 0.7526 0.8359 0.9764 -0.1372 -0.0339 -0.0901 222 LEU B CG  
4159 C CD1 . LEU B 221 ? 0.7589 0.8813 1.0070 -0.1363 -0.0570 -0.0951 222 LEU B CD1 
4160 C CD2 . LEU B 221 ? 0.7518 0.8235 1.0024 -0.1469 -0.0101 -0.0925 222 LEU B CD2 
4161 N N   . ALA B 222 ? 0.6372 0.6650 0.7770 -0.0905 -0.0105 -0.0356 223 ALA B N   
4162 C CA  . ALA B 222 ? 0.5932 0.6191 0.7118 -0.0779 -0.0149 -0.0235 223 ALA B CA  
4163 C C   . ALA B 222 ? 0.5832 0.6257 0.7172 -0.0707 -0.0201 -0.0152 223 ALA B C   
4164 O O   . ALA B 222 ? 0.5826 0.6240 0.7309 -0.0689 -0.0091 -0.0110 223 ALA B O   
4165 C CB  . ALA B 222 ? 0.5763 0.5800 0.6777 -0.0713 0.0004  -0.0164 223 ALA B CB  
4166 N N   . LEU B 223 ? 0.5635 0.6196 0.6931 -0.0665 -0.0362 -0.0129 224 LEU B N   
4167 C CA  . LEU B 223 ? 0.5436 0.6121 0.6843 -0.0580 -0.0417 -0.0047 224 LEU B CA  
4168 C C   . LEU B 223 ? 0.5437 0.5993 0.6652 -0.0492 -0.0353 0.0055  224 LEU B C   
4169 O O   . LEU B 223 ? 0.5366 0.5843 0.6358 -0.0474 -0.0384 0.0079  224 LEU B O   
4170 C CB  . LEU B 223 ? 0.5357 0.6196 0.6753 -0.0556 -0.0611 -0.0054 224 LEU B CB  
4171 C CG  . LEU B 223 ? 0.5509 0.6561 0.7143 -0.0500 -0.0723 -0.0033 224 LEU B CG  
4172 C CD1 . LEU B 223 ? 0.5613 0.6660 0.7043 -0.0408 -0.0862 0.0048  224 LEU B CD1 
4173 C CD2 . LEU B 223 ? 0.5176 0.6252 0.7016 -0.0450 -0.0612 0.0017  224 LEU B CD2 
4174 N N   . VAL B 224 ? 0.5345 0.5885 0.6646 -0.0443 -0.0258 0.0108  225 VAL B N   
4175 C CA  . VAL B 224 ? 0.5321 0.5779 0.6471 -0.0366 -0.0219 0.0184  225 VAL B CA  
4176 C C   . VAL B 224 ? 0.5393 0.5931 0.6577 -0.0311 -0.0314 0.0230  225 VAL B C   
4177 O O   . VAL B 224 ? 0.5331 0.5936 0.6668 -0.0273 -0.0301 0.0245  225 VAL B O   
4178 C CB  . VAL B 224 ? 0.5334 0.5718 0.6491 -0.0329 -0.0083 0.0212  225 VAL B CB  
4179 C CG1 . VAL B 224 ? 0.5110 0.5451 0.6123 -0.0256 -0.0072 0.0264  225 VAL B CG1 
4180 C CG2 . VAL B 224 ? 0.5358 0.5622 0.6475 -0.0373 0.0020  0.0182  225 VAL B CG2 
4181 N N   . ASP B 225 ? 0.5469 0.5975 0.6493 -0.0304 -0.0392 0.0253  226 ASP B N   
4182 C CA  . ASP B 225 ? 0.5623 0.6171 0.6649 -0.0257 -0.0495 0.0302  226 ASP B CA  
4183 C C   . ASP B 225 ? 0.5685 0.6130 0.6576 -0.0217 -0.0464 0.0366  226 ASP B C   
4184 O O   . ASP B 225 ? 0.5798 0.6159 0.6497 -0.0233 -0.0464 0.0387  226 ASP B O   
4185 C CB  . ASP B 225 ? 0.5852 0.6441 0.6786 -0.0282 -0.0619 0.0281  226 ASP B CB  
4186 C CG  . ASP B 225 ? 0.6055 0.6693 0.6995 -0.0208 -0.0742 0.0345  226 ASP B CG  
4187 O OD1 . ASP B 225 ? 0.5926 0.6547 0.6956 -0.0144 -0.0718 0.0403  226 ASP B OD1 
4188 O OD2 . ASP B 225 ? 0.6278 0.6963 0.7117 -0.0209 -0.0865 0.0336  226 ASP B OD2 
4189 N N   . THR B 226 ? 0.5403 0.5852 0.6404 -0.0172 -0.0427 0.0388  227 THR B N   
4190 C CA  . THR B 226 ? 0.5006 0.5364 0.5930 -0.0151 -0.0386 0.0424  227 THR B CA  
4191 C C   . THR B 226 ? 0.5203 0.5479 0.6030 -0.0126 -0.0445 0.0491  227 THR B C   
4192 O O   . THR B 226 ? 0.5347 0.5519 0.6073 -0.0139 -0.0395 0.0519  227 THR B O   
4193 C CB  . THR B 226 ? 0.4855 0.5229 0.5911 -0.0114 -0.0332 0.0406  227 THR B CB  
4194 O OG1 . THR B 226 ? 0.5170 0.5594 0.6379 -0.0067 -0.0376 0.0418  227 THR B OG1 
4195 C CG2 . THR B 226 ? 0.4733 0.5150 0.5818 -0.0125 -0.0260 0.0360  227 THR B CG2 
4196 N N   . GLY B 227 ? 0.5253 0.5578 0.6116 -0.0088 -0.0546 0.0519  228 GLY B N   
4197 C CA  . GLY B 227 ? 0.5553 0.5782 0.6282 -0.0039 -0.0613 0.0606  228 GLY B CA  
4198 C C   . GLY B 227 ? 0.5874 0.6049 0.6346 -0.0068 -0.0660 0.0631  228 GLY B C   
4199 O O   . GLY B 227 ? 0.6174 0.6260 0.6485 -0.0016 -0.0722 0.0716  228 GLY B O   
4200 N N   . ALA B 228 ? 0.5637 0.5848 0.6049 -0.0141 -0.0622 0.0560  229 ALA B N   
4201 C CA  . ALA B 228 ? 0.5780 0.5932 0.5934 -0.0177 -0.0640 0.0558  229 ALA B CA  
4202 C C   . ALA B 228 ? 0.5873 0.5913 0.5904 -0.0226 -0.0500 0.0557  229 ALA B C   
4203 O O   . ALA B 228 ? 0.5573 0.5651 0.5740 -0.0251 -0.0415 0.0510  229 ALA B O   
4204 C CB  . ALA B 228 ? 0.5633 0.5903 0.5826 -0.0224 -0.0697 0.0459  229 ALA B CB  
4205 N N   . SER B 229 ? 0.6234 0.6146 0.6007 -0.0232 -0.0477 0.0612  230 SER B N   
4206 C CA  . SER B 229 ? 0.6426 0.6245 0.6112 -0.0278 -0.0331 0.0616  230 SER B CA  
4207 C C   . SER B 229 ? 0.6459 0.6336 0.6151 -0.0325 -0.0265 0.0522  230 SER B C   
4208 O O   . SER B 229 ? 0.6329 0.6230 0.6127 -0.0346 -0.0160 0.0493  230 SER B O   
4209 C CB  . SER B 229 ? 0.6759 0.6409 0.6145 -0.0275 -0.0298 0.0704  230 SER B CB  
4210 O OG  . SER B 229 ? 0.7204 0.6747 0.6571 -0.0221 -0.0326 0.0811  230 SER B OG  
4211 N N   . TYR B 230 ? 0.6446 0.6350 0.6039 -0.0337 -0.0332 0.0467  231 TYR B N   
4212 C CA  . TYR B 230 ? 0.6393 0.6284 0.5917 -0.0377 -0.0253 0.0384  231 TYR B CA  
4213 C C   . TYR B 230 ? 0.6316 0.6288 0.5997 -0.0393 -0.0286 0.0295  231 TYR B C   
4214 O O   . TYR B 230 ? 0.5966 0.6025 0.5820 -0.0380 -0.0368 0.0294  231 TYR B O   
4215 C CB  . TYR B 230 ? 0.6697 0.6485 0.5892 -0.0397 -0.0259 0.0379  231 TYR B CB  
4216 C CG  . TYR B 230 ? 0.6910 0.6578 0.5895 -0.0378 -0.0231 0.0489  231 TYR B CG  
4217 C CD1 . TYR B 230 ? 0.6898 0.6498 0.5880 -0.0398 -0.0070 0.0526  231 TYR B CD1 
4218 C CD2 . TYR B 230 ? 0.7164 0.6790 0.5959 -0.0336 -0.0362 0.0558  231 TYR B CD2 
4219 C CE1 . TYR B 230 ? 0.7236 0.6690 0.6024 -0.0393 -0.0014 0.0632  231 TYR B CE1 
4220 C CE2 . TYR B 230 ? 0.7474 0.6942 0.6039 -0.0306 -0.0321 0.0680  231 TYR B CE2 
4221 C CZ  . TYR B 230 ? 0.7570 0.6935 0.6127 -0.0343 -0.0134 0.0719  231 TYR B CZ  
4222 O OH  . TYR B 230 ? 0.7949 0.7125 0.6279 -0.0326 -0.0065 0.0845  231 TYR B OH  
4223 N N   . ILE B 231 ? 0.6447 0.6375 0.6080 -0.0419 -0.0199 0.0223  232 ILE B N   
4224 C CA  . ILE B 231 ? 0.6650 0.6588 0.6348 -0.0452 -0.0218 0.0130  232 ILE B CA  
4225 C C   . ILE B 231 ? 0.7066 0.6976 0.6547 -0.0495 -0.0313 0.0074  232 ILE B C   
4226 O O   . ILE B 231 ? 0.7255 0.7075 0.6476 -0.0501 -0.0279 0.0075  232 ILE B O   
4227 C CB  . ILE B 231 ? 0.6508 0.6375 0.6231 -0.0448 -0.0079 0.0077  232 ILE B CB  
4228 C CG1 . ILE B 231 ? 0.6485 0.6409 0.6412 -0.0389 -0.0019 0.0130  232 ILE B CG1 
4229 C CG2 . ILE B 231 ? 0.6264 0.6078 0.6008 -0.0499 -0.0077 -0.0025 232 ILE B CG2 
4230 C CD1 . ILE B 231 ? 0.6620 0.6499 0.6557 -0.0345 0.0109  0.0113  232 ILE B CD1 
4231 N N   . SER B 232 ? 0.6902 0.6903 0.6490 -0.0525 -0.0432 0.0022  233 SER B N   
4232 C CA  . SER B 232 ? 0.7325 0.7340 0.6730 -0.0569 -0.0550 -0.0058 233 SER B CA  
4233 C C   . SER B 232 ? 0.7311 0.7354 0.6848 -0.0653 -0.0562 -0.0205 233 SER B C   
4234 O O   . SER B 232 ? 0.7063 0.7142 0.6873 -0.0669 -0.0506 -0.0217 233 SER B O   
4235 C CB  . SER B 232 ? 0.7460 0.7588 0.6843 -0.0521 -0.0724 0.0013  233 SER B CB  
4236 O OG  . SER B 232 ? 0.7693 0.7977 0.7406 -0.0511 -0.0791 0.0015  233 SER B OG  
4237 N N   . GLY B 233 ? 0.7539 0.7546 0.6860 -0.0712 -0.0620 -0.0320 234 GLY B N   
4238 C CA  . GLY B 233 ? 0.7635 0.7687 0.7071 -0.0815 -0.0668 -0.0488 234 GLY B CA  
4239 C C   . GLY B 233 ? 0.8024 0.8183 0.7261 -0.0843 -0.0868 -0.0571 234 GLY B C   
4240 O O   . GLY B 233 ? 0.8313 0.8492 0.7315 -0.0765 -0.0963 -0.0471 234 GLY B O   
4241 N N   . SER B 234 ? 0.8127 0.8347 0.7448 -0.0954 -0.0934 -0.0756 235 SER B N   
4242 C CA  . SER B 234 ? 0.8226 0.8560 0.7333 -0.0990 -0.1140 -0.0874 235 SER B CA  
4243 C C   . SER B 234 ? 0.8468 0.8599 0.7080 -0.0972 -0.1090 -0.0891 235 SER B C   
4244 O O   . SER B 234 ? 0.8474 0.8384 0.6991 -0.0974 -0.0878 -0.0880 235 SER B O   
4245 C CB  . SER B 234 ? 0.8274 0.8714 0.7614 -0.1139 -0.1197 -0.1101 235 SER B CB  
4246 O OG  . SER B 234 ? 0.8305 0.8500 0.7582 -0.1230 -0.1002 -0.1222 235 SER B OG  
4247 N N   . THR B 235 ? 0.8635 0.8845 0.6930 -0.0942 -0.1281 -0.0912 236 THR B N   
4248 C CA  . THR B 235 ? 0.8773 0.8794 0.6543 -0.0928 -0.1243 -0.0939 236 THR B CA  
4249 C C   . THR B 235 ? 0.8905 0.8722 0.6590 -0.1036 -0.1064 -0.1123 236 THR B C   
4250 O O   . THR B 235 ? 0.9000 0.8594 0.6459 -0.1003 -0.0865 -0.1074 236 THR B O   
4251 C CB  . THR B 235 ? 0.9092 0.9253 0.6532 -0.0896 -0.1511 -0.0983 236 THR B CB  
4252 O OG1 . THR B 235 ? 0.9041 0.9327 0.6520 -0.0762 -0.1639 -0.0775 236 THR B OG1 
4253 C CG2 . THR B 235 ? 0.9398 0.9341 0.6239 -0.0881 -0.1457 -0.1015 236 THR B CG2 
4254 N N   . SER B 236 ? 0.8983 0.8873 0.6884 -0.1165 -0.1118 -0.1335 237 SER B N   
4255 C CA  . SER B 236 ? 0.9293 0.8961 0.7144 -0.1274 -0.0941 -0.1526 237 SER B CA  
4256 C C   . SER B 236 ? 0.8922 0.8397 0.6992 -0.1241 -0.0667 -0.1425 237 SER B C   
4257 O O   . SER B 236 ? 0.9303 0.8537 0.7166 -0.1230 -0.0476 -0.1458 237 SER B O   
4258 C CB  . SER B 236 ? 0.9410 0.9192 0.7490 -0.1435 -0.1050 -0.1779 237 SER B CB  
4259 O OG  . SER B 236 ? 0.9387 0.9272 0.7988 -0.1475 -0.1006 -0.1746 237 SER B OG  
4260 N N   . SER B 237 ? 0.8456 0.8043 0.6931 -0.1212 -0.0651 -0.1303 238 SER B N   
4261 C CA  . SER B 237 ? 0.8252 0.7687 0.6918 -0.1154 -0.0423 -0.1184 238 SER B CA  
4262 C C   . SER B 237 ? 0.8300 0.7612 0.6701 -0.1040 -0.0302 -0.1045 238 SER B C   
4263 O O   . SER B 237 ? 0.8529 0.7639 0.6866 -0.1021 -0.0103 -0.1070 238 SER B O   
4264 C CB  . SER B 237 ? 0.7711 0.7307 0.6772 -0.1119 -0.0452 -0.1052 238 SER B CB  
4265 O OG  . SER B 237 ? 0.7677 0.7308 0.7045 -0.1232 -0.0448 -0.1178 238 SER B OG  
4266 N N   . ILE B 238 ? 0.8133 0.7564 0.6390 -0.0964 -0.0415 -0.0907 239 ILE B N   
4267 C CA  . ILE B 238 ? 0.8221 0.7557 0.6261 -0.0871 -0.0298 -0.0769 239 ILE B CA  
4268 C C   . ILE B 238 ? 0.8683 0.7837 0.6309 -0.0891 -0.0204 -0.0873 239 ILE B C   
4269 O O   . ILE B 238 ? 0.8755 0.7780 0.6309 -0.0841 -0.0008 -0.0825 239 ILE B O   
4270 C CB  . ILE B 238 ? 0.8113 0.7584 0.6120 -0.0791 -0.0421 -0.0586 239 ILE B CB  
4271 C CG1 . ILE B 238 ? 0.7643 0.7268 0.6071 -0.0764 -0.0469 -0.0490 239 ILE B CG1 
4272 C CG2 . ILE B 238 ? 0.8223 0.7582 0.6015 -0.0720 -0.0278 -0.0455 239 ILE B CG2 
4273 C CD1 . ILE B 238 ? 0.7201 0.6767 0.5911 -0.0749 -0.0292 -0.0463 239 ILE B CD1 
4274 N N   . GLU B 239 ? 0.9091 0.8249 0.6464 -0.0962 -0.0338 -0.1029 240 GLU B N   
4275 C CA  . GLU B 239 ? 0.9596 0.8565 0.6544 -0.0991 -0.0246 -0.1162 240 GLU B CA  
4276 C C   . GLU B 239 ? 0.9388 0.8154 0.6444 -0.1020 -0.0007 -0.1275 240 GLU B C   
4277 O O   . GLU B 239 ? 0.9422 0.8034 0.6291 -0.0969 0.0185  -0.1254 240 GLU B O   
4278 C CB  . GLU B 239 ? 1.0209 0.9238 0.6888 -0.1072 -0.0457 -0.1341 240 GLU B CB  
4279 C CG  . GLU B 239 ? 1.0938 1.0061 0.7248 -0.1003 -0.0641 -0.1234 240 GLU B CG  
4280 C CD  . GLU B 239 ? 1.1835 1.1073 0.7903 -0.1069 -0.0896 -0.1417 240 GLU B CD  
4281 O OE1 . GLU B 239 ? 1.1932 1.1184 0.8145 -0.1192 -0.0927 -0.1650 240 GLU B OE1 
4282 O OE2 . GLU B 239 ? 1.2259 1.1571 0.7985 -0.0995 -0.1068 -0.1329 240 GLU B OE2 
4283 N N   . LYS B 240 ? 0.9305 0.8069 0.6681 -0.1093 -0.0009 -0.1383 241 LYS B N   
4284 C CA  . LYS B 240 ? 0.9308 0.7851 0.6815 -0.1111 0.0214  -0.1482 241 LYS B CA  
4285 C C   . LYS B 240 ? 0.8885 0.7395 0.6614 -0.0987 0.0395  -0.1300 241 LYS B C   
4286 O O   . LYS B 240 ? 0.9003 0.7323 0.6727 -0.0945 0.0604  -0.1340 241 LYS B O   
4287 C CB  . LYS B 240 ? 0.9077 0.7606 0.6871 -0.1228 0.0172  -0.1630 241 LYS B CB  
4288 N N   . LEU B 241 ? 0.8521 0.7223 0.6450 -0.0924 0.0309  -0.1110 242 LEU B N   
4289 C CA  . LEU B 241 ? 0.8180 0.6905 0.6301 -0.0808 0.0441  -0.0939 242 LEU B CA  
4290 C C   . LEU B 241 ? 0.8362 0.7044 0.6236 -0.0743 0.0561  -0.0887 242 LEU B C   
4291 O O   . LEU B 241 ? 0.8494 0.7100 0.6451 -0.0670 0.0749  -0.0867 242 LEU B O   
4292 C CB  . LEU B 241 ? 0.7750 0.6688 0.6124 -0.0773 0.0310  -0.0776 242 LEU B CB  
4293 C CG  . LEU B 241 ? 0.7390 0.6391 0.5974 -0.0663 0.0410  -0.0613 242 LEU B CG  
4294 C CD1 . LEU B 241 ? 0.7218 0.6133 0.6053 -0.0619 0.0533  -0.0620 242 LEU B CD1 
4295 C CD2 . LEU B 241 ? 0.6951 0.6146 0.5673 -0.0639 0.0270  -0.0471 242 LEU B CD2 
4296 N N   . MET B 242 ? 0.8487 0.7221 0.6064 -0.0764 0.0457  -0.0861 243 MET B N   
4297 C CA  . MET B 242 ? 0.8747 0.7433 0.6069 -0.0716 0.0581  -0.0796 243 MET B CA  
4298 C C   . MET B 242 ? 0.9176 0.7659 0.6228 -0.0731 0.0756  -0.0951 243 MET B C   
4299 O O   . MET B 242 ? 0.9203 0.7633 0.6186 -0.0676 0.0948  -0.0914 243 MET B O   
4300 C CB  . MET B 242 ? 0.8864 0.7618 0.5903 -0.0723 0.0428  -0.0706 243 MET B CB  
4301 C CG  . MET B 242 ? 0.8523 0.7455 0.5823 -0.0688 0.0296  -0.0535 243 MET B CG  
4302 S SD  . MET B 242 ? 0.8220 0.7221 0.5837 -0.0612 0.0466  -0.0377 243 MET B SD  
4303 C CE  . MET B 242 ? 0.7868 0.7047 0.5749 -0.0593 0.0272  -0.0235 243 MET B CE  
4304 N N   . GLU B 243 ? 0.9671 0.8048 0.6593 -0.0811 0.0698  -0.1137 244 GLU B N   
4305 C CA  . GLU B 243 ? 1.0432 0.8585 0.7111 -0.0835 0.0867  -0.1319 244 GLU B CA  
4306 C C   . GLU B 243 ? 1.0125 0.8185 0.7111 -0.0757 0.1094  -0.1315 244 GLU B C   
4307 O O   . GLU B 243 ? 1.0343 0.8284 0.7204 -0.0705 0.1305  -0.1354 244 GLU B O   
4308 C CB  . GLU B 243 ? 1.1284 0.9357 0.7823 -0.0955 0.0736  -0.1536 244 GLU B CB  
4309 C CG  . GLU B 243 ? 1.2741 1.0595 0.8848 -0.1001 0.0846  -0.1743 244 GLU B CG  
4310 C CD  . GLU B 243 ? 1.3723 1.1578 0.9582 -0.1130 0.0637  -0.1946 244 GLU B CD  
4311 O OE1 . GLU B 243 ? 1.3829 1.1869 0.9540 -0.1145 0.0399  -0.1883 244 GLU B OE1 
4312 O OE2 . GLU B 243 ? 1.4031 1.1701 0.9848 -0.1212 0.0708  -0.2177 244 GLU B OE2 
4313 N N   . ALA B 244 ? 0.9661 0.7784 0.7043 -0.0738 0.1053  -0.1257 245 ALA B N   
4314 C CA  . ALA B 244 ? 0.9520 0.7572 0.7209 -0.0637 0.1233  -0.1219 245 ALA B CA  
4315 C C   . ALA B 244 ? 0.9357 0.7558 0.7194 -0.0517 0.1333  -0.1055 245 ALA B C   
4316 O O   . ALA B 244 ? 0.9536 0.7678 0.7509 -0.0416 0.1521  -0.1057 245 ALA B O   
4317 C CB  . ALA B 244 ? 0.9127 0.7207 0.7146 -0.0646 0.1148  -0.1178 245 ALA B CB  
4318 N N   . LEU B 245 ? 0.9130 0.7528 0.6961 -0.0526 0.1208  -0.0921 246 LEU B N   
4319 C CA  . LEU B 245 ? 0.8915 0.7472 0.6890 -0.0445 0.1290  -0.0781 246 LEU B CA  
4320 C C   . LEU B 245 ? 0.9308 0.7805 0.7009 -0.0442 0.1459  -0.0813 246 LEU B C   
4321 O O   . LEU B 245 ? 0.9439 0.8047 0.7308 -0.0375 0.1594  -0.0738 246 LEU B O   
4322 C CB  . LEU B 245 ? 0.8577 0.7329 0.6658 -0.0466 0.1109  -0.0632 246 LEU B CB  
4323 C CG  . LEU B 245 ? 0.8158 0.7069 0.6634 -0.0409 0.1032  -0.0522 246 LEU B CG  
4324 C CD1 . LEU B 245 ? 0.8184 0.7007 0.6857 -0.0370 0.1057  -0.0574 246 LEU B CD1 
4325 C CD2 . LEU B 245 ? 0.7883 0.6912 0.6365 -0.0462 0.0827  -0.0436 246 LEU B CD2 
4326 N N   . GLY B 246 ? 0.9659 0.7990 0.6943 -0.0517 0.1457  -0.0933 247 GLY B N   
4327 C CA  . GLY B 246 ? 0.9739 0.7986 0.6675 -0.0523 0.1616  -0.0960 247 GLY B CA  
4328 C C   . GLY B 246 ? 0.9897 0.8231 0.6631 -0.0555 0.1530  -0.0818 247 GLY B C   
4329 O O   . GLY B 246 ? 1.0162 0.8437 0.6636 -0.0555 0.1686  -0.0795 247 GLY B O   
4330 N N   . ALA B 247 ? 0.9635 0.8093 0.6489 -0.0578 0.1300  -0.0720 248 ALA B N   
4331 C CA  . ALA B 247 ? 0.9771 0.8294 0.6465 -0.0595 0.1194  -0.0571 248 ALA B CA  
4332 C C   . ALA B 247 ? 1.0507 0.8916 0.6693 -0.0645 0.1050  -0.0617 248 ALA B C   
4333 O O   . ALA B 247 ? 1.0627 0.8993 0.6712 -0.0688 0.0919  -0.0760 248 ALA B O   
4334 C CB  . ALA B 247 ? 0.9127 0.7834 0.6199 -0.0580 0.1025  -0.0449 248 ALA B CB  
4335 N N   . LYS B 248 ? 1.0938 0.9299 0.6809 -0.0639 0.1074  -0.0496 249 LYS B N   
4336 C CA  . LYS B 248 ? 1.1627 0.9866 0.6935 -0.0658 0.0957  -0.0515 249 LYS B CA  
4337 C C   . LYS B 248 ? 1.1715 1.0010 0.6926 -0.0631 0.0776  -0.0327 249 LYS B C   
4338 O O   . LYS B 248 ? 1.1219 0.9573 0.6678 -0.0606 0.0841  -0.0167 249 LYS B O   
4339 C CB  . LYS B 248 ? 1.2090 1.0133 0.6954 -0.0658 0.1203  -0.0552 249 LYS B CB  
4340 C CG  . LYS B 248 ? 1.2750 1.0692 0.7584 -0.0680 0.1356  -0.0770 249 LYS B CG  
4341 C CD  . LYS B 248 ? 1.3647 1.1407 0.8094 -0.0671 0.1643  -0.0800 249 LYS B CD  
4342 C CE  . LYS B 248 ? 1.3957 1.1606 0.8411 -0.0679 0.1815  -0.1022 249 LYS B CE  
4343 N NZ  . LYS B 248 ? 1.4729 1.2195 0.8770 -0.0670 0.2104  -0.1066 249 LYS B NZ  
4344 N N   . LYS B 249 ? 1.2346 1.0626 0.7207 -0.0632 0.0544  -0.0360 250 LYS B N   
4345 C CA  . LYS B 249 ? 1.2767 1.1071 0.7447 -0.0580 0.0359  -0.0185 250 LYS B CA  
4346 C C   . LYS B 249 ? 1.3532 1.1626 0.7723 -0.0543 0.0526  -0.0044 250 LYS B C   
4347 O O   . LYS B 249 ? 1.4265 1.2201 0.7911 -0.0544 0.0565  -0.0115 250 LYS B O   
4348 C CB  . LYS B 249 ? 1.3309 1.1696 0.7775 -0.0580 0.0046  -0.0281 250 LYS B CB  
4349 C CG  . LYS B 249 ? 1.3108 1.1732 0.8059 -0.0580 -0.0186 -0.0279 250 LYS B CG  
4350 C CD  . LYS B 249 ? 1.3249 1.1931 0.8240 -0.0495 -0.0317 -0.0055 250 LYS B CD  
4351 C CE  . LYS B 249 ? 1.3078 1.2007 0.8511 -0.0490 -0.0558 -0.0076 250 LYS B CE  
4352 N NZ  . LYS B 249 ? 1.3500 1.2555 0.8753 -0.0501 -0.0831 -0.0215 250 LYS B NZ  
4353 N N   . ARG B 250 ? 1.3488 1.1569 0.7874 -0.0516 0.0636  0.0149  251 ARG B N   
4354 C CA  . ARG B 250 ? 1.4298 1.2164 0.8306 -0.0492 0.0834  0.0317  251 ARG B CA  
4355 C C   . ARG B 250 ? 1.5218 1.2944 0.8608 -0.0419 0.0651  0.0415  251 ARG B C   
4356 O O   . ARG B 250 ? 1.5679 1.3249 0.8500 -0.0413 0.0691  0.0351  251 ARG B O   
4357 C CB  . ARG B 250 ? 1.3678 1.1589 0.8117 -0.0492 0.0934  0.0486  251 ARG B CB  
4358 C CG  . ARG B 250 ? 1.3665 1.1391 0.7964 -0.0514 0.1254  0.0612  251 ARG B CG  
4359 C CD  . ARG B 250 ? 1.3176 1.0953 0.7888 -0.0518 0.1272  0.0766  251 ARG B CD  
4360 N NE  . ARG B 250 ? 1.2875 1.0651 0.7882 -0.0588 0.1583  0.0788  251 ARG B NE  
4361 C CZ  . ARG B 250 ? 1.2283 1.0197 0.7826 -0.0622 0.1616  0.0826  251 ARG B CZ  
4362 N NH1 . ARG B 250 ? 1.2125 1.0066 0.7934 -0.0693 0.1894  0.0822  251 ARG B NH1 
4363 N NH2 . ARG B 250 ? 1.1651 0.9693 0.7479 -0.0588 0.1375  0.0855  251 ARG B NH2 
4364 N N   . LEU B 251 ? 1.5240 1.3028 0.8746 -0.0354 0.0447  0.0567  252 LEU B N   
4365 C CA  . LEU B 251 ? 1.5595 1.3317 0.8628 -0.0254 0.0203  0.0672  252 LEU B CA  
4366 C C   . LEU B 251 ? 1.5021 1.2968 0.8494 -0.0204 -0.0075 0.0719  252 LEU B C   
4367 O O   . LEU B 251 ? 1.5670 1.3695 0.8933 -0.0122 -0.0362 0.0734  252 LEU B O   
4368 C CB  . LEU B 251 ? 1.5998 1.3414 0.8550 -0.0189 0.0378  0.0913  252 LEU B CB  
4369 N N   . PHE B 252 ? 1.3949 1.2016 0.8034 -0.0250 0.0010  0.0732  253 PHE B N   
4370 C CA  . PHE B 252 ? 1.3336 1.1617 0.7897 -0.0216 -0.0204 0.0759  253 PHE B CA  
4371 C C   . PHE B 252 ? 1.2528 1.1026 0.7684 -0.0304 -0.0177 0.0596  253 PHE B C   
4372 O O   . PHE B 252 ? 1.2127 1.0837 0.7568 -0.0304 -0.0390 0.0504  253 PHE B O   
4373 C CB  . PHE B 252 ? 1.3310 1.1476 0.7989 -0.0157 -0.0134 0.0989  253 PHE B CB  
4374 C CG  . PHE B 252 ? 1.3911 1.1816 0.8011 -0.0051 -0.0141 0.1190  253 PHE B CG  
4375 C CD1 . PHE B 252 ? 1.4143 1.2095 0.8016 0.0078  -0.0437 0.1265  253 PHE B CD1 
4376 C CD2 . PHE B 252 ? 1.4017 1.1629 0.7809 -0.0074 0.0155  0.1315  253 PHE B CD2 
4377 C CE1 . PHE B 252 ? 1.4750 1.2439 0.8055 0.0201  -0.0448 0.1473  253 PHE B CE1 
4378 C CE2 . PHE B 252 ? 1.4799 1.2126 0.8022 0.0029  0.0171  0.1523  253 PHE B CE2 
4379 C CZ  . PHE B 252 ? 1.5170 1.2524 0.8127 0.0177  -0.0135 0.1609  253 PHE B CZ  
4380 N N   . ASP B 253 ? 1.2131 1.0577 0.7470 -0.0373 0.0088  0.0566  254 ASP B N   
4381 C CA  . ASP B 253 ? 1.1221 0.9842 0.7116 -0.0431 0.0144  0.0455  254 ASP B CA  
4382 C C   . ASP B 253 ? 1.0978 0.9583 0.6859 -0.0495 0.0307  0.0284  254 ASP B C   
4383 O O   . ASP B 253 ? 1.1632 1.0074 0.7098 -0.0505 0.0440  0.0259  254 ASP B O   
4384 C CB  . ASP B 253 ? 1.1028 0.9649 0.7264 -0.0437 0.0298  0.0578  254 ASP B CB  
4385 C CG  . ASP B 253 ? 1.0994 0.9687 0.7452 -0.0384 0.0129  0.0692  254 ASP B CG  
4386 O OD1 . ASP B 253 ? 1.0633 0.9517 0.7491 -0.0389 0.0015  0.0622  254 ASP B OD1 
4387 O OD2 . ASP B 253 ? 1.1339 0.9881 0.7564 -0.0330 0.0124  0.0854  254 ASP B OD2 
4388 N N   . TYR B 254 ? 1.0011 0.8766 0.6332 -0.0527 0.0308  0.0173  255 TYR B N   
4389 C CA  . TYR B 254 ? 0.9662 0.8397 0.6060 -0.0565 0.0485  0.0029  255 TYR B CA  
4390 C C   . TYR B 254 ? 0.9456 0.8186 0.6066 -0.0567 0.0737  0.0092  255 TYR B C   
4391 O O   . TYR B 254 ? 0.9252 0.8092 0.6221 -0.0556 0.0734  0.0182  255 TYR B O   
4392 C CB  . TYR B 254 ? 0.9164 0.8033 0.5926 -0.0585 0.0388  -0.0099 255 TYR B CB  
4393 C CG  . TYR B 254 ? 0.9225 0.8096 0.5793 -0.0617 0.0199  -0.0231 255 TYR B CG  
4394 C CD1 . TYR B 254 ? 0.9678 0.8419 0.5919 -0.0656 0.0265  -0.0389 255 TYR B CD1 
4395 C CD2 . TYR B 254 ? 0.9006 0.8021 0.5733 -0.0614 -0.0040 -0.0216 255 TYR B CD2 
4396 C CE1 . TYR B 254 ? 0.9935 0.8694 0.6015 -0.0702 0.0083  -0.0539 255 TYR B CE1 
4397 C CE2 . TYR B 254 ? 0.9311 0.8370 0.5908 -0.0656 -0.0221 -0.0358 255 TYR B CE2 
4398 C CZ  . TYR B 254 ? 0.9669 0.8602 0.5944 -0.0706 -0.0165 -0.0525 255 TYR B CZ  
4399 O OH  . TYR B 254 ? 0.9837 0.8826 0.5999 -0.0765 -0.0351 -0.0692 255 TYR B OH  
4400 N N   . VAL B 255 ? 0.9431 0.8048 0.5835 -0.0582 0.0954  0.0028  256 VAL B N   
4401 C CA  . VAL B 255 ? 0.9235 0.7875 0.5852 -0.0588 0.1212  0.0068  256 VAL B CA  
4402 C C   . VAL B 255 ? 0.9227 0.7891 0.5993 -0.0583 0.1400  -0.0074 256 VAL B C   
4403 O O   . VAL B 255 ? 0.9574 0.8143 0.6117 -0.0585 0.1395  -0.0209 256 VAL B O   
4404 C CB  . VAL B 255 ? 0.9507 0.7983 0.5780 -0.0605 0.1378  0.0193  256 VAL B CB  
4405 C CG1 . VAL B 255 ? 0.9227 0.7701 0.5559 -0.0599 0.1273  0.0367  256 VAL B CG1 
4406 C CG2 . VAL B 255 ? 0.9911 0.8171 0.5557 -0.0604 0.1402  0.0155  256 VAL B CG2 
4407 N N   . VAL B 256 ? 0.8879 0.7677 0.6040 -0.0573 0.1561  -0.0051 257 VAL B N   
4408 C CA  . VAL B 256 ? 0.8896 0.7732 0.6222 -0.0548 0.1783  -0.0158 257 VAL B CA  
4409 C C   . VAL B 256 ? 0.8924 0.7792 0.6324 -0.0573 0.2037  -0.0098 257 VAL B C   
4410 O O   . VAL B 256 ? 0.8676 0.7580 0.6153 -0.0612 0.2026  0.0026  257 VAL B O   
4411 C CB  . VAL B 256 ? 0.8388 0.7415 0.6218 -0.0488 0.1731  -0.0216 257 VAL B CB  
4412 C CG1 . VAL B 256 ? 0.8379 0.7337 0.6137 -0.0474 0.1550  -0.0298 257 VAL B CG1 
4413 C CG2 . VAL B 256 ? 0.7891 0.7129 0.6132 -0.0483 0.1649  -0.0113 257 VAL B CG2 
4414 N N   . LYS B 257 ? 0.9167 0.8014 0.6556 -0.0556 0.2277  -0.0192 258 LYS B N   
4415 C CA  . LYS B 257 ? 0.9346 0.8303 0.6973 -0.0577 0.2541  -0.0166 258 LYS B CA  
4416 C C   . LYS B 257 ? 0.9001 0.8263 0.7253 -0.0554 0.2470  -0.0144 258 LYS B C   
4417 O O   . LYS B 257 ? 0.8798 0.8190 0.7331 -0.0477 0.2355  -0.0209 258 LYS B O   
4418 C CB  . LYS B 257 ? 0.9660 0.8581 0.7245 -0.0540 0.2798  -0.0295 258 LYS B CB  
4419 C CG  . LYS B 257 ? 1.0349 0.8997 0.7345 -0.0586 0.2987  -0.0301 258 LYS B CG  
4420 C CD  . LYS B 257 ? 1.0676 0.9373 0.7803 -0.0580 0.3345  -0.0369 258 LYS B CD  
4421 C CE  . LYS B 257 ? 1.0715 0.9417 0.7933 -0.0491 0.3431  -0.0542 258 LYS B CE  
4422 N NZ  . LYS B 257 ? 1.1112 0.9915 0.8556 -0.0469 0.3781  -0.0608 258 LYS B NZ  
4423 N N   . CYS B 258 ? 0.8951 0.8308 0.7394 -0.0620 0.2534  -0.0051 259 CYS B N   
4424 C CA  . CYS B 258 ? 0.8336 0.7977 0.7324 -0.0615 0.2429  -0.0032 259 CYS B CA  
4425 C C   . CYS B 258 ? 0.7964 0.7888 0.7439 -0.0529 0.2487  -0.0139 259 CYS B C   
4426 O O   . CYS B 258 ? 0.7579 0.7684 0.7366 -0.0467 0.2304  -0.0151 259 CYS B O   
4427 C CB  . CYS B 258 ? 0.8368 0.8040 0.7479 -0.0720 0.2537  0.0056  259 CYS B CB  
4428 S SG  . CYS B 258 ? 0.8625 0.8001 0.7284 -0.0782 0.2394  0.0215  259 CYS B SG  
4429 N N   . ASN B 259 ? 0.8131 0.8084 0.7648 -0.0514 0.2743  -0.0213 260 ASN B N   
4430 C CA  . ASN B 259 ? 0.8069 0.8278 0.8021 -0.0404 0.2817  -0.0317 260 ASN B CA  
4431 C C   . ASN B 259 ? 0.8069 0.8207 0.7962 -0.0278 0.2667  -0.0371 260 ASN B C   
4432 O O   . ASN B 259 ? 0.8117 0.8480 0.8409 -0.0166 0.2618  -0.0411 260 ASN B O   
4433 C CB  . ASN B 259 ? 0.8436 0.8655 0.8402 -0.0410 0.3148  -0.0388 260 ASN B CB  
4434 C CG  . ASN B 259 ? 0.8800 0.8669 0.8192 -0.0404 0.3258  -0.0428 260 ASN B CG  
4435 O OD1 . ASN B 259 ? 0.8936 0.8528 0.7828 -0.0465 0.3154  -0.0368 260 ASN B OD1 
4436 N ND2 . ASN B 259 ? 0.8918 0.8807 0.8384 -0.0322 0.3464  -0.0539 260 ASN B ND2 
4437 N N   . GLU B 260 ? 0.8444 0.8270 0.7843 -0.0297 0.2596  -0.0373 261 GLU B N   
4438 C CA  . GLU B 260 ? 0.8657 0.8363 0.7968 -0.0206 0.2485  -0.0439 261 GLU B CA  
4439 C C   . GLU B 260 ? 0.8249 0.8010 0.7685 -0.0185 0.2203  -0.0379 261 GLU B C   
4440 O O   . GLU B 260 ? 0.8020 0.7715 0.7482 -0.0106 0.2117  -0.0420 261 GLU B O   
4441 C CB  . GLU B 260 ? 0.9416 0.8785 0.8169 -0.0248 0.2539  -0.0503 261 GLU B CB  
4442 C CG  . GLU B 260 ? 1.0158 0.9445 0.8777 -0.0234 0.2841  -0.0595 261 GLU B CG  
4443 C CD  . GLU B 260 ? 1.0984 0.9934 0.9017 -0.0273 0.2889  -0.0683 261 GLU B CD  
4444 O OE1 . GLU B 260 ? 1.1297 1.0088 0.8992 -0.0332 0.2684  -0.0662 261 GLU B OE1 
4445 O OE2 . GLU B 260 ? 1.1247 1.0100 0.9158 -0.0244 0.3136  -0.0785 261 GLU B OE2 
4446 N N   . GLY B 261 ? 0.8050 0.7910 0.7559 -0.0258 0.2082  -0.0283 262 GLY B N   
4447 C CA  . GLY B 261 ? 0.7860 0.7805 0.7528 -0.0239 0.1839  -0.0225 262 GLY B CA  
4448 C C   . GLY B 261 ? 0.7643 0.7763 0.7677 -0.0106 0.1783  -0.0254 262 GLY B C   
4449 O O   . GLY B 261 ? 0.7522 0.7536 0.7487 -0.0059 0.1655  -0.0256 262 GLY B O   
4450 N N   . PRO B 262 ? 0.7525 0.7915 0.7949 -0.0042 0.1884  -0.0278 263 PRO B N   
4451 C CA  . PRO B 262 ? 0.7259 0.7831 0.8020 0.0116  0.1834  -0.0297 263 PRO B CA  
4452 C C   . PRO B 262 ? 0.7488 0.7874 0.8146 0.0236  0.1912  -0.0355 263 PRO B C   
4453 O O   . PRO B 262 ? 0.7507 0.8000 0.8407 0.0388  0.1871  -0.0351 263 PRO B O   
4454 C CB  . PRO B 262 ? 0.7250 0.8163 0.8428 0.0142  0.1953  -0.0331 263 PRO B CB  
4455 C CG  . PRO B 262 ? 0.7147 0.8080 0.8266 -0.0027 0.1992  -0.0301 263 PRO B CG  
4456 C CD  . PRO B 262 ? 0.7347 0.7914 0.7949 -0.0120 0.2029  -0.0278 263 PRO B CD  
4457 N N   . THR B 263 ? 0.7809 0.7911 0.8103 0.0176  0.2026  -0.0410 264 THR B N   
4458 C CA  . THR B 263 ? 0.7906 0.7777 0.8070 0.0269  0.2111  -0.0486 264 THR B CA  
4459 C C   . THR B 263 ? 0.7995 0.7597 0.7876 0.0222  0.1963  -0.0483 264 THR B C   
4460 O O   . THR B 263 ? 0.8306 0.7711 0.8132 0.0297  0.2002  -0.0536 264 THR B O   
4461 C CB  . THR B 263 ? 0.8174 0.7890 0.8122 0.0243  0.2353  -0.0587 264 THR B CB  
4462 O OG1 . THR B 263 ? 0.8223 0.7698 0.7706 0.0092  0.2329  -0.0606 264 THR B OG1 
4463 C CG2 . THR B 263 ? 0.8186 0.8170 0.8407 0.0254  0.2525  -0.0594 264 THR B CG2 
4464 N N   . LEU B 264 ? 0.7902 0.7493 0.7621 0.0097  0.1807  -0.0426 265 LEU B N   
4465 C CA  . LEU B 264 ? 0.8027 0.7419 0.7523 0.0036  0.1656  -0.0428 265 LEU B CA  
4466 C C   . LEU B 264 ? 0.7848 0.7273 0.7575 0.0135  0.1553  -0.0379 265 LEU B C   
4467 O O   . LEU B 264 ? 0.7700 0.7359 0.7724 0.0222  0.1513  -0.0309 265 LEU B O   
4468 C CB  . LEU B 264 ? 0.7979 0.7395 0.7299 -0.0095 0.1513  -0.0367 265 LEU B CB  
4469 C CG  . LEU B 264 ? 0.8215 0.7567 0.7238 -0.0193 0.1593  -0.0379 265 LEU B CG  
4470 C CD1 . LEU B 264 ? 0.8286 0.7606 0.7110 -0.0291 0.1412  -0.0311 265 LEU B CD1 
4471 C CD2 . LEU B 264 ? 0.8489 0.7612 0.7193 -0.0209 0.1737  -0.0501 265 LEU B CD2 
4472 N N   . PRO B 265 ? 0.7965 0.7154 0.7550 0.0122  0.1519  -0.0422 266 PRO B N   
4473 C CA  . PRO B 265 ? 0.7773 0.6944 0.7544 0.0225  0.1461  -0.0365 266 PRO B CA  
4474 C C   . PRO B 265 ? 0.7361 0.6642 0.7192 0.0174  0.1271  -0.0273 266 PRO B C   
4475 O O   . PRO B 265 ? 0.7260 0.6576 0.6962 0.0048  0.1173  -0.0268 266 PRO B O   
4476 C CB  . PRO B 265 ? 0.7980 0.6819 0.7573 0.0204  0.1536  -0.0461 266 PRO B CB  
4477 C CG  . PRO B 265 ? 0.8237 0.6970 0.7526 0.0040  0.1518  -0.0559 266 PRO B CG  
4478 C CD  . PRO B 265 ? 0.8240 0.7164 0.7492 0.0012  0.1540  -0.0533 266 PRO B CD  
4479 N N   . ASP B 266 ? 0.7222 0.6549 0.7235 0.0287  0.1227  -0.0196 267 ASP B N   
4480 C CA  . ASP B 266 ? 0.6881 0.6271 0.6938 0.0256  0.1074  -0.0116 267 ASP B CA  
4481 C C   . ASP B 266 ? 0.6945 0.6133 0.6822 0.0121  0.1025  -0.0163 267 ASP B C   
4482 O O   . ASP B 266 ? 0.7254 0.6202 0.7017 0.0098  0.1115  -0.0245 267 ASP B O   
4483 C CB  . ASP B 266 ? 0.7081 0.6473 0.7287 0.0417  0.1072  -0.0034 267 ASP B CB  
4484 C CG  . ASP B 266 ? 0.6916 0.6564 0.7340 0.0571  0.1083  0.0008  267 ASP B CG  
4485 O OD1 . ASP B 266 ? 0.6818 0.6675 0.7328 0.0532  0.1090  -0.0023 267 ASP B OD1 
4486 O OD2 . ASP B 266 ? 0.6966 0.6610 0.7482 0.0734  0.1085  0.0075  267 ASP B OD2 
4487 N N   . ILE B 267 ? 0.6547 0.5842 0.6420 0.0031  0.0885  -0.0124 268 ILE B N   
4488 C CA  . ILE B 267 ? 0.6658 0.5832 0.6437 -0.0085 0.0813  -0.0161 268 ILE B CA  
4489 C C   . ILE B 267 ? 0.6528 0.5723 0.6445 -0.0043 0.0759  -0.0077 268 ILE B C   
4490 O O   . ILE B 267 ? 0.6600 0.5981 0.6625 0.0002  0.0682  0.0006  268 ILE B O   
4491 C CB  . ILE B 267 ? 0.6511 0.5773 0.6163 -0.0210 0.0700  -0.0186 268 ILE B CB  
4492 C CG1 . ILE B 267 ? 0.6758 0.5957 0.6210 -0.0245 0.0778  -0.0265 268 ILE B CG1 
4493 C CG2 . ILE B 267 ? 0.6460 0.5656 0.6071 -0.0319 0.0605  -0.0233 268 ILE B CG2 
4494 C CD1 . ILE B 267 ? 0.6452 0.5714 0.5724 -0.0336 0.0684  -0.0266 268 ILE B CD1 
4495 N N   . SER B 268 ? 0.6497 0.5484 0.6402 -0.0062 0.0817  -0.0107 269 SER B N   
4496 C CA  . SER B 268 ? 0.6419 0.5374 0.6422 -0.0024 0.0807  -0.0025 269 SER B CA  
4497 C C   . SER B 268 ? 0.6469 0.5388 0.6487 -0.0170 0.0747  -0.0072 269 SER B C   
4498 O O   . SER B 268 ? 0.7047 0.5843 0.7003 -0.0285 0.0767  -0.0187 269 SER B O   
4499 C CB  . SER B 268 ? 0.6608 0.5331 0.6612 0.0093  0.0954  0.0006  269 SER B CB  
4500 O OG  . SER B 268 ? 0.6493 0.5319 0.6543 0.0264  0.0978  0.0077  269 SER B OG  
4501 N N   . PHE B 269 ? 0.6303 0.5346 0.6418 -0.0165 0.0675  0.0005  270 PHE B N   
4502 C CA  . PHE B 269 ? 0.6271 0.5319 0.6460 -0.0287 0.0628  -0.0029 270 PHE B CA  
4503 C C   . PHE B 269 ? 0.6459 0.5364 0.6712 -0.0240 0.0733  0.0041  270 PHE B C   
4504 O O   . PHE B 269 ? 0.6386 0.5358 0.6651 -0.0126 0.0729  0.0153  270 PHE B O   
4505 C CB  . PHE B 269 ? 0.5897 0.5195 0.6145 -0.0321 0.0475  0.0000  270 PHE B CB  
4506 C CG  . PHE B 269 ? 0.6031 0.5438 0.6181 -0.0354 0.0386  -0.0040 270 PHE B CG  
4507 C CD1 . PHE B 269 ? 0.5733 0.5225 0.5838 -0.0268 0.0388  0.0012  270 PHE B CD1 
4508 C CD2 . PHE B 269 ? 0.6091 0.5520 0.6188 -0.0471 0.0304  -0.0135 270 PHE B CD2 
4509 C CE1 . PHE B 269 ? 0.5726 0.5285 0.5722 -0.0305 0.0338  -0.0015 270 PHE B CE1 
4510 C CE2 . PHE B 269 ? 0.5994 0.5489 0.5941 -0.0488 0.0234  -0.0155 270 PHE B CE2 
4511 C CZ  . PHE B 269 ? 0.5789 0.5331 0.5680 -0.0408 0.0265  -0.0088 270 PHE B CZ  
4512 N N   . HIS B 270 ? 0.7057 0.5751 0.7335 -0.0329 0.0836  -0.0028 271 HIS B N   
4513 C CA  . HIS B 270 ? 0.7500 0.6001 0.7821 -0.0301 0.0974  0.0042  271 HIS B CA  
4514 C C   . HIS B 270 ? 0.7216 0.5860 0.7679 -0.0381 0.0926  0.0060  271 HIS B C   
4515 O O   . HIS B 270 ? 0.7214 0.5908 0.7807 -0.0539 0.0895  -0.0047 271 HIS B O   
4516 C CB  . HIS B 270 ? 0.8028 0.6210 0.8335 -0.0375 0.1135  -0.0044 271 HIS B CB  
4517 C CG  . HIS B 270 ? 0.8588 0.6482 0.8869 -0.0293 0.1322  0.0063  271 HIS B CG  
4518 N ND1 . HIS B 270 ? 0.9096 0.6654 0.9388 -0.0372 0.1502  0.0000  271 HIS B ND1 
4519 C CD2 . HIS B 270 ? 0.8803 0.6674 0.9024 -0.0138 0.1364  0.0231  271 HIS B CD2 
4520 C CE1 . HIS B 270 ? 0.9326 0.6645 0.9558 -0.0261 0.1659  0.0144  271 HIS B CE1 
4521 N NE2 . HIS B 270 ? 0.9231 0.6742 0.9404 -0.0112 0.1571  0.0287  271 HIS B NE2 
4522 N N   . LEU B 271 ? 0.7082 0.5809 0.7527 -0.0266 0.0914  0.0187  272 LEU B N   
4523 C CA  . LEU B 271 ? 0.7017 0.5889 0.7585 -0.0316 0.0880  0.0211  272 LEU B CA  
4524 C C   . LEU B 271 ? 0.7122 0.5835 0.7627 -0.0222 0.1021  0.0335  272 LEU B C   
4525 O O   . LEU B 271 ? 0.7153 0.5845 0.7505 -0.0057 0.1022  0.0442  272 LEU B O   
4526 C CB  . LEU B 271 ? 0.6781 0.5945 0.7367 -0.0280 0.0704  0.0228  272 LEU B CB  
4527 C CG  . LEU B 271 ? 0.6549 0.5874 0.7147 -0.0346 0.0557  0.0141  272 LEU B CG  
4528 C CD1 . LEU B 271 ? 0.6042 0.5576 0.6621 -0.0275 0.0434  0.0194  272 LEU B CD1 
4529 C CD2 . LEU B 271 ? 0.6478 0.5879 0.7225 -0.0503 0.0502  0.0031  272 LEU B CD2 
4530 N N   . GLY B 272 ? 0.7231 0.5839 0.7852 -0.0327 0.1142  0.0317  273 GLY B N   
4531 C CA  . GLY B 272 ? 0.7504 0.5927 0.8049 -0.0258 0.1311  0.0437  273 GLY B CA  
4532 C C   . GLY B 272 ? 0.7961 0.6085 0.8272 -0.0098 0.1439  0.0555  273 GLY B C   
4533 O O   . GLY B 272 ? 0.8124 0.6196 0.8259 0.0056  0.1477  0.0693  273 GLY B O   
4534 N N   . GLY B 273 ? 0.8253 0.6181 0.8547 -0.0124 0.1499  0.0500  274 GLY B N   
4535 C CA  . GLY B 273 ? 0.9090 0.6705 0.9182 0.0039  0.1632  0.0610  274 GLY B CA  
4536 C C   . GLY B 273 ? 0.9391 0.7133 0.9365 0.0216  0.1502  0.0648  274 GLY B C   
4537 O O   . GLY B 273 ? 1.0345 0.7888 1.0248 0.0296  0.1574  0.0653  274 GLY B O   
4538 N N   . LYS B 274 ? 0.8784 0.6854 0.8760 0.0276  0.1325  0.0668  275 LYS B N   
4539 C CA  . LYS B 274 ? 0.8226 0.6490 0.8157 0.0410  0.1189  0.0677  275 LYS B CA  
4540 C C   . LYS B 274 ? 0.7950 0.6355 0.7997 0.0293  0.1098  0.0533  275 LYS B C   
4541 O O   . LYS B 274 ? 0.7665 0.6127 0.7825 0.0112  0.1067  0.0426  275 LYS B O   
4542 C CB  . LYS B 274 ? 0.7724 0.6267 0.7620 0.0499  0.1048  0.0735  275 LYS B CB  
4543 N N   . GLU B 275 ? 0.7955 0.6421 0.7967 0.0408  0.1059  0.0534  276 GLU B N   
4544 C CA  . GLU B 275 ? 0.7725 0.6319 0.7800 0.0327  0.0990  0.0415  276 GLU B CA  
4545 C C   . GLU B 275 ? 0.7225 0.6163 0.7352 0.0353  0.0828  0.0414  276 GLU B C   
4546 O O   . GLU B 275 ? 0.7364 0.6423 0.7480 0.0507  0.0789  0.0483  276 GLU B O   
4547 C CB  . GLU B 275 ? 0.7929 0.6344 0.7954 0.0427  0.1095  0.0401  276 GLU B CB  
4548 C CG  . GLU B 275 ? 0.8320 0.6368 0.8307 0.0355  0.1265  0.0351  276 GLU B CG  
4549 C CD  . GLU B 275 ? 0.8502 0.6537 0.8529 0.0144  0.1250  0.0179  276 GLU B CD  
4550 O OE1 . GLU B 275 ? 0.8132 0.6425 0.8188 0.0065  0.1111  0.0112  276 GLU B OE1 
4551 O OE2 . GLU B 275 ? 0.9114 0.6863 0.9129 0.0056  0.1382  0.0107  276 GLU B OE2 
4552 N N   . TYR B 276 ? 0.6917 0.6007 0.7106 0.0205  0.0733  0.0334  277 TYR B N   
4553 C CA  . TYR B 276 ? 0.6714 0.6083 0.6953 0.0204  0.0600  0.0329  277 TYR B CA  
4554 C C   . TYR B 276 ? 0.6845 0.6276 0.7079 0.0178  0.0591  0.0259  277 TYR B C   
4555 O O   . TYR B 276 ? 0.6952 0.6339 0.7152 0.0054  0.0583  0.0178  277 TYR B O   
4556 C CB  . TYR B 276 ? 0.6288 0.5773 0.6585 0.0092  0.0510  0.0316  277 TYR B CB  
4557 C CG  . TYR B 276 ? 0.6199 0.5665 0.6495 0.0149  0.0529  0.0393  277 TYR B CG  
4558 C CD1 . TYR B 276 ? 0.6266 0.5542 0.6558 0.0104  0.0631  0.0406  277 TYR B CD1 
4559 C CD2 . TYR B 276 ? 0.6024 0.5651 0.6312 0.0246  0.0461  0.0447  277 TYR B CD2 
4560 C CE1 . TYR B 276 ? 0.6234 0.5469 0.6493 0.0160  0.0677  0.0486  277 TYR B CE1 
4561 C CE2 . TYR B 276 ? 0.6007 0.5600 0.6242 0.0308  0.0487  0.0515  277 TYR B CE2 
4562 C CZ  . TYR B 276 ? 0.6206 0.5596 0.6415 0.0269  0.0603  0.0542  277 TYR B CZ  
4563 O OH  . TYR B 276 ? 0.6601 0.5939 0.6730 0.0330  0.0654  0.0616  277 TYR B OH  
4564 N N   . THR B 277 ? 0.6737 0.6280 0.7004 0.0301  0.0595  0.0286  278 THR B N   
4565 C CA  . THR B 277 ? 0.6664 0.6234 0.6935 0.0307  0.0641  0.0227  278 THR B CA  
4566 C C   . THR B 277 ? 0.6495 0.6317 0.6840 0.0269  0.0562  0.0209  278 THR B C   
4567 O O   . THR B 277 ? 0.6382 0.6400 0.6830 0.0340  0.0499  0.0248  278 THR B O   
4568 C CB  . THR B 277 ? 0.6765 0.6270 0.7059 0.0483  0.0734  0.0262  278 THR B CB  
4569 O OG1 . THR B 277 ? 0.6891 0.6095 0.7097 0.0503  0.0839  0.0277  278 THR B OG1 
4570 C CG2 . THR B 277 ? 0.6556 0.6118 0.6889 0.0503  0.0801  0.0195  278 THR B CG2 
4571 N N   . LEU B 278 ? 0.6325 0.6129 0.6603 0.0154  0.0569  0.0145  279 LEU B N   
4572 C CA  . LEU B 278 ? 0.6099 0.6081 0.6423 0.0113  0.0544  0.0130  279 LEU B CA  
4573 C C   . LEU B 278 ? 0.6145 0.6116 0.6465 0.0149  0.0663  0.0080  279 LEU B C   
4574 O O   . LEU B 278 ? 0.6215 0.5995 0.6399 0.0121  0.0742  0.0026  279 LEU B O   
4575 C CB  . LEU B 278 ? 0.5928 0.5886 0.6144 -0.0025 0.0477  0.0115  279 LEU B CB  
4576 C CG  . LEU B 278 ? 0.5788 0.5846 0.6066 -0.0061 0.0362  0.0162  279 LEU B CG  
4577 C CD1 . LEU B 278 ? 0.5640 0.5618 0.5921 -0.0060 0.0319  0.0182  279 LEU B CD1 
4578 C CD2 . LEU B 278 ? 0.5623 0.5679 0.5805 -0.0163 0.0316  0.0159  279 LEU B CD2 
4579 N N   . THR B 279 ? 0.6083 0.6265 0.6568 0.0209  0.0680  0.0084  280 THR B N   
4580 C CA  . THR B 279 ? 0.6284 0.6505 0.6813 0.0239  0.0808  0.0033  280 THR B CA  
4581 C C   . THR B 279 ? 0.6314 0.6526 0.6729 0.0101  0.0840  0.0003  280 THR B C   
4582 O O   . THR B 279 ? 0.6144 0.6369 0.6503 0.0009  0.0747  0.0035  280 THR B O   
4583 C CB  . THR B 279 ? 0.6141 0.6639 0.6946 0.0359  0.0816  0.0038  280 THR B CB  
4584 O OG1 . THR B 279 ? 0.6113 0.6828 0.7047 0.0282  0.0744  0.0042  280 THR B OG1 
4585 C CG2 . THR B 279 ? 0.5945 0.6466 0.6830 0.0522  0.0758  0.0092  280 THR B CG2 
4586 N N   . SER B 280 ? 0.6645 0.6817 0.7010 0.0096  0.0981  -0.0051 281 SER B N   
4587 C CA  . SER B 280 ? 0.6756 0.6892 0.6967 -0.0020 0.1046  -0.0070 281 SER B CA  
4588 C C   . SER B 280 ? 0.6480 0.6797 0.6825 -0.0085 0.1000  -0.0024 281 SER B C   
4589 O O   . SER B 280 ? 0.6794 0.7021 0.6958 -0.0189 0.0980  0.0004  281 SER B O   
4590 C CB  . SER B 280 ? 0.7166 0.7278 0.7360 0.0009  0.1237  -0.0137 281 SER B CB  
4591 O OG  . SER B 280 ? 0.7258 0.7632 0.7782 0.0084  0.1302  -0.0142 281 SER B OG  
4592 N N   . ALA B 281 ? 0.6126 0.6691 0.6784 -0.0021 0.0980  -0.0022 282 ALA B N   
4593 C CA  . ALA B 281 ? 0.5893 0.6634 0.6719 -0.0089 0.0927  -0.0001 282 ALA B CA  
4594 C C   . ALA B 281 ? 0.5951 0.6593 0.6650 -0.0148 0.0779  0.0055  282 ALA B C   
4595 O O   . ALA B 281 ? 0.6071 0.6708 0.6753 -0.0243 0.0770  0.0081  282 ALA B O   
4596 C CB  . ALA B 281 ? 0.5347 0.6392 0.6531 0.0000  0.0895  -0.0031 282 ALA B CB  
4597 N N   . ASP B 282 ? 0.5862 0.6414 0.6481 -0.0090 0.0682  0.0074  283 ASP B N   
4598 C CA  . ASP B 282 ? 0.5688 0.6164 0.6219 -0.0130 0.0551  0.0120  283 ASP B CA  
4599 C C   . ASP B 282 ? 0.5773 0.6049 0.6040 -0.0218 0.0536  0.0141  283 ASP B C   
4600 O O   . ASP B 282 ? 0.5698 0.5941 0.5924 -0.0257 0.0436  0.0181  283 ASP B O   
4601 C CB  . ASP B 282 ? 0.5708 0.6154 0.6254 -0.0041 0.0480  0.0133  283 ASP B CB  
4602 C CG  . ASP B 282 ? 0.5720 0.6359 0.6479 0.0072  0.0463  0.0128  283 ASP B CG  
4603 O OD1 . ASP B 282 ? 0.5797 0.6629 0.6721 0.0060  0.0419  0.0117  283 ASP B OD1 
4604 O OD2 . ASP B 282 ? 0.5970 0.6560 0.6725 0.0179  0.0490  0.0134  283 ASP B OD2 
4605 N N   . TYR B 283 ? 0.5808 0.5960 0.5892 -0.0239 0.0628  0.0109  284 TYR B N   
4606 C CA  . TYR B 283 ? 0.6085 0.6061 0.5883 -0.0309 0.0591  0.0118  284 TYR B CA  
4607 C C   . TYR B 283 ? 0.6471 0.6356 0.6053 -0.0367 0.0699  0.0120  284 TYR B C   
4608 O O   . TYR B 283 ? 0.6720 0.6473 0.6038 -0.0414 0.0646  0.0144  284 TYR B O   
4609 C CB  . TYR B 283 ? 0.6012 0.5864 0.5695 -0.0297 0.0549  0.0068  284 TYR B CB  
4610 C CG  . TYR B 283 ? 0.6100 0.5860 0.5711 -0.0265 0.0677  -0.0009 284 TYR B CG  
4611 C CD1 . TYR B 283 ? 0.6175 0.5807 0.5523 -0.0313 0.0758  -0.0059 284 TYR B CD1 
4612 C CD2 . TYR B 283 ? 0.5795 0.5568 0.5571 -0.0176 0.0721  -0.0033 284 TYR B CD2 
4613 C CE1 . TYR B 283 ? 0.6330 0.5859 0.5607 -0.0282 0.0888  -0.0145 284 TYR B CE1 
4614 C CE2 . TYR B 283 ? 0.5965 0.5624 0.5682 -0.0134 0.0849  -0.0104 284 TYR B CE2 
4615 C CZ  . TYR B 283 ? 0.6325 0.5864 0.5803 -0.0192 0.0935  -0.0169 284 TYR B CZ  
4616 O OH  . TYR B 283 ? 0.6613 0.6023 0.6023 -0.0151 0.1076  -0.0254 284 TYR B OH  
4617 N N   . VAL B 284 ? 0.6355 0.6315 0.6043 -0.0357 0.0849  0.0097  285 VAL B N   
4618 C CA  . VAL B 284 ? 0.6682 0.6556 0.6179 -0.0418 0.0982  0.0112  285 VAL B CA  
4619 C C   . VAL B 284 ? 0.6787 0.6751 0.6447 -0.0469 0.1003  0.0176  285 VAL B C   
4620 O O   . VAL B 284 ? 0.6566 0.6730 0.6563 -0.0449 0.1004  0.0155  285 VAL B O   
4621 C CB  . VAL B 284 ? 0.6667 0.6553 0.6178 -0.0390 0.1175  0.0038  285 VAL B CB  
4622 C CG1 . VAL B 284 ? 0.6815 0.6592 0.6097 -0.0460 0.1338  0.0059  285 VAL B CG1 
4623 C CG2 . VAL B 284 ? 0.6633 0.6391 0.5982 -0.0345 0.1166  -0.0037 285 VAL B CG2 
4624 N N   . PHE B 285 ? 0.7139 0.6944 0.6549 -0.0530 0.1013  0.0251  286 PHE B N   
4625 C CA  . PHE B 285 ? 0.7106 0.6927 0.6630 -0.0594 0.1080  0.0312  286 PHE B CA  
4626 C C   . PHE B 285 ? 0.7384 0.7252 0.6989 -0.0638 0.1312  0.0278  286 PHE B C   
4627 O O   . PHE B 285 ? 0.7711 0.7399 0.7020 -0.0679 0.1450  0.0317  286 PHE B O   
4628 C CB  . PHE B 285 ? 0.7203 0.6799 0.6409 -0.0625 0.1028  0.0423  286 PHE B CB  
4629 C CG  . PHE B 285 ? 0.6962 0.6556 0.6186 -0.0587 0.0813  0.0459  286 PHE B CG  
4630 C CD1 . PHE B 285 ? 0.6516 0.6266 0.6078 -0.0578 0.0735  0.0439  286 PHE B CD1 
4631 C CD2 . PHE B 285 ? 0.7181 0.6628 0.6085 -0.0558 0.0689  0.0508  286 PHE B CD2 
4632 C CE1 . PHE B 285 ? 0.6445 0.6190 0.6026 -0.0542 0.0562  0.0470  286 PHE B CE1 
4633 C CE2 . PHE B 285 ? 0.6952 0.6424 0.5916 -0.0520 0.0502  0.0536  286 PHE B CE2 
4634 C CZ  . PHE B 285 ? 0.6725 0.6337 0.6028 -0.0513 0.0452  0.0520  286 PHE B CZ  
4635 N N   . GLN B 286 ? 0.7408 0.7531 0.7416 -0.0623 0.1355  0.0203  287 GLN B N   
4636 C CA  . GLN B 286 ? 0.7582 0.7822 0.7766 -0.0656 0.1575  0.0148  287 GLN B CA  
4637 C C   . GLN B 286 ? 0.7977 0.8208 0.8278 -0.0775 0.1702  0.0188  287 GLN B C   
4638 O O   . GLN B 286 ? 0.8102 0.8582 0.8820 -0.0812 0.1747  0.0123  287 GLN B O   
4639 C CB  . GLN B 286 ? 0.7232 0.7778 0.7820 -0.0573 0.1557  0.0048  287 GLN B CB  
4640 C CG  . GLN B 286 ? 0.7133 0.7645 0.7613 -0.0453 0.1477  0.0012  287 GLN B CG  
4641 C CD  . GLN B 286 ? 0.7542 0.7960 0.7858 -0.0424 0.1657  -0.0037 287 GLN B CD  
4642 O OE1 . GLN B 286 ? 0.7601 0.8007 0.7905 -0.0325 0.1632  -0.0086 287 GLN B OE1 
4643 N NE2 . GLN B 286 ? 0.7545 0.7868 0.7718 -0.0507 0.1855  -0.0025 287 GLN B NE2 
4644 N N   . GLU B 287 ? 0.8616 0.8552 0.8540 -0.0832 0.1759  0.0292  288 GLU B N   
4645 C CA  . GLU B 287 ? 0.9345 0.9167 0.9285 -0.0949 0.1921  0.0357  288 GLU B CA  
4646 C C   . GLU B 287 ? 0.9262 0.9190 0.9394 -0.1024 0.2202  0.0299  288 GLU B C   
4647 O O   . GLU B 287 ? 0.9266 0.9138 0.9506 -0.1141 0.2375  0.0329  288 GLU B O   
4648 C CB  . GLU B 287 ? 1.0200 0.9643 0.9609 -0.0957 0.1928  0.0503  288 GLU B CB  
4649 C CG  . GLU B 287 ? 1.0923 1.0261 1.0160 -0.0889 0.1666  0.0571  288 GLU B CG  
4650 C CD  . GLU B 287 ? 1.1247 1.0468 1.0559 -0.0940 0.1641  0.0655  288 GLU B CD  
4651 O OE1 . GLU B 287 ? 1.1164 1.0495 1.0682 -0.0907 0.1456  0.0630  288 GLU B OE1 
4652 O OE2 . GLU B 287 ? 1.1699 1.0694 1.0848 -0.1010 0.1821  0.0749  288 GLU B OE2 
4653 N N   . SER B 288 ? 0.9245 0.9319 0.9436 -0.0954 0.2256  0.0211  289 SER B N   
4654 C CA  . SER B 288 ? 0.9236 0.9400 0.9550 -0.0992 0.2534  0.0149  289 SER B CA  
4655 C C   . SER B 288 ? 0.9070 0.9422 0.9502 -0.0865 0.2494  0.0043  289 SER B C   
4656 O O   . SER B 288 ? 0.9076 0.9391 0.9372 -0.0767 0.2280  0.0043  289 SER B O   
4657 C CB  . SER B 288 ? 0.9387 0.9188 0.9175 -0.1044 0.2735  0.0249  289 SER B CB  
4658 O OG  . SER B 288 ? 0.9677 0.9529 0.9496 -0.1059 0.3007  0.0184  289 SER B OG  
4659 N N   . TYR B 289 ? 0.9060 0.9609 0.9766 -0.0864 0.2707  -0.0045 290 TYR B N   
4660 C CA  . TYR B 289 ? 0.8812 0.9489 0.9601 -0.0729 0.2716  -0.0138 290 TYR B CA  
4661 C C   . TYR B 289 ? 0.8681 0.9235 0.9268 -0.0743 0.3017  -0.0170 290 TYR B C   
4662 O O   . TYR B 289 ? 0.8294 0.8975 0.9025 -0.0643 0.3104  -0.0263 290 TYR B O   
4663 C CB  . TYR B 289 ? 0.9099 1.0213 1.0507 -0.0656 0.2640  -0.0237 290 TYR B CB  
4664 C CG  . TYR B 289 ? 0.9301 1.0497 1.0795 -0.0582 0.2328  -0.0220 290 TYR B CG  
4665 C CD1 . TYR B 289 ? 0.9356 1.0548 1.0898 -0.0671 0.2191  -0.0170 290 TYR B CD1 
4666 C CD2 . TYR B 289 ? 0.9395 1.0646 1.0909 -0.0421 0.2190  -0.0252 290 TYR B CD2 
4667 C CE1 . TYR B 289 ? 0.9535 1.0789 1.1131 -0.0604 0.1926  -0.0157 290 TYR B CE1 
4668 C CE2 . TYR B 289 ? 0.9470 1.0771 1.1032 -0.0355 0.1929  -0.0226 290 TYR B CE2 
4669 C CZ  . TYR B 289 ? 0.9514 1.0828 1.1115 -0.0448 0.1799  -0.0182 290 TYR B CZ  
4670 O OH  . TYR B 289 ? 0.9728 1.1087 1.1362 -0.0386 0.1561  -0.0161 290 TYR B OH  
4671 N N   . SER B 290 ? 0.8806 0.9087 0.9029 -0.0858 0.3177  -0.0084 291 SER B N   
4672 C CA  . SER B 290 ? 0.8855 0.8972 0.8817 -0.0899 0.3496  -0.0093 291 SER B CA  
4673 C C   . SER B 290 ? 0.8949 0.8819 0.8405 -0.0806 0.3494  -0.0122 291 SER B C   
4674 O O   . SER B 290 ? 0.8972 0.8634 0.8044 -0.0768 0.3267  -0.0075 291 SER B O   
4675 C CB  . SER B 290 ? 0.9047 0.8885 0.8684 -0.1037 0.3635  0.0037  291 SER B CB  
4676 O OG  . SER B 290 ? 0.9887 0.9647 0.9431 -0.1103 0.3999  0.0025  291 SER B OG  
4677 N N   . SER B 291 ? 0.9009 0.8913 0.8491 -0.0775 0.3757  -0.0214 292 SER B N   
4678 C CA  . SER B 291 ? 0.9187 0.8813 0.8140 -0.0714 0.3833  -0.0261 292 SER B CA  
4679 C C   . SER B 291 ? 0.9565 0.8798 0.7832 -0.0802 0.3933  -0.0153 292 SER B C   
4680 O O   . SER B 291 ? 0.9889 0.8850 0.7601 -0.0766 0.3936  -0.0180 292 SER B O   
4681 C CB  . SER B 291 ? 0.9346 0.9123 0.8550 -0.0653 0.4118  -0.0395 292 SER B CB  
4682 O OG  . SER B 291 ? 0.9462 0.9320 0.8837 -0.0752 0.4445  -0.0384 292 SER B OG  
4683 N N   . LYS B 292 ? 0.9449 0.8649 0.7755 -0.0913 0.4006  -0.0032 293 LYS B N   
4684 C CA  . LYS B 292 ? 0.9968 0.8797 0.7665 -0.0990 0.4134  0.0103  293 LYS B CA  
4685 C C   . LYS B 292 ? 0.9927 0.8556 0.7291 -0.0991 0.3831  0.0243  293 LYS B C   
4686 O O   . LYS B 292 ? 1.0445 0.8744 0.7246 -0.1023 0.3887  0.0373  293 LYS B O   
4687 C CB  . LYS B 292 ? 1.0134 0.9003 0.8075 -0.1117 0.4471  0.0156  293 LYS B CB  
4688 C CG  . LYS B 292 ? 1.0182 0.9261 0.8474 -0.1128 0.4817  0.0024  293 LYS B CG  
4689 C CD  . LYS B 292 ? 0.9632 0.9201 0.8805 -0.1139 0.4790  -0.0075 293 LYS B CD  
4690 C CE  . LYS B 292 ? 0.9809 0.9588 0.9404 -0.1219 0.5189  -0.0150 293 LYS B CE  
4691 N NZ  . LYS B 292 ? 0.9924 0.9833 0.9609 -0.1107 0.5348  -0.0297 293 LYS B NZ  
4692 N N   . LYS B 293 ? 0.9415 0.8241 0.7116 -0.0945 0.3520  0.0220  294 LYS B N   
4693 C CA  . LYS B 293 ? 0.9590 0.8290 0.7103 -0.0941 0.3235  0.0340  294 LYS B CA  
4694 C C   . LYS B 293 ? 0.9385 0.8121 0.6814 -0.0844 0.2905  0.0281  294 LYS B C   
4695 O O   . LYS B 293 ? 0.9065 0.8000 0.6788 -0.0784 0.2858  0.0150  294 LYS B O   
4696 C CB  . LYS B 293 ? 0.9402 0.8291 0.7441 -0.1008 0.3194  0.0389  294 LYS B CB  
4697 C CG  . LYS B 293 ? 0.9911 0.8550 0.7738 -0.1102 0.3318  0.0551  294 LYS B CG  
4698 C CD  . LYS B 293 ? 1.0478 0.9143 0.8514 -0.1216 0.3699  0.0543  294 LYS B CD  
4699 C CE  . LYS B 293 ? 1.1153 0.9502 0.8938 -0.1314 0.3855  0.0719  294 LYS B CE  
4700 N NZ  . LYS B 293 ? 1.1055 0.9501 0.9256 -0.1374 0.3721  0.0754  294 LYS B NZ  
4701 N N   . LEU B 294 ? 0.9505 0.8047 0.6549 -0.0826 0.2687  0.0382  295 LEU B N   
4702 C CA  . LEU B 294 ? 0.9307 0.7884 0.6286 -0.0755 0.2373  0.0334  295 LEU B CA  
4703 C C   . LEU B 294 ? 0.8894 0.7637 0.6268 -0.0748 0.2143  0.0381  295 LEU B C   
4704 O O   . LEU B 294 ? 0.8892 0.7591 0.6333 -0.0791 0.2153  0.0499  295 LEU B O   
4705 C CB  . LEU B 294 ? 0.9637 0.7941 0.5955 -0.0728 0.2251  0.0389  295 LEU B CB  
4706 C CG  . LEU B 294 ? 1.0251 0.8341 0.6025 -0.0725 0.2426  0.0338  295 LEU B CG  
4707 C CD1 . LEU B 294 ? 1.0710 0.8554 0.5846 -0.0694 0.2261  0.0433  295 LEU B CD1 
4708 C CD2 . LEU B 294 ? 1.0179 0.8359 0.6039 -0.0692 0.2430  0.0140  295 LEU B CD2 
4709 N N   . CYS B 295 ? 0.8691 0.7599 0.6307 -0.0694 0.1953  0.0288  296 CYS B N   
4710 C CA  . CYS B 295 ? 0.8360 0.7437 0.6349 -0.0678 0.1746  0.0313  296 CYS B CA  
4711 C C   . CYS B 295 ? 0.8353 0.7382 0.6161 -0.0630 0.1476  0.0305  296 CYS B C   
4712 O O   . CYS B 295 ? 0.8489 0.7478 0.6128 -0.0602 0.1436  0.0207  296 CYS B O   
4713 C CB  . CYS B 295 ? 0.8042 0.7400 0.6569 -0.0654 0.1787  0.0216  296 CYS B CB  
4714 S SG  . CYS B 295 ? 0.8406 0.7944 0.7359 -0.0726 0.2008  0.0230  296 CYS B SG  
4715 N N   . THR B 296 ? 0.8229 0.7258 0.6085 -0.0627 0.1303  0.0398  297 THR B N   
4716 C CA  . THR B 296 ? 0.8082 0.7099 0.5822 -0.0587 0.1049  0.0394  297 THR B CA  
4717 C C   . THR B 296 ? 0.7800 0.7021 0.5954 -0.0559 0.0933  0.0316  297 THR B C   
4718 O O   . THR B 296 ? 0.7445 0.6819 0.5974 -0.0560 0.0994  0.0307  297 THR B O   
4719 C CB  . THR B 296 ? 0.8118 0.7038 0.5718 -0.0577 0.0919  0.0535  297 THR B CB  
4720 O OG1 . THR B 296 ? 0.8134 0.7151 0.6109 -0.0595 0.0940  0.0587  297 THR B OG1 
4721 C CG2 . THR B 296 ? 0.8490 0.7165 0.5613 -0.0585 0.1027  0.0640  297 THR B CG2 
4722 N N   . LEU B 297 ? 0.7741 0.6963 0.5819 -0.0535 0.0767  0.0255  298 LEU B N   
4723 C CA  . LEU B 297 ? 0.7216 0.6587 0.5636 -0.0508 0.0668  0.0197  298 LEU B CA  
4724 C C   . LEU B 297 ? 0.7058 0.6492 0.5608 -0.0496 0.0486  0.0271  298 LEU B C   
4725 O O   . LEU B 297 ? 0.7674 0.7025 0.6011 -0.0498 0.0399  0.0348  298 LEU B O   
4726 C CB  . LEU B 297 ? 0.7391 0.6719 0.5714 -0.0503 0.0634  0.0074  298 LEU B CB  
4727 C CG  . LEU B 297 ? 0.7722 0.6949 0.5869 -0.0507 0.0802  -0.0027 298 LEU B CG  
4728 C CD1 . LEU B 297 ? 0.7652 0.6878 0.5934 -0.0487 0.0784  -0.0143 298 LEU B CD1 
4729 C CD2 . LEU B 297 ? 0.7885 0.7159 0.6167 -0.0493 0.1018  -0.0011 298 LEU B CD2 
4730 N N   . ALA B 298 ? 0.6512 0.6085 0.5400 -0.0472 0.0437  0.0251  299 ALA B N   
4731 C CA  . ALA B 298 ? 0.6457 0.6098 0.5499 -0.0457 0.0286  0.0303  299 ALA B CA  
4732 C C   . ALA B 298 ? 0.6516 0.6176 0.5559 -0.0451 0.0149  0.0242  299 ALA B C   
4733 O O   . ALA B 298 ? 0.6478 0.6231 0.5747 -0.0432 0.0069  0.0245  299 ALA B O   
4734 C CB  . ALA B 298 ? 0.6205 0.5981 0.5584 -0.0437 0.0318  0.0314  299 ALA B CB  
4735 N N   . ILE B 299 ? 0.6764 0.6336 0.5554 -0.0475 0.0138  0.0176  300 ILE B N   
4736 C CA  . ILE B 299 ? 0.6969 0.6553 0.5739 -0.0497 0.0014  0.0093  300 ILE B CA  
4737 C C   . ILE B 299 ? 0.7538 0.7059 0.5969 -0.0514 -0.0092 0.0092  300 ILE B C   
4738 O O   . ILE B 299 ? 0.7785 0.7188 0.5911 -0.0523 -0.0010 0.0087  300 ILE B O   
4739 C CB  . ILE B 299 ? 0.7058 0.6593 0.5867 -0.0515 0.0107  -0.0029 300 ILE B CB  
4740 C CG1 . ILE B 299 ? 0.6736 0.6327 0.5836 -0.0468 0.0212  -0.0010 300 ILE B CG1 
4741 C CG2 . ILE B 299 ? 0.6948 0.6493 0.5783 -0.0562 -0.0008 -0.0128 300 ILE B CG2 
4742 C CD1 . ILE B 299 ? 0.6611 0.6115 0.5715 -0.0453 0.0347  -0.0100 300 ILE B CD1 
4743 N N   . HIS B 300 ? 0.7948 0.7558 0.6432 -0.0509 -0.0274 0.0099  301 HIS B N   
4744 C CA  . HIS B 300 ? 0.8744 0.8340 0.6934 -0.0501 -0.0425 0.0105  301 HIS B CA  
4745 C C   . HIS B 300 ? 0.8890 0.8596 0.7148 -0.0547 -0.0582 -0.0030 301 HIS B C   
4746 O O   . HIS B 300 ? 0.8680 0.8481 0.7267 -0.0576 -0.0587 -0.0087 301 HIS B O   
4747 C CB  . HIS B 300 ? 0.8907 0.8535 0.7119 -0.0432 -0.0519 0.0258  301 HIS B CB  
4748 C CG  . HIS B 300 ? 0.9687 0.9158 0.7684 -0.0402 -0.0392 0.0386  301 HIS B CG  
4749 N ND1 . HIS B 300 ? 0.9783 0.9205 0.7902 -0.0425 -0.0194 0.0404  301 HIS B ND1 
4750 C CD2 . HIS B 300 ? 1.0276 0.9629 0.7954 -0.0351 -0.0427 0.0504  301 HIS B CD2 
4751 C CE1 . HIS B 300 ? 1.0051 0.9334 0.7961 -0.0409 -0.0099 0.0516  301 HIS B CE1 
4752 N NE2 . HIS B 300 ? 1.0476 0.9690 0.8096 -0.0362 -0.0228 0.0589  301 HIS B NE2 
4753 N N   . ALA B 301 ? 0.9378 0.9071 0.7317 -0.0557 -0.0704 -0.0088 302 ALA B N   
4754 C CA  . ALA B 301 ? 0.9367 0.9217 0.7393 -0.0600 -0.0899 -0.0215 302 ALA B CA  
4755 C C   . ALA B 301 ? 0.9315 0.9338 0.7529 -0.0526 -0.1074 -0.0108 302 ALA B C   
4756 O O   . ALA B 301 ? 0.9886 0.9857 0.7904 -0.0435 -0.1114 0.0041  302 ALA B O   
4757 C CB  . ALA B 301 ? 0.9719 0.9516 0.7320 -0.0628 -0.0991 -0.0325 302 ALA B CB  
4758 N N   . MET B 302 ? 0.9063 0.9271 0.7666 -0.0560 -0.1154 -0.0180 303 MET B N   
4759 C CA  . MET B 302 ? 0.9038 0.9448 0.7849 -0.0490 -0.1335 -0.0114 303 MET B CA  
4760 C C   . MET B 302 ? 0.8733 0.9375 0.7848 -0.0570 -0.1466 -0.0282 303 MET B C   
4761 O O   . MET B 302 ? 0.8318 0.8985 0.7750 -0.0649 -0.1358 -0.0359 303 MET B O   
4762 C CB  . MET B 302 ? 0.8955 0.9356 0.8031 -0.0424 -0.1241 0.0032  303 MET B CB  
4763 C CG  . MET B 302 ? 0.9507 1.0046 0.8698 -0.0314 -0.1403 0.0140  303 MET B CG  
4764 S SD  . MET B 302 ? 1.0078 1.0548 0.9506 -0.0240 -0.1270 0.0298  303 MET B SD  
4765 C CE  . MET B 302 ? 1.0082 1.0752 0.9707 -0.0115 -0.1482 0.0370  303 MET B CE  
4766 N N   . ASP B 303 ? 0.8994 0.9805 0.8002 -0.0549 -0.1697 -0.0341 304 ASP B N   
4767 C CA  . ASP B 303 ? 0.8875 0.9960 0.8213 -0.0630 -0.1846 -0.0515 304 ASP B CA  
4768 C C   . ASP B 303 ? 0.8562 0.9891 0.8307 -0.0547 -0.1949 -0.0433 304 ASP B C   
4769 O O   . ASP B 303 ? 0.8655 1.0129 0.8334 -0.0426 -0.2149 -0.0355 304 ASP B O   
4770 C CB  . ASP B 303 ? 0.9058 1.0244 0.8105 -0.0661 -0.2057 -0.0660 304 ASP B CB  
4771 C CG  . ASP B 303 ? 0.9412 1.0378 0.8161 -0.0782 -0.1928 -0.0808 304 ASP B CG  
4772 O OD1 . ASP B 303 ? 0.9285 1.0200 0.8285 -0.0911 -0.1780 -0.0938 304 ASP B OD1 
4773 O OD2 . ASP B 303 ? 0.9774 1.0599 0.8025 -0.0741 -0.1962 -0.0791 304 ASP B OD2 
4774 N N   . ILE B 304 ? 0.8221 0.9569 0.8363 -0.0598 -0.1796 -0.0439 305 ILE B N   
4775 C CA  . ILE B 304 ? 0.8000 0.9568 0.8574 -0.0538 -0.1841 -0.0386 305 ILE B CA  
4776 C C   . ILE B 304 ? 0.8186 1.0087 0.9112 -0.0626 -0.2001 -0.0576 305 ILE B C   
4777 O O   . ILE B 304 ? 0.8258 1.0150 0.9293 -0.0786 -0.1925 -0.0747 305 ILE B O   
4778 C CB  . ILE B 304 ? 0.7594 0.9026 0.8394 -0.0556 -0.1596 -0.0318 305 ILE B CB  
4779 C CG1 . ILE B 304 ? 0.7487 0.8643 0.7975 -0.0472 -0.1468 -0.0149 305 ILE B CG1 
4780 C CG2 . ILE B 304 ? 0.7456 0.9109 0.8703 -0.0506 -0.1617 -0.0287 305 ILE B CG2 
4781 C CD1 . ILE B 304 ? 0.6868 0.7849 0.7438 -0.0512 -0.1230 -0.0120 305 ILE B CD1 
4782 N N   . PRO B 305 ? 0.8346 1.0543 0.9462 -0.0521 -0.2220 -0.0552 306 PRO B N   
4783 C CA  . PRO B 305 ? 0.8557 1.1128 1.0037 -0.0607 -0.2398 -0.0751 306 PRO B CA  
4784 C C   . PRO B 305 ? 0.8362 1.1097 1.0429 -0.0705 -0.2257 -0.0831 306 PRO B C   
4785 O O   . PRO B 305 ? 0.7737 1.0333 0.9919 -0.0656 -0.2067 -0.0699 306 PRO B O   
4786 C CB  . PRO B 305 ? 0.8546 1.1370 1.0004 -0.0422 -0.2681 -0.0668 306 PRO B CB  
4787 C CG  . PRO B 305 ? 0.8456 1.1065 0.9775 -0.0250 -0.2582 -0.0415 306 PRO B CG  
4788 C CD  . PRO B 305 ? 0.8392 1.0596 0.9420 -0.0318 -0.2313 -0.0348 306 PRO B CD  
4789 N N   . PRO B 306 ? 0.8854 1.1875 1.1280 -0.0853 -0.2340 -0.1054 307 PRO B N   
4790 C CA  . PRO B 306 ? 0.8691 1.1917 1.1713 -0.0943 -0.2219 -0.1133 307 PRO B CA  
4791 C C   . PRO B 306 ? 0.8598 1.2066 1.1944 -0.0770 -0.2285 -0.1003 307 PRO B C   
4792 O O   . PRO B 306 ? 0.8809 1.2426 1.2027 -0.0603 -0.2520 -0.0923 307 PRO B O   
4793 C CB  . PRO B 306 ? 0.8867 1.2411 1.2173 -0.1113 -0.2372 -0.1405 307 PRO B CB  
4794 C CG  . PRO B 306 ? 0.9129 1.2447 1.1926 -0.1182 -0.2426 -0.1487 307 PRO B CG  
4795 C CD  . PRO B 306 ? 0.9255 1.2382 1.1532 -0.0973 -0.2511 -0.1266 307 PRO B CD  
4796 N N   . PRO B 307 ? 0.8314 1.1802 1.2050 -0.0799 -0.2074 -0.0978 308 PRO B N   
4797 C CA  . PRO B 307 ? 0.8067 1.1393 1.1968 -0.0990 -0.1800 -0.1071 308 PRO B CA  
4798 C C   . PRO B 307 ? 0.7792 1.0643 1.1308 -0.0984 -0.1545 -0.0932 308 PRO B C   
4799 O O   . PRO B 307 ? 0.7679 1.0339 1.1207 -0.1133 -0.1346 -0.1007 308 PRO B O   
4800 C CB  . PRO B 307 ? 0.7837 1.1441 1.2331 -0.0999 -0.1708 -0.1099 308 PRO B CB  
4801 C CG  . PRO B 307 ? 0.7766 1.1509 1.2287 -0.0766 -0.1842 -0.0940 308 PRO B CG  
4802 C CD  . PRO B 307 ? 0.7954 1.1613 1.1992 -0.0636 -0.2076 -0.0854 308 PRO B CD  
4803 N N   . THR B 308 ? 0.7374 1.0043 1.0569 -0.0814 -0.1551 -0.0738 309 THR B N   
4804 C CA  . THR B 308 ? 0.7165 0.9436 1.0015 -0.0797 -0.1340 -0.0614 309 THR B CA  
4805 C C   . THR B 308 ? 0.7271 0.9304 0.9771 -0.0903 -0.1302 -0.0688 309 THR B C   
4806 O O   . THR B 308 ? 0.6888 0.8661 0.9294 -0.0965 -0.1088 -0.0675 309 THR B O   
4807 C CB  . THR B 308 ? 0.7054 0.9194 0.9645 -0.0612 -0.1367 -0.0416 309 THR B CB  
4808 O OG1 . THR B 308 ? 0.6616 0.8940 0.9533 -0.0511 -0.1373 -0.0356 309 THR B OG1 
4809 C CG2 . THR B 308 ? 0.6963 0.8753 0.9270 -0.0606 -0.1155 -0.0314 309 THR B CG2 
4810 N N   . GLY B 309 ? 0.7587 0.9710 0.9891 -0.0913 -0.1510 -0.0767 310 GLY B N   
4811 C CA  . GLY B 309 ? 0.7619 0.9523 0.9562 -0.1001 -0.1487 -0.0850 310 GLY B CA  
4812 C C   . GLY B 309 ? 0.8101 1.0159 1.0184 -0.1170 -0.1580 -0.1091 310 GLY B C   
4813 O O   . GLY B 309 ? 0.8674 1.1037 1.1195 -0.1236 -0.1652 -0.1203 310 GLY B O   
4814 N N   . PRO B 310 ? 0.8219 1.0082 0.9960 -0.1248 -0.1572 -0.1190 311 PRO B N   
4815 C CA  . PRO B 310 ? 0.7929 0.9446 0.9191 -0.1179 -0.1461 -0.1074 311 PRO B CA  
4816 C C   . PRO B 310 ? 0.7518 0.8769 0.8833 -0.1180 -0.1179 -0.0974 311 PRO B C   
4817 O O   . PRO B 310 ? 0.7496 0.8724 0.9104 -0.1290 -0.1035 -0.1055 311 PRO B O   
4818 C CB  . PRO B 310 ? 0.8265 0.9676 0.9270 -0.1302 -0.1494 -0.1267 311 PRO B CB  
4819 C CG  . PRO B 310 ? 0.8553 1.0310 0.9820 -0.1399 -0.1715 -0.1465 311 PRO B CG  
4820 C CD  . PRO B 310 ? 0.8222 1.0212 1.0036 -0.1415 -0.1678 -0.1446 311 PRO B CD  
4821 N N   . THR B 311 ? 0.7125 0.8181 0.8158 -0.1058 -0.1102 -0.0801 312 THR B N   
4822 C CA  . THR B 311 ? 0.6729 0.7582 0.7801 -0.1020 -0.0875 -0.0684 312 THR B CA  
4823 C C   . THR B 311 ? 0.6791 0.7429 0.7503 -0.0920 -0.0806 -0.0555 312 THR B C   
4824 O O   . THR B 311 ? 0.6959 0.7625 0.7433 -0.0847 -0.0927 -0.0494 312 THR B O   
4825 C CB  . THR B 311 ? 0.6445 0.7444 0.7831 -0.0953 -0.0854 -0.0578 312 THR B CB  
4826 O OG1 . THR B 311 ? 0.6284 0.7082 0.7655 -0.0913 -0.0646 -0.0476 312 THR B OG1 
4827 C CG2 . THR B 311 ? 0.6209 0.7349 0.7527 -0.0815 -0.1016 -0.0455 312 THR B CG2 
4828 N N   . TRP B 312 ? 0.6587 0.7018 0.7274 -0.0912 -0.0606 -0.0509 313 TRP B N   
4829 C CA  . TRP B 312 ? 0.6428 0.6718 0.6891 -0.0809 -0.0528 -0.0376 313 TRP B CA  
4830 C C   . TRP B 312 ? 0.5983 0.6377 0.6579 -0.0713 -0.0553 -0.0238 313 TRP B C   
4831 O O   . TRP B 312 ? 0.5520 0.6024 0.6391 -0.0721 -0.0544 -0.0235 313 TRP B O   
4832 C CB  . TRP B 312 ? 0.6387 0.6456 0.6806 -0.0811 -0.0327 -0.0375 313 TRP B CB  
4833 C CG  . TRP B 312 ? 0.6798 0.6714 0.7045 -0.0888 -0.0278 -0.0506 313 TRP B CG  
4834 C CD1 . TRP B 312 ? 0.6972 0.6872 0.7315 -0.1012 -0.0281 -0.0667 313 TRP B CD1 
4835 C CD2 . TRP B 312 ? 0.6994 0.6746 0.6959 -0.0851 -0.0203 -0.0505 313 TRP B CD2 
4836 N NE1 . TRP B 312 ? 0.7317 0.7033 0.7431 -0.1054 -0.0217 -0.0769 313 TRP B NE1 
4837 C CE2 . TRP B 312 ? 0.7208 0.6832 0.7085 -0.0950 -0.0164 -0.0669 313 TRP B CE2 
4838 C CE3 . TRP B 312 ? 0.7078 0.6784 0.6876 -0.0753 -0.0155 -0.0393 313 TRP B CE3 
4839 C CZ2 . TRP B 312 ? 0.7466 0.6907 0.7076 -0.0938 -0.0072 -0.0719 313 TRP B CZ2 
4840 C CZ3 . TRP B 312 ? 0.7284 0.6835 0.6845 -0.0745 -0.0062 -0.0439 313 TRP B CZ3 
4841 C CH2 . TRP B 312 ? 0.7584 0.6999 0.7043 -0.0831 -0.0019 -0.0598 313 TRP B CH2 
4842 N N   . ALA B 313 ? 0.6054 0.6408 0.6456 -0.0630 -0.0574 -0.0133 314 ALA B N   
4843 C CA  . ALA B 313 ? 0.6050 0.6446 0.6548 -0.0543 -0.0562 -0.0011 314 ALA B CA  
4844 C C   . ALA B 313 ? 0.6001 0.6255 0.6380 -0.0501 -0.0425 0.0051  314 ALA B C   
4845 O O   . ALA B 313 ? 0.6378 0.6530 0.6537 -0.0505 -0.0390 0.0044  314 ALA B O   
4846 C CB  . ALA B 313 ? 0.6070 0.6547 0.6489 -0.0482 -0.0706 0.0058  314 ALA B CB  
4847 N N   . LEU B 314 ? 0.5773 0.6035 0.6304 -0.0460 -0.0348 0.0100  315 LEU B N   
4848 C CA  . LEU B 314 ? 0.5678 0.5861 0.6143 -0.0409 -0.0244 0.0153  315 LEU B CA  
4849 C C   . LEU B 314 ? 0.5642 0.5879 0.6136 -0.0354 -0.0282 0.0232  315 LEU B C   
4850 O O   . LEU B 314 ? 0.5849 0.6147 0.6498 -0.0325 -0.0282 0.0256  315 LEU B O   
4851 C CB  . LEU B 314 ? 0.5550 0.5687 0.6121 -0.0395 -0.0131 0.0146  315 LEU B CB  
4852 C CG  . LEU B 314 ? 0.5660 0.5685 0.6206 -0.0448 -0.0056 0.0072  315 LEU B CG  
4853 C CD1 . LEU B 314 ? 0.5567 0.5519 0.6205 -0.0416 0.0062  0.0097  315 LEU B CD1 
4854 C CD2 . LEU B 314 ? 0.5728 0.5646 0.6083 -0.0445 -0.0011 0.0044  315 LEU B CD2 
4855 N N   . GLY B 315 ? 0.5696 0.5892 0.6033 -0.0347 -0.0300 0.0268  316 GLY B N   
4856 C CA  . GLY B 315 ? 0.5661 0.5866 0.6012 -0.0309 -0.0325 0.0338  316 GLY B CA  
4857 C C   . GLY B 315 ? 0.5711 0.5893 0.6063 -0.0294 -0.0233 0.0356  316 GLY B C   
4858 O O   . GLY B 315 ? 0.5829 0.6029 0.6232 -0.0282 -0.0166 0.0325  316 GLY B O   
4859 N N   . ALA B 316 ? 0.5713 0.5853 0.6011 -0.0291 -0.0229 0.0406  317 ALA B N   
4860 C CA  . ALA B 316 ? 0.5531 0.5678 0.5878 -0.0294 -0.0149 0.0407  317 ALA B CA  
4861 C C   . ALA B 316 ? 0.5562 0.5733 0.5882 -0.0303 -0.0065 0.0365  317 ALA B C   
4862 O O   . ALA B 316 ? 0.5516 0.5770 0.5955 -0.0283 -0.0025 0.0338  317 ALA B O   
4863 C CB  . ALA B 316 ? 0.5570 0.5627 0.5847 -0.0312 -0.0134 0.0465  317 ALA B CB  
4864 N N   . THR B 317 ? 0.5708 0.5817 0.5873 -0.0324 -0.0044 0.0353  318 THR B N   
4865 C CA  . THR B 317 ? 0.5711 0.5829 0.5852 -0.0319 0.0046  0.0308  318 THR B CA  
4866 C C   . THR B 317 ? 0.5476 0.5656 0.5749 -0.0267 0.0057  0.0276  318 THR B C   
4867 O O   . THR B 317 ? 0.5451 0.5702 0.5808 -0.0227 0.0115  0.0259  318 THR B O   
4868 C CB  . THR B 317 ? 0.5858 0.5874 0.5791 -0.0349 0.0063  0.0280  318 THR B CB  
4869 O OG1 . THR B 317 ? 0.6016 0.5955 0.5768 -0.0381 0.0042  0.0326  318 THR B OG1 
4870 C CG2 . THR B 317 ? 0.5896 0.5906 0.5811 -0.0335 0.0183  0.0234  318 THR B CG2 
4871 N N   . PHE B 318 ? 0.5304 0.5461 0.5598 -0.0264 0.0004  0.0271  319 PHE B N   
4872 C CA  . PHE B 318 ? 0.5141 0.5310 0.5522 -0.0215 0.0031  0.0260  319 PHE B CA  
4873 C C   . PHE B 318 ? 0.4937 0.5202 0.5435 -0.0164 0.0015  0.0283  319 PHE B C   
4874 O O   . PHE B 318 ? 0.5226 0.5528 0.5757 -0.0098 0.0053  0.0283  319 PHE B O   
4875 C CB  . PHE B 318 ? 0.5144 0.5256 0.5534 -0.0247 0.0003  0.0240  319 PHE B CB  
4876 C CG  . PHE B 318 ? 0.5281 0.5332 0.5707 -0.0209 0.0075  0.0233  319 PHE B CG  
4877 C CD1 . PHE B 318 ? 0.5458 0.5396 0.5810 -0.0205 0.0153  0.0198  319 PHE B CD1 
4878 C CD2 . PHE B 318 ? 0.5283 0.5360 0.5797 -0.0170 0.0083  0.0265  319 PHE B CD2 
4879 C CE1 . PHE B 318 ? 0.5525 0.5361 0.5896 -0.0158 0.0237  0.0207  319 PHE B CE1 
4880 C CE2 . PHE B 318 ? 0.5198 0.5181 0.5708 -0.0125 0.0168  0.0279  319 PHE B CE2 
4881 C CZ  . PHE B 318 ? 0.5510 0.5364 0.5950 -0.0118 0.0245  0.0256  319 PHE B CZ  
4882 N N   . ILE B 319 ? 0.4830 0.5127 0.5375 -0.0186 -0.0042 0.0301  320 ILE B N   
4883 C CA  . ILE B 319 ? 0.4747 0.5120 0.5385 -0.0149 -0.0058 0.0303  320 ILE B CA  
4884 C C   . ILE B 319 ? 0.4736 0.5203 0.5418 -0.0131 -0.0038 0.0280  320 ILE B C   
4885 O O   . ILE B 319 ? 0.4565 0.5116 0.5294 -0.0076 -0.0046 0.0261  320 ILE B O   
4886 C CB  . ILE B 319 ? 0.4840 0.5204 0.5526 -0.0175 -0.0111 0.0319  320 ILE B CB  
4887 C CG1 . ILE B 319 ? 0.4983 0.5314 0.5687 -0.0185 -0.0138 0.0328  320 ILE B CG1 
4888 C CG2 . ILE B 319 ? 0.4693 0.5114 0.5456 -0.0141 -0.0115 0.0300  320 ILE B CG2 
4889 C CD1 . ILE B 319 ? 0.5205 0.5527 0.5938 -0.0203 -0.0205 0.0352  320 ILE B CD1 
4890 N N   . ARG B 320 ? 0.4775 0.5235 0.5438 -0.0179 -0.0011 0.0275  321 ARG B N   
4891 C CA  . ARG B 320 ? 0.4853 0.5429 0.5606 -0.0179 0.0022  0.0239  321 ARG B CA  
4892 C C   . ARG B 320 ? 0.4859 0.5537 0.5654 -0.0092 0.0037  0.0217  321 ARG B C   
4893 O O   . ARG B 320 ? 0.5245 0.6078 0.6152 -0.0057 0.0014  0.0177  321 ARG B O   
4894 C CB  . ARG B 320 ? 0.5045 0.5574 0.5752 -0.0244 0.0087  0.0245  321 ARG B CB  
4895 C CG  . ARG B 320 ? 0.5124 0.5594 0.5839 -0.0317 0.0092  0.0263  321 ARG B CG  
4896 C CD  . ARG B 320 ? 0.5326 0.5773 0.6021 -0.0378 0.0191  0.0264  321 ARG B CD  
4897 N NE  . ARG B 320 ? 0.5593 0.5923 0.6090 -0.0382 0.0229  0.0299  321 ARG B NE  
4898 C CZ  . ARG B 320 ? 0.6035 0.6205 0.6337 -0.0403 0.0203  0.0359  321 ARG B CZ  
4899 N NH1 . ARG B 320 ? 0.5853 0.5953 0.6150 -0.0411 0.0143  0.0405  321 ARG B NH1 
4900 N NH2 . ARG B 320 ? 0.6270 0.6352 0.6374 -0.0408 0.0231  0.0367  321 ARG B NH2 
4901 N N   . LYS B 321 ? 0.4852 0.5439 0.5558 -0.0054 0.0070  0.0238  322 LYS B N   
4902 C CA  . LYS B 321 ? 0.5100 0.5730 0.5820 0.0050  0.0096  0.0239  322 LYS B CA  
4903 C C   . LYS B 321 ? 0.5347 0.5966 0.6037 0.0122  0.0055  0.0267  322 LYS B C   
4904 O O   . LYS B 321 ? 0.5194 0.5923 0.5914 0.0221  0.0031  0.0266  322 LYS B O   
4905 C CB  . LYS B 321 ? 0.5200 0.5687 0.5825 0.0055  0.0170  0.0245  322 LYS B CB  
4906 C CG  . LYS B 321 ? 0.5358 0.5838 0.5990 0.0178  0.0220  0.0256  322 LYS B CG  
4907 C CD  . LYS B 321 ? 0.5501 0.6144 0.6255 0.0232  0.0253  0.0223  322 LYS B CD  
4908 C CE  . LYS B 321 ? 0.5647 0.6247 0.6396 0.0373  0.0311  0.0243  322 LYS B CE  
4909 N NZ  . LYS B 321 ? 0.6029 0.6792 0.6925 0.0430  0.0361  0.0203  322 LYS B NZ  
4910 N N   . PHE B 322 ? 0.5398 0.5895 0.6025 0.0078  0.0049  0.0291  323 PHE B N   
4911 C CA  . PHE B 322 ? 0.5597 0.6054 0.6181 0.0136  0.0045  0.0322  323 PHE B CA  
4912 C C   . PHE B 322 ? 0.5627 0.6121 0.6244 0.0094  -0.0002 0.0309  323 PHE B C   
4913 O O   . PHE B 322 ? 0.5897 0.6332 0.6538 0.0021  -0.0010 0.0311  323 PHE B O   
4914 C CB  . PHE B 322 ? 0.5728 0.6008 0.6242 0.0132  0.0115  0.0354  323 PHE B CB  
4915 C CG  . PHE B 322 ? 0.5984 0.6189 0.6455 0.0188  0.0181  0.0362  323 PHE B CG  
4916 C CD1 . PHE B 322 ? 0.6087 0.6300 0.6517 0.0325  0.0205  0.0402  323 PHE B CD1 
4917 C CD2 . PHE B 322 ? 0.6070 0.6194 0.6526 0.0117  0.0216  0.0327  323 PHE B CD2 
4918 C CE1 . PHE B 322 ? 0.6241 0.6375 0.6647 0.0396  0.0274  0.0413  323 PHE B CE1 
4919 C CE2 . PHE B 322 ? 0.6449 0.6485 0.6866 0.0172  0.0293  0.0322  323 PHE B CE2 
4920 C CZ  . PHE B 322 ? 0.6421 0.6459 0.6829 0.0315  0.0327  0.0368  323 PHE B CZ  
4921 N N   . TYR B 323 ? 0.5203 0.5802 0.5824 0.0150  -0.0041 0.0289  324 TYR B N   
4922 C CA  . TYR B 323 ? 0.5290 0.5897 0.5913 0.0136  -0.0065 0.0271  324 TYR B CA  
4923 C C   . TYR B 323 ? 0.5608 0.6083 0.6182 0.0137  -0.0007 0.0317  324 TYR B C   
4924 O O   . TYR B 323 ? 0.6198 0.6594 0.6685 0.0197  0.0050  0.0363  324 TYR B O   
4925 C CB  . TYR B 323 ? 0.5175 0.5897 0.5747 0.0220  -0.0108 0.0237  324 TYR B CB  
4926 C CG  . TYR B 323 ? 0.5097 0.5833 0.5661 0.0201  -0.0131 0.0189  324 TYR B CG  
4927 C CD1 . TYR B 323 ? 0.5062 0.5695 0.5537 0.0229  -0.0078 0.0221  324 TYR B CD1 
4928 C CD2 . TYR B 323 ? 0.4973 0.5816 0.5629 0.0149  -0.0187 0.0101  324 TYR B CD2 
4929 C CE1 . TYR B 323 ? 0.5057 0.5694 0.5522 0.0219  -0.0082 0.0167  324 TYR B CE1 
4930 C CE2 . TYR B 323 ? 0.4949 0.5778 0.5594 0.0131  -0.0196 0.0041  324 TYR B CE2 
4931 C CZ  . TYR B 323 ? 0.5053 0.5781 0.5595 0.0173  -0.0145 0.0074  324 TYR B CZ  
4932 O OH  . TYR B 323 ? 0.5003 0.5711 0.5532 0.0161  -0.0140 0.0005  324 TYR B OH  
4933 N N   . THR B 324 ? 0.5317 0.5769 0.5966 0.0073  -0.0013 0.0305  325 THR B N   
4934 C CA  . THR B 324 ? 0.5239 0.5609 0.5915 0.0052  0.0041  0.0331  325 THR B CA  
4935 C C   . THR B 324 ? 0.5158 0.5537 0.5852 0.0073  0.0066  0.0317  325 THR B C   
4936 O O   . THR B 324 ? 0.5091 0.5519 0.5834 0.0062  0.0022  0.0278  325 THR B O   
4937 C CB  . THR B 324 ? 0.5136 0.5495 0.5913 -0.0030 0.0008  0.0326  325 THR B CB  
4938 O OG1 . THR B 324 ? 0.5252 0.5594 0.5981 -0.0050 -0.0006 0.0327  325 THR B OG1 
4939 C CG2 . THR B 324 ? 0.4807 0.5123 0.5658 -0.0062 0.0057  0.0334  325 THR B CG2 
4940 N N   . GLU B 325 ? 0.5224 0.5535 0.5873 0.0102  0.0156  0.0348  326 GLU B N   
4941 C CA  . GLU B 325 ? 0.5488 0.5796 0.6160 0.0117  0.0213  0.0334  326 GLU B CA  
4942 C C   . GLU B 325 ? 0.5479 0.5763 0.6312 0.0058  0.0284  0.0344  326 GLU B C   
4943 O O   . GLU B 325 ? 0.5843 0.6053 0.6672 0.0035  0.0351  0.0376  326 GLU B O   
4944 C CB  . GLU B 325 ? 0.5858 0.6115 0.6318 0.0209  0.0278  0.0356  326 GLU B CB  
4945 C CG  . GLU B 325 ? 0.5998 0.6219 0.6441 0.0227  0.0380  0.0347  326 GLU B CG  
4946 C CD  . GLU B 325 ? 0.6556 0.6698 0.6722 0.0327  0.0452  0.0384  326 GLU B CD  
4947 O OE1 . GLU B 325 ? 0.6950 0.7149 0.6969 0.0386  0.0383  0.0338  326 GLU B OE1 
4948 O OE2 . GLU B 325 ? 0.6648 0.6664 0.6732 0.0346  0.0579  0.0457  326 GLU B OE2 
4949 N N   . PHE B 326 ? 0.5243 0.5594 0.6240 0.0035  0.0269  0.0310  327 PHE B N   
4950 C CA  . PHE B 326 ? 0.5017 0.5408 0.6229 -0.0015 0.0319  0.0302  327 PHE B CA  
4951 C C   . PHE B 326 ? 0.5017 0.5388 0.6240 0.0017  0.0455  0.0298  327 PHE B C   
4952 O O   . PHE B 326 ? 0.5026 0.5420 0.6237 0.0064  0.0456  0.0268  327 PHE B O   
4953 C CB  . PHE B 326 ? 0.4732 0.5228 0.6136 -0.0041 0.0206  0.0276  327 PHE B CB  
4954 C CG  . PHE B 326 ? 0.4567 0.5066 0.5927 -0.0077 0.0090  0.0286  327 PHE B CG  
4955 C CD1 . PHE B 326 ? 0.4394 0.4862 0.5618 -0.0054 0.0024  0.0293  327 PHE B CD1 
4956 C CD2 . PHE B 326 ? 0.4448 0.4980 0.5900 -0.0141 0.0057  0.0277  327 PHE B CD2 
4957 C CE1 . PHE B 326 ? 0.4543 0.5002 0.5713 -0.0089 -0.0053 0.0305  327 PHE B CE1 
4958 C CE2 . PHE B 326 ? 0.4338 0.4858 0.5706 -0.0171 -0.0037 0.0280  327 PHE B CE2 
4959 C CZ  . PHE B 326 ? 0.4410 0.4886 0.5630 -0.0141 -0.0083 0.0302  327 PHE B CZ  
4960 N N   . ASP B 327 ? 0.4987 0.5291 0.6219 -0.0009 0.0587  0.0325  328 ASP B N   
4961 C CA  . ASP B 327 ? 0.5345 0.5588 0.6531 0.0019  0.0761  0.0338  328 ASP B CA  
4962 C C   . ASP B 327 ? 0.5361 0.5709 0.6883 -0.0048 0.0847  0.0299  328 ASP B C   
4963 O O   . ASP B 327 ? 0.5724 0.6060 0.7388 -0.0130 0.0920  0.0301  328 ASP B O   
4964 C CB  . ASP B 327 ? 0.5548 0.5607 0.6476 0.0048  0.0877  0.0411  328 ASP B CB  
4965 C CG  . ASP B 327 ? 0.5880 0.5828 0.6651 0.0100  0.1069  0.0447  328 ASP B CG  
4966 O OD1 . ASP B 327 ? 0.6079 0.6097 0.6985 0.0094  0.1147  0.0404  328 ASP B OD1 
4967 O OD2 . ASP B 327 ? 0.6229 0.6004 0.6718 0.0159  0.1152  0.0525  328 ASP B OD2 
4968 N N   . ARG B 328 ? 0.5058 0.5513 0.6726 -0.0015 0.0842  0.0255  329 ARG B N   
4969 C CA  . ARG B 328 ? 0.5063 0.5662 0.7091 -0.0056 0.0924  0.0210  329 ARG B CA  
4970 C C   . ARG B 328 ? 0.5166 0.5689 0.7195 -0.0071 0.1175  0.0223  329 ARG B C   
4971 O O   . ARG B 328 ? 0.4925 0.5561 0.7281 -0.0145 0.1272  0.0189  329 ARG B O   
4972 C CB  . ARG B 328 ? 0.4943 0.5665 0.7134 0.0005  0.0844  0.0164  329 ARG B CB  
4973 C CG  . ARG B 328 ? 0.4776 0.5610 0.7106 0.0002  0.0627  0.0155  329 ARG B CG  
4974 C CD  . ARG B 328 ? 0.4837 0.5852 0.7501 -0.0071 0.0571  0.0129  329 ARG B CD  
4975 N NE  . ARG B 328 ? 0.5024 0.6203 0.8044 -0.0078 0.0686  0.0081  329 ARG B NE  
4976 C CZ  . ARG B 328 ? 0.5236 0.6582 0.8532 -0.0011 0.0631  0.0051  329 ARG B CZ  
4977 N NH1 . ARG B 328 ? 0.5133 0.6467 0.8362 0.0068  0.0467  0.0073  329 ARG B NH1 
4978 N NH2 . ARG B 328 ? 0.5311 0.6829 0.8962 -0.0018 0.0754  0.0001  329 ARG B NH2 
4979 N N   . ARG B 329 ? 0.5395 0.5736 0.7060 -0.0002 0.1281  0.0269  330 ARG B N   
4980 C CA  . ARG B 329 ? 0.5786 0.6000 0.7357 -0.0005 0.1538  0.0304  330 ARG B CA  
4981 C C   . ARG B 329 ? 0.5985 0.6099 0.7611 -0.0100 0.1648  0.0352  330 ARG B C   
4982 O O   . ARG B 329 ? 0.5792 0.5899 0.7611 -0.0170 0.1857  0.0346  330 ARG B O   
4983 C CB  . ARG B 329 ? 0.6015 0.6043 0.7108 0.0107  0.1596  0.0350  330 ARG B CB  
4984 C CG  . ARG B 329 ? 0.6193 0.6029 0.7066 0.0126  0.1871  0.0416  330 ARG B CG  
4985 C CD  . ARG B 329 ? 0.6175 0.6098 0.7331 0.0088  0.2078  0.0363  330 ARG B CD  
4986 N NE  . ARG B 329 ? 0.6615 0.6337 0.7592 0.0080  0.2375  0.0437  330 ARG B NE  
4987 C CZ  . ARG B 329 ? 0.6697 0.6354 0.7862 -0.0028 0.2542  0.0478  330 ARG B CZ  
4988 N NH1 . ARG B 329 ? 0.6367 0.6164 0.7906 -0.0140 0.2424  0.0438  330 ARG B NH1 
4989 N NH2 . ARG B 329 ? 0.6931 0.6366 0.7892 -0.0028 0.2838  0.0556  330 ARG B NH2 
4990 N N   . ASN B 330 ? 0.6074 0.6108 0.7548 -0.0106 0.1516  0.0389  331 ASN B N   
4991 C CA  . ASN B 330 ? 0.6207 0.6085 0.7660 -0.0180 0.1616  0.0436  331 ASN B CA  
4992 C C   . ASN B 330 ? 0.6215 0.6213 0.7960 -0.0295 0.1482  0.0372  331 ASN B C   
4993 O O   . ASN B 330 ? 0.6631 0.6479 0.8354 -0.0363 0.1557  0.0393  331 ASN B O   
4994 C CB  . ASN B 330 ? 0.6354 0.5993 0.7349 -0.0076 0.1616  0.0538  331 ASN B CB  
4995 C CG  . ASN B 330 ? 0.6762 0.6242 0.7417 0.0030  0.1778  0.0611  331 ASN B CG  
4996 O OD1 . ASN B 330 ? 0.7052 0.6484 0.7778 -0.0002 0.1997  0.0617  331 ASN B OD1 
4997 N ND2 . ASN B 330 ? 0.6833 0.6237 0.7110 0.0161  0.1674  0.0661  331 ASN B ND2 
4998 N N   . ASN B 331 ? 0.5929 0.6175 0.7925 -0.0311 0.1292  0.0294  332 ASN B N   
4999 C CA  . ASN B 331 ? 0.5757 0.6137 0.7978 -0.0402 0.1128  0.0227  332 ASN B CA  
5000 C C   . ASN B 331 ? 0.5687 0.5887 0.7660 -0.0409 0.1077  0.0264  332 ASN B C   
5001 O O   . ASN B 331 ? 0.5618 0.5741 0.7681 -0.0512 0.1141  0.0236  332 ASN B O   
5002 C CB  . ASN B 331 ? 0.5677 0.6207 0.8321 -0.0538 0.1210  0.0142  332 ASN B CB  
5003 C CG  . ASN B 331 ? 0.5563 0.6397 0.8564 -0.0528 0.1118  0.0071  332 ASN B CG  
5004 O OD1 . ASN B 331 ? 0.5405 0.6327 0.8346 -0.0434 0.0951  0.0080  332 ASN B OD1 
5005 N ND2 . ASN B 331 ? 0.5868 0.6862 0.9262 -0.0622 0.1237  0.0000  332 ASN B ND2 
5006 N N   . ARG B 332 ? 0.5523 0.5655 0.7198 -0.0302 0.0973  0.0318  333 ARG B N   
5007 C CA  . ARG B 332 ? 0.5448 0.5422 0.6878 -0.0277 0.0929  0.0359  333 ARG B CA  
5008 C C   . ARG B 332 ? 0.5453 0.5498 0.6730 -0.0195 0.0743  0.0367  333 ARG B C   
5009 O O   . ARG B 332 ? 0.5317 0.5480 0.6620 -0.0148 0.0674  0.0353  333 ARG B O   
5010 C CB  . ARG B 332 ? 0.5327 0.5044 0.6489 -0.0214 0.1114  0.0454  333 ARG B CB  
5011 C CG  . ARG B 332 ? 0.5188 0.4870 0.6113 -0.0089 0.1160  0.0515  333 ARG B CG  
5012 C CD  . ARG B 332 ? 0.5300 0.4716 0.5916 -0.0008 0.1333  0.0625  333 ARG B CD  
5013 N NE  . ARG B 332 ? 0.5368 0.4777 0.5686 0.0133  0.1301  0.0672  333 ARG B NE  
5014 C CZ  . ARG B 332 ? 0.5797 0.5012 0.5761 0.0256  0.1385  0.0776  333 ARG B CZ  
5015 N NH1 . ARG B 332 ? 0.5870 0.5129 0.5578 0.0378  0.1320  0.0789  333 ARG B NH1 
5016 N NH2 . ARG B 332 ? 0.6237 0.5205 0.6090 0.0263  0.1532  0.0865  333 ARG B NH2 
5017 N N   . ILE B 333 ? 0.5787 0.5751 0.6921 -0.0185 0.0681  0.0382  334 ILE B N   
5018 C CA  . ILE B 333 ? 0.5692 0.5716 0.6695 -0.0122 0.0532  0.0386  334 ILE B CA  
5019 C C   . ILE B 333 ? 0.6035 0.5920 0.6775 -0.0024 0.0567  0.0451  334 ILE B C   
5020 O O   . ILE B 333 ? 0.6142 0.5878 0.6818 -0.0031 0.0643  0.0477  334 ILE B O   
5021 C CB  . ILE B 333 ? 0.5551 0.5664 0.6665 -0.0196 0.0399  0.0330  334 ILE B CB  
5022 C CG1 . ILE B 333 ? 0.5332 0.5612 0.6696 -0.0256 0.0334  0.0276  334 ILE B CG1 
5023 C CG2 . ILE B 333 ? 0.5437 0.5587 0.6415 -0.0141 0.0284  0.0341  334 ILE B CG2 
5024 C CD1 . ILE B 333 ? 0.5222 0.5582 0.6694 -0.0336 0.0220  0.0218  334 ILE B CD1 
5025 N N   . GLY B 334 ? 0.5936 0.5876 0.6539 0.0068  0.0512  0.0470  335 GLY B N   
5026 C CA  . GLY B 334 ? 0.5751 0.5634 0.6132 0.0180  0.0499  0.0521  335 GLY B CA  
5027 C C   . GLY B 334 ? 0.5553 0.5541 0.5953 0.0183  0.0368  0.0487  335 GLY B C   
5028 O O   . GLY B 334 ? 0.5388 0.5508 0.5891 0.0137  0.0270  0.0434  335 GLY B O   
5029 N N   . PHE B 335 ? 0.5405 0.5318 0.5711 0.0239  0.0384  0.0521  336 PHE B N   
5030 C CA  . PHE B 335 ? 0.5271 0.5287 0.5590 0.0260  0.0288  0.0493  336 PHE B CA  
5031 C C   . PHE B 335 ? 0.5528 0.5573 0.5703 0.0406  0.0269  0.0535  336 PHE B C   
5032 O O   . PHE B 335 ? 0.5912 0.5819 0.5939 0.0502  0.0350  0.0609  336 PHE B O   
5033 C CB  . PHE B 335 ? 0.5134 0.5065 0.5503 0.0200  0.0317  0.0476  336 PHE B CB  
5034 C CG  . PHE B 335 ? 0.5125 0.5073 0.5626 0.0064  0.0293  0.0420  336 PHE B CG  
5035 C CD1 . PHE B 335 ? 0.5067 0.5154 0.5647 0.0011  0.0189  0.0379  336 PHE B CD1 
5036 C CD2 . PHE B 335 ? 0.5344 0.5164 0.5892 -0.0009 0.0373  0.0405  336 PHE B CD2 
5037 C CE1 . PHE B 335 ? 0.5005 0.5113 0.5682 -0.0088 0.0149  0.0339  336 PHE B CE1 
5038 C CE2 . PHE B 335 ? 0.5177 0.5052 0.5854 -0.0126 0.0324  0.0342  336 PHE B CE2 
5039 C CZ  . PHE B 335 ? 0.5078 0.5102 0.5807 -0.0154 0.0203  0.0316  336 PHE B CZ  
5040 N N   . ALA B 336 ? 0.5487 0.5717 0.5712 0.0426  0.0162  0.0487  337 ALA B N   
5041 C CA  . ALA B 336 ? 0.5508 0.5838 0.5664 0.0561  0.0112  0.0503  337 ALA B CA  
5042 C C   . ALA B 336 ? 0.5396 0.5906 0.5711 0.0515  0.0035  0.0431  337 ALA B C   
5043 O O   . ALA B 336 ? 0.5366 0.5928 0.5792 0.0393  0.0007  0.0375  337 ALA B O   
5044 C CB  . ALA B 336 ? 0.5428 0.5846 0.5458 0.0649  0.0057  0.0503  337 ALA B CB  
5045 N N   . LEU B 337 ? 0.5605 0.6204 0.5936 0.0619  0.0015  0.0439  338 LEU B N   
5046 C CA  . LEU B 337 ? 0.5556 0.6331 0.6059 0.0580  -0.0025 0.0371  338 LEU B CA  
5047 C C   . LEU B 337 ? 0.5558 0.6539 0.6168 0.0511  -0.0120 0.0285  338 LEU B C   
5048 O O   . LEU B 337 ? 0.5517 0.6624 0.6084 0.0584  -0.0197 0.0263  338 LEU B O   
5049 C CB  . LEU B 337 ? 0.5785 0.6646 0.6311 0.0731  -0.0028 0.0395  338 LEU B CB  
5050 C CG  . LEU B 337 ? 0.6142 0.7150 0.6855 0.0720  -0.0017 0.0341  338 LEU B CG  
5051 C CD1 . LEU B 337 ? 0.5785 0.6625 0.6510 0.0601  0.0084  0.0331  338 LEU B CD1 
5052 C CD2 . LEU B 337 ? 0.6563 0.7632 0.7276 0.0919  -0.0019 0.0387  338 LEU B CD2 
5053 N N   . ALA B 338 ? 0.5446 0.6435 0.6171 0.0371  -0.0108 0.0237  339 ALA B N   
5054 C CA  . ALA B 338 ? 0.5417 0.6542 0.6253 0.0283  -0.0167 0.0156  339 ALA B CA  
5055 C C   . ALA B 338 ? 0.5619 0.7005 0.6623 0.0307  -0.0221 0.0077  339 ALA B C   
5056 O O   . ALA B 338 ? 0.5663 0.7128 0.6742 0.0364  -0.0195 0.0086  339 ALA B O   
5057 C CB  . ALA B 338 ? 0.5222 0.6238 0.6104 0.0142  -0.0123 0.0152  339 ALA B CB  
5058 N N   . ARG B 339 ? 0.5780 0.7307 0.6860 0.0262  -0.0292 -0.0010 340 ARG B N   
5059 C CA  . ARG B 339 ? 0.5977 0.7776 0.7280 0.0231  -0.0344 -0.0121 340 ARG B CA  
5060 C C   . ARG B 339 ? 0.6231 0.8035 0.7615 0.0091  -0.0360 -0.0216 340 ARG B C   
5061 O O   . ARG B 339 ? 0.6680 0.8671 0.8278 0.0011  -0.0379 -0.0326 340 ARG B O   
5062 C CB  . ARG B 339 ? 0.5868 0.7907 0.7178 0.0386  -0.0453 -0.0153 340 ARG B CB  
5063 C CG  . ARG B 339 ? 0.5901 0.7933 0.7018 0.0456  -0.0542 -0.0168 340 ARG B CG  
5064 C CD  . ARG B 339 ? 0.6409 0.8676 0.7488 0.0633  -0.0663 -0.0185 340 ARG B CD  
5065 N NE  . ARG B 339 ? 0.6853 0.9062 0.7666 0.0710  -0.0729 -0.0182 340 ARG B NE  
5066 C CZ  . ARG B 339 ? 0.6912 0.9329 0.7720 0.0715  -0.0857 -0.0311 340 ARG B CZ  
5067 N NH1 . ARG B 339 ? 0.7009 0.9733 0.8103 0.0640  -0.0943 -0.0465 340 ARG B NH1 
5068 N NH2 . ARG B 339 ? 0.6950 0.9267 0.7462 0.0790  -0.0891 -0.0296 340 ARG B NH2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   2   2   THR THR A . n 
A 1 2   LEU 2   3   3   LEU LEU A . n 
A 1 3   GLY 3   4   4   GLY GLY A . n 
A 1 4   ASN 4   5   5   ASN ASN A . n 
A 1 5   THR 5   6   6   THR THR A . n 
A 1 6   THR 6   7   7   THR THR A . n 
A 1 7   SER 7   8   8   SER SER A . n 
A 1 8   SER 8   9   9   SER SER A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  ILE 10  11  11  ILE ILE A . n 
A 1 11  LEU 11  12  12  LEU LEU A . n 
A 1 12  THR 12  13  13  THR THR A . n 
A 1 13  ASN 13  14  14  ASN ASN A . n 
A 1 14  TYR 14  15  15  TYR TYR A . n 
A 1 15  MET 15  16  16  MET MET A . n 
A 1 16  ASP 16  17  17  ASP ASP A . n 
A 1 17  THR 17  18  18  THR THR A . n 
A 1 18  GLN 18  19  19  GLN GLN A . n 
A 1 19  TYR 19  20  20  TYR TYR A . n 
A 1 20  TYR 20  21  21  TYR TYR A . n 
A 1 21  GLY 21  22  22  GLY GLY A . n 
A 1 22  GLU 22  23  23  GLU GLU A . n 
A 1 23  ILE 23  24  24  ILE ILE A . n 
A 1 24  GLY 24  25  25  GLY GLY A . n 
A 1 25  ILE 25  26  26  ILE ILE A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  THR 27  28  28  THR THR A . n 
A 1 28  PRO 28  29  29  PRO PRO A . n 
A 1 29  PRO 29  30  30  PRO PRO A . n 
A 1 30  GLN 30  31  31  GLN GLN A . n 
A 1 31  THR 31  32  32  THR THR A . n 
A 1 32  PHE 32  33  33  PHE PHE A . n 
A 1 33  LYS 33  34  34  LYS LYS A . n 
A 1 34  VAL 34  35  35  VAL VAL A . n 
A 1 35  VAL 35  36  36  VAL VAL A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ASP 37  38  38  ASP ASP A . n 
A 1 38  THR 38  39  39  THR THR A . n 
A 1 39  GLY 39  40  40  GLY GLY A . n 
A 1 40  SER 40  41  41  SER SER A . n 
A 1 41  SER 41  42  42  SER SER A . n 
A 1 42  ASN 42  43  43  ASN ASN A . n 
A 1 43  VAL 43  44  44  VAL VAL A . n 
A 1 44  TRP 44  45  45  TRP TRP A . n 
A 1 45  VAL 45  46  46  VAL VAL A . n 
A 1 46  PRO 46  47  47  PRO PRO A . n 
A 1 47  SER 47  48  48  SER SER A . n 
A 1 48  SER 48  49  49  SER SER A . n 
A 1 49  LYS 49  50  50  LYS LYS A . n 
A 1 50  CYS 50  51  51  CYS CYS A . n 
A 1 51  SER 51  52  52  SER SER A . n 
A 1 52  ARG 52  53  53  ARG ARG A . n 
A 1 53  LEU 53  54  54  LEU LEU A . n 
A 1 54  TYR 54  55  55  TYR TYR A . n 
A 1 55  THR 55  56  56  THR THR A . n 
A 1 56  ALA 56  57  57  ALA ALA A . n 
A 1 57  CYS 57  58  58  CYS CYS A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  TYR 59  60  60  TYR TYR A . n 
A 1 60  HIS 60  61  61  HIS HIS A . n 
A 1 61  LYS 61  62  62  LYS LYS A . n 
A 1 62  LEU 62  63  63  LEU LEU A . n 
A 1 63  PHE 63  64  64  PHE PHE A . n 
A 1 64  ASP 64  65  65  ASP ASP A . n 
A 1 65  ALA 65  66  66  ALA ALA A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  ASP 67  68  68  ASP ASP A . n 
A 1 68  SER 68  69  69  SER SER A . n 
A 1 69  SER 69  70  70  SER SER A . n 
A 1 70  SER 70  71  71  SER SER A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  LYS 72  73  73  LYS LYS A . n 
A 1 73  HIS 73  74  74  HIS HIS A . n 
A 1 74  ASN 74  75  75  ASN ASN A . n 
A 1 75  GLY 75  76  76  GLY GLY A . n 
A 1 76  THR 76  77  77  THR THR A . n 
A 1 77  GLU 77  78  78  GLU GLU A . n 
A 1 78  LEU 78  79  79  LEU LEU A . n 
A 1 79  THR 79  80  80  THR THR A . n 
A 1 80  LEU 80  81  81  LEU LEU A . n 
A 1 81  ARG 81  82  82  ARG ARG A . n 
A 1 82  TYR 82  83  83  TYR TYR A . n 
A 1 83  SER 83  84  84  SER SER A . n 
A 1 84  THR 84  85  85  THR THR A . n 
A 1 85  GLY 85  86  86  GLY GLY A . n 
A 1 86  THR 86  87  87  THR THR A . n 
A 1 87  VAL 87  88  88  VAL VAL A . n 
A 1 88  SER 88  89  89  SER SER A . n 
A 1 89  GLY 89  90  90  GLY GLY A . n 
A 1 90  PHE 90  91  91  PHE PHE A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLN 93  94  94  GLN GLN A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  ILE 95  96  96  ILE ILE A . n 
A 1 96  ILE 96  97  97  ILE ILE A . n 
A 1 97  THR 97  98  98  THR THR A . n 
A 1 98  VAL 98  99  99  VAL VAL A . n 
A 1 99  GLY 99  100 100 GLY GLY A . n 
A 1 100 GLY 100 101 101 GLY GLY A . n 
A 1 101 ILE 101 102 102 ILE ILE A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 VAL 103 104 104 VAL VAL A . n 
A 1 104 THR 104 105 105 THR THR A . n 
A 1 105 GLN 105 106 106 GLN GLN A . n 
A 1 106 MET 106 107 107 MET MET A . n 
A 1 107 PHE 107 108 108 PHE PHE A . n 
A 1 108 GLY 108 109 109 GLY GLY A . n 
A 1 109 GLU 109 110 110 GLU GLU A . n 
A 1 110 VAL 110 111 111 VAL VAL A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 GLU 112 113 113 GLU GLU A . n 
A 1 113 MET 113 114 114 MET MET A . n 
A 1 114 PRO 114 115 115 PRO PRO A . n 
A 1 115 ALA 115 116 116 ALA ALA A . n 
A 1 116 LEU 116 117 117 LEU LEU A . n 
A 1 117 PRO 117 118 118 PRO PRO A . n 
A 1 118 PHE 118 119 119 PHE PHE A . n 
A 1 119 MET 119 120 120 MET MET A . n 
A 1 120 LEU 120 121 121 LEU LEU A . n 
A 1 121 ALA 121 122 122 ALA ALA A . n 
A 1 122 GLU 122 123 123 GLU GLU A . n 
A 1 123 PHE 123 124 124 PHE PHE A . n 
A 1 124 ASP 124 125 125 ASP ASP A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 VAL 126 127 127 VAL VAL A . n 
A 1 127 VAL 127 128 128 VAL VAL A . n 
A 1 128 GLY 128 129 129 GLY GLY A . n 
A 1 129 MET 129 130 130 MET MET A . n 
A 1 130 GLY 130 131 131 GLY GLY A . n 
A 1 131 PHE 131 132 132 PHE PHE A . n 
A 1 132 ILE 132 133 133 ILE ILE A . n 
A 1 133 GLU 133 134 134 GLU GLU A . n 
A 1 134 GLN 134 135 135 GLN GLN A . n 
A 1 135 ALA 135 136 136 ALA ALA A . n 
A 1 136 ILE 136 137 137 ILE ILE A . n 
A 1 137 GLY 137 138 138 GLY GLY A . n 
A 1 138 ARG 138 139 139 ARG ARG A . n 
A 1 139 VAL 139 140 140 VAL VAL A . n 
A 1 140 THR 140 141 141 THR THR A . n 
A 1 141 PRO 141 142 142 PRO PRO A . n 
A 1 142 ILE 142 143 143 ILE ILE A . n 
A 1 143 PHE 143 144 144 PHE PHE A . n 
A 1 144 ASP 144 145 145 ASP ASP A . n 
A 1 145 ASN 145 146 146 ASN ASN A . n 
A 1 146 ILE 146 147 147 ILE ILE A . n 
A 1 147 ILE 147 148 148 ILE ILE A . n 
A 1 148 SER 148 149 149 SER SER A . n 
A 1 149 GLN 149 150 150 GLN GLN A . n 
A 1 150 GLY 150 151 151 GLY GLY A . n 
A 1 151 VAL 151 152 152 VAL VAL A . n 
A 1 152 LEU 152 153 153 LEU LEU A . n 
A 1 153 LYS 153 154 154 LYS LYS A . n 
A 1 154 GLU 154 155 155 GLU GLU A . n 
A 1 155 ASP 155 156 156 ASP ASP A . n 
A 1 156 VAL 156 157 157 VAL VAL A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 SER 158 159 159 SER SER A . n 
A 1 159 PHE 159 160 160 PHE PHE A . n 
A 1 160 TYR 160 161 161 TYR TYR A . n 
A 1 161 TYR 161 162 162 TYR TYR A . n 
A 1 162 ASN 162 163 163 ASN ASN A . n 
A 1 163 ARG 163 164 164 ARG ARG A . n 
A 1 164 ASP 164 165 165 ASP ASP A . n 
A 1 165 SER 165 166 ?   ?   ?   A . n 
A 1 166 GLU 166 167 ?   ?   ?   A . n 
A 1 167 ASN 167 168 ?   ?   ?   A . n 
A 1 168 SER 168 169 169 SER SER A . n 
A 1 169 GLN 169 170 170 GLN GLN A . n 
A 1 170 SER 170 171 171 SER SER A . n 
A 1 171 LEU 171 172 172 LEU LEU A . n 
A 1 172 GLY 172 173 173 GLY GLY A . n 
A 1 173 GLY 173 174 174 GLY GLY A . n 
A 1 174 GLN 174 175 175 GLN GLN A . n 
A 1 175 ILE 175 176 176 ILE ILE A . n 
A 1 176 VAL 176 177 177 VAL VAL A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 GLY 178 179 179 GLY GLY A . n 
A 1 179 GLY 179 180 180 GLY GLY A . n 
A 1 180 SER 180 181 181 SER SER A . n 
A 1 181 ASP 181 182 182 ASP ASP A . n 
A 1 182 PRO 182 183 183 PRO PRO A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 HIS 184 185 185 HIS HIS A . n 
A 1 185 TYR 185 186 186 TYR TYR A . n 
A 1 186 GLU 186 187 187 GLU GLU A . n 
A 1 187 GLY 187 188 188 GLY GLY A . n 
A 1 188 ASN 188 189 189 ASN ASN A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 HIS 190 191 191 HIS HIS A . n 
A 1 191 TYR 191 192 192 TYR TYR A . n 
A 1 192 ILE 192 193 193 ILE ILE A . n 
A 1 193 ASN 193 194 194 ASN ASN A . n 
A 1 194 LEU 194 195 195 LEU LEU A . n 
A 1 195 ILE 195 196 196 ILE ILE A . n 
A 1 196 LYS 196 197 197 LYS LYS A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 GLY 198 199 199 GLY GLY A . n 
A 1 199 VAL 199 200 200 VAL VAL A . n 
A 1 200 TRP 200 201 201 TRP TRP A . n 
A 1 201 GLN 201 202 202 GLN GLN A . n 
A 1 202 ILE 202 203 203 ILE ILE A . n 
A 1 203 GLN 203 204 204 GLN GLN A . n 
A 1 204 MET 204 205 205 MET MET A . n 
A 1 205 LYS 205 206 206 LYS LYS A . n 
A 1 206 GLY 206 207 207 GLY GLY A . n 
A 1 207 VAL 207 208 208 VAL VAL A . n 
A 1 208 SER 208 209 209 SER SER A . n 
A 1 209 VAL 209 210 210 VAL VAL A . n 
A 1 210 GLY 210 211 211 GLY GLY A . n 
A 1 211 SER 211 212 ?   ?   ?   A . n 
A 1 212 SER 212 213 ?   ?   ?   A . n 
A 1 213 THR 213 214 214 THR THR A . n 
A 1 214 LEU 214 215 215 LEU LEU A . n 
A 1 215 LEU 215 216 216 LEU LEU A . n 
A 1 216 CYS 216 217 217 CYS CYS A . n 
A 1 217 GLU 217 218 218 GLU GLU A . n 
A 1 218 ASP 218 219 219 ASP ASP A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 CYS 220 221 221 CYS CYS A . n 
A 1 221 LEU 221 222 222 LEU LEU A . n 
A 1 222 ALA 222 223 223 ALA ALA A . n 
A 1 223 LEU 223 224 224 LEU LEU A . n 
A 1 224 VAL 224 225 225 VAL VAL A . n 
A 1 225 ASP 225 226 226 ASP ASP A . n 
A 1 226 THR 226 227 227 THR THR A . n 
A 1 227 GLY 227 228 228 GLY GLY A . n 
A 1 228 ALA 228 229 229 ALA ALA A . n 
A 1 229 SER 229 230 230 SER SER A . n 
A 1 230 TYR 230 231 231 TYR TYR A . n 
A 1 231 ILE 231 232 232 ILE ILE A . n 
A 1 232 SER 232 233 233 SER SER A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 SER 234 235 235 SER SER A . n 
A 1 235 THR 235 236 236 THR THR A . n 
A 1 236 SER 236 237 237 SER SER A . n 
A 1 237 SER 237 238 238 SER SER A . n 
A 1 238 ILE 238 239 239 ILE ILE A . n 
A 1 239 GLU 239 240 240 GLU GLU A . n 
A 1 240 LYS 240 241 241 LYS LYS A . n 
A 1 241 LEU 241 242 242 LEU LEU A . n 
A 1 242 MET 242 243 243 MET MET A . n 
A 1 243 GLU 243 244 244 GLU GLU A . n 
A 1 244 ALA 244 245 245 ALA ALA A . n 
A 1 245 LEU 245 246 246 LEU LEU A . n 
A 1 246 GLY 246 247 247 GLY GLY A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 LYS 248 249 249 LYS LYS A . n 
A 1 249 LYS 249 250 250 LYS LYS A . n 
A 1 250 ARG 250 251 251 ARG ARG A . n 
A 1 251 LEU 251 252 252 LEU LEU A . n 
A 1 252 PHE 252 253 253 PHE PHE A . n 
A 1 253 ASP 253 254 254 ASP ASP A . n 
A 1 254 TYR 254 255 255 TYR TYR A . n 
A 1 255 VAL 255 256 256 VAL VAL A . n 
A 1 256 VAL 256 257 257 VAL VAL A . n 
A 1 257 LYS 257 258 258 LYS LYS A . n 
A 1 258 CYS 258 259 259 CYS CYS A . n 
A 1 259 ASN 259 260 260 ASN ASN A . n 
A 1 260 GLU 260 261 261 GLU GLU A . n 
A 1 261 GLY 261 262 262 GLY GLY A . n 
A 1 262 PRO 262 263 263 PRO PRO A . n 
A 1 263 THR 263 264 264 THR THR A . n 
A 1 264 LEU 264 265 265 LEU LEU A . n 
A 1 265 PRO 265 266 266 PRO PRO A . n 
A 1 266 ASP 266 267 267 ASP ASP A . n 
A 1 267 ILE 267 268 268 ILE ILE A . n 
A 1 268 SER 268 269 269 SER SER A . n 
A 1 269 PHE 269 270 270 PHE PHE A . n 
A 1 270 HIS 270 271 271 HIS HIS A . n 
A 1 271 LEU 271 272 272 LEU LEU A . n 
A 1 272 GLY 272 273 273 GLY GLY A . n 
A 1 273 GLY 273 274 274 GLY GLY A . n 
A 1 274 LYS 274 275 275 LYS LYS A . n 
A 1 275 GLU 275 276 276 GLU GLU A . n 
A 1 276 TYR 276 277 277 TYR TYR A . n 
A 1 277 THR 277 278 278 THR THR A . n 
A 1 278 LEU 278 279 279 LEU LEU A . n 
A 1 279 THR 279 280 280 THR THR A . n 
A 1 280 SER 280 281 281 SER SER A . n 
A 1 281 ALA 281 282 282 ALA ALA A . n 
A 1 282 ASP 282 283 283 ASP ASP A . n 
A 1 283 TYR 283 284 284 TYR TYR A . n 
A 1 284 VAL 284 285 285 VAL VAL A . n 
A 1 285 PHE 285 286 286 PHE PHE A . n 
A 1 286 GLN 286 287 287 GLN GLN A . n 
A 1 287 GLU 287 288 288 GLU GLU A . n 
A 1 288 SER 288 289 289 SER SER A . n 
A 1 289 TYR 289 290 290 TYR TYR A . n 
A 1 290 SER 290 291 291 SER SER A . n 
A 1 291 SER 291 292 292 SER SER A . n 
A 1 292 LYS 292 293 293 LYS LYS A . n 
A 1 293 LYS 293 294 294 LYS LYS A . n 
A 1 294 LEU 294 295 295 LEU LEU A . n 
A 1 295 CYS 295 296 296 CYS CYS A . n 
A 1 296 THR 296 297 297 THR THR A . n 
A 1 297 LEU 297 298 298 LEU LEU A . n 
A 1 298 ALA 298 299 299 ALA ALA A . n 
A 1 299 ILE 299 300 300 ILE ILE A . n 
A 1 300 HIS 300 301 301 HIS HIS A . n 
A 1 301 ALA 301 302 302 ALA ALA A . n 
A 1 302 MET 302 303 303 MET MET A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 ILE 304 305 305 ILE ILE A . n 
A 1 305 PRO 305 306 306 PRO PRO A . n 
A 1 306 PRO 306 307 307 PRO PRO A . n 
A 1 307 PRO 307 308 308 PRO PRO A . n 
A 1 308 THR 308 309 309 THR THR A . n 
A 1 309 GLY 309 310 310 GLY GLY A . n 
A 1 310 PRO 310 311 311 PRO PRO A . n 
A 1 311 THR 311 312 312 THR THR A . n 
A 1 312 TRP 312 313 313 TRP TRP A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 GLY 315 316 316 GLY GLY A . n 
A 1 316 ALA 316 317 317 ALA ALA A . n 
A 1 317 THR 317 318 318 THR THR A . n 
A 1 318 PHE 318 319 319 PHE PHE A . n 
A 1 319 ILE 319 320 320 ILE ILE A . n 
A 1 320 ARG 320 321 321 ARG ARG A . n 
A 1 321 LYS 321 322 322 LYS LYS A . n 
A 1 322 PHE 322 323 323 PHE PHE A . n 
A 1 323 TYR 323 324 324 TYR TYR A . n 
A 1 324 THR 324 325 325 THR THR A . n 
A 1 325 GLU 325 326 326 GLU GLU A . n 
A 1 326 PHE 326 327 327 PHE PHE A . n 
A 1 327 ASP 327 328 328 ASP ASP A . n 
A 1 328 ARG 328 329 329 ARG ARG A . n 
A 1 329 ARG 329 330 330 ARG ARG A . n 
A 1 330 ASN 330 331 331 ASN ASN A . n 
A 1 331 ASN 331 332 332 ASN ASN A . n 
A 1 332 ARG 332 333 333 ARG ARG A . n 
A 1 333 ILE 333 334 334 ILE ILE A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 PHE 335 336 336 PHE PHE A . n 
A 1 336 ALA 336 337 337 ALA ALA A . n 
A 1 337 LEU 337 338 338 LEU LEU A . n 
A 1 338 ALA 338 339 339 ALA ALA A . n 
A 1 339 ARG 339 340 340 ARG ARG A . n 
B 1 1   THR 1   2   ?   ?   ?   B . n 
B 1 2   LEU 2   3   3   LEU LEU B . n 
B 1 3   GLY 3   4   4   GLY GLY B . n 
B 1 4   ASN 4   5   5   ASN ASN B . n 
B 1 5   THR 5   6   6   THR THR B . n 
B 1 6   THR 6   7   7   THR THR B . n 
B 1 7   SER 7   8   8   SER SER B . n 
B 1 8   SER 8   9   9   SER SER B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  ILE 10  11  11  ILE ILE B . n 
B 1 11  LEU 11  12  12  LEU LEU B . n 
B 1 12  THR 12  13  13  THR THR B . n 
B 1 13  ASN 13  14  14  ASN ASN B . n 
B 1 14  TYR 14  15  15  TYR TYR B . n 
B 1 15  MET 15  16  16  MET MET B . n 
B 1 16  ASP 16  17  17  ASP ASP B . n 
B 1 17  THR 17  18  18  THR THR B . n 
B 1 18  GLN 18  19  19  GLN GLN B . n 
B 1 19  TYR 19  20  20  TYR TYR B . n 
B 1 20  TYR 20  21  21  TYR TYR B . n 
B 1 21  GLY 21  22  22  GLY GLY B . n 
B 1 22  GLU 22  23  23  GLU GLU B . n 
B 1 23  ILE 23  24  24  ILE ILE B . n 
B 1 24  GLY 24  25  25  GLY GLY B . n 
B 1 25  ILE 25  26  26  ILE ILE B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  THR 27  28  28  THR THR B . n 
B 1 28  PRO 28  29  29  PRO PRO B . n 
B 1 29  PRO 29  30  30  PRO PRO B . n 
B 1 30  GLN 30  31  31  GLN GLN B . n 
B 1 31  THR 31  32  32  THR THR B . n 
B 1 32  PHE 32  33  33  PHE PHE B . n 
B 1 33  LYS 33  34  34  LYS LYS B . n 
B 1 34  VAL 34  35  35  VAL VAL B . n 
B 1 35  VAL 35  36  36  VAL VAL B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ASP 37  38  38  ASP ASP B . n 
B 1 38  THR 38  39  39  THR THR B . n 
B 1 39  GLY 39  40  40  GLY GLY B . n 
B 1 40  SER 40  41  41  SER SER B . n 
B 1 41  SER 41  42  42  SER SER B . n 
B 1 42  ASN 42  43  43  ASN ASN B . n 
B 1 43  VAL 43  44  44  VAL VAL B . n 
B 1 44  TRP 44  45  45  TRP TRP B . n 
B 1 45  VAL 45  46  46  VAL VAL B . n 
B 1 46  PRO 46  47  47  PRO PRO B . n 
B 1 47  SER 47  48  48  SER SER B . n 
B 1 48  SER 48  49  49  SER SER B . n 
B 1 49  LYS 49  50  50  LYS LYS B . n 
B 1 50  CYS 50  51  51  CYS CYS B . n 
B 1 51  SER 51  52  52  SER SER B . n 
B 1 52  ARG 52  53  53  ARG ARG B . n 
B 1 53  LEU 53  54  54  LEU LEU B . n 
B 1 54  TYR 54  55  55  TYR TYR B . n 
B 1 55  THR 55  56  56  THR THR B . n 
B 1 56  ALA 56  57  57  ALA ALA B . n 
B 1 57  CYS 57  58  58  CYS CYS B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  TYR 59  60  60  TYR TYR B . n 
B 1 60  HIS 60  61  61  HIS HIS B . n 
B 1 61  LYS 61  62  62  LYS LYS B . n 
B 1 62  LEU 62  63  63  LEU LEU B . n 
B 1 63  PHE 63  64  64  PHE PHE B . n 
B 1 64  ASP 64  65  65  ASP ASP B . n 
B 1 65  ALA 65  66  66  ALA ALA B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  ASP 67  68  68  ASP ASP B . n 
B 1 68  SER 68  69  69  SER SER B . n 
B 1 69  SER 69  70  70  SER SER B . n 
B 1 70  SER 70  71  71  SER SER B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  LYS 72  73  73  LYS LYS B . n 
B 1 73  HIS 73  74  74  HIS HIS B . n 
B 1 74  ASN 74  75  75  ASN ASN B . n 
B 1 75  GLY 75  76  76  GLY GLY B . n 
B 1 76  THR 76  77  77  THR THR B . n 
B 1 77  GLU 77  78  78  GLU GLU B . n 
B 1 78  LEU 78  79  79  LEU LEU B . n 
B 1 79  THR 79  80  80  THR THR B . n 
B 1 80  LEU 80  81  81  LEU LEU B . n 
B 1 81  ARG 81  82  82  ARG ARG B . n 
B 1 82  TYR 82  83  ?   ?   ?   B . n 
B 1 83  SER 83  84  ?   ?   ?   B . n 
B 1 84  THR 84  85  ?   ?   ?   B . n 
B 1 85  GLY 85  86  ?   ?   ?   B . n 
B 1 86  THR 86  87  87  THR THR B . n 
B 1 87  VAL 87  88  88  VAL VAL B . n 
B 1 88  SER 88  89  89  SER SER B . n 
B 1 89  GLY 89  90  90  GLY GLY B . n 
B 1 90  PHE 90  91  91  PHE PHE B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLN 93  94  94  GLN GLN B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  ILE 95  96  96  ILE ILE B . n 
B 1 96  ILE 96  97  97  ILE ILE B . n 
B 1 97  THR 97  98  98  THR THR B . n 
B 1 98  VAL 98  99  99  VAL VAL B . n 
B 1 99  GLY 99  100 100 GLY GLY B . n 
B 1 100 GLY 100 101 101 GLY GLY B . n 
B 1 101 ILE 101 102 102 ILE ILE B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 VAL 103 104 104 VAL VAL B . n 
B 1 104 THR 104 105 105 THR THR B . n 
B 1 105 GLN 105 106 106 GLN GLN B . n 
B 1 106 MET 106 107 107 MET MET B . n 
B 1 107 PHE 107 108 108 PHE PHE B . n 
B 1 108 GLY 108 109 109 GLY GLY B . n 
B 1 109 GLU 109 110 110 GLU GLU B . n 
B 1 110 VAL 110 111 111 VAL VAL B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 GLU 112 113 113 GLU GLU B . n 
B 1 113 MET 113 114 114 MET MET B . n 
B 1 114 PRO 114 115 115 PRO PRO B . n 
B 1 115 ALA 115 116 116 ALA ALA B . n 
B 1 116 LEU 116 117 117 LEU LEU B . n 
B 1 117 PRO 117 118 118 PRO PRO B . n 
B 1 118 PHE 118 119 119 PHE PHE B . n 
B 1 119 MET 119 120 120 MET MET B . n 
B 1 120 LEU 120 121 121 LEU LEU B . n 
B 1 121 ALA 121 122 122 ALA ALA B . n 
B 1 122 GLU 122 123 123 GLU GLU B . n 
B 1 123 PHE 123 124 124 PHE PHE B . n 
B 1 124 ASP 124 125 125 ASP ASP B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 VAL 126 127 127 VAL VAL B . n 
B 1 127 VAL 127 128 128 VAL VAL B . n 
B 1 128 GLY 128 129 129 GLY GLY B . n 
B 1 129 MET 129 130 130 MET MET B . n 
B 1 130 GLY 130 131 131 GLY GLY B . n 
B 1 131 PHE 131 132 132 PHE PHE B . n 
B 1 132 ILE 132 133 133 ILE ILE B . n 
B 1 133 GLU 133 134 134 GLU GLU B . n 
B 1 134 GLN 134 135 135 GLN GLN B . n 
B 1 135 ALA 135 136 136 ALA ALA B . n 
B 1 136 ILE 136 137 137 ILE ILE B . n 
B 1 137 GLY 137 138 138 GLY GLY B . n 
B 1 138 ARG 138 139 139 ARG ARG B . n 
B 1 139 VAL 139 140 140 VAL VAL B . n 
B 1 140 THR 140 141 141 THR THR B . n 
B 1 141 PRO 141 142 142 PRO PRO B . n 
B 1 142 ILE 142 143 143 ILE ILE B . n 
B 1 143 PHE 143 144 144 PHE PHE B . n 
B 1 144 ASP 144 145 145 ASP ASP B . n 
B 1 145 ASN 145 146 146 ASN ASN B . n 
B 1 146 ILE 146 147 147 ILE ILE B . n 
B 1 147 ILE 147 148 148 ILE ILE B . n 
B 1 148 SER 148 149 149 SER SER B . n 
B 1 149 GLN 149 150 150 GLN GLN B . n 
B 1 150 GLY 150 151 151 GLY GLY B . n 
B 1 151 VAL 151 152 152 VAL VAL B . n 
B 1 152 LEU 152 153 153 LEU LEU B . n 
B 1 153 LYS 153 154 154 LYS LYS B . n 
B 1 154 GLU 154 155 155 GLU GLU B . n 
B 1 155 ASP 155 156 156 ASP ASP B . n 
B 1 156 VAL 156 157 157 VAL VAL B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 SER 158 159 159 SER SER B . n 
B 1 159 PHE 159 160 160 PHE PHE B . n 
B 1 160 TYR 160 161 161 TYR TYR B . n 
B 1 161 TYR 161 162 162 TYR TYR B . n 
B 1 162 ASN 162 163 163 ASN ASN B . n 
B 1 163 ARG 163 164 164 ARG ARG B . n 
B 1 164 ASP 164 165 165 ASP ASP B . n 
B 1 165 SER 165 166 166 SER SER B . n 
B 1 166 GLU 166 167 ?   ?   ?   B . n 
B 1 167 ASN 167 168 ?   ?   ?   B . n 
B 1 168 SER 168 169 ?   ?   ?   B . n 
B 1 169 GLN 169 170 170 GLN GLN B . n 
B 1 170 SER 170 171 171 SER SER B . n 
B 1 171 LEU 171 172 172 LEU LEU B . n 
B 1 172 GLY 172 173 173 GLY GLY B . n 
B 1 173 GLY 173 174 174 GLY GLY B . n 
B 1 174 GLN 174 175 175 GLN GLN B . n 
B 1 175 ILE 175 176 176 ILE ILE B . n 
B 1 176 VAL 176 177 177 VAL VAL B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 GLY 178 179 179 GLY GLY B . n 
B 1 179 GLY 179 180 180 GLY GLY B . n 
B 1 180 SER 180 181 181 SER SER B . n 
B 1 181 ASP 181 182 182 ASP ASP B . n 
B 1 182 PRO 182 183 183 PRO PRO B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 HIS 184 185 185 HIS HIS B . n 
B 1 185 TYR 185 186 186 TYR TYR B . n 
B 1 186 GLU 186 187 187 GLU GLU B . n 
B 1 187 GLY 187 188 188 GLY GLY B . n 
B 1 188 ASN 188 189 189 ASN ASN B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 HIS 190 191 191 HIS HIS B . n 
B 1 191 TYR 191 192 192 TYR TYR B . n 
B 1 192 ILE 192 193 193 ILE ILE B . n 
B 1 193 ASN 193 194 194 ASN ASN B . n 
B 1 194 LEU 194 195 195 LEU LEU B . n 
B 1 195 ILE 195 196 196 ILE ILE B . n 
B 1 196 LYS 196 197 197 LYS LYS B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 GLY 198 199 199 GLY GLY B . n 
B 1 199 VAL 199 200 200 VAL VAL B . n 
B 1 200 TRP 200 201 201 TRP TRP B . n 
B 1 201 GLN 201 202 202 GLN GLN B . n 
B 1 202 ILE 202 203 203 ILE ILE B . n 
B 1 203 GLN 203 204 204 GLN GLN B . n 
B 1 204 MET 204 205 205 MET MET B . n 
B 1 205 LYS 205 206 206 LYS LYS B . n 
B 1 206 GLY 206 207 207 GLY GLY B . n 
B 1 207 VAL 207 208 208 VAL VAL B . n 
B 1 208 SER 208 209 209 SER SER B . n 
B 1 209 VAL 209 210 210 VAL VAL B . n 
B 1 210 GLY 210 211 211 GLY GLY B . n 
B 1 211 SER 211 212 212 SER SER B . n 
B 1 212 SER 212 213 213 SER SER B . n 
B 1 213 THR 213 214 214 THR THR B . n 
B 1 214 LEU 214 215 215 LEU LEU B . n 
B 1 215 LEU 215 216 216 LEU LEU B . n 
B 1 216 CYS 216 217 217 CYS CYS B . n 
B 1 217 GLU 217 218 218 GLU GLU B . n 
B 1 218 ASP 218 219 219 ASP ASP B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 CYS 220 221 221 CYS CYS B . n 
B 1 221 LEU 221 222 222 LEU LEU B . n 
B 1 222 ALA 222 223 223 ALA ALA B . n 
B 1 223 LEU 223 224 224 LEU LEU B . n 
B 1 224 VAL 224 225 225 VAL VAL B . n 
B 1 225 ASP 225 226 226 ASP ASP B . n 
B 1 226 THR 226 227 227 THR THR B . n 
B 1 227 GLY 227 228 228 GLY GLY B . n 
B 1 228 ALA 228 229 229 ALA ALA B . n 
B 1 229 SER 229 230 230 SER SER B . n 
B 1 230 TYR 230 231 231 TYR TYR B . n 
B 1 231 ILE 231 232 232 ILE ILE B . n 
B 1 232 SER 232 233 233 SER SER B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 SER 234 235 235 SER SER B . n 
B 1 235 THR 235 236 236 THR THR B . n 
B 1 236 SER 236 237 237 SER SER B . n 
B 1 237 SER 237 238 238 SER SER B . n 
B 1 238 ILE 238 239 239 ILE ILE B . n 
B 1 239 GLU 239 240 240 GLU GLU B . n 
B 1 240 LYS 240 241 241 LYS LYS B . n 
B 1 241 LEU 241 242 242 LEU LEU B . n 
B 1 242 MET 242 243 243 MET MET B . n 
B 1 243 GLU 243 244 244 GLU GLU B . n 
B 1 244 ALA 244 245 245 ALA ALA B . n 
B 1 245 LEU 245 246 246 LEU LEU B . n 
B 1 246 GLY 246 247 247 GLY GLY B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 LYS 248 249 249 LYS LYS B . n 
B 1 249 LYS 249 250 250 LYS LYS B . n 
B 1 250 ARG 250 251 251 ARG ARG B . n 
B 1 251 LEU 251 252 252 LEU LEU B . n 
B 1 252 PHE 252 253 253 PHE PHE B . n 
B 1 253 ASP 253 254 254 ASP ASP B . n 
B 1 254 TYR 254 255 255 TYR TYR B . n 
B 1 255 VAL 255 256 256 VAL VAL B . n 
B 1 256 VAL 256 257 257 VAL VAL B . n 
B 1 257 LYS 257 258 258 LYS LYS B . n 
B 1 258 CYS 258 259 259 CYS CYS B . n 
B 1 259 ASN 259 260 260 ASN ASN B . n 
B 1 260 GLU 260 261 261 GLU GLU B . n 
B 1 261 GLY 261 262 262 GLY GLY B . n 
B 1 262 PRO 262 263 263 PRO PRO B . n 
B 1 263 THR 263 264 264 THR THR B . n 
B 1 264 LEU 264 265 265 LEU LEU B . n 
B 1 265 PRO 265 266 266 PRO PRO B . n 
B 1 266 ASP 266 267 267 ASP ASP B . n 
B 1 267 ILE 267 268 268 ILE ILE B . n 
B 1 268 SER 268 269 269 SER SER B . n 
B 1 269 PHE 269 270 270 PHE PHE B . n 
B 1 270 HIS 270 271 271 HIS HIS B . n 
B 1 271 LEU 271 272 272 LEU LEU B . n 
B 1 272 GLY 272 273 273 GLY GLY B . n 
B 1 273 GLY 273 274 274 GLY GLY B . n 
B 1 274 LYS 274 275 275 LYS LYS B . n 
B 1 275 GLU 275 276 276 GLU GLU B . n 
B 1 276 TYR 276 277 277 TYR TYR B . n 
B 1 277 THR 277 278 278 THR THR B . n 
B 1 278 LEU 278 279 279 LEU LEU B . n 
B 1 279 THR 279 280 280 THR THR B . n 
B 1 280 SER 280 281 281 SER SER B . n 
B 1 281 ALA 281 282 282 ALA ALA B . n 
B 1 282 ASP 282 283 283 ASP ASP B . n 
B 1 283 TYR 283 284 284 TYR TYR B . n 
B 1 284 VAL 284 285 285 VAL VAL B . n 
B 1 285 PHE 285 286 286 PHE PHE B . n 
B 1 286 GLN 286 287 287 GLN GLN B . n 
B 1 287 GLU 287 288 288 GLU GLU B . n 
B 1 288 SER 288 289 289 SER SER B . n 
B 1 289 TYR 289 290 290 TYR TYR B . n 
B 1 290 SER 290 291 291 SER SER B . n 
B 1 291 SER 291 292 292 SER SER B . n 
B 1 292 LYS 292 293 293 LYS LYS B . n 
B 1 293 LYS 293 294 294 LYS LYS B . n 
B 1 294 LEU 294 295 295 LEU LEU B . n 
B 1 295 CYS 295 296 296 CYS CYS B . n 
B 1 296 THR 296 297 297 THR THR B . n 
B 1 297 LEU 297 298 298 LEU LEU B . n 
B 1 298 ALA 298 299 299 ALA ALA B . n 
B 1 299 ILE 299 300 300 ILE ILE B . n 
B 1 300 HIS 300 301 301 HIS HIS B . n 
B 1 301 ALA 301 302 302 ALA ALA B . n 
B 1 302 MET 302 303 303 MET MET B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 ILE 304 305 305 ILE ILE B . n 
B 1 305 PRO 305 306 306 PRO PRO B . n 
B 1 306 PRO 306 307 307 PRO PRO B . n 
B 1 307 PRO 307 308 308 PRO PRO B . n 
B 1 308 THR 308 309 309 THR THR B . n 
B 1 309 GLY 309 310 310 GLY GLY B . n 
B 1 310 PRO 310 311 311 PRO PRO B . n 
B 1 311 THR 311 312 312 THR THR B . n 
B 1 312 TRP 312 313 313 TRP TRP B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 GLY 315 316 316 GLY GLY B . n 
B 1 316 ALA 316 317 317 ALA ALA B . n 
B 1 317 THR 317 318 318 THR THR B . n 
B 1 318 PHE 318 319 319 PHE PHE B . n 
B 1 319 ILE 319 320 320 ILE ILE B . n 
B 1 320 ARG 320 321 321 ARG ARG B . n 
B 1 321 LYS 321 322 322 LYS LYS B . n 
B 1 322 PHE 322 323 323 PHE PHE B . n 
B 1 323 TYR 323 324 324 TYR TYR B . n 
B 1 324 THR 324 325 325 THR THR B . n 
B 1 325 GLU 325 326 326 GLU GLU B . n 
B 1 326 PHE 326 327 327 PHE PHE B . n 
B 1 327 ASP 327 328 328 ASP ASP B . n 
B 1 328 ARG 328 329 329 ARG ARG B . n 
B 1 329 ARG 329 330 330 ARG ARG B . n 
B 1 330 ASN 330 331 331 ASN ASN B . n 
B 1 331 ASN 331 332 332 ASN ASN B . n 
B 1 332 ARG 332 333 333 ARG ARG B . n 
B 1 333 ILE 333 334 334 ILE ILE B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 PHE 335 336 336 PHE PHE B . n 
B 1 336 ALA 336 337 337 ALA ALA B . n 
B 1 337 LEU 337 338 338 LEU LEU B . n 
B 1 338 ALA 338 339 339 ALA ALA B . n 
B 1 339 ARG 339 340 340 ARG ARG B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 NAG 1  401 400 NAG NAG A . 
D 3 PG6 1  402 600 PG6 PG6 A . 
E 4 DMS 1  403 700 DMS DMS A . 
F 4 DMS 1  404 701 DMS DMS A . 
G 2 NAG 1  401 410 NAG NAG B . 
H 5 77O 1  402 500 77O LIG B . 
I 6 PGE 1  403 610 PGE PGE B . 
J 7 HOH 1  501 11  HOH HOH A . 
J 7 HOH 2  502 5   HOH HOH A . 
J 7 HOH 3  503 50  HOH HOH A . 
J 7 HOH 4  504 87  HOH HOH A . 
J 7 HOH 5  505 49  HOH HOH A . 
J 7 HOH 6  506 90  HOH HOH A . 
J 7 HOH 7  507 35  HOH HOH A . 
J 7 HOH 8  508 14  HOH HOH A . 
J 7 HOH 9  509 59  HOH HOH A . 
J 7 HOH 10 510 7   HOH HOH A . 
J 7 HOH 11 511 16  HOH HOH A . 
J 7 HOH 12 512 99  HOH HOH A . 
J 7 HOH 13 513 47  HOH HOH A . 
J 7 HOH 14 514 83  HOH HOH A . 
J 7 HOH 15 515 29  HOH HOH A . 
J 7 HOH 16 516 41  HOH HOH A . 
J 7 HOH 17 517 9   HOH HOH A . 
J 7 HOH 18 518 92  HOH HOH A . 
J 7 HOH 19 519 95  HOH HOH A . 
J 7 HOH 20 520 8   HOH HOH A . 
J 7 HOH 21 521 51  HOH HOH A . 
J 7 HOH 22 522 33  HOH HOH A . 
J 7 HOH 23 523 10  HOH HOH A . 
J 7 HOH 24 524 24  HOH HOH A . 
J 7 HOH 25 525 31  HOH HOH A . 
J 7 HOH 26 526 69  HOH HOH A . 
J 7 HOH 27 527 84  HOH HOH A . 
J 7 HOH 28 528 54  HOH HOH A . 
J 7 HOH 29 529 32  HOH HOH A . 
J 7 HOH 30 530 60  HOH HOH A . 
J 7 HOH 31 531 38  HOH HOH A . 
J 7 HOH 32 532 96  HOH HOH A . 
J 7 HOH 33 533 86  HOH HOH A . 
J 7 HOH 34 534 2   HOH HOH A . 
J 7 HOH 35 535 91  HOH HOH A . 
J 7 HOH 36 536 94  HOH HOH A . 
J 7 HOH 37 537 78  HOH HOH A . 
J 7 HOH 38 538 82  HOH HOH A . 
J 7 HOH 39 539 42  HOH HOH A . 
J 7 HOH 40 540 22  HOH HOH A . 
J 7 HOH 41 541 75  HOH HOH A . 
J 7 HOH 42 542 85  HOH HOH A . 
J 7 HOH 43 543 23  HOH HOH A . 
J 7 HOH 44 544 12  HOH HOH A . 
J 7 HOH 45 545 43  HOH HOH A . 
J 7 HOH 46 546 70  HOH HOH A . 
J 7 HOH 47 547 132 HOH HOH A . 
J 7 HOH 48 548 17  HOH HOH A . 
J 7 HOH 49 549 128 HOH HOH A . 
J 7 HOH 50 550 66  HOH HOH A . 
J 7 HOH 51 551 36  HOH HOH A . 
J 7 HOH 52 552 93  HOH HOH A . 
J 7 HOH 53 553 101 HOH HOH A . 
J 7 HOH 54 554 98  HOH HOH A . 
J 7 HOH 55 555 81  HOH HOH A . 
J 7 HOH 56 556 79  HOH HOH A . 
J 7 HOH 57 557 27  HOH HOH A . 
J 7 HOH 58 558 88  HOH HOH A . 
J 7 HOH 59 559 89  HOH HOH A . 
J 7 HOH 60 560 126 HOH HOH A . 
J 7 HOH 61 561 133 HOH HOH A . 
J 7 HOH 62 562 25  HOH HOH A . 
J 7 HOH 63 563 19  HOH HOH A . 
J 7 HOH 64 564 55  HOH HOH A . 
J 7 HOH 65 565 65  HOH HOH A . 
J 7 HOH 66 566 57  HOH HOH A . 
J 7 HOH 67 567 72  HOH HOH A . 
J 7 HOH 68 568 6   HOH HOH A . 
J 7 HOH 69 569 40  HOH HOH A . 
J 7 HOH 70 570 44  HOH HOH A . 
J 7 HOH 71 571 76  HOH HOH A . 
J 7 HOH 72 572 37  HOH HOH A . 
J 7 HOH 73 573 13  HOH HOH A . 
J 7 HOH 74 574 100 HOH HOH A . 
J 7 HOH 75 575 97  HOH HOH A . 
J 7 HOH 76 576 80  HOH HOH A . 
K 7 HOH 1  501 73  HOH HOH B . 
K 7 HOH 2  502 46  HOH HOH B . 
K 7 HOH 3  503 104 HOH HOH B . 
K 7 HOH 4  504 1   HOH HOH B . 
K 7 HOH 5  505 113 HOH HOH B . 
K 7 HOH 6  506 116 HOH HOH B . 
K 7 HOH 7  507 117 HOH HOH B . 
K 7 HOH 8  508 123 HOH HOH B . 
K 7 HOH 9  509 34  HOH HOH B . 
K 7 HOH 10 510 21  HOH HOH B . 
K 7 HOH 11 511 74  HOH HOH B . 
K 7 HOH 12 512 18  HOH HOH B . 
K 7 HOH 13 513 28  HOH HOH B . 
K 7 HOH 14 514 137 HOH HOH B . 
K 7 HOH 15 515 125 HOH HOH B . 
K 7 HOH 16 516 30  HOH HOH B . 
K 7 HOH 17 517 68  HOH HOH B . 
K 7 HOH 18 518 102 HOH HOH B . 
K 7 HOH 19 519 63  HOH HOH B . 
K 7 HOH 20 520 56  HOH HOH B . 
K 7 HOH 21 521 139 HOH HOH B . 
K 7 HOH 22 522 62  HOH HOH B . 
K 7 HOH 23 523 15  HOH HOH B . 
K 7 HOH 24 524 112 HOH HOH B . 
K 7 HOH 25 525 58  HOH HOH B . 
K 7 HOH 26 526 39  HOH HOH B . 
K 7 HOH 27 527 134 HOH HOH B . 
K 7 HOH 28 528 26  HOH HOH B . 
K 7 HOH 29 529 106 HOH HOH B . 
K 7 HOH 30 530 61  HOH HOH B . 
K 7 HOH 31 531 67  HOH HOH B . 
K 7 HOH 32 532 108 HOH HOH B . 
K 7 HOH 33 533 121 HOH HOH B . 
K 7 HOH 34 534 103 HOH HOH B . 
K 7 HOH 35 535 131 HOH HOH B . 
K 7 HOH 36 536 3   HOH HOH B . 
K 7 HOH 37 537 45  HOH HOH B . 
K 7 HOH 38 538 122 HOH HOH B . 
K 7 HOH 39 539 71  HOH HOH B . 
K 7 HOH 40 540 114 HOH HOH B . 
K 7 HOH 41 541 111 HOH HOH B . 
K 7 HOH 42 542 109 HOH HOH B . 
K 7 HOH 43 543 64  HOH HOH B . 
K 7 HOH 44 544 105 HOH HOH B . 
K 7 HOH 45 545 4   HOH HOH B . 
K 7 HOH 46 546 115 HOH HOH B . 
K 7 HOH 47 547 107 HOH HOH B . 
K 7 HOH 48 548 119 HOH HOH B . 
K 7 HOH 49 549 118 HOH HOH B . 
K 7 HOH 50 550 124 HOH HOH B . 
K 7 HOH 51 551 142 HOH HOH B . 
K 7 HOH 52 552 52  HOH HOH B . 
K 7 HOH 53 553 77  HOH HOH B . 
K 7 HOH 54 554 141 HOH HOH B . 
K 7 HOH 55 555 110 HOH HOH B . 
K 7 HOH 56 556 120 HOH HOH B . 
K 7 HOH 57 557 129 HOH HOH B . 
K 7 HOH 58 558 135 HOH HOH B . 
K 7 HOH 59 559 53  HOH HOH B . 
K 7 HOH 60 560 48  HOH HOH B . 
K 7 HOH 61 561 140 HOH HOH B . 
K 7 HOH 62 562 136 HOH HOH B . 
K 7 HOH 63 563 127 HOH HOH B . 
K 7 HOH 64 564 138 HOH HOH B . 
K 7 HOH 65 565 130 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly   ?    monomeric 1 
2 author_defined_assembly   ?    monomeric 1 
3 software_defined_assembly PISA hexameric 6 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1     A,C,D,E,F,J           
2 1     B,G,H,I,K             
3 1,2,3 A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
3 'ABSA (A^2)' 13830 ? 
3 MORE         -65   ? 
3 'SSA (A^2)'  72600 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 
0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 
3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 
1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-10-26 
2 'Structure model' 1 1 2016-11-02 
3 'Structure model' 1 2 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 3 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'  
2 3 'Structure model' 'Data collection'      
3 3 'Structure model' 'Database references'  
4 3 'Structure model' 'Derived calculations' 
5 3 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' chem_comp                 
2 3 'Structure model' citation                  
3 3 'Structure model' entity                    
4 3 'Structure model' pdbx_chem_comp_identifier 
5 3 'Structure model' pdbx_entity_nonpoly       
6 3 'Structure model' pdbx_struct_oper_list     
7 3 'Structure model' struct_conn               
8 3 'Structure model' struct_site               
9 3 'Structure model' struct_site_gen           
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_chem_comp.name'                           
2 3 'Structure model' '_chem_comp.type'                           
3 3 'Structure model' '_citation.journal_id_CSD'                  
4 3 'Structure model' '_entity.pdbx_description'                  
5 3 'Structure model' '_pdbx_entity_nonpoly.name'                 
6 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
7 3 'Structure model' '_struct_conn.pdbx_role'                    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined -5.9231 -23.5581 -38.8813 0.1005 0.0417 0.0809 0.0190  0.0321  -0.0067 3.3567 0.9818 1.6817 0.7337 
1.5883  0.3245 0.1268 0.0084  -0.1352 0.0458  -0.2756 -0.2493 -0.0091 0.1565 0.2169 
'X-RAY DIFFRACTION' 2 ? refined 17.4741 -0.2610  -22.4090 0.0495 0.0775 0.1346 -0.0112 -0.0463 0.0501  2.1944 2.7682 2.2506 
-0.4073 -0.9920 0.6137 0.0154 -0.0072 -0.0081 -0.2296 -0.1817 -0.2811 0.3179  0.1680 0.1922 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1 A 2   A 78  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 2  1 A 79  A 91  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 3  1 A 92  A 154 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 4  1 A 155 A 248 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 5  1 A 249 A 265 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 6  1 A 266 A 280 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 7  1 A 281 A 298 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 8  1 A 299 A 302 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 9  1 A 303 A 312 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 10 1 A 313 A 340 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 11 2 B 3   B 78  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 12 2 B 79  B 91  ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 13 2 B 92  B 154 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 14 2 B 155 B 248 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 15 2 B 249 B 265 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 16 2 B 266 B 280 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 17 2 B 281 B 298 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 18 2 B 299 B 302 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 19 2 B 303 B 312 ? ? ? ? ? ? 
'X-RAY DIFFRACTION' 20 2 B 313 B 340 ? ? ? ? ? ? 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0135 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 MET A 16  ? ? 48.25   28.48  
2  1 MET A 16  ? ? 58.24   18.87  
3  1 ASN A 75  ? ? -135.96 -60.86 
4  1 GLN A 170 ? ? -110.67 63.80  
5  1 ALA A 299 ? ? -84.57  30.60  
6  1 MET B 16  ? ? 59.74   19.93  
7  1 ASN B 75  ? ? -129.99 -59.52 
8  1 ARG B 139 ? ? 44.74   22.88  
9  1 ARG B 251 ? ? -61.16  -79.83 
10 1 LEU B 252 ? ? -150.64 -21.65 
11 1 PHE B 253 ? ? -130.73 -43.34 
12 1 ALA B 299 ? ? -95.26  32.89  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 139 ? CD  ? A ARG 138 CD  
2  1 Y 1 A ARG 139 ? NE  ? A ARG 138 NE  
3  1 Y 1 A ARG 139 ? CZ  ? A ARG 138 CZ  
4  1 Y 1 A ARG 139 ? NH1 ? A ARG 138 NH1 
5  1 Y 1 A ARG 139 ? NH2 ? A ARG 138 NH2 
6  1 Y 1 A GLN 170 ? CG  ? A GLN 169 CG  
7  1 Y 1 A GLN 170 ? CD  ? A GLN 169 CD  
8  1 Y 1 A GLN 170 ? OE1 ? A GLN 169 OE1 
9  1 Y 1 A GLN 170 ? NE2 ? A GLN 169 NE2 
10 1 Y 1 A GLN 184 ? CG  ? A GLN 183 CG  
11 1 Y 1 A GLN 184 ? CD  ? A GLN 183 CD  
12 1 Y 1 A GLN 184 ? OE1 ? A GLN 183 OE1 
13 1 Y 1 A GLN 184 ? NE2 ? A GLN 183 NE2 
14 1 Y 1 A LEU 215 ? CG  ? A LEU 214 CG  
15 1 Y 1 A LEU 215 ? CD1 ? A LEU 214 CD1 
16 1 Y 1 A LEU 215 ? CD2 ? A LEU 214 CD2 
17 1 Y 1 A LYS 241 ? CG  ? A LYS 240 CG  
18 1 Y 1 A LYS 241 ? CD  ? A LYS 240 CD  
19 1 Y 1 A LYS 241 ? CE  ? A LYS 240 CE  
20 1 Y 1 A LYS 241 ? NZ  ? A LYS 240 NZ  
21 1 Y 1 A LYS 258 ? CG  ? A LYS 257 CG  
22 1 Y 1 A LYS 258 ? CD  ? A LYS 257 CD  
23 1 Y 1 A LYS 258 ? CE  ? A LYS 257 CE  
24 1 Y 1 A LYS 258 ? NZ  ? A LYS 257 NZ  
25 1 Y 1 A LYS 275 ? CG  ? A LYS 274 CG  
26 1 Y 1 A LYS 275 ? CD  ? A LYS 274 CD  
27 1 Y 1 A LYS 275 ? CE  ? A LYS 274 CE  
28 1 Y 1 A LYS 275 ? NZ  ? A LYS 274 NZ  
29 1 Y 1 A LYS 293 ? CG  ? A LYS 292 CG  
30 1 Y 1 A LYS 293 ? CD  ? A LYS 292 CD  
31 1 Y 1 A LYS 293 ? CE  ? A LYS 292 CE  
32 1 Y 1 A LYS 293 ? NZ  ? A LYS 292 NZ  
33 1 Y 1 A ARG 330 ? NE  ? A ARG 329 NE  
34 1 Y 1 A ARG 330 ? CZ  ? A ARG 329 CZ  
35 1 Y 1 A ARG 330 ? NH1 ? A ARG 329 NH1 
36 1 Y 1 A ARG 330 ? NH2 ? A ARG 329 NH2 
37 1 Y 1 B LYS 50  ? CG  ? B LYS 49  CG  
38 1 Y 1 B LYS 50  ? CD  ? B LYS 49  CD  
39 1 Y 1 B LYS 50  ? CE  ? B LYS 49  CE  
40 1 Y 1 B LYS 50  ? NZ  ? B LYS 49  NZ  
41 1 Y 1 B ARG 53  ? CG  ? B ARG 52  CG  
42 1 Y 1 B ARG 53  ? CD  ? B ARG 52  CD  
43 1 Y 1 B ARG 53  ? NE  ? B ARG 52  NE  
44 1 Y 1 B ARG 53  ? CZ  ? B ARG 52  CZ  
45 1 Y 1 B ARG 53  ? NH1 ? B ARG 52  NH1 
46 1 Y 1 B ARG 53  ? NH2 ? B ARG 52  NH2 
47 1 Y 1 B ARG 82  ? CG  ? B ARG 81  CG  
48 1 Y 1 B ARG 82  ? CD  ? B ARG 81  CD  
49 1 Y 1 B ARG 82  ? NE  ? B ARG 81  NE  
50 1 Y 1 B ARG 82  ? CZ  ? B ARG 81  CZ  
51 1 Y 1 B ARG 82  ? NH1 ? B ARG 81  NH1 
52 1 Y 1 B ARG 82  ? NH2 ? B ARG 81  NH2 
53 1 Y 1 B GLN 170 ? CG  ? B GLN 169 CG  
54 1 Y 1 B GLN 170 ? CD  ? B GLN 169 CD  
55 1 Y 1 B GLN 170 ? OE1 ? B GLN 169 OE1 
56 1 Y 1 B GLN 170 ? NE2 ? B GLN 169 NE2 
57 1 Y 1 B LYS 241 ? CG  ? B LYS 240 CG  
58 1 Y 1 B LYS 241 ? CD  ? B LYS 240 CD  
59 1 Y 1 B LYS 241 ? CE  ? B LYS 240 CE  
60 1 Y 1 B LYS 241 ? NZ  ? B LYS 240 NZ  
61 1 Y 1 B LEU 252 ? CG  ? B LEU 251 CG  
62 1 Y 1 B LEU 252 ? CD1 ? B LEU 251 CD1 
63 1 Y 1 B LEU 252 ? CD2 ? B LEU 251 CD2 
64 1 Y 1 B LYS 275 ? CG  ? B LYS 274 CG  
65 1 Y 1 B LYS 275 ? CD  ? B LYS 274 CD  
66 1 Y 1 B LYS 275 ? CE  ? B LYS 274 CE  
67 1 Y 1 B LYS 275 ? NZ  ? B LYS 274 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 166 ? A SER 165 
2  1 Y 1 A GLU 167 ? A GLU 166 
3  1 Y 1 A ASN 168 ? A ASN 167 
4  1 Y 1 A SER 212 ? A SER 211 
5  1 Y 1 A SER 213 ? A SER 212 
6  1 Y 1 B THR 2   ? B THR 1   
7  1 Y 1 B TYR 83  ? B TYR 82  
8  1 Y 1 B SER 84  ? B SER 83  
9  1 Y 1 B THR 85  ? B THR 84  
10 1 Y 1 B GLY 86  ? B GLY 85  
11 1 Y 1 B GLU 167 ? B GLU 166 
12 1 Y 1 B ASN 168 ? B ASN 167 
13 1 Y 1 B SER 169 ? B SER 168 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 2-acetamido-2-deoxy-beta-D-glucopyranose                         NAG 
3 '1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-ETHOXY}-ETHANE' PG6 
4 'DIMETHYL SULFOXIDE'                                             DMS 
5 '6-chloro-N-[(furan-2-yl)methyl]pyrazin-2-amine'                 77O 
6 'TRIETHYLENE GLYCOL'                                             PGE 
7 water                                                            HOH 
#