data_5TJC
# 
_entry.id   5TJC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TJC         
WWPDB D_1000224343 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5TJB PDB . 
unspecified 5TJA PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TJC 
_pdbx_database_status.recvd_initial_deposition_date   2016-10-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Li, M.'            1  
'Zhang, W.K.'       2  
'Benvin, N.M.'      3  
'Zhou, X.'          4  
'Su, D.'            5  
'Li, H.'            6  
'Wang, S.'          7  
'Michailidis, I.E.' 8  
'Tong, L.'          9  
'Li, X.'            10 
'Yang, J.'          11 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat. Struct. Mol. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1545-9985 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            24 
_citation.language                  ? 
_citation.page_first                205 
_citation.page_last                 213 
_citation.title                     'Structural basis of dual Ca(2+)/pH regulation of the endolysosomal TRPML1 channel.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nsmb.3362 
_citation.pdbx_database_id_PubMed   28112729 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Li, M.'            1  ? 
primary 'Zhang, W.K.'       2  ? 
primary 'Benvin, N.M.'      3  ? 
primary 'Zhou, X.'          4  ? 
primary 'Su, D.'            5  ? 
primary 'Li, H.'            6  ? 
primary 'Wang, S.'          7  ? 
primary 'Michailidis, I.E.' 8  ? 
primary 'Tong, L.'          9  ? 
primary 'Li, X.'            10 ? 
primary 'Yang, J.'          11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5TJC 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     182.811 
_cell.length_a_esd                 ? 
_cell.length_b                     182.811 
_cell.length_b_esd                 ? 
_cell.length_c                     182.811 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        96 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5TJC 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                209 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'F 4 3 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man Mucolipin-1 25195.057 1  ? ? 'UNP residues (84-296)' ? 
2 water   nat water       18.015    66 ? ? ?                       ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        MG-2,Mucolipidin 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GSGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGS
GLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTIN
LQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GSGLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGS
GLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTIN
LQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNSLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   SER n 
1 3   GLY n 
1 4   LEU n 
1 5   SER n 
1 6   ASN n 
1 7   GLN n 
1 8   LEU n 
1 9   ALA n 
1 10  VAL n 
1 11  THR n 
1 12  PHE n 
1 13  ARG n 
1 14  GLU n 
1 15  GLU n 
1 16  ASN n 
1 17  THR n 
1 18  ILE n 
1 19  ALA n 
1 20  PHE n 
1 21  ARG n 
1 22  HIS n 
1 23  LEU n 
1 24  PHE n 
1 25  LEU n 
1 26  LEU n 
1 27  GLY n 
1 28  TYR n 
1 29  SER n 
1 30  ASP n 
1 31  GLY n 
1 32  ALA n 
1 33  ASP n 
1 34  ASP n 
1 35  THR n 
1 36  PHE n 
1 37  ALA n 
1 38  ALA n 
1 39  TYR n 
1 40  THR n 
1 41  ARG n 
1 42  GLU n 
1 43  GLN n 
1 44  LEU n 
1 45  TYR n 
1 46  GLN n 
1 47  ALA n 
1 48  ILE n 
1 49  PHE n 
1 50  HIS n 
1 51  ALA n 
1 52  VAL n 
1 53  ASP n 
1 54  GLN n 
1 55  TYR n 
1 56  LEU n 
1 57  ALA n 
1 58  LEU n 
1 59  PRO n 
1 60  ASP n 
1 61  VAL n 
1 62  SER n 
1 63  LEU n 
1 64  GLY n 
1 65  ARG n 
1 66  TYR n 
1 67  ALA n 
1 68  TYR n 
1 69  VAL n 
1 70  ARG n 
1 71  GLY n 
1 72  GLY n 
1 73  GLY n 
1 74  ASP n 
1 75  PRO n 
1 76  TRP n 
1 77  THR n 
1 78  ASN n 
1 79  GLY n 
1 80  SER n 
1 81  GLY n 
1 82  LEU n 
1 83  ALA n 
1 84  LEU n 
1 85  CYS n 
1 86  GLN n 
1 87  ARG n 
1 88  TYR n 
1 89  TYR n 
1 90  HIS n 
1 91  ARG n 
1 92  GLY n 
1 93  HIS n 
1 94  VAL n 
1 95  ASP n 
1 96  PRO n 
1 97  ALA n 
1 98  ASN n 
1 99  ASP n 
1 100 THR n 
1 101 PHE n 
1 102 ASP n 
1 103 ILE n 
1 104 ASP n 
1 105 PRO n 
1 106 MET n 
1 107 VAL n 
1 108 VAL n 
1 109 THR n 
1 110 ASP n 
1 111 CYS n 
1 112 ILE n 
1 113 GLN n 
1 114 VAL n 
1 115 ASP n 
1 116 PRO n 
1 117 PRO n 
1 118 GLU n 
1 119 ARG n 
1 120 PRO n 
1 121 PRO n 
1 122 PRO n 
1 123 PRO n 
1 124 PRO n 
1 125 SER n 
1 126 ASP n 
1 127 ASP n 
1 128 LEU n 
1 129 THR n 
1 130 LEU n 
1 131 LEU n 
1 132 GLU n 
1 133 SER n 
1 134 SER n 
1 135 SER n 
1 136 SER n 
1 137 TYR n 
1 138 LYS n 
1 139 ASN n 
1 140 LEU n 
1 141 THR n 
1 142 LEU n 
1 143 LYS n 
1 144 PHE n 
1 145 HIS n 
1 146 LYS n 
1 147 LEU n 
1 148 VAL n 
1 149 ASN n 
1 150 VAL n 
1 151 THR n 
1 152 ILE n 
1 153 HIS n 
1 154 PHE n 
1 155 ARG n 
1 156 LEU n 
1 157 LYS n 
1 158 THR n 
1 159 ILE n 
1 160 ASN n 
1 161 LEU n 
1 162 GLN n 
1 163 SER n 
1 164 LEU n 
1 165 ILE n 
1 166 ASN n 
1 167 ASN n 
1 168 GLU n 
1 169 ILE n 
1 170 PRO n 
1 171 ASP n 
1 172 CYS n 
1 173 TYR n 
1 174 THR n 
1 175 PHE n 
1 176 SER n 
1 177 VAL n 
1 178 LEU n 
1 179 ILE n 
1 180 THR n 
1 181 PHE n 
1 182 ASP n 
1 183 ASN n 
1 184 LYS n 
1 185 ALA n 
1 186 HIS n 
1 187 SER n 
1 188 GLY n 
1 189 ARG n 
1 190 ILE n 
1 191 PRO n 
1 192 ILE n 
1 193 SER n 
1 194 LEU n 
1 195 GLU n 
1 196 THR n 
1 197 GLN n 
1 198 ALA n 
1 199 HIS n 
1 200 ILE n 
1 201 GLN n 
1 202 GLU n 
1 203 CYS n 
1 204 LYS n 
1 205 HIS n 
1 206 PRO n 
1 207 SER n 
1 208 VAL n 
1 209 PHE n 
1 210 GLN n 
1 211 HIS n 
1 212 GLY n 
1 213 ASP n 
1 214 ASN n 
1 215 SER n 
1 216 LEU n 
1 217 GLU n 
1 218 HIS n 
1 219 HIS n 
1 220 HIS n 
1 221 HIS n 
1 222 HIS n 
1 223 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   223 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MCOLN1, ML4, MSTP080' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               DE3 
_entity_src_gen.pdbx_host_org_variant              'Rosetta-gami 2' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET26b 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MCLN1_HUMAN 
_struct_ref.pdbx_db_accession          Q9GZU1 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GLSNQLAVTFREENTIAFRHLFLLGYSDGADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGL
ALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSYKNLTLKFHKLVNVTIHFRLKTINLQ
SLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQECKHPSVFQHGDNS
;
_struct_ref.pdbx_align_begin           84 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5TJC 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 215 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9GZU1 
_struct_ref_seq.db_align_beg                  84 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  296 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       84 
_struct_ref_seq.pdbx_auth_seq_align_end       296 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5TJC GLY A 1   ? UNP Q9GZU1 ? ? 'expression tag' 82  1  
1 5TJC SER A 2   ? UNP Q9GZU1 ? ? 'expression tag' 83  2  
1 5TJC LEU A 216 ? UNP Q9GZU1 ? ? 'expression tag' 297 3  
1 5TJC GLU A 217 ? UNP Q9GZU1 ? ? 'expression tag' 298 4  
1 5TJC HIS A 218 ? UNP Q9GZU1 ? ? 'expression tag' 299 5  
1 5TJC HIS A 219 ? UNP Q9GZU1 ? ? 'expression tag' 300 6  
1 5TJC HIS A 220 ? UNP Q9GZU1 ? ? 'expression tag' 301 7  
1 5TJC HIS A 221 ? UNP Q9GZU1 ? ? 'expression tag' 302 8  
1 5TJC HIS A 222 ? UNP Q9GZU1 ? ? 'expression tag' 303 9  
1 5TJC HIS A 223 ? UNP Q9GZU1 ? ? 'expression tag' 304 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TJC 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.53 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         51.30 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM magnesium sulfate, 4% PEG 3350, 100 mM HEPES at pH 7.5, macroseeding' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-11-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0750 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X29A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0750 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X29A 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5TJC 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.4 
_reflns.d_resolution_low                 20 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       10548 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.0 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.2 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  0.059 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            22.3 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.40 
_reflns_shell.d_res_low                   2.49 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3.7 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.6 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.34 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            0.0000 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            0.0000 
_refine.B_iso_max                                112.790 
_refine.B_iso_mean                               50.4821 
_refine.B_iso_min                                24.470 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5TJC 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.4000 
_refine.ls_d_res_low                             20.0000 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     10121 
_refine.ls_number_reflns_R_free                  1033 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.3000 
_refine.ls_percent_reflns_R_free                 9.6000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       0.2533 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2156 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 47.6387 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5TJA 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.4000 
_refine_hist.d_res_low                        20.0000 
_refine_hist.pdbx_number_atoms_ligand         66 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1492 
_refine_hist.pdbx_number_residues_total       176 
_refine_hist.pdbx_B_iso_mean_ligand           47.81 
_refine_hist.pdbx_number_atoms_protein        1426 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006 ?     ? ? c_bond_d     ? ? 
'X-RAY DIFFRACTION' ? 1.385 ?     ? ? c_angle_d    ? ? 
'X-RAY DIFFRACTION' ? 1.664 1.500 ? ? c_mcbond_it  ? ? 
'X-RAY DIFFRACTION' ? 2.189 2.000 ? ? c_scbond_it  ? ? 
'X-RAY DIFFRACTION' ? 2.934 2.000 ? ? c_mcangle_it ? ? 
'X-RAY DIFFRACTION' ? 3.333 2.500 ? ? c_scangle_it ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4000 2.4900  928  . 98  830  88.5000 . . . 0.3282 . 0.2768 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.4900 2.5800  938  . 87  851  90.4000 . . . 0.2860 . 0.2523 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.5800 2.7000  954  . 81  873  91.8000 . . . 0.3195 . 0.2708 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.7000 2.8400  993  . 100 893  94.0000 . . . 0.3214 . 0.2794 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.8400 3.0200  998  . 99  899  96.2000 . . . 0.2573 . 0.2295 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.0200 3.2500  1029 . 128 901  96.6000 . . . 0.2765 . 0.2143 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.2500 3.5800  1045 . 106 939  98.0000 . . . 0.2366 . 0.2038 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.5800 4.0900  1052 . 112 940  97.3000 . . . 0.2400 . 0.2042 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 4.0900 5.1400  1069 . 109 960  96.8000 . . . 0.2397 . 0.1803 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 5.1400 20.0000 1115 . 113 1002 93.0000 . . . 0.2228 . 0.2171 . . . . . . 10 . . . 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 CNS_TOPPAR:protein_rep.param  CNS_TOPPAR:protein.top      
'X-RAY DIFFRACTION' 2 CNS_TOPPAR:dna-rna_rep.param  CNS_TOPPAR:dna-rna.top      
'X-RAY DIFFRACTION' 3 CNS_TOPPAR:water_rep.param    CNS_TOPPAR:water.top        
'X-RAY DIFFRACTION' 4 CNS_TOPPAR:ion.param          CNS_TOPPAR:ion.top          
'X-RAY DIFFRACTION' 5 CNS_TOPPAR:carbohydrate.param CNS_TOPPAR:carbohydrate.top 
# 
_struct.entry_id                     5TJC 
_struct.title                        'I-II linker of TRPML1 channel at pH 7.5' 
_struct.pdbx_descriptor              Mucolipin-1 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TJC 
_struct_keywords.text            'endolysosomal lumen, tetramer, calcium and pH regulation, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 ASN A 6   ? LEU A 25  ? ASN A 87  LEU A 106 1 ? 20 
HELX_P HELX_P2 AA2 THR A 40  ? SER A 62  ? THR A 121 SER A 143 1 ? 23 
HELX_P HELX_P3 AA3 LYS A 143 ? HIS A 145 ? LYS A 224 HIS A 226 5 ? 3  
HELX_P HELX_P4 AA4 LEU A 161 ? ILE A 165 ? LEU A 242 ILE A 246 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 85  SG ? ? ? 1_555 A CYS 111 SG ? ? A CYS 166 A CYS 192 1_555 ? ? ? ? ? ? ? 2.051 ? 
disulf2 disulf ? ? A CYS 172 SG ? ? ? 1_555 A CYS 203 SG ? ? A CYS 253 A CYS 284 1_555 ? ? ? ? ? ? ? 2.033 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 37  ? ALA A 38  ? ALA A 118 ALA A 119 
AA1 2 ILE A 190 ? GLN A 201 ? ILE A 271 GLN A 282 
AA1 3 ASP A 171 ? ASP A 182 ? ASP A 252 ASP A 263 
AA1 4 LEU A 147 ? ASN A 160 ? LEU A 228 ASN A 241 
AA1 5 ALA A 67  ? TYR A 68  ? ALA A 148 TYR A 149 
AA2 1 ALA A 37  ? ALA A 38  ? ALA A 118 ALA A 119 
AA2 2 ILE A 190 ? GLN A 201 ? ILE A 271 GLN A 282 
AA2 3 ASP A 171 ? ASP A 182 ? ASP A 252 ASP A 263 
AA2 4 LEU A 147 ? ASN A 160 ? LEU A 228 ASN A 241 
AA2 5 LEU A 82  ? ASP A 95  ? LEU A 163 ASP A 176 
AA2 6 THR A 100 ? VAL A 114 ? THR A 181 VAL A 195 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 38  ? N ALA A 119 O ILE A 190 ? O ILE A 271 
AA1 2 3 O GLU A 195 ? O GLU A 276 N LEU A 178 ? N LEU A 259 
AA1 3 4 O PHE A 175 ? O PHE A 256 N LEU A 156 ? N LEU A 237 
AA1 4 5 O LYS A 157 ? O LYS A 238 N ALA A 67  ? N ALA A 148 
AA2 1 2 N ALA A 38  ? N ALA A 119 O ILE A 190 ? O ILE A 271 
AA2 2 3 O GLU A 195 ? O GLU A 276 N LEU A 178 ? N LEU A 259 
AA2 3 4 O PHE A 175 ? O PHE A 256 N LEU A 156 ? N LEU A 237 
AA2 4 5 O VAL A 148 ? O VAL A 229 N ARG A 87  ? N ARG A 168 
AA2 5 6 N TYR A 88  ? N TYR A 169 O VAL A 108 ? O VAL A 189 
# 
_atom_sites.entry_id                    5TJC 
_atom_sites.fract_transf_matrix[1][1]   0.005470 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005470 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005470 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 6   ? 14.297 27.388  -25.854 1.00 107.97 ? 87  ASN A N   1 
ATOM   2    C CA  . ASN A 1 6   ? 15.279 26.289  -26.086 1.00 108.17 ? 87  ASN A CA  1 
ATOM   3    C C   . ASN A 1 6   ? 14.616 25.011  -26.580 1.00 107.65 ? 87  ASN A C   1 
ATOM   4    O O   . ASN A 1 6   ? 14.922 24.530  -27.670 1.00 107.83 ? 87  ASN A O   1 
ATOM   5    C CB  . ASN A 1 6   ? 16.060 25.975  -24.805 1.00 108.51 ? 87  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 6   ? 17.039 27.069  -24.433 1.00 108.97 ? 87  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 6   ? 17.712 27.634  -25.298 1.00 108.78 ? 87  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 6   ? 17.138 27.364  -23.140 1.00 108.80 ? 87  ASN A ND2 1 
ATOM   9    N N   . GLN A 1 7   ? 13.718 24.457  -25.771 1.00 106.62 ? 88  GLN A N   1 
ATOM   10   C CA  . GLN A 1 7   ? 13.024 23.227  -26.136 1.00 105.37 ? 88  GLN A CA  1 
ATOM   11   C C   . GLN A 1 7   ? 12.245 23.391  -27.439 1.00 103.73 ? 88  GLN A C   1 
ATOM   12   O O   . GLN A 1 7   ? 11.902 22.404  -28.093 1.00 104.02 ? 88  GLN A O   1 
ATOM   13   C CB  . GLN A 1 7   ? 12.087 22.794  -25.006 1.00 106.21 ? 88  GLN A CB  1 
ATOM   14   C CG  . GLN A 1 7   ? 12.812 22.487  -23.705 1.00 107.69 ? 88  GLN A CG  1 
ATOM   15   C CD  . GLN A 1 7   ? 12.594 21.062  -23.235 1.00 108.91 ? 88  GLN A CD  1 
ATOM   16   O OE1 . GLN A 1 7   ? 12.980 20.105  -23.910 1.00 109.30 ? 88  GLN A OE1 1 
ATOM   17   N NE2 . GLN A 1 7   ? 11.968 20.913  -22.069 1.00 109.04 ? 88  GLN A NE2 1 
ATOM   18   N N   . LEU A 1 8   ? 11.964 24.640  -27.811 1.00 101.16 ? 89  LEU A N   1 
ATOM   19   C CA  . LEU A 1 8   ? 11.253 24.923  -29.054 1.00 97.98  ? 89  LEU A CA  1 
ATOM   20   C C   . LEU A 1 8   ? 12.295 24.794  -30.171 1.00 95.74  ? 89  LEU A C   1 
ATOM   21   O O   . LEU A 1 8   ? 11.954 24.679  -31.351 1.00 95.35  ? 89  LEU A O   1 
ATOM   22   C CB  . LEU A 1 8   ? 10.661 26.341  -29.026 1.00 98.03  ? 89  LEU A CB  1 
ATOM   23   C CG  . LEU A 1 8   ? 9.588  26.690  -30.067 1.00 97.73  ? 89  LEU A CG  1 
ATOM   24   C CD1 . LEU A 1 8   ? 8.346  25.839  -29.832 1.00 96.73  ? 89  LEU A CD1 1 
ATOM   25   C CD2 . LEU A 1 8   ? 9.237  28.172  -29.973 1.00 97.42  ? 89  LEU A CD2 1 
ATOM   26   N N   . ALA A 1 9   ? 13.568 24.815  -29.771 1.00 92.43  ? 90  ALA A N   1 
ATOM   27   C CA  . ALA A 1 9   ? 14.704 24.678  -30.686 1.00 89.00  ? 90  ALA A CA  1 
ATOM   28   C C   . ALA A 1 9   ? 15.141 23.210  -30.697 1.00 86.17  ? 90  ALA A C   1 
ATOM   29   O O   . ALA A 1 9   ? 15.827 22.759  -31.619 1.00 86.12  ? 90  ALA A O   1 
ATOM   30   C CB  . ALA A 1 9   ? 15.860 25.572  -30.239 1.00 88.45  ? 90  ALA A CB  1 
ATOM   31   N N   . VAL A 1 10  ? 14.759 22.483  -29.648 1.00 82.34  ? 91  VAL A N   1 
ATOM   32   C CA  . VAL A 1 10  ? 15.048 21.055  -29.537 1.00 77.42  ? 91  VAL A CA  1 
ATOM   33   C C   . VAL A 1 10  ? 14.087 20.451  -30.541 1.00 74.03  ? 91  VAL A C   1 
ATOM   34   O O   . VAL A 1 10  ? 14.425 19.537  -31.291 1.00 73.60  ? 91  VAL A O   1 
ATOM   35   C CB  . VAL A 1 10  ? 14.698 20.507  -28.130 1.00 77.54  ? 91  VAL A CB  1 
ATOM   36   C CG1 . VAL A 1 10  ? 14.578 18.988  -28.169 1.00 76.77  ? 91  VAL A CG1 1 
ATOM   37   C CG2 . VAL A 1 10  ? 15.769 20.917  -27.130 1.00 78.38  ? 91  VAL A CG2 1 
ATOM   38   N N   . THR A 1 11  ? 12.880 21.003  -30.535 1.00 69.86  ? 92  THR A N   1 
ATOM   39   C CA  . THR A 1 11  ? 11.814 20.597  -31.427 1.00 66.27  ? 92  THR A CA  1 
ATOM   40   C C   . THR A 1 11  ? 12.161 21.017  -32.856 1.00 64.01  ? 92  THR A C   1 
ATOM   41   O O   . THR A 1 11  ? 11.709 20.396  -33.816 1.00 64.55  ? 92  THR A O   1 
ATOM   42   C CB  . THR A 1 11  ? 10.471 21.236  -30.976 1.00 66.10  ? 92  THR A CB  1 
ATOM   43   O OG1 . THR A 1 11  ? 9.945  20.496  -29.868 1.00 65.78  ? 92  THR A OG1 1 
ATOM   44   C CG2 . THR A 1 11  ? 9.455  21.255  -32.106 1.00 66.27  ? 92  THR A CG2 1 
ATOM   45   N N   . PHE A 1 12  ? 12.974 22.060  -33.001 1.00 59.98  ? 93  PHE A N   1 
ATOM   46   C CA  . PHE A 1 12  ? 13.363 22.519  -34.333 1.00 55.81  ? 93  PHE A CA  1 
ATOM   47   C C   . PHE A 1 12  ? 14.343 21.537  -34.959 1.00 55.25  ? 93  PHE A C   1 
ATOM   48   O O   . PHE A 1 12  ? 14.341 21.329  -36.171 1.00 54.64  ? 93  PHE A O   1 
ATOM   49   C CB  . PHE A 1 12  ? 14.017 23.900  -34.276 1.00 49.56  ? 93  PHE A CB  1 
ATOM   50   C CG  . PHE A 1 12  ? 14.364 24.456  -35.630 1.00 44.30  ? 93  PHE A CG  1 
ATOM   51   C CD1 . PHE A 1 12  ? 13.362 24.827  -36.519 1.00 42.10  ? 93  PHE A CD1 1 
ATOM   52   C CD2 . PHE A 1 12  ? 15.688 24.586  -36.027 1.00 42.41  ? 93  PHE A CD2 1 
ATOM   53   C CE1 . PHE A 1 12  ? 13.674 25.320  -37.781 1.00 40.07  ? 93  PHE A CE1 1 
ATOM   54   C CE2 . PHE A 1 12  ? 16.013 25.079  -37.294 1.00 38.52  ? 93  PHE A CE2 1 
ATOM   55   C CZ  . PHE A 1 12  ? 15.006 25.446  -38.170 1.00 39.98  ? 93  PHE A CZ  1 
ATOM   56   N N   . ARG A 1 13  ? 15.190 20.948  -34.122 1.00 55.30  ? 94  ARG A N   1 
ATOM   57   C CA  . ARG A 1 13  ? 16.172 19.980  -34.583 1.00 55.30  ? 94  ARG A CA  1 
ATOM   58   C C   . ARG A 1 13  ? 15.473 18.663  -34.876 1.00 53.57  ? 94  ARG A C   1 
ATOM   59   O O   . ARG A 1 13  ? 15.730 18.015  -35.889 1.00 52.21  ? 94  ARG A O   1 
ATOM   60   C CB  . ARG A 1 13  ? 17.240 19.752  -33.517 1.00 59.03  ? 94  ARG A CB  1 
ATOM   61   C CG  . ARG A 1 13  ? 18.647 20.092  -33.973 1.00 65.01  ? 94  ARG A CG  1 
ATOM   62   C CD  . ARG A 1 13  ? 19.674 19.090  -33.439 1.00 68.89  ? 94  ARG A CD  1 
ATOM   63   N NE  . ARG A 1 13  ? 19.391 17.725  -33.884 1.00 69.77  ? 94  ARG A NE  1 
ATOM   64   C CZ  . ARG A 1 13  ? 19.093 16.720  -33.064 1.00 71.99  ? 94  ARG A CZ  1 
ATOM   65   N NH1 . ARG A 1 13  ? 19.045 16.925  -31.754 1.00 72.24  ? 94  ARG A NH1 1 
ATOM   66   N NH2 . ARG A 1 13  ? 18.829 15.514  -33.551 1.00 72.06  ? 94  ARG A NH2 1 
ATOM   67   N N   . GLU A 1 14  ? 14.573 18.278  -33.981 1.00 53.25  ? 95  GLU A N   1 
ATOM   68   C CA  . GLU A 1 14  ? 13.844 17.030  -34.128 1.00 53.17  ? 95  GLU A CA  1 
ATOM   69   C C   . GLU A 1 14  ? 12.849 17.088  -35.279 1.00 51.24  ? 95  GLU A C   1 
ATOM   70   O O   . GLU A 1 14  ? 12.651 16.092  -35.976 1.00 52.65  ? 95  GLU A O   1 
ATOM   71   C CB  . GLU A 1 14  ? 13.159 16.683  -32.804 1.00 54.79  ? 95  GLU A CB  1 
ATOM   72   C CG  . GLU A 1 14  ? 14.151 16.727  -31.635 1.00 59.95  ? 95  GLU A CG  1 
ATOM   73   C CD  . GLU A 1 14  ? 13.551 16.326  -30.302 1.00 63.63  ? 95  GLU A CD  1 
ATOM   74   O OE1 . GLU A 1 14  ? 12.453 16.823  -29.959 1.00 66.57  ? 95  GLU A OE1 1 
ATOM   75   O OE2 . GLU A 1 14  ? 14.191 15.520  -29.588 1.00 64.25  ? 95  GLU A OE2 1 
ATOM   76   N N   . GLU A 1 15  ? 12.247 18.255  -35.498 1.00 48.36  ? 96  GLU A N   1 
ATOM   77   C CA  . GLU A 1 15  ? 11.288 18.422  -36.588 1.00 46.26  ? 96  GLU A CA  1 
ATOM   78   C C   . GLU A 1 15  ? 12.007 18.355  -37.920 1.00 42.86  ? 96  GLU A C   1 
ATOM   79   O O   . GLU A 1 15  ? 11.511 17.765  -38.874 1.00 42.23  ? 96  GLU A O   1 
ATOM   80   C CB  . GLU A 1 15  ? 10.566 19.766  -36.480 1.00 49.55  ? 96  GLU A CB  1 
ATOM   81   C CG  . GLU A 1 15  ? 9.423  19.779  -35.484 1.00 54.12  ? 96  GLU A CG  1 
ATOM   82   C CD  . GLU A 1 15  ? 8.201  19.049  -35.999 1.00 55.95  ? 96  GLU A CD  1 
ATOM   83   O OE1 . GLU A 1 15  ? 7.592  19.534  -36.975 1.00 57.69  ? 96  GLU A OE1 1 
ATOM   84   O OE2 . GLU A 1 15  ? 7.853  17.989  -35.432 1.00 59.28  ? 96  GLU A OE2 1 
ATOM   85   N N   . ASN A 1 16  ? 13.178 18.973  -37.985 1.00 40.24  ? 97  ASN A N   1 
ATOM   86   C CA  . ASN A 1 16  ? 13.955 18.972  -39.212 1.00 36.78  ? 97  ASN A CA  1 
ATOM   87   C C   . ASN A 1 16  ? 14.452 17.565  -39.509 1.00 36.55  ? 97  ASN A C   1 
ATOM   88   O O   . ASN A 1 16  ? 14.459 17.130  -40.658 1.00 35.84  ? 97  ASN A O   1 
ATOM   89   C CB  . ASN A 1 16  ? 15.132 19.938  -39.079 1.00 35.61  ? 97  ASN A CB  1 
ATOM   90   C CG  . ASN A 1 16  ? 14.777 21.360  -39.502 1.00 33.56  ? 97  ASN A CG  1 
ATOM   91   O OD1 . ASN A 1 16  ? 14.829 21.700  -40.687 1.00 33.63  ? 97  ASN A OD1 1 
ATOM   92   N ND2 . ASN A 1 16  ? 14.407 22.189  -38.539 1.00 27.02  ? 97  ASN A ND2 1 
ATOM   93   N N   . THR A 1 17  ? 14.853 16.849  -38.464 1.00 36.46  ? 98  THR A N   1 
ATOM   94   C CA  . THR A 1 17  ? 15.356 15.492  -38.627 1.00 36.57  ? 98  THR A CA  1 
ATOM   95   C C   . THR A 1 17  ? 14.241 14.590  -39.134 1.00 35.97  ? 98  THR A C   1 
ATOM   96   O O   . THR A 1 17  ? 14.451 13.784  -40.041 1.00 36.06  ? 98  THR A O   1 
ATOM   97   C CB  . THR A 1 17  ? 15.922 14.938  -37.291 1.00 36.37  ? 98  THR A CB  1 
ATOM   98   O OG1 . THR A 1 17  ? 16.981 15.789  -36.834 1.00 34.28  ? 98  THR A OG1 1 
ATOM   99   C CG2 . THR A 1 17  ? 16.484 13.549  -37.484 1.00 35.99  ? 98  THR A CG2 1 
ATOM   100  N N   . ILE A 1 18  ? 13.055 14.730  -38.550 1.00 35.19  ? 99  ILE A N   1 
ATOM   101  C CA  . ILE A 1 18  ? 11.907 13.937  -38.976 1.00 34.46  ? 99  ILE A CA  1 
ATOM   102  C C   . ILE A 1 18  ? 11.642 14.186  -40.457 1.00 32.99  ? 99  ILE A C   1 
ATOM   103  O O   . ILE A 1 18  ? 11.354 13.268  -41.221 1.00 32.83  ? 99  ILE A O   1 
ATOM   104  C CB  . ILE A 1 18  ? 10.641 14.304  -38.177 1.00 36.10  ? 99  ILE A CB  1 
ATOM   105  C CG1 . ILE A 1 18  ? 10.808 13.875  -36.722 1.00 35.93  ? 99  ILE A CG1 1 
ATOM   106  C CG2 . ILE A 1 18  ? 9.419  13.620  -38.790 1.00 36.38  ? 99  ILE A CG2 1 
ATOM   107  C CD1 . ILE A 1 18  ? 9.595  14.133  -35.879 1.00 33.52  ? 99  ILE A CD1 1 
ATOM   108  N N   . ALA A 1 19  ? 11.735 15.440  -40.863 1.00 31.61  ? 100 ALA A N   1 
ATOM   109  C CA  . ALA A 1 19  ? 11.526 15.773  -42.259 1.00 32.90  ? 100 ALA A CA  1 
ATOM   110  C C   . ALA A 1 19  ? 12.569 15.054  -43.120 1.00 31.45  ? 100 ALA A C   1 
ATOM   111  O O   . ALA A 1 19  ? 12.258 14.560  -44.196 1.00 32.53  ? 100 ALA A O   1 
ATOM   112  C CB  . ALA A 1 19  ? 11.624 17.296  -42.459 1.00 31.62  ? 100 ALA A CB  1 
ATOM   113  N N   . PHE A 1 20  ? 13.811 15.004  -42.643 1.00 33.24  ? 101 PHE A N   1 
ATOM   114  C CA  . PHE A 1 20  ? 14.888 14.355  -43.385 1.00 32.99  ? 101 PHE A CA  1 
ATOM   115  C C   . PHE A 1 20  ? 14.618 12.862  -43.575 1.00 33.30  ? 101 PHE A C   1 
ATOM   116  O O   . PHE A 1 20  ? 14.929 12.293  -44.622 1.00 34.87  ? 101 PHE A O   1 
ATOM   117  C CB  . PHE A 1 20  ? 16.233 14.558  -42.674 1.00 35.05  ? 101 PHE A CB  1 
ATOM   118  C CG  . PHE A 1 20  ? 16.649 16.008  -42.544 1.00 33.72  ? 101 PHE A CG  1 
ATOM   119  C CD1 . PHE A 1 20  ? 16.196 16.965  -43.449 1.00 33.51  ? 101 PHE A CD1 1 
ATOM   120  C CD2 . PHE A 1 20  ? 17.511 16.408  -41.528 1.00 33.58  ? 101 PHE A CD2 1 
ATOM   121  C CE1 . PHE A 1 20  ? 16.591 18.302  -43.341 1.00 33.30  ? 101 PHE A CE1 1 
ATOM   122  C CE2 . PHE A 1 20  ? 17.914 17.749  -41.411 1.00 32.48  ? 101 PHE A CE2 1 
ATOM   123  C CZ  . PHE A 1 20  ? 17.455 18.691  -42.319 1.00 31.68  ? 101 PHE A CZ  1 
ATOM   124  N N   . ARG A 1 21  ? 14.037 12.227  -42.568 1.00 31.44  ? 102 ARG A N   1 
ATOM   125  C CA  . ARG A 1 21  ? 13.714 10.820  -42.678 1.00 32.16  ? 102 ARG A CA  1 
ATOM   126  C C   . ARG A 1 21  ? 12.681 10.592  -43.788 1.00 33.22  ? 102 ARG A C   1 
ATOM   127  O O   . ARG A 1 21  ? 12.772 9.617   -44.545 1.00 33.71  ? 102 ARG A O   1 
ATOM   128  C CB  . ARG A 1 21  ? 13.196 10.285  -41.335 1.00 32.50  ? 102 ARG A CB  1 
ATOM   129  C CG  . ARG A 1 21  ? 14.242 10.366  -40.232 1.00 32.99  ? 102 ARG A CG  1 
ATOM   130  C CD  . ARG A 1 21  ? 13.917 9.509   -39.008 1.00 35.33  ? 102 ARG A CD  1 
ATOM   131  N NE  . ARG A 1 21  ? 15.015 9.591   -38.046 1.00 37.24  ? 102 ARG A NE  1 
ATOM   132  C CZ  . ARG A 1 21  ? 15.022 10.363  -36.963 1.00 37.29  ? 102 ARG A CZ  1 
ATOM   133  N NH1 . ARG A 1 21  ? 13.975 11.119  -36.674 1.00 37.56  ? 102 ARG A NH1 1 
ATOM   134  N NH2 . ARG A 1 21  ? 16.104 10.421  -36.195 1.00 36.63  ? 102 ARG A NH2 1 
ATOM   135  N N   . HIS A 1 22  ? 11.709 11.495  -43.906 1.00 31.67  ? 103 HIS A N   1 
ATOM   136  C CA  . HIS A 1 22  ? 10.688 11.349  -44.938 1.00 29.68  ? 103 HIS A CA  1 
ATOM   137  C C   . HIS A 1 22  ? 11.241 11.688  -46.302 1.00 29.65  ? 103 HIS A C   1 
ATOM   138  O O   . HIS A 1 22  ? 10.883 11.073  -47.302 1.00 31.36  ? 103 HIS A O   1 
ATOM   139  C CB  . HIS A 1 22  ? 9.482  12.239  -44.628 1.00 27.63  ? 103 HIS A CB  1 
ATOM   140  C CG  . HIS A 1 22  ? 8.597  11.689  -43.555 1.00 26.12  ? 103 HIS A CG  1 
ATOM   141  N ND1 . HIS A 1 22  ? 7.563  10.819  -43.821 1.00 25.29  ? 103 HIS A ND1 1 
ATOM   142  C CD2 . HIS A 1 22  ? 8.639  11.824  -42.208 1.00 25.56  ? 103 HIS A CD2 1 
ATOM   143  C CE1 . HIS A 1 22  ? 7.008  10.439  -42.683 1.00 28.03  ? 103 HIS A CE1 1 
ATOM   144  N NE2 . HIS A 1 22  ? 7.642  11.035  -41.689 1.00 25.29  ? 103 HIS A NE2 1 
ATOM   145  N N   . LEU A 1 23  ? 12.123 12.675  -46.337 1.00 30.71  ? 104 LEU A N   1 
ATOM   146  C CA  . LEU A 1 23  ? 12.727 13.104  -47.589 1.00 30.39  ? 104 LEU A CA  1 
ATOM   147  C C   . LEU A 1 23  ? 13.758 12.127  -48.135 1.00 29.28  ? 104 LEU A C   1 
ATOM   148  O O   . LEU A 1 23  ? 13.718 11.785  -49.314 1.00 30.58  ? 104 LEU A O   1 
ATOM   149  C CB  . LEU A 1 23  ? 13.405 14.467  -47.414 1.00 31.08  ? 104 LEU A CB  1 
ATOM   150  C CG  . LEU A 1 23  ? 12.581 15.747  -47.309 1.00 32.34  ? 104 LEU A CG  1 
ATOM   151  C CD1 . LEU A 1 23  ? 13.502 16.890  -46.862 1.00 30.60  ? 104 LEU A CD1 1 
ATOM   152  C CD2 . LEU A 1 23  ? 11.943 16.067  -48.660 1.00 29.63  ? 104 LEU A CD2 1 
ATOM   153  N N   . PHE A 1 24  ? 14.671 11.670  -47.282 1.00 29.12  ? 105 PHE A N   1 
ATOM   154  C CA  . PHE A 1 24  ? 15.745 10.788  -47.740 1.00 32.19  ? 105 PHE A CA  1 
ATOM   155  C C   . PHE A 1 24  ? 15.632 9.288   -47.535 1.00 33.17  ? 105 PHE A C   1 
ATOM   156  O O   . PHE A 1 24  ? 16.405 8.540   -48.133 1.00 35.36  ? 105 PHE A O   1 
ATOM   157  C CB  . PHE A 1 24  ? 17.075 11.245  -47.138 1.00 31.24  ? 105 PHE A CB  1 
ATOM   158  C CG  . PHE A 1 24  ? 17.376 12.692  -47.373 1.00 32.40  ? 105 PHE A CG  1 
ATOM   159  C CD1 . PHE A 1 24  ? 17.604 13.166  -48.656 1.00 33.03  ? 105 PHE A CD1 1 
ATOM   160  C CD2 . PHE A 1 24  ? 17.410 13.588  -46.312 1.00 31.22  ? 105 PHE A CD2 1 
ATOM   161  C CE1 . PHE A 1 24  ? 17.860 14.519  -48.881 1.00 34.57  ? 105 PHE A CE1 1 
ATOM   162  C CE2 . PHE A 1 24  ? 17.663 14.936  -46.528 1.00 32.75  ? 105 PHE A CE2 1 
ATOM   163  C CZ  . PHE A 1 24  ? 17.889 15.403  -47.816 1.00 31.28  ? 105 PHE A CZ  1 
ATOM   164  N N   . LEU A 1 25  ? 14.710 8.830   -46.697 1.00 32.66  ? 106 LEU A N   1 
ATOM   165  C CA  . LEU A 1 25  ? 14.608 7.392   -46.477 1.00 32.11  ? 106 LEU A CA  1 
ATOM   166  C C   . LEU A 1 25  ? 13.458 6.754   -47.262 1.00 32.74  ? 106 LEU A C   1 
ATOM   167  O O   . LEU A 1 25  ? 12.286 6.853   -46.883 1.00 32.31  ? 106 LEU A O   1 
ATOM   168  C CB  . LEU A 1 25  ? 14.488 7.106   -44.980 1.00 29.80  ? 106 LEU A CB  1 
ATOM   169  C CG  . LEU A 1 25  ? 15.609 7.701   -44.113 1.00 30.58  ? 106 LEU A CG  1 
ATOM   170  C CD1 . LEU A 1 25  ? 15.438 7.217   -42.663 1.00 28.42  ? 106 LEU A CD1 1 
ATOM   171  C CD2 . LEU A 1 25  ? 16.991 7.292   -44.663 1.00 28.05  ? 106 LEU A CD2 1 
ATOM   172  N N   . LEU A 1 26  ? 13.816 6.102   -48.368 1.00 33.18  ? 107 LEU A N   1 
ATOM   173  C CA  . LEU A 1 26  ? 12.848 5.455   -49.254 1.00 34.72  ? 107 LEU A CA  1 
ATOM   174  C C   . LEU A 1 26  ? 11.911 4.487   -48.539 1.00 36.89  ? 107 LEU A C   1 
ATOM   175  O O   . LEU A 1 26  ? 12.356 3.511   -47.930 1.00 39.17  ? 107 LEU A O   1 
ATOM   176  C CB  . LEU A 1 26  ? 13.581 4.713   -50.373 1.00 31.31  ? 107 LEU A CB  1 
ATOM   177  C CG  . LEU A 1 26  ? 12.695 3.960   -51.368 1.00 31.26  ? 107 LEU A CG  1 
ATOM   178  C CD1 . LEU A 1 26  ? 11.784 4.943   -52.095 1.00 29.62  ? 107 LEU A CD1 1 
ATOM   179  C CD2 . LEU A 1 26  ? 13.558 3.200   -52.354 1.00 27.07  ? 107 LEU A CD2 1 
ATOM   180  N N   . GLY A 1 27  ? 10.611 4.759   -48.619 1.00 37.79  ? 108 GLY A N   1 
ATOM   181  C CA  . GLY A 1 27  ? 9.636  3.891   -47.979 1.00 36.43  ? 108 GLY A CA  1 
ATOM   182  C C   . GLY A 1 27  ? 9.495  4.105   -46.483 1.00 37.88  ? 108 GLY A C   1 
ATOM   183  O O   . GLY A 1 27  ? 8.874  3.297   -45.787 1.00 39.65  ? 108 GLY A O   1 
ATOM   184  N N   . TYR A 1 28  ? 10.063 5.192   -45.977 1.00 36.37  ? 109 TYR A N   1 
ATOM   185  C CA  . TYR A 1 28  ? 9.984  5.491   -44.550 1.00 35.93  ? 109 TYR A CA  1 
ATOM   186  C C   . TYR A 1 28  ? 8.591  5.980   -44.128 1.00 36.33  ? 109 TYR A C   1 
ATOM   187  O O   . TYR A 1 28  ? 7.897  6.633   -44.897 1.00 36.36  ? 109 TYR A O   1 
ATOM   188  C CB  . TYR A 1 28  ? 11.021 6.561   -44.184 1.00 33.05  ? 109 TYR A CB  1 
ATOM   189  C CG  . TYR A 1 28  ? 10.919 7.028   -42.750 1.00 33.58  ? 109 TYR A CG  1 
ATOM   190  C CD1 . TYR A 1 28  ? 11.539 6.322   -41.716 1.00 32.14  ? 109 TYR A CD1 1 
ATOM   191  C CD2 . TYR A 1 28  ? 10.146 8.139   -42.416 1.00 30.04  ? 109 TYR A CD2 1 
ATOM   192  C CE1 . TYR A 1 28  ? 11.385 6.716   -40.390 1.00 32.65  ? 109 TYR A CE1 1 
ATOM   193  C CE2 . TYR A 1 28  ? 9.983  8.535   -41.095 1.00 28.37  ? 109 TYR A CE2 1 
ATOM   194  C CZ  . TYR A 1 28  ? 10.597 7.827   -40.090 1.00 31.47  ? 109 TYR A CZ  1 
ATOM   195  O OH  . TYR A 1 28  ? 10.405 8.216   -38.786 1.00 28.84  ? 109 TYR A OH  1 
ATOM   196  N N   . SER A 1 29  ? 8.195  5.658   -42.901 1.00 36.52  ? 110 SER A N   1 
ATOM   197  C CA  . SER A 1 29  ? 6.913  6.097   -42.356 1.00 38.64  ? 110 SER A CA  1 
ATOM   198  C C   . SER A 1 29  ? 7.095  6.174   -40.851 1.00 37.61  ? 110 SER A C   1 
ATOM   199  O O   . SER A 1 29  ? 7.824  5.381   -40.276 1.00 37.61  ? 110 SER A O   1 
ATOM   200  C CB  . SER A 1 29  ? 5.785  5.113   -42.698 1.00 38.92  ? 110 SER A CB  1 
ATOM   201  O OG  . SER A 1 29  ? 5.920  3.907   -41.972 1.00 42.24  ? 110 SER A OG  1 
ATOM   202  N N   . ASP A 1 30  ? 6.438  7.137   -40.223 1.00 39.23  ? 111 ASP A N   1 
ATOM   203  C CA  . ASP A 1 30  ? 6.547  7.347   -38.786 1.00 40.57  ? 111 ASP A CA  1 
ATOM   204  C C   . ASP A 1 30  ? 6.334  6.085   -37.964 1.00 41.44  ? 111 ASP A C   1 
ATOM   205  O O   . ASP A 1 30  ? 5.516  5.235   -38.306 1.00 42.08  ? 111 ASP A O   1 
ATOM   206  C CB  . ASP A 1 30  ? 5.557  8.426   -38.367 1.00 41.18  ? 111 ASP A CB  1 
ATOM   207  C CG  . ASP A 1 30  ? 5.663  9.667   -39.235 1.00 43.46  ? 111 ASP A CG  1 
ATOM   208  O OD1 . ASP A 1 30  ? 6.689  10.380  -39.155 1.00 44.77  ? 111 ASP A OD1 1 
ATOM   209  O OD2 . ASP A 1 30  ? 4.722  9.919   -40.012 1.00 43.77  ? 111 ASP A OD2 1 
ATOM   210  N N   . GLY A 1 31  ? 7.086  5.968   -36.875 1.00 42.55  ? 112 GLY A N   1 
ATOM   211  C CA  . GLY A 1 31  ? 6.973  4.809   -36.009 1.00 44.80  ? 112 GLY A CA  1 
ATOM   212  C C   . GLY A 1 31  ? 7.850  3.626   -36.393 1.00 46.48  ? 112 GLY A C   1 
ATOM   213  O O   . GLY A 1 31  ? 8.005  2.701   -35.603 1.00 47.04  ? 112 GLY A O   1 
ATOM   214  N N   . ALA A 1 32  ? 8.434  3.656   -37.590 1.00 46.77  ? 113 ALA A N   1 
ATOM   215  C CA  . ALA A 1 32  ? 9.278  2.556   -38.069 1.00 48.78  ? 113 ALA A CA  1 
ATOM   216  C C   . ALA A 1 32  ? 10.762 2.667   -37.712 1.00 48.62  ? 113 ALA A C   1 
ATOM   217  O O   . ALA A 1 32  ? 11.545 1.779   -38.043 1.00 49.01  ? 113 ALA A O   1 
ATOM   218  C CB  . ALA A 1 32  ? 9.136  2.426   -39.592 1.00 47.34  ? 113 ALA A CB  1 
ATOM   219  N N   . ASP A 1 33  ? 11.143 3.740   -37.029 1.00 48.35  ? 114 ASP A N   1 
ATOM   220  C CA  . ASP A 1 33  ? 12.540 3.978   -36.683 1.00 47.48  ? 114 ASP A CA  1 
ATOM   221  C C   . ASP A 1 33  ? 13.444 2.805   -36.286 1.00 48.26  ? 114 ASP A C   1 
ATOM   222  O O   . ASP A 1 33  ? 14.517 2.648   -36.872 1.00 45.18  ? 114 ASP A O   1 
ATOM   223  C CB  . ASP A 1 33  ? 12.638 5.078   -35.625 1.00 46.12  ? 114 ASP A CB  1 
ATOM   224  C CG  . ASP A 1 33  ? 12.258 6.437   -36.171 1.00 45.77  ? 114 ASP A CG  1 
ATOM   225  O OD1 . ASP A 1 33  ? 12.776 7.453   -35.667 1.00 48.34  ? 114 ASP A OD1 1 
ATOM   226  O OD2 . ASP A 1 33  ? 11.431 6.496   -37.102 1.00 47.42  ? 114 ASP A OD2 1 
ATOM   227  N N   . ASP A 1 34  ? 13.047 1.979   -35.319 1.00 49.30  ? 115 ASP A N   1 
ATOM   228  C CA  . ASP A 1 34  ? 13.931 0.879   -34.935 1.00 50.85  ? 115 ASP A CA  1 
ATOM   229  C C   . ASP A 1 34  ? 13.751 -0.478  -35.611 1.00 50.17  ? 115 ASP A C   1 
ATOM   230  O O   . ASP A 1 34  ? 14.307 -1.476  -35.151 1.00 51.72  ? 115 ASP A O   1 
ATOM   231  C CB  . ASP A 1 34  ? 13.965 0.707   -33.409 1.00 55.37  ? 115 ASP A CB  1 
ATOM   232  C CG  . ASP A 1 34  ? 12.621 0.937   -32.756 1.00 59.96  ? 115 ASP A CG  1 
ATOM   233  O OD1 . ASP A 1 34  ? 11.686 0.143   -33.009 1.00 62.18  ? 115 ASP A OD1 1 
ATOM   234  O OD2 . ASP A 1 34  ? 12.507 1.917   -31.984 1.00 61.60  ? 115 ASP A OD2 1 
ATOM   235  N N   . THR A 1 35  ? 12.982 -0.530  -36.695 1.00 46.30  ? 116 THR A N   1 
ATOM   236  C CA  . THR A 1 35  ? 12.828 -1.782  -37.426 1.00 42.76  ? 116 THR A CA  1 
ATOM   237  C C   . THR A 1 35  ? 13.153 -1.522  -38.886 1.00 40.96  ? 116 THR A C   1 
ATOM   238  O O   . THR A 1 35  ? 13.385 -2.449  -39.656 1.00 42.03  ? 116 THR A O   1 
ATOM   239  C CB  . THR A 1 35  ? 11.398 -2.377  -37.334 1.00 43.36  ? 116 THR A CB  1 
ATOM   240  O OG1 . THR A 1 35  ? 10.444 -1.442  -37.851 1.00 43.18  ? 116 THR A OG1 1 
ATOM   241  C CG2 . THR A 1 35  ? 11.063 -2.752  -35.898 1.00 40.81  ? 116 THR A CG2 1 
ATOM   242  N N   . PHE A 1 36  ? 13.178 -0.248  -39.257 1.00 38.30  ? 117 PHE A N   1 
ATOM   243  C CA  . PHE A 1 36  ? 13.478 0.154   -40.626 1.00 36.91  ? 117 PHE A CA  1 
ATOM   244  C C   . PHE A 1 36  ? 14.786 -0.515  -41.089 1.00 35.88  ? 117 PHE A C   1 
ATOM   245  O O   . PHE A 1 36  ? 15.829 -0.380  -40.445 1.00 35.48  ? 117 PHE A O   1 
ATOM   246  C CB  . PHE A 1 36  ? 13.587 1.684   -40.693 1.00 35.52  ? 117 PHE A CB  1 
ATOM   247  C CG  . PHE A 1 36  ? 13.514 2.238   -42.086 1.00 33.92  ? 117 PHE A CG  1 
ATOM   248  C CD1 . PHE A 1 36  ? 12.376 2.052   -42.860 1.00 33.85  ? 117 PHE A CD1 1 
ATOM   249  C CD2 . PHE A 1 36  ? 14.587 2.934   -42.629 1.00 32.45  ? 117 PHE A CD2 1 
ATOM   250  C CE1 . PHE A 1 36  ? 12.306 2.550   -44.159 1.00 34.70  ? 117 PHE A CE1 1 
ATOM   251  C CE2 . PHE A 1 36  ? 14.531 3.437   -43.928 1.00 33.67  ? 117 PHE A CE2 1 
ATOM   252  C CZ  . PHE A 1 36  ? 13.388 3.245   -44.695 1.00 33.27  ? 117 PHE A CZ  1 
ATOM   253  N N   . ALA A 1 37  ? 14.729 -1.239  -42.203 1.00 35.08  ? 118 ALA A N   1 
ATOM   254  C CA  . ALA A 1 37  ? 15.915 -1.937  -42.693 1.00 33.94  ? 118 ALA A CA  1 
ATOM   255  C C   . ALA A 1 37  ? 15.772 -2.448  -44.115 1.00 32.20  ? 118 ALA A C   1 
ATOM   256  O O   . ALA A 1 37  ? 14.678 -2.477  -44.669 1.00 33.79  ? 118 ALA A O   1 
ATOM   257  C CB  . ALA A 1 37  ? 16.238 -3.112  -41.755 1.00 32.88  ? 118 ALA A CB  1 
ATOM   258  N N   . ALA A 1 38  ? 16.894 -2.845  -44.702 1.00 31.42  ? 119 ALA A N   1 
ATOM   259  C CA  . ALA A 1 38  ? 16.912 -3.401  -46.053 1.00 31.18  ? 119 ALA A CA  1 
ATOM   260  C C   . ALA A 1 38  ? 17.204 -4.902  -45.906 1.00 32.13  ? 119 ALA A C   1 
ATOM   261  O O   . ALA A 1 38  ? 17.824 -5.323  -44.925 1.00 30.92  ? 119 ALA A O   1 
ATOM   262  C CB  . ALA A 1 38  ? 17.994 -2.727  -46.889 1.00 30.05  ? 119 ALA A CB  1 
ATOM   263  N N   . TYR A 1 39  ? 16.769 -5.707  -46.874 1.00 32.34  ? 120 TYR A N   1 
ATOM   264  C CA  . TYR A 1 39  ? 16.980 -7.153  -46.801 1.00 33.13  ? 120 TYR A CA  1 
ATOM   265  C C   . TYR A 1 39  ? 17.457 -7.728  -48.119 1.00 35.22  ? 120 TYR A C   1 
ATOM   266  O O   . TYR A 1 39  ? 17.844 -8.896  -48.193 1.00 37.92  ? 120 TYR A O   1 
ATOM   267  C CB  . TYR A 1 39  ? 15.683 -7.848  -46.376 1.00 30.11  ? 120 TYR A CB  1 
ATOM   268  C CG  . TYR A 1 39  ? 15.220 -7.442  -44.995 1.00 29.15  ? 120 TYR A CG  1 
ATOM   269  C CD1 . TYR A 1 39  ? 15.673 -8.114  -43.864 1.00 28.29  ? 120 TYR A CD1 1 
ATOM   270  C CD2 . TYR A 1 39  ? 14.352 -6.365  -44.817 1.00 28.33  ? 120 TYR A CD2 1 
ATOM   271  C CE1 . TYR A 1 39  ? 15.277 -7.728  -42.584 1.00 27.72  ? 120 TYR A CE1 1 
ATOM   272  C CE2 . TYR A 1 39  ? 13.947 -5.970  -43.534 1.00 29.18  ? 120 TYR A CE2 1 
ATOM   273  C CZ  . TYR A 1 39  ? 14.417 -6.660  -42.427 1.00 26.91  ? 120 TYR A CZ  1 
ATOM   274  O OH  . TYR A 1 39  ? 14.025 -6.290  -41.167 1.00 27.97  ? 120 TYR A OH  1 
ATOM   275  N N   . THR A 1 40  ? 17.416 -6.917  -49.165 1.00 34.22  ? 121 THR A N   1 
ATOM   276  C CA  . THR A 1 40  ? 17.876 -7.371  -50.459 1.00 36.39  ? 121 THR A CA  1 
ATOM   277  C C   . THR A 1 40  ? 18.855 -6.365  -51.037 1.00 38.43  ? 121 THR A C   1 
ATOM   278  O O   . THR A 1 40  ? 18.915 -5.209  -50.604 1.00 38.62  ? 121 THR A O   1 
ATOM   279  C CB  . THR A 1 40  ? 16.708 -7.561  -51.455 1.00 35.61  ? 121 THR A CB  1 
ATOM   280  O OG1 . THR A 1 40  ? 16.101 -6.292  -51.734 1.00 33.44  ? 121 THR A OG1 1 
ATOM   281  C CG2 . THR A 1 40  ? 15.676 -8.524  -50.877 1.00 32.52  ? 121 THR A CG2 1 
ATOM   282  N N   . ARG A 1 41  ? 19.618 -6.811  -52.025 1.00 38.82  ? 122 ARG A N   1 
ATOM   283  C CA  . ARG A 1 41  ? 20.592 -5.954  -52.663 1.00 40.68  ? 122 ARG A CA  1 
ATOM   284  C C   . ARG A 1 41  ? 19.880 -4.832  -53.411 1.00 39.67  ? 122 ARG A C   1 
ATOM   285  O O   . ARG A 1 41  ? 20.288 -3.681  -53.316 1.00 39.82  ? 122 ARG A O   1 
ATOM   286  C CB  . ARG A 1 41  ? 21.469 -6.791  -53.601 1.00 41.74  ? 122 ARG A CB  1 
ATOM   287  C CG  . ARG A 1 41  ? 21.746 -8.165  -53.013 1.00 45.21  ? 122 ARG A CG  1 
ATOM   288  C CD  . ARG A 1 41  ? 23.213 -8.523  -52.878 1.00 46.70  ? 122 ARG A CD  1 
ATOM   289  N NE  . ARG A 1 41  ? 23.711 -9.189  -54.074 1.00 49.27  ? 122 ARG A NE  1 
ATOM   290  C CZ  . ARG A 1 41  ? 24.780 -9.979  -54.112 1.00 47.58  ? 122 ARG A CZ  1 
ATOM   291  N NH1 . ARG A 1 41  ? 25.485 -10.220 -53.016 1.00 47.42  ? 122 ARG A NH1 1 
ATOM   292  N NH2 . ARG A 1 41  ? 25.140 -10.536 -55.256 1.00 48.69  ? 122 ARG A NH2 1 
ATOM   293  N N   . GLU A 1 42  ? 18.801 -5.146  -54.125 1.00 40.87  ? 123 GLU A N   1 
ATOM   294  C CA  . GLU A 1 42  ? 18.093 -4.100  -54.863 1.00 42.40  ? 123 GLU A CA  1 
ATOM   295  C C   . GLU A 1 42  ? 17.415 -3.111  -53.906 1.00 41.52  ? 123 GLU A C   1 
ATOM   296  O O   . GLU A 1 42  ? 17.331 -1.915  -54.196 1.00 41.78  ? 123 GLU A O   1 
ATOM   297  C CB  . GLU A 1 42  ? 17.089 -4.705  -55.868 1.00 44.94  ? 123 GLU A CB  1 
ATOM   298  C CG  . GLU A 1 42  ? 15.623 -4.704  -55.462 1.00 54.04  ? 123 GLU A CG  1 
ATOM   299  C CD  . GLU A 1 42  ? 14.685 -4.867  -56.667 1.00 59.55  ? 123 GLU A CD  1 
ATOM   300  O OE1 . GLU A 1 42  ? 14.908 -5.786  -57.491 1.00 60.16  ? 123 GLU A OE1 1 
ATOM   301  O OE2 . GLU A 1 42  ? 13.721 -4.075  -56.790 1.00 61.41  ? 123 GLU A OE2 1 
ATOM   302  N N   . GLN A 1 43  ? 16.944 -3.600  -52.764 1.00 38.56  ? 124 GLN A N   1 
ATOM   303  C CA  . GLN A 1 43  ? 16.335 -2.717  -51.785 1.00 37.28  ? 124 GLN A CA  1 
ATOM   304  C C   . GLN A 1 43  ? 17.386 -1.714  -51.329 1.00 36.99  ? 124 GLN A C   1 
ATOM   305  O O   . GLN A 1 43  ? 17.128 -0.513  -51.272 1.00 38.37  ? 124 GLN A O   1 
ATOM   306  C CB  . GLN A 1 43  ? 15.863 -3.500  -50.564 1.00 39.08  ? 124 GLN A CB  1 
ATOM   307  C CG  . GLN A 1 43  ? 14.419 -3.931  -50.584 1.00 41.05  ? 124 GLN A CG  1 
ATOM   308  C CD  . GLN A 1 43  ? 14.082 -4.836  -49.405 1.00 43.61  ? 124 GLN A CD  1 
ATOM   309  O OE1 . GLN A 1 43  ? 14.471 -4.562  -48.272 1.00 42.56  ? 124 GLN A OE1 1 
ATOM   310  N NE2 . GLN A 1 43  ? 13.348 -5.919  -49.670 1.00 44.82  ? 124 GLN A NE2 1 
ATOM   311  N N   . LEU A 1 44  ? 18.575 -2.217  -51.003 1.00 36.89  ? 125 LEU A N   1 
ATOM   312  C CA  . LEU A 1 44  ? 19.670 -1.371  -50.532 1.00 34.59  ? 125 LEU A CA  1 
ATOM   313  C C   . LEU A 1 44  ? 20.160 -0.388  -51.588 1.00 35.00  ? 125 LEU A C   1 
ATOM   314  O O   . LEU A 1 44  ? 20.405 0.779   -51.276 1.00 36.17  ? 125 LEU A O   1 
ATOM   315  C CB  . LEU A 1 44  ? 20.840 -2.234  -50.039 1.00 31.85  ? 125 LEU A CB  1 
ATOM   316  C CG  . LEU A 1 44  ? 22.065 -1.522  -49.448 1.00 30.50  ? 125 LEU A CG  1 
ATOM   317  C CD1 . LEU A 1 44  ? 21.661 -0.632  -48.282 1.00 28.10  ? 125 LEU A CD1 1 
ATOM   318  C CD2 . LEU A 1 44  ? 23.065 -2.551  -48.978 1.00 27.32  ? 125 LEU A CD2 1 
ATOM   319  N N   . TYR A 1 45  ? 20.313 -0.840  -52.829 1.00 33.19  ? 126 TYR A N   1 
ATOM   320  C CA  . TYR A 1 45  ? 20.772 0.065   -53.883 1.00 34.61  ? 126 TYR A CA  1 
ATOM   321  C C   . TYR A 1 45  ? 19.744 1.167   -54.097 1.00 36.85  ? 126 TYR A C   1 
ATOM   322  O O   . TYR A 1 45  ? 20.092 2.322   -54.336 1.00 37.78  ? 126 TYR A O   1 
ATOM   323  C CB  . TYR A 1 45  ? 20.975 -0.683  -55.203 1.00 33.90  ? 126 TYR A CB  1 
ATOM   324  C CG  . TYR A 1 45  ? 22.360 -1.267  -55.403 1.00 33.81  ? 126 TYR A CG  1 
ATOM   325  C CD1 . TYR A 1 45  ? 23.503 -0.454  -55.340 1.00 32.17  ? 126 TYR A CD1 1 
ATOM   326  C CD2 . TYR A 1 45  ? 22.530 -2.621  -55.686 1.00 33.48  ? 126 TYR A CD2 1 
ATOM   327  C CE1 . TYR A 1 45  ? 24.777 -0.978  -55.555 1.00 32.09  ? 126 TYR A CE1 1 
ATOM   328  C CE2 . TYR A 1 45  ? 23.805 -3.157  -55.900 1.00 34.22  ? 126 TYR A CE2 1 
ATOM   329  C CZ  . TYR A 1 45  ? 24.919 -2.330  -55.833 1.00 33.56  ? 126 TYR A CZ  1 
ATOM   330  O OH  . TYR A 1 45  ? 26.170 -2.858  -56.039 1.00 34.19  ? 126 TYR A OH  1 
ATOM   331  N N   . GLN A 1 46  ? 18.473 0.788   -54.001 1.00 37.51  ? 127 GLN A N   1 
ATOM   332  C CA  . GLN A 1 46  ? 17.365 1.702   -54.191 1.00 38.25  ? 127 GLN A CA  1 
ATOM   333  C C   . GLN A 1 46  ? 17.325 2.762   -53.104 1.00 36.76  ? 127 GLN A C   1 
ATOM   334  O O   . GLN A 1 46  ? 17.118 3.943   -53.378 1.00 34.53  ? 127 GLN A O   1 
ATOM   335  C CB  . GLN A 1 46  ? 16.057 0.926   -54.181 1.00 44.36  ? 127 GLN A CB  1 
ATOM   336  C CG  . GLN A 1 46  ? 15.156 1.260   -55.335 1.00 51.18  ? 127 GLN A CG  1 
ATOM   337  C CD  . GLN A 1 46  ? 14.992 0.100   -56.283 1.00 55.01  ? 127 GLN A CD  1 
ATOM   338  O OE1 . GLN A 1 46  ? 14.245 -0.839  -56.008 1.00 56.30  ? 127 GLN A OE1 1 
ATOM   339  N NE2 . GLN A 1 46  ? 15.699 0.152   -57.410 1.00 58.35  ? 127 GLN A NE2 1 
ATOM   340  N N   . ALA A 1 47  ? 17.512 2.330   -51.864 1.00 34.38  ? 128 ALA A N   1 
ATOM   341  C CA  . ALA A 1 47  ? 17.506 3.250   -50.736 1.00 32.48  ? 128 ALA A CA  1 
ATOM   342  C C   . ALA A 1 47  ? 18.644 4.261   -50.896 1.00 32.59  ? 128 ALA A C   1 
ATOM   343  O O   . ALA A 1 47  ? 18.451 5.468   -50.721 1.00 33.00  ? 128 ALA A O   1 
ATOM   344  C CB  . ALA A 1 47  ? 17.658 2.474   -49.431 1.00 29.39  ? 128 ALA A CB  1 
ATOM   345  N N   . ILE A 1 48  ? 19.824 3.761   -51.252 1.00 31.53  ? 129 ILE A N   1 
ATOM   346  C CA  . ILE A 1 48  ? 20.993 4.611   -51.435 1.00 31.15  ? 129 ILE A CA  1 
ATOM   347  C C   . ILE A 1 48  ? 20.798 5.634   -52.552 1.00 31.01  ? 129 ILE A C   1 
ATOM   348  O O   . ILE A 1 48  ? 21.049 6.821   -52.359 1.00 30.46  ? 129 ILE A O   1 
ATOM   349  C CB  . ILE A 1 48  ? 22.253 3.754   -51.727 1.00 33.01  ? 129 ILE A CB  1 
ATOM   350  C CG1 . ILE A 1 48  ? 22.595 2.907   -50.497 1.00 31.92  ? 129 ILE A CG1 1 
ATOM   351  C CG2 . ILE A 1 48  ? 23.434 4.649   -52.076 1.00 30.87  ? 129 ILE A CG2 1 
ATOM   352  C CD1 . ILE A 1 48  ? 23.638 1.848   -50.762 1.00 32.91  ? 129 ILE A CD1 1 
ATOM   353  N N   . PHE A 1 49  ? 20.341 5.182   -53.714 1.00 31.35  ? 130 PHE A N   1 
ATOM   354  C CA  . PHE A 1 49  ? 20.125 6.090   -54.835 1.00 33.07  ? 130 PHE A CA  1 
ATOM   355  C C   . PHE A 1 49  ? 18.999 7.090   -54.597 1.00 34.77  ? 130 PHE A C   1 
ATOM   356  O O   . PHE A 1 49  ? 19.030 8.206   -55.120 1.00 33.72  ? 130 PHE A O   1 
ATOM   357  C CB  . PHE A 1 49  ? 19.849 5.302   -56.114 1.00 32.53  ? 130 PHE A CB  1 
ATOM   358  C CG  . PHE A 1 49  ? 21.014 4.467   -56.565 1.00 37.97  ? 130 PHE A CG  1 
ATOM   359  C CD1 . PHE A 1 49  ? 22.324 4.889   -56.324 1.00 37.89  ? 130 PHE A CD1 1 
ATOM   360  C CD2 . PHE A 1 49  ? 20.813 3.276   -57.257 1.00 38.31  ? 130 PHE A CD2 1 
ATOM   361  C CE1 . PHE A 1 49  ? 23.413 4.141   -56.763 1.00 38.87  ? 130 PHE A CE1 1 
ATOM   362  C CE2 . PHE A 1 49  ? 21.900 2.520   -57.700 1.00 39.01  ? 130 PHE A CE2 1 
ATOM   363  C CZ  . PHE A 1 49  ? 23.204 2.955   -57.451 1.00 37.46  ? 130 PHE A CZ  1 
ATOM   364  N N   . HIS A 1 50  ? 18.001 6.691   -53.813 1.00 34.75  ? 131 HIS A N   1 
ATOM   365  C CA  . HIS A 1 50  ? 16.894 7.580   -53.518 1.00 34.37  ? 131 HIS A CA  1 
ATOM   366  C C   . HIS A 1 50  ? 17.378 8.734   -52.637 1.00 35.85  ? 131 HIS A C   1 
ATOM   367  O O   . HIS A 1 50  ? 17.007 9.897   -52.854 1.00 35.63  ? 131 HIS A O   1 
ATOM   368  C CB  . HIS A 1 50  ? 15.781 6.826   -52.794 1.00 33.87  ? 131 HIS A CB  1 
ATOM   369  C CG  . HIS A 1 50  ? 14.676 7.714   -52.317 1.00 34.20  ? 131 HIS A CG  1 
ATOM   370  N ND1 . HIS A 1 50  ? 13.734 8.254   -53.167 1.00 35.93  ? 131 HIS A ND1 1 
ATOM   371  C CD2 . HIS A 1 50  ? 14.392 8.194   -51.084 1.00 31.46  ? 131 HIS A CD2 1 
ATOM   372  C CE1 . HIS A 1 50  ? 12.917 9.030   -52.477 1.00 34.11  ? 131 HIS A CE1 1 
ATOM   373  N NE2 . HIS A 1 50  ? 13.295 9.011   -51.212 1.00 34.64  ? 131 HIS A NE2 1 
ATOM   374  N N   . ALA A 1 51  ? 18.216 8.408   -51.652 1.00 34.76  ? 132 ALA A N   1 
ATOM   375  C CA  . ALA A 1 51  ? 18.736 9.411   -50.732 1.00 34.94  ? 132 ALA A CA  1 
ATOM   376  C C   . ALA A 1 51  ? 19.613 10.439  -51.443 1.00 35.95  ? 132 ALA A C   1 
ATOM   377  O O   . ALA A 1 51  ? 19.569 11.622  -51.118 1.00 37.22  ? 132 ALA A O   1 
ATOM   378  C CB  . ALA A 1 51  ? 19.509 8.740   -49.604 1.00 30.99  ? 132 ALA A CB  1 
ATOM   379  N N   . VAL A 1 52  ? 20.393 9.995   -52.423 1.00 36.53  ? 133 VAL A N   1 
ATOM   380  C CA  . VAL A 1 52  ? 21.260 10.908  -53.161 1.00 37.64  ? 133 VAL A CA  1 
ATOM   381  C C   . VAL A 1 52  ? 20.446 11.735  -54.161 1.00 38.98  ? 133 VAL A C   1 
ATOM   382  O O   . VAL A 1 52  ? 20.622 12.950  -54.251 1.00 39.01  ? 133 VAL A O   1 
ATOM   383  C CB  . VAL A 1 52  ? 22.400 10.138  -53.903 1.00 36.13  ? 133 VAL A CB  1 
ATOM   384  C CG1 . VAL A 1 52  ? 23.204 11.084  -54.767 1.00 33.97  ? 133 VAL A CG1 1 
ATOM   385  C CG2 . VAL A 1 52  ? 23.324 9.481   -52.890 1.00 33.44  ? 133 VAL A CG2 1 
ATOM   386  N N   . ASP A 1 53  ? 19.560 11.082  -54.908 1.00 39.68  ? 134 ASP A N   1 
ATOM   387  C CA  . ASP A 1 53  ? 18.731 11.795  -55.874 1.00 41.04  ? 134 ASP A CA  1 
ATOM   388  C C   . ASP A 1 53  ? 17.928 12.870  -55.155 1.00 40.05  ? 134 ASP A C   1 
ATOM   389  O O   . ASP A 1 53  ? 17.821 13.998  -55.631 1.00 39.41  ? 134 ASP A O   1 
ATOM   390  C CB  . ASP A 1 53  ? 17.762 10.851  -56.593 1.00 44.15  ? 134 ASP A CB  1 
ATOM   391  C CG  . ASP A 1 53  ? 18.462 9.914   -57.571 1.00 48.14  ? 134 ASP A CG  1 
ATOM   392  O OD1 . ASP A 1 53  ? 19.419 10.351  -58.239 1.00 51.66  ? 134 ASP A OD1 1 
ATOM   393  O OD2 . ASP A 1 53  ? 18.040 8.744   -57.691 1.00 49.44  ? 134 ASP A OD2 1 
ATOM   394  N N   . GLN A 1 54  ? 17.364 12.513  -54.007 1.00 38.57  ? 135 GLN A N   1 
ATOM   395  C CA  . GLN A 1 54  ? 16.579 13.454  -53.223 1.00 36.78  ? 135 GLN A CA  1 
ATOM   396  C C   . GLN A 1 54  ? 17.449 14.631  -52.814 1.00 38.01  ? 135 GLN A C   1 
ATOM   397  O O   . GLN A 1 54  ? 17.042 15.793  -52.909 1.00 39.17  ? 135 GLN A O   1 
ATOM   398  C CB  . GLN A 1 54  ? 16.016 12.756  -51.993 1.00 37.47  ? 135 GLN A CB  1 
ATOM   399  C CG  . GLN A 1 54  ? 14.829 11.843  -52.288 1.00 38.22  ? 135 GLN A CG  1 
ATOM   400  C CD  . GLN A 1 54  ? 13.585 12.628  -52.668 1.00 39.73  ? 135 GLN A CD  1 
ATOM   401  O OE1 . GLN A 1 54  ? 13.472 13.144  -53.785 1.00 38.77  ? 135 GLN A OE1 1 
ATOM   402  N NE2 . GLN A 1 54  ? 12.650 12.741  -51.727 1.00 38.42  ? 135 GLN A NE2 1 
ATOM   403  N N   . TYR A 1 55  ? 18.654 14.325  -52.355 1.00 37.39  ? 136 TYR A N   1 
ATOM   404  C CA  . TYR A 1 55  ? 19.599 15.356  -51.963 1.00 36.86  ? 136 TYR A CA  1 
ATOM   405  C C   . TYR A 1 55  ? 19.797 16.335  -53.116 1.00 36.52  ? 136 TYR A C   1 
ATOM   406  O O   . TYR A 1 55  ? 19.781 17.549  -52.923 1.00 37.21  ? 136 TYR A O   1 
ATOM   407  C CB  . TYR A 1 55  ? 20.940 14.724  -51.621 1.00 35.23  ? 136 TYR A CB  1 
ATOM   408  C CG  . TYR A 1 55  ? 22.046 15.726  -51.449 1.00 36.17  ? 136 TYR A CG  1 
ATOM   409  C CD1 . TYR A 1 55  ? 22.170 16.466  -50.273 1.00 35.25  ? 136 TYR A CD1 1 
ATOM   410  C CD2 . TYR A 1 55  ? 22.978 15.935  -52.465 1.00 35.56  ? 136 TYR A CD2 1 
ATOM   411  C CE1 . TYR A 1 55  ? 23.206 17.389  -50.112 1.00 35.44  ? 136 TYR A CE1 1 
ATOM   412  C CE2 . TYR A 1 55  ? 24.010 16.853  -52.316 1.00 35.49  ? 136 TYR A CE2 1 
ATOM   413  C CZ  . TYR A 1 55  ? 24.123 17.576  -51.140 1.00 36.49  ? 136 TYR A CZ  1 
ATOM   414  O OH  . TYR A 1 55  ? 25.158 18.482  -51.002 1.00 38.01  ? 136 TYR A OH  1 
ATOM   415  N N   . LEU A 1 56  ? 19.984 15.796  -54.315 1.00 36.84  ? 137 LEU A N   1 
ATOM   416  C CA  . LEU A 1 56  ? 20.197 16.613  -55.505 1.00 37.56  ? 137 LEU A CA  1 
ATOM   417  C C   . LEU A 1 56  ? 18.964 17.412  -55.939 1.00 38.62  ? 137 LEU A C   1 
ATOM   418  O O   . LEU A 1 56  ? 19.089 18.481  -56.539 1.00 38.92  ? 137 LEU A O   1 
ATOM   419  C CB  . LEU A 1 56  ? 20.679 15.728  -56.660 1.00 34.57  ? 137 LEU A CB  1 
ATOM   420  C CG  . LEU A 1 56  ? 22.091 15.157  -56.467 1.00 38.29  ? 137 LEU A CG  1 
ATOM   421  C CD1 . LEU A 1 56  ? 22.389 14.119  -57.535 1.00 37.66  ? 137 LEU A CD1 1 
ATOM   422  C CD2 . LEU A 1 56  ? 23.117 16.281  -56.520 1.00 36.97  ? 137 LEU A CD2 1 
ATOM   423  N N   . ALA A 1 57  ? 17.779 16.900  -55.627 1.00 38.12  ? 138 ALA A N   1 
ATOM   424  C CA  . ALA A 1 57  ? 16.536 17.561  -56.003 1.00 38.99  ? 138 ALA A CA  1 
ATOM   425  C C   . ALA A 1 57  ? 16.000 18.471  -54.898 1.00 40.26  ? 138 ALA A C   1 
ATOM   426  O O   . ALA A 1 57  ? 15.015 19.183  -55.088 1.00 40.60  ? 138 ALA A O   1 
ATOM   427  C CB  . ALA A 1 57  ? 15.491 16.512  -56.355 1.00 36.69  ? 138 ALA A CB  1 
ATOM   428  N N   . LEU A 1 58  ? 16.665 18.451  -53.753 1.00 40.80  ? 139 LEU A N   1 
ATOM   429  C CA  . LEU A 1 58  ? 16.252 19.229  -52.595 1.00 42.94  ? 139 LEU A CA  1 
ATOM   430  C C   . LEU A 1 58  ? 15.662 20.619  -52.857 1.00 45.17  ? 139 LEU A C   1 
ATOM   431  O O   . LEU A 1 58  ? 14.607 20.964  -52.312 1.00 44.48  ? 139 LEU A O   1 
ATOM   432  C CB  . LEU A 1 58  ? 17.424 19.336  -51.618 1.00 42.52  ? 139 LEU A CB  1 
ATOM   433  C CG  . LEU A 1 58  ? 17.047 19.494  -50.145 1.00 42.19  ? 139 LEU A CG  1 
ATOM   434  C CD1 . LEU A 1 58  ? 16.018 18.433  -49.750 1.00 39.57  ? 139 LEU A CD1 1 
ATOM   435  C CD2 . LEU A 1 58  ? 18.300 19.371  -49.298 1.00 42.13  ? 139 LEU A CD2 1 
ATOM   436  N N   . PRO A 1 59  ? 16.323 21.434  -53.698 1.00 46.89  ? 140 PRO A N   1 
ATOM   437  C CA  . PRO A 1 59  ? 15.812 22.782  -53.983 1.00 46.18  ? 140 PRO A CA  1 
ATOM   438  C C   . PRO A 1 59  ? 14.435 22.792  -54.630 1.00 45.21  ? 140 PRO A C   1 
ATOM   439  O O   . PRO A 1 59  ? 13.646 23.715  -54.423 1.00 46.14  ? 140 PRO A O   1 
ATOM   440  C CB  . PRO A 1 59  ? 16.875 23.367  -54.915 1.00 46.11  ? 140 PRO A CB  1 
ATOM   441  C CG  . PRO A 1 59  ? 18.120 22.623  -54.537 1.00 45.55  ? 140 PRO A CG  1 
ATOM   442  C CD  . PRO A 1 59  ? 17.610 21.215  -54.380 1.00 46.72  ? 140 PRO A CD  1 
ATOM   443  N N   . ASP A 1 60  ? 14.146 21.766  -55.416 1.00 43.15  ? 141 ASP A N   1 
ATOM   444  C CA  . ASP A 1 60  ? 12.867 21.699  -56.099 1.00 44.19  ? 141 ASP A CA  1 
ATOM   445  C C   . ASP A 1 60  ? 11.747 20.989  -55.355 1.00 43.09  ? 141 ASP A C   1 
ATOM   446  O O   . ASP A 1 60  ? 10.580 21.220  -55.659 1.00 44.27  ? 141 ASP A O   1 
ATOM   447  C CB  . ASP A 1 60  ? 13.033 21.024  -57.463 1.00 46.00  ? 141 ASP A CB  1 
ATOM   448  C CG  . ASP A 1 60  ? 13.971 21.781  -58.379 1.00 50.50  ? 141 ASP A CG  1 
ATOM   449  O OD1 . ASP A 1 60  ? 14.202 21.313  -59.514 1.00 51.70  ? 141 ASP A OD1 1 
ATOM   450  O OD2 . ASP A 1 60  ? 14.478 22.844  -57.964 1.00 53.05  ? 141 ASP A OD2 1 
ATOM   451  N N   . VAL A 1 61  ? 12.078 20.143  -54.382 1.00 40.09  ? 142 VAL A N   1 
ATOM   452  C CA  . VAL A 1 61  ? 11.042 19.382  -53.698 1.00 37.05  ? 142 VAL A CA  1 
ATOM   453  C C   . VAL A 1 61  ? 10.806 19.658  -52.222 1.00 37.95  ? 142 VAL A C   1 
ATOM   454  O O   . VAL A 1 61  ? 9.710  19.416  -51.716 1.00 38.22  ? 142 VAL A O   1 
ATOM   455  C CB  . VAL A 1 61  ? 11.294 17.860  -53.869 1.00 35.82  ? 142 VAL A CB  1 
ATOM   456  C CG1 . VAL A 1 61  ? 11.626 17.550  -55.330 1.00 30.68  ? 142 VAL A CG1 1 
ATOM   457  C CG2 . VAL A 1 61  ? 12.403 17.405  -52.962 1.00 32.11  ? 142 VAL A CG2 1 
ATOM   458  N N   . SER A 1 62  ? 11.812 20.172  -51.526 1.00 38.13  ? 143 SER A N   1 
ATOM   459  C CA  . SER A 1 62  ? 11.663 20.431  -50.101 1.00 37.65  ? 143 SER A CA  1 
ATOM   460  C C   . SER A 1 62  ? 10.728 21.587  -49.742 1.00 37.77  ? 143 SER A C   1 
ATOM   461  O O   . SER A 1 62  ? 10.614 22.567  -50.478 1.00 37.36  ? 143 SER A O   1 
ATOM   462  C CB  . SER A 1 62  ? 13.032 20.674  -49.465 1.00 37.42  ? 143 SER A CB  1 
ATOM   463  O OG  . SER A 1 62  ? 12.918 20.661  -48.050 1.00 37.28  ? 143 SER A OG  1 
ATOM   464  N N   . LEU A 1 63  ? 10.053 21.447  -48.602 1.00 37.42  ? 144 LEU A N   1 
ATOM   465  C CA  . LEU A 1 63  ? 9.143  22.470  -48.103 1.00 36.82  ? 144 LEU A CA  1 
ATOM   466  C C   . LEU A 1 63  ? 9.929  23.394  -47.182 1.00 37.45  ? 144 LEU A C   1 
ATOM   467  O O   . LEU A 1 63  ? 9.401  24.358  -46.638 1.00 37.51  ? 144 LEU A O   1 
ATOM   468  C CB  . LEU A 1 63  ? 7.981  21.836  -47.333 1.00 34.01  ? 144 LEU A CB  1 
ATOM   469  C CG  . LEU A 1 63  ? 6.988  21.048  -48.180 1.00 32.63  ? 144 LEU A CG  1 
ATOM   470  C CD1 . LEU A 1 63  ? 5.940  20.408  -47.287 1.00 31.18  ? 144 LEU A CD1 1 
ATOM   471  C CD2 . LEU A 1 63  ? 6.342  21.977  -49.187 1.00 29.78  ? 144 LEU A CD2 1 
ATOM   472  N N   . GLY A 1 64  ? 11.202 23.077  -46.999 1.00 38.74  ? 145 GLY A N   1 
ATOM   473  C CA  . GLY A 1 64  ? 12.049 23.912  -46.172 1.00 41.11  ? 145 GLY A CA  1 
ATOM   474  C C   . GLY A 1 64  ? 13.055 24.582  -47.080 1.00 42.17  ? 145 GLY A C   1 
ATOM   475  O O   . GLY A 1 64  ? 13.337 24.076  -48.160 1.00 44.96  ? 145 GLY A O   1 
ATOM   476  N N   . ARG A 1 65  ? 13.579 25.731  -46.679 1.00 44.03  ? 146 ARG A N   1 
ATOM   477  C CA  . ARG A 1 65  ? 14.574 26.395  -47.498 1.00 44.52  ? 146 ARG A CA  1 
ATOM   478  C C   . ARG A 1 65  ? 15.952 25.990  -46.989 1.00 44.53  ? 146 ARG A C   1 
ATOM   479  O O   . ARG A 1 65  ? 16.501 26.611  -46.078 1.00 44.59  ? 146 ARG A O   1 
ATOM   480  C CB  . ARG A 1 65  ? 14.403 27.914  -47.441 1.00 47.91  ? 146 ARG A CB  1 
ATOM   481  C CG  . ARG A 1 65  ? 15.619 28.664  -47.970 1.00 54.00  ? 146 ARG A CG  1 
ATOM   482  C CD  . ARG A 1 65  ? 15.256 29.954  -48.672 1.00 57.32  ? 146 ARG A CD  1 
ATOM   483  N NE  . ARG A 1 65  ? 14.675 29.707  -49.986 1.00 61.73  ? 146 ARG A NE  1 
ATOM   484  C CZ  . ARG A 1 65  ? 14.481 30.651  -50.902 1.00 64.13  ? 146 ARG A CZ  1 
ATOM   485  N NH1 . ARG A 1 65  ? 14.825 31.910  -50.644 1.00 64.52  ? 146 ARG A NH1 1 
ATOM   486  N NH2 . ARG A 1 65  ? 13.941 30.333  -52.074 1.00 64.20  ? 146 ARG A NH2 1 
ATOM   487  N N   . TYR A 1 66  ? 16.502 24.935  -47.582 1.00 44.23  ? 147 TYR A N   1 
ATOM   488  C CA  . TYR A 1 66  ? 17.811 24.417  -47.188 1.00 43.91  ? 147 TYR A CA  1 
ATOM   489  C C   . TYR A 1 66  ? 18.911 24.811  -48.152 1.00 43.75  ? 147 TYR A C   1 
ATOM   490  O O   . TYR A 1 66  ? 18.708 24.863  -49.359 1.00 44.89  ? 147 TYR A O   1 
ATOM   491  C CB  . TYR A 1 66  ? 17.766 22.892  -47.095 1.00 40.57  ? 147 TYR A CB  1 
ATOM   492  C CG  . TYR A 1 66  ? 16.792 22.378  -46.070 1.00 36.83  ? 147 TYR A CG  1 
ATOM   493  C CD1 . TYR A 1 66  ? 17.038 22.535  -44.710 1.00 35.51  ? 147 TYR A CD1 1 
ATOM   494  C CD2 . TYR A 1 66  ? 15.621 21.736  -46.458 1.00 36.97  ? 147 TYR A CD2 1 
ATOM   495  C CE1 . TYR A 1 66  ? 16.141 22.061  -43.760 1.00 34.78  ? 147 TYR A CE1 1 
ATOM   496  C CE2 . TYR A 1 66  ? 14.713 21.256  -45.511 1.00 33.68  ? 147 TYR A CE2 1 
ATOM   497  C CZ  . TYR A 1 66  ? 14.984 21.422  -44.172 1.00 33.26  ? 147 TYR A CZ  1 
ATOM   498  O OH  . TYR A 1 66  ? 14.112 20.927  -43.242 1.00 33.79  ? 147 TYR A OH  1 
ATOM   499  N N   . ALA A 1 67  ? 20.087 25.076  -47.607 1.00 45.18  ? 148 ALA A N   1 
ATOM   500  C CA  . ALA A 1 67  ? 21.222 25.448  -48.429 1.00 48.10  ? 148 ALA A CA  1 
ATOM   501  C C   . ALA A 1 67  ? 22.306 24.374  -48.374 1.00 49.47  ? 148 ALA A C   1 
ATOM   502  O O   . ALA A 1 67  ? 22.567 23.786  -47.316 1.00 49.06  ? 148 ALA A O   1 
ATOM   503  C CB  . ALA A 1 67  ? 21.792 26.779  -47.956 1.00 47.94  ? 148 ALA A CB  1 
ATOM   504  N N   . TYR A 1 68  ? 22.926 24.115  -49.520 1.00 49.94  ? 149 TYR A N   1 
ATOM   505  C CA  . TYR A 1 68  ? 24.005 23.147  -49.584 1.00 52.55  ? 149 TYR A CA  1 
ATOM   506  C C   . TYR A 1 68  ? 25.256 23.756  -48.941 1.00 56.39  ? 149 TYR A C   1 
ATOM   507  O O   . TYR A 1 68  ? 25.406 24.980  -48.876 1.00 56.79  ? 149 TYR A O   1 
ATOM   508  C CB  . TYR A 1 68  ? 24.329 22.795  -51.032 1.00 48.72  ? 149 TYR A CB  1 
ATOM   509  C CG  . TYR A 1 68  ? 23.259 22.025  -51.758 1.00 47.46  ? 149 TYR A CG  1 
ATOM   510  C CD1 . TYR A 1 68  ? 22.850 20.768  -51.314 1.00 44.82  ? 149 TYR A CD1 1 
ATOM   511  C CD2 . TYR A 1 68  ? 22.688 22.531  -52.925 1.00 47.78  ? 149 TYR A CD2 1 
ATOM   512  C CE1 . TYR A 1 68  ? 21.905 20.032  -52.021 1.00 44.76  ? 149 TYR A CE1 1 
ATOM   513  C CE2 . TYR A 1 68  ? 21.739 21.800  -53.638 1.00 46.83  ? 149 TYR A CE2 1 
ATOM   514  C CZ  . TYR A 1 68  ? 21.358 20.553  -53.184 1.00 45.24  ? 149 TYR A CZ  1 
ATOM   515  O OH  . TYR A 1 68  ? 20.461 19.816  -53.920 1.00 47.42  ? 149 TYR A OH  1 
ATOM   516  N N   . VAL A 1 69  ? 26.146 22.890  -48.472 1.00 60.20  ? 150 VAL A N   1 
ATOM   517  C CA  . VAL A 1 69  ? 27.403 23.300  -47.859 1.00 63.19  ? 150 VAL A CA  1 
ATOM   518  C C   . VAL A 1 69  ? 28.498 22.565  -48.632 1.00 66.66  ? 150 VAL A C   1 
ATOM   519  O O   . VAL A 1 69  ? 28.217 21.563  -49.288 1.00 68.12  ? 150 VAL A O   1 
ATOM   520  C CB  . VAL A 1 69  ? 27.455 22.885  -46.381 1.00 62.32  ? 150 VAL A CB  1 
ATOM   521  C CG1 . VAL A 1 69  ? 28.782 23.283  -45.771 1.00 61.83  ? 150 VAL A CG1 1 
ATOM   522  C CG2 . VAL A 1 69  ? 26.307 23.525  -45.626 1.00 61.89  ? 150 VAL A CG2 1 
ATOM   523  N N   . ARG A 1 70  ? 29.733 23.054  -48.569 1.00 70.27  ? 151 ARG A N   1 
ATOM   524  C CA  . ARG A 1 70  ? 30.837 22.407  -49.283 1.00 73.44  ? 151 ARG A CA  1 
ATOM   525  C C   . ARG A 1 70  ? 32.213 22.620  -48.651 1.00 73.67  ? 151 ARG A C   1 
ATOM   526  O O   . ARG A 1 70  ? 32.405 23.510  -47.822 1.00 74.12  ? 151 ARG A O   1 
ATOM   527  C CB  . ARG A 1 70  ? 30.858 22.871  -50.747 1.00 74.91  ? 151 ARG A CB  1 
ATOM   528  C CG  . ARG A 1 70  ? 29.944 22.053  -51.649 1.00 77.59  ? 151 ARG A CG  1 
ATOM   529  C CD  . ARG A 1 70  ? 28.914 22.899  -52.378 1.00 80.86  ? 151 ARG A CD  1 
ATOM   530  N NE  . ARG A 1 70  ? 29.212 23.011  -53.804 1.00 83.31  ? 151 ARG A NE  1 
ATOM   531  C CZ  . ARG A 1 70  ? 28.376 23.512  -54.712 1.00 84.71  ? 151 ARG A CZ  1 
ATOM   532  N NH1 . ARG A 1 70  ? 27.174 23.955  -54.354 1.00 83.91  ? 151 ARG A NH1 1 
ATOM   533  N NH2 . ARG A 1 70  ? 28.748 23.570  -55.984 1.00 85.03  ? 151 ARG A NH2 1 
ATOM   534  N N   . SER A 1 80  ? 33.048 19.713  -51.578 1.00 58.03  ? 161 SER A N   1 
ATOM   535  C CA  . SER A 1 80  ? 32.083 18.680  -51.950 1.00 57.32  ? 161 SER A CA  1 
ATOM   536  C C   . SER A 1 80  ? 30.867 18.665  -51.022 1.00 55.75  ? 161 SER A C   1 
ATOM   537  O O   . SER A 1 80  ? 30.969 18.958  -49.825 1.00 55.18  ? 161 SER A O   1 
ATOM   538  C CB  . SER A 1 80  ? 32.752 17.305  -51.942 1.00 59.01  ? 161 SER A CB  1 
ATOM   539  O OG  . SER A 1 80  ? 31.836 16.290  -52.325 1.00 61.30  ? 161 SER A OG  1 
ATOM   540  N N   . GLY A 1 81  ? 29.715 18.314  -51.585 1.00 54.15  ? 162 GLY A N   1 
ATOM   541  C CA  . GLY A 1 81  ? 28.494 18.282  -50.802 1.00 50.19  ? 162 GLY A CA  1 
ATOM   542  C C   . GLY A 1 81  ? 28.185 16.964  -50.112 1.00 47.41  ? 162 GLY A C   1 
ATOM   543  O O   . GLY A 1 81  ? 28.084 16.910  -48.886 1.00 46.55  ? 162 GLY A O   1 
ATOM   544  N N   . LEU A 1 82  ? 28.053 15.895  -50.889 1.00 43.64  ? 163 LEU A N   1 
ATOM   545  C CA  . LEU A 1 82  ? 27.705 14.601  -50.316 1.00 41.77  ? 163 LEU A CA  1 
ATOM   546  C C   . LEU A 1 82  ? 28.729 13.479  -50.475 1.00 39.93  ? 163 LEU A C   1 
ATOM   547  O O   . LEU A 1 82  ? 29.242 13.223  -51.562 1.00 37.85  ? 163 LEU A O   1 
ATOM   548  C CB  . LEU A 1 82  ? 26.353 14.153  -50.885 1.00 38.76  ? 163 LEU A CB  1 
ATOM   549  C CG  . LEU A 1 82  ? 25.754 12.799  -50.490 1.00 37.21  ? 163 LEU A CG  1 
ATOM   550  C CD1 . LEU A 1 82  ? 24.243 12.839  -50.701 1.00 35.22  ? 163 LEU A CD1 1 
ATOM   551  C CD2 . LEU A 1 82  ? 26.381 11.688  -51.324 1.00 34.89  ? 163 LEU A CD2 1 
ATOM   552  N N   . ALA A 1 83  ? 29.003 12.799  -49.371 1.00 39.04  ? 164 ALA A N   1 
ATOM   553  C CA  . ALA A 1 83  ? 29.938 11.686  -49.376 1.00 41.03  ? 164 ALA A CA  1 
ATOM   554  C C   . ALA A 1 83  ? 29.185 10.353  -49.293 1.00 40.91  ? 164 ALA A C   1 
ATOM   555  O O   . ALA A 1 83  ? 28.555 10.045  -48.277 1.00 42.07  ? 164 ALA A O   1 
ATOM   556  C CB  . ALA A 1 83  ? 30.911 11.814  -48.205 1.00 39.50  ? 164 ALA A CB  1 
ATOM   557  N N   . LEU A 1 84  ? 29.221 9.584   -50.375 1.00 38.54  ? 165 LEU A N   1 
ATOM   558  C CA  . LEU A 1 84  ? 28.577 8.277   -50.395 1.00 38.61  ? 165 LEU A CA  1 
ATOM   559  C C   . LEU A 1 84  ? 29.700 7.272   -50.155 1.00 38.98  ? 165 LEU A C   1 
ATOM   560  O O   . LEU A 1 84  ? 30.468 6.960   -51.069 1.00 39.24  ? 165 LEU A O   1 
ATOM   561  C CB  . LEU A 1 84  ? 27.909 8.024   -51.754 1.00 36.88  ? 165 LEU A CB  1 
ATOM   562  C CG  . LEU A 1 84  ? 27.442 6.598   -52.089 1.00 36.12  ? 165 LEU A CG  1 
ATOM   563  C CD1 . LEU A 1 84  ? 26.572 6.044   -50.984 1.00 32.34  ? 165 LEU A CD1 1 
ATOM   564  C CD2 . LEU A 1 84  ? 26.686 6.617   -53.417 1.00 33.20  ? 165 LEU A CD2 1 
ATOM   565  N N   . CYS A 1 85  ? 29.798 6.765   -48.931 1.00 36.88  ? 166 CYS A N   1 
ATOM   566  C CA  . CYS A 1 85  ? 30.873 5.844   -48.609 1.00 38.74  ? 166 CYS A CA  1 
ATOM   567  C C   . CYS A 1 85  ? 30.486 4.424   -48.235 1.00 37.99  ? 166 CYS A C   1 
ATOM   568  O O   . CYS A 1 85  ? 29.552 4.203   -47.472 1.00 40.44  ? 166 CYS A O   1 
ATOM   569  C CB  . CYS A 1 85  ? 31.704 6.404   -47.459 1.00 40.21  ? 166 CYS A CB  1 
ATOM   570  S SG  . CYS A 1 85  ? 32.212 8.154   -47.563 1.00 42.94  ? 166 CYS A SG  1 
ATOM   571  N N   . GLN A 1 86  ? 31.223 3.455   -48.764 1.00 37.91  ? 167 GLN A N   1 
ATOM   572  C CA  . GLN A 1 86  ? 30.978 2.068   -48.406 1.00 37.14  ? 167 GLN A CA  1 
ATOM   573  C C   . GLN A 1 86  ? 32.225 1.604   -47.690 1.00 36.84  ? 167 GLN A C   1 
ATOM   574  O O   . GLN A 1 86  ? 33.332 2.046   -47.995 1.00 36.79  ? 167 GLN A O   1 
ATOM   575  C CB  . GLN A 1 86  ? 30.713 1.184   -49.627 1.00 35.94  ? 167 GLN A CB  1 
ATOM   576  C CG  . GLN A 1 86  ? 31.920 0.856   -50.482 1.00 37.47  ? 167 GLN A CG  1 
ATOM   577  C CD  . GLN A 1 86  ? 31.621 -0.251  -51.488 1.00 36.63  ? 167 GLN A CD  1 
ATOM   578  O OE1 . GLN A 1 86  ? 31.257 -1.368  -51.110 1.00 37.52  ? 167 GLN A OE1 1 
ATOM   579  N NE2 . GLN A 1 86  ? 31.774 0.055   -52.770 1.00 33.36  ? 167 GLN A NE2 1 
ATOM   580  N N   . ARG A 1 87  ? 32.040 0.733   -46.711 1.00 37.20  ? 168 ARG A N   1 
ATOM   581  C CA  . ARG A 1 87  ? 33.155 0.219   -45.953 1.00 35.99  ? 168 ARG A CA  1 
ATOM   582  C C   . ARG A 1 87  ? 33.144 -1.290  -46.004 1.00 36.55  ? 168 ARG A C   1 
ATOM   583  O O   . ARG A 1 87  ? 32.090 -1.923  -45.933 1.00 38.54  ? 168 ARG A O   1 
ATOM   584  C CB  . ARG A 1 87  ? 33.082 0.721   -44.516 1.00 34.34  ? 168 ARG A CB  1 
ATOM   585  C CG  . ARG A 1 87  ? 33.233 2.235   -44.437 1.00 35.91  ? 168 ARG A CG  1 
ATOM   586  C CD  . ARG A 1 87  ? 33.225 2.753   -43.005 1.00 35.47  ? 168 ARG A CD  1 
ATOM   587  N NE  . ARG A 1 87  ? 33.278 4.216   -42.986 1.00 38.34  ? 168 ARG A NE  1 
ATOM   588  C CZ  . ARG A 1 87  ? 32.314 5.017   -43.432 1.00 35.73  ? 168 ARG A CZ  1 
ATOM   589  N NH1 . ARG A 1 87  ? 31.199 4.509   -43.930 1.00 36.44  ? 168 ARG A NH1 1 
ATOM   590  N NH2 . ARG A 1 87  ? 32.477 6.332   -43.405 1.00 35.17  ? 168 ARG A NH2 1 
ATOM   591  N N   . TYR A 1 88  ? 34.327 -1.865  -46.147 1.00 34.81  ? 169 TYR A N   1 
ATOM   592  C CA  . TYR A 1 88  ? 34.457 -3.305  -46.215 1.00 36.07  ? 169 TYR A CA  1 
ATOM   593  C C   . TYR A 1 88  ? 35.816 -3.758  -45.701 1.00 34.38  ? 169 TYR A C   1 
ATOM   594  O O   . TYR A 1 88  ? 36.750 -2.971  -45.598 1.00 34.31  ? 169 TYR A O   1 
ATOM   595  C CB  . TYR A 1 88  ? 34.271 -3.773  -47.659 1.00 34.10  ? 169 TYR A CB  1 
ATOM   596  C CG  . TYR A 1 88  ? 35.036 -2.943  -48.658 1.00 35.52  ? 169 TYR A CG  1 
ATOM   597  C CD1 . TYR A 1 88  ? 34.397 -1.929  -49.379 1.00 37.07  ? 169 TYR A CD1 1 
ATOM   598  C CD2 . TYR A 1 88  ? 36.396 -3.177  -48.904 1.00 34.58  ? 169 TYR A CD2 1 
ATOM   599  C CE1 . TYR A 1 88  ? 35.084 -1.172  -50.325 1.00 35.43  ? 169 TYR A CE1 1 
ATOM   600  C CE2 . TYR A 1 88  ? 37.097 -2.421  -49.851 1.00 33.58  ? 169 TYR A CE2 1 
ATOM   601  C CZ  . TYR A 1 88  ? 36.428 -1.421  -50.556 1.00 35.67  ? 169 TYR A CZ  1 
ATOM   602  O OH  . TYR A 1 88  ? 37.091 -0.666  -51.495 1.00 36.68  ? 169 TYR A OH  1 
ATOM   603  N N   . TYR A 1 89  ? 35.920 -5.037  -45.385 1.00 34.26  ? 170 TYR A N   1 
ATOM   604  C CA  . TYR A 1 89  ? 37.177 -5.576  -44.905 1.00 35.53  ? 170 TYR A CA  1 
ATOM   605  C C   . TYR A 1 89  ? 38.228 -5.574  -46.004 1.00 35.35  ? 170 TYR A C   1 
ATOM   606  O O   . TYR A 1 89  ? 37.960 -5.930  -47.156 1.00 35.10  ? 170 TYR A O   1 
ATOM   607  C CB  . TYR A 1 89  ? 36.973 -6.993  -44.388 1.00 35.15  ? 170 TYR A CB  1 
ATOM   608  C CG  . TYR A 1 89  ? 35.985 -7.056  -43.253 1.00 36.91  ? 170 TYR A CG  1 
ATOM   609  C CD1 . TYR A 1 89  ? 36.230 -6.379  -42.060 1.00 37.81  ? 170 TYR A CD1 1 
ATOM   610  C CD2 . TYR A 1 89  ? 34.813 -7.800  -43.361 1.00 37.51  ? 170 TYR A CD2 1 
ATOM   611  C CE1 . TYR A 1 89  ? 35.335 -6.441  -40.996 1.00 38.28  ? 170 TYR A CE1 1 
ATOM   612  C CE2 . TYR A 1 89  ? 33.906 -7.868  -42.299 1.00 40.34  ? 170 TYR A CE2 1 
ATOM   613  C CZ  . TYR A 1 89  ? 34.176 -7.185  -41.123 1.00 39.92  ? 170 TYR A CZ  1 
ATOM   614  O OH  . TYR A 1 89  ? 33.286 -7.235  -40.075 1.00 43.27  ? 170 TYR A OH  1 
ATOM   615  N N   . HIS A 1 90  ? 39.429 -5.155  -45.629 1.00 36.63  ? 171 HIS A N   1 
ATOM   616  C CA  . HIS A 1 90  ? 40.555 -5.108  -46.540 1.00 36.73  ? 171 HIS A CA  1 
ATOM   617  C C   . HIS A 1 90  ? 40.653 -6.432  -47.302 1.00 37.73  ? 171 HIS A C   1 
ATOM   618  O O   . HIS A 1 90  ? 40.973 -6.455  -48.488 1.00 39.14  ? 171 HIS A O   1 
ATOM   619  C CB  . HIS A 1 90  ? 41.839 -4.866  -45.753 1.00 34.76  ? 171 HIS A CB  1 
ATOM   620  C CG  . HIS A 1 90  ? 43.077 -5.071  -46.562 1.00 35.69  ? 171 HIS A CG  1 
ATOM   621  N ND1 . HIS A 1 90  ? 43.390 -4.286  -47.650 1.00 35.77  ? 171 HIS A ND1 1 
ATOM   622  C CD2 . HIS A 1 90  ? 44.033 -6.027  -46.501 1.00 36.23  ? 171 HIS A CD2 1 
ATOM   623  C CE1 . HIS A 1 90  ? 44.479 -4.754  -48.229 1.00 37.08  ? 171 HIS A CE1 1 
ATOM   624  N NE2 . HIS A 1 90  ? 44.889 -5.810  -47.552 1.00 38.96  ? 171 HIS A NE2 1 
ATOM   625  N N   . ARG A 1 91  ? 40.386 -7.532  -46.607 1.00 37.96  ? 172 ARG A N   1 
ATOM   626  C CA  . ARG A 1 91  ? 40.425 -8.841  -47.223 1.00 41.78  ? 172 ARG A CA  1 
ATOM   627  C C   . ARG A 1 91  ? 39.281 -9.683  -46.684 1.00 42.50  ? 172 ARG A C   1 
ATOM   628  O O   . ARG A 1 91  ? 39.172 -9.903  -45.481 1.00 42.04  ? 172 ARG A O   1 
ATOM   629  C CB  . ARG A 1 91  ? 41.757 -9.521  -46.936 1.00 46.15  ? 172 ARG A CB  1 
ATOM   630  C CG  . ARG A 1 91  ? 41.902 -10.860 -47.613 1.00 52.60  ? 172 ARG A CG  1 
ATOM   631  C CD  . ARG A 1 91  ? 42.104 -11.962 -46.590 1.00 60.06  ? 172 ARG A CD  1 
ATOM   632  N NE  . ARG A 1 91  ? 43.287 -12.773 -46.883 1.00 65.49  ? 172 ARG A NE  1 
ATOM   633  C CZ  . ARG A 1 91  ? 44.544 -12.340 -46.790 1.00 68.56  ? 172 ARG A CZ  1 
ATOM   634  N NH1 . ARG A 1 91  ? 44.797 -11.092 -46.407 1.00 70.24  ? 172 ARG A NH1 1 
ATOM   635  N NH2 . ARG A 1 91  ? 45.553 -13.155 -47.086 1.00 68.70  ? 172 ARG A NH2 1 
ATOM   636  N N   . GLY A 1 92  ? 38.421 -10.153 -47.577 1.00 44.38  ? 173 GLY A N   1 
ATOM   637  C CA  . GLY A 1 92  ? 37.299 -10.943 -47.122 1.00 46.71  ? 173 GLY A CA  1 
ATOM   638  C C   . GLY A 1 92  ? 36.879 -12.116 -47.981 1.00 49.00  ? 173 GLY A C   1 
ATOM   639  O O   . GLY A 1 92  ? 36.074 -11.972 -48.897 1.00 47.90  ? 173 GLY A O   1 
ATOM   640  N N   . HIS A 1 93  ? 37.443 -13.283 -47.690 1.00 52.09  ? 174 HIS A N   1 
ATOM   641  C CA  . HIS A 1 93  ? 37.072 -14.501 -48.393 1.00 53.94  ? 174 HIS A CA  1 
ATOM   642  C C   . HIS A 1 93  ? 36.175 -15.221 -47.397 1.00 53.78  ? 174 HIS A C   1 
ATOM   643  O O   . HIS A 1 93  ? 36.651 -15.755 -46.399 1.00 53.41  ? 174 HIS A O   1 
ATOM   644  C CB  . HIS A 1 93  ? 38.285 -15.380 -48.697 1.00 56.37  ? 174 HIS A CB  1 
ATOM   645  C CG  . HIS A 1 93  ? 37.933 -16.659 -49.395 1.00 60.02  ? 174 HIS A CG  1 
ATOM   646  N ND1 . HIS A 1 93  ? 37.645 -16.717 -50.742 1.00 61.50  ? 174 HIS A ND1 1 
ATOM   647  C CD2 . HIS A 1 93  ? 37.761 -17.916 -48.919 1.00 60.78  ? 174 HIS A CD2 1 
ATOM   648  C CE1 . HIS A 1 93  ? 37.309 -17.954 -51.067 1.00 61.17  ? 174 HIS A CE1 1 
ATOM   649  N NE2 . HIS A 1 93  ? 37.370 -18.701 -49.979 1.00 60.71  ? 174 HIS A NE2 1 
ATOM   650  N N   . VAL A 1 94  ? 34.875 -15.196 -47.652 1.00 54.31  ? 175 VAL A N   1 
ATOM   651  C CA  . VAL A 1 94  ? 33.911 -15.848 -46.777 1.00 55.08  ? 175 VAL A CA  1 
ATOM   652  C C   . VAL A 1 94  ? 33.289 -16.978 -47.584 1.00 55.64  ? 175 VAL A C   1 
ATOM   653  O O   . VAL A 1 94  ? 32.632 -16.743 -48.597 1.00 56.01  ? 175 VAL A O   1 
ATOM   654  C CB  . VAL A 1 94  ? 32.815 -14.855 -46.318 1.00 55.11  ? 175 VAL A CB  1 
ATOM   655  C CG1 . VAL A 1 94  ? 31.873 -15.525 -45.322 1.00 53.31  ? 175 VAL A CG1 1 
ATOM   656  C CG2 . VAL A 1 94  ? 33.465 -13.627 -45.697 1.00 54.36  ? 175 VAL A CG2 1 
ATOM   657  N N   . ASP A 1 95  ? 33.518 -18.207 -47.140 1.00 56.96  ? 176 ASP A N   1 
ATOM   658  C CA  . ASP A 1 95  ? 33.001 -19.368 -47.843 1.00 59.09  ? 176 ASP A CA  1 
ATOM   659  C C   . ASP A 1 95  ? 32.358 -20.338 -46.861 1.00 58.87  ? 176 ASP A C   1 
ATOM   660  O O   . ASP A 1 95  ? 32.970 -21.320 -46.437 1.00 56.97  ? 176 ASP A O   1 
ATOM   661  C CB  . ASP A 1 95  ? 34.142 -20.042 -48.606 1.00 62.39  ? 176 ASP A CB  1 
ATOM   662  C CG  . ASP A 1 95  ? 33.662 -21.149 -49.511 1.00 65.10  ? 176 ASP A CG  1 
ATOM   663  O OD1 . ASP A 1 95  ? 32.529 -21.042 -50.030 1.00 65.85  ? 176 ASP A OD1 1 
ATOM   664  O OD2 . ASP A 1 95  ? 34.428 -22.116 -49.716 1.00 67.26  ? 176 ASP A OD2 1 
ATOM   665  N N   . PRO A 1 96  ? 31.104 -20.058 -46.478 1.00 59.04  ? 177 PRO A N   1 
ATOM   666  C CA  . PRO A 1 96  ? 30.356 -20.894 -45.540 1.00 59.91  ? 177 PRO A CA  1 
ATOM   667  C C   . PRO A 1 96  ? 30.104 -22.301 -46.086 1.00 61.43  ? 177 PRO A C   1 
ATOM   668  O O   . PRO A 1 96  ? 29.910 -23.252 -45.323 1.00 60.57  ? 177 PRO A O   1 
ATOM   669  C CB  . PRO A 1 96  ? 29.072 -20.093 -45.323 1.00 59.03  ? 177 PRO A CB  1 
ATOM   670  C CG  . PRO A 1 96  ? 28.896 -19.388 -46.636 1.00 58.24  ? 177 PRO A CG  1 
ATOM   671  C CD  . PRO A 1 96  ? 30.286 -18.922 -46.941 1.00 57.74  ? 177 PRO A CD  1 
ATOM   672  N N   . ALA A 1 97  ? 30.121 -22.423 -47.411 1.00 63.00  ? 178 ALA A N   1 
ATOM   673  C CA  . ALA A 1 97  ? 29.898 -23.702 -48.073 1.00 65.87  ? 178 ALA A CA  1 
ATOM   674  C C   . ALA A 1 97  ? 31.000 -24.695 -47.714 1.00 68.67  ? 178 ALA A C   1 
ATOM   675  O O   . ALA A 1 97  ? 30.712 -25.817 -47.288 1.00 70.21  ? 178 ALA A O   1 
ATOM   676  C CB  . ALA A 1 97  ? 29.841 -23.504 -49.575 1.00 66.31  ? 178 ALA A CB  1 
ATOM   677  N N   . ASN A 1 98  ? 32.257 -24.290 -47.902 1.00 70.08  ? 179 ASN A N   1 
ATOM   678  C CA  . ASN A 1 98  ? 33.388 -25.151 -47.566 1.00 70.75  ? 179 ASN A CA  1 
ATOM   679  C C   . ASN A 1 98  ? 33.879 -24.824 -46.165 1.00 71.43  ? 179 ASN A C   1 
ATOM   680  O O   . ASN A 1 98  ? 35.025 -25.076 -45.811 1.00 71.61  ? 179 ASN A O   1 
ATOM   681  C CB  . ASN A 1 98  ? 34.516 -25.000 -48.582 1.00 71.46  ? 179 ASN A CB  1 
ATOM   682  C CG  . ASN A 1 98  ? 34.146 -25.554 -49.949 1.00 73.62  ? 179 ASN A CG  1 
ATOM   683  O OD1 . ASN A 1 98  ? 33.773 -26.724 -50.080 1.00 74.46  ? 179 ASN A OD1 1 
ATOM   684  N ND2 . ASN A 1 98  ? 34.254 -24.715 -50.976 1.00 73.31  ? 179 ASN A ND2 1 
ATOM   685  N N   . ASP A 1 99  ? 32.969 -24.229 -45.398 1.00 73.07  ? 180 ASP A N   1 
ATOM   686  C CA  . ASP A 1 99  ? 33.123 -23.855 -43.992 1.00 74.83  ? 180 ASP A CA  1 
ATOM   687  C C   . ASP A 1 99  ? 34.372 -23.092 -43.535 1.00 75.36  ? 180 ASP A C   1 
ATOM   688  O O   . ASP A 1 99  ? 34.799 -23.238 -42.390 1.00 75.59  ? 180 ASP A O   1 
ATOM   689  C CB  . ASP A 1 99  ? 32.949 -25.109 -43.119 1.00 76.89  ? 180 ASP A CB  1 
ATOM   690  C CG  . ASP A 1 99  ? 31.752 -25.971 -43.545 1.00 79.03  ? 180 ASP A CG  1 
ATOM   691  O OD1 . ASP A 1 99  ? 31.291 -26.815 -42.738 1.00 79.14  ? 180 ASP A OD1 1 
ATOM   692  O OD2 . ASP A 1 99  ? 31.282 -25.813 -44.692 1.00 80.33  ? 180 ASP A OD2 1 
ATOM   693  N N   . THR A 1 100 ? 34.965 -22.287 -44.413 1.00 74.52  ? 181 THR A N   1 
ATOM   694  C CA  . THR A 1 100 ? 36.141 -21.499 -44.039 1.00 73.44  ? 181 THR A CA  1 
ATOM   695  C C   . THR A 1 100 ? 36.003 -20.030 -44.416 1.00 70.94  ? 181 THR A C   1 
ATOM   696  O O   . THR A 1 100 ? 35.033 -19.611 -45.026 1.00 70.22  ? 181 THR A O   1 
ATOM   697  C CB  . THR A 1 100 ? 37.443 -21.992 -44.716 1.00 74.89  ? 181 THR A CB  1 
ATOM   698  O OG1 . THR A 1 100 ? 37.223 -22.119 -46.131 1.00 74.56  ? 181 THR A OG1 1 
ATOM   699  C CG2 . THR A 1 100 ? 37.930 -23.308 -44.095 1.00 75.27  ? 181 THR A CG2 1 
ATOM   700  N N   . PHE A 1 101 ? 37.012 -19.264 -44.028 1.00 68.22  ? 182 PHE A N   1 
ATOM   701  C CA  . PHE A 1 101 ? 37.098 -17.848 -44.308 1.00 64.85  ? 182 PHE A CA  1 
ATOM   702  C C   . PHE A 1 101 ? 38.528 -17.367 -44.092 1.00 62.23  ? 182 PHE A C   1 
ATOM   703  O O   . PHE A 1 101 ? 39.275 -17.927 -43.301 1.00 62.34  ? 182 PHE A O   1 
ATOM   704  C CB  . PHE A 1 101 ? 36.155 -17.054 -43.399 1.00 64.41  ? 182 PHE A CB  1 
ATOM   705  C CG  . PHE A 1 101 ? 36.499 -17.124 -41.933 1.00 64.54  ? 182 PHE A CG  1 
ATOM   706  C CD1 . PHE A 1 101 ? 35.890 -18.065 -41.108 1.00 64.77  ? 182 PHE A CD1 1 
ATOM   707  C CD2 . PHE A 1 101 ? 37.414 -16.230 -41.374 1.00 65.20  ? 182 PHE A CD2 1 
ATOM   708  C CE1 . PHE A 1 101 ? 36.173 -18.118 -39.733 1.00 65.20  ? 182 PHE A CE1 1 
ATOM   709  C CE2 . PHE A 1 101 ? 37.715 -16.264 -40.006 1.00 65.64  ? 182 PHE A CE2 1 
ATOM   710  C CZ  . PHE A 1 101 ? 37.092 -17.214 -39.176 1.00 64.61  ? 182 PHE A CZ  1 
ATOM   711  N N   . ASP A 1 102 ? 38.895 -16.324 -44.818 1.00 58.08  ? 183 ASP A N   1 
ATOM   712  C CA  . ASP A 1 102 ? 40.207 -15.714 -44.706 1.00 54.19  ? 183 ASP A CA  1 
ATOM   713  C C   . ASP A 1 102 ? 39.905 -14.240 -44.613 1.00 49.67  ? 183 ASP A C   1 
ATOM   714  O O   . ASP A 1 102 ? 39.606 -13.609 -45.603 1.00 49.40  ? 183 ASP A O   1 
ATOM   715  C CB  . ASP A 1 102 ? 41.047 -15.992 -45.953 1.00 57.13  ? 183 ASP A CB  1 
ATOM   716  C CG  . ASP A 1 102 ? 42.480 -15.483 -45.820 1.00 58.85  ? 183 ASP A CG  1 
ATOM   717  O OD1 . ASP A 1 102 ? 42.761 -14.731 -44.865 1.00 58.46  ? 183 ASP A OD1 1 
ATOM   718  O OD2 . ASP A 1 102 ? 43.327 -15.827 -46.674 1.00 60.58  ? 183 ASP A OD2 1 
ATOM   719  N N   . ILE A 1 103 ? 39.991 -13.692 -43.415 1.00 47.01  ? 184 ILE A N   1 
ATOM   720  C CA  . ILE A 1 103 ? 39.679 -12.287 -43.211 1.00 46.22  ? 184 ILE A CA  1 
ATOM   721  C C   . ILE A 1 103 ? 40.736 -11.383 -42.595 1.00 44.20  ? 184 ILE A C   1 
ATOM   722  O O   . ILE A 1 103 ? 41.433 -11.757 -41.659 1.00 44.42  ? 184 ILE A O   1 
ATOM   723  C CB  . ILE A 1 103 ? 38.413 -12.151 -42.353 1.00 48.10  ? 184 ILE A CB  1 
ATOM   724  C CG1 . ILE A 1 103 ? 37.234 -12.766 -43.090 1.00 50.83  ? 184 ILE A CG1 1 
ATOM   725  C CG2 . ILE A 1 103 ? 38.138 -10.694 -42.032 1.00 48.77  ? 184 ILE A CG2 1 
ATOM   726  C CD1 . ILE A 1 103 ? 36.032 -12.922 -42.213 1.00 54.40  ? 184 ILE A CD1 1 
ATOM   727  N N   . ASP A 1 104 ? 40.837 -10.181 -43.149 1.00 42.51  ? 185 ASP A N   1 
ATOM   728  C CA  . ASP A 1 104 ? 41.739 -9.158  -42.645 1.00 40.14  ? 185 ASP A CA  1 
ATOM   729  C C   . ASP A 1 104 ? 40.753 -8.087  -42.167 1.00 38.22  ? 185 ASP A C   1 
ATOM   730  O O   . ASP A 1 104 ? 40.250 -7.298  -42.966 1.00 38.94  ? 185 ASP A O   1 
ATOM   731  C CB  . ASP A 1 104 ? 42.617 -8.612  -43.761 1.00 40.70  ? 185 ASP A CB  1 
ATOM   732  C CG  . ASP A 1 104 ? 43.733 -7.747  -43.233 1.00 42.85  ? 185 ASP A CG  1 
ATOM   733  O OD1 . ASP A 1 104 ? 43.451 -6.920  -42.341 1.00 39.05  ? 185 ASP A OD1 1 
ATOM   734  O OD2 . ASP A 1 104 ? 44.886 -7.895  -43.706 1.00 46.65  ? 185 ASP A OD2 1 
ATOM   735  N N   . PRO A 1 105 ? 40.466 -8.057  -40.853 1.00 36.59  ? 186 PRO A N   1 
ATOM   736  C CA  . PRO A 1 105 ? 39.542 -7.140  -40.177 1.00 36.27  ? 186 PRO A CA  1 
ATOM   737  C C   . PRO A 1 105 ? 39.719 -5.643  -40.379 1.00 36.51  ? 186 PRO A C   1 
ATOM   738  O O   . PRO A 1 105 ? 38.832 -4.868  -40.020 1.00 37.45  ? 186 PRO A O   1 
ATOM   739  C CB  . PRO A 1 105 ? 39.671 -7.545  -38.712 1.00 36.03  ? 186 PRO A CB  1 
ATOM   740  C CG  . PRO A 1 105 ? 41.113 -7.906  -38.611 1.00 35.84  ? 186 PRO A CG  1 
ATOM   741  C CD  . PRO A 1 105 ? 41.310 -8.749  -39.859 1.00 36.53  ? 186 PRO A CD  1 
ATOM   742  N N   . MET A 1 106 ? 40.847 -5.222  -40.939 1.00 36.34  ? 187 MET A N   1 
ATOM   743  C CA  . MET A 1 106 ? 41.049 -3.800  -41.162 1.00 36.56  ? 187 MET A CA  1 
ATOM   744  C C   . MET A 1 106 ? 39.901 -3.298  -42.040 1.00 37.60  ? 187 MET A C   1 
ATOM   745  O O   . MET A 1 106 ? 39.617 -3.875  -43.092 1.00 37.65  ? 187 MET A O   1 
ATOM   746  C CB  . MET A 1 106 ? 42.382 -3.524  -41.861 1.00 35.30  ? 187 MET A CB  1 
ATOM   747  C CG  . MET A 1 106 ? 42.635 -2.024  -42.024 1.00 37.12  ? 187 MET A CG  1 
ATOM   748  S SD  . MET A 1 106 ? 44.172 -1.577  -42.830 1.00 38.09  ? 187 MET A SD  1 
ATOM   749  C CE  . MET A 1 106 ? 45.375 -2.071  -41.540 1.00 42.87  ? 187 MET A CE  1 
ATOM   750  N N   . VAL A 1 107 ? 39.241 -2.228  -41.607 1.00 36.21  ? 188 VAL A N   1 
ATOM   751  C CA  . VAL A 1 107 ? 38.125 -1.683  -42.366 1.00 35.37  ? 188 VAL A CA  1 
ATOM   752  C C   . VAL A 1 107 ? 38.544 -0.615  -43.360 1.00 35.28  ? 188 VAL A C   1 
ATOM   753  O O   . VAL A 1 107 ? 39.038 0.439   -42.982 1.00 36.04  ? 188 VAL A O   1 
ATOM   754  C CB  . VAL A 1 107 ? 37.051 -1.074  -41.440 1.00 34.86  ? 188 VAL A CB  1 
ATOM   755  C CG1 . VAL A 1 107 ? 35.914 -0.505  -42.279 1.00 33.60  ? 188 VAL A CG1 1 
ATOM   756  C CG2 . VAL A 1 107 ? 36.530 -2.126  -40.480 1.00 30.52  ? 188 VAL A CG2 1 
ATOM   757  N N   . VAL A 1 108 ? 38.314 -0.888  -44.636 1.00 35.65  ? 189 VAL A N   1 
ATOM   758  C CA  . VAL A 1 108 ? 38.655 0.045   -45.694 1.00 35.23  ? 189 VAL A CA  1 
ATOM   759  C C   . VAL A 1 108 ? 37.439 0.885   -46.102 1.00 36.09  ? 189 VAL A C   1 
ATOM   760  O O   . VAL A 1 108 ? 36.331 0.373   -46.244 1.00 34.91  ? 189 VAL A O   1 
ATOM   761  C CB  . VAL A 1 108 ? 39.195 -0.713  -46.929 1.00 36.18  ? 189 VAL A CB  1 
ATOM   762  C CG1 . VAL A 1 108 ? 39.475 0.252   -48.066 1.00 35.11  ? 189 VAL A CG1 1 
ATOM   763  C CG2 . VAL A 1 108 ? 40.461 -1.470  -46.548 1.00 37.41  ? 189 VAL A CG2 1 
ATOM   764  N N   . THR A 1 109 ? 37.665 2.180   -46.286 1.00 35.32  ? 190 THR A N   1 
ATOM   765  C CA  . THR A 1 109 ? 36.614 3.104   -46.675 1.00 35.21  ? 190 THR A CA  1 
ATOM   766  C C   . THR A 1 109 ? 36.787 3.591   -48.113 1.00 35.53  ? 190 THR A C   1 
ATOM   767  O O   . THR A 1 109 ? 37.856 4.056   -48.496 1.00 37.11  ? 190 THR A O   1 
ATOM   768  C CB  . THR A 1 109 ? 36.603 4.340   -45.741 1.00 34.54  ? 190 THR A CB  1 
ATOM   769  O OG1 . THR A 1 109 ? 36.430 3.909   -44.388 1.00 35.85  ? 190 THR A OG1 1 
ATOM   770  C CG2 . THR A 1 109 ? 35.462 5.285   -46.101 1.00 34.47  ? 190 THR A CG2 1 
ATOM   771  N N   . ASP A 1 110 ? 35.736 3.472   -48.912 1.00 35.93  ? 191 ASP A N   1 
ATOM   772  C CA  . ASP A 1 110 ? 35.780 3.946   -50.285 1.00 38.69  ? 191 ASP A CA  1 
ATOM   773  C C   . ASP A 1 110 ? 34.619 4.920   -50.473 1.00 39.73  ? 191 ASP A C   1 
ATOM   774  O O   . ASP A 1 110 ? 33.455 4.537   -50.353 1.00 39.69  ? 191 ASP A O   1 
ATOM   775  C CB  . ASP A 1 110 ? 35.666 2.781   -51.269 1.00 40.08  ? 191 ASP A CB  1 
ATOM   776  C CG  . ASP A 1 110 ? 35.634 3.250   -52.706 1.00 43.33  ? 191 ASP A CG  1 
ATOM   777  O OD1 . ASP A 1 110 ? 35.982 4.421   -52.956 1.00 45.98  ? 191 ASP A OD1 1 
ATOM   778  O OD2 . ASP A 1 110 ? 35.268 2.456   -53.591 1.00 46.65  ? 191 ASP A OD2 1 
ATOM   779  N N   . CYS A 1 111 ? 34.935 6.183   -50.745 1.00 41.06  ? 192 CYS A N   1 
ATOM   780  C CA  . CYS A 1 111 ? 33.903 7.198   -50.912 1.00 44.06  ? 192 CYS A CA  1 
ATOM   781  C C   . CYS A 1 111 ? 33.776 7.771   -52.308 1.00 45.13  ? 192 CYS A C   1 
ATOM   782  O O   . CYS A 1 111 ? 34.737 7.835   -53.072 1.00 46.47  ? 192 CYS A O   1 
ATOM   783  C CB  . CYS A 1 111 ? 34.134 8.380   -49.976 1.00 43.40  ? 192 CYS A CB  1 
ATOM   784  S SG  . CYS A 1 111 ? 34.166 8.080   -48.182 1.00 51.28  ? 192 CYS A SG  1 
ATOM   785  N N   . ILE A 1 112 ? 32.564 8.211   -52.616 1.00 46.61  ? 193 ILE A N   1 
ATOM   786  C CA  . ILE A 1 112 ? 32.254 8.838   -53.886 1.00 47.22  ? 193 ILE A CA  1 
ATOM   787  C C   . ILE A 1 112 ? 31.702 10.213  -53.511 1.00 48.77  ? 193 ILE A C   1 
ATOM   788  O O   . ILE A 1 112 ? 30.710 10.309  -52.791 1.00 49.71  ? 193 ILE A O   1 
ATOM   789  C CB  . ILE A 1 112 ? 31.182 8.054   -54.647 1.00 46.34  ? 193 ILE A CB  1 
ATOM   790  C CG1 . ILE A 1 112 ? 31.619 6.596   -54.807 1.00 47.37  ? 193 ILE A CG1 1 
ATOM   791  C CG2 . ILE A 1 112 ? 30.949 8.690   -56.001 1.00 46.84  ? 193 ILE A CG2 1 
ATOM   792  C CD1 . ILE A 1 112 ? 30.644 5.735   -55.610 1.00 46.36  ? 193 ILE A CD1 1 
ATOM   793  N N   . GLN A 1 113 ? 32.357 11.271  -53.974 1.00 51.55  ? 194 GLN A N   1 
ATOM   794  C CA  . GLN A 1 113 ? 31.922 12.632  -53.677 1.00 54.50  ? 194 GLN A CA  1 
ATOM   795  C C   . GLN A 1 113 ? 30.873 13.082  -54.680 1.00 54.73  ? 194 GLN A C   1 
ATOM   796  O O   . GLN A 1 113 ? 31.012 12.854  -55.883 1.00 54.33  ? 194 GLN A O   1 
ATOM   797  C CB  . GLN A 1 113 ? 33.107 13.601  -53.727 1.00 56.87  ? 194 GLN A CB  1 
ATOM   798  C CG  . GLN A 1 113 ? 34.222 13.293  -52.743 1.00 62.92  ? 194 GLN A CG  1 
ATOM   799  C CD  . GLN A 1 113 ? 33.749 13.302  -51.299 1.00 66.48  ? 194 GLN A CD  1 
ATOM   800  O OE1 . GLN A 1 113 ? 32.983 14.182  -50.891 1.00 67.55  ? 194 GLN A OE1 1 
ATOM   801  N NE2 . GLN A 1 113 ? 34.216 12.330  -50.511 1.00 66.50  ? 194 GLN A NE2 1 
ATOM   802  N N   . VAL A 1 114 ? 29.821 13.718  -54.178 1.00 55.70  ? 195 VAL A N   1 
ATOM   803  C CA  . VAL A 1 114 ? 28.756 14.213  -55.032 1.00 58.06  ? 195 VAL A CA  1 
ATOM   804  C C   . VAL A 1 114 ? 28.584 15.715  -54.850 1.00 60.89  ? 195 VAL A C   1 
ATOM   805  O O   . VAL A 1 114 ? 28.290 16.193  -53.753 1.00 60.60  ? 195 VAL A O   1 
ATOM   806  C CB  . VAL A 1 114 ? 27.413 13.504  -54.730 1.00 57.56  ? 195 VAL A CB  1 
ATOM   807  C CG1 . VAL A 1 114 ? 26.286 14.151  -55.529 1.00 55.93  ? 195 VAL A CG1 1 
ATOM   808  C CG2 . VAL A 1 114 ? 27.517 12.022  -55.077 1.00 55.64  ? 195 VAL A CG2 1 
ATOM   809  N N   . ASP A 1 115 ? 28.796 16.458  -55.931 1.00 65.00  ? 196 ASP A N   1 
ATOM   810  C CA  . ASP A 1 115 ? 28.635 17.907  -55.892 1.00 68.76  ? 196 ASP A CA  1 
ATOM   811  C C   . ASP A 1 115 ? 27.325 18.324  -56.533 1.00 70.42  ? 196 ASP A C   1 
ATOM   812  O O   . ASP A 1 115 ? 27.110 18.110  -57.737 1.00 70.24  ? 196 ASP A O   1 
ATOM   813  C CB  . ASP A 1 115 ? 29.805 18.627  -56.572 1.00 70.78  ? 196 ASP A CB  1 
ATOM   814  C CG  . ASP A 1 115 ? 31.082 18.536  -55.765 1.00 73.44  ? 196 ASP A CG  1 
ATOM   815  O OD1 . ASP A 1 115 ? 30.979 18.686  -54.531 1.00 74.06  ? 196 ASP A OD1 1 
ATOM   816  O OD2 . ASP A 1 115 ? 32.174 18.331  -56.348 1.00 75.27  ? 196 ASP A OD2 1 
ATOM   817  N N   . PRO A 1 116 ? 26.439 18.939  -55.725 1.00 71.89  ? 197 PRO A N   1 
ATOM   818  C CA  . PRO A 1 116 ? 25.111 19.428  -56.112 1.00 74.65  ? 197 PRO A CA  1 
ATOM   819  C C   . PRO A 1 116 ? 24.985 19.970  -57.534 1.00 77.74  ? 197 PRO A C   1 
ATOM   820  O O   . PRO A 1 116 ? 23.995 19.714  -58.212 1.00 77.98  ? 197 PRO A O   1 
ATOM   821  C CB  . PRO A 1 116 ? 24.819 20.475  -55.054 1.00 73.58  ? 197 PRO A CB  1 
ATOM   822  C CG  . PRO A 1 116 ? 25.396 19.841  -53.814 1.00 72.55  ? 197 PRO A CG  1 
ATOM   823  C CD  . PRO A 1 116 ? 26.757 19.375  -54.347 1.00 71.51  ? 197 PRO A CD  1 
ATOM   824  N N   . PRO A 1 117 ? 25.969 20.750  -57.999 1.00 80.75  ? 198 PRO A N   1 
ATOM   825  C CA  . PRO A 1 117 ? 25.783 21.230  -59.371 1.00 83.63  ? 198 PRO A CA  1 
ATOM   826  C C   . PRO A 1 117 ? 25.855 20.113  -60.417 1.00 85.84  ? 198 PRO A C   1 
ATOM   827  O O   . PRO A 1 117 ? 26.652 20.175  -61.351 1.00 86.21  ? 198 PRO A O   1 
ATOM   828  C CB  . PRO A 1 117 ? 26.892 22.272  -59.526 1.00 84.02  ? 198 PRO A CB  1 
ATOM   829  C CG  . PRO A 1 117 ? 26.948 22.869  -58.128 1.00 83.85  ? 198 PRO A CG  1 
ATOM   830  C CD  . PRO A 1 117 ? 26.902 21.618  -57.258 1.00 81.63  ? 198 PRO A CD  1 
ATOM   831  N N   . GLU A 1 118 ? 25.017 19.093  -60.243 1.00 87.23  ? 199 GLU A N   1 
ATOM   832  C CA  . GLU A 1 118 ? 24.934 17.966  -61.173 1.00 88.48  ? 199 GLU A CA  1 
ATOM   833  C C   . GLU A 1 118 ? 23.478 17.531  -61.360 1.00 88.73  ? 199 GLU A C   1 
ATOM   834  O O   . GLU A 1 118 ? 22.968 17.481  -62.485 1.00 89.74  ? 199 GLU A O   1 
ATOM   835  C CB  . GLU A 1 118 ? 25.767 16.773  -60.678 1.00 88.92  ? 199 GLU A CB  1 
ATOM   836  C CG  . GLU A 1 118 ? 25.446 15.448  -61.385 1.00 90.03  ? 199 GLU A CG  1 
ATOM   837  C CD  . GLU A 1 118 ? 25.412 15.571  -62.904 1.00 91.10  ? 199 GLU A CD  1 
ATOM   838  O OE1 . GLU A 1 118 ? 26.402 16.078  -63.477 1.00 91.06  ? 199 GLU A OE1 1 
ATOM   839  O OE2 . GLU A 1 118 ? 24.401 15.156  -63.523 1.00 90.80  ? 199 GLU A OE2 1 
ATOM   840  N N   . TYR A 1 137 ? 27.746 8.525   -59.799 1.00 54.79  ? 218 TYR A N   1 
ATOM   841  C CA  . TYR A 1 137 ? 27.706 7.826   -58.520 1.00 55.78  ? 218 TYR A CA  1 
ATOM   842  C C   . TYR A 1 137 ? 26.833 6.589   -58.623 1.00 55.60  ? 218 TYR A C   1 
ATOM   843  O O   . TYR A 1 137 ? 26.841 5.744   -57.731 1.00 54.23  ? 218 TYR A O   1 
ATOM   844  C CB  . TYR A 1 137 ? 27.159 8.739   -57.416 1.00 56.49  ? 218 TYR A CB  1 
ATOM   845  C CG  . TYR A 1 137 ? 25.684 9.056   -57.545 1.00 57.44  ? 218 TYR A CG  1 
ATOM   846  C CD1 . TYR A 1 137 ? 24.716 8.185   -57.056 1.00 57.75  ? 218 TYR A CD1 1 
ATOM   847  C CD2 . TYR A 1 137 ? 25.258 10.216  -58.183 1.00 58.87  ? 218 TYR A CD2 1 
ATOM   848  C CE1 . TYR A 1 137 ? 23.358 8.461   -57.202 1.00 59.34  ? 218 TYR A CE1 1 
ATOM   849  C CE2 . TYR A 1 137 ? 23.911 10.500  -58.335 1.00 59.82  ? 218 TYR A CE2 1 
ATOM   850  C CZ  . TYR A 1 137 ? 22.968 9.620   -57.843 1.00 60.83  ? 218 TYR A CZ  1 
ATOM   851  O OH  . TYR A 1 137 ? 21.636 9.903   -58.002 1.00 63.14  ? 218 TYR A OH  1 
ATOM   852  N N   . LYS A 1 138 ? 26.070 6.492   -59.708 1.00 56.60  ? 219 LYS A N   1 
ATOM   853  C CA  . LYS A 1 138 ? 25.199 5.339   -59.915 1.00 56.32  ? 219 LYS A CA  1 
ATOM   854  C C   . LYS A 1 138 ? 25.969 4.113   -60.381 1.00 55.37  ? 219 LYS A C   1 
ATOM   855  O O   . LYS A 1 138 ? 25.397 3.029   -60.500 1.00 54.52  ? 219 LYS A O   1 
ATOM   856  C CB  . LYS A 1 138 ? 24.100 5.649   -60.931 1.00 58.39  ? 219 LYS A CB  1 
ATOM   857  C CG  . LYS A 1 138 ? 22.940 6.458   -60.380 1.00 60.83  ? 219 LYS A CG  1 
ATOM   858  C CD  . LYS A 1 138 ? 21.699 6.269   -61.241 1.00 64.19  ? 219 LYS A CD  1 
ATOM   859  C CE  . LYS A 1 138 ? 20.878 5.063   -60.802 1.00 65.31  ? 219 LYS A CE  1 
ATOM   860  N NZ  . LYS A 1 138 ? 20.133 5.355   -59.548 1.00 66.80  ? 219 LYS A NZ  1 
ATOM   861  N N   . ASN A 1 139 ? 27.259 4.281   -60.657 1.00 54.97  ? 220 ASN A N   1 
ATOM   862  C CA  . ASN A 1 139 ? 28.079 3.150   -61.087 1.00 55.30  ? 220 ASN A CA  1 
ATOM   863  C C   . ASN A 1 139 ? 28.508 2.355   -59.858 1.00 53.34  ? 220 ASN A C   1 
ATOM   864  O O   . ASN A 1 139 ? 29.162 1.319   -59.964 1.00 54.34  ? 220 ASN A O   1 
ATOM   865  C CB  . ASN A 1 139 ? 29.315 3.629   -61.851 1.00 57.37  ? 220 ASN A CB  1 
ATOM   866  C CG  . ASN A 1 139 ? 28.961 4.308   -63.162 1.00 60.35  ? 220 ASN A CG  1 
ATOM   867  O OD1 . ASN A 1 139 ? 28.103 3.830   -63.910 1.00 59.84  ? 220 ASN A OD1 1 
ATOM   868  N ND2 . ASN A 1 139 ? 29.632 5.423   -63.453 1.00 60.76  ? 220 ASN A ND2 1 
ATOM   869  N N   . LEU A 1 140 ? 28.120 2.866   -58.695 1.00 49.38  ? 221 LEU A N   1 
ATOM   870  C CA  . LEU A 1 140 ? 28.419 2.263   -57.407 1.00 46.90  ? 221 LEU A CA  1 
ATOM   871  C C   . LEU A 1 140 ? 28.262 0.742   -57.439 1.00 45.21  ? 221 LEU A C   1 
ATOM   872  O O   . LEU A 1 140 ? 27.250 0.225   -57.913 1.00 47.39  ? 221 LEU A O   1 
ATOM   873  C CB  . LEU A 1 140 ? 27.468 2.847   -56.354 1.00 45.98  ? 221 LEU A CB  1 
ATOM   874  C CG  . LEU A 1 140 ? 27.800 2.895   -54.856 1.00 44.82  ? 221 LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 140 ? 26.580 2.414   -54.099 1.00 44.09  ? 221 LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 140 ? 29.003 2.048   -54.505 1.00 45.85  ? 221 LEU A CD2 1 
ATOM   877  N N   . THR A 1 141 ? 29.269 0.030   -56.944 1.00 42.16  ? 222 THR A N   1 
ATOM   878  C CA  . THR A 1 141 ? 29.215 -1.428  -56.877 1.00 39.39  ? 222 THR A CA  1 
ATOM   879  C C   . THR A 1 141 ? 29.621 -1.827  -55.472 1.00 38.92  ? 222 THR A C   1 
ATOM   880  O O   . THR A 1 141 ? 30.797 -1.738  -55.110 1.00 40.21  ? 222 THR A O   1 
ATOM   881  C CB  . THR A 1 141 ? 30.185 -2.093  -57.860 1.00 40.30  ? 222 THR A CB  1 
ATOM   882  O OG1 . THR A 1 141 ? 29.833 -1.729  -59.202 1.00 42.67  ? 222 THR A OG1 1 
ATOM   883  C CG2 . THR A 1 141 ? 30.118 -3.609  -57.720 1.00 37.91  ? 222 THR A CG2 1 
ATOM   884  N N   . LEU A 1 142 ? 28.648 -2.254  -54.679 1.00 37.55  ? 223 LEU A N   1 
ATOM   885  C CA  . LEU A 1 142 ? 28.904 -2.647  -53.299 1.00 37.64  ? 223 LEU A CA  1 
ATOM   886  C C   . LEU A 1 142 ? 29.559 -4.020  -53.197 1.00 39.70  ? 223 LEU A C   1 
ATOM   887  O O   . LEU A 1 142 ? 29.237 -4.932  -53.964 1.00 40.88  ? 223 LEU A O   1 
ATOM   888  C CB  . LEU A 1 142 ? 27.593 -2.646  -52.504 1.00 34.86  ? 223 LEU A CB  1 
ATOM   889  C CG  . LEU A 1 142 ? 26.880 -1.293  -52.399 1.00 33.84  ? 223 LEU A CG  1 
ATOM   890  C CD1 . LEU A 1 142 ? 25.538 -1.454  -51.693 1.00 31.61  ? 223 LEU A CD1 1 
ATOM   891  C CD2 . LEU A 1 142 ? 27.772 -0.312  -51.656 1.00 27.37  ? 223 LEU A CD2 1 
ATOM   892  N N   . LYS A 1 143 ? 30.483 -4.159  -52.247 1.00 40.00  ? 224 LYS A N   1 
ATOM   893  C CA  . LYS A 1 143 ? 31.176 -5.429  -52.028 1.00 38.76  ? 224 LYS A CA  1 
ATOM   894  C C   . LYS A 1 143 ? 30.430 -6.183  -50.928 1.00 37.30  ? 224 LYS A C   1 
ATOM   895  O O   . LYS A 1 143 ? 30.911 -6.345  -49.807 1.00 34.35  ? 224 LYS A O   1 
ATOM   896  C CB  . LYS A 1 143 ? 32.641 -5.170  -51.643 1.00 38.93  ? 224 LYS A CB  1 
ATOM   897  C CG  . LYS A 1 143 ? 33.419 -4.423  -52.734 1.00 37.37  ? 224 LYS A CG  1 
ATOM   898  C CD  . LYS A 1 143 ? 34.893 -4.312  -52.402 1.00 36.73  ? 224 LYS A CD  1 
ATOM   899  C CE  . LYS A 1 143 ? 35.614 -3.326  -53.329 1.00 37.37  ? 224 LYS A CE  1 
ATOM   900  N NZ  . LYS A 1 143 ? 35.607 -3.720  -54.765 1.00 36.84  ? 224 LYS A NZ  1 
ATOM   901  N N   . PHE A 1 144 ? 29.227 -6.621  -51.288 1.00 37.10  ? 225 PHE A N   1 
ATOM   902  C CA  . PHE A 1 144 ? 28.317 -7.346  -50.406 1.00 37.09  ? 225 PHE A CA  1 
ATOM   903  C C   . PHE A 1 144 ? 28.918 -8.468  -49.563 1.00 37.89  ? 225 PHE A C   1 
ATOM   904  O O   . PHE A 1 144 ? 28.566 -8.623  -48.392 1.00 38.80  ? 225 PHE A O   1 
ATOM   905  C CB  . PHE A 1 144 ? 27.157 -7.925  -51.229 1.00 34.97  ? 225 PHE A CB  1 
ATOM   906  C CG  . PHE A 1 144 ? 26.275 -6.887  -51.859 1.00 33.45  ? 225 PHE A CG  1 
ATOM   907  C CD1 . PHE A 1 144 ? 25.503 -6.040  -51.071 1.00 32.20  ? 225 PHE A CD1 1 
ATOM   908  C CD2 . PHE A 1 144 ? 26.214 -6.756  -53.247 1.00 33.35  ? 225 PHE A CD2 1 
ATOM   909  C CE1 . PHE A 1 144 ? 24.682 -5.077  -51.657 1.00 30.60  ? 225 PHE A CE1 1 
ATOM   910  C CE2 . PHE A 1 144 ? 25.400 -5.801  -53.837 1.00 29.57  ? 225 PHE A CE2 1 
ATOM   911  C CZ  . PHE A 1 144 ? 24.633 -4.961  -53.043 1.00 30.63  ? 225 PHE A CZ  1 
ATOM   912  N N   . HIS A 1 145 ? 29.811 -9.256  -50.150 1.00 39.72  ? 226 HIS A N   1 
ATOM   913  C CA  . HIS A 1 145 ? 30.411 -10.370 -49.422 1.00 41.31  ? 226 HIS A CA  1 
ATOM   914  C C   . HIS A 1 145 ? 31.218 -9.983  -48.180 1.00 41.61  ? 226 HIS A C   1 
ATOM   915  O O   . HIS A 1 145 ? 31.453 -10.820 -47.312 1.00 43.91  ? 226 HIS A O   1 
ATOM   916  C CB  . HIS A 1 145 ? 31.288 -11.210 -50.355 1.00 43.25  ? 226 HIS A CB  1 
ATOM   917  C CG  . HIS A 1 145 ? 32.460 -10.472 -50.924 1.00 46.24  ? 226 HIS A CG  1 
ATOM   918  N ND1 . HIS A 1 145 ? 32.328 -9.480  -51.873 1.00 47.62  ? 226 HIS A ND1 1 
ATOM   919  C CD2 . HIS A 1 145 ? 33.790 -10.605 -50.701 1.00 46.12  ? 226 HIS A CD2 1 
ATOM   920  C CE1 . HIS A 1 145 ? 33.527 -9.039  -52.214 1.00 47.99  ? 226 HIS A CE1 1 
ATOM   921  N NE2 . HIS A 1 145 ? 34.432 -9.705  -51.517 1.00 46.69  ? 226 HIS A NE2 1 
ATOM   922  N N   . LYS A 1 146 ? 31.633 -8.724  -48.084 1.00 39.28  ? 227 LYS A N   1 
ATOM   923  C CA  . LYS A 1 146 ? 32.420 -8.278  -46.937 1.00 37.71  ? 227 LYS A CA  1 
ATOM   924  C C   . LYS A 1 146 ? 32.089 -6.832  -46.556 1.00 36.60  ? 227 LYS A C   1 
ATOM   925  O O   . LYS A 1 146 ? 32.937 -6.092  -46.040 1.00 34.75  ? 227 LYS A O   1 
ATOM   926  C CB  . LYS A 1 146 ? 33.917 -8.415  -47.254 1.00 34.94  ? 227 LYS A CB  1 
ATOM   927  C CG  . LYS A 1 146 ? 34.341 -7.733  -48.544 1.00 33.63  ? 227 LYS A CG  1 
ATOM   928  C CD  . LYS A 1 146 ? 35.848 -7.837  -48.747 1.00 34.92  ? 227 LYS A CD  1 
ATOM   929  C CE  . LYS A 1 146 ? 36.313 -6.980  -49.918 1.00 34.42  ? 227 LYS A CE  1 
ATOM   930  N NZ  . LYS A 1 146 ? 37.797 -6.921  -49.994 1.00 36.28  ? 227 LYS A NZ  1 
ATOM   931  N N   . LEU A 1 147 ? 30.845 -6.444  -46.814 1.00 35.74  ? 228 LEU A N   1 
ATOM   932  C CA  . LEU A 1 147 ? 30.371 -5.096  -46.530 1.00 34.59  ? 228 LEU A CA  1 
ATOM   933  C C   . LEU A 1 147 ? 30.200 -4.861  -45.036 1.00 32.14  ? 228 LEU A C   1 
ATOM   934  O O   . LEU A 1 147 ? 29.568 -5.650  -44.353 1.00 33.59  ? 228 LEU A O   1 
ATOM   935  C CB  . LEU A 1 147 ? 29.040 -4.865  -47.244 1.00 33.52  ? 228 LEU A CB  1 
ATOM   936  C CG  . LEU A 1 147 ? 28.371 -3.493  -47.144 1.00 35.50  ? 228 LEU A CG  1 
ATOM   937  C CD1 . LEU A 1 147 ? 29.181 -2.462  -47.911 1.00 33.12  ? 228 LEU A CD1 1 
ATOM   938  C CD2 . LEU A 1 147 ? 26.951 -3.586  -47.716 1.00 33.64  ? 228 LEU A CD2 1 
ATOM   939  N N   . VAL A 1 148 ? 30.770 -3.773  -44.531 1.00 32.04  ? 229 VAL A N   1 
ATOM   940  C CA  . VAL A 1 148 ? 30.656 -3.435  -43.116 1.00 30.48  ? 229 VAL A CA  1 
ATOM   941  C C   . VAL A 1 148 ? 29.499 -2.448  -42.948 1.00 31.44  ? 229 VAL A C   1 
ATOM   942  O O   . VAL A 1 148 ? 28.738 -2.519  -41.987 1.00 32.63  ? 229 VAL A O   1 
ATOM   943  C CB  . VAL A 1 148 ? 31.975 -2.813  -42.590 1.00 29.37  ? 229 VAL A CB  1 
ATOM   944  C CG1 . VAL A 1 148 ? 31.793 -2.295  -41.182 1.00 24.47  ? 229 VAL A CG1 1 
ATOM   945  C CG2 . VAL A 1 148 ? 33.084 -3.866  -42.617 1.00 28.67  ? 229 VAL A CG2 1 
ATOM   946  N N   . ASN A 1 149 ? 29.385 -1.517  -43.886 1.00 31.60  ? 230 ASN A N   1 
ATOM   947  C CA  . ASN A 1 149 ? 28.298 -0.547  -43.880 1.00 32.31  ? 230 ASN A CA  1 
ATOM   948  C C   . ASN A 1 149 ? 28.420 0.414   -45.038 1.00 32.37  ? 230 ASN A C   1 
ATOM   949  O O   . ASN A 1 149 ? 29.399 0.395   -45.787 1.00 32.98  ? 230 ASN A O   1 
ATOM   950  C CB  . ASN A 1 149 ? 28.247 0.262   -42.568 1.00 29.89  ? 230 ASN A CB  1 
ATOM   951  C CG  . ASN A 1 149 ? 29.418 1.225   -42.409 1.00 33.83  ? 230 ASN A CG  1 
ATOM   952  O OD1 . ASN A 1 149 ? 29.863 1.866   -43.365 1.00 30.12  ? 230 ASN A OD1 1 
ATOM   953  N ND2 . ASN A 1 149 ? 29.907 1.350   -41.180 1.00 35.11  ? 230 ASN A ND2 1 
ATOM   954  N N   . VAL A 1 150 ? 27.390 1.231   -45.200 1.00 32.13  ? 231 VAL A N   1 
ATOM   955  C CA  . VAL A 1 150 ? 27.394 2.278   -46.206 1.00 31.80  ? 231 VAL A CA  1 
ATOM   956  C C   . VAL A 1 150 ? 26.907 3.514   -45.459 1.00 33.24  ? 231 VAL A C   1 
ATOM   957  O O   . VAL A 1 150 ? 26.031 3.419   -44.590 1.00 31.48  ? 231 VAL A O   1 
ATOM   958  C CB  . VAL A 1 150 ? 26.424 2.008   -47.368 1.00 31.50  ? 231 VAL A CB  1 
ATOM   959  C CG1 . VAL A 1 150 ? 26.328 3.255   -48.244 1.00 27.97  ? 231 VAL A CG1 1 
ATOM   960  C CG2 . VAL A 1 150 ? 26.888 0.819   -48.185 1.00 28.92  ? 231 VAL A CG2 1 
ATOM   961  N N   . THR A 1 151 ? 27.496 4.664   -45.761 1.00 33.74  ? 232 THR A N   1 
ATOM   962  C CA  . THR A 1 151 ? 27.063 5.895   -45.125 1.00 33.78  ? 232 THR A CA  1 
ATOM   963  C C   . THR A 1 151 ? 26.930 6.979   -46.161 1.00 34.69  ? 232 THR A C   1 
ATOM   964  O O   . THR A 1 151 ? 27.591 6.963   -47.198 1.00 34.46  ? 232 THR A O   1 
ATOM   965  C CB  . THR A 1 151 ? 28.039 6.395   -44.041 1.00 34.26  ? 232 THR A CB  1 
ATOM   966  O OG1 . THR A 1 151 ? 29.361 6.469   -44.588 1.00 37.51  ? 232 THR A OG1 1 
ATOM   967  C CG2 . THR A 1 151 ? 28.016 5.480   -42.832 1.00 30.58  ? 232 THR A CG2 1 
ATOM   968  N N   . ILE A 1 152 ? 26.033 7.907   -45.876 1.00 35.30  ? 233 ILE A N   1 
ATOM   969  C CA  . ILE A 1 152 ? 25.802 9.044   -46.734 1.00 35.90  ? 233 ILE A CA  1 
ATOM   970  C C   . ILE A 1 152 ? 25.887 10.213  -45.770 1.00 37.61  ? 233 ILE A C   1 
ATOM   971  O O   . ILE A 1 152 ? 25.135 10.265  -44.794 1.00 37.19  ? 233 ILE A O   1 
ATOM   972  C CB  . ILE A 1 152 ? 24.413 8.975   -47.397 1.00 36.37  ? 233 ILE A CB  1 
ATOM   973  C CG1 . ILE A 1 152 ? 24.376 7.784   -48.361 1.00 37.12  ? 233 ILE A CG1 1 
ATOM   974  C CG2 . ILE A 1 152 ? 24.113 10.271  -48.152 1.00 33.57  ? 233 ILE A CG2 1 
ATOM   975  C CD1 . ILE A 1 152 ? 23.137 7.725   -49.234 1.00 36.66  ? 233 ILE A CD1 1 
ATOM   976  N N   . HIS A 1 153 ? 26.830 11.120  -46.031 1.00 38.65  ? 234 HIS A N   1 
ATOM   977  C CA  . HIS A 1 153 ? 27.047 12.291  -45.184 1.00 40.54  ? 234 HIS A CA  1 
ATOM   978  C C   . HIS A 1 153 ? 26.922 13.583  -45.967 1.00 39.93  ? 234 HIS A C   1 
ATOM   979  O O   . HIS A 1 153 ? 27.359 13.679  -47.111 1.00 40.67  ? 234 HIS A O   1 
ATOM   980  C CB  . HIS A 1 153 ? 28.449 12.292  -44.533 1.00 44.93  ? 234 HIS A CB  1 
ATOM   981  C CG  . HIS A 1 153 ? 29.133 10.956  -44.507 1.00 51.55  ? 234 HIS A CG  1 
ATOM   982  N ND1 . HIS A 1 153 ? 29.995 10.589  -43.494 1.00 53.58  ? 234 HIS A ND1 1 
ATOM   983  C CD2 . HIS A 1 153 ? 29.103 9.911   -45.370 1.00 52.40  ? 234 HIS A CD2 1 
ATOM   984  C CE1 . HIS A 1 153 ? 30.461 9.376   -43.732 1.00 55.24  ? 234 HIS A CE1 1 
ATOM   985  N NE2 . HIS A 1 153 ? 29.935 8.942   -44.865 1.00 54.53  ? 234 HIS A NE2 1 
ATOM   986  N N   . PHE A 1 154 ? 26.325 14.581  -45.336 1.00 41.08  ? 235 PHE A N   1 
ATOM   987  C CA  . PHE A 1 154 ? 26.175 15.897  -45.937 1.00 41.58  ? 235 PHE A CA  1 
ATOM   988  C C   . PHE A 1 154 ? 25.620 16.855  -44.909 1.00 41.60  ? 235 PHE A C   1 
ATOM   989  O O   . PHE A 1 154 ? 25.058 16.438  -43.894 1.00 40.92  ? 235 PHE A O   1 
ATOM   990  C CB  . PHE A 1 154 ? 25.275 15.872  -47.180 1.00 41.30  ? 235 PHE A CB  1 
ATOM   991  C CG  . PHE A 1 154 ? 23.884 15.360  -46.930 1.00 44.39  ? 235 PHE A CG  1 
ATOM   992  C CD1 . PHE A 1 154 ? 23.583 14.010  -47.118 1.00 43.09  ? 235 PHE A CD1 1 
ATOM   993  C CD2 . PHE A 1 154 ? 22.862 16.232  -46.553 1.00 44.18  ? 235 PHE A CD2 1 
ATOM   994  C CE1 . PHE A 1 154 ? 22.287 13.536  -46.937 1.00 43.80  ? 235 PHE A CE1 1 
ATOM   995  C CE2 . PHE A 1 154 ? 21.559 15.767  -46.368 1.00 45.01  ? 235 PHE A CE2 1 
ATOM   996  C CZ  . PHE A 1 154 ? 21.271 14.416  -46.563 1.00 44.17  ? 235 PHE A CZ  1 
ATOM   997  N N   . ARG A 1 155 ? 25.813 18.141  -45.169 1.00 43.14  ? 236 ARG A N   1 
ATOM   998  C CA  . ARG A 1 155 ? 25.345 19.188  -44.279 1.00 44.49  ? 236 ARG A CA  1 
ATOM   999  C C   . ARG A 1 155 ? 24.339 20.072  -45.004 1.00 43.71  ? 236 ARG A C   1 
ATOM   1000 O O   . ARG A 1 155 ? 24.414 20.249  -46.224 1.00 43.34  ? 236 ARG A O   1 
ATOM   1001 C CB  . ARG A 1 155 ? 26.528 20.035  -43.809 1.00 47.91  ? 236 ARG A CB  1 
ATOM   1002 C CG  . ARG A 1 155 ? 27.480 19.341  -42.841 1.00 52.75  ? 236 ARG A CG  1 
ATOM   1003 C CD  . ARG A 1 155 ? 28.877 19.930  -42.971 1.00 56.88  ? 236 ARG A CD  1 
ATOM   1004 N NE  . ARG A 1 155 ? 29.414 19.665  -44.309 1.00 64.74  ? 236 ARG A NE  1 
ATOM   1005 C CZ  . ARG A 1 155 ? 30.474 20.269  -44.844 1.00 66.68  ? 236 ARG A CZ  1 
ATOM   1006 N NH1 . ARG A 1 155 ? 31.135 21.197  -44.158 1.00 68.30  ? 236 ARG A NH1 1 
ATOM   1007 N NH2 . ARG A 1 155 ? 30.879 19.940  -46.068 1.00 66.63  ? 236 ARG A NH2 1 
ATOM   1008 N N   . LEU A 1 156 ? 23.390 20.612  -44.245 1.00 42.78  ? 237 LEU A N   1 
ATOM   1009 C CA  . LEU A 1 156 ? 22.366 21.503  -44.791 1.00 41.70  ? 237 LEU A CA  1 
ATOM   1010 C C   . LEU A 1 156 ? 22.234 22.737  -43.909 1.00 40.19  ? 237 LEU A C   1 
ATOM   1011 O O   . LEU A 1 156 ? 22.170 22.618  -42.690 1.00 38.64  ? 237 LEU A O   1 
ATOM   1012 C CB  . LEU A 1 156 ? 21.013 20.789  -44.855 1.00 38.55  ? 237 LEU A CB  1 
ATOM   1013 C CG  . LEU A 1 156 ? 20.897 19.596  -45.797 1.00 37.64  ? 237 LEU A CG  1 
ATOM   1014 C CD1 . LEU A 1 156 ? 19.466 19.077  -45.749 1.00 35.11  ? 237 LEU A CD1 1 
ATOM   1015 C CD2 . LEU A 1 156 ? 21.273 19.995  -47.216 1.00 33.92  ? 237 LEU A CD2 1 
ATOM   1016 N N   . LYS A 1 157 ? 22.200 23.919  -44.519 1.00 42.85  ? 238 LYS A N   1 
ATOM   1017 C CA  . LYS A 1 157 ? 22.054 25.154  -43.745 1.00 45.64  ? 238 LYS A CA  1 
ATOM   1018 C C   . LYS A 1 157 ? 20.627 25.691  -43.835 1.00 46.16  ? 238 LYS A C   1 
ATOM   1019 O O   . LYS A 1 157 ? 20.026 25.716  -44.911 1.00 46.23  ? 238 LYS A O   1 
ATOM   1020 C CB  . LYS A 1 157 ? 23.046 26.224  -44.222 1.00 47.10  ? 238 LYS A CB  1 
ATOM   1021 C CG  . LYS A 1 157 ? 24.503 25.886  -43.923 1.00 51.97  ? 238 LYS A CG  1 
ATOM   1022 C CD  . LYS A 1 157 ? 25.409 27.121  -43.880 1.00 54.49  ? 238 LYS A CD  1 
ATOM   1023 C CE  . LYS A 1 157 ? 25.648 27.709  -45.260 1.00 57.32  ? 238 LYS A CE  1 
ATOM   1024 N NZ  . LYS A 1 157 ? 26.568 28.885  -45.213 1.00 56.46  ? 238 LYS A NZ  1 
ATOM   1025 N N   . THR A 1 158 ? 20.086 26.111  -42.695 1.00 46.49  ? 239 THR A N   1 
ATOM   1026 C CA  . THR A 1 158 ? 18.730 26.643  -42.643 1.00 46.27  ? 239 THR A CA  1 
ATOM   1027 C C   . THR A 1 158 ? 18.584 27.684  -41.537 1.00 46.02  ? 239 THR A C   1 
ATOM   1028 O O   . THR A 1 158 ? 19.283 27.627  -40.528 1.00 46.17  ? 239 THR A O   1 
ATOM   1029 C CB  . THR A 1 158 ? 17.712 25.513  -42.391 1.00 47.18  ? 239 THR A CB  1 
ATOM   1030 O OG1 . THR A 1 158 ? 16.394 26.061  -42.314 1.00 46.42  ? 239 THR A OG1 1 
ATOM   1031 C CG2 . THR A 1 158 ? 18.023 24.792  -41.085 1.00 47.82  ? 239 THR A CG2 1 
ATOM   1032 N N   . ILE A 1 159 ? 17.673 28.634  -41.729 1.00 46.63  ? 240 ILE A N   1 
ATOM   1033 C CA  . ILE A 1 159 ? 17.425 29.675  -40.728 1.00 46.65  ? 240 ILE A CA  1 
ATOM   1034 C C   . ILE A 1 159 ? 16.223 29.280  -39.880 1.00 46.84  ? 240 ILE A C   1 
ATOM   1035 O O   . ILE A 1 159 ? 15.208 28.824  -40.412 1.00 49.00  ? 240 ILE A O   1 
ATOM   1036 C CB  . ILE A 1 159 ? 17.078 31.042  -41.371 1.00 46.37  ? 240 ILE A CB  1 
ATOM   1037 C CG1 . ILE A 1 159 ? 18.104 31.415  -42.444 1.00 47.15  ? 240 ILE A CG1 1 
ATOM   1038 C CG2 . ILE A 1 159 ? 17.027 32.108  -40.300 1.00 45.99  ? 240 ILE A CG2 1 
ATOM   1039 C CD1 . ILE A 1 159 ? 19.507 31.546  -41.932 1.00 45.92  ? 240 ILE A CD1 1 
ATOM   1040 N N   . ASN A 1 160 ? 16.330 29.457  -38.567 1.00 47.49  ? 241 ASN A N   1 
ATOM   1041 C CA  . ASN A 1 160 ? 15.223 29.135  -37.671 1.00 48.65  ? 241 ASN A CA  1 
ATOM   1042 C C   . ASN A 1 160 ? 14.277 30.344  -37.602 1.00 50.20  ? 241 ASN A C   1 
ATOM   1043 O O   . ASN A 1 160 ? 14.305 31.115  -36.642 1.00 48.70  ? 241 ASN A O   1 
ATOM   1044 C CB  . ASN A 1 160 ? 15.745 28.806  -36.271 1.00 46.78  ? 241 ASN A CB  1 
ATOM   1045 C CG  . ASN A 1 160 ? 14.660 28.262  -35.358 1.00 47.35  ? 241 ASN A CG  1 
ATOM   1046 O OD1 . ASN A 1 160 ? 13.487 28.227  -35.723 1.00 47.74  ? 241 ASN A OD1 1 
ATOM   1047 N ND2 . ASN A 1 160 ? 15.049 27.837  -34.161 1.00 48.24  ? 241 ASN A ND2 1 
ATOM   1048 N N   . LEU A 1 161 ? 13.448 30.502  -38.632 1.00 51.75  ? 242 LEU A N   1 
ATOM   1049 C CA  . LEU A 1 161 ? 12.500 31.608  -38.705 1.00 54.37  ? 242 LEU A CA  1 
ATOM   1050 C C   . LEU A 1 161 ? 11.504 31.633  -37.569 1.00 56.46  ? 242 LEU A C   1 
ATOM   1051 O O   . LEU A 1 161 ? 11.011 32.692  -37.206 1.00 57.09  ? 242 LEU A O   1 
ATOM   1052 C CB  . LEU A 1 161 ? 11.720 31.569  -40.016 1.00 52.66  ? 242 LEU A CB  1 
ATOM   1053 C CG  . LEU A 1 161 ? 12.520 31.843  -41.285 1.00 54.54  ? 242 LEU A CG  1 
ATOM   1054 C CD1 . LEU A 1 161 ? 11.574 31.946  -42.471 1.00 55.32  ? 242 LEU A CD1 1 
ATOM   1055 C CD2 . LEU A 1 161 ? 13.303 33.130  -41.120 1.00 53.22  ? 242 LEU A CD2 1 
ATOM   1056 N N   . GLN A 1 162 ? 11.200 30.466  -37.018 1.00 61.14  ? 243 GLN A N   1 
ATOM   1057 C CA  . GLN A 1 162 ? 10.242 30.367  -35.925 1.00 65.41  ? 243 GLN A CA  1 
ATOM   1058 C C   . GLN A 1 162 ? 10.508 31.397  -34.834 1.00 68.06  ? 243 GLN A C   1 
ATOM   1059 O O   . GLN A 1 162 ? 9.571  31.971  -34.281 1.00 67.97  ? 243 GLN A O   1 
ATOM   1060 C CB  . GLN A 1 162 ? 10.282 28.966  -35.320 1.00 66.69  ? 243 GLN A CB  1 
ATOM   1061 C CG  . GLN A 1 162 ? 8.910  28.366  -35.069 1.00 70.15  ? 243 GLN A CG  1 
ATOM   1062 C CD  . GLN A 1 162 ? 8.986  27.018  -34.377 1.00 72.59  ? 243 GLN A CD  1 
ATOM   1063 O OE1 . GLN A 1 162 ? 10.036 26.368  -34.371 1.00 73.89  ? 243 GLN A OE1 1 
ATOM   1064 N NE2 . GLN A 1 162 ? 7.870  26.583  -33.798 1.00 73.69  ? 243 GLN A NE2 1 
ATOM   1065 N N   . SER A 1 163 ? 11.787 31.623  -34.534 1.00 71.54  ? 244 SER A N   1 
ATOM   1066 C CA  . SER A 1 163 ? 12.211 32.584  -33.514 1.00 74.94  ? 244 SER A CA  1 
ATOM   1067 C C   . SER A 1 163 ? 11.528 33.944  -33.692 1.00 78.34  ? 244 SER A C   1 
ATOM   1068 O O   . SER A 1 163 ? 11.433 34.730  -32.747 1.00 79.50  ? 244 SER A O   1 
ATOM   1069 C CB  . SER A 1 163 ? 13.727 32.773  -33.577 1.00 73.97  ? 244 SER A CB  1 
ATOM   1070 O OG  . SER A 1 163 ? 14.382 31.543  -33.830 1.00 73.94  ? 244 SER A OG  1 
ATOM   1071 N N   . LEU A 1 164 ? 11.067 34.227  -34.909 1.00 81.78  ? 245 LEU A N   1 
ATOM   1072 C CA  . LEU A 1 164 ? 10.384 35.488  -35.192 1.00 84.45  ? 245 LEU A CA  1 
ATOM   1073 C C   . LEU A 1 164 ? 9.058  35.595  -34.449 1.00 87.09  ? 245 LEU A C   1 
ATOM   1074 O O   . LEU A 1 164 ? 8.613  36.694  -34.123 1.00 87.67  ? 245 LEU A O   1 
ATOM   1075 C CB  . LEU A 1 164 ? 10.121 35.650  -36.693 1.00 83.39  ? 245 LEU A CB  1 
ATOM   1076 C CG  . LEU A 1 164 ? 11.253 36.216  -37.546 1.00 83.16  ? 245 LEU A CG  1 
ATOM   1077 C CD1 . LEU A 1 164 ? 10.705 36.615  -38.906 1.00 82.78  ? 245 LEU A CD1 1 
ATOM   1078 C CD2 . LEU A 1 164 ? 11.856 37.424  -36.851 1.00 82.83  ? 245 LEU A CD2 1 
ATOM   1079 N N   . ILE A 1 165 ? 8.424  34.453  -34.190 1.00 90.01  ? 246 ILE A N   1 
ATOM   1080 C CA  . ILE A 1 165 ? 7.144  34.434  -33.484 1.00 92.18  ? 246 ILE A CA  1 
ATOM   1081 C C   . ILE A 1 165 ? 7.304  35.043  -32.086 1.00 93.56  ? 246 ILE A C   1 
ATOM   1082 O O   . ILE A 1 165 ? 6.541  35.929  -31.696 1.00 93.62  ? 246 ILE A O   1 
ATOM   1083 C CB  . ILE A 1 165 ? 6.570  32.975  -33.377 1.00 91.99  ? 246 ILE A CB  1 
ATOM   1084 C CG1 . ILE A 1 165 ? 5.102  33.014  -32.938 1.00 91.70  ? 246 ILE A CG1 1 
ATOM   1085 C CG2 . ILE A 1 165 ? 7.377  32.144  -32.384 1.00 90.93  ? 246 ILE A CG2 1 
ATOM   1086 C CD1 . ILE A 1 165 ? 4.167  33.661  -33.949 1.00 90.48  ? 246 ILE A CD1 1 
ATOM   1087 N N   . ASN A 1 166 ? 8.308  34.579  -31.344 1.00 95.04  ? 247 ASN A N   1 
ATOM   1088 C CA  . ASN A 1 166 ? 8.563  35.085  -29.998 1.00 96.36  ? 247 ASN A CA  1 
ATOM   1089 C C   . ASN A 1 166 ? 9.225  36.459  -30.039 1.00 95.82  ? 247 ASN A C   1 
ATOM   1090 O O   . ASN A 1 166 ? 9.729  36.935  -29.023 1.00 96.60  ? 247 ASN A O   1 
ATOM   1091 C CB  . ASN A 1 166 ? 9.464  34.122  -29.202 1.00 98.15  ? 247 ASN A CB  1 
ATOM   1092 C CG  . ASN A 1 166 ? 8.777  32.801  -28.872 1.00 99.95  ? 247 ASN A CG  1 
ATOM   1093 O OD1 . ASN A 1 166 ? 7.557  32.749  -28.694 1.00 100.44 ? 247 ASN A OD1 1 
ATOM   1094 N ND2 . ASN A 1 166 ? 9.565  31.730  -28.767 1.00 99.99  ? 247 ASN A ND2 1 
ATOM   1095 N N   . ASN A 1 167 ? 9.227  37.089  -31.211 1.00 94.13  ? 248 ASN A N   1 
ATOM   1096 C CA  . ASN A 1 167 ? 9.830  38.410  -31.380 1.00 92.62  ? 248 ASN A CA  1 
ATOM   1097 C C   . ASN A 1 167 ? 11.348 38.408  -31.255 1.00 92.30  ? 248 ASN A C   1 
ATOM   1098 O O   . ASN A 1 167 ? 11.956 39.453  -31.022 1.00 92.28  ? 248 ASN A O   1 
ATOM   1099 C CB  . ASN A 1 167 ? 9.249  39.403  -30.370 1.00 91.56  ? 248 ASN A CB  1 
ATOM   1100 C CG  . ASN A 1 167 ? 7.880  39.900  -30.770 1.00 90.67  ? 248 ASN A CG  1 
ATOM   1101 O OD1 . ASN A 1 167 ? 6.896  39.686  -30.066 1.00 90.51  ? 248 ASN A OD1 1 
ATOM   1102 N ND2 . ASN A 1 167 ? 7.809  40.570  -31.910 1.00 89.78  ? 248 ASN A ND2 1 
ATOM   1103 N N   . GLU A 1 168 ? 11.952 37.235  -31.413 1.00 91.40  ? 249 GLU A N   1 
ATOM   1104 C CA  . GLU A 1 168 ? 13.401 37.094  -31.327 1.00 90.48  ? 249 GLU A CA  1 
ATOM   1105 C C   . GLU A 1 168 ? 13.997 37.055  -32.727 1.00 89.08  ? 249 GLU A C   1 
ATOM   1106 O O   . GLU A 1 168 ? 13.272 37.056  -33.721 1.00 88.87  ? 249 GLU A O   1 
ATOM   1107 C CB  . GLU A 1 168 ? 13.755 35.802  -30.591 1.00 92.31  ? 249 GLU A CB  1 
ATOM   1108 C CG  . GLU A 1 168 ? 15.241 35.473  -30.555 1.00 94.88  ? 249 GLU A CG  1 
ATOM   1109 C CD  . GLU A 1 168 ? 15.950 36.046  -29.338 1.00 96.44  ? 249 GLU A CD  1 
ATOM   1110 O OE1 . GLU A 1 168 ? 16.210 37.271  -29.261 1.00 96.49  ? 249 GLU A OE1 1 
ATOM   1111 O OE2 . GLU A 1 168 ? 16.246 35.247  -28.435 1.00 97.36  ? 249 GLU A OE2 1 
ATOM   1112 N N   . ILE A 1 169 ? 15.323 37.028  -32.796 1.00 87.46  ? 250 ILE A N   1 
ATOM   1113 C CA  . ILE A 1 169 ? 16.014 36.963  -34.069 1.00 86.06  ? 250 ILE A CA  1 
ATOM   1114 C C   . ILE A 1 169 ? 16.370 35.507  -34.367 1.00 84.72  ? 250 ILE A C   1 
ATOM   1115 O O   . ILE A 1 169 ? 16.926 34.801  -33.522 1.00 84.26  ? 250 ILE A O   1 
ATOM   1116 C CB  . ILE A 1 169 ? 17.290 37.835  -34.064 1.00 86.23  ? 250 ILE A CB  1 
ATOM   1117 C CG1 . ILE A 1 169 ? 16.892 39.316  -34.042 1.00 86.01  ? 250 ILE A CG1 1 
ATOM   1118 C CG2 . ILE A 1 169 ? 18.151 37.517  -35.283 1.00 86.16  ? 250 ILE A CG2 1 
ATOM   1119 C CD1 . ILE A 1 169 ? 18.038 40.283  -34.304 1.00 85.77  ? 250 ILE A CD1 1 
ATOM   1120 N N   . PRO A 1 170 ? 16.029 35.041  -35.577 1.00 83.25  ? 251 PRO A N   1 
ATOM   1121 C CA  . PRO A 1 170 ? 16.269 33.682  -36.071 1.00 82.17  ? 251 PRO A CA  1 
ATOM   1122 C C   . PRO A 1 170 ? 17.726 33.207  -36.045 1.00 80.98  ? 251 PRO A C   1 
ATOM   1123 O O   . PRO A 1 170 ? 18.630 33.911  -36.506 1.00 81.33  ? 251 PRO A O   1 
ATOM   1124 C CB  . PRO A 1 170 ? 15.713 33.738  -37.493 1.00 82.64  ? 251 PRO A CB  1 
ATOM   1125 C CG  . PRO A 1 170 ? 14.596 34.720  -37.369 1.00 82.77  ? 251 PRO A CG  1 
ATOM   1126 C CD  . PRO A 1 170 ? 15.229 35.808  -36.549 1.00 82.68  ? 251 PRO A CD  1 
ATOM   1127 N N   . ASP A 1 171 ? 17.936 32.003  -35.511 1.00 78.60  ? 252 ASP A N   1 
ATOM   1128 C CA  . ASP A 1 171 ? 19.265 31.397  -35.437 1.00 75.14  ? 252 ASP A CA  1 
ATOM   1129 C C   . ASP A 1 171 ? 19.682 30.835  -36.787 1.00 72.97  ? 252 ASP A C   1 
ATOM   1130 O O   . ASP A 1 171 ? 18.846 30.564  -37.642 1.00 72.63  ? 252 ASP A O   1 
ATOM   1131 C CB  . ASP A 1 171 ? 19.285 30.251  -34.427 1.00 75.42  ? 252 ASP A CB  1 
ATOM   1132 C CG  . ASP A 1 171 ? 19.388 30.726  -33.002 1.00 76.02  ? 252 ASP A CG  1 
ATOM   1133 O OD1 . ASP A 1 171 ? 20.312 31.516  -32.709 1.00 76.70  ? 252 ASP A OD1 1 
ATOM   1134 O OD2 . ASP A 1 171 ? 18.556 30.297  -32.173 1.00 76.03  ? 252 ASP A OD2 1 
ATOM   1135 N N   . CYS A 1 172 ? 20.982 30.648  -36.972 1.00 71.59  ? 253 CYS A N   1 
ATOM   1136 C CA  . CYS A 1 172 ? 21.499 30.096  -38.221 1.00 69.99  ? 253 CYS A CA  1 
ATOM   1137 C C   . CYS A 1 172 ? 21.952 28.659  -37.955 1.00 65.87  ? 253 CYS A C   1 
ATOM   1138 O O   . CYS A 1 172 ? 22.995 28.430  -37.346 1.00 66.28  ? 253 CYS A O   1 
ATOM   1139 C CB  . CYS A 1 172 ? 22.672 30.947  -38.743 1.00 74.37  ? 253 CYS A CB  1 
ATOM   1140 S SG  . CYS A 1 172 ? 22.290 31.850  -40.278 1.00 82.55  ? 253 CYS A SG  1 
ATOM   1141 N N   . TYR A 1 173 ? 21.155 27.695  -38.409 1.00 60.92  ? 254 TYR A N   1 
ATOM   1142 C CA  . TYR A 1 173 ? 21.457 26.282  -38.205 1.00 55.08  ? 254 TYR A CA  1 
ATOM   1143 C C   . TYR A 1 173 ? 22.216 25.578  -39.313 1.00 52.91  ? 254 TYR A C   1 
ATOM   1144 O O   . TYR A 1 173 ? 21.988 25.809  -40.500 1.00 53.73  ? 254 TYR A O   1 
ATOM   1145 C CB  . TYR A 1 173 ? 20.175 25.489  -37.970 1.00 53.08  ? 254 TYR A CB  1 
ATOM   1146 C CG  . TYR A 1 173 ? 19.586 25.622  -36.592 1.00 51.75  ? 254 TYR A CG  1 
ATOM   1147 C CD1 . TYR A 1 173 ? 19.444 24.504  -35.771 1.00 50.92  ? 254 TYR A CD1 1 
ATOM   1148 C CD2 . TYR A 1 173 ? 19.154 26.855  -36.108 1.00 50.06  ? 254 TYR A CD2 1 
ATOM   1149 C CE1 . TYR A 1 173 ? 18.887 24.609  -34.500 1.00 51.76  ? 254 TYR A CE1 1 
ATOM   1150 C CE2 . TYR A 1 173 ? 18.594 26.971  -34.837 1.00 50.87  ? 254 TYR A CE2 1 
ATOM   1151 C CZ  . TYR A 1 173 ? 18.464 25.845  -34.038 1.00 51.49  ? 254 TYR A CZ  1 
ATOM   1152 O OH  . TYR A 1 173 ? 17.929 25.952  -32.772 1.00 52.58  ? 254 TYR A OH  1 
ATOM   1153 N N   . THR A 1 174 ? 23.129 24.707  -38.906 1.00 50.63  ? 255 THR A N   1 
ATOM   1154 C CA  . THR A 1 174 ? 23.878 23.896  -39.850 1.00 49.10  ? 255 THR A CA  1 
ATOM   1155 C C   . THR A 1 174 ? 23.608 22.466  -39.410 1.00 47.65  ? 255 THR A C   1 
ATOM   1156 O O   . THR A 1 174 ? 24.024 22.051  -38.323 1.00 47.09  ? 255 THR A O   1 
ATOM   1157 C CB  . THR A 1 174 ? 25.391 24.142  -39.793 1.00 48.83  ? 255 THR A CB  1 
ATOM   1158 O OG1 . THR A 1 174 ? 25.665 25.528  -40.028 1.00 52.44  ? 255 THR A OG1 1 
ATOM   1159 C CG2 . THR A 1 174 ? 26.088 23.317  -40.860 1.00 47.34  ? 255 THR A CG2 1 
ATOM   1160 N N   . PHE A 1 175 ? 22.878 21.723  -40.231 1.00 45.22  ? 256 PHE A N   1 
ATOM   1161 C CA  . PHE A 1 175 ? 22.571 20.339  -39.902 1.00 43.37  ? 256 PHE A CA  1 
ATOM   1162 C C   . PHE A 1 175 ? 23.571 19.392  -40.533 1.00 41.73  ? 256 PHE A C   1 
ATOM   1163 O O   . PHE A 1 175 ? 23.909 19.511  -41.713 1.00 41.10  ? 256 PHE A O   1 
ATOM   1164 C CB  . PHE A 1 175 ? 21.160 19.971  -40.366 1.00 43.48  ? 256 PHE A CB  1 
ATOM   1165 C CG  . PHE A 1 175 ? 20.075 20.501  -39.477 1.00 44.60  ? 256 PHE A CG  1 
ATOM   1166 C CD1 . PHE A 1 175 ? 19.883 19.971  -38.208 1.00 44.40  ? 256 PHE A CD1 1 
ATOM   1167 C CD2 . PHE A 1 175 ? 19.257 21.547  -39.897 1.00 43.30  ? 256 PHE A CD2 1 
ATOM   1168 C CE1 . PHE A 1 175 ? 18.890 20.475  -37.368 1.00 44.82  ? 256 PHE A CE1 1 
ATOM   1169 C CE2 . PHE A 1 175 ? 18.265 22.055  -39.062 1.00 43.74  ? 256 PHE A CE2 1 
ATOM   1170 C CZ  . PHE A 1 175 ? 18.082 21.519  -37.797 1.00 42.40  ? 256 PHE A CZ  1 
ATOM   1171 N N   . SER A 1 176 ? 24.057 18.458  -39.731 1.00 39.77  ? 257 SER A N   1 
ATOM   1172 C CA  . SER A 1 176 ? 25.000 17.469  -40.221 1.00 41.97  ? 257 SER A CA  1 
ATOM   1173 C C   . SER A 1 176 ? 24.179 16.188  -40.301 1.00 38.74  ? 257 SER A C   1 
ATOM   1174 O O   . SER A 1 176 ? 23.773 15.646  -39.281 1.00 37.11  ? 257 SER A O   1 
ATOM   1175 C CB  . SER A 1 176 ? 26.159 17.316  -39.235 1.00 45.03  ? 257 SER A CB  1 
ATOM   1176 O OG  . SER A 1 176 ? 27.234 16.623  -39.840 1.00 53.17  ? 257 SER A OG  1 
ATOM   1177 N N   . VAL A 1 177 ? 23.914 15.720  -41.514 1.00 37.63  ? 258 VAL A N   1 
ATOM   1178 C CA  . VAL A 1 177 ? 23.092 14.531  -41.693 1.00 36.57  ? 258 VAL A CA  1 
ATOM   1179 C C   . VAL A 1 177 ? 23.906 13.269  -41.948 1.00 34.93  ? 258 VAL A C   1 
ATOM   1180 O O   . VAL A 1 177 ? 24.783 13.248  -42.802 1.00 33.42  ? 258 VAL A O   1 
ATOM   1181 C CB  . VAL A 1 177 ? 22.093 14.736  -42.859 1.00 37.25  ? 258 VAL A CB  1 
ATOM   1182 C CG1 . VAL A 1 177 ? 21.186 13.517  -43.007 1.00 33.50  ? 258 VAL A CG1 1 
ATOM   1183 C CG2 . VAL A 1 177 ? 21.269 15.994  -42.612 1.00 36.00  ? 258 VAL A CG2 1 
ATOM   1184 N N   . LEU A 1 178 ? 23.605 12.218  -41.196 1.00 33.08  ? 259 LEU A N   1 
ATOM   1185 C CA  . LEU A 1 178 ? 24.305 10.956  -41.357 1.00 33.16  ? 259 LEU A CA  1 
ATOM   1186 C C   . LEU A 1 178 ? 23.353 9.785   -41.554 1.00 32.50  ? 259 LEU A C   1 
ATOM   1187 O O   . LEU A 1 178 ? 22.648 9.378   -40.625 1.00 31.15  ? 259 LEU A O   1 
ATOM   1188 C CB  . LEU A 1 178 ? 25.189 10.685  -40.145 1.00 33.48  ? 259 LEU A CB  1 
ATOM   1189 C CG  . LEU A 1 178 ? 26.007 9.395   -40.244 1.00 34.14  ? 259 LEU A CG  1 
ATOM   1190 C CD1 . LEU A 1 178 ? 26.953 9.458   -41.423 1.00 30.11  ? 259 LEU A CD1 1 
ATOM   1191 C CD2 . LEU A 1 178 ? 26.766 9.196   -38.959 1.00 31.57  ? 259 LEU A CD2 1 
ATOM   1192 N N   . ILE A 1 179 ? 23.320 9.260   -42.775 1.00 30.77  ? 260 ILE A N   1 
ATOM   1193 C CA  . ILE A 1 179 ? 22.476 8.116   -43.072 1.00 31.68  ? 260 ILE A CA  1 
ATOM   1194 C C   . ILE A 1 179 ? 23.363 6.869   -43.044 1.00 33.20  ? 260 ILE A C   1 
ATOM   1195 O O   . ILE A 1 179 ? 24.344 6.775   -43.790 1.00 31.14  ? 260 ILE A O   1 
ATOM   1196 C CB  . ILE A 1 179 ? 21.816 8.228   -44.470 1.00 29.93  ? 260 ILE A CB  1 
ATOM   1197 C CG1 . ILE A 1 179 ? 20.931 9.473   -44.546 1.00 27.79  ? 260 ILE A CG1 1 
ATOM   1198 C CG2 . ILE A 1 179 ? 20.970 6.995   -44.730 1.00 28.10  ? 260 ILE A CG2 1 
ATOM   1199 C CD1 . ILE A 1 179 ? 20.453 9.803   -45.950 1.00 27.12  ? 260 ILE A CD1 1 
ATOM   1200 N N   . THR A 1 180 ? 23.018 5.918   -42.182 1.00 34.23  ? 261 THR A N   1 
ATOM   1201 C CA  . THR A 1 180 ? 23.789 4.689   -42.058 1.00 34.66  ? 261 THR A CA  1 
ATOM   1202 C C   . THR A 1 180 ? 23.029 3.417   -42.423 1.00 34.41  ? 261 THR A C   1 
ATOM   1203 O O   . THR A 1 180 ? 21.918 3.192   -41.951 1.00 35.00  ? 261 THR A O   1 
ATOM   1204 C CB  . THR A 1 180 ? 24.287 4.480   -40.623 1.00 35.57  ? 261 THR A CB  1 
ATOM   1205 O OG1 . THR A 1 180 ? 24.927 5.670   -40.159 1.00 35.75  ? 261 THR A OG1 1 
ATOM   1206 C CG2 . THR A 1 180 ? 25.263 3.288   -40.568 1.00 33.96  ? 261 THR A CG2 1 
ATOM   1207 N N   . PHE A 1 181 ? 23.653 2.593   -43.260 1.00 34.95  ? 262 PHE A N   1 
ATOM   1208 C CA  . PHE A 1 181 ? 23.116 1.297   -43.677 1.00 32.95  ? 262 PHE A CA  1 
ATOM   1209 C C   . PHE A 1 181 ? 24.087 0.357   -42.980 1.00 33.57  ? 262 PHE A C   1 
ATOM   1210 O O   . PHE A 1 181 ? 25.088 -0.056  -43.553 1.00 34.22  ? 262 PHE A O   1 
ATOM   1211 C CB  . PHE A 1 181 ? 23.224 1.164   -45.186 1.00 31.11  ? 262 PHE A CB  1 
ATOM   1212 C CG  . PHE A 1 181 ? 22.508 2.250   -45.929 1.00 32.31  ? 262 PHE A CG  1 
ATOM   1213 C CD1 . PHE A 1 181 ? 21.198 2.069   -46.363 1.00 32.62  ? 262 PHE A CD1 1 
ATOM   1214 C CD2 . PHE A 1 181 ? 23.125 3.477   -46.154 1.00 31.75  ? 262 PHE A CD2 1 
ATOM   1215 C CE1 . PHE A 1 181 ? 20.511 3.094   -47.009 1.00 31.64  ? 262 PHE A CE1 1 
ATOM   1216 C CE2 . PHE A 1 181 ? 22.449 4.514   -46.797 1.00 31.07  ? 262 PHE A CE2 1 
ATOM   1217 C CZ  . PHE A 1 181 ? 21.139 4.322   -47.226 1.00 32.91  ? 262 PHE A CZ  1 
ATOM   1218 N N   . ASP A 1 182 ? 23.789 0.041   -41.728 1.00 34.65  ? 263 ASP A N   1 
ATOM   1219 C CA  . ASP A 1 182 ? 24.665 -0.777  -40.905 1.00 36.42  ? 263 ASP A CA  1 
ATOM   1220 C C   . ASP A 1 182 ? 24.609 -2.287  -41.114 1.00 38.68  ? 263 ASP A C   1 
ATOM   1221 O O   . ASP A 1 182 ? 23.570 -2.917  -40.915 1.00 40.48  ? 263 ASP A O   1 
ATOM   1222 C CB  . ASP A 1 182 ? 24.404 -0.436  -39.435 1.00 34.05  ? 263 ASP A CB  1 
ATOM   1223 C CG  . ASP A 1 182 ? 25.496 -0.949  -38.507 1.00 38.04  ? 263 ASP A CG  1 
ATOM   1224 O OD1 . ASP A 1 182 ? 26.622 -1.195  -38.981 1.00 37.69  ? 263 ASP A OD1 1 
ATOM   1225 O OD2 . ASP A 1 182 ? 25.231 -1.091  -37.291 1.00 40.45  ? 263 ASP A OD2 1 
ATOM   1226 N N   . ASN A 1 183 ? 25.742 -2.869  -41.497 1.00 39.16  ? 264 ASN A N   1 
ATOM   1227 C CA  . ASN A 1 183 ? 25.821 -4.312  -41.712 1.00 39.47  ? 264 ASN A CA  1 
ATOM   1228 C C   . ASN A 1 183 ? 26.844 -4.941  -40.761 1.00 40.05  ? 264 ASN A C   1 
ATOM   1229 O O   . ASN A 1 183 ? 27.294 -6.064  -40.979 1.00 39.17  ? 264 ASN A O   1 
ATOM   1230 C CB  . ASN A 1 183 ? 26.201 -4.606  -43.172 1.00 37.93  ? 264 ASN A CB  1 
ATOM   1231 C CG  . ASN A 1 183 ? 26.044 -6.077  -43.538 1.00 38.09  ? 264 ASN A CG  1 
ATOM   1232 O OD1 . ASN A 1 183 ? 25.067 -6.730  -43.149 1.00 34.31  ? 264 ASN A OD1 1 
ATOM   1233 N ND2 . ASN A 1 183 ? 26.998 -6.600  -44.302 1.00 33.42  ? 264 ASN A ND2 1 
ATOM   1234 N N   . LYS A 1 184 ? 27.187 -4.220  -39.693 1.00 42.32  ? 265 LYS A N   1 
ATOM   1235 C CA  . LYS A 1 184 ? 28.178 -4.699  -38.720 1.00 44.29  ? 265 LYS A CA  1 
ATOM   1236 C C   . LYS A 1 184 ? 27.819 -6.053  -38.110 1.00 44.21  ? 265 LYS A C   1 
ATOM   1237 O O   . LYS A 1 184 ? 28.700 -6.787  -37.657 1.00 45.48  ? 265 LYS A O   1 
ATOM   1238 C CB  . LYS A 1 184 ? 28.374 -3.671  -37.594 1.00 44.15  ? 265 LYS A CB  1 
ATOM   1239 C CG  . LYS A 1 184 ? 27.264 -3.660  -36.545 1.00 49.34  ? 265 LYS A CG  1 
ATOM   1240 C CD  . LYS A 1 184 ? 27.391 -2.489  -35.561 1.00 51.10  ? 265 LYS A CD  1 
ATOM   1241 C CE  . LYS A 1 184 ? 28.754 -2.470  -34.882 1.00 55.55  ? 265 LYS A CE  1 
ATOM   1242 N NZ  . LYS A 1 184 ? 28.859 -1.455  -33.785 1.00 57.67  ? 265 LYS A NZ  1 
ATOM   1243 N N   . ALA A 1 185 ? 26.532 -6.384  -38.108 1.00 42.50  ? 266 ALA A N   1 
ATOM   1244 C CA  . ALA A 1 185 ? 26.074 -7.651  -37.545 1.00 40.61  ? 266 ALA A CA  1 
ATOM   1245 C C   . ALA A 1 185 ? 26.137 -8.803  -38.544 1.00 39.37  ? 266 ALA A C   1 
ATOM   1246 O O   . ALA A 1 185 ? 25.971 -9.958  -38.162 1.00 40.23  ? 266 ALA A O   1 
ATOM   1247 C CB  . ALA A 1 185 ? 24.652 -7.504  -37.009 1.00 38.59  ? 266 ALA A CB  1 
ATOM   1248 N N   . HIS A 1 186 ? 26.369 -8.493  -39.816 1.00 38.20  ? 267 HIS A N   1 
ATOM   1249 C CA  . HIS A 1 186 ? 26.457 -9.527  -40.845 1.00 38.56  ? 267 HIS A CA  1 
ATOM   1250 C C   . HIS A 1 186 ? 25.377 -10.583 -40.632 1.00 38.34  ? 267 HIS A C   1 
ATOM   1251 O O   . HIS A 1 186 ? 25.657 -11.782 -40.635 1.00 38.56  ? 267 HIS A O   1 
ATOM   1252 C CB  . HIS A 1 186 ? 27.837 -10.189 -40.792 1.00 39.19  ? 267 HIS A CB  1 
ATOM   1253 C CG  . HIS A 1 186 ? 28.973 -9.236  -41.002 1.00 40.30  ? 267 HIS A CG  1 
ATOM   1254 N ND1 . HIS A 1 186 ? 29.321 -8.754  -42.246 1.00 39.80  ? 267 HIS A ND1 1 
ATOM   1255 C CD2 . HIS A 1 186 ? 29.815 -8.647  -40.120 1.00 39.41  ? 267 HIS A CD2 1 
ATOM   1256 C CE1 . HIS A 1 186 ? 30.328 -7.908  -42.122 1.00 39.07  ? 267 HIS A CE1 1 
ATOM   1257 N NE2 . HIS A 1 186 ? 30.646 -7.826  -40.842 1.00 41.71  ? 267 HIS A NE2 1 
ATOM   1258 N N   . SER A 1 187 ? 24.138 -10.137 -40.457 1.00 39.32  ? 268 SER A N   1 
ATOM   1259 C CA  . SER A 1 187 ? 23.039 -11.058 -40.204 1.00 38.08  ? 268 SER A CA  1 
ATOM   1260 C C   . SER A 1 187 ? 21.958 -11.121 -41.280 1.00 37.47  ? 268 SER A C   1 
ATOM   1261 O O   . SER A 1 187 ? 20.875 -11.634 -41.026 1.00 38.03  ? 268 SER A O   1 
ATOM   1262 C CB  . SER A 1 187 ? 22.391 -10.718 -38.867 1.00 39.79  ? 268 SER A CB  1 
ATOM   1263 O OG  . SER A 1 187 ? 21.843 -9.410  -38.894 1.00 45.97  ? 268 SER A OG  1 
ATOM   1264 N N   . GLY A 1 188 ? 22.250 -10.617 -42.476 1.00 36.74  ? 269 GLY A N   1 
ATOM   1265 C CA  . GLY A 1 188 ? 21.263 -10.646 -43.545 1.00 35.74  ? 269 GLY A CA  1 
ATOM   1266 C C   . GLY A 1 188 ? 20.260 -9.504  -43.464 1.00 34.89  ? 269 GLY A C   1 
ATOM   1267 O O   . GLY A 1 188 ? 19.472 -9.285  -44.380 1.00 34.12  ? 269 GLY A O   1 
ATOM   1268 N N   . ARG A 1 189 ? 20.295 -8.775  -42.357 1.00 33.86  ? 270 ARG A N   1 
ATOM   1269 C CA  . ARG A 1 189 ? 19.398 -7.653  -42.137 1.00 34.65  ? 270 ARG A CA  1 
ATOM   1270 C C   . ARG A 1 189 ? 20.227 -6.379  -41.960 1.00 33.32  ? 270 ARG A C   1 
ATOM   1271 O O   . ARG A 1 189 ? 21.093 -6.316  -41.087 1.00 31.75  ? 270 ARG A O   1 
ATOM   1272 C CB  . ARG A 1 189 ? 18.555 -7.912  -40.880 1.00 35.84  ? 270 ARG A CB  1 
ATOM   1273 C CG  . ARG A 1 189 ? 17.754 -6.710  -40.391 1.00 37.45  ? 270 ARG A CG  1 
ATOM   1274 C CD  . ARG A 1 189 ? 16.934 -7.046  -39.142 1.00 39.39  ? 270 ARG A CD  1 
ATOM   1275 N NE  . ARG A 1 189 ? 16.077 -5.931  -38.741 1.00 41.80  ? 270 ARG A NE  1 
ATOM   1276 C CZ  . ARG A 1 189 ? 16.450 -4.944  -37.930 1.00 43.00  ? 270 ARG A CZ  1 
ATOM   1277 N NH1 . ARG A 1 189 ? 17.670 -4.924  -37.411 1.00 43.56  ? 270 ARG A NH1 1 
ATOM   1278 N NH2 . ARG A 1 189 ? 15.603 -3.964  -37.649 1.00 43.13  ? 270 ARG A NH2 1 
ATOM   1279 N N   . ILE A 1 190 ? 19.967 -5.369  -42.788 1.00 33.42  ? 271 ILE A N   1 
ATOM   1280 C CA  . ILE A 1 190 ? 20.706 -4.108  -42.688 1.00 32.62  ? 271 ILE A CA  1 
ATOM   1281 C C   . ILE A 1 190 ? 19.847 -2.934  -42.222 1.00 33.45  ? 271 ILE A C   1 
ATOM   1282 O O   . ILE A 1 190 ? 19.183 -2.264  -43.019 1.00 33.55  ? 271 ILE A O   1 
ATOM   1283 C CB  . ILE A 1 190 ? 21.383 -3.744  -44.029 1.00 32.13  ? 271 ILE A CB  1 
ATOM   1284 C CG1 . ILE A 1 190 ? 22.476 -4.783  -44.346 1.00 32.12  ? 271 ILE A CG1 1 
ATOM   1285 C CG2 . ILE A 1 190 ? 21.971 -2.344  -43.959 1.00 28.42  ? 271 ILE A CG2 1 
ATOM   1286 C CD1 . ILE A 1 190 ? 23.273 -4.520  -45.617 1.00 28.93  ? 271 ILE A CD1 1 
ATOM   1287 N N   . PRO A 1 191 ? 19.843 -2.675  -40.908 1.00 32.53  ? 272 PRO A N   1 
ATOM   1288 C CA  . PRO A 1 191 ? 19.051 -1.563  -40.378 1.00 33.65  ? 272 PRO A CA  1 
ATOM   1289 C C   . PRO A 1 191 ? 19.540 -0.239  -40.941 1.00 34.98  ? 272 PRO A C   1 
ATOM   1290 O O   . PRO A 1 191 ? 20.748 -0.014  -41.079 1.00 34.62  ? 272 PRO A O   1 
ATOM   1291 C CB  . PRO A 1 191 ? 19.253 -1.670  -38.865 1.00 33.94  ? 272 PRO A CB  1 
ATOM   1292 C CG  . PRO A 1 191 ? 20.602 -2.345  -38.743 1.00 35.44  ? 272 PRO A CG  1 
ATOM   1293 C CD  . PRO A 1 191 ? 20.558 -3.385  -39.835 1.00 32.09  ? 272 PRO A CD  1 
ATOM   1294 N N   . ILE A 1 192 ? 18.596 0.634   -41.270 1.00 35.48  ? 273 ILE A N   1 
ATOM   1295 C CA  . ILE A 1 192 ? 18.920 1.937   -41.829 1.00 35.61  ? 273 ILE A CA  1 
ATOM   1296 C C   . ILE A 1 192 ? 18.474 3.033   -40.866 1.00 37.64  ? 273 ILE A C   1 
ATOM   1297 O O   . ILE A 1 192 ? 17.349 3.021   -40.373 1.00 38.84  ? 273 ILE A O   1 
ATOM   1298 C CB  . ILE A 1 192 ? 18.218 2.129   -43.184 1.00 34.06  ? 273 ILE A CB  1 
ATOM   1299 C CG1 . ILE A 1 192 ? 18.691 1.051   -44.166 1.00 33.38  ? 273 ILE A CG1 1 
ATOM   1300 C CG2 . ILE A 1 192 ? 18.503 3.518   -43.720 1.00 34.78  ? 273 ILE A CG2 1 
ATOM   1301 C CD1 . ILE A 1 192 ? 17.825 0.905   -45.406 1.00 32.04  ? 273 ILE A CD1 1 
ATOM   1302 N N   . SER A 1 193 ? 19.356 3.988   -40.598 1.00 37.86  ? 274 SER A N   1 
ATOM   1303 C CA  . SER A 1 193 ? 19.021 5.066   -39.683 1.00 35.39  ? 274 SER A CA  1 
ATOM   1304 C C   . SER A 1 193 ? 19.500 6.407   -40.222 1.00 34.26  ? 274 SER A C   1 
ATOM   1305 O O   . SER A 1 193 ? 20.390 6.462   -41.065 1.00 34.84  ? 274 SER A O   1 
ATOM   1306 C CB  . SER A 1 193 ? 19.650 4.789   -38.311 1.00 35.03  ? 274 SER A CB  1 
ATOM   1307 O OG  . SER A 1 193 ? 21.067 4.736   -38.392 1.00 33.98  ? 274 SER A OG  1 
ATOM   1308 N N   . LEU A 1 194 ? 18.879 7.485   -39.754 1.00 35.15  ? 275 LEU A N   1 
ATOM   1309 C CA  . LEU A 1 194 ? 19.252 8.833   -40.165 1.00 35.08  ? 275 LEU A CA  1 
ATOM   1310 C C   . LEU A 1 194 ? 19.361 9.650   -38.909 1.00 36.03  ? 275 LEU A C   1 
ATOM   1311 O O   . LEU A 1 194 ? 18.394 9.784   -38.174 1.00 37.73  ? 275 LEU A O   1 
ATOM   1312 C CB  . LEU A 1 194 ? 18.198 9.466   -41.085 1.00 33.82  ? 275 LEU A CB  1 
ATOM   1313 C CG  . LEU A 1 194 ? 18.518 10.891  -41.584 1.00 31.47  ? 275 LEU A CG  1 
ATOM   1314 C CD1 . LEU A 1 194 ? 17.758 11.200  -42.851 1.00 31.29  ? 275 LEU A CD1 1 
ATOM   1315 C CD2 . LEU A 1 194 ? 18.185 11.898  -40.519 1.00 30.29  ? 275 LEU A CD2 1 
ATOM   1316 N N   . GLU A 1 195 ? 20.546 10.179  -38.649 1.00 37.90  ? 276 GLU A N   1 
ATOM   1317 C CA  . GLU A 1 195 ? 20.750 11.002  -37.470 1.00 40.32  ? 276 GLU A CA  1 
ATOM   1318 C C   . GLU A 1 195 ? 21.307 12.348  -37.909 1.00 39.86  ? 276 GLU A C   1 
ATOM   1319 O O   . GLU A 1 195 ? 21.815 12.492  -39.021 1.00 38.34  ? 276 GLU A O   1 
ATOM   1320 C CB  . GLU A 1 195 ? 21.723 10.333  -36.493 1.00 41.82  ? 276 GLU A CB  1 
ATOM   1321 C CG  . GLU A 1 195 ? 21.276 8.971   -35.941 1.00 46.37  ? 276 GLU A CG  1 
ATOM   1322 C CD  . GLU A 1 195 ? 19.941 9.005   -35.203 1.00 47.55  ? 276 GLU A CD  1 
ATOM   1323 O OE1 . GLU A 1 195 ? 19.689 9.947   -34.426 1.00 49.87  ? 276 GLU A OE1 1 
ATOM   1324 O OE2 . GLU A 1 195 ? 19.144 8.064   -35.386 1.00 52.03  ? 276 GLU A OE2 1 
ATOM   1325 N N   . THR A 1 196 ? 21.193 13.344  -37.042 1.00 40.93  ? 277 THR A N   1 
ATOM   1326 C CA  . THR A 1 196 ? 21.712 14.662  -37.372 1.00 42.56  ? 277 THR A CA  1 
ATOM   1327 C C   . THR A 1 196 ? 22.358 15.332  -36.181 1.00 43.79  ? 277 THR A C   1 
ATOM   1328 O O   . THR A 1 196 ? 22.210 14.910  -35.034 1.00 41.69  ? 277 THR A O   1 
ATOM   1329 C CB  . THR A 1 196 ? 20.610 15.624  -37.871 1.00 40.37  ? 277 THR A CB  1 
ATOM   1330 O OG1 . THR A 1 196 ? 19.694 15.891  -36.804 1.00 40.78  ? 277 THR A OG1 1 
ATOM   1331 C CG2 . THR A 1 196 ? 19.863 15.027  -39.041 1.00 41.73  ? 277 THR A CG2 1 
ATOM   1332 N N   . GLN A 1 197 ? 23.085 16.393  -36.480 1.00 48.41  ? 278 GLN A N   1 
ATOM   1333 C CA  . GLN A 1 197 ? 23.719 17.185  -35.454 1.00 54.59  ? 278 GLN A CA  1 
ATOM   1334 C C   . GLN A 1 197 ? 23.635 18.627  -35.914 1.00 55.12  ? 278 GLN A C   1 
ATOM   1335 O O   . GLN A 1 197 ? 23.911 18.938  -37.077 1.00 54.71  ? 278 GLN A O   1 
ATOM   1336 C CB  . GLN A 1 197 ? 25.162 16.746  -35.232 1.00 57.16  ? 278 GLN A CB  1 
ATOM   1337 C CG  . GLN A 1 197 ? 25.432 16.545  -33.751 1.00 65.37  ? 278 GLN A CG  1 
ATOM   1338 C CD  . GLN A 1 197 ? 26.687 15.761  -33.485 1.00 70.21  ? 278 GLN A CD  1 
ATOM   1339 O OE1 . GLN A 1 197 ? 26.849 14.640  -33.985 1.00 72.14  ? 278 GLN A OE1 1 
ATOM   1340 N NE2 . GLN A 1 197 ? 27.595 16.339  -32.694 1.00 70.56  ? 278 GLN A NE2 1 
ATOM   1341 N N   . ALA A 1 198 ? 23.228 19.499  -35.000 1.00 57.13  ? 279 ALA A N   1 
ATOM   1342 C CA  . ALA A 1 198 ? 23.071 20.905  -35.325 1.00 59.49  ? 279 ALA A CA  1 
ATOM   1343 C C   . ALA A 1 198 ? 24.107 21.823  -34.706 1.00 61.41  ? 279 ALA A C   1 
ATOM   1344 O O   . ALA A 1 198 ? 24.435 21.720  -33.524 1.00 60.88  ? 279 ALA A O   1 
ATOM   1345 C CB  . ALA A 1 198 ? 21.674 21.371  -34.933 1.00 58.64  ? 279 ALA A CB  1 
ATOM   1346 N N   . HIS A 1 199 ? 24.620 22.721  -35.535 1.00 64.43  ? 280 HIS A N   1 
ATOM   1347 C CA  . HIS A 1 199 ? 25.584 23.713  -35.106 1.00 68.18  ? 280 HIS A CA  1 
ATOM   1348 C C   . HIS A 1 199 ? 24.841 25.040  -35.175 1.00 70.73  ? 280 HIS A C   1 
ATOM   1349 O O   . HIS A 1 199 ? 24.489 25.510  -36.260 1.00 70.69  ? 280 HIS A O   1 
ATOM   1350 C CB  . HIS A 1 199 ? 26.794 23.732  -36.046 1.00 70.27  ? 280 HIS A CB  1 
ATOM   1351 C CG  . HIS A 1 199 ? 27.687 24.923  -35.861 1.00 71.92  ? 280 HIS A CG  1 
ATOM   1352 N ND1 . HIS A 1 199 ? 28.226 25.267  -34.640 1.00 72.28  ? 280 HIS A ND1 1 
ATOM   1353 C CD2 . HIS A 1 199 ? 28.126 25.852  -36.743 1.00 72.56  ? 280 HIS A CD2 1 
ATOM   1354 C CE1 . HIS A 1 199 ? 28.957 26.360  -34.777 1.00 73.03  ? 280 HIS A CE1 1 
ATOM   1355 N NE2 . HIS A 1 199 ? 28.913 26.734  -36.042 1.00 73.69  ? 280 HIS A NE2 1 
ATOM   1356 N N   . ILE A 1 200 ? 24.587 25.632  -34.014 1.00 73.83  ? 281 ILE A N   1 
ATOM   1357 C CA  . ILE A 1 200 ? 23.880 26.901  -33.958 1.00 77.01  ? 281 ILE A CA  1 
ATOM   1358 C C   . ILE A 1 200 ? 24.836 28.066  -33.738 1.00 80.09  ? 281 ILE A C   1 
ATOM   1359 O O   . ILE A 1 200 ? 25.646 28.057  -32.809 1.00 81.11  ? 281 ILE A O   1 
ATOM   1360 C CB  . ILE A 1 200 ? 22.850 26.919  -32.816 1.00 76.59  ? 281 ILE A CB  1 
ATOM   1361 C CG1 . ILE A 1 200 ? 22.053 25.618  -32.803 1.00 76.98  ? 281 ILE A CG1 1 
ATOM   1362 C CG2 . ILE A 1 200 ? 21.900 28.089  -33.001 1.00 76.72  ? 281 ILE A CG2 1 
ATOM   1363 C CD1 . ILE A 1 200 ? 21.068 25.526  -31.660 1.00 77.10  ? 281 ILE A CD1 1 
ATOM   1364 N N   . GLN A 1 201 ? 24.737 29.066  -34.604 1.00 82.63  ? 282 GLN A N   1 
ATOM   1365 C CA  . GLN A 1 201 ? 25.559 30.264  -34.499 1.00 84.91  ? 282 GLN A CA  1 
ATOM   1366 C C   . GLN A 1 201 ? 24.643 31.440  -34.809 1.00 86.84  ? 282 GLN A C   1 
ATOM   1367 O O   . GLN A 1 201 ? 23.423 31.280  -34.862 1.00 87.95  ? 282 GLN A O   1 
ATOM   1368 C CB  . GLN A 1 201 ? 26.704 30.227  -35.508 1.00 84.11  ? 282 GLN A CB  1 
ATOM   1369 C CG  . GLN A 1 201 ? 26.252 30.086  -36.940 1.00 85.08  ? 282 GLN A CG  1 
ATOM   1370 C CD  . GLN A 1 201 ? 27.290 30.582  -37.918 1.00 86.22  ? 282 GLN A CD  1 
ATOM   1371 O OE1 . GLN A 1 201 ? 28.466 30.232  -37.822 1.00 87.37  ? 282 GLN A OE1 1 
ATOM   1372 N NE2 . GLN A 1 201 ? 26.862 31.403  -38.873 1.00 86.49  ? 282 GLN A NE2 1 
ATOM   1373 N N   . GLU A 1 202 ? 25.217 32.622  -35.000 1.00 88.17  ? 283 GLU A N   1 
ATOM   1374 C CA  . GLU A 1 202 ? 24.406 33.785  -35.333 1.00 88.86  ? 283 GLU A CA  1 
ATOM   1375 C C   . GLU A 1 202 ? 24.617 34.136  -36.794 1.00 88.93  ? 283 GLU A C   1 
ATOM   1376 O O   . GLU A 1 202 ? 25.752 34.280  -37.247 1.00 88.16  ? 283 GLU A O   1 
ATOM   1377 C CB  . GLU A 1 202 ? 24.768 34.990  -34.465 1.00 90.54  ? 283 GLU A CB  1 
ATOM   1378 C CG  . GLU A 1 202 ? 23.979 35.107  -33.164 1.00 91.82  ? 283 GLU A CG  1 
ATOM   1379 C CD  . GLU A 1 202 ? 24.060 36.509  -32.569 1.00 93.16  ? 283 GLU A CD  1 
ATOM   1380 O OE1 . GLU A 1 202 ? 24.930 37.296  -33.008 1.00 92.45  ? 283 GLU A OE1 1 
ATOM   1381 O OE2 . GLU A 1 202 ? 23.259 36.824  -31.661 1.00 93.23  ? 283 GLU A OE2 1 
ATOM   1382 N N   . CYS A 1 203 ? 23.518 34.269  -37.529 1.00 89.68  ? 284 CYS A N   1 
ATOM   1383 C CA  . CYS A 1 203 ? 23.589 34.595  -38.946 1.00 91.12  ? 284 CYS A CA  1 
ATOM   1384 C C   . CYS A 1 203 ? 24.427 35.855  -39.153 1.00 93.23  ? 284 CYS A C   1 
ATOM   1385 O O   . CYS A 1 203 ? 24.461 36.733  -38.289 1.00 93.29  ? 284 CYS A O   1 
ATOM   1386 C CB  . CYS A 1 203 ? 22.185 34.806  -39.520 1.00 89.07  ? 284 CYS A CB  1 
ATOM   1387 S SG  . CYS A 1 203 ? 21.087 33.353  -39.626 1.00 87.92  ? 284 CYS A SG  1 
ATOM   1388 N N   . LYS A 1 204 ? 25.101 35.933  -40.299 1.00 95.76  ? 285 LYS A N   1 
ATOM   1389 C CA  . LYS A 1 204 ? 25.950 37.073  -40.632 1.00 98.25  ? 285 LYS A CA  1 
ATOM   1390 C C   . LYS A 1 204 ? 25.282 38.395  -40.292 1.00 100.60 ? 285 LYS A C   1 
ATOM   1391 O O   . LYS A 1 204 ? 25.684 39.077  -39.351 1.00 101.17 ? 285 LYS A O   1 
ATOM   1392 C CB  . LYS A 1 204 ? 26.313 37.056  -42.121 1.00 97.80  ? 285 LYS A CB  1 
ATOM   1393 C CG  . LYS A 1 204 ? 26.995 35.778  -42.571 1.00 98.43  ? 285 LYS A CG  1 
ATOM   1394 C CD  . LYS A 1 204 ? 28.166 35.420  -41.660 1.00 98.74  ? 285 LYS A CD  1 
ATOM   1395 C CE  . LYS A 1 204 ? 29.478 35.414  -42.418 1.00 98.68  ? 285 LYS A CE  1 
ATOM   1396 N NZ  . LYS A 1 204 ? 29.450 34.448  -43.552 1.00 99.23  ? 285 LYS A NZ  1 
ATOM   1397 N N   . HIS A 1 205 ? 24.261 38.755  -41.061 1.00 102.70 ? 286 HIS A N   1 
ATOM   1398 C CA  . HIS A 1 205 ? 23.544 40.002  -40.832 1.00 104.55 ? 286 HIS A CA  1 
ATOM   1399 C C   . HIS A 1 205 ? 22.053 39.799  -41.047 1.00 104.32 ? 286 HIS A C   1 
ATOM   1400 O O   . HIS A 1 205 ? 21.611 39.478  -42.147 1.00 104.53 ? 286 HIS A O   1 
ATOM   1401 C CB  . HIS A 1 205 ? 24.055 41.091  -41.783 1.00 107.37 ? 286 HIS A CB  1 
ATOM   1402 C CG  . HIS A 1 205 ? 25.506 41.419  -41.606 1.00 110.66 ? 286 HIS A CG  1 
ATOM   1403 N ND1 . HIS A 1 205 ? 26.004 41.997  -40.457 1.00 111.81 ? 286 HIS A ND1 1 
ATOM   1404 C CD2 . HIS A 1 205 ? 26.572 41.218  -42.418 1.00 111.82 ? 286 HIS A CD2 1 
ATOM   1405 C CE1 . HIS A 1 205 ? 27.313 42.136  -40.568 1.00 112.43 ? 286 HIS A CE1 1 
ATOM   1406 N NE2 . HIS A 1 205 ? 27.684 41.670  -41.748 1.00 112.79 ? 286 HIS A NE2 1 
ATOM   1407 N N   . PRO A 1 206 ? 21.257 39.968  -39.989 1.00 103.88 ? 287 PRO A N   1 
ATOM   1408 C CA  . PRO A 1 206 ? 19.811 39.795  -40.123 1.00 103.26 ? 287 PRO A CA  1 
ATOM   1409 C C   . PRO A 1 206 ? 19.110 41.135  -40.345 1.00 102.66 ? 287 PRO A C   1 
ATOM   1410 O O   . PRO A 1 206 ? 19.723 42.195  -40.201 1.00 102.65 ? 287 PRO A O   1 
ATOM   1411 C CB  . PRO A 1 206 ? 19.441 39.156  -38.800 1.00 103.69 ? 287 PRO A CB  1 
ATOM   1412 C CG  . PRO A 1 206 ? 20.344 39.875  -37.851 1.00 103.69 ? 287 PRO A CG  1 
ATOM   1413 C CD  . PRO A 1 206 ? 21.668 39.950  -38.575 1.00 103.55 ? 287 PRO A CD  1 
ATOM   1414 N N   . SER A 1 207 ? 17.827 41.079  -40.693 1.00 102.23 ? 288 SER A N   1 
ATOM   1415 C CA  . SER A 1 207 ? 17.032 42.280  -40.930 1.00 101.22 ? 288 SER A CA  1 
ATOM   1416 C C   . SER A 1 207 ? 15.553 42.011  -40.632 1.00 100.83 ? 288 SER A C   1 
ATOM   1417 O O   . SER A 1 207 ? 14.847 41.410  -41.443 1.00 100.33 ? 288 SER A O   1 
ATOM   1418 C CB  . SER A 1 207 ? 17.194 42.741  -42.383 1.00 100.71 ? 288 SER A CB  1 
ATOM   1419 O OG  . SER A 1 207 ? 18.560 42.911  -42.723 1.00 99.79  ? 288 SER A OG  1 
ATOM   1420 N N   . VAL A 1 208 ? 15.092 42.455  -39.465 1.00 100.80 ? 289 VAL A N   1 
ATOM   1421 C CA  . VAL A 1 208 ? 13.701 42.268  -39.057 1.00 100.59 ? 289 VAL A CA  1 
ATOM   1422 C C   . VAL A 1 208 ? 13.077 43.601  -38.655 1.00 100.40 ? 289 VAL A C   1 
ATOM   1423 O O   . VAL A 1 208 ? 13.341 44.026  -37.508 1.00 100.25 ? 289 VAL A O   1 
ATOM   1424 C CB  . VAL A 1 208 ? 13.589 41.297  -37.856 1.00 100.98 ? 289 VAL A CB  1 
ATOM   1425 C CG1 . VAL A 1 208 ? 12.128 41.109  -37.467 1.00 100.49 ? 289 VAL A CG1 1 
ATOM   1426 C CG2 . VAL A 1 208 ? 14.224 39.960  -38.206 1.00 100.68 ? 289 VAL A CG2 1 
HETATM 1427 O O   . HOH B 2 .   ? 6.621  21.256  -38.324 1.00 61.23  ? 401 HOH A O   1 
HETATM 1428 O O   . HOH B 2 .   ? 35.804 0.075   -53.586 1.00 45.93  ? 402 HOH A O   1 
HETATM 1429 O O   . HOH B 2 .   ? 18.928 8.041   -59.857 1.00 65.82  ? 403 HOH A O   1 
HETATM 1430 O O   . HOH B 2 .   ? 19.100 12.344  -34.528 1.00 46.48  ? 404 HOH A O   1 
HETATM 1431 O O   . HOH B 2 .   ? 12.326 -4.301  -40.922 1.00 35.27  ? 405 HOH A O   1 
HETATM 1432 O O   . HOH B 2 .   ? 16.974 6.863   -35.657 1.00 31.56  ? 406 HOH A O   1 
HETATM 1433 O O   . HOH B 2 .   ? 30.074 -20.516 -49.782 1.00 54.66  ? 407 HOH A O   1 
HETATM 1434 O O   . HOH B 2 .   ? 11.002 44.980  -37.268 1.00 50.17  ? 408 HOH A O   1 
HETATM 1435 O O   . HOH B 2 .   ? 38.472 3.033   -43.140 1.00 43.85  ? 409 HOH A O   1 
HETATM 1436 O O   . HOH B 2 .   ? 25.465 19.890  -48.899 1.00 38.28  ? 410 HOH A O   1 
HETATM 1437 O O   . HOH B 2 .   ? 11.652 10.072  -36.286 1.00 48.37  ? 411 HOH A O   1 
HETATM 1438 O O   . HOH B 2 .   ? 16.783 5.981   -48.809 1.00 29.37  ? 412 HOH A O   1 
HETATM 1439 O O   . HOH B 2 .   ? 18.942 -10.637 -46.581 1.00 33.77  ? 413 HOH A O   1 
HETATM 1440 O O   . HOH B 2 .   ? 17.500 14.391  -58.213 1.00 45.22  ? 414 HOH A O   1 
HETATM 1441 O O   . HOH B 2 .   ? 15.700 4.194   -38.691 1.00 38.80  ? 415 HOH A O   1 
HETATM 1442 O O   . HOH B 2 .   ? 14.762 0.355   -50.476 1.00 43.56  ? 416 HOH A O   1 
HETATM 1443 O O   . HOH B 2 .   ? 23.822 -7.258  -40.876 1.00 33.26  ? 417 HOH A O   1 
HETATM 1444 O O   . HOH B 2 .   ? 27.981 18.923  -47.164 1.00 43.78  ? 418 HOH A O   1 
HETATM 1445 O O   . HOH B 2 .   ? 16.209 4.349   -55.844 1.00 45.16  ? 419 HOH A O   1 
HETATM 1446 O O   . HOH B 2 .   ? 15.870 23.598  -49.795 1.00 47.86  ? 420 HOH A O   1 
HETATM 1447 O O   . HOH B 2 .   ? 14.906 7.714   -34.090 1.00 44.72  ? 421 HOH A O   1 
HETATM 1448 O O   . HOH B 2 .   ? 13.318 -5.330  -37.942 1.00 35.33  ? 422 HOH A O   1 
HETATM 1449 O O   . HOH B 2 .   ? 11.899 -7.839  -48.430 1.00 57.34  ? 423 HOH A O   1 
HETATM 1450 O O   . HOH B 2 .   ? 8.787  7.799   -35.796 1.00 43.03  ? 424 HOH A O   1 
HETATM 1451 O O   . HOH B 2 .   ? 32.293 2.519   -53.864 1.00 41.83  ? 425 HOH A O   1 
HETATM 1452 O O   . HOH B 2 .   ? 23.120 7.154   -38.697 1.00 47.48  ? 426 HOH A O   1 
HETATM 1453 O O   . HOH B 2 .   ? 24.504 -9.378  -43.682 1.00 37.35  ? 427 HOH A O   1 
HETATM 1454 O O   . HOH B 2 .   ? 21.121 20.344  -56.977 1.00 51.76  ? 428 HOH A O   1 
HETATM 1455 O O   . HOH B 2 .   ? 16.271 0.612   -37.866 1.00 35.23  ? 429 HOH A O   1 
HETATM 1456 O O   . HOH B 2 .   ? 28.408 -6.385  -56.236 1.00 48.18  ? 430 HOH A O   1 
HETATM 1457 O O   . HOH B 2 .   ? 13.603 -6.689  -52.986 1.00 49.73  ? 431 HOH A O   1 
HETATM 1458 O O   . HOH B 2 .   ? 6.858  10.242  -46.494 1.00 45.90  ? 432 HOH A O   1 
HETATM 1459 O O   . HOH B 2 .   ? 44.849 -5.421  -40.397 1.00 47.78  ? 433 HOH A O   1 
HETATM 1460 O O   . HOH B 2 .   ? 31.406 4.609   -52.333 1.00 42.51  ? 434 HOH A O   1 
HETATM 1461 O O   . HOH B 2 .   ? 12.747 6.585   -55.248 1.00 67.77  ? 435 HOH A O   1 
HETATM 1462 O O   . HOH B 2 .   ? 31.497 -6.243  -37.111 1.00 54.25  ? 436 HOH A O   1 
HETATM 1463 O O   . HOH B 2 .   ? 34.871 -14.748 -50.544 1.00 56.31  ? 437 HOH A O   1 
HETATM 1464 O O   . HOH B 2 .   ? 18.085 -7.943  -54.625 1.00 34.92  ? 438 HOH A O   1 
HETATM 1465 O O   . HOH B 2 .   ? 23.916 -5.026  -38.868 1.00 36.80  ? 439 HOH A O   1 
HETATM 1466 O O   . HOH B 2 .   ? 9.850  -0.820  -40.685 1.00 53.03  ? 440 HOH A O   1 
HETATM 1467 O O   . HOH B 2 .   ? 16.317 6.937   -38.287 1.00 31.51  ? 441 HOH A O   1 
HETATM 1468 O O   . HOH B 2 .   ? 27.801 -9.728  -44.610 1.00 48.33  ? 442 HOH A O   1 
HETATM 1469 O O   . HOH B 2 .   ? 8.618  1.962   -43.117 1.00 58.07  ? 443 HOH A O   1 
HETATM 1470 O O   . HOH B 2 .   ? 29.069 15.365  -58.721 1.00 49.41  ? 444 HOH A O   1 
HETATM 1471 O O   . HOH B 2 .   ? 27.687 13.804  -42.138 1.00 56.79  ? 445 HOH A O   1 
HETATM 1472 O O   . HOH B 2 .   ? 22.651 25.848  -52.005 1.00 53.33  ? 446 HOH A O   1 
HETATM 1473 O O   . HOH B 2 .   ? 13.497 -0.659  -46.828 1.00 55.24  ? 447 HOH A O   1 
HETATM 1474 O O   . HOH B 2 .   ? 38.267 -9.893  -50.627 1.00 33.99  ? 448 HOH A O   1 
HETATM 1475 O O   . HOH B 2 .   ? 4.010  7.913   -42.261 1.00 49.33  ? 449 HOH A O   1 
HETATM 1476 O O   . HOH B 2 .   ? 5.536  17.404  -33.456 1.00 58.10  ? 450 HOH A O   1 
HETATM 1477 O O   . HOH B 2 .   ? 34.308 13.303  -47.557 1.00 44.20  ? 451 HOH A O   1 
HETATM 1478 O O   . HOH B 2 .   ? 38.782 -4.957  -52.198 1.00 52.89  ? 452 HOH A O   1 
HETATM 1479 O O   . HOH B 2 .   ? 29.957 -9.260  -53.905 1.00 44.52  ? 453 HOH A O   1 
HETATM 1480 O O   . HOH B 2 .   ? 9.568  25.903  -26.176 1.00 58.57  ? 454 HOH A O   1 
HETATM 1481 O O   . HOH B 2 .   ? 32.100 1.450   -56.420 1.00 42.67  ? 455 HOH A O   1 
HETATM 1482 O O   . HOH B 2 .   ? 14.707 1.298   -47.965 1.00 46.69  ? 456 HOH A O   1 
HETATM 1483 O O   . HOH B 2 .   ? 9.582  7.506   -50.087 1.00 43.42  ? 457 HOH A O   1 
HETATM 1484 O O   . HOH B 2 .   ? 26.740 -2.626  -59.828 1.00 65.65  ? 458 HOH A O   1 
HETATM 1485 O O   . HOH B 2 .   ? 40.372 2.957   -50.301 1.00 51.10  ? 459 HOH A O   1 
HETATM 1486 O O   . HOH B 2 .   ? 30.299 15.774  -46.735 1.00 51.89  ? 460 HOH A O   1 
HETATM 1487 O O   . HOH B 2 .   ? 27.299 20.195  -34.264 1.00 64.49  ? 461 HOH A O   1 
HETATM 1488 O O   . HOH B 2 .   ? 14.105 26.852  -55.535 1.00 68.57  ? 462 HOH A O   1 
HETATM 1489 O O   . HOH B 2 .   ? 17.196 33.610  -52.686 1.00 59.57  ? 463 HOH A O   1 
HETATM 1490 O O   . HOH B 2 .   ? 11.155 -2.865  -44.190 1.00 57.70  ? 464 HOH A O   1 
HETATM 1491 O O   . HOH B 2 .   ? 14.460 13.420  -33.957 1.00 50.78  ? 465 HOH A O   1 
HETATM 1492 O O   . HOH B 2 .   ? 15.199 -8.506  -55.035 1.00 45.08  ? 466 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   82  ?   ?   ?   A . n 
A 1 2   SER 2   83  ?   ?   ?   A . n 
A 1 3   GLY 3   84  ?   ?   ?   A . n 
A 1 4   LEU 4   85  ?   ?   ?   A . n 
A 1 5   SER 5   86  ?   ?   ?   A . n 
A 1 6   ASN 6   87  87  ASN ASN A . n 
A 1 7   GLN 7   88  88  GLN GLN A . n 
A 1 8   LEU 8   89  89  LEU LEU A . n 
A 1 9   ALA 9   90  90  ALA ALA A . n 
A 1 10  VAL 10  91  91  VAL VAL A . n 
A 1 11  THR 11  92  92  THR THR A . n 
A 1 12  PHE 12  93  93  PHE PHE A . n 
A 1 13  ARG 13  94  94  ARG ARG A . n 
A 1 14  GLU 14  95  95  GLU GLU A . n 
A 1 15  GLU 15  96  96  GLU GLU A . n 
A 1 16  ASN 16  97  97  ASN ASN A . n 
A 1 17  THR 17  98  98  THR THR A . n 
A 1 18  ILE 18  99  99  ILE ILE A . n 
A 1 19  ALA 19  100 100 ALA ALA A . n 
A 1 20  PHE 20  101 101 PHE PHE A . n 
A 1 21  ARG 21  102 102 ARG ARG A . n 
A 1 22  HIS 22  103 103 HIS HIS A . n 
A 1 23  LEU 23  104 104 LEU LEU A . n 
A 1 24  PHE 24  105 105 PHE PHE A . n 
A 1 25  LEU 25  106 106 LEU LEU A . n 
A 1 26  LEU 26  107 107 LEU LEU A . n 
A 1 27  GLY 27  108 108 GLY GLY A . n 
A 1 28  TYR 28  109 109 TYR TYR A . n 
A 1 29  SER 29  110 110 SER SER A . n 
A 1 30  ASP 30  111 111 ASP ASP A . n 
A 1 31  GLY 31  112 112 GLY GLY A . n 
A 1 32  ALA 32  113 113 ALA ALA A . n 
A 1 33  ASP 33  114 114 ASP ASP A . n 
A 1 34  ASP 34  115 115 ASP ASP A . n 
A 1 35  THR 35  116 116 THR THR A . n 
A 1 36  PHE 36  117 117 PHE PHE A . n 
A 1 37  ALA 37  118 118 ALA ALA A . n 
A 1 38  ALA 38  119 119 ALA ALA A . n 
A 1 39  TYR 39  120 120 TYR TYR A . n 
A 1 40  THR 40  121 121 THR THR A . n 
A 1 41  ARG 41  122 122 ARG ARG A . n 
A 1 42  GLU 42  123 123 GLU GLU A . n 
A 1 43  GLN 43  124 124 GLN GLN A . n 
A 1 44  LEU 44  125 125 LEU LEU A . n 
A 1 45  TYR 45  126 126 TYR TYR A . n 
A 1 46  GLN 46  127 127 GLN GLN A . n 
A 1 47  ALA 47  128 128 ALA ALA A . n 
A 1 48  ILE 48  129 129 ILE ILE A . n 
A 1 49  PHE 49  130 130 PHE PHE A . n 
A 1 50  HIS 50  131 131 HIS HIS A . n 
A 1 51  ALA 51  132 132 ALA ALA A . n 
A 1 52  VAL 52  133 133 VAL VAL A . n 
A 1 53  ASP 53  134 134 ASP ASP A . n 
A 1 54  GLN 54  135 135 GLN GLN A . n 
A 1 55  TYR 55  136 136 TYR TYR A . n 
A 1 56  LEU 56  137 137 LEU LEU A . n 
A 1 57  ALA 57  138 138 ALA ALA A . n 
A 1 58  LEU 58  139 139 LEU LEU A . n 
A 1 59  PRO 59  140 140 PRO PRO A . n 
A 1 60  ASP 60  141 141 ASP ASP A . n 
A 1 61  VAL 61  142 142 VAL VAL A . n 
A 1 62  SER 62  143 143 SER SER A . n 
A 1 63  LEU 63  144 144 LEU LEU A . n 
A 1 64  GLY 64  145 145 GLY GLY A . n 
A 1 65  ARG 65  146 146 ARG ARG A . n 
A 1 66  TYR 66  147 147 TYR TYR A . n 
A 1 67  ALA 67  148 148 ALA ALA A . n 
A 1 68  TYR 68  149 149 TYR TYR A . n 
A 1 69  VAL 69  150 150 VAL VAL A . n 
A 1 70  ARG 70  151 151 ARG ARG A . n 
A 1 71  GLY 71  152 ?   ?   ?   A . n 
A 1 72  GLY 72  153 ?   ?   ?   A . n 
A 1 73  GLY 73  154 ?   ?   ?   A . n 
A 1 74  ASP 74  155 ?   ?   ?   A . n 
A 1 75  PRO 75  156 ?   ?   ?   A . n 
A 1 76  TRP 76  157 ?   ?   ?   A . n 
A 1 77  THR 77  158 ?   ?   ?   A . n 
A 1 78  ASN 78  159 ?   ?   ?   A . n 
A 1 79  GLY 79  160 ?   ?   ?   A . n 
A 1 80  SER 80  161 161 SER SER A . n 
A 1 81  GLY 81  162 162 GLY GLY A . n 
A 1 82  LEU 82  163 163 LEU LEU A . n 
A 1 83  ALA 83  164 164 ALA ALA A . n 
A 1 84  LEU 84  165 165 LEU LEU A . n 
A 1 85  CYS 85  166 166 CYS CYS A . n 
A 1 86  GLN 86  167 167 GLN GLN A . n 
A 1 87  ARG 87  168 168 ARG ARG A . n 
A 1 88  TYR 88  169 169 TYR TYR A . n 
A 1 89  TYR 89  170 170 TYR TYR A . n 
A 1 90  HIS 90  171 171 HIS HIS A . n 
A 1 91  ARG 91  172 172 ARG ARG A . n 
A 1 92  GLY 92  173 173 GLY GLY A . n 
A 1 93  HIS 93  174 174 HIS HIS A . n 
A 1 94  VAL 94  175 175 VAL VAL A . n 
A 1 95  ASP 95  176 176 ASP ASP A . n 
A 1 96  PRO 96  177 177 PRO PRO A . n 
A 1 97  ALA 97  178 178 ALA ALA A . n 
A 1 98  ASN 98  179 179 ASN ASN A . n 
A 1 99  ASP 99  180 180 ASP ASP A . n 
A 1 100 THR 100 181 181 THR THR A . n 
A 1 101 PHE 101 182 182 PHE PHE A . n 
A 1 102 ASP 102 183 183 ASP ASP A . n 
A 1 103 ILE 103 184 184 ILE ILE A . n 
A 1 104 ASP 104 185 185 ASP ASP A . n 
A 1 105 PRO 105 186 186 PRO PRO A . n 
A 1 106 MET 106 187 187 MET MET A . n 
A 1 107 VAL 107 188 188 VAL VAL A . n 
A 1 108 VAL 108 189 189 VAL VAL A . n 
A 1 109 THR 109 190 190 THR THR A . n 
A 1 110 ASP 110 191 191 ASP ASP A . n 
A 1 111 CYS 111 192 192 CYS CYS A . n 
A 1 112 ILE 112 193 193 ILE ILE A . n 
A 1 113 GLN 113 194 194 GLN GLN A . n 
A 1 114 VAL 114 195 195 VAL VAL A . n 
A 1 115 ASP 115 196 196 ASP ASP A . n 
A 1 116 PRO 116 197 197 PRO PRO A . n 
A 1 117 PRO 117 198 198 PRO PRO A . n 
A 1 118 GLU 118 199 199 GLU GLU A . n 
A 1 119 ARG 119 200 ?   ?   ?   A . n 
A 1 120 PRO 120 201 ?   ?   ?   A . n 
A 1 121 PRO 121 202 ?   ?   ?   A . n 
A 1 122 PRO 122 203 ?   ?   ?   A . n 
A 1 123 PRO 123 204 ?   ?   ?   A . n 
A 1 124 PRO 124 205 ?   ?   ?   A . n 
A 1 125 SER 125 206 ?   ?   ?   A . n 
A 1 126 ASP 126 207 ?   ?   ?   A . n 
A 1 127 ASP 127 208 ?   ?   ?   A . n 
A 1 128 LEU 128 209 ?   ?   ?   A . n 
A 1 129 THR 129 210 ?   ?   ?   A . n 
A 1 130 LEU 130 211 ?   ?   ?   A . n 
A 1 131 LEU 131 212 ?   ?   ?   A . n 
A 1 132 GLU 132 213 ?   ?   ?   A . n 
A 1 133 SER 133 214 ?   ?   ?   A . n 
A 1 134 SER 134 215 ?   ?   ?   A . n 
A 1 135 SER 135 216 ?   ?   ?   A . n 
A 1 136 SER 136 217 ?   ?   ?   A . n 
A 1 137 TYR 137 218 218 TYR TYR A . n 
A 1 138 LYS 138 219 219 LYS LYS A . n 
A 1 139 ASN 139 220 220 ASN ASN A . n 
A 1 140 LEU 140 221 221 LEU LEU A . n 
A 1 141 THR 141 222 222 THR THR A . n 
A 1 142 LEU 142 223 223 LEU LEU A . n 
A 1 143 LYS 143 224 224 LYS LYS A . n 
A 1 144 PHE 144 225 225 PHE PHE A . n 
A 1 145 HIS 145 226 226 HIS HIS A . n 
A 1 146 LYS 146 227 227 LYS LYS A . n 
A 1 147 LEU 147 228 228 LEU LEU A . n 
A 1 148 VAL 148 229 229 VAL VAL A . n 
A 1 149 ASN 149 230 230 ASN ASN A . n 
A 1 150 VAL 150 231 231 VAL VAL A . n 
A 1 151 THR 151 232 232 THR THR A . n 
A 1 152 ILE 152 233 233 ILE ILE A . n 
A 1 153 HIS 153 234 234 HIS HIS A . n 
A 1 154 PHE 154 235 235 PHE PHE A . n 
A 1 155 ARG 155 236 236 ARG ARG A . n 
A 1 156 LEU 156 237 237 LEU LEU A . n 
A 1 157 LYS 157 238 238 LYS LYS A . n 
A 1 158 THR 158 239 239 THR THR A . n 
A 1 159 ILE 159 240 240 ILE ILE A . n 
A 1 160 ASN 160 241 241 ASN ASN A . n 
A 1 161 LEU 161 242 242 LEU LEU A . n 
A 1 162 GLN 162 243 243 GLN GLN A . n 
A 1 163 SER 163 244 244 SER SER A . n 
A 1 164 LEU 164 245 245 LEU LEU A . n 
A 1 165 ILE 165 246 246 ILE ILE A . n 
A 1 166 ASN 166 247 247 ASN ASN A . n 
A 1 167 ASN 167 248 248 ASN ASN A . n 
A 1 168 GLU 168 249 249 GLU GLU A . n 
A 1 169 ILE 169 250 250 ILE ILE A . n 
A 1 170 PRO 170 251 251 PRO PRO A . n 
A 1 171 ASP 171 252 252 ASP ASP A . n 
A 1 172 CYS 172 253 253 CYS CYS A . n 
A 1 173 TYR 173 254 254 TYR TYR A . n 
A 1 174 THR 174 255 255 THR THR A . n 
A 1 175 PHE 175 256 256 PHE PHE A . n 
A 1 176 SER 176 257 257 SER SER A . n 
A 1 177 VAL 177 258 258 VAL VAL A . n 
A 1 178 LEU 178 259 259 LEU LEU A . n 
A 1 179 ILE 179 260 260 ILE ILE A . n 
A 1 180 THR 180 261 261 THR THR A . n 
A 1 181 PHE 181 262 262 PHE PHE A . n 
A 1 182 ASP 182 263 263 ASP ASP A . n 
A 1 183 ASN 183 264 264 ASN ASN A . n 
A 1 184 LYS 184 265 265 LYS LYS A . n 
A 1 185 ALA 185 266 266 ALA ALA A . n 
A 1 186 HIS 186 267 267 HIS HIS A . n 
A 1 187 SER 187 268 268 SER SER A . n 
A 1 188 GLY 188 269 269 GLY GLY A . n 
A 1 189 ARG 189 270 270 ARG ARG A . n 
A 1 190 ILE 190 271 271 ILE ILE A . n 
A 1 191 PRO 191 272 272 PRO PRO A . n 
A 1 192 ILE 192 273 273 ILE ILE A . n 
A 1 193 SER 193 274 274 SER SER A . n 
A 1 194 LEU 194 275 275 LEU LEU A . n 
A 1 195 GLU 195 276 276 GLU GLU A . n 
A 1 196 THR 196 277 277 THR THR A . n 
A 1 197 GLN 197 278 278 GLN GLN A . n 
A 1 198 ALA 198 279 279 ALA ALA A . n 
A 1 199 HIS 199 280 280 HIS HIS A . n 
A 1 200 ILE 200 281 281 ILE ILE A . n 
A 1 201 GLN 201 282 282 GLN GLN A . n 
A 1 202 GLU 202 283 283 GLU GLU A . n 
A 1 203 CYS 203 284 284 CYS CYS A . n 
A 1 204 LYS 204 285 285 LYS LYS A . n 
A 1 205 HIS 205 286 286 HIS HIS A . n 
A 1 206 PRO 206 287 287 PRO PRO A . n 
A 1 207 SER 207 288 288 SER SER A . n 
A 1 208 VAL 208 289 289 VAL VAL A . n 
A 1 209 PHE 209 290 ?   ?   ?   A . n 
A 1 210 GLN 210 291 ?   ?   ?   A . n 
A 1 211 HIS 211 292 ?   ?   ?   A . n 
A 1 212 GLY 212 293 ?   ?   ?   A . n 
A 1 213 ASP 213 294 ?   ?   ?   A . n 
A 1 214 ASN 214 295 ?   ?   ?   A . n 
A 1 215 SER 215 296 ?   ?   ?   A . n 
A 1 216 LEU 216 297 ?   ?   ?   A . n 
A 1 217 GLU 217 298 ?   ?   ?   A . n 
A 1 218 HIS 218 299 ?   ?   ?   A . n 
A 1 219 HIS 219 300 ?   ?   ?   A . n 
A 1 220 HIS 220 301 ?   ?   ?   A . n 
A 1 221 HIS 221 302 ?   ?   ?   A . n 
A 1 222 HIS 222 303 ?   ?   ?   A . n 
A 1 223 HIS 223 304 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1  401 39 HOH WAT A . 
B 2 HOH 2  402 19 HOH WAT A . 
B 2 HOH 3  403 56 HOH WAT A . 
B 2 HOH 4  404 64 HOH WAT A . 
B 2 HOH 5  405 13 HOH WAT A . 
B 2 HOH 6  406 3  HOH WAT A . 
B 2 HOH 7  407 18 HOH WAT A . 
B 2 HOH 8  408 41 HOH WAT A . 
B 2 HOH 9  409 7  HOH WAT A . 
B 2 HOH 10 410 57 HOH WAT A . 
B 2 HOH 11 411 38 HOH WAT A . 
B 2 HOH 12 412 2  HOH WAT A . 
B 2 HOH 13 413 21 HOH WAT A . 
B 2 HOH 14 414 30 HOH WAT A . 
B 2 HOH 15 415 37 HOH WAT A . 
B 2 HOH 16 416 45 HOH WAT A . 
B 2 HOH 17 417 11 HOH WAT A . 
B 2 HOH 18 418 28 HOH WAT A . 
B 2 HOH 19 419 23 HOH WAT A . 
B 2 HOH 20 420 36 HOH WAT A . 
B 2 HOH 21 421 55 HOH WAT A . 
B 2 HOH 22 422 5  HOH WAT A . 
B 2 HOH 23 423 65 HOH WAT A . 
B 2 HOH 24 424 14 HOH WAT A . 
B 2 HOH 25 425 25 HOH WAT A . 
B 2 HOH 26 426 53 HOH WAT A . 
B 2 HOH 27 427 4  HOH WAT A . 
B 2 HOH 28 428 48 HOH WAT A . 
B 2 HOH 29 429 12 HOH WAT A . 
B 2 HOH 30 430 33 HOH WAT A . 
B 2 HOH 31 431 32 HOH WAT A . 
B 2 HOH 32 432 27 HOH WAT A . 
B 2 HOH 33 433 63 HOH WAT A . 
B 2 HOH 34 434 43 HOH WAT A . 
B 2 HOH 35 435 61 HOH WAT A . 
B 2 HOH 36 436 17 HOH WAT A . 
B 2 HOH 37 437 62 HOH WAT A . 
B 2 HOH 38 438 8  HOH WAT A . 
B 2 HOH 39 439 6  HOH WAT A . 
B 2 HOH 40 440 46 HOH WAT A . 
B 2 HOH 41 441 20 HOH WAT A . 
B 2 HOH 42 442 15 HOH WAT A . 
B 2 HOH 43 443 47 HOH WAT A . 
B 2 HOH 44 444 22 HOH WAT A . 
B 2 HOH 45 445 16 HOH WAT A . 
B 2 HOH 46 446 31 HOH WAT A . 
B 2 HOH 47 447 26 HOH WAT A . 
B 2 HOH 48 448 1  HOH WAT A . 
B 2 HOH 49 449 58 HOH WAT A . 
B 2 HOH 50 450 44 HOH WAT A . 
B 2 HOH 51 451 29 HOH WAT A . 
B 2 HOH 52 452 60 HOH WAT A . 
B 2 HOH 53 453 10 HOH WAT A . 
B 2 HOH 54 454 9  HOH WAT A . 
B 2 HOH 55 455 24 HOH WAT A . 
B 2 HOH 56 456 42 HOH WAT A . 
B 2 HOH 57 457 40 HOH WAT A . 
B 2 HOH 58 458 34 HOH WAT A . 
B 2 HOH 59 459 52 HOH WAT A . 
B 2 HOH 60 460 35 HOH WAT A . 
B 2 HOH 61 461 66 HOH WAT A . 
B 2 HOH 62 462 49 HOH WAT A . 
B 2 HOH 63 463 51 HOH WAT A . 
B 2 HOH 64 464 50 HOH WAT A . 
B 2 HOH 65 465 59 HOH WAT A . 
B 2 HOH 66 466 54 HOH WAT A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 11060 ? 
1 MORE         -75   ? 
1 'SSA (A^2)'  32310 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z   1.0000000000  0.0000000000  0.0000000000 0.0000000000 0.0000000000  1.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_555  -x,-y,z -1.0000000000 0.0000000000  0.0000000000 0.0000000000 0.0000000000  -1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 15_555 y,-x,z  0.0000000000  1.0000000000  0.0000000000 0.0000000000 -1.0000000000 0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 16_555 -y,x,z  0.0000000000  -1.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-01-25 
2 'Structure model' 1 1 2017-02-08 
3 'Structure model' 1 2 2017-03-15 
4 'Structure model' 1 3 2017-09-27 
5 'Structure model' 1 4 2019-12-18 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' 'Database references'        
3 4 'Structure model' 'Author supporting evidence' 
4 5 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' pdbx_audit_support 
2 5 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_pdbx_audit_support.funding_organization' 
2 5 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
_phasing.method   MR 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    1 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .    2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? CNS         ? ? ? .    3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .    5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 180 ? ? 48.53   29.60  
2 1 PRO A 198 ? ? -67.42  55.55  
3 1 LYS A 227 ? ? -145.32 30.23  
4 1 ASN A 230 ? ? 178.80  172.45 
5 1 LYS A 285 ? ? -43.95  -71.13 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 82  ? A GLY 1   
2  1 Y 1 A SER 83  ? A SER 2   
3  1 Y 1 A GLY 84  ? A GLY 3   
4  1 Y 1 A LEU 85  ? A LEU 4   
5  1 Y 1 A SER 86  ? A SER 5   
6  1 Y 1 A GLY 152 ? A GLY 71  
7  1 Y 1 A GLY 153 ? A GLY 72  
8  1 Y 1 A GLY 154 ? A GLY 73  
9  1 Y 1 A ASP 155 ? A ASP 74  
10 1 Y 1 A PRO 156 ? A PRO 75  
11 1 Y 1 A TRP 157 ? A TRP 76  
12 1 Y 1 A THR 158 ? A THR 77  
13 1 Y 1 A ASN 159 ? A ASN 78  
14 1 Y 1 A GLY 160 ? A GLY 79  
15 1 Y 1 A ARG 200 ? A ARG 119 
16 1 Y 1 A PRO 201 ? A PRO 120 
17 1 Y 1 A PRO 202 ? A PRO 121 
18 1 Y 1 A PRO 203 ? A PRO 122 
19 1 Y 1 A PRO 204 ? A PRO 123 
20 1 Y 1 A PRO 205 ? A PRO 124 
21 1 Y 1 A SER 206 ? A SER 125 
22 1 Y 1 A ASP 207 ? A ASP 126 
23 1 Y 1 A ASP 208 ? A ASP 127 
24 1 Y 1 A LEU 209 ? A LEU 128 
25 1 Y 1 A THR 210 ? A THR 129 
26 1 Y 1 A LEU 211 ? A LEU 130 
27 1 Y 1 A LEU 212 ? A LEU 131 
28 1 Y 1 A GLU 213 ? A GLU 132 
29 1 Y 1 A SER 214 ? A SER 133 
30 1 Y 1 A SER 215 ? A SER 134 
31 1 Y 1 A SER 216 ? A SER 135 
32 1 Y 1 A SER 217 ? A SER 136 
33 1 Y 1 A PHE 290 ? A PHE 209 
34 1 Y 1 A GLN 291 ? A GLN 210 
35 1 Y 1 A HIS 292 ? A HIS 211 
36 1 Y 1 A GLY 293 ? A GLY 212 
37 1 Y 1 A ASP 294 ? A ASP 213 
38 1 Y 1 A ASN 295 ? A ASN 214 
39 1 Y 1 A SER 296 ? A SER 215 
40 1 Y 1 A LEU 297 ? A LEU 216 
41 1 Y 1 A GLU 298 ? A GLU 217 
42 1 Y 1 A HIS 299 ? A HIS 218 
43 1 Y 1 A HIS 300 ? A HIS 219 
44 1 Y 1 A HIS 301 ? A HIS 220 
45 1 Y 1 A HIS 302 ? A HIS 221 
46 1 Y 1 A HIS 303 ? A HIS 222 
47 1 Y 1 A HIS 304 ? A HIS 223 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)'          'United States' R01GM085234  1 
'National Institutes of Health/National Institute of Neurological Disorders and Stroke (NIH/NINDS)' 'United States' RO1NS053494  2 
'National Basic Research Program of China (973 Program)'                                            China           2014CB910301 3 
'National Natural Science Foundation of China (NSFC)'                                               China           31370821     4 
'Top Talents Program of Yunnan Province'                                                            China           2011HA012    5 
'High-level Overseas Talents of Yunnan Province'                                                    China           ?            6 
'China Youth 1000-Talent Program of the State Council of China'                                     China           ?            7 
'Beijing Advanced Innovation Center for Structural Biology'                                         China           ?            8 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#