data_5TJB
# 
_entry.id   5TJB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TJB         
WWPDB D_1000224338 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5TJA PDB . 
unspecified 5TJC PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TJB 
_pdbx_database_status.recvd_initial_deposition_date   2016-10-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, M.'            1  
'Zhang, W.K.'       2  
'Benvin, N.M.'      3  
'Zhou, X.'          4  
'Su, D.'            5  
'Li, H.'            6  
'Wang, S.'          7  
'Michailidis, I.E.' 8  
'Tong, L.'          9  
'Li, X.'            10 
'Yang, J.'          11 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                205 
_citation.page_last                 213 
_citation.title                     'Structural basis of dual Ca(2+)/pH regulation of the endolysosomal TRPML1 channel.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nsmb.3362 
_citation.pdbx_database_id_PubMed   28112729 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, M.'            1  ? 
primary 'Zhang, W.K.'       2  ? 
primary 'Benvin, N.M.'      3  ? 
primary 'Zhou, X.'          4  ? 
primary 'Su, D.'            5  ? 
primary 'Li, H.'            6  ? 
primary 'Wang, S.'          7  ? 
primary 'Michailidis, I.E.' 8  ? 
primary 'Tong, L.'          9  ? 
primary 'Li, X.'            10 ? 
primary 'Yang, J.'          11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5TJB 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     94.353 
_cell.length_a_esd                 ? 
_cell.length_b                     94.353 
_cell.length_b_esd                 ? 
_cell.length_c                     50.715 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5TJB 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                90 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 4 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Mucolipin-1 25195.057 1   ? ? 'UNP residues (84-296)' ? 
2 water   nat water       18.015    104 ? ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        MG-2,Mucolipidin 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGS
GLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTIN
LQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGS
GLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTIN
LQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLY n 
1 4   LEU n 
1 5   SER n 
1 6   ASN n 
1 7   GLN n 
1 8   LEU n 
1 9   ALA n 
1 10  VAL n 
1 11  THR n 
1 12  PHE n 
1 13  ARG n 
1 14  GLU n 
1 15  GLU n 
1 16  ASN n 
1 17  THR n 
1 18  ILE n 
1 19  ALA n 
1 20  PHE n 
1 21  ARG n 
1 22  HIS n 
1 23  LEU n 
1 24  PHE n 
1 25  LEU n 
1 26  LEU n 
1 27  GLY n 
1 28  TYR n 
1 29  SER n 
1 30  ASP n 
1 31  GLY n 
1 32  ALA n 
1 33  ASP n 
1 34  ASP n 
1 35  THR n 
1 36  PHE n 
1 37  ALA n 
1 38  ALA n 
1 39  TYR n 
1 40  THR n 
1 41  ARG n 
1 42  GLU n 
1 43  GLN n 
1 44  LEU n 
1 45  TYR n 
1 46  GLN n 
1 47  ALA n 
1 48  ILE n 
1 49  PHE n 
1 50  HIS n 
1 51  ALA n 
1 52  VAL n 
1 53  ASP n 
1 54  GLN n 
1 55  TYR n 
1 56  LEU n 
1 57  ALA n 
1 58  LEU n 
1 59  PRO n 
1 60  ASP n 
1 61  VAL n 
1 62  SER n 
1 63  LEU n 
1 64  GLY n 
1 65  ARG n 
1 66  TYR n 
1 67  ALA n 
1 68  TYR n 
1 69  VAL n 
1 70  ARG n 
1 71  GLY n 
1 72  GLY n 
1 73  GLY n 
1 74  ASP n 
1 75  PRO n 
1 76  TRP n 
1 77  THR n 
1 78  ASN n 
1 79  GLY n 
1 80  SER n 
1 81  GLY n 
1 82  LEU n 
1 83  ALA n 
1 84  LEU n 
1 85  CYS n 
1 86  GLN n 
1 87  ARG n 
1 88  TYR n 
1 89  TYR n 
1 90  HIS n 
1 91  ARG n 
1 92  GLY n 
1 93  HIS n 
1 94  VAL n 
1 95  ASP n 
1 96  PRO n 
1 97  ALA n 
1 98  ASN n 
1 99  ASP n 
1 100 THR n 
1 101 PHE n 
1 102 ASP n 
1 103 ILE n 
1 104 ASP n 
1 105 PRO n 
1 106 MET n 
1 107 VAL n 
1 108 VAL n 
1 109 THR n 
1 110 ASP n 
1 111 CYS n 
1 112 ILE n 
1 113 GLN n 
1 114 VAL n 
1 115 ASP n 
1 116 PRO n 
1 117 PRO n 
1 118 GLU n 
1 119 ARG n 
1 120 PRO n 
1 121 PRO n 
1 122 PRO n 
1 123 PRO n 
1 124 PRO n 
1 125 SER n 
1 126 ASP n 
1 127 ASP n 
1 128 LEU n 
1 129 THR n 
1 130 LEU n 
1 131 LEU n 
1 132 GLU n 
1 133 SER n 
1 134 SER n 
1 135 SER n 
1 136 SER n 
1 137 TYR n 
1 138 LYS n 
1 139 ASN n 
1 140 LEU n 
1 141 THR n 
1 142 LEU n 
1 143 LYS n 
1 144 PHE n 
1 145 HIS n 
1 146 LYS n 
1 147 LEU n 
1 148 VAL n 
1 149 ASN n 
1 150 VAL n 
1 151 THR n 
1 152 ILE n 
1 153 HIS n 
1 154 PHE n 
1 155 ARG n 
1 156 LEU n 
1 157 LYS n 
1 158 THR n 
1 159 ILE n 
1 160 ASN n 
1 161 LEU n 
1 162 GLN n 
1 163 SER n 
1 164 LEU n 
1 165 ILE n 
1 166 ASN n 
1 167 ASN n 
1 168 GLU n 
1 169 ILE n 
1 170 PRO n 
1 171 ASP n 
1 172 CYS n 
1 173 TYR n 
1 174 THR n 
1 175 PHE n 
1 176 SER n 
1 177 VAL n 
1 178 LEU n 
1 179 ILE n 
1 180 THR n 
1 181 PHE n 
1 182 ASP n 
1 183 ASN n 
1 184 LYS n 
1 185 ALA n 
1 186 HIS n 
1 187 SER n 
1 188 GLY n 
1 189 ARG n 
1 190 ILE n 
1 191 PRO n 
1 192 ILE n 
1 193 SER n 
1 194 LEU n 
1 195 GLU n 
1 196 THR n 
1 197 GLN n 
1 198 ALA n 
1 199 HIS n 
1 200 ILE n 
1 201 GLN n 
1 202 GLU n 
1 203 CYS n 
1 204 LYS n 
1 205 HIS n 
1 206 PRO n 
1 207 SER n 
1 208 VAL n 
1 209 PHE n 
1 210 GLN n 
1 211 HIS n 
1 212 GLY n 
1 213 ASP n 
1 214 ASN n 
1 215 SER n 
1 216 LEU n 
1 217 GLU n 
1 218 HIS n 
1 219 HIS n 
1 220 HIS n 
1 221 HIS n 
1 222 HIS n 
1 223 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   223 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MCOLN1, ML4, MSTP080' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DE3 
_entity_src_gen.pdbx_host_org_variant              'Rosetta-gami 2' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET26b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MCLN1_HUMAN 
_struct_ref.pdbx_db_accession          Q9GZU1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGL
ALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTINLQ
SLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNS
;
_struct_ref.pdbx_align_begin           84 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5TJB 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9GZU1 
_struct_ref_seq.db_align_beg                  84 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  296 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       84 
_struct_ref_seq.pdbx_auth_seq_align_end       296 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5TJB GLY A 1   ? UNP Q9GZU1 ? ? 'expression tag' 82  1  
1 5TJB SER A 2   ? UNP Q9GZU1 ? ? 'expression tag' 83  2  
1 5TJB LEU A 216 ? UNP Q9GZU1 ? ? 'expression tag' 297 3  
1 5TJB GLU A 217 ? UNP Q9GZU1 ? ? 'expression tag' 298 4  
1 5TJB HIS A 218 ? UNP Q9GZU1 ? ? 'expression tag' 299 5  
1 5TJB HIS A 219 ? UNP Q9GZU1 ? ? 'expression tag' 300 6  
1 5TJB HIS A 220 ? UNP Q9GZU1 ? ? 'expression tag' 301 7  
1 5TJB HIS A 221 ? UNP Q9GZU1 ? ? 'expression tag' 302 8  
1 5TJB HIS A 222 ? UNP Q9GZU1 ? ? 'expression tag' 303 9  
1 5TJB HIS A 223 ? UNP Q9GZU1 ? ? 'expression tag' 304 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TJB 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.09 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              4.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '200 mM magnesium sulfate, 5.3% PEG 3350, and 100 mM acetate pH 4.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     'IMAGE PLATE' 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RIGAKU RAXIS IV' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-04-24 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU RUH3R' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5TJB 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.4 
_reflns.d_resolution_low                 20 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       9374 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.3 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.068 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.0 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.4 
_reflns_shell.d_res_low                   2.49 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.8 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.434 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -8.5910 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            -8.5910 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            17.1820 
_refine.B_iso_max                                93.020 
_refine.B_iso_mean                               42.0072 
_refine.B_iso_min                                24.070 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5TJB 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4000 
_refine.ls_d_res_low                             20.0000 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     8777 
_refine.ls_number_reflns_R_free                  927 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    93.5000 
_refine.ls_percent_reflns_R_free                 9.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       0.2523 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2117 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 53.9992 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5TJA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4000 
_refine_hist.d_res_low                        20.0000 
_refine_hist.pdbx_number_atoms_ligand         104 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1372 
_refine_hist.pdbx_number_residues_total       156 
_refine_hist.pdbx_B_iso_mean_ligand           45.73 
_refine_hist.pdbx_number_atoms_protein        1268 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007 ?     ? ? c_bond_d     ? ? 
'X-RAY DIFFRACTION' ? 1.491 ?     ? ? c_angle_d    ? ? 
'X-RAY DIFFRACTION' ? 1.421 1.500 ? ? c_mcbond_it  ? ? 
'X-RAY DIFFRACTION' ? 2.082 2.000 ? ? c_scbond_it  ? ? 
'X-RAY DIFFRACTION' ? 2.393 2.000 ? ? c_mcangle_it ? ? 
'X-RAY DIFFRACTION' ? 3.129 2.500 ? ? c_scangle_it ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4000 2.4900  792 . 78  714 86.3000 . . . 0.3639 . 0.3084 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.4900 2.5800  788 . 77  711 87.7000 . . . 0.3313 . 0.2953 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.5800 2.7000  849 . 83  766 90.6000 . . . 0.3680 . 0.2631 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.7000 2.8400  856 . 83  773 93.4000 . . . 0.2962 . 0.2535 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.8400 3.0200  864 . 101 763 93.6000 . . . 0.3047 . 0.2379 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.0200 3.2500  900 . 91  809 96.5000 . . . 0.2602 . 0.2176 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.2500 3.5800  887 . 92  795 95.6000 . . . 0.2364 . 0.2189 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.5800 4.0900  919 . 111 808 96.7000 . . . 0.2263 . 0.1865 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 4.0900 5.1400  945 . 103 842 97.9000 . . . 0.2209 . 0.1696 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 5.1400 20.0000 977 . 108 869 95.5000 . . . 0.2278 . 0.2019 . . . . . . 10 . . . 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 CNS_TOPPAR:protein_rep.param  CNS_TOPPAR:protein.top      
'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param  CNS_TOPPAR:dna-rna.top      
'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param    CNS_TOPPAR:water.top        
'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param          CNS_TOPPAR:ion.top          
'X-RAY DIFFRACTION' 5 CNS_TOPPAR:carbohydrate.param CNS_TOPPAR:carbohydrate.top 
# 
_struct.entry_id                     5TJB 
_struct.title                        'I-II linker of TRPML1 channel at pH 4.5' 
_struct.pdbx_descriptor              Mucolipin-1 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TJB 
_struct_keywords.text            'endolysosomal lumen, tetramer, calcium and pH regulation, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 THR A 11  ? LEU A 25  ? THR A 92  LEU A 106 1 ? 15 
HELX_P HELX_P2 AA2 THR A 40  ? SER A 62  ? THR A 121 SER A 143 1 ? 23 
HELX_P HELX_P3 AA3 LEU A 161 ? ASN A 167 ? LEU A 242 ASN A 248 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 85  SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 166 A CYS 192 1_555 ? ? ? ? ? ? ? 2.032 ? 
disulf2 disulf ? ? A CYS 172 SG ? ? ? 1_555 A CYS 203 SG ? ? A CYS 253 A CYS 284 1_555 ? ? ? ? ? ? ? 2.036 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          PRO 
_struct_mon_prot_cis.label_seq_id           116 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           PRO 
_struct_mon_prot_cis.auth_seq_id            197 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    117 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     198 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.44 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 37  ? ALA A 38  ? ALA A 118 ALA A 119 
AA1 2 ILE A 190 ? GLN A 201 ? ILE A 271 GLN A 282 
AA1 3 CYS A 172 ? ASP A 182 ? CYS A 253 ASP A 263 
AA1 4 LEU A 147 ? ILE A 159 ? LEU A 228 ILE A 240 
AA1 5 ALA A 67  ? ARG A 70  ? ALA A 148 ARG A 151 
AA2 1 ALA A 37  ? ALA A 38  ? ALA A 118 ALA A 119 
AA2 2 ILE A 190 ? GLN A 201 ? ILE A 271 GLN A 282 
AA2 3 CYS A 172 ? ASP A 182 ? CYS A 253 ASP A 263 
AA2 4 LEU A 147 ? ILE A 159 ? LEU A 228 ILE A 240 
AA2 5 LEU A 82  ? TYR A 88  ? LEU A 163 TYR A 169 
AA2 6 VAL A 108 ? VAL A 114 ? VAL A 189 VAL A 195 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 38  ? N ALA A 119 O ILE A 190 ? O ILE A 271 
AA1 2 3 O GLN A 197 ? O GLN A 278 N SER A 176 ? N SER A 257 
AA1 3 4 O TYR A 173 ? O TYR A 254 N THR A 158 ? N THR A 239 
AA1 4 5 O LYS A 157 ? O LYS A 238 N ALA A 67  ? N ALA A 148 
AA2 1 2 N ALA A 38  ? N ALA A 119 O ILE A 190 ? O ILE A 271 
AA2 2 3 O GLN A 197 ? O GLN A 278 N SER A 176 ? N SER A 257 
AA2 3 4 O TYR A 173 ? O TYR A 254 N THR A 158 ? N THR A 239 
AA2 4 5 O VAL A 148 ? O VAL A 229 N ARG A 87  ? N ARG A 168 
AA2 5 6 N LEU A 82  ? N LEU A 163 O VAL A 114 ? O VAL A 195 
# 
_atom_sites.entry_id                    5TJB 
_atom_sites.fract_transf_matrix[1][1]   0.010598 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010598 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.019718 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLN A 1 7   ? -13.692 -37.993 28.918 1.00 68.51 ? 88  GLN A N   1 
ATOM   2    C CA  . GLN A 1 7   ? -12.978 -36.915 28.167 1.00 68.87 ? 88  GLN A CA  1 
ATOM   3    C C   . GLN A 1 7   ? -12.633 -35.704 29.029 1.00 67.23 ? 88  GLN A C   1 
ATOM   4    O O   . GLN A 1 7   ? -13.490 -35.146 29.719 1.00 66.63 ? 88  GLN A O   1 
ATOM   5    C CB  . GLN A 1 7   ? -13.817 -36.449 26.975 1.00 70.83 ? 88  GLN A CB  1 
ATOM   6    C CG  . GLN A 1 7   ? -13.767 -37.371 25.776 1.00 74.01 ? 88  GLN A CG  1 
ATOM   7    C CD  . GLN A 1 7   ? -15.142 -37.792 25.308 1.00 75.04 ? 88  GLN A CD  1 
ATOM   8    O OE1 . GLN A 1 7   ? -16.160 -37.421 25.902 1.00 74.71 ? 88  GLN A OE1 1 
ATOM   9    N NE2 . GLN A 1 7   ? -15.180 -38.582 24.240 1.00 75.07 ? 88  GLN A NE2 1 
ATOM   10   N N   . LEU A 1 8   ? -11.372 -35.292 28.974 1.00 65.11 ? 89  LEU A N   1 
ATOM   11   C CA  . LEU A 1 8   ? -10.936 -34.150 29.756 1.00 62.53 ? 89  LEU A CA  1 
ATOM   12   C C   . LEU A 1 8   ? -11.369 -32.840 29.114 1.00 59.54 ? 89  LEU A C   1 
ATOM   13   O O   . LEU A 1 8   ? -11.193 -32.642 27.914 1.00 59.84 ? 89  LEU A O   1 
ATOM   14   C CB  . LEU A 1 8   ? -9.423  -34.135 29.909 1.00 63.22 ? 89  LEU A CB  1 
ATOM   15   C CG  . LEU A 1 8   ? -9.182  -33.434 31.242 1.00 64.27 ? 89  LEU A CG  1 
ATOM   16   C CD1 . LEU A 1 8   ? -9.313  -34.497 32.330 1.00 64.21 ? 89  LEU A CD1 1 
ATOM   17   C CD2 . LEU A 1 8   ? -7.824  -32.742 31.300 1.00 62.98 ? 89  LEU A CD2 1 
ATOM   18   N N   . ALA A 1 9   ? -11.930 -31.947 29.921 1.00 54.70 ? 90  ALA A N   1 
ATOM   19   C CA  . ALA A 1 9   ? -12.371 -30.672 29.400 1.00 51.01 ? 90  ALA A CA  1 
ATOM   20   C C   . ALA A 1 9   ? -11.154 -29.808 29.154 1.00 47.15 ? 90  ALA A C   1 
ATOM   21   O O   . ALA A 1 9   ? -10.174 -29.882 29.880 1.00 46.93 ? 90  ALA A O   1 
ATOM   22   C CB  . ALA A 1 9   ? -13.329 -29.994 30.377 1.00 50.43 ? 90  ALA A CB  1 
ATOM   23   N N   . VAL A 1 10  ? -11.217 -29.029 28.087 1.00 41.17 ? 91  VAL A N   1 
ATOM   24   C CA  . VAL A 1 10  ? -10.155 -28.112 27.722 1.00 37.43 ? 91  VAL A CA  1 
ATOM   25   C C   . VAL A 1 10  ? -10.896 -26.837 27.355 1.00 37.14 ? 91  VAL A C   1 
ATOM   26   O O   . VAL A 1 10  ? -12.113 -26.835 27.360 1.00 39.20 ? 91  VAL A O   1 
ATOM   27   C CB  . VAL A 1 10  ? -9.336  -28.622 26.499 1.00 36.20 ? 91  VAL A CB  1 
ATOM   28   C CG1 . VAL A 1 10  ? -8.486  -29.835 26.899 1.00 29.94 ? 91  VAL A CG1 1 
ATOM   29   C CG2 . VAL A 1 10  ? -10.254 -28.925 25.323 1.00 30.36 ? 91  VAL A CG2 1 
ATOM   30   N N   . THR A 1 11  ? -10.194 -25.759 27.045 1.00 33.21 ? 92  THR A N   1 
ATOM   31   C CA  . THR A 1 11  ? -10.886 -24.535 26.690 1.00 32.11 ? 92  THR A CA  1 
ATOM   32   C C   . THR A 1 11  ? -11.232 -24.591 25.225 1.00 31.19 ? 92  THR A C   1 
ATOM   33   O O   . THR A 1 11  ? -10.743 -25.447 24.509 1.00 31.01 ? 92  THR A O   1 
ATOM   34   C CB  . THR A 1 11  ? -10.018 -23.279 26.922 1.00 32.46 ? 92  THR A CB  1 
ATOM   35   O OG1 . THR A 1 11  ? -8.822  -23.368 26.143 1.00 32.60 ? 92  THR A OG1 1 
ATOM   36   C CG2 . THR A 1 11  ? -9.629  -23.145 28.360 1.00 32.48 ? 92  THR A CG2 1 
ATOM   37   N N   . PHE A 1 12  ? -12.084 -23.667 24.799 1.00 29.41 ? 93  PHE A N   1 
ATOM   38   C CA  . PHE A 1 12  ? -12.514 -23.544 23.412 1.00 29.75 ? 93  PHE A CA  1 
ATOM   39   C C   . PHE A 1 12  ? -11.277 -23.405 22.525 1.00 30.60 ? 93  PHE A C   1 
ATOM   40   O O   . PHE A 1 12  ? -11.165 -24.062 21.495 1.00 29.21 ? 93  PHE A O   1 
ATOM   41   C CB  . PHE A 1 12  ? -13.416 -22.311 23.246 1.00 28.66 ? 93  PHE A CB  1 
ATOM   42   C CG  . PHE A 1 12  ? -13.947 -22.131 21.854 1.00 28.34 ? 93  PHE A CG  1 
ATOM   43   C CD1 . PHE A 1 12  ? -14.776 -23.080 21.294 1.00 26.99 ? 93  PHE A CD1 1 
ATOM   44   C CD2 . PHE A 1 12  ? -13.626 -21.011 21.111 1.00 29.29 ? 93  PHE A CD2 1 
ATOM   45   C CE1 . PHE A 1 12  ? -15.275 -22.921 20.038 1.00 27.01 ? 93  PHE A CE1 1 
ATOM   46   C CE2 . PHE A 1 12  ? -14.124 -20.842 19.839 1.00 27.97 ? 93  PHE A CE2 1 
ATOM   47   C CZ  . PHE A 1 12  ? -14.955 -21.796 19.306 1.00 28.58 ? 93  PHE A CZ  1 
ATOM   48   N N   . ARG A 1 13  ? -10.349 -22.550 22.944 1.00 30.71 ? 94  ARG A N   1 
ATOM   49   C CA  . ARG A 1 13  ? -9.113  -22.325 22.201 1.00 33.52 ? 94  ARG A CA  1 
ATOM   50   C C   . ARG A 1 13  ? -8.383  -23.640 22.030 1.00 33.91 ? 94  ARG A C   1 
ATOM   51   O O   . ARG A 1 13  ? -7.935  -23.968 20.946 1.00 32.96 ? 94  ARG A O   1 
ATOM   52   C CB  . ARG A 1 13  ? -8.202  -21.358 22.958 1.00 33.82 ? 94  ARG A CB  1 
ATOM   53   C CG  . ARG A 1 13  ? -6.926  -20.938 22.216 1.00 33.67 ? 94  ARG A CG  1 
ATOM   54   C CD  . ARG A 1 13  ? -5.797  -20.602 23.212 1.00 34.47 ? 94  ARG A CD  1 
ATOM   55   N NE  . ARG A 1 13  ? -4.982  -21.780 23.526 1.00 40.85 ? 94  ARG A NE  1 
ATOM   56   C CZ  . ARG A 1 13  ? -4.575  -22.114 24.742 1.00 38.69 ? 94  ARG A CZ  1 
ATOM   57   N NH1 . ARG A 1 13  ? -4.911  -21.367 25.768 1.00 41.70 ? 94  ARG A NH1 1 
ATOM   58   N NH2 . ARG A 1 13  ? -3.828  -23.188 24.925 1.00 42.11 ? 94  ARG A NH2 1 
ATOM   59   N N   . GLU A 1 14  ? -8.272  -24.396 23.113 1.00 35.51 ? 95  GLU A N   1 
ATOM   60   C CA  . GLU A 1 14  ? -7.598  -25.683 23.078 1.00 36.00 ? 95  GLU A CA  1 
ATOM   61   C C   . GLU A 1 14  ? -8.286  -26.678 22.142 1.00 34.59 ? 95  GLU A C   1 
ATOM   62   O O   . GLU A 1 14  ? -7.611  -27.381 21.386 1.00 35.60 ? 95  GLU A O   1 
ATOM   63   C CB  . GLU A 1 14  ? -7.474  -26.237 24.509 1.00 37.73 ? 95  GLU A CB  1 
ATOM   64   C CG  . GLU A 1 14  ? -6.599  -25.339 25.385 1.00 43.48 ? 95  GLU A CG  1 
ATOM   65   C CD  . GLU A 1 14  ? -6.476  -25.802 26.834 1.00 47.04 ? 95  GLU A CD  1 
ATOM   66   O OE1 . GLU A 1 14  ? -7.518  -26.085 27.473 1.00 45.49 ? 95  GLU A OE1 1 
ATOM   67   O OE2 . GLU A 1 14  ? -5.328  -25.864 27.336 1.00 48.50 ? 95  GLU A OE2 1 
ATOM   68   N N   . GLU A 1 15  ? -9.615  -26.743 22.178 1.00 32.12 ? 96  GLU A N   1 
ATOM   69   C CA  . GLU A 1 15  ? -10.335 -27.643 21.275 1.00 32.84 ? 96  GLU A CA  1 
ATOM   70   C C   . GLU A 1 15  ? -9.980  -27.284 19.829 1.00 31.23 ? 96  GLU A C   1 
ATOM   71   O O   . GLU A 1 15  ? -9.724  -28.150 18.991 1.00 30.77 ? 96  GLU A O   1 
ATOM   72   C CB  . GLU A 1 15  ? -11.848 -27.504 21.449 1.00 33.63 ? 96  GLU A CB  1 
ATOM   73   C CG  . GLU A 1 15  ? -12.494 -28.679 22.126 1.00 41.35 ? 96  GLU A CG  1 
ATOM   74   C CD  . GLU A 1 15  ? -12.148 -29.992 21.452 1.00 41.19 ? 96  GLU A CD  1 
ATOM   75   O OE1 . GLU A 1 15  ? -12.578 -30.206 20.302 1.00 43.82 ? 96  GLU A OE1 1 
ATOM   76   O OE2 . GLU A 1 15  ? -11.440 -30.805 22.074 1.00 39.85 ? 96  GLU A OE2 1 
ATOM   77   N N   . ASN A 1 16  ? -9.991  -25.989 19.546 1.00 30.35 ? 97  ASN A N   1 
ATOM   78   C CA  . ASN A 1 16  ? -9.666  -25.486 18.225 1.00 30.49 ? 97  ASN A CA  1 
ATOM   79   C C   . ASN A 1 16  ? -8.226  -25.836 17.860 1.00 28.81 ? 97  ASN A C   1 
ATOM   80   O O   . ASN A 1 16  ? -7.941  -26.224 16.728 1.00 30.39 ? 97  ASN A O   1 
ATOM   81   C CB  . ASN A 1 16  ? -9.858  -23.965 18.198 1.00 30.21 ? 97  ASN A CB  1 
ATOM   82   C CG  . ASN A 1 16  ? -11.301 -23.561 17.966 1.00 29.66 ? 97  ASN A CG  1 
ATOM   83   O OD1 . ASN A 1 16  ? -11.733 -23.396 16.822 1.00 27.78 ? 97  ASN A OD1 1 
ATOM   84   N ND2 . ASN A 1 16  ? -12.058 -23.406 19.051 1.00 28.60 ? 97  ASN A ND2 1 
ATOM   85   N N   . THR A 1 17  ? -7.330  -25.704 18.834 1.00 28.54 ? 98  THR A N   1 
ATOM   86   C CA  . THR A 1 17  ? -5.910  -25.979 18.638 1.00 29.29 ? 98  THR A CA  1 
ATOM   87   C C   . THR A 1 17  ? -5.646  -27.430 18.254 1.00 28.36 ? 98  THR A C   1 
ATOM   88   O O   . THR A 1 17  ? -4.744  -27.712 17.470 1.00 29.65 ? 98  THR A O   1 
ATOM   89   C CB  . THR A 1 17  ? -5.109  -25.610 19.904 1.00 30.17 ? 98  THR A CB  1 
ATOM   90   O OG1 . THR A 1 17  ? -5.252  -24.208 20.147 1.00 28.97 ? 98  THR A OG1 1 
ATOM   91   C CG2 . THR A 1 17  ? -3.630  -25.934 19.732 1.00 29.99 ? 98  THR A CG2 1 
ATOM   92   N N   . ILE A 1 18  ? -6.430  -28.350 18.802 1.00 27.19 ? 99  ILE A N   1 
ATOM   93   C CA  . ILE A 1 18  ? -6.272  -29.756 18.460 1.00 27.74 ? 99  ILE A CA  1 
ATOM   94   C C   . ILE A 1 18  ? -6.604  -29.916 16.976 1.00 28.56 ? 99  ILE A C   1 
ATOM   95   O O   . ILE A 1 18  ? -5.912  -30.632 16.249 1.00 29.65 ? 99  ILE A O   1 
ATOM   96   C CB  . ILE A 1 18  ? -7.215  -30.659 19.289 1.00 26.79 ? 99  ILE A CB  1 
ATOM   97   C CG1 . ILE A 1 18  ? -6.768  -30.673 20.754 1.00 26.76 ? 99  ILE A CG1 1 
ATOM   98   C CG2 . ILE A 1 18  ? -7.225  -32.089 18.715 1.00 24.07 ? 99  ILE A CG2 1 
ATOM   99   C CD1 . ILE A 1 18  ? -7.678  -31.496 21.663 1.00 24.11 ? 99  ILE A CD1 1 
ATOM   100  N N   . ALA A 1 19  ? -7.661  -29.249 16.524 1.00 27.84 ? 100 ALA A N   1 
ATOM   101  C CA  . ALA A 1 19  ? -8.033  -29.326 15.117 1.00 28.10 ? 100 ALA A CA  1 
ATOM   102  C C   . ALA A 1 19  ? -6.887  -28.739 14.280 1.00 28.23 ? 100 ALA A C   1 
ATOM   103  O O   . ALA A 1 19  ? -6.539  -29.276 13.221 1.00 25.23 ? 100 ALA A O   1 
ATOM   104  C CB  . ALA A 1 19  ? -9.337  -28.554 14.866 1.00 27.72 ? 100 ALA A CB  1 
ATOM   105  N N   . PHE A 1 20  ? -6.291  -27.649 14.767 1.00 26.63 ? 101 PHE A N   1 
ATOM   106  C CA  . PHE A 1 20  ? -5.181  -27.017 14.050 1.00 29.74 ? 101 PHE A CA  1 
ATOM   107  C C   . PHE A 1 20  ? -3.991  -27.964 13.885 1.00 30.39 ? 101 PHE A C   1 
ATOM   108  O O   . PHE A 1 20  ? -3.315  -27.936 12.853 1.00 29.33 ? 101 PHE A O   1 
ATOM   109  C CB  . PHE A 1 20  ? -4.701  -25.741 14.762 1.00 29.72 ? 101 PHE A CB  1 
ATOM   110  C CG  . PHE A 1 20  ? -5.704  -24.614 14.757 1.00 30.07 ? 101 PHE A CG  1 
ATOM   111  C CD1 . PHE A 1 20  ? -6.791  -24.623 13.886 1.00 29.66 ? 101 PHE A CD1 1 
ATOM   112  C CD2 . PHE A 1 20  ? -5.547  -23.534 15.613 1.00 30.71 ? 101 PHE A CD2 1 
ATOM   113  C CE1 . PHE A 1 20  ? -7.710  -23.571 13.867 1.00 30.26 ? 101 PHE A CE1 1 
ATOM   114  C CE2 . PHE A 1 20  ? -6.462  -22.472 15.606 1.00 32.41 ? 101 PHE A CE2 1 
ATOM   115  C CZ  . PHE A 1 20  ? -7.547  -22.493 14.728 1.00 31.08 ? 101 PHE A CZ  1 
ATOM   116  N N   . ARG A 1 21  ? -3.728  -28.796 14.894 1.00 29.43 ? 102 ARG A N   1 
ATOM   117  C CA  . ARG A 1 21  ? -2.607  -29.729 14.804 1.00 30.68 ? 102 ARG A CA  1 
ATOM   118  C C   . ARG A 1 21  ? -2.859  -30.793 13.738 1.00 30.55 ? 102 ARG A C   1 
ATOM   119  O O   . ARG A 1 21  ? -1.942  -31.168 13.001 1.00 28.72 ? 102 ARG A O   1 
ATOM   120  C CB  . ARG A 1 21  ? -2.322  -30.386 16.162 1.00 29.38 ? 102 ARG A CB  1 
ATOM   121  C CG  . ARG A 1 21  ? -1.826  -29.398 17.213 1.00 27.19 ? 102 ARG A CG  1 
ATOM   122  C CD  . ARG A 1 21  ? -1.243  -30.104 18.434 1.00 28.88 ? 102 ARG A CD  1 
ATOM   123  N NE  . ARG A 1 21  ? -0.784  -29.147 19.438 1.00 28.12 ? 102 ARG A NE  1 
ATOM   124  C CZ  . ARG A 1 21  ? -1.541  -28.667 20.418 1.00 26.45 ? 102 ARG A CZ  1 
ATOM   125  N NH1 . ARG A 1 21  ? -2.800  -29.066 20.539 1.00 26.25 ? 102 ARG A NH1 1 
ATOM   126  N NH2 . ARG A 1 21  ? -1.052  -27.755 21.250 1.00 24.30 ? 102 ARG A NH2 1 
ATOM   127  N N   . HIS A 1 22  ? -4.102  -31.267 13.649 1.00 30.07 ? 103 HIS A N   1 
ATOM   128  C CA  . HIS A 1 22  ? -4.466  -32.270 12.652 1.00 30.04 ? 103 HIS A CA  1 
ATOM   129  C C   . HIS A 1 22  ? -4.423  -31.667 11.241 1.00 30.73 ? 103 HIS A C   1 
ATOM   130  O O   . HIS A 1 22  ? -3.983  -32.318 10.298 1.00 33.77 ? 103 HIS A O   1 
ATOM   131  C CB  . HIS A 1 22  ? -5.867  -32.822 12.949 1.00 30.94 ? 103 HIS A CB  1 
ATOM   132  C CG  . HIS A 1 22  ? -5.894  -33.838 14.051 1.00 30.94 ? 103 HIS A CG  1 
ATOM   133  N ND1 . HIS A 1 22  ? -5.800  -35.194 13.815 1.00 29.79 ? 103 HIS A ND1 1 
ATOM   134  C CD2 . HIS A 1 22  ? -5.933  -33.693 15.398 1.00 30.19 ? 103 HIS A CD2 1 
ATOM   135  C CE1 . HIS A 1 22  ? -5.777  -35.839 14.968 1.00 30.64 ? 103 HIS A CE1 1 
ATOM   136  N NE2 . HIS A 1 22  ? -5.856  -34.951 15.944 1.00 30.92 ? 103 HIS A NE2 1 
ATOM   137  N N   . LEU A 1 23  ? -4.866  -30.418 11.112 1.00 30.63 ? 104 LEU A N   1 
ATOM   138  C CA  . LEU A 1 23  ? -4.885  -29.714 9.830  1.00 30.45 ? 104 LEU A CA  1 
ATOM   139  C C   . LEU A 1 23  ? -3.531  -29.216 9.302  1.00 30.93 ? 104 LEU A C   1 
ATOM   140  O O   . LEU A 1 23  ? -3.237  -29.363 8.115  1.00 29.28 ? 104 LEU A O   1 
ATOM   141  C CB  . LEU A 1 23  ? -5.832  -28.508 9.899  1.00 30.98 ? 104 LEU A CB  1 
ATOM   142  C CG  . LEU A 1 23  ? -7.350  -28.708 9.953  1.00 34.42 ? 104 LEU A CG  1 
ATOM   143  C CD1 . LEU A 1 23  ? -8.016  -27.404 10.374 1.00 32.86 ? 104 LEU A CD1 1 
ATOM   144  C CD2 . LEU A 1 23  ? -7.875  -29.168 8.602  1.00 33.66 ? 104 LEU A CD2 1 
ATOM   145  N N   . PHE A 1 24  ? -2.711  -28.626 10.166 1.00 30.23 ? 105 PHE A N   1 
ATOM   146  C CA  . PHE A 1 24  ? -1.431  -28.080 9.715  1.00 31.83 ? 105 PHE A CA  1 
ATOM   147  C C   . PHE A 1 24  ? -0.167  -28.920 9.879  1.00 34.23 ? 105 PHE A C   1 
ATOM   148  O O   . PHE A 1 24  ? 0.825   -28.674 9.189  1.00 34.89 ? 105 PHE A O   1 
ATOM   149  C CB  . PHE A 1 24  ? -1.217  -26.716 10.360 1.00 30.35 ? 105 PHE A CB  1 
ATOM   150  C CG  . PHE A 1 24  ? -2.330  -25.752 10.088 1.00 29.81 ? 105 PHE A CG  1 
ATOM   151  C CD1 . PHE A 1 24  ? -2.606  -25.348 8.782  1.00 28.68 ? 105 PHE A CD1 1 
ATOM   152  C CD2 . PHE A 1 24  ? -3.127  -25.274 11.127 1.00 26.99 ? 105 PHE A CD2 1 
ATOM   153  C CE1 . PHE A 1 24  ? -3.660  -24.482 8.512  1.00 29.23 ? 105 PHE A CE1 1 
ATOM   154  C CE2 . PHE A 1 24  ? -4.184  -24.410 10.872 1.00 28.56 ? 105 PHE A CE2 1 
ATOM   155  C CZ  . PHE A 1 24  ? -4.452  -24.010 9.556  1.00 29.97 ? 105 PHE A CZ  1 
ATOM   156  N N   . LEU A 1 25  ? -0.189  -29.900 10.779 1.00 33.59 ? 106 LEU A N   1 
ATOM   157  C CA  . LEU A 1 25  ? 0.978   -30.746 10.996 1.00 32.33 ? 106 LEU A CA  1 
ATOM   158  C C   . LEU A 1 25  ? 0.843   -32.051 10.215 1.00 34.95 ? 106 LEU A C   1 
ATOM   159  O O   . LEU A 1 25  ? -0.050  -32.867 10.474 1.00 36.18 ? 106 LEU A O   1 
ATOM   160  C CB  . LEU A 1 25  ? 1.143   -31.034 12.484 1.00 31.84 ? 106 LEU A CB  1 
ATOM   161  C CG  . LEU A 1 25  ? 1.176   -29.810 13.404 1.00 31.48 ? 106 LEU A CG  1 
ATOM   162  C CD1 . LEU A 1 25  ? 1.290   -30.264 14.854 1.00 29.34 ? 106 LEU A CD1 1 
ATOM   163  C CD2 . LEU A 1 25  ? 2.343   -28.914 13.030 1.00 28.94 ? 106 LEU A CD2 1 
ATOM   164  N N   . LEU A 1 26  ? 1.740   -32.240 9.256  1.00 35.05 ? 107 LEU A N   1 
ATOM   165  C CA  . LEU A 1 26  ? 1.723   -33.421 8.406  1.00 35.16 ? 107 LEU A CA  1 
ATOM   166  C C   . LEU A 1 26  ? 2.009   -34.707 9.164  1.00 33.98 ? 107 LEU A C   1 
ATOM   167  O O   . LEU A 1 26  ? 3.057   -34.852 9.775  1.00 35.18 ? 107 LEU A O   1 
ATOM   168  C CB  . LEU A 1 26  ? 2.741   -33.253 7.276  1.00 33.55 ? 107 LEU A CB  1 
ATOM   169  C CG  . LEU A 1 26  ? 2.830   -34.361 6.227  1.00 33.49 ? 107 LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 26  ? 1.500   -34.513 5.499  1.00 32.13 ? 107 LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 26  ? 3.939   -34.010 5.236  1.00 34.91 ? 107 LEU A CD2 1 
ATOM   172  N N   . GLY A 1 27  ? 1.068   -35.638 9.127  1.00 33.66 ? 108 GLY A N   1 
ATOM   173  C CA  . GLY A 1 27  ? 1.275   -36.905 9.801  1.00 35.93 ? 108 GLY A CA  1 
ATOM   174  C C   . GLY A 1 27  ? 0.991   -36.878 11.290 1.00 37.41 ? 108 GLY A C   1 
ATOM   175  O O   . GLY A 1 27  ? 1.149   -37.886 11.981 1.00 38.09 ? 108 GLY A O   1 
ATOM   176  N N   . TYR A 1 28  ? 0.577   -35.725 11.793 1.00 35.79 ? 109 TYR A N   1 
ATOM   177  C CA  . TYR A 1 28  ? 0.268   -35.605 13.202 1.00 36.34 ? 109 TYR A CA  1 
ATOM   178  C C   . TYR A 1 28  ? -0.812  -36.602 13.604 1.00 38.25 ? 109 TYR A C   1 
ATOM   179  O O   . TYR A 1 28  ? -1.673  -36.968 12.796 1.00 39.29 ? 109 TYR A O   1 
ATOM   180  C CB  . TYR A 1 28  ? -0.241  -34.205 13.521 1.00 36.26 ? 109 TYR A CB  1 
ATOM   181  C CG  . TYR A 1 28  ? -0.731  -34.070 14.943 1.00 35.04 ? 109 TYR A CG  1 
ATOM   182  C CD1 . TYR A 1 28  ? 0.163   -33.878 15.996 1.00 33.76 ? 109 TYR A CD1 1 
ATOM   183  C CD2 . TYR A 1 28  ? -2.089  -34.174 15.243 1.00 33.25 ? 109 TYR A CD2 1 
ATOM   184  C CE1 . TYR A 1 28  ? -0.283  -33.793 17.309 1.00 31.90 ? 109 TYR A CE1 1 
ATOM   185  C CE2 . TYR A 1 28  ? -2.540  -34.093 16.551 1.00 30.76 ? 109 TYR A CE2 1 
ATOM   186  C CZ  . TYR A 1 28  ? -1.633  -33.903 17.576 1.00 31.14 ? 109 TYR A CZ  1 
ATOM   187  O OH  . TYR A 1 28  ? -2.080  -33.824 18.869 1.00 32.10 ? 109 TYR A OH  1 
ATOM   188  N N   . SER A 1 29  ? -0.758  -37.038 14.856 1.00 36.76 ? 110 SER A N   1 
ATOM   189  C CA  . SER A 1 29  ? -1.753  -37.954 15.395 1.00 37.20 ? 110 SER A CA  1 
ATOM   190  C C   . SER A 1 29  ? -1.822  -37.699 16.888 1.00 36.83 ? 110 SER A C   1 
ATOM   191  O O   . SER A 1 29  ? -0.819  -37.348 17.514 1.00 36.77 ? 110 SER A O   1 
ATOM   192  C CB  . SER A 1 29  ? -1.373  -39.408 15.124 1.00 37.51 ? 110 SER A CB  1 
ATOM   193  O OG  . SER A 1 29  ? -0.163  -39.735 15.769 1.00 40.64 ? 110 SER A OG  1 
ATOM   194  N N   . ASP A 1 30  ? -3.006  -37.862 17.461 1.00 36.60 ? 111 ASP A N   1 
ATOM   195  C CA  . ASP A 1 30  ? -3.185  -37.630 18.887 1.00 37.76 ? 111 ASP A CA  1 
ATOM   196  C C   . ASP A 1 30  ? -2.191  -38.412 19.750 1.00 39.81 ? 111 ASP A C   1 
ATOM   197  O O   . ASP A 1 30  ? -1.871  -39.571 19.461 1.00 39.69 ? 111 ASP A O   1 
ATOM   198  C CB  . ASP A 1 30  ? -4.615  -37.983 19.274 1.00 36.53 ? 111 ASP A CB  1 
ATOM   199  C CG  . ASP A 1 30  ? -5.635  -37.245 18.433 1.00 37.15 ? 111 ASP A CG  1 
ATOM   200  O OD1 . ASP A 1 30  ? -5.641  -35.998 18.466 1.00 35.98 ? 111 ASP A OD1 1 
ATOM   201  O OD2 . ASP A 1 30  ? -6.424  -37.907 17.732 1.00 38.22 ? 111 ASP A OD2 1 
ATOM   202  N N   . GLY A 1 31  ? -1.691  -37.759 20.796 1.00 41.48 ? 112 GLY A N   1 
ATOM   203  C CA  . GLY A 1 31  ? -0.749  -38.395 21.704 1.00 44.63 ? 112 GLY A CA  1 
ATOM   204  C C   . GLY A 1 31  ? 0.721   -38.351 21.313 1.00 46.23 ? 112 GLY A C   1 
ATOM   205  O O   . GLY A 1 31  ? 1.574   -38.866 22.034 1.00 47.61 ? 112 GLY A O   1 
ATOM   206  N N   . ALA A 1 32  ? 1.027   -37.732 20.182 1.00 46.23 ? 113 ALA A N   1 
ATOM   207  C CA  . ALA A 1 32  ? 2.405   -37.654 19.727 1.00 47.32 ? 113 ALA A CA  1 
ATOM   208  C C   . ALA A 1 32  ? 2.966   -36.251 19.855 1.00 46.88 ? 113 ALA A C   1 
ATOM   209  O O   . ALA A 1 32  ? 3.991   -35.944 19.257 1.00 48.15 ? 113 ALA A O   1 
ATOM   210  C CB  . ALA A 1 32  ? 2.494   -38.104 18.272 1.00 47.52 ? 113 ALA A CB  1 
ATOM   211  N N   . ASP A 1 33  ? 2.314   -35.404 20.642 1.00 46.63 ? 114 ASP A N   1 
ATOM   212  C CA  . ASP A 1 33  ? 2.769   -34.024 20.782 1.00 47.06 ? 114 ASP A CA  1 
ATOM   213  C C   . ASP A 1 33  ? 4.212   -33.794 21.214 1.00 47.35 ? 114 ASP A C   1 
ATOM   214  O O   . ASP A 1 33  ? 4.882   -32.932 20.653 1.00 47.44 ? 114 ASP A O   1 
ATOM   215  C CB  . ASP A 1 33  ? 1.850   -33.232 21.719 1.00 46.61 ? 114 ASP A CB  1 
ATOM   216  C CG  . ASP A 1 33  ? 0.465   -33.024 21.143 1.00 45.77 ? 114 ASP A CG  1 
ATOM   217  O OD1 . ASP A 1 33  ? -0.184  -32.020 21.508 1.00 44.94 ? 114 ASP A OD1 1 
ATOM   218  O OD2 . ASP A 1 33  ? 0.021   -33.867 20.338 1.00 47.14 ? 114 ASP A OD2 1 
ATOM   219  N N   . ASP A 1 34  ? 4.710   -34.530 22.200 1.00 47.95 ? 115 ASP A N   1 
ATOM   220  C CA  . ASP A 1 34  ? 6.086   -34.273 22.614 1.00 50.29 ? 115 ASP A CA  1 
ATOM   221  C C   . ASP A 1 34  ? 7.167   -35.133 21.988 1.00 48.53 ? 115 ASP A C   1 
ATOM   222  O O   . ASP A 1 34  ? 8.294   -35.144 22.468 1.00 49.98 ? 115 ASP A O   1 
ATOM   223  C CB  . ASP A 1 34  ? 6.224   -34.302 24.139 1.00 54.17 ? 115 ASP A CB  1 
ATOM   224  C CG  . ASP A 1 34  ? 5.190   -35.172 24.803 1.00 59.07 ? 115 ASP A CG  1 
ATOM   225  O OD1 . ASP A 1 34  ? 5.143   -36.384 24.491 1.00 61.90 ? 115 ASP A OD1 1 
ATOM   226  O OD2 . ASP A 1 34  ? 4.424   -34.637 25.640 1.00 60.05 ? 115 ASP A OD2 1 
ATOM   227  N N   . THR A 1 35  ? 6.831   -35.861 20.931 1.00 45.15 ? 116 THR A N   1 
ATOM   228  C CA  . THR A 1 35  ? 7.835   -36.654 20.242 1.00 42.64 ? 116 THR A CA  1 
ATOM   229  C C   . THR A 1 35  ? 7.792   -36.273 18.767 1.00 40.24 ? 116 THR A C   1 
ATOM   230  O O   . THR A 1 35  ? 8.721   -36.553 18.019 1.00 40.83 ? 116 THR A O   1 
ATOM   231  C CB  . THR A 1 35  ? 7.602   -38.181 20.373 1.00 42.70 ? 116 THR A CB  1 
ATOM   232  O OG1 . THR A 1 35  ? 6.315   -38.527 19.851 1.00 43.45 ? 116 THR A OG1 1 
ATOM   233  C CG2 . THR A 1 35  ? 7.720   -38.615 21.818 1.00 41.95 ? 116 THR A CG2 1 
ATOM   234  N N   . PHE A 1 36  ? 6.711   -35.618 18.361 1.00 36.60 ? 117 PHE A N   1 
ATOM   235  C CA  . PHE A 1 36  ? 6.547   -35.204 16.971 1.00 35.17 ? 117 PHE A CA  1 
ATOM   236  C C   . PHE A 1 36  ? 7.772   -34.390 16.541 1.00 33.49 ? 117 PHE A C   1 
ATOM   237  O O   . PHE A 1 36  ? 8.096   -33.368 17.153 1.00 31.09 ? 117 PHE A O   1 
ATOM   238  C CB  . PHE A 1 36  ? 5.267   -34.373 16.828 1.00 33.55 ? 117 PHE A CB  1 
ATOM   239  C CG  . PHE A 1 36  ? 4.798   -34.216 15.413 1.00 33.44 ? 117 PHE A CG  1 
ATOM   240  C CD1 . PHE A 1 36  ? 4.423   -35.328 14.665 1.00 32.66 ? 117 PHE A CD1 1 
ATOM   241  C CD2 . PHE A 1 36  ? 4.719   -32.950 14.830 1.00 32.80 ? 117 PHE A CD2 1 
ATOM   242  C CE1 . PHE A 1 36  ? 3.976   -35.186 13.355 1.00 34.43 ? 117 PHE A CE1 1 
ATOM   243  C CE2 . PHE A 1 36  ? 4.275   -32.792 13.523 1.00 33.27 ? 117 PHE A CE2 1 
ATOM   244  C CZ  . PHE A 1 36  ? 3.901   -33.913 12.779 1.00 35.06 ? 117 PHE A CZ  1 
ATOM   245  N N   . ALA A 1 37  ? 8.452   -34.849 15.494 1.00 32.47 ? 118 ALA A N   1 
ATOM   246  C CA  . ALA A 1 37  ? 9.651   -34.161 15.018 1.00 33.44 ? 118 ALA A CA  1 
ATOM   247  C C   . ALA A 1 37  ? 10.027  -34.530 13.588 1.00 33.97 ? 118 ALA A C   1 
ATOM   248  O O   . ALA A 1 37  ? 9.435   -35.424 12.985 1.00 33.64 ? 118 ALA A O   1 
ATOM   249  C CB  . ALA A 1 37  ? 10.830  -34.463 15.956 1.00 32.71 ? 118 ALA A CB  1 
ATOM   250  N N   . ALA A 1 38  ? 11.022  -33.827 13.054 1.00 34.64 ? 119 ALA A N   1 
ATOM   251  C CA  . ALA A 1 38  ? 11.504  -34.066 11.703 1.00 33.50 ? 119 ALA A CA  1 
ATOM   252  C C   . ALA A 1 38  ? 12.923  -34.599 11.804 1.00 33.47 ? 119 ALA A C   1 
ATOM   253  O O   . ALA A 1 38  ? 13.673  -34.211 12.703 1.00 33.08 ? 119 ALA A O   1 
ATOM   254  C CB  . ALA A 1 38  ? 11.482  -32.770 10.907 1.00 34.56 ? 119 ALA A CB  1 
ATOM   255  N N   . TYR A 1 39  ? 13.295  -35.479 10.881 1.00 32.63 ? 120 TYR A N   1 
ATOM   256  C CA  . TYR A 1 39  ? 14.634  -36.063 10.901 1.00 31.92 ? 120 TYR A CA  1 
ATOM   257  C C   . TYR A 1 39  ? 15.395  -35.918 9.584  1.00 32.33 ? 120 TYR A C   1 
ATOM   258  O O   . TYR A 1 39  ? 16.588  -36.216 9.523  1.00 33.76 ? 120 TYR A O   1 
ATOM   259  C CB  . TYR A 1 39  ? 14.543  -37.540 11.298 1.00 29.08 ? 120 TYR A CB  1 
ATOM   260  C CG  . TYR A 1 39  ? 13.953  -37.741 12.676 1.00 28.61 ? 120 TYR A CG  1 
ATOM   261  C CD1 . TYR A 1 39  ? 14.758  -37.690 13.820 1.00 29.21 ? 120 TYR A CD1 1 
ATOM   262  C CD2 . TYR A 1 39  ? 12.580  -37.908 12.846 1.00 27.98 ? 120 TYR A CD2 1 
ATOM   263  C CE1 . TYR A 1 39  ? 14.208  -37.795 15.101 1.00 27.03 ? 120 TYR A CE1 1 
ATOM   264  C CE2 . TYR A 1 39  ? 12.021  -38.010 14.118 1.00 27.70 ? 120 TYR A CE2 1 
ATOM   265  C CZ  . TYR A 1 39  ? 12.839  -37.950 15.235 1.00 28.26 ? 120 TYR A CZ  1 
ATOM   266  O OH  . TYR A 1 39  ? 12.273  -38.026 16.477 1.00 28.52 ? 120 TYR A OH  1 
ATOM   267  N N   . THR A 1 40  ? 14.713  -35.476 8.532  1.00 30.10 ? 121 THR A N   1 
ATOM   268  C CA  . THR A 1 40  ? 15.370  -35.295 7.246  1.00 32.15 ? 121 THR A CA  1 
ATOM   269  C C   . THR A 1 40  ? 14.981  -33.964 6.624  1.00 34.46 ? 121 THR A C   1 
ATOM   270  O O   . THR A 1 40  ? 13.983  -33.342 7.003  1.00 33.20 ? 121 THR A O   1 
ATOM   271  C CB  . THR A 1 40  ? 15.011  -36.409 6.235  1.00 31.63 ? 121 THR A CB  1 
ATOM   272  O OG1 . THR A 1 40  ? 13.647  -36.262 5.826  1.00 32.88 ? 121 THR A OG1 1 
ATOM   273  C CG2 . THR A 1 40  ? 15.203  -37.779 6.854  1.00 31.02 ? 121 THR A CG2 1 
ATOM   274  N N   . ARG A 1 41  ? 15.774  -33.537 5.653  1.00 36.09 ? 122 ARG A N   1 
ATOM   275  C CA  . ARG A 1 41  ? 15.526  -32.281 4.971  1.00 38.20 ? 122 ARG A CA  1 
ATOM   276  C C   . ARG A 1 41  ? 14.199  -32.326 4.228  1.00 39.02 ? 122 ARG A C   1 
ATOM   277  O O   . ARG A 1 41  ? 13.423  -31.371 4.251  1.00 40.52 ? 122 ARG A O   1 
ATOM   278  C CB  . ARG A 1 41  ? 16.675  -31.996 4.008  1.00 38.19 ? 122 ARG A CB  1 
ATOM   279  C CG  . ARG A 1 41  ? 18.012  -31.918 4.718  1.00 39.16 ? 122 ARG A CG  1 
ATOM   280  C CD  . ARG A 1 41  ? 19.099  -31.416 3.810  1.00 39.52 ? 122 ARG A CD  1 
ATOM   281  N NE  . ARG A 1 41  ? 20.329  -31.132 4.540  1.00 39.07 ? 122 ARG A NE  1 
ATOM   282  C CZ  . ARG A 1 41  ? 21.333  -30.422 4.043  1.00 39.20 ? 122 ARG A CZ  1 
ATOM   283  N NH1 . ARG A 1 41  ? 21.244  -29.927 2.818  1.00 39.02 ? 122 ARG A NH1 1 
ATOM   284  N NH2 . ARG A 1 41  ? 22.422  -30.208 4.768  1.00 40.38 ? 122 ARG A NH2 1 
ATOM   285  N N   . GLU A 1 42  ? 13.936  -33.450 3.580  1.00 39.54 ? 123 GLU A N   1 
ATOM   286  C CA  . GLU A 1 42  ? 12.703  -33.630 2.829  1.00 40.14 ? 123 GLU A CA  1 
ATOM   287  C C   . GLU A 1 42  ? 11.483  -33.558 3.754  1.00 38.17 ? 123 GLU A C   1 
ATOM   288  O O   . GLU A 1 42  ? 10.469  -32.936 3.418  1.00 35.23 ? 123 GLU A O   1 
ATOM   289  C CB  . GLU A 1 42  ? 12.768  -34.968 2.096  1.00 45.27 ? 123 GLU A CB  1 
ATOM   290  C CG  . GLU A 1 42  ? 11.517  -35.352 1.352  1.00 54.97 ? 123 GLU A CG  1 
ATOM   291  C CD  . GLU A 1 42  ? 11.763  -36.503 0.398  1.00 60.51 ? 123 GLU A CD  1 
ATOM   292  O OE1 . GLU A 1 42  ? 12.516  -37.432 0.774  1.00 63.21 ? 123 GLU A OE1 1 
ATOM   293  O OE2 . GLU A 1 42  ? 11.203  -36.480 -0.723 1.00 63.54 ? 123 GLU A OE2 1 
ATOM   294  N N   . GLN A 1 43  ? 11.588  -34.191 4.921  1.00 36.05 ? 124 GLN A N   1 
ATOM   295  C CA  . GLN A 1 43  ? 10.508  -34.169 5.903  1.00 34.54 ? 124 GLN A CA  1 
ATOM   296  C C   . GLN A 1 43  ? 10.256  -32.741 6.358  1.00 33.10 ? 124 GLN A C   1 
ATOM   297  O O   . GLN A 1 43  ? 9.114   -32.303 6.477  1.00 33.83 ? 124 GLN A O   1 
ATOM   298  C CB  . GLN A 1 43  ? 10.879  -34.995 7.128  1.00 35.43 ? 124 GLN A CB  1 
ATOM   299  C CG  . GLN A 1 43  ? 10.554  -36.454 7.048  1.00 36.60 ? 124 GLN A CG  1 
ATOM   300  C CD  . GLN A 1 43  ? 11.293  -37.238 8.106  1.00 39.18 ? 124 GLN A CD  1 
ATOM   301  O OE1 . GLN A 1 43  ? 11.455  -36.774 9.238  1.00 39.86 ? 124 GLN A OE1 1 
ATOM   302  N NE2 . GLN A 1 43  ? 11.746  -38.435 7.747  1.00 39.23 ? 124 GLN A NE2 1 
ATOM   303  N N   . LEU A 1 44  ? 11.333  -32.016 6.632  1.00 32.38 ? 125 LEU A N   1 
ATOM   304  C CA  . LEU A 1 44  ? 11.191  -30.647 7.080  1.00 32.56 ? 125 LEU A CA  1 
ATOM   305  C C   . LEU A 1 44  ? 10.605  -29.783 5.977  1.00 34.60 ? 125 LEU A C   1 
ATOM   306  O O   . LEU A 1 44  ? 9.840   -28.863 6.261  1.00 37.40 ? 125 LEU A O   1 
ATOM   307  C CB  . LEU A 1 44  ? 12.531  -30.083 7.551  1.00 30.30 ? 125 LEU A CB  1 
ATOM   308  C CG  . LEU A 1 44  ? 12.466  -28.655 8.098  1.00 29.62 ? 125 LEU A CG  1 
ATOM   309  C CD1 . LEU A 1 44  ? 11.320  -28.527 9.081  1.00 30.10 ? 125 LEU A CD1 1 
ATOM   310  C CD2 . LEU A 1 44  ? 13.782  -28.300 8.764  1.00 31.36 ? 125 LEU A CD2 1 
ATOM   311  N N   . TYR A 1 45  ? 10.947  -30.075 4.721  1.00 35.44 ? 126 TYR A N   1 
ATOM   312  C CA  . TYR A 1 45  ? 10.399  -29.301 3.605  1.00 36.26 ? 126 TYR A CA  1 
ATOM   313  C C   . TYR A 1 45  ? 8.909   -29.623 3.417  1.00 36.20 ? 126 TYR A C   1 
ATOM   314  O O   . TYR A 1 45  ? 8.079   -28.722 3.286  1.00 34.77 ? 126 TYR A O   1 
ATOM   315  C CB  . TYR A 1 45  ? 11.172  -29.583 2.299  1.00 36.30 ? 126 TYR A CB  1 
ATOM   316  C CG  . TYR A 1 45  ? 12.321  -28.617 2.018  1.00 34.50 ? 126 TYR A CG  1 
ATOM   317  C CD1 . TYR A 1 45  ? 12.103  -27.238 1.979  1.00 32.96 ? 126 TYR A CD1 1 
ATOM   318  C CD2 . TYR A 1 45  ? 13.635  -29.084 1.822  1.00 35.50 ? 126 TYR A CD2 1 
ATOM   319  C CE1 . TYR A 1 45  ? 13.155  -26.340 1.761  1.00 32.60 ? 126 TYR A CE1 1 
ATOM   320  C CE2 . TYR A 1 45  ? 14.703  -28.192 1.602  1.00 32.43 ? 126 TYR A CE2 1 
ATOM   321  C CZ  . TYR A 1 45  ? 14.454  -26.820 1.579  1.00 34.43 ? 126 TYR A CZ  1 
ATOM   322  O OH  . TYR A 1 45  ? 15.494  -25.922 1.414  1.00 34.44 ? 126 TYR A OH  1 
ATOM   323  N N   . GLN A 1 46  ? 8.570   -30.907 3.428  1.00 37.31 ? 127 GLN A N   1 
ATOM   324  C CA  . GLN A 1 46  ? 7.184   -31.327 3.252  1.00 39.06 ? 127 GLN A CA  1 
ATOM   325  C C   . GLN A 1 46  ? 6.290   -30.779 4.356  1.00 38.57 ? 127 GLN A C   1 
ATOM   326  O O   . GLN A 1 46  ? 5.145   -30.382 4.111  1.00 38.51 ? 127 GLN A O   1 
ATOM   327  C CB  . GLN A 1 46  ? 7.085   -32.848 3.257  1.00 42.80 ? 127 GLN A CB  1 
ATOM   328  C CG  . GLN A 1 46  ? 7.959   -33.544 2.241  1.00 50.02 ? 127 GLN A CG  1 
ATOM   329  C CD  . GLN A 1 46  ? 7.852   -35.053 2.358  1.00 55.19 ? 127 GLN A CD  1 
ATOM   330  O OE1 . GLN A 1 46  ? 6.814   -35.638 2.031  1.00 58.33 ? 127 GLN A OE1 1 
ATOM   331  N NE2 . GLN A 1 46  ? 8.919   -35.693 2.842  1.00 55.52 ? 127 GLN A NE2 1 
ATOM   332  N N   . ALA A 1 47  ? 6.816   -30.772 5.575  1.00 36.64 ? 128 ALA A N   1 
ATOM   333  C CA  . ALA A 1 47  ? 6.068   -30.283 6.720  1.00 36.30 ? 128 ALA A CA  1 
ATOM   334  C C   . ALA A 1 47  ? 5.742   -28.803 6.558  1.00 36.07 ? 128 ALA A C   1 
ATOM   335  O O   . ALA A 1 47  ? 4.603   -28.371 6.745  1.00 37.42 ? 128 ALA A O   1 
ATOM   336  C CB  . ALA A 1 47  ? 6.871   -30.507 7.995  1.00 35.40 ? 128 ALA A CB  1 
ATOM   337  N N   . ILE A 1 48  ? 6.753   -28.024 6.207  1.00 35.47 ? 129 ILE A N   1 
ATOM   338  C CA  . ILE A 1 48  ? 6.565   -26.597 6.033  1.00 35.58 ? 129 ILE A CA  1 
ATOM   339  C C   . ILE A 1 48  ? 5.572   -26.306 4.920  1.00 34.98 ? 129 ILE A C   1 
ATOM   340  O O   . ILE A 1 48  ? 4.653   -25.509 5.094  1.00 34.19 ? 129 ILE A O   1 
ATOM   341  C CB  . ILE A 1 48  ? 7.917   -25.904 5.727  1.00 37.17 ? 129 ILE A CB  1 
ATOM   342  C CG1 . ILE A 1 48  ? 8.810   -25.960 6.966  1.00 35.71 ? 129 ILE A CG1 1 
ATOM   343  C CG2 . ILE A 1 48  ? 7.696   -24.453 5.297  1.00 35.87 ? 129 ILE A CG2 1 
ATOM   344  C CD1 . ILE A 1 48  ? 10.210  -25.512 6.708  1.00 34.52 ? 129 ILE A CD1 1 
ATOM   345  N N   . PHE A 1 49  ? 5.752   -26.956 3.776  1.00 35.19 ? 130 PHE A N   1 
ATOM   346  C CA  . PHE A 1 49  ? 4.859   -26.728 2.654  1.00 34.49 ? 130 PHE A CA  1 
ATOM   347  C C   . PHE A 1 49  ? 3.444   -27.173 2.977  1.00 35.00 ? 130 PHE A C   1 
ATOM   348  O O   . PHE A 1 49  ? 2.483   -26.457 2.694  1.00 35.49 ? 130 PHE A O   1 
ATOM   349  C CB  . PHE A 1 49  ? 5.384   -27.438 1.402  1.00 34.66 ? 130 PHE A CB  1 
ATOM   350  C CG  . PHE A 1 49  ? 6.689   -26.880 0.900  1.00 34.86 ? 130 PHE A CG  1 
ATOM   351  C CD1 . PHE A 1 49  ? 6.939   -25.510 0.953  1.00 35.57 ? 130 PHE A CD1 1 
ATOM   352  C CD2 . PHE A 1 49  ? 7.679   -27.719 0.394  1.00 34.88 ? 130 PHE A CD2 1 
ATOM   353  C CE1 . PHE A 1 49  ? 8.156   -24.983 0.514  1.00 35.37 ? 130 PHE A CE1 1 
ATOM   354  C CE2 . PHE A 1 49  ? 8.899   -27.201 -0.048 1.00 34.37 ? 130 PHE A CE2 1 
ATOM   355  C CZ  . PHE A 1 49  ? 9.137   -25.830 0.015  1.00 32.54 ? 130 PHE A CZ  1 
ATOM   356  N N   . HIS A 1 50  ? 3.309   -28.346 3.583  1.00 33.93 ? 131 HIS A N   1 
ATOM   357  C CA  . HIS A 1 50  ? 1.989   -28.835 3.937  1.00 33.50 ? 131 HIS A CA  1 
ATOM   358  C C   . HIS A 1 50  ? 1.237   -27.811 4.805  1.00 33.66 ? 131 HIS A C   1 
ATOM   359  O O   . HIS A 1 50  ? 0.053   -27.535 4.591  1.00 30.91 ? 131 HIS A O   1 
ATOM   360  C CB  . HIS A 1 50  ? 2.099   -30.148 4.693  1.00 33.88 ? 131 HIS A CB  1 
ATOM   361  C CG  . HIS A 1 50  ? 0.780   -30.692 5.128  1.00 35.22 ? 131 HIS A CG  1 
ATOM   362  N ND1 . HIS A 1 50  ? -0.107  -31.277 4.251  1.00 36.23 ? 131 HIS A ND1 1 
ATOM   363  C CD2 . HIS A 1 50  ? 0.176   -30.704 6.340  1.00 36.90 ? 131 HIS A CD2 1 
ATOM   364  C CE1 . HIS A 1 50  ? -1.202  -31.627 4.904  1.00 36.89 ? 131 HIS A CE1 1 
ATOM   365  N NE2 . HIS A 1 50  ? -1.056  -31.290 6.173  1.00 37.51 ? 131 HIS A NE2 1 
ATOM   366  N N   . ALA A 1 51  ? 1.926   -27.245 5.785  1.00 32.02 ? 132 ALA A N   1 
ATOM   367  C CA  . ALA A 1 51  ? 1.291   -26.272 6.656  1.00 33.90 ? 132 ALA A CA  1 
ATOM   368  C C   . ALA A 1 51  ? 0.784   -25.070 5.857  1.00 33.82 ? 132 ALA A C   1 
ATOM   369  O O   . ALA A 1 51  ? -0.380  -24.676 5.975  1.00 33.29 ? 132 ALA A O   1 
ATOM   370  C CB  . ALA A 1 51  ? 2.274   -25.818 7.744  1.00 32.13 ? 132 ALA A CB  1 
ATOM   371  N N   . VAL A 1 52  ? 1.653   -24.502 5.029  1.00 33.02 ? 133 VAL A N   1 
ATOM   372  C CA  . VAL A 1 52  ? 1.272   -23.342 4.231  1.00 33.65 ? 133 VAL A CA  1 
ATOM   373  C C   . VAL A 1 52  ? 0.150   -23.677 3.246  1.00 32.70 ? 133 VAL A C   1 
ATOM   374  O O   . VAL A 1 52  ? -0.816  -22.931 3.145  1.00 33.72 ? 133 VAL A O   1 
ATOM   375  C CB  . VAL A 1 52  ? 2.500   -22.756 3.476  1.00 33.84 ? 133 VAL A CB  1 
ATOM   376  C CG1 . VAL A 1 52  ? 2.095   -21.505 2.707  1.00 31.78 ? 133 VAL A CG1 1 
ATOM   377  C CG2 . VAL A 1 52  ? 3.619   -22.427 4.480  1.00 31.73 ? 133 VAL A CG2 1 
ATOM   378  N N   . ASP A 1 53  ? 0.274   -24.791 2.528  1.00 32.88 ? 134 ASP A N   1 
ATOM   379  C CA  . ASP A 1 53  ? -0.763  -25.205 1.582  1.00 35.70 ? 134 ASP A CA  1 
ATOM   380  C C   . ASP A 1 53  ? -2.108  -25.274 2.303  1.00 36.75 ? 134 ASP A C   1 
ATOM   381  O O   . ASP A 1 53  ? -3.123  -24.777 1.812  1.00 37.05 ? 134 ASP A O   1 
ATOM   382  C CB  . ASP A 1 53  ? -0.458  -26.591 0.998  1.00 36.50 ? 134 ASP A CB  1 
ATOM   383  C CG  . ASP A 1 53  ? 0.752   -26.592 0.093  1.00 40.29 ? 134 ASP A CG  1 
ATOM   384  O OD1 . ASP A 1 53  ? 1.243   -25.493 -0.245 1.00 41.69 ? 134 ASP A OD1 1 
ATOM   385  O OD2 . ASP A 1 53  ? 1.206   -27.694 -0.290 1.00 41.73 ? 134 ASP A OD2 1 
ATOM   386  N N   . GLN A 1 54  ? -2.099  -25.904 3.474  1.00 37.35 ? 135 GLN A N   1 
ATOM   387  C CA  . GLN A 1 54  ? -3.296  -26.055 4.290  1.00 37.05 ? 135 GLN A CA  1 
ATOM   388  C C   . GLN A 1 54  ? -3.859  -24.697 4.688  1.00 35.34 ? 135 GLN A C   1 
ATOM   389  O O   . GLN A 1 54  ? -5.069  -24.495 4.704  1.00 33.18 ? 135 GLN A O   1 
ATOM   390  C CB  . GLN A 1 54  ? -2.975  -26.879 5.538  1.00 38.04 ? 135 GLN A CB  1 
ATOM   391  C CG  . GLN A 1 54  ? -2.801  -28.351 5.263  1.00 38.29 ? 135 GLN A CG  1 
ATOM   392  C CD  . GLN A 1 54  ? -4.068  -28.970 4.728  1.00 41.74 ? 135 GLN A CD  1 
ATOM   393  O OE1 . GLN A 1 54  ? -4.459  -28.726 3.584  1.00 43.63 ? 135 GLN A OE1 1 
ATOM   394  N NE2 . GLN A 1 54  ? -4.733  -29.765 5.560  1.00 39.90 ? 135 GLN A NE2 1 
ATOM   395  N N   . TYR A 1 55  ? -2.974  -23.770 5.023  1.00 35.25 ? 136 TYR A N   1 
ATOM   396  C CA  . TYR A 1 55  ? -3.407  -22.432 5.386  1.00 36.80 ? 136 TYR A CA  1 
ATOM   397  C C   . TYR A 1 55  ? -4.157  -21.808 4.206  1.00 37.14 ? 136 TYR A C   1 
ATOM   398  O O   . TYR A 1 55  ? -5.200  -21.176 4.384  1.00 37.64 ? 136 TYR A O   1 
ATOM   399  C CB  . TYR A 1 55  ? -2.202  -21.565 5.725  1.00 37.77 ? 136 TYR A CB  1 
ATOM   400  C CG  . TYR A 1 55  ? -2.538  -20.101 5.866  1.00 40.37 ? 136 TYR A CG  1 
ATOM   401  C CD1 . TYR A 1 55  ? -3.091  -19.602 7.044  1.00 40.51 ? 136 TYR A CD1 1 
ATOM   402  C CD2 . TYR A 1 55  ? -2.292  -19.208 4.822  1.00 40.27 ? 136 TYR A CD2 1 
ATOM   403  C CE1 . TYR A 1 55  ? -3.389  -18.248 7.183  1.00 40.67 ? 136 TYR A CE1 1 
ATOM   404  C CE2 . TYR A 1 55  ? -2.588  -17.850 4.951  1.00 41.03 ? 136 TYR A CE2 1 
ATOM   405  C CZ  . TYR A 1 55  ? -3.132  -17.380 6.133  1.00 40.45 ? 136 TYR A CZ  1 
ATOM   406  O OH  . TYR A 1 55  ? -3.416  -16.045 6.267  1.00 40.30 ? 136 TYR A OH  1 
ATOM   407  N N   . LEU A 1 56  ? -3.623  -21.999 3.001  1.00 35.37 ? 137 LEU A N   1 
ATOM   408  C CA  . LEU A 1 56  ? -4.230  -21.441 1.804  1.00 34.76 ? 137 LEU A CA  1 
ATOM   409  C C   . LEU A 1 56  ? -5.536  -22.117 1.428  1.00 34.24 ? 137 LEU A C   1 
ATOM   410  O O   . LEU A 1 56  ? -6.457  -21.464 0.953  1.00 34.39 ? 137 LEU A O   1 
ATOM   411  C CB  . LEU A 1 56  ? -3.247  -21.511 0.631  1.00 35.28 ? 137 LEU A CB  1 
ATOM   412  C CG  . LEU A 1 56  ? -2.010  -20.608 0.760  1.00 36.83 ? 137 LEU A CG  1 
ATOM   413  C CD1 . LEU A 1 56  ? -1.046  -20.855 -0.394 1.00 36.84 ? 137 LEU A CD1 1 
ATOM   414  C CD2 . LEU A 1 56  ? -2.443  -19.152 0.777  1.00 36.59 ? 137 LEU A CD2 1 
ATOM   415  N N   . ALA A 1 57  ? -5.630  -23.420 1.660  1.00 34.16 ? 138 ALA A N   1 
ATOM   416  C CA  . ALA A 1 57  ? -6.843  -24.163 1.317  1.00 33.15 ? 138 ALA A CA  1 
ATOM   417  C C   . ALA A 1 57  ? -7.915  -24.147 2.405  1.00 32.84 ? 138 ALA A C   1 
ATOM   418  O O   . ALA A 1 57  ? -9.037  -24.590 2.171  1.00 31.44 ? 138 ALA A O   1 
ATOM   419  C CB  . ALA A 1 57  ? -6.483  -25.603 0.993  1.00 30.08 ? 138 ALA A CB  1 
ATOM   420  N N   . LEU A 1 58  ? -7.575  -23.611 3.574  1.00 33.37 ? 139 LEU A N   1 
ATOM   421  C CA  . LEU A 1 58  ? -8.477  -23.605 4.724  1.00 36.50 ? 139 LEU A CA  1 
ATOM   422  C C   . LEU A 1 58  ? -9.990  -23.487 4.492  1.00 38.38 ? 139 LEU A C   1 
ATOM   423  O O   . LEU A 1 58  ? -10.761 -24.282 5.036  1.00 39.63 ? 139 LEU A O   1 
ATOM   424  C CB  . LEU A 1 58  ? -8.033  -22.547 5.741  1.00 36.02 ? 139 LEU A CB  1 
ATOM   425  C CG  . LEU A 1 58  ? -8.491  -22.825 7.183  1.00 36.07 ? 139 LEU A CG  1 
ATOM   426  C CD1 . LEU A 1 58  ? -7.977  -24.191 7.621  1.00 34.92 ? 139 LEU A CD1 1 
ATOM   427  C CD2 . LEU A 1 58  ? -7.969  -21.747 8.129  1.00 34.78 ? 139 LEU A CD2 1 
ATOM   428  N N   . PRO A 1 59  ? -10.437 -22.511 3.682  1.00 38.96 ? 140 PRO A N   1 
ATOM   429  C CA  . PRO A 1 59  ? -11.873 -22.349 3.433  1.00 38.58 ? 140 PRO A CA  1 
ATOM   430  C C   . PRO A 1 59  ? -12.570 -23.549 2.788  1.00 40.07 ? 140 PRO A C   1 
ATOM   431  O O   . PRO A 1 59  ? -13.743 -23.822 3.062  1.00 39.50 ? 140 PRO A O   1 
ATOM   432  C CB  . PRO A 1 59  ? -11.929 -21.111 2.538  1.00 37.62 ? 140 PRO A CB  1 
ATOM   433  C CG  . PRO A 1 59  ? -10.725 -20.324 2.968  1.00 38.15 ? 140 PRO A CG  1 
ATOM   434  C CD  . PRO A 1 59  ? -9.677  -21.404 3.072  1.00 39.69 ? 140 PRO A CD  1 
ATOM   435  N N   . ASP A 1 60  ? -11.848 -24.266 1.935  1.00 40.81 ? 141 ASP A N   1 
ATOM   436  C CA  . ASP A 1 60  ? -12.427 -25.407 1.231  1.00 42.81 ? 141 ASP A CA  1 
ATOM   437  C C   . ASP A 1 60  ? -12.265 -26.738 1.950  1.00 42.38 ? 141 ASP A C   1 
ATOM   438  O O   . ASP A 1 60  ? -12.796 -27.750 1.493  1.00 43.68 ? 141 ASP A O   1 
ATOM   439  C CB  . ASP A 1 60  ? -11.817 -25.520 -0.172 1.00 44.44 ? 141 ASP A CB  1 
ATOM   440  C CG  . ASP A 1 60  ? -11.816 -24.195 -0.915 1.00 48.36 ? 141 ASP A CG  1 
ATOM   441  O OD1 . ASP A 1 60  ? -10.761 -23.837 -1.484 1.00 50.11 ? 141 ASP A OD1 1 
ATOM   442  O OD2 . ASP A 1 60  ? -12.865 -23.511 -0.929 1.00 49.62 ? 141 ASP A OD2 1 
ATOM   443  N N   . VAL A 1 61  ? -11.555 -26.752 3.074  1.00 41.32 ? 142 VAL A N   1 
ATOM   444  C CA  . VAL A 1 61  ? -11.357 -28.013 3.776  1.00 40.48 ? 142 VAL A CA  1 
ATOM   445  C C   . VAL A 1 61  ? -11.752 -28.063 5.252  1.00 39.02 ? 142 VAL A C   1 
ATOM   446  O O   . VAL A 1 61  ? -12.305 -29.058 5.714  1.00 39.76 ? 142 VAL A O   1 
ATOM   447  C CB  . VAL A 1 61  ? -9.894  -28.460 3.660  1.00 41.48 ? 142 VAL A CB  1 
ATOM   448  C CG1 . VAL A 1 61  ? -9.486  -28.521 2.195  1.00 42.10 ? 142 VAL A CG1 1 
ATOM   449  C CG2 . VAL A 1 61  ? -9.003  -27.505 4.418  1.00 41.61 ? 142 VAL A CG2 1 
ATOM   450  N N   . SER A 1 62  ? -11.475 -26.998 5.990  1.00 37.70 ? 143 SER A N   1 
ATOM   451  C CA  . SER A 1 62  ? -11.778 -26.974 7.417  1.00 36.55 ? 143 SER A CA  1 
ATOM   452  C C   . SER A 1 62  ? -13.242 -27.135 7.809  1.00 35.86 ? 143 SER A C   1 
ATOM   453  O O   . SER A 1 62  ? -14.142 -26.692 7.097  1.00 34.12 ? 143 SER A O   1 
ATOM   454  C CB  . SER A 1 62  ? -11.252 -25.689 8.039  1.00 36.73 ? 143 SER A CB  1 
ATOM   455  O OG  . SER A 1 62  ? -11.613 -25.635 9.401  1.00 39.05 ? 143 SER A OG  1 
ATOM   456  N N   . LEU A 1 63  ? -13.462 -27.771 8.960  1.00 35.26 ? 144 LEU A N   1 
ATOM   457  C CA  . LEU A 1 63  ? -14.809 -27.986 9.486  1.00 34.82 ? 144 LEU A CA  1 
ATOM   458  C C   . LEU A 1 63  ? -15.214 -26.811 10.348 1.00 33.35 ? 144 LEU A C   1 
ATOM   459  O O   . LEU A 1 63  ? -16.352 -26.711 10.787 1.00 34.11 ? 144 LEU A O   1 
ATOM   460  C CB  . LEU A 1 63  ? -14.882 -29.283 10.294 1.00 33.71 ? 144 LEU A CB  1 
ATOM   461  C CG  . LEU A 1 63  ? -14.847 -30.537 9.418  1.00 33.05 ? 144 LEU A CG  1 
ATOM   462  C CD1 . LEU A 1 63  ? -14.784 -31.773 10.289 1.00 31.77 ? 144 LEU A CD1 1 
ATOM   463  C CD2 . LEU A 1 63  ? -16.085 -30.556 8.515  1.00 29.64 ? 144 LEU A CD2 1 
ATOM   464  N N   . GLY A 1 64  ? -14.263 -25.923 10.594 1.00 33.78 ? 145 GLY A N   1 
ATOM   465  C CA  . GLY A 1 64  ? -14.560 -24.732 11.362 1.00 36.20 ? 145 GLY A CA  1 
ATOM   466  C C   . GLY A 1 64  ? -14.728 -23.598 10.364 1.00 36.59 ? 145 GLY A C   1 
ATOM   467  O O   . GLY A 1 64  ? -14.503 -23.795 9.168  1.00 35.79 ? 145 GLY A O   1 
ATOM   468  N N   . ARG A 1 65  ? -15.124 -22.419 10.834 1.00 37.37 ? 146 ARG A N   1 
ATOM   469  C CA  . ARG A 1 65  ? -15.299 -21.279 9.939  1.00 38.53 ? 146 ARG A CA  1 
ATOM   470  C C   . ARG A 1 65  ? -14.353 -20.159 10.340 1.00 38.02 ? 146 ARG A C   1 
ATOM   471  O O   . ARG A 1 65  ? -14.736 -19.215 11.024 1.00 38.66 ? 146 ARG A O   1 
ATOM   472  C CB  . ARG A 1 65  ? -16.736 -20.778 9.984  1.00 41.03 ? 146 ARG A CB  1 
ATOM   473  C CG  . ARG A 1 65  ? -17.031 -19.722 8.933  1.00 44.32 ? 146 ARG A CG  1 
ATOM   474  C CD  . ARG A 1 65  ? -18.461 -19.244 9.024  1.00 46.73 ? 146 ARG A CD  1 
ATOM   475  N NE  . ARG A 1 65  ? -18.847 -18.482 7.843  1.00 51.69 ? 146 ARG A NE  1 
ATOM   476  C CZ  . ARG A 1 65  ? -20.060 -17.977 7.646  1.00 53.47 ? 146 ARG A CZ  1 
ATOM   477  N NH1 . ARG A 1 65  ? -21.009 -18.151 8.559  1.00 54.20 ? 146 ARG A NH1 1 
ATOM   478  N NH2 . ARG A 1 65  ? -20.325 -17.302 6.535  1.00 54.44 ? 146 ARG A NH2 1 
ATOM   479  N N   . TYR A 1 66  ? -13.114 -20.272 9.886  1.00 37.59 ? 147 TYR A N   1 
ATOM   480  C CA  . TYR A 1 66  ? -12.074 -19.311 10.202 1.00 37.44 ? 147 TYR A CA  1 
ATOM   481  C C   . TYR A 1 66  ? -11.862 -18.234 9.144  1.00 37.23 ? 147 TYR A C   1 
ATOM   482  O O   . TYR A 1 66  ? -11.800 -18.518 7.956  1.00 39.68 ? 147 TYR A O   1 
ATOM   483  C CB  . TYR A 1 66  ? -10.769 -20.074 10.421 1.00 37.76 ? 147 TYR A CB  1 
ATOM   484  C CG  . TYR A 1 66  ? -10.895 -21.173 11.454 1.00 37.33 ? 147 TYR A CG  1 
ATOM   485  C CD1 . TYR A 1 66  ? -10.956 -20.870 12.816 1.00 37.02 ? 147 TYR A CD1 1 
ATOM   486  C CD2 . TYR A 1 66  ? -10.995 -22.514 11.072 1.00 36.01 ? 147 TYR A CD2 1 
ATOM   487  C CE1 . TYR A 1 66  ? -11.115 -21.869 13.772 1.00 36.96 ? 147 TYR A CE1 1 
ATOM   488  C CE2 . TYR A 1 66  ? -11.156 -23.527 12.025 1.00 36.38 ? 147 TYR A CE2 1 
ATOM   489  C CZ  . TYR A 1 66  ? -11.215 -23.194 13.374 1.00 37.28 ? 147 TYR A CZ  1 
ATOM   490  O OH  . TYR A 1 66  ? -11.386 -24.172 14.331 1.00 36.71 ? 147 TYR A OH  1 
ATOM   491  N N   . ALA A 1 67  ? -11.745 -16.990 9.584  1.00 37.13 ? 148 ALA A N   1 
ATOM   492  C CA  . ALA A 1 67  ? -11.502 -15.890 8.664  1.00 38.86 ? 148 ALA A CA  1 
ATOM   493  C C   . ALA A 1 67  ? -10.027 -15.484 8.761  1.00 40.57 ? 148 ALA A C   1 
ATOM   494  O O   . ALA A 1 67  ? -9.432  -15.547 9.838  1.00 39.68 ? 148 ALA A O   1 
ATOM   495  C CB  . ALA A 1 67  ? -12.395 -14.709 9.013  1.00 34.03 ? 148 ALA A CB  1 
ATOM   496  N N   . TYR A 1 68  ? -9.433  -15.088 7.638  1.00 42.60 ? 149 TYR A N   1 
ATOM   497  C CA  . TYR A 1 68  ? -8.040  -14.652 7.641  1.00 44.84 ? 149 TYR A CA  1 
ATOM   498  C C   . TYR A 1 68  ? -7.952  -13.277 8.311  1.00 48.10 ? 149 TYR A C   1 
ATOM   499  O O   . TYR A 1 68  ? -8.946  -12.560 8.406  1.00 48.60 ? 149 TYR A O   1 
ATOM   500  C CB  . TYR A 1 68  ? -7.498  -14.536 6.208  1.00 42.44 ? 149 TYR A CB  1 
ATOM   501  C CG  . TYR A 1 68  ? -7.358  -15.843 5.455  1.00 41.36 ? 149 TYR A CG  1 
ATOM   502  C CD1 . TYR A 1 68  ? -6.543  -16.865 5.935  1.00 39.31 ? 149 TYR A CD1 1 
ATOM   503  C CD2 . TYR A 1 68  ? -8.032  -16.052 4.252  1.00 40.39 ? 149 TYR A CD2 1 
ATOM   504  C CE1 . TYR A 1 68  ? -6.406  -18.059 5.241  1.00 38.03 ? 149 TYR A CE1 1 
ATOM   505  C CE2 . TYR A 1 68  ? -7.903  -17.246 3.548  1.00 37.60 ? 149 TYR A CE2 1 
ATOM   506  C CZ  . TYR A 1 68  ? -7.090  -18.245 4.046  1.00 38.95 ? 149 TYR A CZ  1 
ATOM   507  O OH  . TYR A 1 68  ? -6.962  -19.432 3.354  1.00 36.28 ? 149 TYR A OH  1 
ATOM   508  N N   . VAL A 1 69  ? -6.761  -12.923 8.783  1.00 52.16 ? 150 VAL A N   1 
ATOM   509  C CA  . VAL A 1 69  ? -6.510  -11.626 9.410  1.00 56.91 ? 150 VAL A CA  1 
ATOM   510  C C   . VAL A 1 69  ? -5.176  -11.138 8.844  1.00 61.14 ? 150 VAL A C   1 
ATOM   511  O O   . VAL A 1 69  ? -4.108  -11.511 9.340  1.00 63.45 ? 150 VAL A O   1 
ATOM   512  C CB  . VAL A 1 69  ? -6.391  -11.741 10.945 1.00 56.69 ? 150 VAL A CB  1 
ATOM   513  C CG1 . VAL A 1 69  ? -5.968  -10.406 11.533 1.00 55.37 ? 150 VAL A CG1 1 
ATOM   514  C CG2 . VAL A 1 69  ? -7.716  -12.181 11.541 1.00 57.70 ? 150 VAL A CG2 1 
ATOM   515  N N   . ARG A 1 70  ? -5.238  -10.308 7.806  1.00 64.82 ? 151 ARG A N   1 
ATOM   516  C CA  . ARG A 1 70  ? -4.030  -9.804  7.150  1.00 67.54 ? 151 ARG A CA  1 
ATOM   517  C C   . ARG A 1 70  ? -3.266  -8.730  7.915  1.00 68.24 ? 151 ARG A C   1 
ATOM   518  O O   . ARG A 1 70  ? -2.033  -8.696  7.871  1.00 68.83 ? 151 ARG A O   1 
ATOM   519  C CB  . ARG A 1 70  ? -4.379  -9.297  5.747  1.00 68.43 ? 151 ARG A CB  1 
ATOM   520  C CG  . ARG A 1 70  ? -4.866  -10.404 4.827  1.00 70.63 ? 151 ARG A CG  1 
ATOM   521  C CD  . ARG A 1 70  ? -5.125  -9.920  3.416  1.00 72.15 ? 151 ARG A CD  1 
ATOM   522  N NE  . ARG A 1 70  ? -5.494  -11.024 2.533  1.00 73.63 ? 151 ARG A NE  1 
ATOM   523  C CZ  . ARG A 1 70  ? -6.527  -11.841 2.738  1.00 74.73 ? 151 ARG A CZ  1 
ATOM   524  N NH1 . ARG A 1 70  ? -7.308  -11.689 3.803  1.00 74.43 ? 151 ARG A NH1 1 
ATOM   525  N NH2 . ARG A 1 70  ? -6.782  -12.813 1.872  1.00 74.79 ? 151 ARG A NH2 1 
ATOM   526  N N   . GLY A 1 81  ? -1.035  -11.637 6.590  1.00 41.09 ? 162 GLY A N   1 
ATOM   527  C CA  . GLY A 1 81  ? -1.366  -12.995 6.176  1.00 42.34 ? 162 GLY A CA  1 
ATOM   528  C C   . GLY A 1 81  ? -0.591  -14.043 6.965  1.00 42.01 ? 162 GLY A C   1 
ATOM   529  O O   . GLY A 1 81  ? -0.796  -14.191 8.168  1.00 42.03 ? 162 GLY A O   1 
ATOM   530  N N   . LEU A 1 82  ? 0.300   -14.768 6.290  1.00 40.86 ? 163 LEU A N   1 
ATOM   531  C CA  . LEU A 1 82  ? 1.116   -15.793 6.943  1.00 39.49 ? 163 LEU A CA  1 
ATOM   532  C C   . LEU A 1 82  ? 2.597   -15.453 6.796  1.00 39.44 ? 163 LEU A C   1 
ATOM   533  O O   . LEU A 1 82  ? 3.045   -15.106 5.706  1.00 40.04 ? 163 LEU A O   1 
ATOM   534  C CB  . LEU A 1 82  ? 0.838   -17.174 6.331  1.00 37.28 ? 163 LEU A CB  1 
ATOM   535  C CG  . LEU A 1 82  ? 1.622   -18.378 6.885  1.00 34.63 ? 163 LEU A CG  1 
ATOM   536  C CD1 . LEU A 1 82  ? 0.838   -19.651 6.637  1.00 34.47 ? 163 LEU A CD1 1 
ATOM   537  C CD2 . LEU A 1 82  ? 2.990   -18.480 6.236  1.00 32.30 ? 163 LEU A CD2 1 
ATOM   538  N N   . ALA A 1 83  ? 3.348   -15.558 7.893  1.00 38.85 ? 164 ALA A N   1 
ATOM   539  C CA  . ALA A 1 83  ? 4.783   -15.265 7.888  1.00 37.60 ? 164 ALA A CA  1 
ATOM   540  C C   . ALA A 1 83  ? 5.626   -16.525 8.059  1.00 37.50 ? 164 ALA A C   1 
ATOM   541  O O   . ALA A 1 83  ? 5.575   -17.180 9.100  1.00 36.39 ? 164 ALA A O   1 
ATOM   542  C CB  . ALA A 1 83  ? 5.127   -14.263 8.995  1.00 36.78 ? 164 ALA A CB  1 
ATOM   543  N N   . LEU A 1 84  ? 6.393   -16.857 7.024  1.00 37.72 ? 165 LEU A N   1 
ATOM   544  C CA  . LEU A 1 84  ? 7.271   -18.021 7.038  1.00 37.98 ? 165 LEU A CA  1 
ATOM   545  C C   . LEU A 1 84  ? 8.673   -17.498 7.281  1.00 39.64 ? 165 LEU A C   1 
ATOM   546  O O   . LEU A 1 84  ? 9.267   -16.892 6.397  1.00 40.02 ? 165 LEU A O   1 
ATOM   547  C CB  . LEU A 1 84  ? 7.218   -18.751 5.692  1.00 36.00 ? 165 LEU A CB  1 
ATOM   548  C CG  . LEU A 1 84  ? 8.120   -19.976 5.498  1.00 37.83 ? 165 LEU A CG  1 
ATOM   549  C CD1 . LEU A 1 84  ? 7.890   -20.977 6.619  1.00 38.88 ? 165 LEU A CD1 1 
ATOM   550  C CD2 . LEU A 1 84  ? 7.820   -20.636 4.155  1.00 36.50 ? 165 LEU A CD2 1 
ATOM   551  N N   . CYS A 1 85  ? 9.203   -17.716 8.478  1.00 40.56 ? 166 CYS A N   1 
ATOM   552  C CA  . CYS A 1 85  ? 10.539  -17.227 8.784  1.00 42.10 ? 166 CYS A CA  1 
ATOM   553  C C   . CYS A 1 85  ? 11.503  -18.332 9.175  1.00 42.38 ? 166 CYS A C   1 
ATOM   554  O O   . CYS A 1 85  ? 11.118  -19.340 9.765  1.00 43.02 ? 166 CYS A O   1 
ATOM   555  C CB  . CYS A 1 85  ? 10.507  -16.228 9.941  1.00 43.55 ? 166 CYS A CB  1 
ATOM   556  S SG  . CYS A 1 85  ? 9.262   -14.896 9.900  1.00 47.88 ? 166 CYS A SG  1 
ATOM   557  N N   . GLN A 1 86  ? 12.769  -18.129 8.847  1.00 41.95 ? 167 GLN A N   1 
ATOM   558  C CA  . GLN A 1 86  ? 13.791  -19.077 9.227  1.00 42.81 ? 167 GLN A CA  1 
ATOM   559  C C   . GLN A 1 86  ? 14.916  -18.264 9.844  1.00 43.57 ? 167 GLN A C   1 
ATOM   560  O O   . GLN A 1 86  ? 15.284  -17.205 9.335  1.00 44.25 ? 167 GLN A O   1 
ATOM   561  C CB  . GLN A 1 86  ? 14.284  -19.879 8.022  1.00 41.40 ? 167 GLN A CB  1 
ATOM   562  C CG  . GLN A 1 86  ? 14.895  -19.068 6.909  1.00 41.61 ? 167 GLN A CG  1 
ATOM   563  C CD  . GLN A 1 86  ? 15.598  -19.960 5.902  1.00 42.33 ? 167 GLN A CD  1 
ATOM   564  O OE1 . GLN A 1 86  ? 16.355  -20.861 6.277  1.00 41.45 ? 167 GLN A OE1 1 
ATOM   565  N NE2 . GLN A 1 86  ? 15.361  -19.712 4.621  1.00 41.49 ? 167 GLN A NE2 1 
ATOM   566  N N   . ARG A 1 87  ? 15.429  -18.742 10.969 1.00 42.99 ? 168 ARG A N   1 
ATOM   567  C CA  . ARG A 1 87  ? 16.506  -18.060 11.656 1.00 42.23 ? 168 ARG A CA  1 
ATOM   568  C C   . ARG A 1 87  ? 17.762  -18.909 11.575 1.00 43.69 ? 168 ARG A C   1 
ATOM   569  O O   . ARG A 1 87  ? 17.733  -20.107 11.846 1.00 45.26 ? 168 ARG A O   1 
ATOM   570  C CB  . ARG A 1 87  ? 16.103  -17.805 13.103 1.00 40.01 ? 168 ARG A CB  1 
ATOM   571  C CG  . ARG A 1 87  ? 14.859  -16.954 13.198 1.00 38.07 ? 168 ARG A CG  1 
ATOM   572  C CD  . ARG A 1 87  ? 14.452  -16.680 14.635 1.00 40.59 ? 168 ARG A CD  1 
ATOM   573  N NE  . ARG A 1 87  ? 13.233  -15.880 14.675 1.00 41.87 ? 168 ARG A NE  1 
ATOM   574  C CZ  . ARG A 1 87  ? 12.089  -16.228 14.088 1.00 44.22 ? 168 ARG A CZ  1 
ATOM   575  N NH1 . ARG A 1 87  ? 11.991  -17.371 13.412 1.00 43.12 ? 168 ARG A NH1 1 
ATOM   576  N NH2 . ARG A 1 87  ? 11.044  -15.418 14.151 1.00 45.42 ? 168 ARG A NH2 1 
ATOM   577  N N   . TYR A 1 88  ? 18.863  -18.286 11.184 1.00 44.83 ? 169 TYR A N   1 
ATOM   578  C CA  . TYR A 1 88  ? 20.124  -18.997 11.046 1.00 48.10 ? 169 TYR A CA  1 
ATOM   579  C C   . TYR A 1 88  ? 21.293  -18.074 11.334 1.00 49.85 ? 169 TYR A C   1 
ATOM   580  O O   . TYR A 1 88  ? 21.131  -16.856 11.403 1.00 48.79 ? 169 TYR A O   1 
ATOM   581  C CB  . TYR A 1 88  ? 20.263  -19.547 9.631  1.00 47.62 ? 169 TYR A CB  1 
ATOM   582  C CG  . TYR A 1 88  ? 20.023  -18.503 8.568  1.00 49.19 ? 169 TYR A CG  1 
ATOM   583  C CD1 . TYR A 1 88  ? 18.728  -18.183 8.162  1.00 50.74 ? 169 TYR A CD1 1 
ATOM   584  C CD2 . TYR A 1 88  ? 21.088  -17.827 7.972  1.00 48.88 ? 169 TYR A CD2 1 
ATOM   585  C CE1 . TYR A 1 88  ? 18.498  -17.218 7.186  1.00 52.11 ? 169 TYR A CE1 1 
ATOM   586  C CE2 . TYR A 1 88  ? 20.871  -16.861 6.999  1.00 50.47 ? 169 TYR A CE2 1 
ATOM   587  C CZ  . TYR A 1 88  ? 19.573  -16.564 6.609  1.00 51.90 ? 169 TYR A CZ  1 
ATOM   588  O OH  . TYR A 1 88  ? 19.342  -15.623 5.634  1.00 54.45 ? 169 TYR A OH  1 
ATOM   589  N N   . TYR A 1 89  ? 22.471  -18.667 11.491 1.00 52.29 ? 170 TYR A N   1 
ATOM   590  C CA  . TYR A 1 89  ? 23.679  -17.911 11.776 1.00 55.75 ? 170 TYR A CA  1 
ATOM   591  C C   . TYR A 1 89  ? 24.295  -17.341 10.505 1.00 58.41 ? 170 TYR A C   1 
ATOM   592  O O   . TYR A 1 89  ? 24.381  -18.030 9.488  1.00 59.03 ? 170 TYR A O   1 
ATOM   593  C CB  . TYR A 1 89  ? 24.693  -18.807 12.488 1.00 55.00 ? 170 TYR A CB  1 
ATOM   594  C CG  . TYR A 1 89  ? 24.267  -19.217 13.877 1.00 54.68 ? 170 TYR A CG  1 
ATOM   595  C CD1 . TYR A 1 89  ? 24.247  -18.293 14.921 1.00 54.06 ? 170 TYR A CD1 1 
ATOM   596  C CD2 . TYR A 1 89  ? 23.858  -20.524 14.146 1.00 55.05 ? 170 TYR A CD2 1 
ATOM   597  C CE1 . TYR A 1 89  ? 23.829  -18.659 16.203 1.00 53.70 ? 170 TYR A CE1 1 
ATOM   598  C CE2 . TYR A 1 89  ? 23.436  -20.900 15.425 1.00 54.28 ? 170 TYR A CE2 1 
ATOM   599  C CZ  . TYR A 1 89  ? 23.423  -19.962 16.447 1.00 53.41 ? 170 TYR A CZ  1 
ATOM   600  O OH  . TYR A 1 89  ? 22.992  -20.323 17.706 1.00 54.15 ? 170 TYR A OH  1 
ATOM   601  N N   . HIS A 1 90  ? 24.710  -16.077 10.576 1.00 62.03 ? 171 HIS A N   1 
ATOM   602  C CA  . HIS A 1 90  ? 25.339  -15.378 9.455  1.00 65.39 ? 171 HIS A CA  1 
ATOM   603  C C   . HIS A 1 90  ? 26.709  -15.996 9.169  1.00 65.34 ? 171 HIS A C   1 
ATOM   604  O O   . HIS A 1 90  ? 27.052  -16.281 8.021  1.00 66.16 ? 171 HIS A O   1 
ATOM   605  C CB  . HIS A 1 90  ? 25.504  -13.895 9.804  1.00 68.68 ? 171 HIS A CB  1 
ATOM   606  C CG  . HIS A 1 90  ? 26.231  -13.097 8.765  1.00 73.40 ? 171 HIS A CG  1 
ATOM   607  N ND1 . HIS A 1 90  ? 27.377  -13.547 8.144  1.00 75.02 ? 171 HIS A ND1 1 
ATOM   608  C CD2 . HIS A 1 90  ? 26.002  -11.854 8.275  1.00 74.42 ? 171 HIS A CD2 1 
ATOM   609  C CE1 . HIS A 1 90  ? 27.823  -12.618 7.318  1.00 74.91 ? 171 HIS A CE1 1 
ATOM   610  N NE2 . HIS A 1 90  ? 27.008  -11.580 7.379  1.00 75.15 ? 171 HIS A NE2 1 
ATOM   611  N N   . MET A 1 106 ? 25.991  -14.055 14.980 1.00 63.27 ? 187 MET A N   1 
ATOM   612  C CA  . MET A 1 106 ? 24.782  -13.268 14.768 1.00 62.42 ? 187 MET A CA  1 
ATOM   613  C C   . MET A 1 106 ? 23.641  -14.089 14.167 1.00 59.91 ? 187 MET A C   1 
ATOM   614  O O   . MET A 1 106 ? 23.826  -14.790 13.169 1.00 57.70 ? 187 MET A O   1 
ATOM   615  C CB  . MET A 1 106 ? 25.068  -12.083 13.845 1.00 66.72 ? 187 MET A CB  1 
ATOM   616  C CG  . MET A 1 106 ? 23.796  -11.413 13.333 1.00 72.42 ? 187 MET A CG  1 
ATOM   617  S SD  . MET A 1 106 ? 24.058  -10.301 11.933 1.00 80.31 ? 187 MET A SD  1 
ATOM   618  C CE  . MET A 1 106 ? 23.558  -8.706  12.662 1.00 76.75 ? 187 MET A CE  1 
ATOM   619  N N   . VAL A 1 107 ? 22.462  -13.975 14.777 1.00 56.76 ? 188 VAL A N   1 
ATOM   620  C CA  . VAL A 1 107 ? 21.272  -14.683 14.322 1.00 53.65 ? 188 VAL A CA  1 
ATOM   621  C C   . VAL A 1 107 ? 20.468  -13.811 13.360 1.00 52.96 ? 188 VAL A C   1 
ATOM   622  O O   . VAL A 1 107 ? 20.010  -12.723 13.711 1.00 51.62 ? 188 VAL A O   1 
ATOM   623  C CB  . VAL A 1 107 ? 20.374  -15.086 15.514 1.00 53.15 ? 188 VAL A CB  1 
ATOM   624  C CG1 . VAL A 1 107 ? 19.071  -15.696 15.016 1.00 52.17 ? 188 VAL A CG1 1 
ATOM   625  C CG2 . VAL A 1 107 ? 21.105  -16.076 16.388 1.00 53.03 ? 188 VAL A CG2 1 
ATOM   626  N N   . VAL A 1 108 ? 20.299  -14.306 12.140 1.00 51.90 ? 189 VAL A N   1 
ATOM   627  C CA  . VAL A 1 108 ? 19.563  -13.592 11.114 1.00 51.17 ? 189 VAL A CA  1 
ATOM   628  C C   . VAL A 1 108 ? 18.183  -14.203 10.891 1.00 50.62 ? 189 VAL A C   1 
ATOM   629  O O   . VAL A 1 108 ? 18.054  -15.412 10.714 1.00 51.38 ? 189 VAL A O   1 
ATOM   630  C CB  . VAL A 1 108 ? 20.351  -13.610 9.784  1.00 51.21 ? 189 VAL A CB  1 
ATOM   631  C CG1 . VAL A 1 108 ? 19.502  -13.050 8.659  1.00 50.81 ? 189 VAL A CG1 1 
ATOM   632  C CG2 . VAL A 1 108 ? 21.626  -12.801 9.936  1.00 51.42 ? 189 VAL A CG2 1 
ATOM   633  N N   . THR A 1 109 ? 17.149  -13.369 10.918 1.00 50.20 ? 190 THR A N   1 
ATOM   634  C CA  . THR A 1 109 ? 15.792  -13.850 10.687 1.00 49.27 ? 190 THR A CA  1 
ATOM   635  C C   . THR A 1 109 ? 15.471  -13.526 9.236  1.00 49.62 ? 190 THR A C   1 
ATOM   636  O O   . THR A 1 109 ? 15.756  -12.433 8.762  1.00 50.43 ? 190 THR A O   1 
ATOM   637  C CB  . THR A 1 109 ? 14.776  -13.160 11.610 1.00 48.42 ? 190 THR A CB  1 
ATOM   638  O OG1 . THR A 1 109 ? 15.135  -13.389 12.979 1.00 48.13 ? 190 THR A OG1 1 
ATOM   639  C CG2 . THR A 1 109 ? 13.383  -13.717 11.365 1.00 48.44 ? 190 THR A CG2 1 
ATOM   640  N N   . ASP A 1 110 ? 14.884  -14.480 8.531  1.00 50.77 ? 191 ASP A N   1 
ATOM   641  C CA  . ASP A 1 110 ? 14.565  -14.304 7.121  1.00 52.31 ? 191 ASP A CA  1 
ATOM   642  C C   . ASP A 1 110 ? 13.107  -14.715 6.895  1.00 53.36 ? 191 ASP A C   1 
ATOM   643  O O   . ASP A 1 110 ? 12.785  -15.906 6.840  1.00 52.25 ? 191 ASP A O   1 
ATOM   644  C CB  . ASP A 1 110 ? 15.507  -15.189 6.304  1.00 55.63 ? 191 ASP A CB  1 
ATOM   645  C CG  . ASP A 1 110 ? 15.752  -14.664 4.914  1.00 57.72 ? 191 ASP A CG  1 
ATOM   646  O OD1 . ASP A 1 110 ? 14.774  -14.541 4.146  1.00 59.13 ? 191 ASP A OD1 1 
ATOM   647  O OD2 . ASP A 1 110 ? 16.931  -14.385 4.593  1.00 59.35 ? 191 ASP A OD2 1 
ATOM   648  N N   . CYS A 1 111 ? 12.229  -13.727 6.758  1.00 53.33 ? 192 CYS A N   1 
ATOM   649  C CA  . CYS A 1 111 ? 10.815  -14.013 6.580  1.00 53.25 ? 192 CYS A CA  1 
ATOM   650  C C   . CYS A 1 111 ? 10.260  -13.862 5.166  1.00 53.63 ? 192 CYS A C   1 
ATOM   651  O O   . CYS A 1 111 ? 10.699  -13.025 4.389  1.00 54.36 ? 192 CYS A O   1 
ATOM   652  C CB  . CYS A 1 111 ? 9.979   -13.133 7.505  1.00 51.16 ? 192 CYS A CB  1 
ATOM   653  S SG  . CYS A 1 111 ? 10.307  -13.263 9.292  1.00 50.49 ? 192 CYS A SG  1 
ATOM   654  N N   . ILE A 1 112 ? 9.269   -14.699 4.877  1.00 54.55 ? 193 ILE A N   1 
ATOM   655  C CA  . ILE A 1 112 ? 8.563   -14.707 3.605  1.00 54.21 ? 193 ILE A CA  1 
ATOM   656  C C   . ILE A 1 112 ? 7.083   -14.497 3.908  1.00 55.91 ? 193 ILE A C   1 
ATOM   657  O O   . ILE A 1 112 ? 6.540   -15.082 4.844  1.00 55.68 ? 193 ILE A O   1 
ATOM   658  C CB  . ILE A 1 112 ? 8.710   -16.053 2.879  1.00 52.56 ? 193 ILE A CB  1 
ATOM   659  C CG1 . ILE A 1 112 ? 10.163  -16.265 2.472  1.00 51.50 ? 193 ILE A CG1 1 
ATOM   660  C CG2 . ILE A 1 112 ? 7.836   -16.072 1.648  1.00 52.05 ? 193 ILE A CG2 1 
ATOM   661  C CD1 . ILE A 1 112 ? 10.420  -17.518 1.651  1.00 49.69 ? 193 ILE A CD1 1 
ATOM   662  N N   . GLN A 1 113 ? 6.442   -13.658 3.106  1.00 56.96 ? 194 GLN A N   1 
ATOM   663  C CA  . GLN A 1 113 ? 5.029   -13.371 3.263  1.00 57.46 ? 194 GLN A CA  1 
ATOM   664  C C   . GLN A 1 113 ? 4.150   -14.178 2.321  1.00 58.31 ? 194 GLN A C   1 
ATOM   665  O O   . GLN A 1 113 ? 4.487   -14.421 1.171  1.00 58.05 ? 194 GLN A O   1 
ATOM   666  C CB  . GLN A 1 113 ? 4.774   -11.878 3.052  1.00 58.00 ? 194 GLN A CB  1 
ATOM   667  C CG  . GLN A 1 113 ? 4.990   -11.019 4.291  1.00 60.67 ? 194 GLN A CG  1 
ATOM   668  C CD  . GLN A 1 113 ? 4.017   -11.334 5.432  1.00 63.25 ? 194 GLN A CD  1 
ATOM   669  O OE1 . GLN A 1 113 ? 2.804   -11.507 5.221  1.00 64.23 ? 194 GLN A OE1 1 
ATOM   670  N NE2 . GLN A 1 113 ? 4.547   -11.387 6.653  1.00 62.46 ? 194 GLN A NE2 1 
ATOM   671  N N   . VAL A 1 114 ? 3.036   -14.640 2.857  1.00 60.23 ? 195 VAL A N   1 
ATOM   672  C CA  . VAL A 1 114 ? 2.059   -15.374 2.091  1.00 61.89 ? 195 VAL A CA  1 
ATOM   673  C C   . VAL A 1 114 ? 0.750   -14.686 2.447  1.00 64.32 ? 195 VAL A C   1 
ATOM   674  O O   . VAL A 1 114 ? 0.342   -14.630 3.609  1.00 64.43 ? 195 VAL A O   1 
ATOM   675  C CB  . VAL A 1 114 ? 2.016   -16.872 2.462  1.00 60.42 ? 195 VAL A CB  1 
ATOM   676  C CG1 . VAL A 1 114 ? 0.876   -17.545 1.738  1.00 58.79 ? 195 VAL A CG1 1 
ATOM   677  C CG2 . VAL A 1 114 ? 3.319   -17.539 2.060  1.00 59.88 ? 195 VAL A CG2 1 
ATOM   678  N N   . ASP A 1 115 ? 0.153   -14.094 1.425  1.00 66.62 ? 196 ASP A N   1 
ATOM   679  C CA  . ASP A 1 115 ? -1.101  -13.387 1.546  1.00 69.77 ? 196 ASP A CA  1 
ATOM   680  C C   . ASP A 1 115 ? -2.152  -14.249 0.901  1.00 71.02 ? 196 ASP A C   1 
ATOM   681  O O   . ASP A 1 115 ? -2.097  -14.477 -0.316 1.00 71.12 ? 196 ASP A O   1 
ATOM   682  C CB  . ASP A 1 115 ? -1.035  -12.042 0.834  1.00 71.37 ? 196 ASP A CB  1 
ATOM   683  C CG  . ASP A 1 115 ? -0.816  -10.894 1.782  1.00 73.91 ? 196 ASP A CG  1 
ATOM   684  O OD1 . ASP A 1 115 ? -1.486  -10.836 2.838  1.00 75.16 ? 196 ASP A OD1 1 
ATOM   685  O OD2 . ASP A 1 115 ? 0.029   -10.041 1.457  1.00 75.62 ? 196 ASP A OD2 1 
ATOM   686  N N   . PRO A 1 116 ? -3.097  -14.791 1.681  1.00 72.49 ? 197 PRO A N   1 
ATOM   687  C CA  . PRO A 1 116 ? -4.035  -15.576 0.897  1.00 74.75 ? 197 PRO A CA  1 
ATOM   688  C C   . PRO A 1 116 ? -4.538  -14.557 -0.137 1.00 77.07 ? 197 PRO A C   1 
ATOM   689  O O   . PRO A 1 116 ? -4.265  -13.370 -0.008 1.00 77.75 ? 197 PRO A O   1 
ATOM   690  C CB  . PRO A 1 116 ? -5.066  -16.028 1.936  1.00 73.60 ? 197 PRO A CB  1 
ATOM   691  C CG  . PRO A 1 116 ? -4.983  -15.005 2.976  1.00 72.89 ? 197 PRO A CG  1 
ATOM   692  C CD  . PRO A 1 116 ? -3.511  -14.731 3.094  1.00 71.84 ? 197 PRO A CD  1 
ATOM   693  N N   . PRO A 1 117 ? -5.295  -14.982 -1.136 1.00 78.59 ? 198 PRO A N   1 
ATOM   694  C CA  . PRO A 1 117 ? -5.757  -16.328 -1.421 1.00 80.35 ? 198 PRO A CA  1 
ATOM   695  C C   . PRO A 1 117 ? -4.875  -17.176 -2.327 1.00 82.57 ? 198 PRO A C   1 
ATOM   696  O O   . PRO A 1 117 ? -5.360  -17.614 -3.358 1.00 83.70 ? 198 PRO A O   1 
ATOM   697  C CB  . PRO A 1 117 ? -7.101  -16.050 -2.050 1.00 79.68 ? 198 PRO A CB  1 
ATOM   698  C CG  . PRO A 1 117 ? -6.743  -14.930 -2.974 1.00 78.92 ? 198 PRO A CG  1 
ATOM   699  C CD  . PRO A 1 117 ? -5.816  -14.045 -2.159 1.00 78.47 ? 198 PRO A CD  1 
ATOM   700  N N   . GLU A 1 118 ? -3.614  -17.415 -1.978 1.00 84.67 ? 199 GLU A N   1 
ATOM   701  C CA  . GLU A 1 118 ? -2.728  -18.255 -2.809 1.00 86.63 ? 199 GLU A CA  1 
ATOM   702  C C   . GLU A 1 118 ? -1.879  -17.479 -3.826 1.00 86.88 ? 199 GLU A C   1 
ATOM   703  O O   . GLU A 1 118 ? -1.953  -16.253 -3.929 1.00 87.55 ? 199 GLU A O   1 
ATOM   704  C CB  . GLU A 1 118 ? -3.546  -19.330 -3.563 1.00 88.27 ? 199 GLU A CB  1 
ATOM   705  C CG  . GLU A 1 118 ? -4.466  -20.205 -2.687 1.00 90.54 ? 199 GLU A CG  1 
ATOM   706  C CD  . GLU A 1 118 ? -5.460  -21.054 -3.493 1.00 92.61 ? 199 GLU A CD  1 
ATOM   707  O OE1 . GLU A 1 118 ? -5.429  -21.012 -4.746 1.00 93.02 ? 199 GLU A OE1 1 
ATOM   708  O OE2 . GLU A 1 118 ? -6.278  -21.767 -2.864 1.00 92.55 ? 199 GLU A OE2 1 
ATOM   709  N N   . SER A 1 135 ? 0.800   -18.061 -3.140 1.00 81.21 ? 216 SER A N   1 
ATOM   710  C CA  . SER A 1 135 ? 1.857   -19.012 -3.476 1.00 81.98 ? 216 SER A CA  1 
ATOM   711  C C   . SER A 1 135 ? 3.156   -18.241 -3.709 1.00 81.62 ? 216 SER A C   1 
ATOM   712  O O   . SER A 1 135 ? 3.379   -17.228 -3.053 1.00 81.83 ? 216 SER A O   1 
ATOM   713  C CB  . SER A 1 135 ? 1.483   -19.843 -4.719 1.00 81.93 ? 216 SER A CB  1 
ATOM   714  O OG  . SER A 1 135 ? 0.448   -20.778 -4.435 1.00 82.88 ? 216 SER A OG  1 
ATOM   715  N N   . SER A 1 136 ? 4.007   -18.719 -4.621 1.00 80.90 ? 217 SER A N   1 
ATOM   716  C CA  . SER A 1 136 ? 5.304   -18.077 -4.936 1.00 79.05 ? 217 SER A CA  1 
ATOM   717  C C   . SER A 1 136 ? 6.408   -18.302 -3.894 1.00 76.71 ? 217 SER A C   1 
ATOM   718  O O   . SER A 1 136 ? 7.528   -17.807 -4.043 1.00 76.76 ? 217 SER A O   1 
ATOM   719  C CB  . SER A 1 136 ? 5.145   -16.562 -5.104 1.00 80.12 ? 217 SER A CB  1 
ATOM   720  O OG  . SER A 1 136 ? 5.058   -15.900 -3.843 1.00 81.42 ? 217 SER A OG  1 
ATOM   721  N N   . TYR A 1 137 ? 6.078   -19.063 -2.857 1.00 73.27 ? 218 TYR A N   1 
ATOM   722  C CA  . TYR A 1 137 ? 6.979   -19.326 -1.737 1.00 68.58 ? 218 TYR A CA  1 
ATOM   723  C C   . TYR A 1 137 ? 7.576   -20.722 -1.718 1.00 66.52 ? 218 TYR A C   1 
ATOM   724  O O   . TYR A 1 137 ? 8.272   -21.057 -0.771 1.00 65.01 ? 218 TYR A O   1 
ATOM   725  C CB  . TYR A 1 137 ? 6.213   -19.171 -0.424 1.00 67.11 ? 218 TYR A CB  1 
ATOM   726  C CG  . TYR A 1 137 ? 5.326   -20.371 -0.160 1.00 62.94 ? 218 TYR A CG  1 
ATOM   727  C CD1 . TYR A 1 137 ? 4.218   -20.644 -0.969 1.00 61.55 ? 218 TYR A CD1 1 
ATOM   728  C CD2 . TYR A 1 137 ? 5.676   -21.309 0.802  1.00 61.85 ? 218 TYR A CD2 1 
ATOM   729  C CE1 . TYR A 1 137 ? 3.512   -21.826 -0.842 1.00 59.73 ? 218 TYR A CE1 1 
ATOM   730  C CE2 . TYR A 1 137 ? 4.977   -22.491 0.931  1.00 60.99 ? 218 TYR A CE2 1 
ATOM   731  C CZ  . TYR A 1 137 ? 3.899   -22.736 0.114  1.00 60.56 ? 218 TYR A CZ  1 
ATOM   732  O OH  . TYR A 1 137 ? 3.229   -23.916 0.257  1.00 61.15 ? 218 TYR A OH  1 
ATOM   733  N N   . LYS A 1 138 ? 7.294   -21.544 -2.721 1.00 64.38 ? 219 LYS A N   1 
ATOM   734  C CA  . LYS A 1 138 ? 7.797   -22.912 -2.705 1.00 62.20 ? 219 LYS A CA  1 
ATOM   735  C C   . LYS A 1 138 ? 9.227   -23.066 -3.169 1.00 59.97 ? 219 LYS A C   1 
ATOM   736  O O   . LYS A 1 138 ? 9.697   -24.178 -3.368 1.00 59.80 ? 219 LYS A O   1 
ATOM   737  C CB  . LYS A 1 138 ? 6.893   -23.821 -3.544 1.00 63.31 ? 219 LYS A CB  1 
ATOM   738  C CG  . LYS A 1 138 ? 6.592   -25.156 -2.883 1.00 64.28 ? 219 LYS A CG  1 
ATOM   739  C CD  . LYS A 1 138 ? 5.150   -25.575 -3.113 1.00 65.00 ? 219 LYS A CD  1 
ATOM   740  C CE  . LYS A 1 138 ? 4.582   -26.209 -1.855 1.00 64.59 ? 219 LYS A CE  1 
ATOM   741  N NZ  . LYS A 1 138 ? 4.008   -27.553 -2.120 1.00 64.06 ? 219 LYS A NZ  1 
ATOM   742  N N   . ASN A 1 139 ? 9.919   -21.949 -3.332 1.00 57.38 ? 220 ASN A N   1 
ATOM   743  C CA  . ASN A 1 139 ? 11.312  -21.966 -3.760 1.00 55.42 ? 220 ASN A CA  1 
ATOM   744  C C   . ASN A 1 139 ? 12.236  -21.695 -2.570 1.00 54.00 ? 220 ASN A C   1 
ATOM   745  O O   . ASN A 1 139 ? 13.385  -21.285 -2.716 1.00 53.70 ? 220 ASN A O   1 
ATOM   746  C CB  . ASN A 1 139 ? 11.505  -20.937 -4.871 1.00 55.36 ? 220 ASN A CB  1 
ATOM   747  C CG  . ASN A 1 139 ? 11.025  -21.449 -6.215 1.00 54.48 ? 220 ASN A CG  1 
ATOM   748  O OD1 . ASN A 1 139 ? 10.487  -20.694 -7.021 1.00 55.35 ? 220 ASN A OD1 1 
ATOM   749  N ND2 . ASN A 1 139 ? 11.230  -22.737 -6.467 1.00 53.11 ? 220 ASN A ND2 1 
ATOM   750  N N   . LEU A 1 140 ? 11.698  -21.939 -1.383 1.00 52.21 ? 221 LEU A N   1 
ATOM   751  C CA  . LEU A 1 140 ? 12.412  -21.756 -0.125 1.00 50.32 ? 221 LEU A CA  1 
ATOM   752  C C   . LEU A 1 140 ? 13.669  -22.617 -0.096 1.00 48.67 ? 221 LEU A C   1 
ATOM   753  O O   . LEU A 1 140 ? 13.666  -23.748 -0.578 1.00 48.73 ? 221 LEU A O   1 
ATOM   754  C CB  . LEU A 1 140 ? 11.495  -22.156 1.040  1.00 49.75 ? 221 LEU A CB  1 
ATOM   755  C CG  . LEU A 1 140 ? 12.071  -22.208 2.455  1.00 47.07 ? 221 LEU A CG  1 
ATOM   756  C CD1 . LEU A 1 140 ? 12.222  -20.800 3.018  1.00 44.44 ? 221 LEU A CD1 1 
ATOM   757  C CD2 . LEU A 1 140 ? 11.128  -23.027 3.327  1.00 47.68 ? 221 LEU A CD2 1 
ATOM   758  N N   . THR A 1 141 ? 14.742  -22.069 0.462  1.00 47.32 ? 222 THR A N   1 
ATOM   759  C CA  . THR A 1 141 ? 16.002  -22.784 0.584  1.00 46.25 ? 222 THR A CA  1 
ATOM   760  C C   . THR A 1 141 ? 16.411  -22.667 2.035  1.00 45.70 ? 222 THR A C   1 
ATOM   761  O O   . THR A 1 141 ? 16.766  -21.584 2.506  1.00 44.51 ? 222 THR A O   1 
ATOM   762  C CB  . THR A 1 141 ? 17.107  -22.167 -0.280 1.00 47.07 ? 222 THR A CB  1 
ATOM   763  O OG1 . THR A 1 141 ? 16.783  -22.340 -1.663 1.00 49.47 ? 222 THR A OG1 1 
ATOM   764  C CG2 . THR A 1 141 ? 18.443  -22.840 0.015  1.00 46.24 ? 222 THR A CG2 1 
ATOM   765  N N   . LEU A 1 142 ? 16.353  -23.787 2.741  1.00 44.22 ? 223 LEU A N   1 
ATOM   766  C CA  . LEU A 1 142 ? 16.695  -23.809 4.152  1.00 43.55 ? 223 LEU A CA  1 
ATOM   767  C C   . LEU A 1 142 ? 18.191  -23.816 4.432  1.00 43.50 ? 223 LEU A C   1 
ATOM   768  O O   . LEU A 1 142 ? 18.935  -24.635 3.897  1.00 44.19 ? 223 LEU A O   1 
ATOM   769  C CB  . LEU A 1 142 ? 16.041  -25.021 4.810  1.00 42.30 ? 223 LEU A CB  1 
ATOM   770  C CG  . LEU A 1 142 ? 14.520  -24.972 4.773  1.00 42.46 ? 223 LEU A CG  1 
ATOM   771  C CD1 . LEU A 1 142 ? 13.945  -26.325 5.128  1.00 42.87 ? 223 LEU A CD1 1 
ATOM   772  C CD2 . LEU A 1 142 ? 14.038  -23.895 5.728  1.00 43.66 ? 223 LEU A CD2 1 
ATOM   773  N N   . LYS A 1 143 ? 18.623  -22.887 5.275  1.00 44.44 ? 224 LYS A N   1 
ATOM   774  C CA  . LYS A 1 143 ? 20.020  -22.788 5.678  1.00 44.78 ? 224 LYS A CA  1 
ATOM   775  C C   . LYS A 1 143 ? 20.306  -23.904 6.692  1.00 44.49 ? 224 LYS A C   1 
ATOM   776  O O   . LYS A 1 143 ? 20.699  -23.630 7.822  1.00 43.61 ? 224 LYS A O   1 
ATOM   777  C CB  . LYS A 1 143 ? 20.264  -21.438 6.346  1.00 47.84 ? 224 LYS A CB  1 
ATOM   778  C CG  . LYS A 1 143 ? 20.869  -20.354 5.471  1.00 52.73 ? 224 LYS A CG  1 
ATOM   779  C CD  . LYS A 1 143 ? 19.980  -19.912 4.320  1.00 54.02 ? 224 LYS A CD  1 
ATOM   780  C CE  . LYS A 1 143 ? 20.563  -18.646 3.685  1.00 56.83 ? 224 LYS A CE  1 
ATOM   781  N NZ  . LYS A 1 143 ? 22.058  -18.722 3.516  1.00 55.71 ? 224 LYS A NZ  1 
ATOM   782  N N   . PHE A 1 144 ? 20.111  -25.155 6.285  1.00 44.31 ? 225 PHE A N   1 
ATOM   783  C CA  . PHE A 1 144 ? 20.312  -26.306 7.170  1.00 44.90 ? 225 PHE A CA  1 
ATOM   784  C C   . PHE A 1 144 ? 21.510  -26.252 8.117  1.00 46.00 ? 225 PHE A C   1 
ATOM   785  O O   . PHE A 1 144 ? 21.359  -26.399 9.334  1.00 45.51 ? 225 PHE A O   1 
ATOM   786  C CB  . PHE A 1 144 ? 20.383  -27.597 6.348  1.00 43.88 ? 225 PHE A CB  1 
ATOM   787  C CG  . PHE A 1 144 ? 19.073  -28.000 5.746  1.00 42.47 ? 225 PHE A CG  1 
ATOM   788  C CD1 . PHE A 1 144 ? 17.963  -28.221 6.554  1.00 41.92 ? 225 PHE A CD1 1 
ATOM   789  C CD2 . PHE A 1 144 ? 18.941  -28.155 4.373  1.00 43.79 ? 225 PHE A CD2 1 
ATOM   790  C CE1 . PHE A 1 144 ? 16.739  -28.592 6.005  1.00 41.32 ? 225 PHE A CE1 1 
ATOM   791  C CE2 . PHE A 1 144 ? 17.716  -28.527 3.810  1.00 44.06 ? 225 PHE A CE2 1 
ATOM   792  C CZ  . PHE A 1 144 ? 16.614  -28.746 4.630  1.00 43.79 ? 225 PHE A CZ  1 
ATOM   793  N N   . HIS A 1 145 ? 22.698  -26.051 7.568  1.00 46.33 ? 226 HIS A N   1 
ATOM   794  C CA  . HIS A 1 145 ? 23.893  -26.002 8.390  1.00 46.38 ? 226 HIS A CA  1 
ATOM   795  C C   . HIS A 1 145 ? 23.900  -24.865 9.407  1.00 46.26 ? 226 HIS A C   1 
ATOM   796  O O   . HIS A 1 145 ? 24.473  -24.998 10.485 1.00 45.01 ? 226 HIS A O   1 
ATOM   797  C CB  . HIS A 1 145 ? 25.122  -25.924 7.486  1.00 49.18 ? 226 HIS A CB  1 
ATOM   798  C CG  . HIS A 1 145 ? 25.397  -27.197 6.744  1.00 52.77 ? 226 HIS A CG  1 
ATOM   799  N ND1 . HIS A 1 145 ? 26.349  -27.292 5.754  1.00 53.46 ? 226 HIS A ND1 1 
ATOM   800  C CD2 . HIS A 1 145 ? 24.852  -28.431 6.863  1.00 53.24 ? 226 HIS A CD2 1 
ATOM   801  C CE1 . HIS A 1 145 ? 26.378  -28.531 5.293  1.00 53.11 ? 226 HIS A CE1 1 
ATOM   802  N NE2 . HIS A 1 145 ? 25.480  -29.242 5.950  1.00 53.77 ? 226 HIS A NE2 1 
ATOM   803  N N   . LYS A 1 146 ? 23.236  -23.764 9.078  1.00 46.81 ? 227 LYS A N   1 
ATOM   804  C CA  . LYS A 1 146 ? 23.190  -22.596 9.960  1.00 48.06 ? 227 LYS A CA  1 
ATOM   805  C C   . LYS A 1 146 ? 21.899  -22.506 10.787 1.00 46.45 ? 227 LYS A C   1 
ATOM   806  O O   . LYS A 1 146 ? 21.834  -21.772 11.777 1.00 47.44 ? 227 LYS A O   1 
ATOM   807  C CB  . LYS A 1 146 ? 23.295  -21.319 9.118  1.00 52.36 ? 227 LYS A CB  1 
ATOM   808  C CG  . LYS A 1 146 ? 24.129  -21.446 7.843  1.00 57.53 ? 227 LYS A CG  1 
ATOM   809  C CD  . LYS A 1 146 ? 25.562  -20.974 8.055  1.00 61.39 ? 227 LYS A CD  1 
ATOM   810  C CE  . LYS A 1 146 ? 26.359  -21.019 6.753  1.00 63.57 ? 227 LYS A CE  1 
ATOM   811  N NZ  . LYS A 1 146 ? 27.694  -20.365 6.903  1.00 64.65 ? 227 LYS A NZ  1 
ATOM   812  N N   . LEU A 1 147 ? 20.883  -23.255 10.368 1.00 42.48 ? 228 LEU A N   1 
ATOM   813  C CA  . LEU A 1 147 ? 19.563  -23.233 10.984 1.00 37.92 ? 228 LEU A CA  1 
ATOM   814  C C   . LEU A 1 147 ? 19.424  -23.212 12.509 1.00 37.74 ? 228 LEU A C   1 
ATOM   815  O O   . LEU A 1 147 ? 20.004  -24.028 13.231 1.00 35.21 ? 228 LEU A O   1 
ATOM   816  C CB  . LEU A 1 147 ? 18.720  -24.378 10.412 1.00 36.34 ? 228 LEU A CB  1 
ATOM   817  C CG  . LEU A 1 147 ? 17.216  -24.288 10.708 1.00 36.55 ? 228 LEU A CG  1 
ATOM   818  C CD1 . LEU A 1 147 ? 16.649  -22.995 10.127 1.00 35.75 ? 228 LEU A CD1 1 
ATOM   819  C CD2 . LEU A 1 147 ? 16.501  -25.497 10.122 1.00 34.01 ? 228 LEU A CD2 1 
ATOM   820  N N   . VAL A 1 148 ? 18.638  -22.250 12.984 1.00 35.60 ? 229 VAL A N   1 
ATOM   821  C CA  . VAL A 1 148 ? 18.352  -22.105 14.401 1.00 35.45 ? 229 VAL A CA  1 
ATOM   822  C C   . VAL A 1 148 ? 16.955  -22.703 14.578 1.00 36.28 ? 229 VAL A C   1 
ATOM   823  O O   . VAL A 1 148 ? 16.729  -23.570 15.419 1.00 37.66 ? 229 VAL A O   1 
ATOM   824  C CB  . VAL A 1 148 ? 18.358  -20.612 14.826 1.00 35.75 ? 229 VAL A CB  1 
ATOM   825  C CG1 . VAL A 1 148 ? 17.898  -20.468 16.274 1.00 33.61 ? 229 VAL A CG1 1 
ATOM   826  C CG2 . VAL A 1 148 ? 19.767  -20.044 14.678 1.00 34.47 ? 229 VAL A CG2 1 
ATOM   827  N N   . ASN A 1 149 ? 16.022  -22.235 13.763 1.00 35.20 ? 230 ASN A N   1 
ATOM   828  C CA  . ASN A 1 149 ? 14.657  -22.731 13.781 1.00 33.67 ? 230 ASN A CA  1 
ATOM   829  C C   . ASN A 1 149 ? 13.930  -22.184 12.567 1.00 33.89 ? 230 ASN A C   1 
ATOM   830  O O   . ASN A 1 149 ? 14.514  -21.502 11.723 1.00 33.12 ? 230 ASN A O   1 
ATOM   831  C CB  . ASN A 1 149 ? 13.905  -22.297 15.055 1.00 32.25 ? 230 ASN A CB  1 
ATOM   832  C CG  . ASN A 1 149 ? 13.558  -20.808 15.071 1.00 33.24 ? 230 ASN A CG  1 
ATOM   833  O OD1 . ASN A 1 149 ? 13.196  -20.230 14.045 1.00 32.89 ? 230 ASN A OD1 1 
ATOM   834  N ND2 . ASN A 1 149 ? 13.647  -20.188 16.246 1.00 32.62 ? 230 ASN A ND2 1 
ATOM   835  N N   . VAL A 1 150 ? 12.649  -22.503 12.494 1.00 34.37 ? 231 VAL A N   1 
ATOM   836  C CA  . VAL A 1 150 ? 11.778  -22.034 11.435 1.00 35.44 ? 231 VAL A CA  1 
ATOM   837  C C   . VAL A 1 150 ? 10.420  -21.898 12.089 1.00 35.52 ? 231 VAL A C   1 
ATOM   838  O O   . VAL A 1 150 ? 10.014  -22.754 12.875 1.00 36.97 ? 231 VAL A O   1 
ATOM   839  C CB  . VAL A 1 150 ? 11.659  -23.032 10.270 1.00 34.77 ? 231 VAL A CB  1 
ATOM   840  C CG1 . VAL A 1 150 ? 10.645  -22.512 9.249  1.00 34.85 ? 231 VAL A CG1 1 
ATOM   841  C CG2 . VAL A 1 150 ? 13.007  -23.232 9.621  1.00 35.93 ? 231 VAL A CG2 1 
ATOM   842  N N   . THR A 1 151 ? 9.726   -20.814 11.784 1.00 35.04 ? 232 THR A N   1 
ATOM   843  C CA  . THR A 1 151 ? 8.418   -20.599 12.361 1.00 33.86 ? 232 THR A CA  1 
ATOM   844  C C   . THR A 1 151 ? 7.432   -20.167 11.295 1.00 35.91 ? 232 THR A C   1 
ATOM   845  O O   . THR A 1 151 ? 7.793   -19.508 10.315 1.00 37.11 ? 232 THR A O   1 
ATOM   846  C CB  . THR A 1 151 ? 8.459   -19.520 13.456 1.00 32.70 ? 232 THR A CB  1 
ATOM   847  O OG1 . THR A 1 151 ? 8.937   -18.292 12.897 1.00 32.28 ? 232 THR A OG1 1 
ATOM   848  C CG2 . THR A 1 151 ? 9.371   -19.947 14.596 1.00 29.19 ? 232 THR A CG2 1 
ATOM   849  N N   . ILE A 1 152 ? 6.188   -20.580 11.476 1.00 35.81 ? 233 ILE A N   1 
ATOM   850  C CA  . ILE A 1 152 ? 5.126   -20.198 10.570 1.00 36.73 ? 233 ILE A CA  1 
ATOM   851  C C   . ILE A 1 152 ? 4.107   -19.538 11.475 1.00 37.75 ? 233 ILE A C   1 
ATOM   852  O O   . ILE A 1 152 ? 3.595   -20.164 12.405 1.00 38.81 ? 233 ILE A O   1 
ATOM   853  C CB  . ILE A 1 152 ? 4.502   -21.401 9.871  1.00 34.69 ? 233 ILE A CB  1 
ATOM   854  C CG1 . ILE A 1 152 ? 5.556   -22.090 9.000  1.00 34.65 ? 233 ILE A CG1 1 
ATOM   855  C CG2 . ILE A 1 152 ? 3.317   -20.938 9.027  1.00 34.88 ? 233 ILE A CG2 1 
ATOM   856  C CD1 . ILE A 1 152 ? 5.041   -23.288 8.233  1.00 32.41 ? 233 ILE A CD1 1 
ATOM   857  N N   . HIS A 1 153 ? 3.827   -18.270 11.213 1.00 37.78 ? 234 HIS A N   1 
ATOM   858  C CA  . HIS A 1 153 ? 2.903   -17.529 12.042 1.00 39.75 ? 234 HIS A CA  1 
ATOM   859  C C   . HIS A 1 153 ? 1.743   -16.926 11.260 1.00 39.28 ? 234 HIS A C   1 
ATOM   860  O O   . HIS A 1 153 ? 1.931   -16.329 10.198 1.00 39.77 ? 234 HIS A O   1 
ATOM   861  C CB  . HIS A 1 153 ? 3.672   -16.432 12.780 1.00 44.04 ? 234 HIS A CB  1 
ATOM   862  C CG  . HIS A 1 153 ? 2.832   -15.632 13.721 1.00 51.68 ? 234 HIS A CG  1 
ATOM   863  N ND1 . HIS A 1 153 ? 1.862   -14.753 13.289 1.00 55.07 ? 234 HIS A ND1 1 
ATOM   864  C CD2 . HIS A 1 153 ? 2.792   -15.605 15.075 1.00 54.21 ? 234 HIS A CD2 1 
ATOM   865  C CE1 . HIS A 1 153 ? 1.257   -14.219 14.337 1.00 56.46 ? 234 HIS A CE1 1 
ATOM   866  N NE2 . HIS A 1 153 ? 1.803   -14.720 15.432 1.00 57.24 ? 234 HIS A NE2 1 
ATOM   867  N N   . PHE A 1 154 ? 0.539   -17.104 11.793 1.00 37.64 ? 235 PHE A N   1 
ATOM   868  C CA  . PHE A 1 154 ? -0.666  -16.557 11.186 1.00 36.15 ? 235 PHE A CA  1 
ATOM   869  C C   . PHE A 1 154 ? -1.793  -16.528 12.199 1.00 36.43 ? 235 PHE A C   1 
ATOM   870  O O   . PHE A 1 154 ? -1.733  -17.200 13.229 1.00 36.62 ? 235 PHE A O   1 
ATOM   871  C CB  . PHE A 1 154 ? -1.095  -17.361 9.960  1.00 33.10 ? 235 PHE A CB  1 
ATOM   872  C CG  . PHE A 1 154 ? -1.331  -18.811 10.233 1.00 32.31 ? 235 PHE A CG  1 
ATOM   873  C CD1 . PHE A 1 154 ? -0.303  -19.734 10.081 1.00 30.54 ? 235 PHE A CD1 1 
ATOM   874  C CD2 . PHE A 1 154 ? -2.589  -19.260 10.630 1.00 32.15 ? 235 PHE A CD2 1 
ATOM   875  C CE1 . PHE A 1 154 ? -0.524  -21.084 10.311 1.00 31.88 ? 235 PHE A CE1 1 
ATOM   876  C CE2 . PHE A 1 154 ? -2.825  -20.612 10.866 1.00 31.68 ? 235 PHE A CE2 1 
ATOM   877  C CZ  . PHE A 1 154 ? -1.793  -21.528 10.708 1.00 32.24 ? 235 PHE A CZ  1 
ATOM   878  N N   . ARG A 1 155 ? -2.818  -15.737 11.906 1.00 37.78 ? 236 ARG A N   1 
ATOM   879  C CA  . ARG A 1 155 ? -3.959  -15.603 12.799 1.00 39.75 ? 236 ARG A CA  1 
ATOM   880  C C   . ARG A 1 155 ? -5.258  -15.987 12.111 1.00 39.13 ? 236 ARG A C   1 
ATOM   881  O O   . ARG A 1 155 ? -5.447  -15.711 10.925 1.00 38.52 ? 236 ARG A O   1 
ATOM   882  C CB  . ARG A 1 155 ? -4.069  -14.160 13.298 1.00 42.28 ? 236 ARG A CB  1 
ATOM   883  C CG  . ARG A 1 155 ? -3.022  -13.747 14.310 1.00 46.72 ? 236 ARG A CG  1 
ATOM   884  C CD  . ARG A 1 155 ? -2.877  -12.246 14.316 1.00 51.70 ? 236 ARG A CD  1 
ATOM   885  N NE  . ARG A 1 155 ? -2.304  -11.781 13.056 1.00 58.20 ? 236 ARG A NE  1 
ATOM   886  C CZ  . ARG A 1 155 ? -2.224  -10.505 12.686 1.00 62.07 ? 236 ARG A CZ  1 
ATOM   887  N NH1 . ARG A 1 155 ? -2.688  -9.544  13.481 1.00 62.08 ? 236 ARG A NH1 1 
ATOM   888  N NH2 . ARG A 1 155 ? -1.678  -10.188 11.516 1.00 65.00 ? 236 ARG A NH2 1 
ATOM   889  N N   . LEU A 1 156 ? -6.146  -16.627 12.867 1.00 38.39 ? 237 LEU A N   1 
ATOM   890  C CA  . LEU A 1 156 ? -7.451  -17.028 12.356 1.00 38.04 ? 237 LEU A CA  1 
ATOM   891  C C   . LEU A 1 156 ? -8.531  -16.403 13.228 1.00 37.99 ? 237 LEU A C   1 
ATOM   892  O O   . LEU A 1 156 ? -8.441  -16.390 14.453 1.00 37.67 ? 237 LEU A O   1 
ATOM   893  C CB  . LEU A 1 156 ? -7.593  -18.549 12.357 1.00 38.06 ? 237 LEU A CB  1 
ATOM   894  C CG  . LEU A 1 156 ? -6.635  -19.325 11.450 1.00 37.99 ? 237 LEU A CG  1 
ATOM   895  C CD1 . LEU A 1 156 ? -6.918  -20.807 11.584 1.00 36.32 ? 237 LEU A CD1 1 
ATOM   896  C CD2 . LEU A 1 156 ? -6.794  -18.880 10.001 1.00 37.46 ? 237 LEU A CD2 1 
ATOM   897  N N   . LYS A 1 157 ? -9.558  -15.877 12.588 1.00 39.96 ? 238 LYS A N   1 
ATOM   898  C CA  . LYS A 1 157 ? -10.628 -15.235 13.322 1.00 41.44 ? 238 LYS A CA  1 
ATOM   899  C C   . LYS A 1 157 ? -11.911 -16.036 13.191 1.00 40.96 ? 238 LYS A C   1 
ATOM   900  O O   . LYS A 1 157 ? -12.234 -16.525 12.105 1.00 42.25 ? 238 LYS A O   1 
ATOM   901  C CB  . LYS A 1 157 ? -10.829 -13.821 12.779 1.00 42.16 ? 238 LYS A CB  1 
ATOM   902  C CG  . LYS A 1 157 ? -11.832 -13.001 13.546 1.00 47.21 ? 238 LYS A CG  1 
ATOM   903  C CD  . LYS A 1 157 ? -11.801 -11.550 13.096 1.00 48.43 ? 238 LYS A CD  1 
ATOM   904  C CE  . LYS A 1 157 ? -12.812 -10.739 13.871 1.00 49.99 ? 238 LYS A CE  1 
ATOM   905  N NZ  . LYS A 1 157 ? -12.575 -10.872 15.332 1.00 51.91 ? 238 LYS A NZ  1 
ATOM   906  N N   . THR A 1 158 ? -12.634 -16.189 14.296 1.00 37.90 ? 239 THR A N   1 
ATOM   907  C CA  . THR A 1 158 ? -13.889 -16.913 14.250 1.00 36.85 ? 239 THR A CA  1 
ATOM   908  C C   . THR A 1 158 ? -14.818 -16.600 15.407 1.00 37.15 ? 239 THR A C   1 
ATOM   909  O O   . THR A 1 158 ? -14.450 -15.940 16.374 1.00 36.43 ? 239 THR A O   1 
ATOM   910  C CB  . THR A 1 158 ? -13.681 -18.436 14.207 1.00 37.47 ? 239 THR A CB  1 
ATOM   911  O OG1 . THR A 1 158 ? -14.927 -19.071 13.869 1.00 35.50 ? 239 THR A OG1 1 
ATOM   912  C CG2 . THR A 1 158 ? -13.202 -18.951 15.567 1.00 35.87 ? 239 THR A CG2 1 
ATOM   913  N N   . ILE A 1 159 ? -16.035 -17.105 15.279 1.00 37.28 ? 240 ILE A N   1 
ATOM   914  C CA  . ILE A 1 159 ? -17.084 -16.923 16.262 1.00 38.52 ? 240 ILE A CA  1 
ATOM   915  C C   . ILE A 1 159 ? -17.283 -18.216 17.061 1.00 37.95 ? 240 ILE A C   1 
ATOM   916  O O   . ILE A 1 159 ? -16.959 -19.301 16.573 1.00 36.75 ? 240 ILE A O   1 
ATOM   917  C CB  . ILE A 1 159 ? -18.398 -16.550 15.528 1.00 40.58 ? 240 ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 159 ? -18.565 -15.036 15.515 1.00 42.30 ? 240 ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 159 ? -19.582 -17.256 16.137 1.00 42.70 ? 240 ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 159 ? -17.536 -14.326 14.669 1.00 46.09 ? 240 ILE A CD1 1 
ATOM   921  N N   . ASN A 1 160 ? -17.780 -18.099 18.294 1.00 36.09 ? 241 ASN A N   1 
ATOM   922  C CA  . ASN A 1 160 ? -18.063 -19.284 19.100 1.00 34.95 ? 241 ASN A CA  1 
ATOM   923  C C   . ASN A 1 160 ? -19.579 -19.452 19.104 1.00 34.17 ? 241 ASN A C   1 
ATOM   924  O O   . ASN A 1 160 ? -20.290 -18.800 19.871 1.00 32.62 ? 241 ASN A O   1 
ATOM   925  C CB  . ASN A 1 160 ? -17.557 -19.145 20.535 1.00 33.03 ? 241 ASN A CB  1 
ATOM   926  C CG  . ASN A 1 160 ? -17.841 -20.393 21.359 1.00 33.19 ? 241 ASN A CG  1 
ATOM   927  O OD1 . ASN A 1 160 ? -18.460 -21.335 20.869 1.00 31.59 ? 241 ASN A OD1 1 
ATOM   928  N ND2 . ASN A 1 160 ? -17.397 -20.404 22.607 1.00 33.92 ? 241 ASN A ND2 1 
ATOM   929  N N   . LEU A 1 161 ? -20.061 -20.336 18.235 1.00 34.95 ? 242 LEU A N   1 
ATOM   930  C CA  . LEU A 1 161 ? -21.492 -20.579 18.074 1.00 35.13 ? 242 LEU A CA  1 
ATOM   931  C C   . LEU A 1 161 ? -22.230 -21.259 19.200 1.00 34.18 ? 242 LEU A C   1 
ATOM   932  O O   . LEU A 1 161 ? -23.435 -21.463 19.096 1.00 35.75 ? 242 LEU A O   1 
ATOM   933  C CB  . LEU A 1 161 ? -21.741 -21.362 16.790 1.00 36.93 ? 242 LEU A CB  1 
ATOM   934  C CG  . LEU A 1 161 ? -21.365 -20.617 15.511 1.00 37.65 ? 242 LEU A CG  1 
ATOM   935  C CD1 . LEU A 1 161 ? -21.524 -21.543 14.321 1.00 38.34 ? 242 LEU A CD1 1 
ATOM   936  C CD2 . LEU A 1 161 ? -22.246 -19.378 15.367 1.00 38.30 ? 242 LEU A CD2 1 
ATOM   937  N N   . GLN A 1 162 ? -21.526 -21.620 20.266 1.00 34.49 ? 243 GLN A N   1 
ATOM   938  C CA  . GLN A 1 162 ? -22.166 -22.271 21.410 1.00 33.71 ? 243 GLN A CA  1 
ATOM   939  C C   . GLN A 1 162 ? -23.222 -21.346 22.027 1.00 34.47 ? 243 GLN A C   1 
ATOM   940  O O   . GLN A 1 162 ? -24.142 -21.800 22.710 1.00 33.82 ? 243 GLN A O   1 
ATOM   941  C CB  . GLN A 1 162 ? -21.107 -22.660 22.445 1.00 32.24 ? 243 GLN A CB  1 
ATOM   942  C CG  . GLN A 1 162 ? -20.181 -23.784 21.970 1.00 32.39 ? 243 GLN A CG  1 
ATOM   943  C CD  . GLN A 1 162 ? -19.058 -24.078 22.947 1.00 33.58 ? 243 GLN A CD  1 
ATOM   944  O OE1 . GLN A 1 162 ? -19.134 -23.711 24.123 1.00 36.11 ? 243 GLN A OE1 1 
ATOM   945  N NE2 . GLN A 1 162 ? -18.015 -24.755 22.472 1.00 31.04 ? 243 GLN A NE2 1 
ATOM   946  N N   . SER A 1 163 ? -23.084 -20.048 21.758 1.00 35.00 ? 244 SER A N   1 
ATOM   947  C CA  . SER A 1 163 ? -24.014 -19.027 22.242 1.00 35.50 ? 244 SER A CA  1 
ATOM   948  C C   . SER A 1 163 ? -25.439 -19.258 21.759 1.00 35.40 ? 244 SER A C   1 
ATOM   949  O O   . SER A 1 163 ? -26.400 -18.956 22.461 1.00 34.45 ? 244 SER A O   1 
ATOM   950  C CB  . SER A 1 163 ? -23.586 -17.648 21.751 1.00 33.86 ? 244 SER A CB  1 
ATOM   951  O OG  . SER A 1 163 ? -22.527 -17.130 22.527 1.00 45.47 ? 244 SER A OG  1 
ATOM   952  N N   . LEU A 1 164 ? -25.568 -19.778 20.545 1.00 35.69 ? 245 LEU A N   1 
ATOM   953  C CA  . LEU A 1 164 ? -26.875 -20.002 19.964 1.00 36.71 ? 245 LEU A CA  1 
ATOM   954  C C   . LEU A 1 164 ? -27.819 -20.837 20.806 1.00 36.94 ? 245 LEU A C   1 
ATOM   955  O O   . LEU A 1 164 ? -29.003 -20.514 20.905 1.00 37.38 ? 245 LEU A O   1 
ATOM   956  C CB  . LEU A 1 164 ? -26.731 -20.621 18.577 1.00 36.21 ? 245 LEU A CB  1 
ATOM   957  C CG  . LEU A 1 164 ? -26.040 -19.709 17.567 1.00 37.78 ? 245 LEU A CG  1 
ATOM   958  C CD1 . LEU A 1 164 ? -26.222 -20.274 16.166 1.00 38.32 ? 245 LEU A CD1 1 
ATOM   959  C CD2 . LEU A 1 164 ? -26.638 -18.317 17.650 1.00 37.47 ? 245 LEU A CD2 1 
ATOM   960  N N   . ILE A 1 165 ? -27.312 -21.901 21.420 1.00 36.71 ? 246 ILE A N   1 
ATOM   961  C CA  . ILE A 1 165 ? -28.173 -22.748 22.236 1.00 38.08 ? 246 ILE A CA  1 
ATOM   962  C C   . ILE A 1 165 ? -28.808 -21.972 23.392 1.00 38.31 ? 246 ILE A C   1 
ATOM   963  O O   . ILE A 1 165 ? -29.835 -22.384 23.925 1.00 39.19 ? 246 ILE A O   1 
ATOM   964  C CB  . ILE A 1 165 ? -27.410 -23.969 22.803 1.00 38.51 ? 246 ILE A CB  1 
ATOM   965  C CG1 . ILE A 1 165 ? -28.405 -24.971 23.384 1.00 40.71 ? 246 ILE A CG1 1 
ATOM   966  C CG2 . ILE A 1 165 ? -26.456 -23.536 23.904 1.00 39.69 ? 246 ILE A CG2 1 
ATOM   967  C CD1 . ILE A 1 165 ? -29.443 -25.459 22.385 1.00 41.73 ? 246 ILE A CD1 1 
ATOM   968  N N   . ASN A 1 166 ? -28.202 -20.851 23.776 1.00 37.92 ? 247 ASN A N   1 
ATOM   969  C CA  . ASN A 1 166 ? -28.740 -20.032 24.861 1.00 39.23 ? 247 ASN A CA  1 
ATOM   970  C C   . ASN A 1 166 ? -29.272 -18.701 24.342 1.00 38.96 ? 247 ASN A C   1 
ATOM   971  O O   . ASN A 1 166 ? -29.367 -17.719 25.083 1.00 38.95 ? 247 ASN A O   1 
ATOM   972  C CB  . ASN A 1 166 ? -27.672 -19.776 25.926 1.00 40.96 ? 247 ASN A CB  1 
ATOM   973  C CG  . ASN A 1 166 ? -27.199 -21.047 26.585 1.00 42.26 ? 247 ASN A CG  1 
ATOM   974  O OD1 . ASN A 1 166 ? -26.141 -21.584 26.247 1.00 44.03 ? 247 ASN A OD1 1 
ATOM   975  N ND2 . ASN A 1 166 ? -27.989 -21.548 27.524 1.00 42.66 ? 247 ASN A ND2 1 
ATOM   976  N N   . ASN A 1 167 ? -29.605 -18.686 23.057 1.00 39.30 ? 248 ASN A N   1 
ATOM   977  C CA  . ASN A 1 167 ? -30.146 -17.513 22.385 1.00 39.45 ? 248 ASN A CA  1 
ATOM   978  C C   . ASN A 1 167 ? -29.311 -16.251 22.606 1.00 38.75 ? 248 ASN A C   1 
ATOM   979  O O   . ASN A 1 167 ? -29.857 -15.169 22.848 1.00 39.27 ? 248 ASN A O   1 
ATOM   980  C CB  . ASN A 1 167 ? -31.600 -17.298 22.833 1.00 42.39 ? 248 ASN A CB  1 
ATOM   981  C CG  . ASN A 1 167 ? -32.339 -16.288 21.969 1.00 46.56 ? 248 ASN A CG  1 
ATOM   982  O OD1 . ASN A 1 167 ? -32.096 -16.187 20.763 1.00 50.17 ? 248 ASN A OD1 1 
ATOM   983  N ND2 . ASN A 1 167 ? -33.259 -15.548 22.578 1.00 46.78 ? 248 ASN A ND2 1 
ATOM   984  N N   . GLU A 1 168 ? -27.987 -16.393 22.506 1.00 37.10 ? 249 GLU A N   1 
ATOM   985  C CA  . GLU A 1 168 ? -27.072 -15.265 22.687 1.00 35.15 ? 249 GLU A CA  1 
ATOM   986  C C   . GLU A 1 168 ? -26.185 -14.998 21.472 1.00 34.95 ? 249 GLU A C   1 
ATOM   987  O O   . GLU A 1 168 ? -25.841 -15.916 20.725 1.00 32.77 ? 249 GLU A O   1 
ATOM   988  C CB  . GLU A 1 168 ? -26.209 -15.474 23.946 1.00 31.59 ? 249 GLU A CB  1 
ATOM   989  C CG  . GLU A 1 168 ? -26.835 -14.839 25.189 1.00 31.88 ? 249 GLU A CG  1 
ATOM   990  C CD  . GLU A 1 168 ? -26.107 -15.134 26.492 1.00 33.64 ? 249 GLU A CD  1 
ATOM   991  O OE1 . GLU A 1 168 ? -24.897 -15.464 26.458 1.00 29.95 ? 249 GLU A OE1 1 
ATOM   992  O OE2 . GLU A 1 168 ? -26.756 -15.012 27.561 1.00 33.89 ? 249 GLU A OE2 1 
ATOM   993  N N   . ILE A 1 169 ? -25.845 -13.725 21.270 1.00 35.19 ? 250 ILE A N   1 
ATOM   994  C CA  . ILE A 1 169 ? -24.979 -13.317 20.171 1.00 36.25 ? 250 ILE A CA  1 
ATOM   995  C C   . ILE A 1 169 ? -23.595 -13.866 20.499 1.00 36.95 ? 250 ILE A C   1 
ATOM   996  O O   . ILE A 1 169 ? -23.070 -13.624 21.584 1.00 38.24 ? 250 ILE A O   1 
ATOM   997  C CB  . ILE A 1 169 ? -24.844 -11.770 20.069 1.00 37.77 ? 250 ILE A CB  1 
ATOM   998  C CG1 . ILE A 1 169 ? -26.219 -11.106 20.007 1.00 38.36 ? 250 ILE A CG1 1 
ATOM   999  C CG2 . ILE A 1 169 ? -24.016 -11.405 18.843 1.00 34.27 ? 250 ILE A CG2 1 
ATOM   1000 C CD1 . ILE A 1 169 ? -27.042 -11.512 18.810 1.00 43.18 ? 250 ILE A CD1 1 
ATOM   1001 N N   . PRO A 1 170 ? -22.982 -14.600 19.566 1.00 37.11 ? 251 PRO A N   1 
ATOM   1002 C CA  . PRO A 1 170 ? -21.652 -15.173 19.790 1.00 37.50 ? 251 PRO A CA  1 
ATOM   1003 C C   . PRO A 1 170 ? -20.566 -14.118 19.930 1.00 37.95 ? 251 PRO A C   1 
ATOM   1004 O O   . PRO A 1 170 ? -20.592 -13.088 19.252 1.00 38.85 ? 251 PRO A O   1 
ATOM   1005 C CB  . PRO A 1 170 ? -21.424 -16.032 18.545 1.00 36.43 ? 251 PRO A CB  1 
ATOM   1006 C CG  . PRO A 1 170 ? -22.804 -16.334 18.056 1.00 38.39 ? 251 PRO A CG  1 
ATOM   1007 C CD  . PRO A 1 170 ? -23.523 -15.032 18.267 1.00 38.85 ? 251 PRO A CD  1 
ATOM   1008 N N   . ASP A 1 171 ? -19.613 -14.370 20.818 1.00 37.32 ? 252 ASP A N   1 
ATOM   1009 C CA  . ASP A 1 171 ? -18.514 -13.449 20.983 1.00 37.27 ? 252 ASP A CA  1 
ATOM   1010 C C   . ASP A 1 171 ? -17.423 -13.894 20.018 1.00 38.75 ? 252 ASP A C   1 
ATOM   1011 O O   . ASP A 1 171 ? -17.498 -14.984 19.444 1.00 37.57 ? 252 ASP A O   1 
ATOM   1012 C CB  . ASP A 1 171 ? -18.033 -13.434 22.429 1.00 38.80 ? 252 ASP A CB  1 
ATOM   1013 C CG  . ASP A 1 171 ? -18.926 -12.584 23.322 1.00 40.37 ? 252 ASP A CG  1 
ATOM   1014 O OD1 . ASP A 1 171 ? -19.276 -11.454 22.910 1.00 40.25 ? 252 ASP A OD1 1 
ATOM   1015 O OD2 . ASP A 1 171 ? -19.272 -13.032 24.433 1.00 41.66 ? 252 ASP A OD2 1 
ATOM   1016 N N   . CYS A 1 172 ? -16.412 -13.050 19.839 1.00 39.84 ? 253 CYS A N   1 
ATOM   1017 C CA  . CYS A 1 172 ? -15.345 -13.319 18.884 1.00 38.23 ? 253 CYS A CA  1 
ATOM   1018 C C   . CYS A 1 172 ? -14.005 -13.823 19.424 1.00 37.33 ? 253 CYS A C   1 
ATOM   1019 O O   . CYS A 1 172 ? -13.537 -13.395 20.480 1.00 36.60 ? 253 CYS A O   1 
ATOM   1020 C CB  . CYS A 1 172 ? -15.145 -12.059 18.016 1.00 40.04 ? 253 CYS A CB  1 
ATOM   1021 S SG  . CYS A 1 172 ? -16.181 -12.058 16.505 1.00 43.21 ? 253 CYS A SG  1 
ATOM   1022 N N   . TYR A 1 173 ? -13.402 -14.746 18.675 1.00 36.42 ? 254 TYR A N   1 
ATOM   1023 C CA  . TYR A 1 173 ? -12.109 -15.341 19.013 1.00 36.42 ? 254 TYR A CA  1 
ATOM   1024 C C   . TYR A 1 173 ? -11.104 -15.161 17.879 1.00 36.25 ? 254 TYR A C   1 
ATOM   1025 O O   . TYR A 1 173 ? -11.379 -15.496 16.729 1.00 37.25 ? 254 TYR A O   1 
ATOM   1026 C CB  . TYR A 1 173 ? -12.252 -16.848 19.277 1.00 35.48 ? 254 TYR A CB  1 
ATOM   1027 C CG  . TYR A 1 173 ? -12.801 -17.208 20.633 1.00 36.13 ? 254 TYR A CG  1 
ATOM   1028 C CD1 . TYR A 1 173 ? -11.959 -17.668 21.648 1.00 37.40 ? 254 TYR A CD1 1 
ATOM   1029 C CD2 . TYR A 1 173 ? -14.162 -17.084 20.909 1.00 37.03 ? 254 TYR A CD2 1 
ATOM   1030 C CE1 . TYR A 1 173 ? -12.464 -17.995 22.910 1.00 38.99 ? 254 TYR A CE1 1 
ATOM   1031 C CE2 . TYR A 1 173 ? -14.677 -17.402 22.160 1.00 38.64 ? 254 TYR A CE2 1 
ATOM   1032 C CZ  . TYR A 1 173 ? -13.822 -17.857 23.157 1.00 39.07 ? 254 TYR A CZ  1 
ATOM   1033 O OH  . TYR A 1 173 ? -14.327 -18.152 24.400 1.00 40.09 ? 254 TYR A OH  1 
ATOM   1034 N N   . THR A 1 174 ? -9.934  -14.632 18.202 1.00 36.66 ? 255 THR A N   1 
ATOM   1035 C CA  . THR A 1 174 ? -8.893  -14.473 17.198 1.00 36.29 ? 255 THR A CA  1 
ATOM   1036 C C   . THR A 1 174 ? -7.713  -15.293 17.700 1.00 34.65 ? 255 THR A C   1 
ATOM   1037 O O   . THR A 1 174 ? -7.107  -14.972 18.723 1.00 34.56 ? 255 THR A O   1 
ATOM   1038 C CB  . THR A 1 174 ? -8.486  -12.996 17.015 1.00 37.01 ? 255 THR A CB  1 
ATOM   1039 O OG1 . THR A 1 174 ? -9.646  -12.223 16.672 1.00 39.42 ? 255 THR A OG1 1 
ATOM   1040 C CG2 . THR A 1 174 ? -7.468  -12.865 15.893 1.00 34.24 ? 255 THR A CG2 1 
ATOM   1041 N N   . PHE A 1 175 ? -7.415  -16.373 16.988 1.00 33.06 ? 256 PHE A N   1 
ATOM   1042 C CA  . PHE A 1 175 ? -6.327  -17.262 17.367 1.00 33.83 ? 256 PHE A CA  1 
ATOM   1043 C C   . PHE A 1 175 ? -5.011  -16.893 16.694 1.00 35.56 ? 256 PHE A C   1 
ATOM   1044 O O   . PHE A 1 175 ? -4.949  -16.686 15.479 1.00 35.95 ? 256 PHE A O   1 
ATOM   1045 C CB  . PHE A 1 175 ? -6.674  -18.722 17.010 1.00 32.37 ? 256 PHE A CB  1 
ATOM   1046 C CG  . PHE A 1 175 ? -7.910  -19.253 17.701 1.00 29.78 ? 256 PHE A CG  1 
ATOM   1047 C CD1 . PHE A 1 175 ? -7.988  -19.304 19.089 1.00 30.31 ? 256 PHE A CD1 1 
ATOM   1048 C CD2 . PHE A 1 175 ? -8.995  -19.708 16.958 1.00 29.69 ? 256 PHE A CD2 1 
ATOM   1049 C CE1 . PHE A 1 175 ? -9.134  -19.805 19.732 1.00 31.47 ? 256 PHE A CE1 1 
ATOM   1050 C CE2 . PHE A 1 175 ? -10.144 -20.210 17.588 1.00 30.66 ? 256 PHE A CE2 1 
ATOM   1051 C CZ  . PHE A 1 175 ? -10.212 -20.256 18.978 1.00 28.71 ? 256 PHE A CZ  1 
ATOM   1052 N N   . SER A 1 176 ? -3.960  -16.797 17.499 1.00 36.91 ? 257 SER A N   1 
ATOM   1053 C CA  . SER A 1 176 ? -2.631  -16.502 16.985 1.00 37.99 ? 257 SER A CA  1 
ATOM   1054 C C   . SER A 1 176 ? -1.922  -17.855 16.946 1.00 37.22 ? 257 SER A C   1 
ATOM   1055 O O   . SER A 1 176 ? -1.642  -18.447 17.990 1.00 37.04 ? 257 SER A O   1 
ATOM   1056 C CB  . SER A 1 176 ? -1.896  -15.549 17.920 1.00 39.71 ? 257 SER A CB  1 
ATOM   1057 O OG  . SER A 1 176 ? -0.614  -15.250 17.397 1.00 47.32 ? 257 SER A OG  1 
ATOM   1058 N N   . VAL A 1 177 ? -1.665  -18.352 15.741 1.00 36.72 ? 258 VAL A N   1 
ATOM   1059 C CA  . VAL A 1 177 ? -1.026  -19.650 15.564 1.00 34.91 ? 258 VAL A CA  1 
ATOM   1060 C C   . VAL A 1 177 ? 0.467   -19.537 15.296 1.00 34.81 ? 258 VAL A C   1 
ATOM   1061 O O   . VAL A 1 177 ? 0.895   -18.760 14.447 1.00 36.25 ? 258 VAL A O   1 
ATOM   1062 C CB  . VAL A 1 177 ? -1.683  -20.424 14.402 1.00 33.73 ? 258 VAL A CB  1 
ATOM   1063 C CG1 . VAL A 1 177 ? -1.026  -21.776 14.235 1.00 33.62 ? 258 VAL A CG1 1 
ATOM   1064 C CG2 . VAL A 1 177 ? -3.159  -20.594 14.668 1.00 32.36 ? 258 VAL A CG2 1 
ATOM   1065 N N   . LEU A 1 178 ? 1.250   -20.318 16.033 1.00 34.62 ? 259 LEU A N   1 
ATOM   1066 C CA  . LEU A 1 178 ? 2.703   -20.335 15.886 1.00 33.72 ? 259 LEU A CA  1 
ATOM   1067 C C   . LEU A 1 178 ? 3.208   -21.768 15.783 1.00 34.59 ? 259 LEU A C   1 
ATOM   1068 O O   . LEU A 1 178 ? 3.137   -22.540 16.750 1.00 35.37 ? 259 LEU A O   1 
ATOM   1069 C CB  . LEU A 1 178 ? 3.386   -19.658 17.079 1.00 32.04 ? 259 LEU A CB  1 
ATOM   1070 C CG  . LEU A 1 178 ? 4.923   -19.605 17.016 1.00 32.97 ? 259 LEU A CG  1 
ATOM   1071 C CD1 . LEU A 1 178 ? 5.341   -18.816 15.788 1.00 30.56 ? 259 LEU A CD1 1 
ATOM   1072 C CD2 . LEU A 1 178 ? 5.497   -18.951 18.277 1.00 31.75 ? 259 LEU A CD2 1 
ATOM   1073 N N   . ILE A 1 179 ? 3.712   -22.124 14.608 1.00 33.42 ? 260 ILE A N   1 
ATOM   1074 C CA  . ILE A 1 179 ? 4.243   -23.455 14.384 1.00 33.76 ? 260 ILE A CA  1 
ATOM   1075 C C   . ILE A 1 179 ? 5.757   -23.329 14.400 1.00 33.40 ? 260 ILE A C   1 
ATOM   1076 O O   . ILE A 1 179 ? 6.316   -22.547 13.643 1.00 33.78 ? 260 ILE A O   1 
ATOM   1077 C CB  . ILE A 1 179 ? 3.787   -23.997 13.033 1.00 36.16 ? 260 ILE A CB  1 
ATOM   1078 C CG1 . ILE A 1 179 ? 2.255   -24.012 12.991 1.00 36.81 ? 260 ILE A CG1 1 
ATOM   1079 C CG2 . ILE A 1 179 ? 4.373   -25.380 12.804 1.00 35.46 ? 260 ILE A CG2 1 
ATOM   1080 C CD1 . ILE A 1 179 ? 1.675   -24.466 11.670 1.00 37.54 ? 260 ILE A CD1 1 
ATOM   1081 N N   . THR A 1 180 ? 6.411   -24.089 15.273 1.00 32.30 ? 261 THR A N   1 
ATOM   1082 C CA  . THR A 1 180 ? 7.863   -24.029 15.403 1.00 31.55 ? 261 THR A CA  1 
ATOM   1083 C C   . THR A 1 180 ? 8.597   -25.333 15.109 1.00 31.82 ? 261 THR A C   1 
ATOM   1084 O O   . THR A 1 180 ? 8.222   -26.406 15.581 1.00 31.79 ? 261 THR A O   1 
ATOM   1085 C CB  . THR A 1 180 ? 8.291   -23.584 16.824 1.00 30.00 ? 261 THR A CB  1 
ATOM   1086 O OG1 . THR A 1 180 ? 7.743   -22.298 17.118 1.00 27.18 ? 261 THR A OG1 1 
ATOM   1087 C CG2 . THR A 1 180 ? 9.800   -23.505 16.918 1.00 27.80 ? 261 THR A CG2 1 
ATOM   1088 N N   . PHE A 1 181 ? 9.651   -25.206 14.316 1.00 31.96 ? 262 PHE A N   1 
ATOM   1089 C CA  . PHE A 1 181 ? 10.519  -26.311 13.945 1.00 32.12 ? 262 PHE A CA  1 
ATOM   1090 C C   . PHE A 1 181 ? 11.791  -25.876 14.664 1.00 32.91 ? 262 PHE A C   1 
ATOM   1091 O O   . PHE A 1 181 ? 12.561  -25.069 14.156 1.00 32.94 ? 262 PHE A O   1 
ATOM   1092 C CB  . PHE A 1 181 ? 10.691  -26.328 12.425 1.00 31.58 ? 262 PHE A CB  1 
ATOM   1093 C CG  . PHE A 1 181 ? 9.384   -26.426 11.681 1.00 32.78 ? 262 PHE A CG  1 
ATOM   1094 C CD1 . PHE A 1 181 ? 8.865   -27.665 11.311 1.00 33.66 ? 262 PHE A CD1 1 
ATOM   1095 C CD2 . PHE A 1 181 ? 8.640   -25.282 11.405 1.00 31.56 ? 262 PHE A CD2 1 
ATOM   1096 C CE1 . PHE A 1 181 ? 7.622   -27.767 10.675 1.00 33.00 ? 262 PHE A CE1 1 
ATOM   1097 C CE2 . PHE A 1 181 ? 7.397   -25.373 10.773 1.00 34.32 ? 262 PHE A CE2 1 
ATOM   1098 C CZ  . PHE A 1 181 ? 6.887   -26.622 10.407 1.00 32.90 ? 262 PHE A CZ  1 
ATOM   1099 N N   . ASP A 1 182 ? 11.971  -26.397 15.872 1.00 33.30 ? 263 ASP A N   1 
ATOM   1100 C CA  . ASP A 1 182 ? 13.086  -26.032 16.726 1.00 34.18 ? 263 ASP A CA  1 
ATOM   1101 C C   . ASP A 1 182 ? 14.369  -26.827 16.518 1.00 35.44 ? 263 ASP A C   1 
ATOM   1102 O O   . ASP A 1 182 ? 14.408  -28.043 16.727 1.00 34.36 ? 263 ASP A O   1 
ATOM   1103 C CB  . ASP A 1 182 ? 12.627  -26.130 18.183 1.00 34.97 ? 263 ASP A CB  1 
ATOM   1104 C CG  . ASP A 1 182 ? 13.597  -25.498 19.147 1.00 36.03 ? 263 ASP A CG  1 
ATOM   1105 O OD1 . ASP A 1 182 ? 14.379  -24.625 18.723 1.00 38.67 ? 263 ASP A OD1 1 
ATOM   1106 O OD2 . ASP A 1 182 ? 13.566  -25.864 20.340 1.00 38.48 ? 263 ASP A OD2 1 
ATOM   1107 N N   . ASN A 1 183 ? 15.422  -26.117 16.114 1.00 34.88 ? 264 ASN A N   1 
ATOM   1108 C CA  . ASN A 1 183 ? 16.724  -26.721 15.882 1.00 33.25 ? 264 ASN A CA  1 
ATOM   1109 C C   . ASN A 1 183 ? 17.796  -26.157 16.821 1.00 33.12 ? 264 ASN A C   1 
ATOM   1110 O O   . ASN A 1 183 ? 18.992  -26.281 16.553 1.00 33.42 ? 264 ASN A O   1 
ATOM   1111 C CB  . ASN A 1 183 ? 17.148  -26.505 14.431 1.00 30.98 ? 264 ASN A CB  1 
ATOM   1112 C CG  . ASN A 1 183 ? 18.353  -27.336 14.060 1.00 33.17 ? 264 ASN A CG  1 
ATOM   1113 O OD1 . ASN A 1 183 ? 18.362  -28.549 14.262 1.00 34.90 ? 264 ASN A OD1 1 
ATOM   1114 N ND2 . ASN A 1 183 ? 19.378  -26.694 13.518 1.00 31.04 ? 264 ASN A ND2 1 
ATOM   1115 N N   . LYS A 1 184 ? 17.372  -25.551 17.927 1.00 33.43 ? 265 LYS A N   1 
ATOM   1116 C CA  . LYS A 1 184 ? 18.320  -24.963 18.873 1.00 35.54 ? 265 LYS A CA  1 
ATOM   1117 C C   . LYS A 1 184 ? 19.253  -25.970 19.541 1.00 35.11 ? 265 LYS A C   1 
ATOM   1118 O O   . LYS A 1 184 ? 20.322  -25.601 20.019 1.00 36.72 ? 265 LYS A O   1 
ATOM   1119 C CB  . LYS A 1 184 ? 17.582  -24.156 19.947 1.00 38.70 ? 265 LYS A CB  1 
ATOM   1120 C CG  . LYS A 1 184 ? 16.869  -22.923 19.400 1.00 43.52 ? 265 LYS A CG  1 
ATOM   1121 C CD  . LYS A 1 184 ? 16.532  -21.920 20.497 1.00 46.70 ? 265 LYS A CD  1 
ATOM   1122 C CE  . LYS A 1 184 ? 15.864  -20.671 19.928 1.00 48.26 ? 265 LYS A CE  1 
ATOM   1123 N NZ  . LYS A 1 184 ? 15.586  -19.655 20.986 1.00 49.89 ? 265 LYS A NZ  1 
ATOM   1124 N N   . ALA A 1 185 ? 18.854  -27.236 19.582 1.00 33.19 ? 266 ALA A N   1 
ATOM   1125 C CA  . ALA A 1 185 ? 19.699  -28.253 20.183 1.00 30.54 ? 266 ALA A CA  1 
ATOM   1126 C C   . ALA A 1 185 ? 20.742  -28.738 19.168 1.00 29.90 ? 266 ALA A C   1 
ATOM   1127 O O   . ALA A 1 185 ? 21.713  -29.399 19.539 1.00 30.62 ? 266 ALA A O   1 
ATOM   1128 C CB  . ALA A 1 185 ? 18.851  -29.417 20.677 1.00 30.02 ? 266 ALA A CB  1 
ATOM   1129 N N   . HIS A 1 186 ? 20.541  -28.409 17.894 1.00 28.35 ? 267 HIS A N   1 
ATOM   1130 C CA  . HIS A 1 186 ? 21.478  -28.807 16.837 1.00 29.21 ? 267 HIS A CA  1 
ATOM   1131 C C   . HIS A 1 186 ? 21.881  -30.258 17.047 1.00 28.40 ? 267 HIS A C   1 
ATOM   1132 O O   . HIS A 1 186 ? 23.070  -30.599 17.038 1.00 26.06 ? 267 HIS A O   1 
ATOM   1133 C CB  . HIS A 1 186 ? 22.723  -27.907 16.877 1.00 29.30 ? 267 HIS A CB  1 
ATOM   1134 C CG  . HIS A 1 186 ? 22.406  -26.447 16.779 1.00 31.62 ? 267 HIS A CG  1 
ATOM   1135 N ND1 . HIS A 1 186 ? 22.000  -25.852 15.602 1.00 31.57 ? 267 HIS A ND1 1 
ATOM   1136 C CD2 . HIS A 1 186 ? 22.354  -25.480 17.728 1.00 30.19 ? 267 HIS A CD2 1 
ATOM   1137 C CE1 . HIS A 1 186 ? 21.709  -24.583 15.832 1.00 33.12 ? 267 HIS A CE1 1 
ATOM   1138 N NE2 . HIS A 1 186 ? 21.913  -24.332 17.113 1.00 31.07 ? 267 HIS A NE2 1 
ATOM   1139 N N   . SER A 1 187 ? 20.873  -31.105 17.227 1.00 27.76 ? 268 SER A N   1 
ATOM   1140 C CA  . SER A 1 187 ? 21.086  -32.524 17.489 1.00 29.90 ? 268 SER A CA  1 
ATOM   1141 C C   . SER A 1 187 ? 20.750  -33.456 16.334 1.00 28.60 ? 268 SER A C   1 
ATOM   1142 O O   . SER A 1 187 ? 20.876  -34.666 16.472 1.00 29.76 ? 268 SER A O   1 
ATOM   1143 C CB  . SER A 1 187 ? 20.251  -32.948 18.699 1.00 27.59 ? 268 SER A CB  1 
ATOM   1144 O OG  . SER A 1 187 ? 18.868  -32.889 18.377 1.00 29.84 ? 268 SER A OG  1 
ATOM   1145 N N   . GLY A 1 188 ? 20.316  -32.908 15.207 1.00 28.88 ? 269 GLY A N   1 
ATOM   1146 C CA  . GLY A 1 188 ? 19.955  -33.760 14.088 1.00 28.50 ? 269 GLY A CA  1 
ATOM   1147 C C   . GLY A 1 188 ? 18.480  -34.115 14.173 1.00 30.43 ? 269 GLY A C   1 
ATOM   1148 O O   . GLY A 1 188 ? 17.928  -34.758 13.276 1.00 29.39 ? 269 GLY A O   1 
ATOM   1149 N N   . ARG A 1 189 ? 17.841  -33.697 15.264 1.00 29.59 ? 270 ARG A N   1 
ATOM   1150 C CA  . ARG A 1 189 ? 16.421  -33.947 15.472 1.00 30.19 ? 270 ARG A CA  1 
ATOM   1151 C C   . ARG A 1 189 ? 15.724  -32.617 15.672 1.00 31.00 ? 270 ARG A C   1 
ATOM   1152 O O   . ARG A 1 189 ? 16.069  -31.866 16.577 1.00 33.85 ? 270 ARG A O   1 
ATOM   1153 C CB  . ARG A 1 189 ? 16.201  -34.820 16.711 1.00 30.95 ? 270 ARG A CB  1 
ATOM   1154 C CG  . ARG A 1 189 ? 14.731  -34.990 17.120 1.00 31.55 ? 270 ARG A CG  1 
ATOM   1155 C CD  . ARG A 1 189 ? 14.584  -35.933 18.329 1.00 30.69 ? 270 ARG A CD  1 
ATOM   1156 N NE  . ARG A 1 189 ? 13.193  -36.073 18.752 1.00 30.00 ? 270 ARG A NE  1 
ATOM   1157 C CZ  . ARG A 1 189 ? 12.549  -35.214 19.539 1.00 31.15 ? 270 ARG A CZ  1 
ATOM   1158 N NH1 . ARG A 1 189 ? 13.174  -34.144 20.010 1.00 29.91 ? 270 ARG A NH1 1 
ATOM   1159 N NH2 . ARG A 1 189 ? 11.264  -35.406 19.826 1.00 29.75 ? 270 ARG A NH2 1 
ATOM   1160 N N   . ILE A 1 190 ? 14.743  -32.320 14.832 1.00 30.88 ? 271 ILE A N   1 
ATOM   1161 C CA  . ILE A 1 190 ? 14.016  -31.067 14.959 1.00 31.74 ? 271 ILE A CA  1 
ATOM   1162 C C   . ILE A 1 190 ? 12.569  -31.290 15.406 1.00 30.31 ? 271 ILE A C   1 
ATOM   1163 O O   . ILE A 1 190 ? 11.726  -31.733 14.627 1.00 29.92 ? 271 ILE A O   1 
ATOM   1164 C CB  . ILE A 1 190 ? 14.051  -30.273 13.621 1.00 33.67 ? 271 ILE A CB  1 
ATOM   1165 C CG1 . ILE A 1 190 ? 15.509  -29.903 13.290 1.00 34.67 ? 271 ILE A CG1 1 
ATOM   1166 C CG2 . ILE A 1 190 ? 13.164  -29.030 13.717 1.00 30.37 ? 271 ILE A CG2 1 
ATOM   1167 C CD1 . ILE A 1 190 ? 15.695  -29.202 11.972 1.00 35.85 ? 271 ILE A CD1 1 
ATOM   1168 N N   . PRO A 1 191 ? 12.271  -31.012 16.688 1.00 29.72 ? 272 PRO A N   1 
ATOM   1169 C CA  . PRO A 1 191 ? 10.904  -31.197 17.189 1.00 28.49 ? 272 PRO A CA  1 
ATOM   1170 C C   . PRO A 1 191 ? 9.982   -30.137 16.611 1.00 28.73 ? 272 PRO A C   1 
ATOM   1171 O O   . PRO A 1 191 ? 10.361  -28.973 16.504 1.00 28.19 ? 272 PRO A O   1 
ATOM   1172 C CB  . PRO A 1 191 ? 11.063  -31.087 18.703 1.00 26.22 ? 272 PRO A CB  1 
ATOM   1173 C CG  . PRO A 1 191 ? 12.245  -30.194 18.857 1.00 29.60 ? 272 PRO A CG  1 
ATOM   1174 C CD  . PRO A 1 191 ? 13.195  -30.674 17.786 1.00 28.20 ? 272 PRO A CD  1 
ATOM   1175 N N   . ILE A 1 192 ? 8.784   -30.555 16.215 1.00 29.54 ? 273 ILE A N   1 
ATOM   1176 C CA  . ILE A 1 192 ? 7.798   -29.649 15.628 1.00 30.09 ? 273 ILE A CA  1 
ATOM   1177 C C   . ILE A 1 192 ? 6.658   -29.421 16.609 1.00 29.51 ? 273 ILE A C   1 
ATOM   1178 O O   . ILE A 1 192 ? 6.142   -30.364 17.196 1.00 30.93 ? 273 ILE A O   1 
ATOM   1179 C CB  . ILE A 1 192 ? 7.229   -30.238 14.316 1.00 31.14 ? 273 ILE A CB  1 
ATOM   1180 C CG1 . ILE A 1 192 ? 8.375   -30.504 13.334 1.00 30.79 ? 273 ILE A CG1 1 
ATOM   1181 C CG2 . ILE A 1 192 ? 6.214   -29.282 13.696 1.00 27.98 ? 273 ILE A CG2 1 
ATOM   1182 C CD1 . ILE A 1 192 ? 7.959   -31.272 12.095 1.00 30.09 ? 273 ILE A CD1 1 
ATOM   1183 N N   . SER A 1 193 ? 6.256   -28.170 16.785 1.00 30.60 ? 274 SER A N   1 
ATOM   1184 C CA  . SER A 1 193 ? 5.180   -27.873 17.724 1.00 31.26 ? 274 SER A CA  1 
ATOM   1185 C C   . SER A 1 193 ? 4.283   -26.766 17.223 1.00 30.80 ? 274 SER A C   1 
ATOM   1186 O O   . SER A 1 193 ? 4.703   -25.910 16.446 1.00 30.98 ? 274 SER A O   1 
ATOM   1187 C CB  . SER A 1 193 ? 5.754   -27.458 19.080 1.00 29.92 ? 274 SER A CB  1 
ATOM   1188 O OG  . SER A 1 193 ? 6.448   -26.225 18.962 1.00 32.88 ? 274 SER A OG  1 
ATOM   1189 N N   . LEU A 1 194 ? 3.038   -26.795 17.677 1.00 30.09 ? 275 LEU A N   1 
ATOM   1190 C CA  . LEU A 1 194 ? 2.069   -25.774 17.317 1.00 30.52 ? 275 LEU A CA  1 
ATOM   1191 C C   . LEU A 1 194 ? 1.392   -25.327 18.607 1.00 32.35 ? 275 LEU A C   1 
ATOM   1192 O O   . LEU A 1 194 ? 0.869   -26.147 19.369 1.00 32.51 ? 275 LEU A O   1 
ATOM   1193 C CB  . LEU A 1 194 ? 1.044   -26.330 16.331 1.00 28.03 ? 275 LEU A CB  1 
ATOM   1194 C CG  . LEU A 1 194 ? -0.015  -25.377 15.787 1.00 26.79 ? 275 LEU A CG  1 
ATOM   1195 C CD1 . LEU A 1 194 ? -0.660  -26.014 14.580 1.00 26.67 ? 275 LEU A CD1 1 
ATOM   1196 C CD2 . LEU A 1 194 ? -1.064  -25.060 16.847 1.00 27.46 ? 275 LEU A CD2 1 
ATOM   1197 N N   . GLU A 1 195 ? 1.441   -24.026 18.860 1.00 32.92 ? 276 GLU A N   1 
ATOM   1198 C CA  . GLU A 1 195 ? 0.836   -23.447 20.047 1.00 34.72 ? 276 GLU A CA  1 
ATOM   1199 C C   . GLU A 1 195 ? -0.025  -22.274 19.603 1.00 34.55 ? 276 GLU A C   1 
ATOM   1200 O O   . GLU A 1 195 ? 0.163   -21.717 18.523 1.00 34.11 ? 276 GLU A O   1 
ATOM   1201 C CB  . GLU A 1 195 ? 1.908   -22.954 21.025 1.00 35.06 ? 276 GLU A CB  1 
ATOM   1202 C CG  . GLU A 1 195 ? 2.885   -24.020 21.499 1.00 41.63 ? 276 GLU A CG  1 
ATOM   1203 C CD  . GLU A 1 195 ? 2.203   -25.211 22.165 1.00 45.69 ? 276 GLU A CD  1 
ATOM   1204 O OE1 . GLU A 1 195 ? 1.290   -24.995 22.994 1.00 48.69 ? 276 GLU A OE1 1 
ATOM   1205 O OE2 . GLU A 1 195 ? 2.591   -26.365 21.869 1.00 47.65 ? 276 GLU A OE2 1 
ATOM   1206 N N   . THR A 1 196 ? -0.977  -21.896 20.436 1.00 33.79 ? 277 THR A N   1 
ATOM   1207 C CA  . THR A 1 196 ? -1.840  -20.795 20.080 1.00 34.54 ? 277 THR A CA  1 
ATOM   1208 C C   . THR A 1 196 ? -2.121  -19.912 21.273 1.00 36.11 ? 277 THR A C   1 
ATOM   1209 O O   . THR A 1 196 ? -1.884  -20.282 22.424 1.00 34.71 ? 277 THR A O   1 
ATOM   1210 C CB  . THR A 1 196 ? -3.196  -21.290 19.552 1.00 33.27 ? 277 THR A CB  1 
ATOM   1211 O OG1 . THR A 1 196 ? -3.873  -21.999 20.594 1.00 32.34 ? 277 THR A OG1 1 
ATOM   1212 C CG2 . THR A 1 196 ? -3.013  -22.208 18.365 1.00 32.80 ? 277 THR A CG2 1 
ATOM   1213 N N   . GLN A 1 197 ? -2.636  -18.732 20.964 1.00 37.91 ? 278 GLN A N   1 
ATOM   1214 C CA  . GLN A 1 197 ? -3.029  -17.752 21.957 1.00 38.62 ? 278 GLN A CA  1 
ATOM   1215 C C   . GLN A 1 197 ? -4.308  -17.159 21.396 1.00 37.23 ? 278 GLN A C   1 
ATOM   1216 O O   . GLN A 1 197 ? -4.446  -17.005 20.179 1.00 37.90 ? 278 GLN A O   1 
ATOM   1217 C CB  . GLN A 1 197 ? -1.943  -16.698 22.117 1.00 39.76 ? 278 GLN A CB  1 
ATOM   1218 C CG  . GLN A 1 197 ? -0.777  -17.207 22.925 1.00 46.10 ? 278 GLN A CG  1 
ATOM   1219 C CD  . GLN A 1 197 ? 0.396   -16.262 22.898 1.00 50.80 ? 278 GLN A CD  1 
ATOM   1220 O OE1 . GLN A 1 197 ? 1.184   -16.256 21.948 1.00 53.24 ? 278 GLN A OE1 1 
ATOM   1221 N NE2 . GLN A 1 197 ? 0.515   -15.441 23.937 1.00 52.55 ? 278 GLN A NE2 1 
ATOM   1222 N N   . ALA A 1 198 ? -5.254  -16.845 22.271 1.00 35.43 ? 279 ALA A N   1 
ATOM   1223 C CA  . ALA A 1 198 ? -6.523  -16.308 21.813 1.00 36.24 ? 279 ALA A CA  1 
ATOM   1224 C C   . ALA A 1 198 ? -6.853  -14.919 22.325 1.00 37.27 ? 279 ALA A C   1 
ATOM   1225 O O   . ALA A 1 198 ? -6.625  -14.594 23.492 1.00 38.13 ? 279 ALA A O   1 
ATOM   1226 C CB  . ALA A 1 198 ? -7.649  -17.274 22.185 1.00 34.96 ? 279 ALA A CB  1 
ATOM   1227 N N   . HIS A 1 199 ? -7.379  -14.096 21.427 1.00 37.67 ? 280 HIS A N   1 
ATOM   1228 C CA  . HIS A 1 199 ? -7.807  -12.757 21.777 1.00 38.89 ? 280 HIS A CA  1 
ATOM   1229 C C   . HIS A 1 199 ? -9.326  -12.813 21.672 1.00 38.42 ? 280 HIS A C   1 
ATOM   1230 O O   . HIS A 1 199 ? -9.868  -13.027 20.586 1.00 38.53 ? 280 HIS A O   1 
ATOM   1231 C CB  . HIS A 1 199 ? -7.251  -11.720 20.804 1.00 41.72 ? 280 HIS A CB  1 
ATOM   1232 C CG  . HIS A 1 199 ? -7.764  -10.333 21.055 1.00 47.25 ? 280 HIS A CG  1 
ATOM   1233 N ND1 . HIS A 1 199 ? -7.789  -9.768  22.313 1.00 48.49 ? 280 HIS A ND1 1 
ATOM   1234 C CD2 . HIS A 1 199 ? -8.283  -9.405  20.215 1.00 47.73 ? 280 HIS A CD2 1 
ATOM   1235 C CE1 . HIS A 1 199 ? -8.304  -8.553  22.238 1.00 49.52 ? 280 HIS A CE1 1 
ATOM   1236 N NE2 . HIS A 1 199 ? -8.611  -8.309  20.977 1.00 49.68 ? 280 HIS A NE2 1 
ATOM   1237 N N   . ILE A 1 200 ? -10.006 -12.638 22.802 1.00 38.03 ? 281 ILE A N   1 
ATOM   1238 C CA  . ILE A 1 200 ? -11.467 -12.706 22.845 1.00 39.03 ? 281 ILE A CA  1 
ATOM   1239 C C   . ILE A 1 200 ? -12.076 -11.326 23.091 1.00 39.91 ? 281 ILE A C   1 
ATOM   1240 O O   . ILE A 1 200 ? -11.535 -10.529 23.854 1.00 41.99 ? 281 ILE A O   1 
ATOM   1241 C CB  . ILE A 1 200 ? -11.941 -13.675 23.963 1.00 38.74 ? 281 ILE A CB  1 
ATOM   1242 C CG1 . ILE A 1 200 ? -10.965 -14.849 24.084 1.00 37.79 ? 281 ILE A CG1 1 
ATOM   1243 C CG2 . ILE A 1 200 ? -13.325 -14.221 23.635 1.00 37.87 ? 281 ILE A CG2 1 
ATOM   1244 C CD1 . ILE A 1 200 ? -11.277 -15.793 25.218 1.00 37.53 ? 281 ILE A CD1 1 
ATOM   1245 N N   . GLN A 1 201 ? -13.205 -11.054 22.446 1.00 40.70 ? 282 GLN A N   1 
ATOM   1246 C CA  . GLN A 1 201 ? -13.888 -9.766  22.572 1.00 42.68 ? 282 GLN A CA  1 
ATOM   1247 C C   . GLN A 1 201 ? -15.217 -9.894  21.850 1.00 42.56 ? 282 GLN A C   1 
ATOM   1248 O O   . GLN A 1 201 ? -15.404 -10.826 21.065 1.00 42.08 ? 282 GLN A O   1 
ATOM   1249 C CB  . GLN A 1 201 ? -13.076 -8.683  21.872 1.00 44.86 ? 282 GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 201 ? -12.981 -8.952  20.374 1.00 49.78 ? 282 GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 201 ? -11.847 -8.221  19.693 1.00 52.97 ? 282 GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 201 ? -11.405 -8.624  18.613 1.00 56.07 ? 282 GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 201 ? -11.373 -7.139  20.308 1.00 53.53 ? 282 GLN A NE2 1 
ATOM   1254 N N   . GLU A 1 202 ? -16.134 -8.964  22.100 1.00 41.83 ? 283 GLU A N   1 
ATOM   1255 C CA  . GLU A 1 202 ? -17.416 -9.007  21.410 1.00 41.34 ? 283 GLU A CA  1 
ATOM   1256 C C   . GLU A 1 202 ? -17.099 -8.661  19.967 1.00 41.19 ? 283 GLU A C   1 
ATOM   1257 O O   . GLU A 1 202 ? -16.117 -7.968  19.696 1.00 40.35 ? 283 GLU A O   1 
ATOM   1258 C CB  . GLU A 1 202 ? -18.387 -7.983  21.985 1.00 41.39 ? 283 GLU A CB  1 
ATOM   1259 C CG  . GLU A 1 202 ? -18.638 -8.140  23.468 1.00 44.67 ? 283 GLU A CG  1 
ATOM   1260 C CD  . GLU A 1 202 ? -19.926 -7.477  23.903 1.00 46.59 ? 283 GLU A CD  1 
ATOM   1261 O OE1 . GLU A 1 202 ? -20.210 -6.369  23.406 1.00 48.75 ? 283 GLU A OE1 1 
ATOM   1262 O OE2 . GLU A 1 202 ? -20.649 -8.059  24.742 1.00 46.60 ? 283 GLU A OE2 1 
ATOM   1263 N N   . CYS A 1 203 ? -17.916 -9.139  19.037 1.00 41.73 ? 284 CYS A N   1 
ATOM   1264 C CA  . CYS A 1 203 ? -17.663 -8.861  17.631 1.00 43.15 ? 284 CYS A CA  1 
ATOM   1265 C C   . CYS A 1 203 ? -18.090 -7.446  17.222 1.00 42.60 ? 284 CYS A C   1 
ATOM   1266 O O   . CYS A 1 203 ? -18.942 -6.864  17.930 1.00 42.37 ? 284 CYS A O   1 
ATOM   1267 C CB  . CYS A 1 203 ? -18.378 -9.892  16.758 1.00 42.73 ? 284 CYS A CB  1 
ATOM   1268 S SG  . CYS A 1 203 ? -18.081 -11.663 17.121 1.00 42.62 ? 284 CYS A SG  1 
HETATM 1269 O O   . HOH B 2 .   ? -1.104  -9.130  4.262  1.00 60.40 ? 401 HOH A O   1 
HETATM 1270 O O   . HOH B 2 .   ? -12.842 -33.150 26.307 1.00 78.56 ? 402 HOH A O   1 
HETATM 1271 O O   . HOH B 2 .   ? 3.067   -29.548 8.661  1.00 39.03 ? 403 HOH A O   1 
HETATM 1272 O O   . HOH B 2 .   ? -7.786  -29.134 30.050 1.00 43.29 ? 404 HOH A O   1 
HETATM 1273 O O   . HOH B 2 .   ? 13.575  -22.240 18.517 1.00 42.78 ? 405 HOH A O   1 
HETATM 1274 O O   . HOH B 2 .   ? -2.430  -13.607 10.004 1.00 40.48 ? 406 HOH A O   1 
HETATM 1275 O O   . HOH B 2 .   ? 13.899  -18.065 3.376  1.00 40.27 ? 407 HOH A O   1 
HETATM 1276 O O   . HOH B 2 .   ? -15.016 -16.729 10.608 1.00 54.56 ? 408 HOH A O   1 
HETATM 1277 O O   . HOH B 2 .   ? -22.042 -13.677 23.905 1.00 34.95 ? 409 HOH A O   1 
HETATM 1278 O O   . HOH B 2 .   ? -8.665  -37.450 16.596 1.00 37.19 ? 410 HOH A O   1 
HETATM 1279 O O   . HOH B 2 .   ? -17.991 -21.630 16.819 1.00 27.93 ? 411 HOH A O   1 
HETATM 1280 O O   . HOH B 2 .   ? 0.289   -40.925 19.129 1.00 48.70 ? 412 HOH A O   1 
HETATM 1281 O O   . HOH B 2 .   ? -13.319 -30.092 0.549  1.00 56.71 ? 413 HOH A O   1 
HETATM 1282 O O   . HOH B 2 .   ? 18.700  -35.821 10.951 1.00 26.67 ? 414 HOH A O   1 
HETATM 1283 O O   . HOH B 2 .   ? 7.036   -17.060 11.648 1.00 42.89 ? 415 HOH A O   1 
HETATM 1284 O O   . HOH B 2 .   ? 17.246  -12.405 14.119 1.00 57.32 ? 416 HOH A O   1 
HETATM 1285 O O   . HOH B 2 .   ? -11.357 -11.566 18.525 1.00 36.09 ? 417 HOH A O   1 
HETATM 1286 O O   . HOH B 2 .   ? -4.706  -15.096 8.328  1.00 34.27 ? 418 HOH A O   1 
HETATM 1287 O O   . HOH B 2 .   ? -12.431 -21.879 7.922  1.00 57.51 ? 419 HOH A O   1 
HETATM 1288 O O   . HOH B 2 .   ? -19.691 -16.760 21.925 1.00 28.06 ? 420 HOH A O   1 
HETATM 1289 O O   . HOH B 2 .   ? -9.990  -18.565 6.029  1.00 49.07 ? 421 HOH A O   1 
HETATM 1290 O O   . HOH B 2 .   ? -1.069  -23.857 22.571 1.00 24.84 ? 422 HOH A O   1 
HETATM 1291 O O   . HOH B 2 .   ? 5.621   -39.048 17.342 1.00 48.57 ? 423 HOH A O   1 
HETATM 1292 O O   . HOH B 2 .   ? 9.117   -20.697 18.736 1.00 31.30 ? 424 HOH A O   1 
HETATM 1293 O O   . HOH B 2 .   ? -8.424  -22.544 -0.475 1.00 49.86 ? 425 HOH A O   1 
HETATM 1294 O O   . HOH B 2 .   ? 17.983  -30.022 16.465 1.00 30.77 ? 426 HOH A O   1 
HETATM 1295 O O   . HOH B 2 .   ? -5.748  -35.862 11.217 1.00 34.46 ? 427 HOH A O   1 
HETATM 1296 O O   . HOH B 2 .   ? 20.884  -22.091 18.176 1.00 39.56 ? 428 HOH A O   1 
HETATM 1297 O O   . HOH B 2 .   ? 12.126  -25.157 -2.283 1.00 44.67 ? 429 HOH A O   1 
HETATM 1298 O O   . HOH B 2 .   ? -2.553  -35.426 21.842 1.00 34.14 ? 430 HOH A O   1 
HETATM 1299 O O   . HOH B 2 .   ? -4.788  -34.368 20.451 1.00 41.24 ? 431 HOH A O   1 
HETATM 1300 O O   . HOH B 2 .   ? 2.254   -29.061 18.933 1.00 33.15 ? 432 HOH A O   1 
HETATM 1301 O O   . HOH B 2 .   ? -22.473 -16.013 25.006 1.00 32.21 ? 433 HOH A O   1 
HETATM 1302 O O   . HOH B 2 .   ? -33.005 -15.727 25.282 1.00 48.60 ? 434 HOH A O   1 
HETATM 1303 O O   . HOH B 2 .   ? -20.048 -10.596 20.432 1.00 34.44 ? 435 HOH A O   1 
HETATM 1304 O O   . HOH B 2 .   ? 16.696  -31.900 19.721 1.00 33.93 ? 436 HOH A O   1 
HETATM 1305 O O   . HOH B 2 .   ? -3.096  -31.955 20.595 1.00 36.20 ? 437 HOH A O   1 
HETATM 1306 O O   . HOH B 2 .   ? -20.637 -10.679 25.579 1.00 37.46 ? 438 HOH A O   1 
HETATM 1307 O O   . HOH B 2 .   ? 5.910   -39.017 24.257 1.00 57.76 ? 439 HOH A O   1 
HETATM 1308 O O   . HOH B 2 .   ? -11.855 -8.242  25.360 1.00 40.73 ? 440 HOH A O   1 
HETATM 1309 O O   . HOH B 2 .   ? -19.677 -21.751 26.004 1.00 46.07 ? 441 HOH A O   1 
HETATM 1310 O O   . HOH B 2 .   ? -19.624 -3.888  22.320 1.00 65.36 ? 442 HOH A O   1 
HETATM 1311 O O   . HOH B 2 .   ? 11.828  -17.914 5.182  1.00 46.48 ? 443 HOH A O   1 
HETATM 1312 O O   . HOH B 2 .   ? 4.493   -31.940 24.992 1.00 82.33 ? 444 HOH A O   1 
HETATM 1313 O O   . HOH B 2 .   ? 7.669   -32.376 19.709 1.00 33.45 ? 445 HOH A O   1 
HETATM 1314 O O   . HOH B 2 .   ? 5.421   -23.088 18.447 1.00 34.88 ? 446 HOH A O   1 
HETATM 1315 O O   . HOH B 2 .   ? 16.619  -28.712 18.773 1.00 30.83 ? 447 HOH A O   1 
HETATM 1316 O O   . HOH B 2 .   ? -16.713 -24.947 7.862  1.00 47.82 ? 448 HOH A O   1 
HETATM 1317 O O   . HOH B 2 .   ? 20.454  -30.387 13.847 1.00 32.70 ? 449 HOH A O   1 
HETATM 1318 O O   . HOH B 2 .   ? -15.459 -21.970 13.594 1.00 33.64 ? 450 HOH A O   1 
HETATM 1319 O O   . HOH B 2 .   ? 9.842   -33.188 21.160 1.00 44.02 ? 451 HOH A O   1 
HETATM 1320 O O   . HOH B 2 .   ? 3.777   -31.254 18.651 1.00 28.66 ? 452 HOH A O   1 
HETATM 1321 O O   . HOH B 2 .   ? -2.970  -36.119 10.413 1.00 60.30 ? 453 HOH A O   1 
HETATM 1322 O O   . HOH B 2 .   ? -15.541 -27.303 0.889  1.00 42.22 ? 454 HOH A O   1 
HETATM 1323 O O   . HOH B 2 .   ? -2.014  -25.145 25.924 1.00 56.39 ? 455 HOH A O   1 
HETATM 1324 O O   . HOH B 2 .   ? -14.341 -22.605 15.962 1.00 29.61 ? 456 HOH A O   1 
HETATM 1325 O O   . HOH B 2 .   ? 19.366  -28.214 10.313 1.00 50.56 ? 457 HOH A O   1 
HETATM 1326 O O   . HOH B 2 .   ? -21.551 -12.335 16.646 1.00 39.90 ? 458 HOH A O   1 
HETATM 1327 O O   . HOH B 2 .   ? 15.838  -35.502 2.908  1.00 43.54 ? 459 HOH A O   1 
HETATM 1328 O O   . HOH B 2 .   ? -3.474  -25.083 -1.031 1.00 41.58 ? 460 HOH A O   1 
HETATM 1329 O O   . HOH B 2 .   ? -30.087 -13.065 24.807 1.00 37.75 ? 461 HOH A O   1 
HETATM 1330 O O   . HOH B 2 .   ? 0.180   -21.406 24.118 1.00 48.32 ? 462 HOH A O   1 
HETATM 1331 O O   . HOH B 2 .   ? 12.120  -38.224 4.335  1.00 44.74 ? 463 HOH A O   1 
HETATM 1332 O O   . HOH B 2 .   ? 1.072   -30.077 23.278 1.00 43.91 ? 464 HOH A O   1 
HETATM 1333 O O   . HOH B 2 .   ? 8.709   -15.795 -2.264 1.00 54.50 ? 465 HOH A O   1 
HETATM 1334 O O   . HOH B 2 .   ? -0.043  -30.624 1.374  1.00 53.02 ? 466 HOH A O   1 
HETATM 1335 O O   . HOH B 2 .   ? -4.632  -28.292 22.729 1.00 34.64 ? 467 HOH A O   1 
HETATM 1336 O O   . HOH B 2 .   ? -2.153  -19.747 25.393 1.00 43.02 ? 468 HOH A O   1 
HETATM 1337 O O   . HOH B 2 .   ? -14.388 -23.219 5.973  1.00 52.26 ? 469 HOH A O   1 
HETATM 1338 O O   . HOH B 2 .   ? 1.076   -18.474 19.850 1.00 51.42 ? 470 HOH A O   1 
HETATM 1339 O O   . HOH B 2 .   ? 6.826   -34.232 7.277  1.00 37.99 ? 471 HOH A O   1 
HETATM 1340 O O   . HOH B 2 .   ? 14.922  -38.020 2.689  1.00 41.00 ? 472 HOH A O   1 
HETATM 1341 O O   . HOH B 2 .   ? 9.429   -27.275 19.041 1.00 35.74 ? 473 HOH A O   1 
HETATM 1342 O O   . HOH B 2 .   ? 1.381   -13.117 10.601 1.00 47.18 ? 474 HOH A O   1 
HETATM 1343 O O   . HOH B 2 .   ? -4.966  -17.687 25.329 1.00 47.15 ? 475 HOH A O   1 
HETATM 1344 O O   . HOH B 2 .   ? 22.150  -28.311 13.357 1.00 49.11 ? 476 HOH A O   1 
HETATM 1345 O O   . HOH B 2 .   ? -18.055 -24.027 10.205 1.00 66.74 ? 477 HOH A O   1 
HETATM 1346 O O   . HOH B 2 .   ? 12.117  -17.241 17.444 1.00 43.47 ? 478 HOH A O   1 
HETATM 1347 O O   . HOH B 2 .   ? -2.859  -25.981 23.350 1.00 36.28 ? 479 HOH A O   1 
HETATM 1348 O O   . HOH B 2 .   ? 1.290   -32.748 1.631  1.00 56.99 ? 480 HOH A O   1 
HETATM 1349 O O   . HOH B 2 .   ? 24.276  -28.168 2.892  1.00 44.16 ? 481 HOH A O   1 
HETATM 1350 O O   . HOH B 2 .   ? -8.363  -9.133  16.720 1.00 42.11 ? 482 HOH A O   1 
HETATM 1351 O O   . HOH B 2 .   ? 0.776   -40.248 24.984 1.00 59.88 ? 483 HOH A O   1 
HETATM 1352 O O   . HOH B 2 .   ? 23.059  -26.001 4.209  1.00 47.73 ? 484 HOH A O   1 
HETATM 1353 O O   . HOH B 2 .   ? 23.495  -23.558 5.310  1.00 37.03 ? 485 HOH A O   1 
HETATM 1354 O O   . HOH B 2 .   ? 15.353  -24.298 22.860 1.00 65.41 ? 486 HOH A O   1 
HETATM 1355 O O   . HOH B 2 .   ? 16.009  -14.594 16.435 1.00 49.50 ? 487 HOH A O   1 
HETATM 1356 O O   . HOH B 2 .   ? -17.959 -21.748 14.189 1.00 38.29 ? 488 HOH A O   1 
HETATM 1357 O O   . HOH B 2 .   ? -0.812  -23.747 -2.576 1.00 60.41 ? 489 HOH A O   1 
HETATM 1358 O O   . HOH B 2 .   ? 7.493   -14.929 13.078 1.00 60.83 ? 490 HOH A O   1 
HETATM 1359 O O   . HOH B 2 .   ? 9.235   -24.826 20.907 1.00 56.00 ? 491 HOH A O   1 
HETATM 1360 O O   . HOH B 2 .   ? -0.224  -42.101 22.315 1.00 57.47 ? 492 HOH A O   1 
HETATM 1361 O O   . HOH B 2 .   ? 12.277  -34.122 23.614 1.00 48.22 ? 493 HOH A O   1 
HETATM 1362 O O   . HOH B 2 .   ? 7.872   -29.919 20.472 1.00 41.40 ? 494 HOH A O   1 
HETATM 1363 O O   . HOH B 2 .   ? -2.473  -23.787 28.599 1.00 65.10 ? 495 HOH A O   1 
HETATM 1364 O O   . HOH B 2 .   ? -17.411 -16.404 11.556 1.00 56.13 ? 496 HOH A O   1 
HETATM 1365 O O   . HOH B 2 .   ? 5.531   -23.072 21.108 1.00 54.41 ? 497 HOH A O   1 
HETATM 1366 O O   . HOH B 2 .   ? -6.490  -9.715  26.052 1.00 48.50 ? 498 HOH A O   1 
HETATM 1367 O O   . HOH B 2 .   ? 1.289   -31.542 -1.605 1.00 60.68 ? 499 HOH A O   1 
HETATM 1368 O O   . HOH B 2 .   ? -3.447  -15.498 25.909 1.00 65.18 ? 500 HOH A O   1 
HETATM 1369 O O   . HOH B 2 .   ? -15.055 -13.741 10.844 1.00 60.10 ? 501 HOH A O   1 
HETATM 1370 O O   . HOH B 2 .   ? -2.653  -37.914 8.539  1.00 49.35 ? 502 HOH A O   1 
HETATM 1371 O O   . HOH B 2 .   ? -16.678 -31.683 21.523 1.00 40.08 ? 503 HOH A O   1 
HETATM 1372 O O   . HOH B 2 .   ? -1.156  -39.977 7.819  1.00 61.33 ? 504 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   82  ?   ?   ?   A . n 
A 1 2   SER 2   83  ?   ?   ?   A . n 
A 1 3   GLY 3   84  ?   ?   ?   A . n 
A 1 4   LEU 4   85  ?   ?   ?   A . n 
A 1 5   SER 5   86  ?   ?   ?   A . n 
A 1 6   ASN 6   87  ?   ?   ?   A . n 
A 1 7   GLN 7   88  88  GLN GLN A . n 
A 1 8   LEU 8   89  89  LEU LEU A . n 
A 1 9   ALA 9   90  90  ALA ALA A . n 
A 1 10  VAL 10  91  91  VAL VAL A . n 
A 1 11  THR 11  92  92  THR THR A . n 
A 1 12  PHE 12  93  93  PHE PHE A . n 
A 1 13  ARG 13  94  94  ARG ARG A . n 
A 1 14  GLU 14  95  95  GLU GLU A . n 
A 1 15  GLU 15  96  96  GLU GLU A . n 
A 1 16  ASN 16  97  97  ASN ASN A . n 
A 1 17  THR 17  98  98  THR THR A . n 
A 1 18  ILE 18  99  99  ILE ILE A . n 
A 1 19  ALA 19  100 100 ALA ALA A . n 
A 1 20  PHE 20  101 101 PHE PHE A . n 
A 1 21  ARG 21  102 102 ARG ARG A . n 
A 1 22  HIS 22  103 103 HIS HIS A . n 
A 1 23  LEU 23  104 104 LEU LEU A . n 
A 1 24  PHE 24  105 105 PHE PHE A . n 
A 1 25  LEU 25  106 106 LEU LEU A . n 
A 1 26  LEU 26  107 107 LEU LEU A . n 
A 1 27  GLY 27  108 108 GLY GLY A . n 
A 1 28  TYR 28  109 109 TYR TYR A . n 
A 1 29  SER 29  110 110 SER SER A . n 
A 1 30  ASP 30  111 111 ASP ASP A . n 
A 1 31  GLY 31  112 112 GLY GLY A . n 
A 1 32  ALA 32  113 113 ALA ALA A . n 
A 1 33  ASP 33  114 114 ASP ASP A . n 
A 1 34  ASP 34  115 115 ASP ASP A . n 
A 1 35  THR 35  116 116 THR THR A . n 
A 1 36  PHE 36  117 117 PHE PHE A . n 
A 1 37  ALA 37  118 118 ALA ALA A . n 
A 1 38  ALA 38  119 119 ALA ALA A . n 
A 1 39  TYR 39  120 120 TYR TYR A . n 
A 1 40  THR 40  121 121 THR THR A . n 
A 1 41  ARG 41  122 122 ARG ARG A . n 
A 1 42  GLU 42  123 123 GLU GLU A . n 
A 1 43  GLN 43  124 124 GLN GLN A . n 
A 1 44  LEU 44  125 125 LEU LEU A . n 
A 1 45  TYR 45  126 126 TYR TYR A . n 
A 1 46  GLN 46  127 127 GLN GLN A . n 
A 1 47  ALA 47  128 128 ALA ALA A . n 
A 1 48  ILE 48  129 129 ILE ILE A . n 
A 1 49  PHE 49  130 130 PHE PHE A . n 
A 1 50  HIS 50  131 131 HIS HIS A . n 
A 1 51  ALA 51  132 132 ALA ALA A . n 
A 1 52  VAL 52  133 133 VAL VAL A . n 
A 1 53  ASP 53  134 134 ASP ASP A . n 
A 1 54  GLN 54  135 135 GLN GLN A . n 
A 1 55  TYR 55  136 136 TYR TYR A . n 
A 1 56  LEU 56  137 137 LEU LEU A . n 
A 1 57  ALA 57  138 138 ALA ALA A . n 
A 1 58  LEU 58  139 139 LEU LEU A . n 
A 1 59  PRO 59  140 140 PRO PRO A . n 
A 1 60  ASP 60  141 141 ASP ASP A . n 
A 1 61  VAL 61  142 142 VAL VAL A . n 
A 1 62  SER 62  143 143 SER SER A . n 
A 1 63  LEU 63  144 144 LEU LEU A . n 
A 1 64  GLY 64  145 145 GLY GLY A . n 
A 1 65  ARG 65  146 146 ARG ARG A . n 
A 1 66  TYR 66  147 147 TYR TYR A . n 
A 1 67  ALA 67  148 148 ALA ALA A . n 
A 1 68  TYR 68  149 149 TYR TYR A . n 
A 1 69  VAL 69  150 150 VAL VAL A . n 
A 1 70  ARG 70  151 151 ARG ARG A . n 
A 1 71  GLY 71  152 ?   ?   ?   A . n 
A 1 72  GLY 72  153 ?   ?   ?   A . n 
A 1 73  GLY 73  154 ?   ?   ?   A . n 
A 1 74  ASP 74  155 ?   ?   ?   A . n 
A 1 75  PRO 75  156 ?   ?   ?   A . n 
A 1 76  TRP 76  157 ?   ?   ?   A . n 
A 1 77  THR 77  158 ?   ?   ?   A . n 
A 1 78  ASN 78  159 ?   ?   ?   A . n 
A 1 79  GLY 79  160 ?   ?   ?   A . n 
A 1 80  SER 80  161 ?   ?   ?   A . n 
A 1 81  GLY 81  162 162 GLY GLY A . n 
A 1 82  LEU 82  163 163 LEU LEU A . n 
A 1 83  ALA 83  164 164 ALA ALA A . n 
A 1 84  LEU 84  165 165 LEU LEU A . n 
A 1 85  CYS 85  166 166 CYS CYS A . n 
A 1 86  GLN 86  167 167 GLN GLN A . n 
A 1 87  ARG 87  168 168 ARG ARG A . n 
A 1 88  TYR 88  169 169 TYR TYR A . n 
A 1 89  TYR 89  170 170 TYR TYR A . n 
A 1 90  HIS 90  171 171 HIS HIS A . n 
A 1 91  ARG 91  172 ?   ?   ?   A . n 
A 1 92  GLY 92  173 ?   ?   ?   A . n 
A 1 93  HIS 93  174 ?   ?   ?   A . n 
A 1 94  VAL 94  175 ?   ?   ?   A . n 
A 1 95  ASP 95  176 ?   ?   ?   A . n 
A 1 96  PRO 96  177 ?   ?   ?   A . n 
A 1 97  ALA 97  178 ?   ?   ?   A . n 
A 1 98  ASN 98  179 ?   ?   ?   A . n 
A 1 99  ASP 99  180 ?   ?   ?   A . n 
A 1 100 THR 100 181 ?   ?   ?   A . n 
A 1 101 PHE 101 182 ?   ?   ?   A . n 
A 1 102 ASP 102 183 ?   ?   ?   A . n 
A 1 103 ILE 103 184 ?   ?   ?   A . n 
A 1 104 ASP 104 185 ?   ?   ?   A . n 
A 1 105 PRO 105 186 ?   ?   ?   A . n 
A 1 106 MET 106 187 187 MET MET A . n 
A 1 107 VAL 107 188 188 VAL VAL A . n 
A 1 108 VAL 108 189 189 VAL VAL A . n 
A 1 109 THR 109 190 190 THR THR A . n 
A 1 110 ASP 110 191 191 ASP ASP A . n 
A 1 111 CYS 111 192 192 CYS CYS A . n 
A 1 112 ILE 112 193 193 ILE ILE A . n 
A 1 113 GLN 113 194 194 GLN GLN A . n 
A 1 114 VAL 114 195 195 VAL VAL A . n 
A 1 115 ASP 115 196 196 ASP ASP A . n 
A 1 116 PRO 116 197 197 PRO PRO A . n 
A 1 117 PRO 117 198 198 PRO PRO A . n 
A 1 118 GLU 118 199 199 GLU GLU A . n 
A 1 119 ARG 119 200 ?   ?   ?   A . n 
A 1 120 PRO 120 201 ?   ?   ?   A . n 
A 1 121 PRO 121 202 ?   ?   ?   A . n 
A 1 122 PRO 122 203 ?   ?   ?   A . n 
A 1 123 PRO 123 204 ?   ?   ?   A . n 
A 1 124 PRO 124 205 ?   ?   ?   A . n 
A 1 125 SER 125 206 ?   ?   ?   A . n 
A 1 126 ASP 126 207 ?   ?   ?   A . n 
A 1 127 ASP 127 208 ?   ?   ?   A . n 
A 1 128 LEU 128 209 ?   ?   ?   A . n 
A 1 129 THR 129 210 ?   ?   ?   A . n 
A 1 130 LEU 130 211 ?   ?   ?   A . n 
A 1 131 LEU 131 212 ?   ?   ?   A . n 
A 1 132 GLU 132 213 ?   ?   ?   A . n 
A 1 133 SER 133 214 ?   ?   ?   A . n 
A 1 134 SER 134 215 ?   ?   ?   A . n 
A 1 135 SER 135 216 216 SER SER A . n 
A 1 136 SER 136 217 217 SER SER A . n 
A 1 137 TYR 137 218 218 TYR TYR A . n 
A 1 138 LYS 138 219 219 LYS LYS A . n 
A 1 139 ASN 139 220 220 ASN ASN A . n 
A 1 140 LEU 140 221 221 LEU LEU A . n 
A 1 141 THR 141 222 222 THR THR A . n 
A 1 142 LEU 142 223 223 LEU LEU A . n 
A 1 143 LYS 143 224 224 LYS LYS A . n 
A 1 144 PHE 144 225 225 PHE PHE A . n 
A 1 145 HIS 145 226 226 HIS HIS A . n 
A 1 146 LYS 146 227 227 LYS LYS A . n 
A 1 147 LEU 147 228 228 LEU LEU A . n 
A 1 148 VAL 148 229 229 VAL VAL A . n 
A 1 149 ASN 149 230 230 ASN ASN A . n 
A 1 150 VAL 150 231 231 VAL VAL A . n 
A 1 151 THR 151 232 232 THR THR A . n 
A 1 152 ILE 152 233 233 ILE ILE A . n 
A 1 153 HIS 153 234 234 HIS HIS A . n 
A 1 154 PHE 154 235 235 PHE PHE A . n 
A 1 155 ARG 155 236 236 ARG ARG A . n 
A 1 156 LEU 156 237 237 LEU LEU A . n 
A 1 157 LYS 157 238 238 LYS LYS A . n 
A 1 158 THR 158 239 239 THR THR A . n 
A 1 159 ILE 159 240 240 ILE ILE A . n 
A 1 160 ASN 160 241 241 ASN ASN A . n 
A 1 161 LEU 161 242 242 LEU LEU A . n 
A 1 162 GLN 162 243 243 GLN GLN A . n 
A 1 163 SER 163 244 244 SER SER A . n 
A 1 164 LEU 164 245 245 LEU LEU A . n 
A 1 165 ILE 165 246 246 ILE ILE A . n 
A 1 166 ASN 166 247 247 ASN ASN A . n 
A 1 167 ASN 167 248 248 ASN ASN A . n 
A 1 168 GLU 168 249 249 GLU GLU A . n 
A 1 169 ILE 169 250 250 ILE ILE A . n 
A 1 170 PRO 170 251 251 PRO PRO A . n 
A 1 171 ASP 171 252 252 ASP ASP A . n 
A 1 172 CYS 172 253 253 CYS CYS A . n 
A 1 173 TYR 173 254 254 TYR TYR A . n 
A 1 174 THR 174 255 255 THR THR A . n 
A 1 175 PHE 175 256 256 PHE PHE A . n 
A 1 176 SER 176 257 257 SER SER A . n 
A 1 177 VAL 177 258 258 VAL VAL A . n 
A 1 178 LEU 178 259 259 LEU LEU A . n 
A 1 179 ILE 179 260 260 ILE ILE A . n 
A 1 180 THR 180 261 261 THR THR A . n 
A 1 181 PHE 181 262 262 PHE PHE A . n 
A 1 182 ASP 182 263 263 ASP ASP A . n 
A 1 183 ASN 183 264 264 ASN ASN A . n 
A 1 184 LYS 184 265 265 LYS LYS A . n 
A 1 185 ALA 185 266 266 ALA ALA A . n 
A 1 186 HIS 186 267 267 HIS HIS A . n 
A 1 187 SER 187 268 268 SER SER A . n 
A 1 188 GLY 188 269 269 GLY GLY A . n 
A 1 189 ARG 189 270 270 ARG ARG A . n 
A 1 190 ILE 190 271 271 ILE ILE A . n 
A 1 191 PRO 191 272 272 PRO PRO A . n 
A 1 192 ILE 192 273 273 ILE ILE A . n 
A 1 193 SER 193 274 274 SER SER A . n 
A 1 194 LEU 194 275 275 LEU LEU A . n 
A 1 195 GLU 195 276 276 GLU GLU A . n 
A 1 196 THR 196 277 277 THR THR A . n 
A 1 197 GLN 197 278 278 GLN GLN A . n 
A 1 198 ALA 198 279 279 ALA ALA A . n 
A 1 199 HIS 199 280 280 HIS HIS A . n 
A 1 200 ILE 200 281 281 ILE ILE A . n 
A 1 201 GLN 201 282 282 GLN GLN A . n 
A 1 202 GLU 202 283 283 GLU GLU A . n 
A 1 203 CYS 203 284 284 CYS CYS A . n 
A 1 204 LYS 204 285 ?   ?   ?   A . n 
A 1 205 HIS 205 286 ?   ?   ?   A . n 
A 1 206 PRO 206 287 ?   ?   ?   A . n 
A 1 207 SER 207 288 ?   ?   ?   A . n 
A 1 208 VAL 208 289 ?   ?   ?   A . n 
A 1 209 PHE 209 290 ?   ?   ?   A . n 
A 1 210 GLN 210 291 ?   ?   ?   A . n 
A 1 211 HIS 211 292 ?   ?   ?   A . n 
A 1 212 GLY 212 293 ?   ?   ?   A . n 
A 1 213 ASP 213 294 ?   ?   ?   A . n 
A 1 214 ASN 214 295 ?   ?   ?   A . n 
A 1 215 SER 215 296 ?   ?   ?   A . n 
A 1 216 LEU 216 297 ?   ?   ?   A . n 
A 1 217 GLU 217 298 ?   ?   ?   A . n 
A 1 218 HIS 218 299 ?   ?   ?   A . n 
A 1 219 HIS 219 300 ?   ?   ?   A . n 
A 1 220 HIS 220 301 ?   ?   ?   A . n 
A 1 221 HIS 221 302 ?   ?   ?   A . n 
A 1 222 HIS 222 303 ?   ?   ?   A . n 
A 1 223 HIS 223 304 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   401 96  HOH WAT A . 
B 2 HOH 2   402 45  HOH WAT A . 
B 2 HOH 3   403 18  HOH WAT A . 
B 2 HOH 4   404 46  HOH WAT A . 
B 2 HOH 5   405 13  HOH WAT A . 
B 2 HOH 6   406 94  HOH WAT A . 
B 2 HOH 7   407 33  HOH WAT A . 
B 2 HOH 8   408 60  HOH WAT A . 
B 2 HOH 9   409 38  HOH WAT A . 
B 2 HOH 10  410 6   HOH WAT A . 
B 2 HOH 11  411 5   HOH WAT A . 
B 2 HOH 12  412 89  HOH WAT A . 
B 2 HOH 13  413 54  HOH WAT A . 
B 2 HOH 14  414 2   HOH WAT A . 
B 2 HOH 15  415 101 HOH WAT A . 
B 2 HOH 16  416 95  HOH WAT A . 
B 2 HOH 17  417 12  HOH WAT A . 
B 2 HOH 18  418 10  HOH WAT A . 
B 2 HOH 19  419 53  HOH WAT A . 
B 2 HOH 20  420 15  HOH WAT A . 
B 2 HOH 21  421 63  HOH WAT A . 
B 2 HOH 22  422 9   HOH WAT A . 
B 2 HOH 23  423 50  HOH WAT A . 
B 2 HOH 24  424 11  HOH WAT A . 
B 2 HOH 25  425 56  HOH WAT A . 
B 2 HOH 26  426 1   HOH WAT A . 
B 2 HOH 27  427 40  HOH WAT A . 
B 2 HOH 28  428 25  HOH WAT A . 
B 2 HOH 29  429 66  HOH WAT A . 
B 2 HOH 30  430 48  HOH WAT A . 
B 2 HOH 31  431 37  HOH WAT A . 
B 2 HOH 32  432 16  HOH WAT A . 
B 2 HOH 33  433 42  HOH WAT A . 
B 2 HOH 34  434 68  HOH WAT A . 
B 2 HOH 35  435 7   HOH WAT A . 
B 2 HOH 36  436 17  HOH WAT A . 
B 2 HOH 37  437 31  HOH WAT A . 
B 2 HOH 38  438 71  HOH WAT A . 
B 2 HOH 39  439 28  HOH WAT A . 
B 2 HOH 40  440 36  HOH WAT A . 
B 2 HOH 41  441 19  HOH WAT A . 
B 2 HOH 42  442 80  HOH WAT A . 
B 2 HOH 43  443 64  HOH WAT A . 
B 2 HOH 44  444 44  HOH WAT A . 
B 2 HOH 45  445 22  HOH WAT A . 
B 2 HOH 46  446 20  HOH WAT A . 
B 2 HOH 47  447 3   HOH WAT A . 
B 2 HOH 48  448 58  HOH WAT A . 
B 2 HOH 49  449 4   HOH WAT A . 
B 2 HOH 50  450 8   HOH WAT A . 
B 2 HOH 51  451 84  HOH WAT A . 
B 2 HOH 52  452 49  HOH WAT A . 
B 2 HOH 53  453 47  HOH WAT A . 
B 2 HOH 54  454 27  HOH WAT A . 
B 2 HOH 55  455 86  HOH WAT A . 
B 2 HOH 56  456 29  HOH WAT A . 
B 2 HOH 57  457 57  HOH WAT A . 
B 2 HOH 58  458 32  HOH WAT A . 
B 2 HOH 59  459 23  HOH WAT A . 
B 2 HOH 60  460 34  HOH WAT A . 
B 2 HOH 61  461 70  HOH WAT A . 
B 2 HOH 62  462 77  HOH WAT A . 
B 2 HOH 63  463 93  HOH WAT A . 
B 2 HOH 64  464 30  HOH WAT A . 
B 2 HOH 65  465 21  HOH WAT A . 
B 2 HOH 66  466 102 HOH WAT A . 
B 2 HOH 67  467 39  HOH WAT A . 
B 2 HOH 68  468 26  HOH WAT A . 
B 2 HOH 69  469 52  HOH WAT A . 
B 2 HOH 70  470 41  HOH WAT A . 
B 2 HOH 71  471 24  HOH WAT A . 
B 2 HOH 72  472 55  HOH WAT A . 
B 2 HOH 73  473 73  HOH WAT A . 
B 2 HOH 74  474 97  HOH WAT A . 
B 2 HOH 75  475 79  HOH WAT A . 
B 2 HOH 76  476 81  HOH WAT A . 
B 2 HOH 77  477 59  HOH WAT A . 
B 2 HOH 78  478 104 HOH WAT A . 
B 2 HOH 79  479 76  HOH WAT A . 
B 2 HOH 80  480 103 HOH WAT A . 
B 2 HOH 81  481 67  HOH WAT A . 
B 2 HOH 82  482 99  HOH WAT A . 
B 2 HOH 83  483 91  HOH WAT A . 
B 2 HOH 84  484 35  HOH WAT A . 
B 2 HOH 85  485 14  HOH WAT A . 
B 2 HOH 86  486 98  HOH WAT A . 
B 2 HOH 87  487 65  HOH WAT A . 
B 2 HOH 88  488 72  HOH WAT A . 
B 2 HOH 89  489 82  HOH WAT A . 
B 2 HOH 90  490 43  HOH WAT A . 
B 2 HOH 91  491 74  HOH WAT A . 
B 2 HOH 92  492 90  HOH WAT A . 
B 2 HOH 93  493 83  HOH WAT A . 
B 2 HOH 94  494 92  HOH WAT A . 
B 2 HOH 95  495 85  HOH WAT A . 
B 2 HOH 96  496 61  HOH WAT A . 
B 2 HOH 97  497 75  HOH WAT A . 
B 2 HOH 98  498 100 HOH WAT A . 
B 2 HOH 99  499 51  HOH WAT A . 
B 2 HOH 100 500 78  HOH WAT A . 
B 2 HOH 101 501 62  HOH WAT A . 
B 2 HOH 102 502 87  HOH WAT A . 
B 2 HOH 103 503 69  HOH WAT A . 
B 2 HOH 104 504 88  HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6790  ? 
1 MORE         -35   ? 
1 'SSA (A^2)'  31220 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_545 -x,-y-1,z      -1.0000000000 0.0000000000  0.0000000000 0.0000000000   0.0000000000  
-1.0000000000 0.0000000000 -94.3530000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_445 -y-1/2,x-1/2,z 0.0000000000  -1.0000000000 0.0000000000 -47.1765000000 1.0000000000  
0.0000000000  0.0000000000 -47.1765000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_545 y+1/2,-x-1/2,z 0.0000000000  1.0000000000  0.0000000000 47.1765000000  -1.0000000000 
0.0000000000  0.0000000000 -47.1765000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-01-25 
2 'Structure model' 1 1 2017-02-08 
3 'Structure model' 1 2 2017-03-15 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_audit_support 
2 5 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_audit_support.funding_organization' 
2 5 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? CNS         ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PRO A 197 ? ? -56.19 171.47 
2 1 PRO A 198 ? ? -91.21 58.33  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 82  ? A GLY 1   
2  1 Y 1 A SER 83  ? A SER 2   
3  1 Y 1 A GLY 84  ? A GLY 3   
4  1 Y 1 A LEU 85  ? A LEU 4   
5  1 Y 1 A SER 86  ? A SER 5   
6  1 Y 1 A ASN 87  ? A ASN 6   
7  1 Y 1 A GLY 152 ? A GLY 71  
8  1 Y 1 A GLY 153 ? A GLY 72  
9  1 Y 1 A GLY 154 ? A GLY 73  
10 1 Y 1 A ASP 155 ? A ASP 74  
11 1 Y 1 A PRO 156 ? A PRO 75  
12 1 Y 1 A TRP 157 ? A TRP 76  
13 1 Y 1 A THR 158 ? A THR 77  
14 1 Y 1 A ASN 159 ? A ASN 78  
15 1 Y 1 A GLY 160 ? A GLY 79  
16 1 Y 1 A SER 161 ? A SER 80  
17 1 Y 1 A ARG 172 ? A ARG 91  
18 1 Y 1 A GLY 173 ? A GLY 92  
19 1 Y 1 A HIS 174 ? A HIS 93  
20 1 Y 1 A VAL 175 ? A VAL 94  
21 1 Y 1 A ASP 176 ? A ASP 95  
22 1 Y 1 A PRO 177 ? A PRO 96  
23 1 Y 1 A ALA 178 ? A ALA 97  
24 1 Y 1 A ASN 179 ? A ASN 98  
25 1 Y 1 A ASP 180 ? A ASP 99  
26 1 Y 1 A THR 181 ? A THR 100 
27 1 Y 1 A PHE 182 ? A PHE 101 
28 1 Y 1 A ASP 183 ? A ASP 102 
29 1 Y 1 A ILE 184 ? A ILE 103 
30 1 Y 1 A ASP 185 ? A ASP 104 
31 1 Y 1 A PRO 186 ? A PRO 105 
32 1 Y 1 A ARG 200 ? A ARG 119 
33 1 Y 1 A PRO 201 ? A PRO 120 
34 1 Y 1 A PRO 202 ? A PRO 121 
35 1 Y 1 A PRO 203 ? A PRO 122 
36 1 Y 1 A PRO 204 ? A PRO 123 
37 1 Y 1 A PRO 205 ? A PRO 124 
38 1 Y 1 A SER 206 ? A SER 125 
39 1 Y 1 A ASP 207 ? A ASP 126 
40 1 Y 1 A ASP 208 ? A ASP 127 
41 1 Y 1 A LEU 209 ? A LEU 128 
42 1 Y 1 A THR 210 ? A THR 129 
43 1 Y 1 A LEU 211 ? A LEU 130 
44 1 Y 1 A LEU 212 ? A LEU 131 
45 1 Y 1 A GLU 213 ? A GLU 132 
46 1 Y 1 A SER 214 ? A SER 133 
47 1 Y 1 A SER 215 ? A SER 134 
48 1 Y 1 A LYS 285 ? A LYS 204 
49 1 Y 1 A HIS 286 ? A HIS 205 
50 1 Y 1 A PRO 287 ? A PRO 206 
51 1 Y 1 A SER 288 ? A SER 207 
52 1 Y 1 A VAL 289 ? A VAL 208 
53 1 Y 1 A PHE 290 ? A PHE 209 
54 1 Y 1 A GLN 291 ? A GLN 210 
55 1 Y 1 A HIS 292 ? A HIS 211 
56 1 Y 1 A GLY 293 ? A GLY 212 
57 1 Y 1 A ASP 294 ? A ASP 213 
58 1 Y 1 A ASN 295 ? A ASN 214 
59 1 Y 1 A SER 296 ? A SER 215 
60 1 Y 1 A LEU 297 ? A LEU 216 
61 1 Y 1 A GLU 298 ? A GLU 217 
62 1 Y 1 A HIS 299 ? A HIS 218 
63 1 Y 1 A HIS 300 ? A HIS 219 
64 1 Y 1 A HIS 301 ? A HIS 220 
65 1 Y 1 A HIS 302 ? A HIS 221 
66 1 Y 1 A HIS 303 ? A HIS 222 
67 1 Y 1 A HIS 304 ? A HIS 223 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'          'United States' R01GM085234  1 
'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' RO1NS053494  2 
'National Basic Research Program of China (973 Program)'                                            China           2014CB910301 3 
'National Natural Science Foundation of China (NSFC)'                                               China           31370821     4 
'Top Talents Program of Yunnan Province'                                                            China           2011HA012    5 
'High-level Overseas Talents of Yunnan Province'                                                    China           ?            6 
'China Youth 1000-Talent Program of the State Council of China'                                     China           ?            7 
'Beijing Advanced Innovation Center for Structural Biology'                                         China           ?            8 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#