data_5TKM
# 
_entry.id   5TKM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TKM         
WWPDB D_1000224236 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TKM 
_pdbx_database_status.recvd_initial_deposition_date   2016-10-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Xiao, X.'       1 
'Yang, H.'       2 
'Arutiunian, V.' 3 
'Besse, G.'      4 
'Morimoto, C.'   5 
'Zirkle, B.'     6 
'Chen, X.S.'     7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            45 
_citation.language                  ? 
_citation.page_first                7494 
_citation.page_last                 7506 
_citation.title                     
'Structural determinants of APOBEC3B non-catalytic domain for molecular assembly and catalytic regulation.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkx362 
_citation.pdbx_database_id_PubMed   28575276 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Xiao, X.'       1 ? 
primary 'Yang, H.'       2 ? 
primary 'Arutiunian, V.' 3 ? 
primary 'Fang, Y.'       4 ? 
primary 'Besse, G.'      5 ? 
primary 'Morimoto, C.'   6 ? 
primary 'Zirkle, B.'     7 ? 
primary 'Chen, X.S.'     8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5TKM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     60.739 
_cell.length_a_esd                 ? 
_cell.length_b                     60.802 
_cell.length_b_esd                 ? 
_cell.length_c                     111.515 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5TKM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA dC->dU-editing enzyme APOBEC-3B' 23583.730 2   3.5.4.- 'Y13D, Y28S, Y83D, W127S, Y146K, Y162D, Y191H' ? ? 
2 non-polymer nat 'ZINC ION'                            65.409    2   ?       ?                                              ? ? 
3 water       nat water                                 18.015    234 ?       ?                                              ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'A3B,Phorbolin-1-related protein,Phorbolin-2/3' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPGGSGGMNPQIRNPMERMDRDTFYDNFENEPILSGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAEMCFLS
WFCGNQLPADKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYSERDYRRALCRLSQAGARVKIMDYEEF
AYCWENFVDNEGQQFMPWYKFDENYAFLHRTLKEILRH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPGGSGGMNPQIRNPMERMDRDTFYDNFENEPILSGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAEMCFLS
WFCGNQLPADKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYSERDYRRALCRLSQAGARVKIMDYEEF
AYCWENFVDNEGQQFMPWYKFDENYAFLHRTLKEILRH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   GLY n 
1 5   SER n 
1 6   GLY n 
1 7   GLY n 
1 8   MET n 
1 9   ASN n 
1 10  PRO n 
1 11  GLN n 
1 12  ILE n 
1 13  ARG n 
1 14  ASN n 
1 15  PRO n 
1 16  MET n 
1 17  GLU n 
1 18  ARG n 
1 19  MET n 
1 20  ASP n 
1 21  ARG n 
1 22  ASP n 
1 23  THR n 
1 24  PHE n 
1 25  TYR n 
1 26  ASP n 
1 27  ASN n 
1 28  PHE n 
1 29  GLU n 
1 30  ASN n 
1 31  GLU n 
1 32  PRO n 
1 33  ILE n 
1 34  LEU n 
1 35  SER n 
1 36  GLY n 
1 37  ARG n 
1 38  SER n 
1 39  TYR n 
1 40  THR n 
1 41  TRP n 
1 42  LEU n 
1 43  CYS n 
1 44  TYR n 
1 45  GLU n 
1 46  VAL n 
1 47  LYS n 
1 48  ILE n 
1 49  LYS n 
1 50  ARG n 
1 51  GLY n 
1 52  ARG n 
1 53  SER n 
1 54  ASN n 
1 55  LEU n 
1 56  LEU n 
1 57  TRP n 
1 58  ASP n 
1 59  THR n 
1 60  GLY n 
1 61  VAL n 
1 62  PHE n 
1 63  ARG n 
1 64  GLY n 
1 65  GLN n 
1 66  VAL n 
1 67  TYR n 
1 68  PHE n 
1 69  LYS n 
1 70  PRO n 
1 71  GLN n 
1 72  TYR n 
1 73  HIS n 
1 74  ALA n 
1 75  GLU n 
1 76  MET n 
1 77  CYS n 
1 78  PHE n 
1 79  LEU n 
1 80  SER n 
1 81  TRP n 
1 82  PHE n 
1 83  CYS n 
1 84  GLY n 
1 85  ASN n 
1 86  GLN n 
1 87  LEU n 
1 88  PRO n 
1 89  ALA n 
1 90  ASP n 
1 91  LYS n 
1 92  CYS n 
1 93  PHE n 
1 94  GLN n 
1 95  ILE n 
1 96  THR n 
1 97  TRP n 
1 98  PHE n 
1 99  VAL n 
1 100 SER n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 CYS n 
1 105 PRO n 
1 106 ASP n 
1 107 CYS n 
1 108 VAL n 
1 109 ALA n 
1 110 LYS n 
1 111 LEU n 
1 112 ALA n 
1 113 GLU n 
1 114 PHE n 
1 115 LEU n 
1 116 SER n 
1 117 GLU n 
1 118 HIS n 
1 119 PRO n 
1 120 ASN n 
1 121 VAL n 
1 122 THR n 
1 123 LEU n 
1 124 THR n 
1 125 ILE n 
1 126 SER n 
1 127 ALA n 
1 128 ALA n 
1 129 ARG n 
1 130 LEU n 
1 131 TYR n 
1 132 TYR n 
1 133 TYR n 
1 134 SER n 
1 135 GLU n 
1 136 ARG n 
1 137 ASP n 
1 138 TYR n 
1 139 ARG n 
1 140 ARG n 
1 141 ALA n 
1 142 LEU n 
1 143 CYS n 
1 144 ARG n 
1 145 LEU n 
1 146 SER n 
1 147 GLN n 
1 148 ALA n 
1 149 GLY n 
1 150 ALA n 
1 151 ARG n 
1 152 VAL n 
1 153 LYS n 
1 154 ILE n 
1 155 MET n 
1 156 ASP n 
1 157 TYR n 
1 158 GLU n 
1 159 GLU n 
1 160 PHE n 
1 161 ALA n 
1 162 TYR n 
1 163 CYS n 
1 164 TRP n 
1 165 GLU n 
1 166 ASN n 
1 167 PHE n 
1 168 VAL n 
1 169 ASP n 
1 170 ASN n 
1 171 GLU n 
1 172 GLY n 
1 173 GLN n 
1 174 GLN n 
1 175 PHE n 
1 176 MET n 
1 177 PRO n 
1 178 TRP n 
1 179 TYR n 
1 180 LYS n 
1 181 PHE n 
1 182 ASP n 
1 183 GLU n 
1 184 ASN n 
1 185 TYR n 
1 186 ALA n 
1 187 PHE n 
1 188 LEU n 
1 189 HIS n 
1 190 ARG n 
1 191 THR n 
1 192 LEU n 
1 193 LYS n 
1 194 GLU n 
1 195 ILE n 
1 196 LEU n 
1 197 ARG n 
1 198 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   198 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 APOBEC3B 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli K-12' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     83333 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ABC3B_HUMAN 
_struct_ref.pdbx_db_accession          Q9UH17 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MNPQIRNPMERMYRDTFYDNFENEPILYGRSYTWLCYEVKIKRGRSNLLWDTGVFRGQVYFKPQYHAEMCFLSWFCGNQL
PAYKCFQITWFVSWTPCPDCVAKLAEFLSEHPNVTLTISAARLYYYWERDYRRALCRLSQAGARVTIMDYEEFAYCWENF
VYNEGQQFMPWYKFDENYAFLHRTLKEILRY
;
_struct_ref.pdbx_align_begin           1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5TKM A 8 ? 198 ? Q9UH17 1 ? 191 ? 1 191 
2 1 5TKM B 8 ? 198 ? Q9UH17 1 ? 191 ? 1 191 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5TKM GLY A 1   ? UNP Q9UH17 ?   ?   'expression tag'      -6  1  
1 5TKM PRO A 2   ? UNP Q9UH17 ?   ?   'expression tag'      -5  2  
1 5TKM GLY A 3   ? UNP Q9UH17 ?   ?   'expression tag'      -4  3  
1 5TKM GLY A 4   ? UNP Q9UH17 ?   ?   'expression tag'      -3  4  
1 5TKM SER A 5   ? UNP Q9UH17 ?   ?   'expression tag'      -2  5  
1 5TKM GLY A 6   ? UNP Q9UH17 ?   ?   'expression tag'      -1  6  
1 5TKM GLY A 7   ? UNP Q9UH17 ?   ?   'expression tag'      0   7  
1 5TKM ASP A 20  ? UNP Q9UH17 TYR 13  'engineered mutation' 13  8  
1 5TKM SER A 35  ? UNP Q9UH17 TYR 28  'engineered mutation' 28  9  
1 5TKM ASP A 90  ? UNP Q9UH17 TYR 83  'engineered mutation' 83  10 
1 5TKM SER A 134 ? UNP Q9UH17 TRP 127 'engineered mutation' 127 11 
1 5TKM LYS A 153 ? UNP Q9UH17 THR 146 'engineered mutation' 146 12 
1 5TKM ASP A 169 ? UNP Q9UH17 TYR 162 'engineered mutation' 162 13 
1 5TKM HIS A 198 ? UNP Q9UH17 TYR 191 'engineered mutation' 191 14 
2 5TKM GLY B 1   ? UNP Q9UH17 ?   ?   'expression tag'      -6  15 
2 5TKM PRO B 2   ? UNP Q9UH17 ?   ?   'expression tag'      -5  16 
2 5TKM GLY B 3   ? UNP Q9UH17 ?   ?   'expression tag'      -4  17 
2 5TKM GLY B 4   ? UNP Q9UH17 ?   ?   'expression tag'      -3  18 
2 5TKM SER B 5   ? UNP Q9UH17 ?   ?   'expression tag'      -2  19 
2 5TKM GLY B 6   ? UNP Q9UH17 ?   ?   'expression tag'      -1  20 
2 5TKM GLY B 7   ? UNP Q9UH17 ?   ?   'expression tag'      0   21 
2 5TKM ASP B 20  ? UNP Q9UH17 TYR 13  'engineered mutation' 13  22 
2 5TKM SER B 35  ? UNP Q9UH17 TYR 28  'engineered mutation' 28  23 
2 5TKM ASP B 90  ? UNP Q9UH17 TYR 83  'engineered mutation' 83  24 
2 5TKM SER B 134 ? UNP Q9UH17 TRP 127 'engineered mutation' 127 25 
2 5TKM LYS B 153 ? UNP Q9UH17 THR 146 'engineered mutation' 146 26 
2 5TKM ASP B 169 ? UNP Q9UH17 TYR 162 'engineered mutation' 162 27 
2 5TKM HIS B 198 ? UNP Q9UH17 TYR 191 'engineered mutation' 191 28 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TKM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.23 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         44.77 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'0.01 M Iron (III) chloride hexahydrate, 0.1 M sodium citrate dehydrate pH 5.6, 10% v/v Jeffamine M-600' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-10-25 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5TKM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.90 
_reflns.d_resolution_low                 50.00 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       33189 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.3 
_reflns.pdbx_Rmerge_I_obs                0.066 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            29.19 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5TKM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.900 
_refine.ls_d_res_low                             30.370 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     33127 
_refine.ls_number_reflns_R_free                  1993 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.56 
_refine.ls_percent_reflns_R_free                 6.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1886 
_refine.ls_R_factor_R_free                       0.2027 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1877 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5K81 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 20.59 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.17 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3132 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             234 
_refine_hist.number_atoms_total               3368 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        30.370 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 3234 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.793  ? 4382 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.428 ? 1174 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.053  ? 428  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 564  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8997 1.9472  . . 135 2098 97.00  . . . 0.2902 . 0.2394 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9472 1.9998  . . 144 2212 100.00 . . . 0.2661 . 0.2263 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9998 2.0586  . . 140 2183 100.00 . . . 0.2367 . 0.2114 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0586 2.1251  . . 137 2204 100.00 . . . 0.2500 . 0.2163 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.1251 2.2010  . . 142 2223 100.00 . . . 0.2377 . 0.2144 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2010 2.2891  . . 138 2187 100.00 . . . 0.2467 . 0.1970 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2891 2.3932  . . 142 2221 100.00 . . . 0.2294 . 0.2052 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3932 2.5193  . . 147 2213 100.00 . . . 0.1833 . 0.2085 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5193 2.6771  . . 142 2229 100.00 . . . 0.2173 . 0.1970 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6771 2.8836  . . 141 2263 100.00 . . . 0.1934 . 0.1988 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8836 3.1736  . . 143 2230 100.00 . . . 0.1791 . 0.1832 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1736 3.6321  . . 141 2246 100.00 . . . 0.1931 . 0.1725 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6321 4.5736  . . 150 2283 100.00 . . . 0.1747 . 0.1538 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.5736 30.3734 . . 151 2342 97.00  . . . 0.2040 . 0.1927 . . . . . . . . . . 
# 
_struct.entry_id                     5TKM 
_struct.title                        'Crystal structure of human APOBEC3B N-terminal Domain' 
_struct.pdbx_descriptor              'DNA dC->dU-editing enzyme APOBEC-3B (E.C.3.5.4.-)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TKM 
_struct_keywords.text            'HYDROLASE, DEAMINASE, APOBEC' 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 21  ? GLU A 29  ? ARG A 14  GLU A 22  1 ? 9  
HELX_P HELX_P2  AA2 LYS A 69  ? TYR A 72  ? LYS A 62  TYR A 65  5 ? 4  
HELX_P HELX_P3  AA3 HIS A 73  ? GLN A 86  ? HIS A 66  GLN A 79  1 ? 14 
HELX_P HELX_P4  AA4 CYS A 104 ? HIS A 118 ? CYS A 97  HIS A 111 1 ? 15 
HELX_P HELX_P5  AA5 SER A 134 ? ARG A 139 ? SER A 127 ARG A 132 1 ? 6  
HELX_P HELX_P6  AA6 ARG A 140 ? ALA A 148 ? ARG A 133 ALA A 141 1 ? 9  
HELX_P HELX_P7  AA7 ASP A 156 ? PHE A 167 ? ASP A 149 PHE A 160 1 ? 12 
HELX_P HELX_P8  AA8 LYS A 180 ? LEU A 196 ? LYS A 173 LEU A 189 1 ? 17 
HELX_P HELX_P9  AA9 ARG B 21  ? GLU B 29  ? ARG B 14  GLU B 22  1 ? 9  
HELX_P HELX_P10 AB1 LYS B 69  ? TYR B 72  ? LYS B 62  TYR B 65  5 ? 4  
HELX_P HELX_P11 AB2 HIS B 73  ? GLN B 86  ? HIS B 66  GLN B 79  1 ? 14 
HELX_P HELX_P12 AB3 CYS B 104 ? HIS B 118 ? CYS B 97  HIS B 111 1 ? 15 
HELX_P HELX_P13 AB4 SER B 134 ? ARG B 139 ? SER B 127 ARG B 132 1 ? 6  
HELX_P HELX_P14 AB5 ARG B 140 ? ALA B 148 ? ARG B 133 ALA B 141 1 ? 9  
HELX_P HELX_P15 AB6 ASP B 156 ? PHE B 167 ? ASP B 149 PHE B 160 1 ? 12 
HELX_P HELX_P16 AB7 LYS B 180 ? LEU B 196 ? LYS B 173 LEU B 189 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 73  ND1 ? ? ? 1_555 C ZN  . ZN ? ? A HIS 66  A ZN  401 1_555 ? ? ? ? ? ? ? 1.957 ? 
metalc2 metalc ? ? A CYS 104 SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 97  A ZN  401 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc3 metalc ? ? A CYS 107 SG  ? ? ? 1_555 C ZN  . ZN ? ? A CYS 100 A ZN  401 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc4 metalc ? ? B HIS 73  ND1 ? ? ? 1_555 D ZN  . ZN ? ? B HIS 66  B ZN  401 1_555 ? ? ? ? ? ? ? 1.957 ? 
metalc5 metalc ? ? B CYS 104 SG  ? ? ? 1_555 D ZN  . ZN ? ? B CYS 97  B ZN  401 1_555 ? ? ? ? ? ? ? 2.269 ? 
metalc6 metalc ? ? B CYS 107 SG  ? ? ? 1_555 D ZN  . ZN ? ? B CYS 100 B ZN  401 1_555 ? ? ? ? ? ? ? 2.256 ? 
metalc7 metalc ? ? C ZN  .   ZN  ? ? ? 1_555 E HOH . O  ? ? A ZN  401 A HOH 526 1_555 ? ? ? ? ? ? ? 2.141 ? 
metalc8 metalc ? ? D ZN  .   ZN  ? ? ? 1_555 F HOH . O  ? ? B ZN  401 B HOH 524 1_555 ? ? ? ? ? ? ? 2.142 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 87 A . ? LEU 80 A PRO 88 A ? PRO 81 A 1 3.52 
2 LEU 87 B . ? LEU 80 B PRO 88 B ? PRO 81 B 1 3.58 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 2 ? 
AA4 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 MET A 19  ? ASP A 20  ? MET A 12  ASP A 13  
AA1 2 VAL A 168 ? ASP A 169 ? VAL A 161 ASP A 162 
AA2 1 SER A 53  ? GLN A 65  ? SER A 46  GLN A 58  
AA2 2 TYR A 39  ? ARG A 50  ? TYR A 32  ARG A 43  
AA2 3 PHE A 93  ? TRP A 101 ? PHE A 86  TRP A 94  
AA2 4 VAL A 121 ? ARG A 129 ? VAL A 114 ARG A 122 
AA2 5 ARG A 151 ? ILE A 154 ? ARG A 144 ILE A 147 
AA3 1 MET B 19  ? ASP B 20  ? MET B 12  ASP B 13  
AA3 2 VAL B 168 ? ASP B 169 ? VAL B 161 ASP B 162 
AA4 1 SER B 53  ? GLN B 65  ? SER B 46  GLN B 58  
AA4 2 TYR B 39  ? ARG B 50  ? TYR B 32  ARG B 43  
AA4 3 PHE B 93  ? TRP B 101 ? PHE B 86  TRP B 94  
AA4 4 VAL B 121 ? ARG B 129 ? VAL B 114 ARG B 122 
AA4 5 ARG B 151 ? ILE B 154 ? ARG B 144 ILE B 147 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N MET A 19  ? N MET A 12  O ASP A 169 ? O ASP A 162 
AA2 1 2 O ASP A 58  ? O ASP A 51  N VAL A 46  ? N VAL A 39  
AA2 2 3 N CYS A 43  ? N CYS A 36  O PHE A 98  ? O PHE A 91  
AA2 3 4 N ILE A 95  ? N ILE A 88  O THR A 122 ? O THR A 115 
AA2 4 5 N ILE A 125 ? N ILE A 118 O ARG A 151 ? O ARG A 144 
AA3 1 2 N MET B 19  ? N MET B 12  O ASP B 169 ? O ASP B 162 
AA4 1 2 O ASP B 58  ? O ASP B 51  N VAL B 46  ? N VAL B 39  
AA4 2 3 N CYS B 43  ? N CYS B 36  O PHE B 98  ? O PHE B 91  
AA4 3 4 N ILE B 95  ? N ILE B 88  O THR B 122 ? O THR B 115 
AA4 4 5 N ILE B 125 ? N ILE B 118 O ARG B 151 ? O ARG B 144 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 401 ? 4 'binding site for residue ZN A 401' 
AC2 Software B ZN 401 ? 4 'binding site for residue ZN B 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 73  ? HIS A 66  . ? 1_555 ? 
2 AC1 4 CYS A 104 ? CYS A 97  . ? 1_555 ? 
3 AC1 4 CYS A 107 ? CYS A 100 . ? 1_555 ? 
4 AC1 4 HOH E .   ? HOH A 526 . ? 1_555 ? 
5 AC2 4 HIS B 73  ? HIS B 66  . ? 1_555 ? 
6 AC2 4 CYS B 104 ? CYS B 97  . ? 1_555 ? 
7 AC2 4 CYS B 107 ? CYS B 100 . ? 1_555 ? 
8 AC2 4 HOH F .   ? HOH B 524 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5TKM 
_atom_sites.fract_transf_matrix[1][1]   0.016464 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016447 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008967 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ASN A 1 14  ? 9.650   1.834   -16.539 1.00 55.94 ?  7   ASN A N   1 
ATOM   2    C  CA  . ASN A 1 14  ? 9.515   2.673   -17.727 1.00 49.69 ?  7   ASN A CA  1 
ATOM   3    C  C   . ASN A 1 14  ? 8.909   4.064   -17.418 1.00 43.84 ?  7   ASN A C   1 
ATOM   4    O  O   . ASN A 1 14  ? 9.423   5.071   -17.908 1.00 49.15 ?  7   ASN A O   1 
ATOM   5    C  CB  . ASN A 1 14  ? 8.695   1.942   -18.784 1.00 53.82 ?  7   ASN A CB  1 
ATOM   6    C  CG  . ASN A 1 14  ? 8.602   2.712   -20.062 1.00 51.87 ?  7   ASN A CG  1 
ATOM   7    O  OD1 . ASN A 1 14  ? 9.537   3.418   -20.442 1.00 59.74 ?  7   ASN A OD1 1 
ATOM   8    N  ND2 . ASN A 1 14  ? 7.468   2.590   -20.740 1.00 46.75 ?  7   ASN A ND2 1 
ATOM   9    N  N   . PRO A 1 15  ? 7.838   4.136   -16.626 1.00 39.68 ?  8   PRO A N   1 
ATOM   10   C  CA  . PRO A 1 15  ? 7.479   5.414   -16.006 1.00 39.65 ?  8   PRO A CA  1 
ATOM   11   C  C   . PRO A 1 15  ? 8.291   5.647   -14.740 1.00 41.92 ?  8   PRO A C   1 
ATOM   12   O  O   . PRO A 1 15  ? 8.780   4.713   -14.108 1.00 40.39 ?  8   PRO A O   1 
ATOM   13   C  CB  . PRO A 1 15  ? 5.995   5.239   -15.670 1.00 33.10 ?  8   PRO A CB  1 
ATOM   14   C  CG  . PRO A 1 15  ? 5.875   3.794   -15.376 1.00 40.84 ?  8   PRO A CG  1 
ATOM   15   C  CD  . PRO A 1 15  ? 6.801   3.115   -16.355 1.00 40.15 ?  8   PRO A CD  1 
ATOM   16   N  N   . MET A 1 16  ? 8.425   6.920   -14.376 1.00 36.76 ?  9   MET A N   1 
ATOM   17   C  CA  . MET A 1 16  ? 9.067   7.299   -13.122 1.00 37.07 ?  9   MET A CA  1 
ATOM   18   C  C   . MET A 1 16  ? 8.040   7.365   -11.990 1.00 33.58 ?  9   MET A C   1 
ATOM   19   O  O   . MET A 1 16  ? 6.830   7.282   -12.203 1.00 33.58 ?  9   MET A O   1 
ATOM   20   C  CB  . MET A 1 16  ? 9.762   8.649   -13.273 1.00 40.94 ?  9   MET A CB  1 
ATOM   21   C  CG  . MET A 1 16  ? 10.670  8.759   -14.480 1.00 47.42 ?  9   MET A CG  1 
ATOM   22   S  SD  . MET A 1 16  ? 10.713  10.440  -15.148 1.00 58.72 ?  9   MET A SD  1 
ATOM   23   C  CE  . MET A 1 16  ? 10.689  11.401  -13.639 1.00 40.02 ?  9   MET A CE  1 
ATOM   24   N  N   . GLU A 1 17  ? 8.530   7.502   -10.759 1.00 36.43 ?  10  GLU A N   1 
ATOM   25   C  CA  . GLU A 1 17  ? 7.590   7.700   -9.664  1.00 34.41 ?  10  GLU A CA  1 
ATOM   26   C  C   . GLU A 1 17  ? 7.204   9.163   -9.503  1.00 34.16 ?  10  GLU A C   1 
ATOM   27   O  O   . GLU A 1 17  ? 6.030   9.468   -9.279  1.00 37.62 ?  10  GLU A O   1 
ATOM   28   C  CB  . GLU A 1 17  ? 8.174   7.169   -8.350  1.00 39.34 ?  10  GLU A CB  1 
ATOM   29   C  CG  . GLU A 1 17  ? 8.306   5.668   -8.332  1.00 42.34 ?  10  GLU A CG  1 
ATOM   30   C  CD  . GLU A 1 17  ? 8.934   5.158   -7.055  1.00 58.53 ?  10  GLU A CD  1 
ATOM   31   O  OE1 . GLU A 1 17  ? 10.015  5.662   -6.676  1.00 60.28 ?  10  GLU A OE1 1 
ATOM   32   O  OE2 . GLU A 1 17  ? 8.341   4.250   -6.431  1.00 63.66 -1 10  GLU A OE2 1 
ATOM   33   N  N   . ARG A 1 18  ? 8.170   10.068  -9.618  1.00 37.87 ?  11  ARG A N   1 
ATOM   34   C  CA  . ARG A 1 18  ? 7.956   11.482  -9.342  1.00 37.88 ?  11  ARG A CA  1 
ATOM   35   C  C   . ARG A 1 18  ? 8.921   12.299  -10.185 1.00 38.48 ?  11  ARG A C   1 
ATOM   36   O  O   . ARG A 1 18  ? 9.950   11.797  -10.644 1.00 45.01 ?  11  ARG A O   1 
ATOM   37   C  CB  . ARG A 1 18  ? 8.160   11.809  -7.848  1.00 40.13 ?  11  ARG A CB  1 
ATOM   38   C  CG  . ARG A 1 18  ? 7.115   11.229  -6.886  1.00 40.94 ?  11  ARG A CG  1 
ATOM   39   C  CD  . ARG A 1 18  ? 7.545   11.394  -5.411  1.00 43.67 ?  11  ARG A CD  1 
ATOM   40   N  NE  . ARG A 1 18  ? 6.618   12.221  -4.643  1.00 49.88 ?  11  ARG A NE  1 
ATOM   41   C  CZ  . ARG A 1 18  ? 5.600   11.755  -3.922  1.00 46.78 ?  11  ARG A CZ  1 
ATOM   42   N  NH1 . ARG A 1 18  ? 5.362   10.454  -3.848  1.00 47.06 1  11  ARG A NH1 1 
ATOM   43   N  NH2 . ARG A 1 18  ? 4.816   12.600  -3.277  1.00 48.15 ?  11  ARG A NH2 1 
ATOM   44   N  N   . MET A 1 19  ? 8.589   13.571  -10.380 1.00 37.87 ?  12  MET A N   1 
ATOM   45   C  CA  . MET A 1 19  ? 9.499   14.514  -11.014 1.00 38.72 ?  12  MET A CA  1 
ATOM   46   C  C   . MET A 1 19  ? 10.030  15.494  -9.969  1.00 39.81 ?  12  MET A C   1 
ATOM   47   O  O   . MET A 1 19  ? 9.446   15.673  -8.899  1.00 41.26 ?  12  MET A O   1 
ATOM   48   C  CB  . MET A 1 19  ? 8.806   15.266  -12.166 1.00 39.18 ?  12  MET A CB  1 
ATOM   49   C  CG  . MET A 1 19  ? 7.793   16.303  -11.715 1.00 38.54 ?  12  MET A CG  1 
ATOM   50   S  SD  . MET A 1 19  ? 6.746   16.978  -13.036 1.00 38.40 ?  12  MET A SD  1 
ATOM   51   C  CE  . MET A 1 19  ? 5.327   15.909  -12.904 1.00 33.08 ?  12  MET A CE  1 
ATOM   52   N  N   . ASP A 1 20  ? 11.162  16.117  -10.270 1.00 41.70 ?  13  ASP A N   1 
ATOM   53   C  CA  . ASP A 1 20  ? 11.693  17.056  -9.298  1.00 44.96 ?  13  ASP A CA  1 
ATOM   54   C  C   . ASP A 1 20  ? 10.929  18.379  -9.373  1.00 46.58 ?  13  ASP A C   1 
ATOM   55   O  O   . ASP A 1 20  ? 10.147  18.625  -10.299 1.00 41.91 ?  13  ASP A O   1 
ATOM   56   C  CB  . ASP A 1 20  ? 13.196  17.261  -9.504  1.00 44.98 ?  13  ASP A CB  1 
ATOM   57   C  CG  . ASP A 1 20  ? 13.541  17.702  -10.904 1.00 53.51 ?  13  ASP A CG  1 
ATOM   58   O  OD1 . ASP A 1 20  ? 13.081  18.788  -11.323 1.00 52.89 ?  13  ASP A OD1 1 
ATOM   59   O  OD2 . ASP A 1 20  ? 14.293  16.976  -11.591 1.00 63.24 -1 13  ASP A OD2 1 
ATOM   60   N  N   . ARG A 1 21  ? 11.161  19.238  -8.371  1.00 38.64 ?  14  ARG A N   1 
ATOM   61   C  CA  . ARG A 1 21  ? 10.406  20.487  -8.253  1.00 43.34 ?  14  ARG A CA  1 
ATOM   62   C  C   . ARG A 1 21  ? 10.655  21.421  -9.434  1.00 42.66 ?  14  ARG A C   1 
ATOM   63   O  O   . ARG A 1 21  ? 9.725   22.079  -9.917  1.00 40.52 ?  14  ARG A O   1 
ATOM   64   C  CB  . ARG A 1 21  ? 10.763  21.204  -6.947  1.00 44.75 ?  14  ARG A CB  1 
ATOM   65   C  CG  . ARG A 1 21  ? 10.371  20.450  -5.682  1.00 48.23 ?  14  ARG A CG  1 
ATOM   66   C  CD  . ARG A 1 21  ? 10.660  21.291  -4.434  1.00 50.62 ?  14  ARG A CD  1 
ATOM   67   N  NE  . ARG A 1 21  ? 12.032  21.798  -4.429  1.00 55.33 ?  14  ARG A NE  1 
ATOM   68   C  CZ  . ARG A 1 21  ? 13.060  21.156  -3.888  1.00 57.13 ?  14  ARG A CZ  1 
ATOM   69   N  NH1 . ARG A 1 21  ? 12.867  19.981  -3.309  1.00 56.39 1  14  ARG A NH1 1 
ATOM   70   N  NH2 . ARG A 1 21  ? 14.279  21.681  -3.924  1.00 56.96 ?  14  ARG A NH2 1 
ATOM   71   N  N   . ASP A 1 22  ? 11.912  21.532  -9.873  1.00 40.80 ?  15  ASP A N   1 
ATOM   72   C  CA  . ASP A 1 22  ? 12.237  22.382  -11.015 1.00 45.50 ?  15  ASP A CA  1 
ATOM   73   C  C   . ASP A 1 22  ? 11.447  21.962  -12.247 1.00 40.59 ?  15  ASP A C   1 
ATOM   74   O  O   . ASP A 1 22  ? 10.845  22.800  -12.926 1.00 37.90 ?  15  ASP A O   1 
ATOM   75   C  CB  . ASP A 1 22  ? 13.738  22.323  -11.313 1.00 45.74 ?  15  ASP A CB  1 
ATOM   76   C  CG  . ASP A 1 22  ? 14.562  23.239  -10.413 1.00 56.23 ?  15  ASP A CG  1 
ATOM   77   O  OD1 . ASP A 1 22  ? 13.991  23.844  -9.478  1.00 55.94 ?  15  ASP A OD1 1 
ATOM   78   O  OD2 . ASP A 1 22  ? 15.789  23.342  -10.642 1.00 58.12 -1 15  ASP A OD2 1 
ATOM   79   N  N   . THR A 1 23  ? 11.443  20.660  -12.542 1.00 40.54 ?  16  THR A N   1 
ATOM   80   C  CA  . THR A 1 23  ? 10.700  20.145  -13.686 1.00 38.42 ?  16  THR A CA  1 
ATOM   81   C  C   . THR A 1 23  ? 9.220   20.498  -13.587 1.00 36.56 ?  16  THR A C   1 
ATOM   82   O  O   . THR A 1 23  ? 8.627   20.998  -14.551 1.00 34.69 ?  16  THR A O   1 
ATOM   83   C  CB  . THR A 1 23  ? 10.897  18.635  -13.790 1.00 38.74 ?  16  THR A CB  1 
ATOM   84   O  OG1 . THR A 1 23  ? 12.280  18.362  -14.038 1.00 43.02 ?  16  THR A OG1 1 
ATOM   85   C  CG2 . THR A 1 23  ? 10.072  18.054  -14.934 1.00 39.85 ?  16  THR A CG2 1 
ATOM   86   N  N   . PHE A 1 24  ? 8.610   20.257  -12.422 1.00 32.56 ?  17  PHE A N   1 
ATOM   87   C  CA  . PHE A 1 24  ? 7.187   20.546  -12.266 1.00 33.20 ?  17  PHE A CA  1 
ATOM   88   C  C   . PHE A 1 24  ? 6.889   22.013  -12.542 1.00 36.30 ?  17  PHE A C   1 
ATOM   89   O  O   . PHE A 1 24  ? 5.957   22.337  -13.284 1.00 31.18 ?  17  PHE A O   1 
ATOM   90   C  CB  . PHE A 1 24  ? 6.704   20.156  -10.869 1.00 32.80 ?  17  PHE A CB  1 
ATOM   91   C  CG  . PHE A 1 24  ? 5.250   20.483  -10.618 1.00 31.08 ?  17  PHE A CG  1 
ATOM   92   C  CD1 . PHE A 1 24  ? 4.247   19.596  -10.997 1.00 37.08 ?  17  PHE A CD1 1 
ATOM   93   C  CD2 . PHE A 1 24  ? 4.886   21.670  -10.005 1.00 34.80 ?  17  PHE A CD2 1 
ATOM   94   C  CE1 . PHE A 1 24  ? 2.916   19.891  -10.777 1.00 33.64 ?  17  PHE A CE1 1 
ATOM   95   C  CE2 . PHE A 1 24  ? 3.549   21.970  -9.775  1.00 38.17 ?  17  PHE A CE2 1 
ATOM   96   C  CZ  . PHE A 1 24  ? 2.562   21.079  -10.162 1.00 33.01 ?  17  PHE A CZ  1 
ATOM   97   N  N   . TYR A 1 25  ? 7.664   22.923  -11.941 1.00 33.86 ?  18  TYR A N   1 
ATOM   98   C  CA  . TYR A 1 25  ? 7.405   24.344  -12.151 1.00 33.73 ?  18  TYR A CA  1 
ATOM   99   C  C   . TYR A 1 25  ? 7.609   24.732  -13.614 1.00 34.96 ?  18  TYR A C   1 
ATOM   100  O  O   . TYR A 1 25  ? 6.812   25.487  -14.177 1.00 34.97 ?  18  TYR A O   1 
ATOM   101  C  CB  . TYR A 1 25  ? 8.297   25.177  -11.231 1.00 38.97 ?  18  TYR A CB  1 
ATOM   102  C  CG  . TYR A 1 25  ? 7.733   25.318  -9.836  1.00 37.00 ?  18  TYR A CG  1 
ATOM   103  C  CD1 . TYR A 1 25  ? 6.421   25.699  -9.653  1.00 34.96 ?  18  TYR A CD1 1 
ATOM   104  C  CD2 . TYR A 1 25  ? 8.508   25.057  -8.703  1.00 41.59 ?  18  TYR A CD2 1 
ATOM   105  C  CE1 . TYR A 1 25  ? 5.884   25.833  -8.398  1.00 40.11 ?  18  TYR A CE1 1 
ATOM   106  C  CE2 . TYR A 1 25  ? 7.970   25.191  -7.424  1.00 39.99 ?  18  TYR A CE2 1 
ATOM   107  C  CZ  . TYR A 1 25  ? 6.657   25.579  -7.290  1.00 41.96 ?  18  TYR A CZ  1 
ATOM   108  O  OH  . TYR A 1 25  ? 6.075   25.722  -6.063  1.00 43.44 ?  18  TYR A OH  1 
ATOM   109  N  N   . ASP A 1 26  ? 8.657   24.200  -14.251 1.00 29.02 ?  19  ASP A N   1 
ATOM   110  C  CA  . ASP A 1 26  ? 8.972   24.587  -15.621 1.00 33.23 ?  19  ASP A CA  1 
ATOM   111  C  C   . ASP A 1 26  ? 7.921   24.087  -16.610 1.00 33.14 ?  19  ASP A C   1 
ATOM   112  O  O   . ASP A 1 26  ? 7.725   24.697  -17.667 1.00 34.33 ?  19  ASP A O   1 
ATOM   113  C  CB  . ASP A 1 26  ? 10.357  24.056  -15.994 1.00 37.27 ?  19  ASP A CB  1 
ATOM   114  C  CG  . ASP A 1 26  ? 10.795  24.478  -17.385 1.00 42.73 ?  19  ASP A CG  1 
ATOM   115  O  OD1 . ASP A 1 26  ? 10.544  25.639  -17.763 1.00 43.74 ?  19  ASP A OD1 1 
ATOM   116  O  OD2 . ASP A 1 26  ? 11.391  23.648  -18.110 1.00 47.62 -1 19  ASP A OD2 1 
ATOM   117  N  N   . ASN A 1 27  ? 7.236   22.989  -16.295 1.00 28.49 ?  20  ASN A N   1 
ATOM   118  C  CA  . ASN A 1 27  ? 6.379   22.344  -17.277 1.00 30.58 ?  20  ASN A CA  1 
ATOM   119  C  C   . ASN A 1 27  ? 4.893   22.490  -17.018 1.00 25.66 ?  20  ASN A C   1 
ATOM   120  O  O   . ASN A 1 27  ? 4.108   22.325  -17.957 1.00 27.19 ?  20  ASN A O   1 
ATOM   121  C  CB  . ASN A 1 27  ? 6.720   20.853  -17.380 1.00 28.16 ?  20  ASN A CB  1 
ATOM   122  C  CG  . ASN A 1 27  ? 7.946   20.613  -18.225 1.00 29.33 ?  20  ASN A CG  1 
ATOM   123  O  OD1 . ASN A 1 27  ? 7.873   20.620  -19.463 1.00 31.15 ?  20  ASN A OD1 1 
ATOM   124  N  ND2 . ASN A 1 27  ? 9.086   20.411  -17.574 1.00 31.60 ?  20  ASN A ND2 1 
ATOM   125  N  N   . PHE A 1 28  ? 4.472   22.798  -15.795 1.00 25.81 ?  21  PHE A N   1 
ATOM   126  C  CA  . PHE A 1 28  ? 3.046   22.839  -15.502 1.00 24.38 ?  21  PHE A CA  1 
ATOM   127  C  C   . PHE A 1 28  ? 2.476   24.242  -15.328 1.00 24.27 ?  21  PHE A C   1 
ATOM   128  O  O   . PHE A 1 28  ? 1.275   24.376  -15.063 1.00 28.64 ?  21  PHE A O   1 
ATOM   129  C  CB  . PHE A 1 28  ? 2.747   21.974  -14.273 1.00 24.70 ?  21  PHE A CB  1 
ATOM   130  C  CG  . PHE A 1 28  ? 2.621   20.513  -14.604 1.00 24.23 ?  21  PHE A CG  1 
ATOM   131  C  CD1 . PHE A 1 28  ? 3.744   19.712  -14.707 1.00 26.00 ?  21  PHE A CD1 1 
ATOM   132  C  CD2 . PHE A 1 28  ? 1.382   19.958  -14.850 1.00 24.39 ?  21  PHE A CD2 1 
ATOM   133  C  CE1 . PHE A 1 28  ? 3.632   18.377  -15.039 1.00 28.08 ?  21  PHE A CE1 1 
ATOM   134  C  CE2 . PHE A 1 28  ? 1.265   18.612  -15.167 1.00 24.76 ?  21  PHE A CE2 1 
ATOM   135  C  CZ  . PHE A 1 28  ? 2.386   17.832  -15.261 1.00 25.56 ?  21  PHE A CZ  1 
ATOM   136  N  N   . GLU A 1 29  ? 3.283   25.286  -15.503 1.00 29.04 ?  22  GLU A N   1 
ATOM   137  C  CA  . GLU A 1 29  ? 2.775   26.657  -15.478 1.00 28.13 ?  22  GLU A CA  1 
ATOM   138  C  C   . GLU A 1 29  ? 1.681   26.837  -16.518 1.00 29.16 ?  22  GLU A C   1 
ATOM   139  O  O   . GLU A 1 29  ? 1.900   26.576  -17.706 1.00 27.97 ?  22  GLU A O   1 
ATOM   140  C  CB  . GLU A 1 29  ? 3.908   27.645  -15.738 1.00 31.80 ?  22  GLU A CB  1 
ATOM   141  C  CG  . GLU A 1 29  ? 3.446   29.094  -15.660 1.00 34.23 ?  22  GLU A CG  1 
ATOM   142  C  CD  . GLU A 1 29  ? 4.543   30.087  -15.998 1.00 40.78 ?  22  GLU A CD  1 
ATOM   143  O  OE1 . GLU A 1 29  ? 5.676   29.659  -16.323 1.00 42.83 ?  22  GLU A OE1 1 
ATOM   144  O  OE2 . GLU A 1 29  ? 4.254   31.299  -15.945 1.00 41.68 -1 22  GLU A OE2 1 
ATOM   145  N  N   . ASN A 1 30  ? 0.502   27.272  -16.077 1.00 26.91 ?  23  ASN A N   1 
ATOM   146  C  CA  . ASN A 1 30  ? -0.666  27.289  -16.957 1.00 28.44 ?  23  ASN A CA  1 
ATOM   147  C  C   . ASN A 1 30  ? -0.784  28.579  -17.768 1.00 26.58 ?  23  ASN A C   1 
ATOM   148  O  O   . ASN A 1 30  ? -1.885  29.101  -17.924 1.00 25.24 ?  23  ASN A O   1 
ATOM   149  C  CB  . ASN A 1 30  ? -1.941  27.012  -16.153 1.00 25.90 ?  23  ASN A CB  1 
ATOM   150  C  CG  . ASN A 1 30  ? -2.209  28.055  -15.056 1.00 32.84 ?  23  ASN A CG  1 
ATOM   151  O  OD1 . ASN A 1 30  ? -1.336  28.840  -14.709 1.00 28.70 ?  23  ASN A OD1 1 
ATOM   152  N  ND2 . ASN A 1 30  ? -3.419  28.045  -14.510 1.00 30.78 ?  23  ASN A ND2 1 
ATOM   153  N  N   . GLU A 1 31  ? 0.326   29.102  -18.315 1.00 25.48 ?  24  GLU A N   1 
ATOM   154  C  CA  . GLU A 1 31  ? 0.253   30.204  -19.286 1.00 29.08 ?  24  GLU A CA  1 
ATOM   155  C  C   . GLU A 1 31  ? -0.377  29.694  -20.568 1.00 26.09 ?  24  GLU A C   1 
ATOM   156  O  O   . GLU A 1 31  ? 0.119   28.712  -21.133 1.00 25.95 ?  24  GLU A O   1 
ATOM   157  C  CB  . GLU A 1 31  ? 1.639   30.764  -19.615 1.00 32.86 ?  24  GLU A CB  1 
ATOM   158  C  CG  . GLU A 1 31  ? 2.235   31.700  -18.584 1.00 35.52 ?  24  GLU A CG  1 
ATOM   159  C  CD  . GLU A 1 31  ? 1.504   33.030  -18.507 1.00 37.84 ?  24  GLU A CD  1 
ATOM   160  O  OE1 . GLU A 1 31  ? 1.080   33.570  -19.560 1.00 40.21 ?  24  GLU A OE1 1 
ATOM   161  O  OE2 . GLU A 1 31  ? 1.343   33.535  -17.382 1.00 42.80 -1 24  GLU A OE2 1 
ATOM   162  N  N   . PRO A 1 32  ? -1.449  30.309  -21.067 1.00 27.24 ?  25  PRO A N   1 
ATOM   163  C  CA  . PRO A 1 32  ? -2.039  29.810  -22.320 1.00 28.87 ?  25  PRO A CA  1 
ATOM   164  C  C   . PRO A 1 32  ? -1.057  29.825  -23.469 1.00 30.31 ?  25  PRO A C   1 
ATOM   165  O  O   . PRO A 1 32  ? -0.981  28.849  -24.224 1.00 28.12 ?  25  PRO A O   1 
ATOM   166  C  CB  . PRO A 1 32  ? -3.216  30.762  -22.555 1.00 27.66 ?  25  PRO A CB  1 
ATOM   167  C  CG  . PRO A 1 32  ? -3.582  31.197  -21.160 1.00 32.06 ?  25  PRO A CG  1 
ATOM   168  C  CD  . PRO A 1 32  ? -2.272  31.366  -20.453 1.00 31.41 ?  25  PRO A CD  1 
ATOM   169  N  N   . ILE A 1 33  ? -0.292  30.904  -23.607 1.00 28.31 ?  26  ILE A N   1 
ATOM   170  C  CA  . ILE A 1 33  ? 0.754   31.029  -24.614 1.00 26.50 ?  26  ILE A CA  1 
ATOM   171  C  C   . ILE A 1 33  ? 2.088   30.798  -23.929 1.00 29.15 ?  26  ILE A C   1 
ATOM   172  O  O   . ILE A 1 33  ? 2.501   31.589  -23.074 1.00 31.63 ?  26  ILE A O   1 
ATOM   173  C  CB  . ILE A 1 33  ? 0.723   32.408  -25.293 1.00 30.33 ?  26  ILE A CB  1 
ATOM   174  C  CG1 . ILE A 1 33  ? -0.565  32.603  -26.086 1.00 34.81 ?  26  ILE A CG1 1 
ATOM   175  C  CG2 . ILE A 1 33  ? 1.950   32.587  -26.181 1.00 31.04 ?  26  ILE A CG2 1 
ATOM   176  C  CD1 . ILE A 1 33  ? -0.694  31.664  -27.286 1.00 36.66 ?  26  ILE A CD1 1 
ATOM   177  N  N   . LEU A 1 34  ? 2.779   29.730  -24.306 1.00 25.82 ?  27  LEU A N   1 
ATOM   178  C  CA  . LEU A 1 34  ? 4.009   29.364  -23.620 1.00 30.07 ?  27  LEU A CA  1 
ATOM   179  C  C   . LEU A 1 34  ? 4.929   28.703  -24.630 1.00 32.61 ?  27  LEU A C   1 
ATOM   180  O  O   . LEU A 1 34  ? 4.522   27.739  -25.290 1.00 32.60 ?  27  LEU A O   1 
ATOM   181  C  CB  . LEU A 1 34  ? 3.734   28.411  -22.447 1.00 26.35 ?  27  LEU A CB  1 
ATOM   182  C  CG  . LEU A 1 34  ? 4.927   28.164  -21.516 1.00 28.83 ?  27  LEU A CG  1 
ATOM   183  C  CD1 . LEU A 1 34  ? 5.238   29.445  -20.751 1.00 30.03 ?  27  LEU A CD1 1 
ATOM   184  C  CD2 . LEU A 1 34  ? 4.660   27.004  -20.543 1.00 28.89 ?  27  LEU A CD2 1 
ATOM   185  N  N   . SER A 1 35  ? 6.154   29.217  -24.752 1.00 27.11 ?  28  SER A N   1 
ATOM   186  C  CA  . SER A 1 35  ? 7.134   28.697  -25.695 1.00 29.77 ?  28  SER A CA  1 
ATOM   187  C  C   . SER A 1 35  ? 8.213   27.902  -24.967 1.00 30.18 ?  28  SER A C   1 
ATOM   188  O  O   . SER A 1 35  ? 8.507   28.150  -23.794 1.00 30.67 ?  28  SER A O   1 
ATOM   189  C  CB  . SER A 1 35  ? 7.786   29.836  -26.491 1.00 30.57 ?  28  SER A CB  1 
ATOM   190  O  OG  . SER A 1 35  ? 6.803   30.579  -27.203 1.00 33.83 ?  28  SER A OG  1 
ATOM   191  N  N   . GLY A 1 36  ? 8.794   26.933  -25.670 1.00 27.88 ?  29  GLY A N   1 
ATOM   192  C  CA  . GLY A 1 36  ? 9.932   26.196  -25.154 1.00 33.12 ?  29  GLY A CA  1 
ATOM   193  C  C   . GLY A 1 36  ? 9.620   24.936  -24.365 1.00 37.13 ?  29  GLY A C   1 
ATOM   194  O  O   . GLY A 1 36  ? 10.555  24.251  -23.922 1.00 34.33 ?  29  GLY A O   1 
ATOM   195  N  N   . ARG A 1 37  ? 8.350   24.597  -24.171 1.00 30.67 ?  30  ARG A N   1 
ATOM   196  C  CA  . ARG A 1 37  ? 7.998   23.389  -23.426 1.00 30.32 ?  30  ARG A CA  1 
ATOM   197  C  C   . ARG A 1 37  ? 7.709   22.292  -24.448 1.00 26.59 ?  30  ARG A C   1 
ATOM   198  O  O   . ARG A 1 37  ? 6.558   21.946  -24.733 1.00 25.38 ?  30  ARG A O   1 
ATOM   199  C  CB  . ARG A 1 37  ? 6.823   23.647  -22.498 1.00 25.75 ?  30  ARG A CB  1 
ATOM   200  C  CG  . ARG A 1 37  ? 7.230   24.248  -21.151 1.00 30.92 ?  30  ARG A CG  1 
ATOM   201  C  CD  . ARG A 1 37  ? 7.873   25.627  -21.311 1.00 33.14 ?  30  ARG A CD  1 
ATOM   202  N  NE  . ARG A 1 37  ? 8.086   26.268  -20.018 1.00 35.09 ?  30  ARG A NE  1 
ATOM   203  C  CZ  . ARG A 1 37  ? 8.485   27.527  -19.854 1.00 37.32 ?  30  ARG A CZ  1 
ATOM   204  N  NH1 . ARG A 1 37  ? 8.724   28.293  -20.910 1.00 36.32 1  30  ARG A NH1 1 
ATOM   205  N  NH2 . ARG A 1 37  ? 8.648   28.014  -18.628 1.00 35.08 ?  30  ARG A NH2 1 
ATOM   206  N  N   . SER A 1 38  ? 8.787   21.755  -25.010 1.00 25.94 ?  31  SER A N   1 
ATOM   207  C  CA  . SER A 1 38  ? 8.706   20.779  -26.088 1.00 32.59 ?  31  SER A CA  1 
ATOM   208  C  C   . SER A 1 38  ? 8.364   19.377  -25.596 1.00 28.87 ?  31  SER A C   1 
ATOM   209  O  O   . SER A 1 38  ? 8.219   18.472  -26.421 1.00 28.54 ?  31  SER A O   1 
ATOM   210  C  CB  . SER A 1 38  ? 10.027  20.744  -26.855 1.00 35.08 ?  31  SER A CB  1 
ATOM   211  O  OG  . SER A 1 38  ? 11.052  20.216  -26.036 1.00 47.17 ?  31  SER A OG  1 
ATOM   212  N  N   . TYR A 1 39  ? 8.237   19.176  -24.286 1.00 28.27 ?  32  TYR A N   1 
ATOM   213  C  CA  . TYR A 1 39  ? 7.809   17.902  -23.728 1.00 27.17 ?  32  TYR A CA  1 
ATOM   214  C  C   . TYR A 1 39  ? 6.394   18.008  -23.189 1.00 27.64 ?  32  TYR A C   1 
ATOM   215  O  O   . TYR A 1 39  ? 5.925   19.083  -22.807 1.00 24.98 ?  32  TYR A O   1 
ATOM   216  C  CB  . TYR A 1 39  ? 8.721   17.449  -22.582 1.00 32.93 ?  32  TYR A CB  1 
ATOM   217  C  CG  . TYR A 1 39  ? 10.139  17.171  -22.994 1.00 36.94 ?  32  TYR A CG  1 
ATOM   218  C  CD1 . TYR A 1 39  ? 10.463  16.018  -23.695 1.00 36.71 ?  32  TYR A CD1 1 
ATOM   219  C  CD2 . TYR A 1 39  ? 11.158  18.058  -22.671 1.00 39.17 ?  32  TYR A CD2 1 
ATOM   220  C  CE1 . TYR A 1 39  ? 11.767  15.759  -24.072 1.00 44.79 ?  32  TYR A CE1 1 
ATOM   221  C  CE2 . TYR A 1 39  ? 12.460  17.808  -23.040 1.00 43.37 ?  32  TYR A CE2 1 
ATOM   222  C  CZ  . TYR A 1 39  ? 12.763  16.659  -23.742 1.00 48.91 ?  32  TYR A CZ  1 
ATOM   223  O  OH  . TYR A 1 39  ? 14.072  16.413  -24.112 1.00 53.73 ?  32  TYR A OH  1 
ATOM   224  N  N   . THR A 1 40  ? 5.730   16.860  -23.135 1.00 25.60 ?  33  THR A N   1 
ATOM   225  C  CA  . THR A 1 40  ? 4.513   16.690  -22.368 1.00 22.23 ?  33  THR A CA  1 
ATOM   226  C  C   . THR A 1 40  ? 4.820   15.788  -21.186 1.00 24.59 ?  33  THR A C   1 
ATOM   227  O  O   . THR A 1 40  ? 5.373   14.703  -21.367 1.00 26.62 ?  33  THR A O   1 
ATOM   228  C  CB  . THR A 1 40  ? 3.410   16.077  -23.225 1.00 25.44 ?  33  THR A CB  1 
ATOM   229  O  OG1 . THR A 1 40  ? 3.036   17.024  -24.237 1.00 25.97 ?  33  THR A OG1 1 
ATOM   230  C  CG2 . THR A 1 40  ? 2.192   15.718  -22.363 1.00 24.19 ?  33  THR A CG2 1 
ATOM   231  N  N   . TRP A 1 41  ? 4.486   16.245  -19.987 1.00 23.61 ?  34  TRP A N   1 
ATOM   232  C  CA  . TRP A 1 41  ? 4.614   15.441  -18.781 1.00 28.16 ?  34  TRP A CA  1 
ATOM   233  C  C   . TRP A 1 41  ? 3.232   14.930  -18.414 1.00 26.88 ?  34  TRP A C   1 
ATOM   234  O  O   . TRP A 1 41  ? 2.261   15.686  -18.456 1.00 25.91 ?  34  TRP A O   1 
ATOM   235  C  CB  . TRP A 1 41  ? 5.234   16.251  -17.638 1.00 25.02 ?  34  TRP A CB  1 
ATOM   236  C  CG  . TRP A 1 41  ? 6.703   16.398  -17.809 1.00 27.33 ?  34  TRP A CG  1 
ATOM   237  C  CD1 . TRP A 1 41  ? 7.351   17.301  -18.598 1.00 28.47 ?  34  TRP A CD1 1 
ATOM   238  C  CD2 . TRP A 1 41  ? 7.708   15.590  -17.211 1.00 29.52 ?  34  TRP A CD2 1 
ATOM   239  N  NE1 . TRP A 1 41  ? 8.712   17.113  -18.512 1.00 30.19 ?  34  TRP A NE1 1 
ATOM   240  C  CE2 . TRP A 1 41  ? 8.955   16.068  -17.663 1.00 30.22 ?  34  TRP A CE2 1 
ATOM   241  C  CE3 . TRP A 1 41  ? 7.683   14.522  -16.315 1.00 32.65 ?  34  TRP A CE3 1 
ATOM   242  C  CZ2 . TRP A 1 41  ? 10.163  15.502  -17.256 1.00 36.44 ?  34  TRP A CZ2 1 
ATOM   243  C  CZ3 . TRP A 1 41  ? 8.892   13.956  -15.916 1.00 35.68 ?  34  TRP A CZ3 1 
ATOM   244  C  CH2 . TRP A 1 41  ? 10.108  14.451  -16.379 1.00 34.43 ?  34  TRP A CH2 1 
ATOM   245  N  N   . LEU A 1 42  ? 3.130   13.637  -18.102 1.00 22.20 ?  35  LEU A N   1 
ATOM   246  C  CA  . LEU A 1 42  ? 1.831   13.012  -17.882 1.00 20.72 ?  35  LEU A CA  1 
ATOM   247  C  C   . LEU A 1 42  ? 1.909   12.269  -16.556 1.00 22.48 ?  35  LEU A C   1 
ATOM   248  O  O   . LEU A 1 42  ? 2.605   11.253  -16.453 1.00 25.13 ?  35  LEU A O   1 
ATOM   249  C  CB  . LEU A 1 42  ? 1.461   12.071  -19.041 1.00 20.14 ?  35  LEU A CB  1 
ATOM   250  C  CG  . LEU A 1 42  ? 0.072   11.424  -19.117 1.00 21.85 ?  35  LEU A CG  1 
ATOM   251  C  CD1 . LEU A 1 42  ? -0.169  10.856  -20.521 1.00 24.59 ?  35  LEU A CD1 1 
ATOM   252  C  CD2 . LEU A 1 42  ? -0.122  10.298  -18.110 1.00 22.62 ?  35  LEU A CD2 1 
ATOM   253  N  N   . CYS A 1 43  ? 1.224   12.794  -15.549 1.00 24.35 ?  36  CYS A N   1 
ATOM   254  C  CA  . CYS A 1 43  ? 1.048   12.110  -14.270 1.00 27.55 ?  36  CYS A CA  1 
ATOM   255  C  C   . CYS A 1 43  ? -0.227  11.286  -14.321 1.00 24.70 ?  36  CYS A C   1 
ATOM   256  O  O   . CYS A 1 43  ? -1.279  11.792  -14.712 1.00 25.06 ?  36  CYS A O   1 
ATOM   257  C  CB  . CYS A 1 43  ? 0.955   13.114  -13.122 1.00 28.58 ?  36  CYS A CB  1 
ATOM   258  S  SG  . CYS A 1 43  ? 2.266   14.300  -13.083 1.00 32.35 ?  36  CYS A SG  1 
ATOM   259  N  N   . TYR A 1 44  ? -0.154  10.029  -13.896 1.00 25.67 ?  37  TYR A N   1 
ATOM   260  C  CA  . TYR A 1 44  ? -1.325  9.175   -13.986 1.00 26.13 ?  37  TYR A CA  1 
ATOM   261  C  C   . TYR A 1 44  ? -1.617  8.500   -12.655 1.00 26.96 ?  37  TYR A C   1 
ATOM   262  O  O   . TYR A 1 44  ? -0.715  8.210   -11.865 1.00 27.65 ?  37  TYR A O   1 
ATOM   263  C  CB  . TYR A 1 44  ? -1.184  8.095   -15.089 1.00 25.95 ?  37  TYR A CB  1 
ATOM   264  C  CG  . TYR A 1 44  ? -0.093  7.080   -14.851 1.00 27.18 ?  37  TYR A CG  1 
ATOM   265  C  CD1 . TYR A 1 44  ? -0.332  5.921   -14.114 1.00 27.93 ?  37  TYR A CD1 1 
ATOM   266  C  CD2 . TYR A 1 44  ? 1.172   7.277   -15.371 1.00 28.16 ?  37  TYR A CD2 1 
ATOM   267  C  CE1 . TYR A 1 44  ? 0.680   4.996   -13.890 1.00 28.87 ?  37  TYR A CE1 1 
ATOM   268  C  CE2 . TYR A 1 44  ? 2.180   6.356   -15.163 1.00 31.38 ?  37  TYR A CE2 1 
ATOM   269  C  CZ  . TYR A 1 44  ? 1.934   5.228   -14.432 1.00 30.72 ?  37  TYR A CZ  1 
ATOM   270  O  OH  . TYR A 1 44  ? 2.960   4.334   -14.245 1.00 34.97 ?  37  TYR A OH  1 
ATOM   271  N  N   . GLU A 1 45  ? -2.900  8.268   -12.431 1.00 28.21 ?  38  GLU A N   1 
ATOM   272  C  CA  . GLU A 1 45  ? -3.387  7.357   -11.408 1.00 30.73 ?  38  GLU A CA  1 
ATOM   273  C  C   . GLU A 1 45  ? -4.297  6.356   -12.087 1.00 30.07 ?  38  GLU A C   1 
ATOM   274  O  O   . GLU A 1 45  ? -5.197  6.740   -12.845 1.00 33.03 ?  38  GLU A O   1 
ATOM   275  C  CB  . GLU A 1 45  ? -4.135  8.092   -10.294 1.00 31.78 ?  38  GLU A CB  1 
ATOM   276  C  CG  . GLU A 1 45  ? -3.230  8.900   -9.421  1.00 30.97 ?  38  GLU A CG  1 
ATOM   277  C  CD  . GLU A 1 45  ? -3.900  9.349   -8.123  1.00 36.28 ?  38  GLU A CD  1 
ATOM   278  O  OE1 . GLU A 1 45  ? -5.144  9.284   -8.028  1.00 40.98 ?  38  GLU A OE1 1 
ATOM   279  O  OE2 . GLU A 1 45  ? -3.170  9.754   -7.198  1.00 43.80 -1 38  GLU A OE2 1 
ATOM   280  N  N   . VAL A 1 46  ? -4.014  5.077   -11.877 1.00 28.02 ?  39  VAL A N   1 
ATOM   281  C  CA  . VAL A 1 46  ? -4.902  4.003   -12.287 1.00 25.37 ?  39  VAL A CA  1 
ATOM   282  C  C   . VAL A 1 46  ? -5.606  3.505   -11.034 1.00 31.85 ?  39  VAL A C   1 
ATOM   283  O  O   . VAL A 1 46  ? -4.950  3.090   -10.069 1.00 28.34 ?  39  VAL A O   1 
ATOM   284  C  CB  . VAL A 1 46  ? -4.129  2.873   -12.982 1.00 31.73 ?  39  VAL A CB  1 
ATOM   285  C  CG1 . VAL A 1 46  ? -5.051  1.690   -13.249 1.00 30.40 ?  39  VAL A CG1 1 
ATOM   286  C  CG2 . VAL A 1 46  ? -3.481  3.386   -14.285 1.00 25.87 ?  39  VAL A CG2 1 
ATOM   287  N  N   . LYS A 1 47  ? -6.929  3.598   -11.025 1.00 31.13 ?  40  LYS A N   1 
ATOM   288  C  CA  . LYS A 1 47  ? -7.738  3.151   -9.907  1.00 34.83 ?  40  LYS A CA  1 
ATOM   289  C  C   . LYS A 1 47  ? -8.688  2.054   -10.360 1.00 36.55 ?  40  LYS A C   1 
ATOM   290  O  O   . LYS A 1 47  ? -9.132  2.027   -11.513 1.00 33.18 ?  40  LYS A O   1 
ATOM   291  C  CB  . LYS A 1 47  ? -8.542  4.305   -9.296  1.00 35.18 ?  40  LYS A CB  1 
ATOM   292  C  CG  . LYS A 1 47  ? -7.685  5.418   -8.754  1.00 35.19 ?  40  LYS A CG  1 
ATOM   293  C  CD  . LYS A 1 47  ? -8.557  6.555   -8.279  1.00 42.73 ?  40  LYS A CD  1 
ATOM   294  C  CE  . LYS A 1 47  ? -7.762  7.555   -7.466  1.00 50.59 ?  40  LYS A CE  1 
ATOM   295  N  NZ  . LYS A 1 47  ? -8.620  8.174   -6.406  1.00 56.81 1  40  LYS A NZ  1 
ATOM   296  N  N   . ILE A 1 48  ? -8.970  1.129   -9.448  1.00 33.24 ?  41  ILE A N   1 
ATOM   297  C  CA  . ILE A 1 48  ? -10.054 0.171   -9.627  1.00 35.65 ?  41  ILE A CA  1 
ATOM   298  C  C   . ILE A 1 48  ? -11.279 0.781   -8.970  1.00 38.51 ?  41  ILE A C   1 
ATOM   299  O  O   . ILE A 1 48  ? -11.280 1.030   -7.761  1.00 39.15 ?  41  ILE A O   1 
ATOM   300  C  CB  . ILE A 1 48  ? -9.717  -1.193  -9.009  1.00 40.63 ?  41  ILE A CB  1 
ATOM   301  C  CG1 . ILE A 1 48  ? -8.313  -1.633  -9.414  1.00 41.44 ?  41  ILE A CG1 1 
ATOM   302  C  CG2 . ILE A 1 48  ? -10.773 -2.224  -9.392  1.00 43.16 ?  41  ILE A CG2 1 
ATOM   303  C  CD1 . ILE A 1 48  ? -8.122  -1.732  -10.908 1.00 42.64 ?  41  ILE A CD1 1 
ATOM   304  N  N   . LYS A 1 49  ? -12.302 1.072   -9.762  1.00 38.21 ?  42  LYS A N   1 
ATOM   305  C  CA  . LYS A 1 49  ? -13.421 1.867   -9.284  1.00 43.35 ?  42  LYS A CA  1 
ATOM   306  C  C   . LYS A 1 49  ? -14.720 1.120   -9.517  1.00 50.22 ?  42  LYS A C   1 
ATOM   307  O  O   . LYS A 1 49  ? -14.942 0.550   -10.589 1.00 51.56 ?  42  LYS A O   1 
ATOM   308  C  CB  . LYS A 1 49  ? -13.477 3.245   -9.969  1.00 50.09 ?  42  LYS A CB  1 
ATOM   309  C  CG  . LYS A 1 49  ? -14.762 4.027   -9.694  1.00 54.16 ?  42  LYS A CG  1 
ATOM   310  C  CD  . LYS A 1 49  ? -14.663 5.484   -10.148 1.00 59.14 ?  42  LYS A CD  1 
ATOM   311  C  CE  . LYS A 1 49  ? -14.431 6.426   -8.960  1.00 59.12 ?  42  LYS A CE  1 
ATOM   312  N  NZ  . LYS A 1 49  ? -15.577 6.440   -8.006  1.00 56.99 1  42  LYS A NZ  1 
ATOM   313  N  N   . ARG A 1 50  ? -15.570 1.122   -8.495  1.00 48.16 ?  43  ARG A N   1 
ATOM   314  C  CA  . ARG A 1 50  ? -16.849 0.424   -8.567  1.00 52.67 ?  43  ARG A CA  1 
ATOM   315  C  C   . ARG A 1 50  ? -17.756 1.107   -7.540  1.00 54.46 ?  43  ARG A C   1 
ATOM   316  O  O   . ARG A 1 50  ? -17.784 0.715   -6.375  1.00 56.63 ?  43  ARG A O   1 
ATOM   317  C  CB  . ARG A 1 50  ? -16.697 -1.058  -8.292  1.00 52.09 ?  43  ARG A CB  1 
ATOM   318  C  CG  . ARG A 1 50  ? -17.979 -1.813  -8.479  1.00 48.74 ?  43  ARG A CG  1 
ATOM   319  C  CD  . ARG A 1 50  ? -17.939 -3.203  -7.887  1.00 47.50 ?  43  ARG A CD  1 
ATOM   320  N  NE  . ARG A 1 50  ? -19.300 -3.715  -7.834  1.00 40.45 ?  43  ARG A NE  1 
ATOM   321  C  CZ  . ARG A 1 50  ? -20.089 -3.602  -6.776  1.00 42.88 ?  43  ARG A CZ  1 
ATOM   322  N  NH1 . ARG A 1 50  ? -19.634 -3.023  -5.670  1.00 45.21 1  43  ARG A NH1 1 
ATOM   323  N  NH2 . ARG A 1 50  ? -21.331 -4.076  -6.820  1.00 45.22 ?  43  ARG A NH2 1 
ATOM   324  N  N   . GLY A 1 51  ? -18.463 2.145   -7.987  1.00 60.17 ?  44  GLY A N   1 
ATOM   325  C  CA  . GLY A 1 51  ? -19.282 2.949   -7.102  1.00 61.56 ?  44  GLY A CA  1 
ATOM   326  C  C   . GLY A 1 51  ? -18.485 3.624   -6.002  1.00 66.47 ?  44  GLY A C   1 
ATOM   327  O  O   . GLY A 1 51  ? -17.695 4.541   -6.255  1.00 69.74 ?  44  GLY A O   1 
ATOM   328  N  N   . ARG A 1 52  ? -18.673 3.165   -4.769  1.00 64.79 ?  45  ARG A N   1 
ATOM   329  C  CA  . ARG A 1 52  ? -18.028 3.784   -3.618  1.00 69.50 ?  45  ARG A CA  1 
ATOM   330  C  C   . ARG A 1 52  ? -16.635 3.221   -3.346  1.00 67.50 ?  45  ARG A C   1 
ATOM   331  O  O   . ARG A 1 52  ? -15.827 3.883   -2.681  1.00 66.97 ?  45  ARG A O   1 
ATOM   332  C  CB  . ARG A 1 52  ? -18.919 3.618   -2.381  1.00 75.53 ?  45  ARG A CB  1 
ATOM   333  C  CG  . ARG A 1 52  ? -20.426 3.797   -2.665  1.00 78.53 ?  45  ARG A CG  1 
ATOM   334  C  CD  . ARG A 1 52  ? -20.735 5.087   -3.449  1.00 74.85 ?  45  ARG A CD  1 
ATOM   335  N  NE  . ARG A 1 52  ? -22.172 5.293   -3.638  1.00 76.39 ?  45  ARG A NE  1 
ATOM   336  C  CZ  . ARG A 1 52  ? -22.701 6.271   -4.368  1.00 75.35 ?  45  ARG A CZ  1 
ATOM   337  N  NH1 . ARG A 1 52  ? -21.914 7.140   -4.995  1.00 72.81 1  45  ARG A NH1 1 
ATOM   338  N  NH2 . ARG A 1 52  ? -24.020 6.383   -4.475  1.00 73.94 ?  45  ARG A NH2 1 
ATOM   339  N  N   . SER A 1 53  ? -16.345 2.019   -3.834  1.00 56.56 ?  46  SER A N   1 
ATOM   340  C  CA  . SER A 1 53  ? -14.989 1.497   -3.804  1.00 55.00 ?  46  SER A CA  1 
ATOM   341  C  C   . SER A 1 53  ? -14.117 2.280   -4.779  1.00 55.70 ?  46  SER A C   1 
ATOM   342  O  O   . SER A 1 53  ? -14.527 2.581   -5.905  1.00 53.19 ?  46  SER A O   1 
ATOM   343  C  CB  . SER A 1 53  ? -14.994 0.006   -4.160  1.00 50.81 ?  46  SER A CB  1 
ATOM   344  O  OG  . SER A 1 53  ? -13.683 -0.527  -4.262  1.00 52.32 ?  46  SER A OG  1 
ATOM   345  N  N   . ASN A 1 54  ? -12.907 2.619   -4.342  1.00 50.01 ?  47  ASN A N   1 
ATOM   346  C  CA  . ASN A 1 54  ? -12.038 3.458   -5.161  1.00 47.86 ?  47  ASN A CA  1 
ATOM   347  C  C   . ASN A 1 54  ? -10.596 3.188   -4.719  1.00 47.40 ?  47  ASN A C   1 
ATOM   348  O  O   . ASN A 1 54  ? -10.064 3.886   -3.857  1.00 52.95 ?  47  ASN A O   1 
ATOM   349  C  CB  . ASN A 1 54  ? -12.398 4.919   -5.028  1.00 55.28 ?  47  ASN A CB  1 
ATOM   350  C  CG  . ASN A 1 54  ? -11.508 5.810   -5.861  1.00 57.51 ?  47  ASN A CG  1 
ATOM   351  O  OD1 . ASN A 1 54  ? -10.733 6.611   -5.327  1.00 63.72 ?  47  ASN A OD1 1 
ATOM   352  N  ND2 . ASN A 1 54  ? -11.595 5.662   -7.178  1.00 57.45 ?  47  ASN A ND2 1 
ATOM   353  N  N   . LEU A 1 55  ? -9.984  2.183   -5.332  1.00 39.62 ?  48  LEU A N   1 
ATOM   354  C  CA  . LEU A 1 55  ? -8.679  1.686   -4.923  1.00 37.18 ?  48  LEU A CA  1 
ATOM   355  C  C   . LEU A 1 55  ? -7.605  2.267   -5.819  1.00 36.76 ?  48  LEU A C   1 
ATOM   356  O  O   . LEU A 1 55  ? -7.623  2.040   -7.031  1.00 37.20 ?  48  LEU A O   1 
ATOM   357  C  CB  . LEU A 1 55  ? -8.625  0.161   -5.001  1.00 39.12 ?  48  LEU A CB  1 
ATOM   358  C  CG  . LEU A 1 55  ? -9.352  -0.655  -3.949  1.00 40.70 ?  48  LEU A CG  1 
ATOM   359  C  CD1 . LEU A 1 55  ? -9.282  -2.126  -4.336  1.00 39.02 ?  48  LEU A CD1 1 
ATOM   360  C  CD2 . LEU A 1 55  ? -8.709  -0.405  -2.601  1.00 35.44 ?  48  LEU A CD2 1 
ATOM   361  N  N   . LEU A 1 56  ? -6.660  2.979   -5.224  1.00 38.18 ?  49  LEU A N   1 
ATOM   362  C  CA  . LEU A 1 56  ? -5.465  3.367   -5.951  1.00 34.79 ?  49  LEU A CA  1 
ATOM   363  C  C   . LEU A 1 56  ? -4.678  2.118   -6.317  1.00 39.53 ?  49  LEU A C   1 
ATOM   364  O  O   . LEU A 1 56  ? -4.321  1.316   -5.445  1.00 34.50 ?  49  LEU A O   1 
ATOM   365  C  CB  . LEU A 1 56  ? -4.616  4.320   -5.111  1.00 36.51 ?  49  LEU A CB  1 
ATOM   366  C  CG  . LEU A 1 56  ? -3.406  4.900   -5.843  1.00 37.10 ?  49  LEU A CG  1 
ATOM   367  C  CD1 . LEU A 1 56  ? -3.879  5.729   -7.032  1.00 38.86 ?  49  LEU A CD1 1 
ATOM   368  C  CD2 . LEU A 1 56  ? -2.531  5.731   -4.909  1.00 40.40 ?  49  LEU A CD2 1 
ATOM   369  N  N   . TRP A 1 57  ? -4.427  1.939   -7.612  1.00 35.32 ?  50  TRP A N   1 
ATOM   370  C  CA  . TRP A 1 57  ? -3.804  0.725   -8.107  1.00 33.32 ?  50  TRP A CA  1 
ATOM   371  C  C   . TRP A 1 57  ? -2.416  0.947   -8.672  1.00 36.59 ?  50  TRP A C   1 
ATOM   372  O  O   . TRP A 1 57  ? -1.526  0.127   -8.451  1.00 34.68 ?  50  TRP A O   1 
ATOM   373  C  CB  . TRP A 1 57  ? -4.700  0.081   -9.168  1.00 38.20 ?  50  TRP A CB  1 
ATOM   374  C  CG  . TRP A 1 57  ? -4.500  -1.388  -9.259  1.00 41.48 ?  50  TRP A CG  1 
ATOM   375  C  CD1 . TRP A 1 57  ? -4.129  -2.105  -10.359 1.00 45.51 ?  50  TRP A CD1 1 
ATOM   376  C  CD2 . TRP A 1 57  ? -4.641  -2.331  -8.189  1.00 40.91 ?  50  TRP A CD2 1 
ATOM   377  N  NE1 . TRP A 1 57  ? -4.033  -3.445  -10.039 1.00 48.01 ?  50  TRP A NE1 1 
ATOM   378  C  CE2 . TRP A 1 57  ? -4.341  -3.604  -8.712  1.00 42.82 ?  50  TRP A CE2 1 
ATOM   379  C  CE3 . TRP A 1 57  ? -4.988  -2.216  -6.835  1.00 42.97 ?  50  TRP A CE3 1 
ATOM   380  C  CZ2 . TRP A 1 57  ? -4.390  -4.760  -7.934  1.00 44.45 ?  50  TRP A CZ2 1 
ATOM   381  C  CZ3 . TRP A 1 57  ? -5.028  -3.366  -6.059  1.00 43.49 ?  50  TRP A CZ3 1 
ATOM   382  C  CH2 . TRP A 1 57  ? -4.728  -4.619  -6.611  1.00 43.00 ?  50  TRP A CH2 1 
ATOM   383  N  N   . ASP A 1 58  ? -2.201  2.044   -9.387  1.00 30.74 ?  51  ASP A N   1 
ATOM   384  C  CA  . ASP A 1 58  ? -0.898  2.326   -9.964  1.00 35.54 ?  51  ASP A CA  1 
ATOM   385  C  C   . ASP A 1 58  ? -0.794  3.831   -10.160 1.00 31.54 ?  51  ASP A C   1 
ATOM   386  O  O   . ASP A 1 58  ? -1.800  4.498   -10.404 1.00 32.82 ?  51  ASP A O   1 
ATOM   387  C  CB  . ASP A 1 58  ? -0.709  1.572   -11.286 1.00 34.99 ?  51  ASP A CB  1 
ATOM   388  C  CG  . ASP A 1 58  ? 0.476   0.644   -11.254 1.00 43.84 ?  51  ASP A CG  1 
ATOM   389  O  OD1 . ASP A 1 58  ? 1.544   1.069   -10.771 1.00 47.19 ?  51  ASP A OD1 1 
ATOM   390  O  OD2 . ASP A 1 58  ? 0.339   -0.517  -11.689 1.00 44.91 -1 51  ASP A OD2 1 
ATOM   391  N  N   . THR A 1 59  ? 0.417   4.360   -9.982  1.00 30.83 ?  52  THR A N   1 
ATOM   392  C  CA  . THR A 1 59  ? 0.710   5.774   -10.190 1.00 30.76 ?  52  THR A CA  1 
ATOM   393  C  C   . THR A 1 59  ? 2.089   5.895   -10.810 1.00 33.89 ?  52  THR A C   1 
ATOM   394  O  O   . THR A 1 59  ? 2.935   5.006   -10.676 1.00 34.05 ?  52  THR A O   1 
ATOM   395  C  CB  . THR A 1 59  ? 0.691   6.594   -8.882  1.00 36.56 ?  52  THR A CB  1 
ATOM   396  O  OG1 . THR A 1 59  ? 1.692   6.087   -7.985  1.00 43.88 ?  52  THR A OG1 1 
ATOM   397  C  CG2 . THR A 1 59  ? -0.648  6.522   -8.207  1.00 38.93 ?  52  THR A CG2 1 
ATOM   398  N  N   . GLY A 1 60  ? 2.329   7.023   -11.461 1.00 27.05 ?  53  GLY A N   1 
ATOM   399  C  CA  . GLY A 1 60  ? 3.622   7.245   -12.067 1.00 28.43 ?  53  GLY A CA  1 
ATOM   400  C  C   . GLY A 1 60  ? 3.584   8.465   -12.962 1.00 29.30 ?  53  GLY A C   1 
ATOM   401  O  O   . GLY A 1 60  ? 2.592   9.200   -13.010 1.00 27.82 ?  53  GLY A O   1 
ATOM   402  N  N   . VAL A 1 61  ? 4.696   8.668   -13.662 1.00 28.27 ?  54  VAL A N   1 
ATOM   403  C  CA  . VAL A 1 61  ? 4.901   9.854   -14.485 1.00 32.27 ?  54  VAL A CA  1 
ATOM   404  C  C   . VAL A 1 61  ? 5.587   9.432   -15.776 1.00 29.98 ?  54  VAL A C   1 
ATOM   405  O  O   . VAL A 1 61  ? 6.591   8.714   -15.744 1.00 31.13 ?  54  VAL A O   1 
ATOM   406  C  CB  . VAL A 1 61  ? 5.745   10.912  -13.742 1.00 31.82 ?  54  VAL A CB  1 
ATOM   407  C  CG1 . VAL A 1 61  ? 5.997   12.123  -14.634 1.00 33.32 ?  54  VAL A CG1 1 
ATOM   408  C  CG2 . VAL A 1 61  ? 5.061   11.342  -12.450 1.00 30.12 ?  54  VAL A CG2 1 
ATOM   409  N  N   . PHE A 1 62  ? 5.038   9.857   -16.913 1.00 28.60 ?  55  PHE A N   1 
ATOM   410  C  CA  . PHE A 1 62  ? 5.681   9.704   -18.206 1.00 25.60 ?  55  PHE A CA  1 
ATOM   411  C  C   . PHE A 1 62  ? 6.070   11.076  -18.737 1.00 27.38 ?  55  PHE A C   1 
ATOM   412  O  O   . PHE A 1 62  ? 5.390   12.073  -18.478 1.00 25.20 ?  55  PHE A O   1 
ATOM   413  C  CB  . PHE A 1 62  ? 4.763   9.036   -19.241 1.00 26.51 ?  55  PHE A CB  1 
ATOM   414  C  CG  . PHE A 1 62  ? 4.578   7.558   -19.046 1.00 30.69 ?  55  PHE A CG  1 
ATOM   415  C  CD1 . PHE A 1 62  ? 5.503   6.659   -19.541 1.00 33.13 ?  55  PHE A CD1 1 
ATOM   416  C  CD2 . PHE A 1 62  ? 3.457   7.067   -18.401 1.00 26.29 ?  55  PHE A CD2 1 
ATOM   417  C  CE1 . PHE A 1 62  ? 5.327   5.296   -19.363 1.00 34.06 ?  55  PHE A CE1 1 
ATOM   418  C  CE2 . PHE A 1 62  ? 3.280   5.704   -18.224 1.00 32.08 ?  55  PHE A CE2 1 
ATOM   419  C  CZ  . PHE A 1 62  ? 4.220   4.823   -18.708 1.00 30.67 ?  55  PHE A CZ  1 
ATOM   420  N  N   . ARG A 1 63  ? 7.169   11.114  -19.483 1.00 27.14 ?  56  ARG A N   1 
ATOM   421  C  CA  . ARG A 1 63  ? 7.539   12.268  -20.282 1.00 31.21 ?  56  ARG A CA  1 
ATOM   422  C  C   . ARG A 1 63  ? 7.648   11.841  -21.737 1.00 31.84 ?  56  ARG A C   1 
ATOM   423  O  O   . ARG A 1 63  ? 8.220   10.792  -22.051 1.00 31.12 ?  56  ARG A O   1 
ATOM   424  C  CB  . ARG A 1 63  ? 8.857   12.901  -19.836 1.00 32.13 ?  56  ARG A CB  1 
ATOM   425  C  CG  . ARG A 1 63  ? 9.167   14.174  -20.624 1.00 35.65 ?  56  ARG A CG  1 
ATOM   426  C  CD  . ARG A 1 63  ? 10.581  14.692  -20.427 1.00 38.66 ?  56  ARG A CD  1 
ATOM   427  N  NE  . ARG A 1 63  ? 11.601  13.839  -21.022 1.00 45.11 ?  56  ARG A NE  1 
ATOM   428  C  CZ  . ARG A 1 63  ? 12.900  14.129  -21.012 1.00 51.24 ?  56  ARG A CZ  1 
ATOM   429  N  NH1 . ARG A 1 63  ? 13.321  15.253  -20.441 1.00 46.54 1  56  ARG A NH1 1 
ATOM   430  N  NH2 . ARG A 1 63  ? 13.771  13.302  -21.576 1.00 47.92 ?  56  ARG A NH2 1 
ATOM   431  N  N   . GLY A 1 64  ? 7.093   12.652  -22.624 1.00 29.08 ?  57  GLY A N   1 
ATOM   432  C  CA  . GLY A 1 64  ? 7.196   12.407  -24.044 1.00 26.25 ?  57  GLY A CA  1 
ATOM   433  C  C   . GLY A 1 64  ? 7.365   13.727  -24.764 1.00 28.25 ?  57  GLY A C   1 
ATOM   434  O  O   . GLY A 1 64  ? 7.468   14.774  -24.138 1.00 25.86 ?  57  GLY A O   1 
ATOM   435  N  N   . GLN A 1 65  ? 7.418   13.651  -26.085 1.00 26.21 ?  58  GLN A N   1 
ATOM   436  C  CA  . GLN A 1 65  ? 7.493   14.841  -26.918 1.00 29.47 ?  58  GLN A CA  1 
ATOM   437  C  C   . GLN A 1 65  ? 6.096   15.383  -27.184 1.00 26.52 ?  58  GLN A C   1 
ATOM   438  O  O   . GLN A 1 65  ? 5.131   14.628  -27.256 1.00 25.03 ?  58  GLN A O   1 
ATOM   439  C  CB  . GLN A 1 65  ? 8.174   14.513  -28.247 1.00 30.76 ?  58  GLN A CB  1 
ATOM   440  C  CG  . GLN A 1 65  ? 9.557   13.939  -28.082 1.00 33.11 ?  58  GLN A CG  1 
ATOM   441  C  CD  . GLN A 1 65  ? 10.585  15.011  -27.835 1.00 39.62 ?  58  GLN A CD  1 
ATOM   442  O  OE1 . GLN A 1 65  ? 10.364  16.182  -28.161 1.00 37.53 ?  58  GLN A OE1 1 
ATOM   443  N  NE2 . GLN A 1 65  ? 11.717  14.627  -27.248 1.00 42.32 ?  58  GLN A NE2 1 
ATOM   444  N  N   . VAL A 1 66  ? 5.997   16.704  -27.331 1.00 25.73 ?  59  VAL A N   1 
ATOM   445  C  CA  . VAL A 1 66  ? 4.747   17.302  -27.803 1.00 27.55 ?  59  VAL A CA  1 
ATOM   446  C  C   . VAL A 1 66  ? 4.600   17.102  -29.299 1.00 27.52 ?  59  VAL A C   1 
ATOM   447  O  O   . VAL A 1 66  ? 3.501   16.831  -29.804 1.00 24.93 ?  59  VAL A O   1 
ATOM   448  C  CB  . VAL A 1 66  ? 4.685   18.799  -27.445 1.00 25.80 ?  59  VAL A CB  1 
ATOM   449  C  CG1 . VAL A 1 66  ? 3.336   19.375  -27.841 1.00 31.13 ?  59  VAL A CG1 1 
ATOM   450  C  CG2 . VAL A 1 66  ? 4.888   18.978  -26.005 1.00 29.75 ?  59  VAL A CG2 1 
ATOM   451  N  N   . TYR A 1 67  ? 5.693   17.262  -30.038 1.00 29.27 ?  60  TYR A N   1 
ATOM   452  C  CA  . TYR A 1 67  ? 5.687   17.087  -31.468 1.00 28.45 ?  60  TYR A CA  1 
ATOM   453  C  C   . TYR A 1 67  ? 6.495   15.826  -31.789 1.00 31.30 ?  60  TYR A C   1 
ATOM   454  O  O   . TYR A 1 67  ? 6.622   14.942  -30.917 1.00 29.74 ?  60  TYR A O   1 
ATOM   455  C  CB  . TYR A 1 67  ? 6.187   18.372  -32.125 1.00 34.39 ?  60  TYR A CB  1 
ATOM   456  C  CG  . TYR A 1 67  ? 5.246   19.556  -31.877 1.00 32.48 ?  60  TYR A CG  1 
ATOM   457  C  CD1 . TYR A 1 67  ? 3.922   19.516  -32.315 1.00 32.39 ?  60  TYR A CD1 1 
ATOM   458  C  CD2 . TYR A 1 67  ? 5.674   20.693  -31.205 1.00 32.08 ?  60  TYR A CD2 1 
ATOM   459  C  CE1 . TYR A 1 67  ? 3.049   20.584  -32.100 1.00 32.36 ?  60  TYR A CE1 1 
ATOM   460  C  CE2 . TYR A 1 67  ? 4.806   21.770  -30.983 1.00 32.70 ?  60  TYR A CE2 1 
ATOM   461  C  CZ  . TYR A 1 67  ? 3.497   21.703  -31.432 1.00 31.59 ?  60  TYR A CZ  1 
ATOM   462  O  OH  . TYR A 1 67  ? 2.618   22.754  -31.222 1.00 35.83 ?  60  TYR A OH  1 
ATOM   463  N  N   . PHE A 1 68  ? 7.023   15.737  -33.016 1.00 32.36 ?  61  PHE A N   1 
ATOM   464  C  CA  . PHE A 1 68  ? 7.573   14.500  -33.564 1.00 32.96 ?  61  PHE A CA  1 
ATOM   465  C  C   . PHE A 1 68  ? 6.457   13.481  -33.742 1.00 35.11 ?  61  PHE A C   1 
ATOM   466  O  O   . PHE A 1 68  ? 5.278   13.800  -33.535 1.00 30.45 ?  61  PHE A O   1 
ATOM   467  C  CB  . PHE A 1 68  ? 8.698   13.945  -32.681 1.00 36.77 ?  61  PHE A CB  1 
ATOM   468  C  CG  . PHE A 1 68  ? 9.894   14.847  -32.600 1.00 34.88 ?  61  PHE A CG  1 
ATOM   469  C  CD1 . PHE A 1 68  ? 10.888  14.792  -33.569 1.00 40.80 ?  61  PHE A CD1 1 
ATOM   470  C  CD2 . PHE A 1 68  ? 10.012  15.772  -31.579 1.00 38.40 ?  61  PHE A CD2 1 
ATOM   471  C  CE1 . PHE A 1 68  ? 11.993  15.633  -33.504 1.00 37.69 ?  61  PHE A CE1 1 
ATOM   472  C  CE2 . PHE A 1 68  ? 11.110  16.605  -31.500 1.00 41.24 ?  61  PHE A CE2 1 
ATOM   473  C  CZ  . PHE A 1 68  ? 12.103  16.539  -32.469 1.00 43.21 ?  61  PHE A CZ  1 
ATOM   474  N  N   . LYS A 1 69  ? 6.810   12.267  -34.162 1.00 35.69 ?  62  LYS A N   1 
ATOM   475  C  CA  . LYS A 1 69  ? 5.798   11.274  -34.478 1.00 38.51 ?  62  LYS A CA  1 
ATOM   476  C  C   . LYS A 1 69  ? 5.122   10.775  -33.199 1.00 35.42 ?  62  LYS A C   1 
ATOM   477  O  O   . LYS A 1 69  ? 5.732   10.774  -32.127 1.00 34.11 ?  62  LYS A O   1 
ATOM   478  C  CB  . LYS A 1 69  ? 6.422   10.110  -35.249 1.00 39.47 ?  62  LYS A CB  1 
ATOM   479  C  CG  . LYS A 1 69  ? 6.745   10.440  -36.715 1.00 43.30 ?  62  LYS A CG  1 
ATOM   480  C  CD  . LYS A 1 69  ? 5.487   10.775  -37.504 1.00 47.03 ?  62  LYS A CD  1 
ATOM   481  C  CE  . LYS A 1 69  ? 5.815   11.178  -38.945 1.00 59.22 ?  62  LYS A CE  1 
ATOM   482  N  NZ  . LYS A 1 69  ? 6.768   10.227  -39.606 1.00 53.50 1  62  LYS A NZ  1 
ATOM   483  N  N   . PRO A 1 70  ? 3.858   10.342  -33.289 1.00 33.61 ?  63  PRO A N   1 
ATOM   484  C  CA  . PRO A 1 70  ? 3.097   10.031  -32.063 1.00 35.62 ?  63  PRO A CA  1 
ATOM   485  C  C   . PRO A 1 70  ? 3.689   8.901   -31.238 1.00 35.11 ?  63  PRO A C   1 
ATOM   486  O  O   . PRO A 1 70  ? 3.402   8.818   -30.036 1.00 30.33 ?  63  PRO A O   1 
ATOM   487  C  CB  . PRO A 1 70  ? 1.703   9.666   -32.594 1.00 32.66 ?  63  PRO A CB  1 
ATOM   488  C  CG  . PRO A 1 70  ? 1.632   10.272  -33.958 1.00 38.79 ?  63  PRO A CG  1 
ATOM   489  C  CD  . PRO A 1 70  ? 3.021   10.268  -34.499 1.00 34.23 ?  63  PRO A CD  1 
ATOM   490  N  N   . GLN A 1 71  ? 4.528   8.049   -31.831 1.00 34.73 ?  64  GLN A N   1 
ATOM   491  C  CA  . GLN A 1 71  ? 5.211   7.021   -31.048 1.00 40.32 ?  64  GLN A CA  1 
ATOM   492  C  C   . GLN A 1 71  ? 6.037   7.624   -29.914 1.00 36.20 ?  64  GLN A C   1 
ATOM   493  O  O   . GLN A 1 71  ? 6.255   6.968   -28.886 1.00 41.76 ?  64  GLN A O   1 
ATOM   494  C  CB  . GLN A 1 71  ? 6.112   6.174   -31.953 1.00 43.29 ?  64  GLN A CB  1 
ATOM   495  C  CG  . GLN A 1 71  ? 5.434   5.693   -33.223 1.00 46.03 ?  64  GLN A CG  1 
ATOM   496  C  CD  . GLN A 1 71  ? 5.589   6.678   -34.368 1.00 54.19 ?  64  GLN A CD  1 
ATOM   497  O  OE1 . GLN A 1 71  ? 6.711   6.966   -34.803 1.00 54.51 ?  64  GLN A OE1 1 
ATOM   498  N  NE2 . GLN A 1 71  ? 4.464   7.207   -34.857 1.00 56.61 ?  64  GLN A NE2 1 
ATOM   499  N  N   . TYR A 1 72  ? 6.506   8.858   -30.079 1.00 35.99 ?  65  TYR A N   1 
ATOM   500  C  CA  . TYR A 1 72  ? 7.303   9.524   -29.061 1.00 35.98 ?  65  TYR A CA  1 
ATOM   501  C  C   . TYR A 1 72  ? 6.465   10.294  -28.045 1.00 31.75 ?  65  TYR A C   1 
ATOM   502  O  O   . TYR A 1 72  ? 7.037   10.948  -27.169 1.00 28.30 ?  65  TYR A O   1 
ATOM   503  C  CB  . TYR A 1 72  ? 8.305   10.488  -29.713 1.00 38.38 ?  65  TYR A CB  1 
ATOM   504  C  CG  . TYR A 1 72  ? 9.249   9.842   -30.712 1.00 48.63 ?  65  TYR A CG  1 
ATOM   505  C  CD1 . TYR A 1 72  ? 10.276  9.002   -30.288 1.00 52.87 ?  65  TYR A CD1 1 
ATOM   506  C  CD2 . TYR A 1 72  ? 9.119   10.081  -32.082 1.00 48.03 ?  65  TYR A CD2 1 
ATOM   507  C  CE1 . TYR A 1 72  ? 11.143  8.406   -31.202 1.00 55.58 ?  65  TYR A CE1 1 
ATOM   508  C  CE2 . TYR A 1 72  ? 9.980   9.489   -33.001 1.00 54.24 ?  65  TYR A CE2 1 
ATOM   509  C  CZ  . TYR A 1 72  ? 10.990  8.653   -32.554 1.00 58.66 ?  65  TYR A CZ  1 
ATOM   510  O  OH  . TYR A 1 72  ? 11.850  8.065   -33.459 1.00 59.71 ?  65  TYR A OH  1 
ATOM   511  N  N   . HIS A 1 73  ? 5.142   10.250  -28.136 1.00 25.94 ?  66  HIS A N   1 
ATOM   512  C  CA  . HIS A 1 73  ? 4.313   11.100  -27.292 1.00 26.25 ?  66  HIS A CA  1 
ATOM   513  C  C   . HIS A 1 73  ? 4.004   10.430  -25.964 1.00 23.61 ?  66  HIS A C   1 
ATOM   514  O  O   . HIS A 1 73  ? 3.917   9.206   -25.873 1.00 25.13 ?  66  HIS A O   1 
ATOM   515  C  CB  . HIS A 1 73  ? 3.009   11.458  -28.003 1.00 24.44 ?  66  HIS A CB  1 
ATOM   516  C  CG  . HIS A 1 73  ? 3.214   12.296  -29.219 1.00 27.00 ?  66  HIS A CG  1 
ATOM   517  N  ND1 . HIS A 1 73  ? 2.171   12.823  -29.945 1.00 21.96 ?  66  HIS A ND1 1 
ATOM   518  C  CD2 . HIS A 1 73  ? 4.351   12.709  -29.826 1.00 23.86 ?  66  HIS A CD2 1 
ATOM   519  C  CE1 . HIS A 1 73  ? 2.662   13.514  -30.963 1.00 30.63 ?  66  HIS A CE1 1 
ATOM   520  N  NE2 . HIS A 1 73  ? 3.981   13.467  -30.907 1.00 28.14 ?  66  HIS A NE2 1 
ATOM   521  N  N   . ALA A 1 74  ? 3.833   11.262  -24.933 1.00 23.04 ?  67  ALA A N   1 
ATOM   522  C  CA  . ALA A 1 74  ? 3.544   10.759  -23.588 1.00 23.70 ?  67  ALA A CA  1 
ATOM   523  C  C   . ALA A 1 74  ? 2.305   9.875   -23.576 1.00 24.64 ?  67  ALA A C   1 
ATOM   524  O  O   . ALA A 1 74  ? 2.253   8.860   -22.866 1.00 23.69 ?  67  ALA A O   1 
ATOM   525  C  CB  . ALA A 1 74  ? 3.355   11.939  -22.629 1.00 23.16 ?  67  ALA A CB  1 
ATOM   526  N  N   . GLU A 1 75  ? 1.285   10.258  -24.341 1.00 21.11 ?  68  GLU A N   1 
ATOM   527  C  CA  . GLU A 1 75  ? 0.016   9.542   -24.341 1.00 21.97 ?  68  GLU A CA  1 
ATOM   528  C  C   . GLU A 1 75  ? 0.165   8.130   -24.907 1.00 21.83 ?  68  GLU A C   1 
ATOM   529  O  O   . GLU A 1 75  ? -0.496  7.198   -24.439 1.00 24.66 ?  68  GLU A O   1 
ATOM   530  C  CB  . GLU A 1 75  ? -1.019  10.334  -25.154 1.00 24.61 ?  68  GLU A CB  1 
ATOM   531  C  CG  . GLU A 1 75  ? -1.360  11.717  -24.567 1.00 21.91 ?  68  GLU A CG  1 
ATOM   532  C  CD  . GLU A 1 75  ? -0.439  12.833  -25.076 1.00 25.77 ?  68  GLU A CD  1 
ATOM   533  O  OE1 . GLU A 1 75  ? 0.549   12.544  -25.785 1.00 26.47 ?  68  GLU A OE1 1 
ATOM   534  O  OE2 . GLU A 1 75  ? -0.710  14.013  -24.756 1.00 25.49 -1 68  GLU A OE2 1 
ATOM   535  N  N   . MET A 1 76  ? 1.011   7.957   -25.927 1.00 24.79 ?  69  MET A N   1 
ATOM   536  C  CA  . MET A 1 76  ? 1.293   6.623   -26.449 1.00 26.12 ?  69  MET A CA  1 
ATOM   537  C  C   . MET A 1 76  ? 2.275   5.859   -25.568 1.00 26.43 ?  69  MET A C   1 
ATOM   538  O  O   . MET A 1 76  ? 2.188   4.626   -25.494 1.00 28.10 ?  69  MET A O   1 
ATOM   539  C  CB  . MET A 1 76  ? 1.823   6.720   -27.883 1.00 26.80 ?  69  MET A CB  1 
ATOM   540  C  CG  . MET A 1 76  ? 0.813   7.300   -28.883 1.00 30.43 ?  69  MET A CG  1 
ATOM   541  S  SD  . MET A 1 76  ? -0.751  6.400   -28.926 1.00 31.47 ?  69  MET A SD  1 
ATOM   542  C  CE  . MET A 1 76  ? -1.779  7.354   -27.795 1.00 32.38 ?  69  MET A CE  1 
ATOM   543  N  N   . CYS A 1 77  ? 3.208   6.558   -24.909 1.00 26.78 ?  70  CYS A N   1 
ATOM   544  C  CA  . CYS A 1 77  ? 4.013   5.919   -23.867 1.00 29.11 ?  70  CYS A CA  1 
ATOM   545  C  C   . CYS A 1 77  ? 3.111   5.300   -22.815 1.00 28.56 ?  70  CYS A C   1 
ATOM   546  O  O   . CYS A 1 77  ? 3.293   4.139   -22.426 1.00 27.14 ?  70  CYS A O   1 
ATOM   547  C  CB  . CYS A 1 77  ? 4.950   6.924   -23.201 1.00 30.20 ?  70  CYS A CB  1 
ATOM   548  S  SG  . CYS A 1 77  ? 6.272   7.545   -24.247 1.00 42.68 ?  70  CYS A SG  1 
ATOM   549  N  N   . PHE A 1 78  ? 2.124   6.065   -22.349 1.00 22.97 ?  71  PHE A N   1 
ATOM   550  C  CA  . PHE A 1 78  ? 1.192   5.544   -21.362 1.00 22.90 ?  71  PHE A CA  1 
ATOM   551  C  C   . PHE A 1 78  ? 0.383   4.380   -21.911 1.00 26.37 ?  71  PHE A C   1 
ATOM   552  O  O   . PHE A 1 78  ? 0.148   3.389   -21.208 1.00 23.36 ?  71  PHE A O   1 
ATOM   553  C  CB  . PHE A 1 78  ? 0.245   6.642   -20.877 1.00 25.49 ?  71  PHE A CB  1 
ATOM   554  C  CG  . PHE A 1 78  ? -0.792  6.129   -19.935 1.00 22.97 ?  71  PHE A CG  1 
ATOM   555  C  CD1 . PHE A 1 78  ? -1.973  5.578   -20.421 1.00 23.25 ?  71  PHE A CD1 1 
ATOM   556  C  CD2 . PHE A 1 78  ? -0.550  6.105   -18.571 1.00 26.33 ?  71  PHE A CD2 1 
ATOM   557  C  CE1 . PHE A 1 78  ? -2.905  5.045   -19.585 1.00 23.28 ?  71  PHE A CE1 1 
ATOM   558  C  CE2 . PHE A 1 78  ? -1.495  5.581   -17.711 1.00 25.65 ?  71  PHE A CE2 1 
ATOM   559  C  CZ  . PHE A 1 78  ? -2.673  5.048   -18.218 1.00 26.80 ?  71  PHE A CZ  1 
ATOM   560  N  N   . LEU A 1 79  ? -0.151  4.523   -23.133 1.00 23.54 ?  72  LEU A N   1 
ATOM   561  C  CA  . LEU A 1 79  ? -1.049  3.491   -23.638 1.00 23.95 ?  72  LEU A CA  1 
ATOM   562  C  C   . LEU A 1 79  ? -0.301  2.183   -23.851 1.00 23.71 ?  72  LEU A C   1 
ATOM   563  O  O   . LEU A 1 79  ? -0.834  1.101   -23.573 1.00 22.88 ?  72  LEU A O   1 
ATOM   564  C  CB  . LEU A 1 79  ? -1.701  3.962   -24.934 1.00 24.84 ?  72  LEU A CB  1 
ATOM   565  C  CG  . LEU A 1 79  ? -3.089  3.453   -25.296 1.00 33.77 ?  72  LEU A CG  1 
ATOM   566  C  CD1 . LEU A 1 79  ? -4.078  3.779   -24.196 1.00 28.27 ?  72  LEU A CD1 1 
ATOM   567  C  CD2 . LEU A 1 79  ? -3.530  4.080   -26.624 1.00 31.28 ?  72  LEU A CD2 1 
ATOM   568  N  N   . SER A 1 80  ? 0.936   2.264   -24.348 1.00 25.16 ?  73  SER A N   1 
ATOM   569  C  CA  . SER A 1 80  ? 1.734   1.054   -24.549 1.00 28.84 ?  73  SER A CA  1 
ATOM   570  C  C   . SER A 1 80  ? 2.063   0.384   -23.216 1.00 29.13 ?  73  SER A C   1 
ATOM   571  O  O   . SER A 1 80  ? 1.973   -0.843  -23.088 1.00 27.86 ?  73  SER A O   1 
ATOM   572  C  CB  . SER A 1 80  ? 3.018   1.396   -25.304 1.00 35.59 ?  73  SER A CB  1 
ATOM   573  O  OG  . SER A 1 80  ? 3.810   0.232   -25.481 1.00 41.91 ?  73  SER A OG  1 
ATOM   574  N  N   . TRP A 1 81  ? 2.427   1.174   -22.211 1.00 23.09 ?  74  TRP A N   1 
ATOM   575  C  CA  . TRP A 1 81  ? 2.659   0.622   -20.876 1.00 27.01 ?  74  TRP A CA  1 
ATOM   576  C  C   . TRP A 1 81  ? 1.388   0.006   -20.285 1.00 25.11 ?  74  TRP A C   1 
ATOM   577  O  O   . TRP A 1 81  ? 1.434   -1.079  -19.688 1.00 25.75 ?  74  TRP A O   1 
ATOM   578  C  CB  . TRP A 1 81  ? 3.206   1.710   -19.954 1.00 27.84 ?  74  TRP A CB  1 
ATOM   579  C  CG  . TRP A 1 81  ? 3.231   1.296   -18.506 1.00 29.00 ?  74  TRP A CG  1 
ATOM   580  C  CD1 . TRP A 1 81  ? 4.230   0.622   -17.857 1.00 33.09 ?  74  TRP A CD1 1 
ATOM   581  C  CD2 . TRP A 1 81  ? 2.203   1.520   -17.537 1.00 28.70 ?  74  TRP A CD2 1 
ATOM   582  N  NE1 . TRP A 1 81  ? 3.888   0.422   -16.539 1.00 30.47 ?  74  TRP A NE1 1 
ATOM   583  C  CE2 . TRP A 1 81  ? 2.650   0.965   -16.317 1.00 35.11 ?  74  TRP A CE2 1 
ATOM   584  C  CE3 . TRP A 1 81  ? 0.957   2.156   -17.575 1.00 27.72 ?  74  TRP A CE3 1 
ATOM   585  C  CZ2 . TRP A 1 81  ? 1.887   1.011   -15.153 1.00 33.63 ?  74  TRP A CZ2 1 
ATOM   586  C  CZ3 . TRP A 1 81  ? 0.196   2.202   -16.422 1.00 35.20 ?  74  TRP A CZ3 1 
ATOM   587  C  CH2 . TRP A 1 81  ? 0.664   1.629   -15.223 1.00 33.48 ?  74  TRP A CH2 1 
ATOM   588  N  N   . PHE A 1 82  ? 0.243   0.687   -20.425 1.00 23.32 ?  75  PHE A N   1 
ATOM   589  C  CA  . PHE A 1 82  ? -1.001  0.206   -19.824 1.00 23.85 ?  75  PHE A CA  1 
ATOM   590  C  C   . PHE A 1 82  ? -1.447  -1.114  -20.447 1.00 26.88 ?  75  PHE A C   1 
ATOM   591  O  O   . PHE A 1 82  ? -1.830  -2.053  -19.738 1.00 25.28 ?  75  PHE A O   1 
ATOM   592  C  CB  . PHE A 1 82  ? -2.097  1.275   -19.961 1.00 23.53 ?  75  PHE A CB  1 
ATOM   593  C  CG  . PHE A 1 82  ? -3.401  0.912   -19.296 1.00 25.50 ?  75  PHE A CG  1 
ATOM   594  C  CD1 . PHE A 1 82  ? -3.611  1.180   -17.946 1.00 27.31 ?  75  PHE A CD1 1 
ATOM   595  C  CD2 . PHE A 1 82  ? -4.420  0.318   -20.015 1.00 29.69 ?  75  PHE A CD2 1 
ATOM   596  C  CE1 . PHE A 1 82  ? -4.806  0.838   -17.335 1.00 27.30 ?  75  PHE A CE1 1 
ATOM   597  C  CE2 . PHE A 1 82  ? -5.621  -0.027  -19.400 1.00 30.47 ?  75  PHE A CE2 1 
ATOM   598  C  CZ  . PHE A 1 82  ? -5.807  0.243   -18.059 1.00 29.15 ?  75  PHE A CZ  1 
ATOM   599  N  N   . CYS A 1 83  ? -1.414  -1.209  -21.778 1.00 22.73 ?  76  CYS A N   1 
ATOM   600  C  CA  . CYS A 1 83  ? -1.792  -2.467  -22.414 1.00 26.67 ?  76  CYS A CA  1 
ATOM   601  C  C   . CYS A 1 83  ? -0.840  -3.604  -22.063 1.00 27.10 ?  76  CYS A C   1 
ATOM   602  O  O   . CYS A 1 83  ? -1.269  -4.753  -21.968 1.00 30.23 ?  76  CYS A O   1 
ATOM   603  C  CB  . CYS A 1 83  ? -1.856  -2.284  -23.924 1.00 29.54 ?  76  CYS A CB  1 
ATOM   604  S  SG  . CYS A 1 83  ? -3.231  -1.231  -24.351 1.00 34.59 ?  76  CYS A SG  1 
ATOM   605  N  N   . GLY A 1 84  ? 0.451   -3.310  -21.883 1.00 26.91 ?  77  GLY A N   1 
ATOM   606  C  CA  . GLY A 1 84  ? 1.408   -4.355  -21.576 1.00 27.38 ?  77  GLY A CA  1 
ATOM   607  C  C   . GLY A 1 84  ? 1.463   -4.752  -20.118 1.00 29.39 ?  77  GLY A C   1 
ATOM   608  O  O   . GLY A 1 84  ? 1.898   -5.863  -19.809 1.00 26.75 ?  77  GLY A O   1 
ATOM   609  N  N   . ASN A 1 85  ? 1.009   -3.888  -19.217 1.00 25.79 ?  78  ASN A N   1 
ATOM   610  C  CA  . ASN A 1 85  ? 1.252   -4.085  -17.793 1.00 27.56 ?  78  ASN A CA  1 
ATOM   611  C  C   . ASN A 1 85  ? 0.009   -4.055  -16.933 1.00 28.97 ?  78  ASN A C   1 
ATOM   612  O  O   . ASN A 1 85  ? 0.051   -4.594  -15.824 1.00 33.59 ?  78  ASN A O   1 
ATOM   613  C  CB  . ASN A 1 85  ? 2.242   -3.039  -17.277 1.00 27.32 ?  78  ASN A CB  1 
ATOM   614  C  CG  . ASN A 1 85  ? 3.620   -3.219  -17.869 1.00 30.64 ?  78  ASN A CG  1 
ATOM   615  O  OD1 . ASN A 1 85  ? 4.405   -4.047  -17.403 1.00 29.59 ?  78  ASN A OD1 1 
ATOM   616  N  ND2 . ASN A 1 85  ? 3.907   -2.480  -18.931 1.00 27.31 ?  78  ASN A ND2 1 
ATOM   617  N  N   . GLN A 1 86  ? -1.087  -3.456  -17.389 1.00 29.44 ?  79  GLN A N   1 
ATOM   618  C  CA  . GLN A 1 86  ? -2.344  -3.491  -16.656 1.00 29.45 ?  79  GLN A CA  1 
ATOM   619  C  C   . GLN A 1 86  ? -3.368  -4.404  -17.296 1.00 34.98 ?  79  GLN A C   1 
ATOM   620  O  O   . GLN A 1 86  ? -4.291  -4.847  -16.609 1.00 35.28 ?  79  GLN A O   1 
ATOM   621  C  CB  . GLN A 1 86  ? -2.954  -2.088  -16.551 1.00 29.56 ?  79  GLN A CB  1 
ATOM   622  C  CG  . GLN A 1 86  ? -2.123  -1.096  -15.774 1.00 32.64 ?  79  GLN A CG  1 
ATOM   623  C  CD  . GLN A 1 86  ? -1.914  -1.521  -14.339 1.00 40.27 ?  79  GLN A CD  1 
ATOM   624  O  OE1 . GLN A 1 86  ? -2.771  -2.177  -13.742 1.00 40.78 ?  79  GLN A OE1 1 
ATOM   625  N  NE2 . GLN A 1 86  ? -0.758  -1.168  -13.780 1.00 44.71 ?  79  GLN A NE2 1 
ATOM   626  N  N   . LEU A 1 87  ? -3.221  -4.682  -18.585 1.00 34.49 ?  80  LEU A N   1 
ATOM   627  C  CA  . LEU A 1 87  ? -4.092  -5.576  -19.330 1.00 34.94 ?  80  LEU A CA  1 
ATOM   628  C  C   . LEU A 1 87  ? -3.258  -6.799  -19.715 1.00 37.20 ?  80  LEU A C   1 
ATOM   629  O  O   . LEU A 1 87  ? -2.035  -6.698  -19.851 1.00 41.61 ?  80  LEU A O   1 
ATOM   630  C  CB  . LEU A 1 87  ? -4.653  -4.871  -20.579 1.00 37.59 ?  80  LEU A CB  1 
ATOM   631  C  CG  . LEU A 1 87  ? -5.393  -3.550  -20.378 1.00 32.56 ?  80  LEU A CG  1 
ATOM   632  C  CD1 . LEU A 1 87  ? -5.832  -2.948  -21.722 1.00 35.61 ?  80  LEU A CD1 1 
ATOM   633  C  CD2 . LEU A 1 87  ? -6.584  -3.741  -19.458 1.00 34.04 ?  80  LEU A CD2 1 
ATOM   634  N  N   . PRO A 1 88  ? -3.901  -7.954  -19.912 1.00 38.52 ?  81  PRO A N   1 
ATOM   635  C  CA  . PRO A 1 88  ? -5.349  -8.181  -19.871 1.00 38.77 ?  81  PRO A CA  1 
ATOM   636  C  C   . PRO A 1 88  ? -5.892  -8.202  -18.454 1.00 37.25 ?  81  PRO A C   1 
ATOM   637  O  O   . PRO A 1 88  ? -5.255  -8.768  -17.566 1.00 40.43 ?  81  PRO A O   1 
ATOM   638  C  CB  . PRO A 1 88  ? -5.501  -9.552  -20.529 1.00 38.85 ?  81  PRO A CB  1 
ATOM   639  C  CG  . PRO A 1 88  ? -4.231  -10.256 -20.164 1.00 41.75 ?  81  PRO A CG  1 
ATOM   640  C  CD  . PRO A 1 88  ? -3.159  -9.195  -20.201 1.00 39.88 ?  81  PRO A CD  1 
ATOM   641  N  N   . ALA A 1 89  ? -7.050  -7.576  -18.259 1.00 36.83 ?  82  ALA A N   1 
ATOM   642  C  CA  . ALA A 1 89  ? -7.742  -7.604  -16.979 1.00 43.42 ?  82  ALA A CA  1 
ATOM   643  C  C   . ALA A 1 89  ? -9.185  -7.187  -17.210 1.00 44.47 ?  82  ALA A C   1 
ATOM   644  O  O   . ALA A 1 89  ? -9.488  -6.433  -18.142 1.00 49.65 ?  82  ALA A O   1 
ATOM   645  C  CB  . ALA A 1 89  ? -7.074  -6.694  -15.939 1.00 41.58 ?  82  ALA A CB  1 
ATOM   646  N  N   . ASP A 1 90  ? -10.064 -7.693  -16.351 1.00 45.35 ?  83  ASP A N   1 
ATOM   647  C  CA  . ASP A 1 90  ? -11.500 -7.466  -16.437 1.00 45.80 ?  83  ASP A CA  1 
ATOM   648  C  C   . ASP A 1 90  ? -11.980 -6.339  -15.538 1.00 47.90 ?  83  ASP A C   1 
ATOM   649  O  O   . ASP A 1 90  ? -13.158 -5.979  -15.598 1.00 57.34 ?  83  ASP A O   1 
ATOM   650  C  CB  . ASP A 1 90  ? -12.249 -8.752  -16.077 1.00 50.69 ?  83  ASP A CB  1 
ATOM   651  C  CG  . ASP A 1 90  ? -12.102 -9.818  -17.133 1.00 47.30 ?  83  ASP A CG  1 
ATOM   652  O  OD1 . ASP A 1 90  ? -12.302 -9.489  -18.323 1.00 53.47 ?  83  ASP A OD1 1 
ATOM   653  O  OD2 . ASP A 1 90  ? -11.769 -10.973 -16.779 1.00 44.76 -1 83  ASP A OD2 1 
ATOM   654  N  N   . LYS A 1 91  ? -11.103 -5.783  -14.708 1.00 43.06 ?  84  LYS A N   1 
ATOM   655  C  CA  . LYS A 1 91  ? -11.488 -4.779  -13.736 1.00 41.55 ?  84  LYS A CA  1 
ATOM   656  C  C   . LYS A 1 91  ? -12.061 -3.539  -14.420 1.00 41.27 ?  84  LYS A C   1 
ATOM   657  O  O   . LYS A 1 91  ? -11.802 -3.264  -15.595 1.00 38.57 ?  84  LYS A O   1 
ATOM   658  C  CB  . LYS A 1 91  ? -10.278 -4.403  -12.883 1.00 44.68 ?  84  LYS A CB  1 
ATOM   659  C  CG  . LYS A 1 91  ? -9.780  -5.528  -11.995 1.00 45.12 ?  84  LYS A CG  1 
ATOM   660  C  CD  . LYS A 1 91  ? -10.873 -5.913  -11.028 1.00 47.41 ?  84  LYS A CD  1 
ATOM   661  C  CE  . LYS A 1 91  ? -10.400 -6.930  -9.998  1.00 55.40 ?  84  LYS A CE  1 
ATOM   662  N  NZ  . LYS A 1 91  ? -11.396 -7.032  -8.888  1.00 53.90 1  84  LYS A NZ  1 
ATOM   663  N  N   . CYS A 1 92  ? -12.883 -2.808  -13.670 1.00 39.65 ?  85  CYS A N   1 
ATOM   664  C  CA  . CYS A 1 92  ? -13.268 -1.453  -14.048 1.00 42.26 ?  85  CYS A CA  1 
ATOM   665  C  C   . CYS A 1 92  ? -12.136 -0.515  -13.664 1.00 38.25 ?  85  CYS A C   1 
ATOM   666  O  O   . CYS A 1 92  ? -11.813 -0.380  -12.481 1.00 37.36 ?  85  CYS A O   1 
ATOM   667  C  CB  . CYS A 1 92  ? -14.563 -1.032  -13.356 1.00 43.62 ?  85  CYS A CB  1 
ATOM   668  S  SG  . CYS A 1 92  ? -16.087 -1.549  -14.177 1.00 70.56 ?  85  CYS A SG  1 
ATOM   669  N  N   . PHE A 1 93  ? -11.520 0.114   -14.655 1.00 33.01 ?  86  PHE A N   1 
ATOM   670  C  CA  . PHE A 1 93  ? -10.417 1.026   -14.418 1.00 32.46 ?  86  PHE A CA  1 
ATOM   671  C  C   . PHE A 1 93  ? -10.906 2.457   -14.567 1.00 30.26 ?  86  PHE A C   1 
ATOM   672  O  O   . PHE A 1 93  ? -11.616 2.787   -15.522 1.00 34.06 ?  86  PHE A O   1 
ATOM   673  C  CB  . PHE A 1 93  ? -9.266  0.789   -15.397 1.00 34.19 ?  86  PHE A CB  1 
ATOM   674  C  CG  . PHE A 1 93  ? -8.572  -0.536  -15.245 1.00 33.36 ?  86  PHE A CG  1 
ATOM   675  C  CD1 . PHE A 1 93  ? -7.655  -0.741  -14.236 1.00 37.45 ?  86  PHE A CD1 1 
ATOM   676  C  CD2 . PHE A 1 93  ? -8.788  -1.554  -16.168 1.00 38.74 ?  86  PHE A CD2 1 
ATOM   677  C  CE1 . PHE A 1 93  ? -6.987  -1.948  -14.118 1.00 40.62 ?  86  PHE A CE1 1 
ATOM   678  C  CE2 . PHE A 1 93  ? -8.123  -2.759  -16.060 1.00 38.65 ?  86  PHE A CE2 1 
ATOM   679  C  CZ  . PHE A 1 93  ? -7.220  -2.956  -15.030 1.00 37.87 ?  86  PHE A CZ  1 
ATOM   680  N  N   . GLN A 1 94  ? -10.535 3.303   -13.625 1.00 27.78 ?  87  GLN A N   1 
ATOM   681  C  CA  . GLN A 1 94  ? -10.653 4.741   -13.814 1.00 31.38 ?  87  GLN A CA  1 
ATOM   682  C  C   . GLN A 1 94  ? -9.246  5.303   -13.933 1.00 34.04 ?  87  GLN A C   1 
ATOM   683  O  O   . GLN A 1 94  ? -8.463  5.225   -12.981 1.00 31.79 ?  87  GLN A O   1 
ATOM   684  C  CB  . GLN A 1 94  ? -11.410 5.410   -12.670 1.00 38.50 ?  87  GLN A CB  1 
ATOM   685  C  CG  . GLN A 1 94  ? -11.439 6.928   -12.809 1.00 42.31 ?  87  GLN A CG  1 
ATOM   686  C  CD  . GLN A 1 94  ? -11.616 7.639   -11.484 1.00 53.63 ?  87  GLN A CD  1 
ATOM   687  O  OE1 . GLN A 1 94  ? -12.741 7.930   -11.071 1.00 61.81 ?  87  GLN A OE1 1 
ATOM   688  N  NE2 . GLN A 1 94  ? -10.502 7.925   -10.808 1.00 51.91 ?  87  GLN A NE2 1 
ATOM   689  N  N   . ILE A 1 95  ? -8.923  5.853   -15.101 1.00 28.19 ?  88  ILE A N   1 
ATOM   690  C  CA  . ILE A 1 95  ? -7.614  6.441   -15.347 1.00 25.90 ?  88  ILE A CA  1 
ATOM   691  C  C   . ILE A 1 95  ? -7.737  7.949   -15.213 1.00 29.38 ?  88  ILE A C   1 
ATOM   692  O  O   . ILE A 1 95  ? -8.597  8.568   -15.853 1.00 26.33 ?  88  ILE A O   1 
ATOM   693  C  CB  . ILE A 1 95  ? -7.072  6.072   -16.738 1.00 24.98 ?  88  ILE A CB  1 
ATOM   694  C  CG1 . ILE A 1 95  ? -7.054  4.553   -16.942 1.00 31.00 ?  88  ILE A CG1 1 
ATOM   695  C  CG2 . ILE A 1 95  ? -5.676  6.661   -16.900 1.00 26.26 ?  88  ILE A CG2 1 
ATOM   696  C  CD1 . ILE A 1 95  ? -6.593  4.148   -18.339 1.00 27.87 ?  88  ILE A CD1 1 
ATOM   697  N  N   . THR A 1 96  ? -6.883  8.540   -14.386 1.00 26.19 ?  89  THR A N   1 
ATOM   698  C  CA  . THR A 1 96  ? -6.802  9.987   -14.236 1.00 25.56 ?  89  THR A CA  1 
ATOM   699  C  C   . THR A 1 96  ? -5.437  10.448  -14.709 1.00 23.88 ?  89  THR A C   1 
ATOM   700  O  O   . THR A 1 96  ? -4.414  9.909   -14.280 1.00 25.79 ?  89  THR A O   1 
ATOM   701  C  CB  . THR A 1 96  ? -7.030  10.398  -12.780 1.00 31.24 ?  89  THR A CB  1 
ATOM   702  O  OG1 . THR A 1 96  ? -8.396  10.144  -12.450 1.00 34.48 ?  89  THR A OG1 1 
ATOM   703  C  CG2 . THR A 1 96  ? -6.749  11.874  -12.593 1.00 34.46 ?  89  THR A CG2 1 
ATOM   704  N  N   . TRP A 1 97  ? -5.417  11.418  -15.618 1.00 23.12 ?  90  TRP A N   1 
ATOM   705  C  CA  . TRP A 1 97  ? -4.176  12.034  -16.056 1.00 22.30 ?  90  TRP A CA  1 
ATOM   706  C  C   . TRP A 1 97  ? -4.108  13.472  -15.576 1.00 24.89 ?  90  TRP A C   1 
ATOM   707  O  O   . TRP A 1 97  ? -5.108  14.200  -15.599 1.00 24.35 ?  90  TRP A O   1 
ATOM   708  C  CB  . TRP A 1 97  ? -4.026  12.068  -17.583 1.00 22.89 ?  90  TRP A CB  1 
ATOM   709  C  CG  . TRP A 1 97  ? -3.793  10.787  -18.272 1.00 23.77 ?  90  TRP A CG  1 
ATOM   710  C  CD1 . TRP A 1 97  ? -3.593  9.554   -17.708 1.00 24.20 ?  90  TRP A CD1 1 
ATOM   711  C  CD2 . TRP A 1 97  ? -3.729  10.601  -19.689 1.00 20.60 ?  90  TRP A CD2 1 
ATOM   712  N  NE1 . TRP A 1 97  ? -3.409  8.608   -18.706 1.00 25.15 ?  90  TRP A NE1 1 
ATOM   713  C  CE2 . TRP A 1 97  ? -3.486  9.229   -19.926 1.00 23.74 ?  90  TRP A CE2 1 
ATOM   714  C  CE3 . TRP A 1 97  ? -3.843  11.469  -20.786 1.00 24.33 ?  90  TRP A CE3 1 
ATOM   715  C  CZ2 . TRP A 1 97  ? -3.367  8.702   -21.219 1.00 21.68 ?  90  TRP A CZ2 1 
ATOM   716  C  CZ3 . TRP A 1 97  ? -3.724  10.944  -22.065 1.00 24.14 ?  90  TRP A CZ3 1 
ATOM   717  C  CH2 . TRP A 1 97  ? -3.495  9.575   -22.272 1.00 25.29 ?  90  TRP A CH2 1 
ATOM   718  N  N   . PHE A 1 98  ? -2.910  13.884  -15.189 1.00 24.97 ?  91  PHE A N   1 
ATOM   719  C  CA  . PHE A 1 98  ? -2.583  15.290  -15.003 1.00 27.42 ?  91  PHE A CA  1 
ATOM   720  C  C   . PHE A 1 98  ? -1.489  15.605  -16.002 1.00 20.79 ?  91  PHE A C   1 
ATOM   721  O  O   . PHE A 1 98  ? -0.362  15.125  -15.854 1.00 26.73 ?  91  PHE A O   1 
ATOM   722  C  CB  . PHE A 1 98  ? -2.137  15.550  -13.572 1.00 29.55 ?  91  PHE A CB  1 
ATOM   723  C  CG  . PHE A 1 98  ? -3.156  15.145  -12.564 1.00 27.53 ?  91  PHE A CG  1 
ATOM   724  C  CD1 . PHE A 1 98  ? -4.266  15.927  -12.343 1.00 29.24 ?  91  PHE A CD1 1 
ATOM   725  C  CD2 . PHE A 1 98  ? -3.024  13.961  -11.866 1.00 33.20 ?  91  PHE A CD2 1 
ATOM   726  C  CE1 . PHE A 1 98  ? -5.215  15.557  -11.413 1.00 32.16 ?  91  PHE A CE1 1 
ATOM   727  C  CE2 . PHE A 1 98  ? -3.970  13.580  -10.944 1.00 38.22 ?  91  PHE A CE2 1 
ATOM   728  C  CZ  . PHE A 1 98  ? -5.068  14.389  -10.714 1.00 34.39 ?  91  PHE A CZ  1 
ATOM   729  N  N   . VAL A 1 99  ? -1.817  16.385  -17.026 1.00 25.41 ?  92  VAL A N   1 
ATOM   730  C  CA  . VAL A 1 99  ? -0.921  16.537  -18.167 1.00 21.78 ?  92  VAL A CA  1 
ATOM   731  C  C   . VAL A 1 99  ? -0.577  18.005  -18.355 1.00 20.79 ?  92  VAL A C   1 
ATOM   732  O  O   . VAL A 1 99  ? -1.385  18.894  -18.091 1.00 22.45 ?  92  VAL A O   1 
ATOM   733  C  CB  . VAL A 1 99  ? -1.522  15.970  -19.471 1.00 25.74 ?  92  VAL A CB  1 
ATOM   734  C  CG1 . VAL A 1 99  ? -1.759  14.488  -19.350 1.00 27.92 ?  92  VAL A CG1 1 
ATOM   735  C  CG2 . VAL A 1 99  ? -2.806  16.695  -19.832 1.00 22.76 ?  92  VAL A CG2 1 
ATOM   736  N  N   . SER A 1 100 ? 0.627   18.251  -18.847 1.00 20.26 ?  93  SER A N   1 
ATOM   737  C  CA  . SER A 1 100 ? 1.036   19.633  -19.045 1.00 21.71 ?  93  SER A CA  1 
ATOM   738  C  C   . SER A 1 100 ? 0.470   20.201  -20.342 1.00 24.58 ?  93  SER A C   1 
ATOM   739  O  O   . SER A 1 100 ? 0.214   21.406  -20.415 1.00 24.06 ?  93  SER A O   1 
ATOM   740  C  CB  . SER A 1 100 ? 2.561   19.738  -18.990 1.00 21.42 ?  93  SER A CB  1 
ATOM   741  O  OG  . SER A 1 100 ? 3.213   18.918  -19.954 1.00 23.87 ?  93  SER A OG  1 
ATOM   742  N  N   . TRP A 1 101 ? 0.230   19.349  -21.349 1.00 21.07 ?  94  TRP A N   1 
ATOM   743  C  CA  . TRP A 1 101 ? -0.477  19.730  -22.572 1.00 22.34 ?  94  TRP A CA  1 
ATOM   744  C  C   . TRP A 1 101 ? -1.571  18.706  -22.843 1.00 22.03 ?  94  TRP A C   1 
ATOM   745  O  O   . TRP A 1 101 ? -1.405  17.529  -22.522 1.00 20.02 ?  94  TRP A O   1 
ATOM   746  C  CB  . TRP A 1 101 ? 0.439   19.750  -23.800 1.00 20.08 ?  94  TRP A CB  1 
ATOM   747  C  CG  . TRP A 1 101 ? 1.621   20.666  -23.803 1.00 21.95 ?  94  TRP A CG  1 
ATOM   748  C  CD1 . TRP A 1 101 ? 2.925   20.320  -23.595 1.00 23.11 ?  94  TRP A CD1 1 
ATOM   749  C  CD2 . TRP A 1 101 ? 1.622   22.071  -24.105 1.00 23.70 ?  94  TRP A CD2 1 
ATOM   750  N  NE1 . TRP A 1 101 ? 3.738   21.425  -23.727 1.00 25.03 ?  94  TRP A NE1 1 
ATOM   751  C  CE2 . TRP A 1 101 ? 2.966   22.511  -24.046 1.00 25.05 ?  94  TRP A CE2 1 
ATOM   752  C  CE3 . TRP A 1 101 ? 0.617   23.003  -24.395 1.00 22.35 ?  94  TRP A CE3 1 
ATOM   753  C  CZ2 . TRP A 1 101 ? 3.331   23.847  -24.275 1.00 21.12 ?  94  TRP A CZ2 1 
ATOM   754  C  CZ3 . TRP A 1 101 ? 0.989   24.346  -24.626 1.00 22.78 ?  94  TRP A CZ3 1 
ATOM   755  C  CH2 . TRP A 1 101 ? 2.325   24.742  -24.566 1.00 22.12 ?  94  TRP A CH2 1 
ATOM   756  N  N   . THR A 1 102 ? -2.669  19.129  -23.484 1.00 20.98 ?  95  THR A N   1 
ATOM   757  C  CA  . THR A 1 102 ? -3.664  18.153  -23.965 1.00 24.56 ?  95  THR A CA  1 
ATOM   758  C  C   . THR A 1 102 ? -3.085  17.363  -25.149 1.00 24.06 ?  95  THR A C   1 
ATOM   759  O  O   . THR A 1 102 ? -2.018  17.707  -25.673 1.00 21.85 ?  95  THR A O   1 
ATOM   760  C  CB  . THR A 1 102 ? -4.987  18.841  -24.341 1.00 20.94 ?  95  THR A CB  1 
ATOM   761  O  OG1 . THR A 1 102 ? -4.770  19.901  -25.276 1.00 21.41 ?  95  THR A OG1 1 
ATOM   762  C  CG2 . THR A 1 102 ? -5.706  19.403  -23.102 1.00 25.28 ?  95  THR A CG2 1 
ATOM   763  N  N   . PRO A 1 103 ? -3.743  16.263  -25.563 1.00 22.27 ?  96  PRO A N   1 
ATOM   764  C  CA  . PRO A 1 103 ? -3.168  15.401  -26.609 1.00 21.08 ?  96  PRO A CA  1 
ATOM   765  C  C   . PRO A 1 103 ? -3.292  15.979  -28.008 1.00 24.47 ?  96  PRO A C   1 
ATOM   766  O  O   . PRO A 1 103 ? -4.222  16.724  -28.323 1.00 24.66 ?  96  PRO A O   1 
ATOM   767  C  CB  . PRO A 1 103 ? -4.006  14.114  -26.511 1.00 21.65 ?  96  PRO A CB  1 
ATOM   768  C  CG  . PRO A 1 103 ? -4.576  14.118  -25.112 1.00 23.46 ?  96  PRO A CG  1 
ATOM   769  C  CD  . PRO A 1 103 ? -4.872  15.592  -24.893 1.00 22.83 ?  96  PRO A CD  1 
ATOM   770  N  N   . CYS A 1 104 ? -2.334  15.598  -28.853 1.00 23.21 ?  97  CYS A N   1 
ATOM   771  C  CA  . CYS A 1 104 ? -2.379  15.931  -30.268 1.00 22.59 ?  97  CYS A CA  1 
ATOM   772  C  C   . CYS A 1 104 ? -3.528  15.180  -30.935 1.00 25.46 ?  97  CYS A C   1 
ATOM   773  O  O   . CYS A 1 104 ? -4.075  14.230  -30.362 1.00 23.20 ?  97  CYS A O   1 
ATOM   774  C  CB  . CYS A 1 104 ? -1.044  15.590  -30.928 1.00 23.45 ?  97  CYS A CB  1 
ATOM   775  S  SG  . CYS A 1 104 ? -0.800  13.860  -31.461 1.00 22.89 ?  97  CYS A SG  1 
ATOM   776  N  N   . PRO A 1 105 ? -3.928  15.601  -32.144 1.00 23.93 ?  98  PRO A N   1 
ATOM   777  C  CA  . PRO A 1 105 ? -5.080  14.955  -32.793 1.00 26.51 ?  98  PRO A CA  1 
ATOM   778  C  C   . PRO A 1 105 ? -4.866  13.487  -33.091 1.00 24.75 ?  98  PRO A C   1 
ATOM   779  O  O   . PRO A 1 105 ? -5.828  12.714  -33.037 1.00 26.28 ?  98  PRO A O   1 
ATOM   780  C  CB  . PRO A 1 105 ? -5.258  15.773  -34.080 1.00 26.99 ?  98  PRO A CB  1 
ATOM   781  C  CG  . PRO A 1 105 ? -4.759  17.135  -33.698 1.00 28.07 ?  98  PRO A CG  1 
ATOM   782  C  CD  . PRO A 1 105 ? -3.535  16.843  -32.835 1.00 26.63 ?  98  PRO A CD  1 
ATOM   783  N  N   . ASP A 1 106 ? -3.641  13.071  -33.412 1.00 22.20 ?  99  ASP A N   1 
ATOM   784  C  CA  . ASP A 1 106 ? -3.415  11.652  -33.663 1.00 26.80 ?  99  ASP A CA  1 
ATOM   785  C  C   . ASP A 1 106 ? -3.559  10.834  -32.381 1.00 25.68 ?  99  ASP A C   1 
ATOM   786  O  O   . ASP A 1 106 ? -4.112  9.728   -32.400 1.00 24.09 ?  99  ASP A O   1 
ATOM   787  C  CB  . ASP A 1 106 ? -2.041  11.435  -34.286 1.00 28.04 ?  99  ASP A CB  1 
ATOM   788  C  CG  . ASP A 1 106 ? -1.971  11.900  -35.731 1.00 40.89 ?  99  ASP A CG  1 
ATOM   789  O  OD1 . ASP A 1 106 ? -2.983  11.780  -36.465 1.00 43.46 ?  99  ASP A OD1 1 
ATOM   790  O  OD2 . ASP A 1 106 ? -0.893  12.378  -36.131 1.00 46.70 -1 99  ASP A OD2 1 
ATOM   791  N  N   . CYS A 1 107 ? -3.095  11.362  -31.246 1.00 23.01 ?  100 CYS A N   1 
ATOM   792  C  CA  . CYS A 1 107 ? -3.291  10.616  -30.007 1.00 24.67 ?  100 CYS A CA  1 
ATOM   793  C  C   . CYS A 1 107 ? -4.748  10.653  -29.558 1.00 26.52 ?  100 CYS A C   1 
ATOM   794  O  O   . CYS A 1 107 ? -5.231  9.690   -28.964 1.00 23.80 ?  100 CYS A O   1 
ATOM   795  C  CB  . CYS A 1 107 ? -2.357  11.132  -28.909 1.00 23.83 ?  100 CYS A CB  1 
ATOM   796  S  SG  . CYS A 1 107 ? -0.599  10.689  -29.235 1.00 24.53 ?  100 CYS A SG  1 
ATOM   797  N  N   . VAL A 1 108 ? -5.487  11.713  -29.887 1.00 21.56 ?  101 VAL A N   1 
ATOM   798  C  CA  . VAL A 1 108 ? -6.925  11.705  -29.627 1.00 23.78 ?  101 VAL A CA  1 
ATOM   799  C  C   . VAL A 1 108 ? -7.587  10.532  -30.332 1.00 25.74 ?  101 VAL A C   1 
ATOM   800  O  O   . VAL A 1 108 ? -8.441  9.843   -29.760 1.00 25.13 ?  101 VAL A O   1 
ATOM   801  C  CB  . VAL A 1 108 ? -7.566  13.033  -30.065 1.00 26.80 ?  101 VAL A CB  1 
ATOM   802  C  CG1 . VAL A 1 108 ? -9.078  12.834  -30.248 1.00 25.94 ?  101 VAL A CG1 1 
ATOM   803  C  CG2 . VAL A 1 108 ? -7.309  14.092  -29.030 1.00 23.41 ?  101 VAL A CG2 1 
ATOM   804  N  N   . ALA A 1 109 ? -7.225  10.308  -31.595 1.00 26.33 ?  102 ALA A N   1 
ATOM   805  C  CA  . ALA A 1 109 ? -7.821  9.214   -32.353 1.00 30.12 ?  102 ALA A CA  1 
ATOM   806  C  C   . ALA A 1 109 ? -7.500  7.870   -31.715 1.00 25.91 ?  102 ALA A C   1 
ATOM   807  O  O   . ALA A 1 109 ? -8.389  7.033   -31.544 1.00 27.95 ?  102 ALA A O   1 
ATOM   808  C  CB  . ALA A 1 109 ? -7.349  9.263   -33.809 1.00 28.16 ?  102 ALA A CB  1 
ATOM   809  N  N   . LYS A 1 110 ? -6.227  7.635   -31.364 1.00 25.72 ?  103 LYS A N   1 
ATOM   810  C  CA  . LYS A 1 110 ? -5.869  6.364   -30.732 1.00 25.03 ?  103 LYS A CA  1 
ATOM   811  C  C   . LYS A 1 110 ? -6.567  6.190   -29.391 1.00 25.48 ?  103 LYS A C   1 
ATOM   812  O  O   . LYS A 1 110 ? -6.985  5.079   -29.039 1.00 22.13 ?  103 LYS A O   1 
ATOM   813  C  CB  . LYS A 1 110 ? -4.358  6.256   -30.524 1.00 26.76 ?  103 LYS A CB  1 
ATOM   814  C  CG  . LYS A 1 110 ? -3.539  6.060   -31.769 1.00 35.58 ?  103 LYS A CG  1 
ATOM   815  C  CD  . LYS A 1 110 ? -3.714  4.651   -32.315 1.00 35.33 ?  103 LYS A CD  1 
ATOM   816  C  CE  . LYS A 1 110 ? -2.823  4.432   -33.519 1.00 33.94 ?  103 LYS A CE  1 
ATOM   817  N  NZ  . LYS A 1 110 ? -3.354  3.280   -34.295 1.00 36.16 1  103 LYS A NZ  1 
ATOM   818  N  N   . LEU A 1 111 ? -6.642  7.263   -28.594 1.00 24.60 ?  104 LEU A N   1 
ATOM   819  C  CA  . LEU A 1 111 ? -7.297  7.168   -27.291 1.00 25.47 ?  104 LEU A CA  1 
ATOM   820  C  C   . LEU A 1 111 ? -8.789  6.931   -27.443 1.00 25.32 ?  104 LEU A C   1 
ATOM   821  O  O   . LEU A 1 111 ? -9.381  6.144   -26.692 1.00 24.39 ?  104 LEU A O   1 
ATOM   822  C  CB  . LEU A 1 111 ? -7.049  8.440   -26.476 1.00 21.78 ?  104 LEU A CB  1 
ATOM   823  C  CG  . LEU A 1 111 ? -5.582  8.664   -26.083 1.00 26.02 ?  104 LEU A CG  1 
ATOM   824  C  CD1 . LEU A 1 111 ? -5.336  10.081  -25.534 1.00 24.73 ?  104 LEU A CD1 1 
ATOM   825  C  CD2 . LEU A 1 111 ? -5.149  7.608   -25.054 1.00 26.77 ?  104 LEU A CD2 1 
ATOM   826  N  N   . ALA A 1 112 ? -9.419  7.621   -28.402 1.00 23.74 ?  105 ALA A N   1 
ATOM   827  C  CA  . ALA A 1 112 ? -10.844 7.414   -28.641 1.00 24.66 ?  105 ALA A CA  1 
ATOM   828  C  C   . ALA A 1 112 ? -11.121 5.981   -29.080 1.00 24.44 ?  105 ALA A C   1 
ATOM   829  O  O   . ALA A 1 112 ? -12.095 5.363   -28.632 1.00 27.61 ?  105 ALA A O   1 
ATOM   830  C  CB  . ALA A 1 112 ? -11.351 8.401   -29.703 1.00 24.59 ?  105 ALA A CB  1 
ATOM   831  N  N   . GLU A 1 113 ? -10.285 5.440   -29.967 1.00 26.25 ?  106 GLU A N   1 
ATOM   832  C  CA  . GLU A 1 113 ? -10.452 4.047   -30.371 1.00 28.30 ?  106 GLU A CA  1 
ATOM   833  C  C   . GLU A 1 113 ? -10.273 3.108   -29.187 1.00 28.67 ?  106 GLU A C   1 
ATOM   834  O  O   . GLU A 1 113 ? -11.037 2.148   -29.015 1.00 27.46 ?  106 GLU A O   1 
ATOM   835  C  CB  . GLU A 1 113 ? -9.450  3.691   -31.464 1.00 31.70 ?  106 GLU A CB  1 
ATOM   836  C  CG  . GLU A 1 113 ? -9.579  4.483   -32.740 1.00 35.78 ?  106 GLU A CG  1 
ATOM   837  C  CD  . GLU A 1 113 ? -8.405  4.206   -33.677 1.00 46.41 ?  106 GLU A CD  1 
ATOM   838  O  OE1 . GLU A 1 113 ? -8.089  3.012   -33.899 1.00 55.05 ?  106 GLU A OE1 1 
ATOM   839  O  OE2 . GLU A 1 113 ? -7.776  5.169   -34.167 1.00 47.77 -1 106 GLU A OE2 1 
ATOM   840  N  N   . PHE A 1 114 ? -9.240  3.357   -28.374 1.00 24.74 ?  107 PHE A N   1 
ATOM   841  C  CA  . PHE A 1 114 ? -9.000  2.538   -27.189 1.00 24.72 ?  107 PHE A CA  1 
ATOM   842  C  C   . PHE A 1 114 ? -10.212 2.537   -26.261 1.00 25.99 ?  107 PHE A C   1 
ATOM   843  O  O   . PHE A 1 114 ? -10.654 1.480   -25.795 1.00 26.81 ?  107 PHE A O   1 
ATOM   844  C  CB  . PHE A 1 114 ? -7.748  3.045   -26.470 1.00 21.72 ?  107 PHE A CB  1 
ATOM   845  C  CG  . PHE A 1 114 ? -7.522  2.410   -25.132 1.00 27.53 ?  107 PHE A CG  1 
ATOM   846  C  CD1 . PHE A 1 114 ? -6.989  1.130   -25.038 1.00 29.01 ?  107 PHE A CD1 1 
ATOM   847  C  CD2 . PHE A 1 114 ? -7.827  3.102   -23.964 1.00 30.76 ?  107 PHE A CD2 1 
ATOM   848  C  CE1 . PHE A 1 114 ? -6.785  0.536   -23.794 1.00 33.13 ?  107 PHE A CE1 1 
ATOM   849  C  CE2 . PHE A 1 114 ? -7.611  2.513   -22.712 1.00 31.35 ?  107 PHE A CE2 1 
ATOM   850  C  CZ  . PHE A 1 114 ? -7.092  1.227   -22.640 1.00 29.14 ?  107 PHE A CZ  1 
ATOM   851  N  N   . LEU A 1 115 ? -10.776 3.713   -25.993 1.00 26.38 ?  108 LEU A N   1 
ATOM   852  C  CA  . LEU A 1 115 ? -11.932 3.797   -25.104 1.00 25.41 ?  108 LEU A CA  1 
ATOM   853  C  C   . LEU A 1 115 ? -13.154 3.092   -25.685 1.00 27.25 ?  108 LEU A C   1 
ATOM   854  O  O   . LEU A 1 115 ? -13.921 2.465   -24.945 1.00 29.55 ?  108 LEU A O   1 
ATOM   855  C  CB  . LEU A 1 115 ? -12.269 5.255   -24.818 1.00 23.24 ?  108 LEU A CB  1 
ATOM   856  C  CG  . LEU A 1 115 ? -11.295 5.987   -23.907 1.00 31.08 ?  108 LEU A CG  1 
ATOM   857  C  CD1 . LEU A 1 115 ? -11.737 7.442   -23.842 1.00 26.18 ?  108 LEU A CD1 1 
ATOM   858  C  CD2 . LEU A 1 115 ? -11.253 5.355   -22.502 1.00 27.04 ?  108 LEU A CD2 1 
ATOM   859  N  N   . SER A 1 116 ? -13.367 3.200   -26.997 1.00 28.01 ?  109 SER A N   1 
ATOM   860  C  CA  . SER A 1 116 ? -14.523 2.544   -27.597 1.00 31.34 ?  109 SER A CA  1 
ATOM   861  C  C   . SER A 1 116 ? -14.396 1.025   -27.551 1.00 32.52 ?  109 SER A C   1 
ATOM   862  O  O   . SER A 1 116 ? -15.412 0.328   -27.505 1.00 34.66 ?  109 SER A O   1 
ATOM   863  C  CB  . SER A 1 116 ? -14.740 3.039   -29.031 1.00 33.84 ?  109 SER A CB  1 
ATOM   864  O  OG  . SER A 1 116 ? -13.730 2.575   -29.914 1.00 43.33 ?  109 SER A OG  1 
ATOM   865  N  N   . GLU A 1 117 ? -13.174 0.492   -27.527 1.00 32.40 ?  110 GLU A N   1 
ATOM   866  C  CA  . GLU A 1 117 ? -12.976 -0.951  -27.476 1.00 31.82 ?  110 GLU A CA  1 
ATOM   867  C  C   . GLU A 1 117 ? -12.827 -1.487  -26.062 1.00 35.50 ?  110 GLU A C   1 
ATOM   868  O  O   . GLU A 1 117 ? -12.787 -2.708  -25.881 1.00 32.65 ?  110 GLU A O   1 
ATOM   869  C  CB  . GLU A 1 117 ? -11.738 -1.365  -28.288 1.00 32.02 ?  110 GLU A CB  1 
ATOM   870  C  CG  . GLU A 1 117 ? -11.783 -1.041  -29.768 1.00 30.45 ?  110 GLU A CG  1 
ATOM   871  C  CD  . GLU A 1 117 ? -12.607 -2.027  -30.594 1.00 37.65 ?  110 GLU A CD  1 
ATOM   872  O  OE1 . GLU A 1 117 ? -13.113 -3.027  -30.038 1.00 38.39 ?  110 GLU A OE1 1 
ATOM   873  O  OE2 . GLU A 1 117 ? -12.730 -1.800  -31.817 1.00 44.78 -1 110 GLU A OE2 1 
ATOM   874  N  N   . HIS A 1 118 ? -12.725 -0.619  -25.057 1.00 29.28 ?  111 HIS A N   1 
ATOM   875  C  CA  . HIS A 1 118 ? -12.568 -1.035  -23.669 1.00 29.83 ?  111 HIS A CA  1 
ATOM   876  C  C   . HIS A 1 118 ? -13.606 -0.294  -22.849 1.00 32.96 ?  111 HIS A C   1 
ATOM   877  O  O   . HIS A 1 118 ? -13.295 0.711   -22.198 1.00 34.03 ?  111 HIS A O   1 
ATOM   878  C  CB  . HIS A 1 118 ? -11.151 -0.760  -23.166 1.00 30.99 ?  111 HIS A CB  1 
ATOM   879  C  CG  . HIS A 1 118 ? -10.108 -1.594  -23.837 1.00 32.69 ?  111 HIS A CG  1 
ATOM   880  N  ND1 . HIS A 1 118 ? -9.511  -1.228  -25.021 1.00 33.62 ?  111 HIS A ND1 1 
ATOM   881  C  CD2 . HIS A 1 118 ? -9.568  -2.788  -23.499 1.00 37.33 ?  111 HIS A CD2 1 
ATOM   882  C  CE1 . HIS A 1 118 ? -8.638  -2.153  -25.379 1.00 33.74 ?  111 HIS A CE1 1 
ATOM   883  N  NE2 . HIS A 1 118 ? -8.653  -3.111  -24.471 1.00 36.32 ?  111 HIS A NE2 1 
ATOM   884  N  N   . PRO A 1 119 ? -14.861 -0.752  -22.868 1.00 35.62 ?  112 PRO A N   1 
ATOM   885  C  CA  . PRO A 1 119 ? -15.899 -0.057  -22.095 1.00 37.31 ?  112 PRO A CA  1 
ATOM   886  C  C   . PRO A 1 119 ? -15.688 -0.142  -20.590 1.00 35.58 ?  112 PRO A C   1 
ATOM   887  O  O   . PRO A 1 119 ? -16.290 0.652   -19.859 1.00 38.42 ?  112 PRO A O   1 
ATOM   888  C  CB  . PRO A 1 119 ? -17.189 -0.763  -22.530 1.00 42.16 ?  112 PRO A CB  1 
ATOM   889  C  CG  . PRO A 1 119 ? -16.736 -2.121  -22.984 1.00 37.94 ?  112 PRO A CG  1 
ATOM   890  C  CD  . PRO A 1 119 ? -15.384 -1.929  -23.585 1.00 39.00 ?  112 PRO A CD  1 
ATOM   891  N  N   . ASN A 1 120 ? -14.829 -1.038  -20.113 1.00 33.54 ?  113 ASN A N   1 
ATOM   892  C  CA  . ASN A 1 120 ? -14.498 -1.110  -18.692 1.00 35.50 ?  113 ASN A CA  1 
ATOM   893  C  C   . ASN A 1 120 ? -13.482 -0.058  -18.252 1.00 36.24 ?  113 ASN A C   1 
ATOM   894  O  O   . ASN A 1 120 ? -13.123 -0.022  -17.065 1.00 38.07 ?  113 ASN A O   1 
ATOM   895  C  CB  . ASN A 1 120 ? -13.971 -2.504  -18.338 1.00 37.48 ?  113 ASN A CB  1 
ATOM   896  C  CG  . ASN A 1 120 ? -12.688 -2.852  -19.065 1.00 43.70 ?  113 ASN A CG  1 
ATOM   897  O  OD1 . ASN A 1 120 ? -12.542 -2.591  -20.269 1.00 42.69 ?  113 ASN A OD1 1 
ATOM   898  N  ND2 . ASN A 1 120 ? -11.745 -3.446  -18.340 1.00 41.70 ?  113 ASN A ND2 1 
ATOM   899  N  N   . VAL A 1 121 ? -13.014 0.798   -19.157 1.00 32.85 ?  114 VAL A N   1 
ATOM   900  C  CA  . VAL A 1 121 ? -12.040 1.837   -18.838 1.00 29.10 ?  114 VAL A CA  1 
ATOM   901  C  C   . VAL A 1 121 ? -12.711 3.196   -19.000 1.00 28.90 ?  114 VAL A C   1 
ATOM   902  O  O   . VAL A 1 121 ? -13.396 3.438   -19.999 1.00 32.07 ?  114 VAL A O   1 
ATOM   903  C  CB  . VAL A 1 121 ? -10.788 1.730   -19.731 1.00 33.01 ?  114 VAL A CB  1 
ATOM   904  C  CG1 . VAL A 1 121 ? -9.812  2.860   -19.423 1.00 29.46 ?  114 VAL A CG1 1 
ATOM   905  C  CG2 . VAL A 1 121 ? -10.105 0.371   -19.547 1.00 32.74 ?  114 VAL A CG2 1 
ATOM   906  N  N   . THR A 1 122 ? -12.529 4.076   -18.016 1.00 27.35 ?  115 THR A N   1 
ATOM   907  C  CA  . THR A 1 122 ? -12.875 5.484   -18.159 1.00 28.44 ?  115 THR A CA  1 
ATOM   908  C  C   . THR A 1 122 ? -11.611 6.308   -17.984 1.00 28.25 ?  115 THR A C   1 
ATOM   909  O  O   . THR A 1 122 ? -10.709 5.933   -17.230 1.00 30.95 ?  115 THR A O   1 
ATOM   910  C  CB  . THR A 1 122 ? -13.927 5.952   -17.146 1.00 33.51 ?  115 THR A CB  1 
ATOM   911  O  OG1 . THR A 1 122 ? -13.416 5.797   -15.818 1.00 39.78 ?  115 THR A OG1 1 
ATOM   912  C  CG2 . THR A 1 122 ? -15.215 5.163   -17.294 1.00 36.04 ?  115 THR A CG2 1 
ATOM   913  N  N   . LEU A 1 123 ? -11.538 7.426   -18.697 1.00 24.33 ?  116 LEU A N   1 
ATOM   914  C  CA  . LEU A 1 123 ? -10.365 8.286   -18.654 1.00 22.71 ?  116 LEU A CA  1 
ATOM   915  C  C   . LEU A 1 123 ? -10.787 9.712   -18.344 1.00 25.37 ?  116 LEU A C   1 
ATOM   916  O  O   . LEU A 1 123 ? -11.738 10.225  -18.945 1.00 27.25 ?  116 LEU A O   1 
ATOM   917  C  CB  . LEU A 1 123 ? -9.612  8.255   -19.984 1.00 24.62 ?  116 LEU A CB  1 
ATOM   918  C  CG  . LEU A 1 123 ? -8.458  9.241   -20.200 1.00 24.78 ?  116 LEU A CG  1 
ATOM   919  C  CD1 . LEU A 1 123 ? -7.292  8.930   -19.275 1.00 23.67 ?  116 LEU A CD1 1 
ATOM   920  C  CD2 . LEU A 1 123 ? -8.021  9.158   -21.651 1.00 29.44 ?  116 LEU A CD2 1 
ATOM   921  N  N   . THR A 1 124 ? -10.064 10.346  -17.428 1.00 24.01 ?  117 THR A N   1 
ATOM   922  C  CA  . THR A 1 124 ? -10.183 11.774  -17.153 1.00 25.86 ?  117 THR A CA  1 
ATOM   923  C  C   . THR A 1 124 ? -8.838  12.418  -17.417 1.00 24.04 ?  117 THR A C   1 
ATOM   924  O  O   . THR A 1 124 ? -7.808  11.932  -16.936 1.00 26.70 ?  117 THR A O   1 
ATOM   925  C  CB  . THR A 1 124 ? -10.604 12.044  -15.699 1.00 32.08 ?  117 THR A CB  1 
ATOM   926  O  OG1 . THR A 1 124 ? -11.893 11.477  -15.468 1.00 32.08 ?  117 THR A OG1 1 
ATOM   927  C  CG2 . THR A 1 124 ? -10.658 13.557  -15.422 1.00 35.48 ?  117 THR A CG2 1 
ATOM   928  N  N   . ILE A 1 125 ? -8.839  13.486  -18.207 1.00 23.81 ?  118 ILE A N   1 
ATOM   929  C  CA  . ILE A 1 125 ? -7.633  14.241  -18.501 1.00 23.54 ?  118 ILE A CA  1 
ATOM   930  C  C   . ILE A 1 125 ? -7.824  15.640  -17.933 1.00 25.41 ?  118 ILE A C   1 
ATOM   931  O  O   . ILE A 1 125 ? -8.789  16.325  -18.289 1.00 26.68 ?  118 ILE A O   1 
ATOM   932  C  CB  . ILE A 1 125 ? -7.349  14.287  -20.009 1.00 25.63 ?  118 ILE A CB  1 
ATOM   933  C  CG1 . ILE A 1 125 ? -7.230  12.857  -20.564 1.00 21.36 ?  118 ILE A CG1 1 
ATOM   934  C  CG2 . ILE A 1 125 ? -6.096  15.102  -20.286 1.00 25.68 ?  118 ILE A CG2 1 
ATOM   935  C  CD1 . ILE A 1 125 ? -7.088  12.795  -22.088 1.00 27.75 ?  118 ILE A CD1 1 
ATOM   936  N  N   . SER A 1 126 ? -6.942  16.036  -17.015 1.00 25.20 ?  119 SER A N   1 
ATOM   937  C  CA  . SER A 1 126 ? -6.873  17.407  -16.504 1.00 25.11 ?  119 SER A CA  1 
ATOM   938  C  C   . SER A 1 126 ? -5.562  17.997  -16.988 1.00 21.36 ?  119 SER A C   1 
ATOM   939  O  O   . SER A 1 126 ? -4.495  17.445  -16.711 1.00 24.92 ?  119 SER A O   1 
ATOM   940  C  CB  . SER A 1 126 ? -6.941  17.465  -14.970 1.00 29.72 ?  119 SER A CB  1 
ATOM   941  O  OG  . SER A 1 126 ? -8.188  17.013  -14.494 1.00 38.25 ?  119 SER A OG  1 
ATOM   942  N  N   . ALA A 1 127 ? -5.639  19.103  -17.720 1.00 23.09 ?  120 ALA A N   1 
ATOM   943  C  CA  . ALA A 1 127 ? -4.487  19.651  -18.417 1.00 19.47 ?  120 ALA A CA  1 
ATOM   944  C  C   . ALA A 1 127 ? -4.095  21.003  -17.837 1.00 23.60 ?  120 ALA A C   1 
ATOM   945  O  O   . ALA A 1 127 ? -4.959  21.809  -17.489 1.00 24.83 ?  120 ALA A O   1 
ATOM   946  C  CB  . ALA A 1 127 ? -4.792  19.807  -19.903 1.00 22.94 ?  120 ALA A CB  1 
ATOM   947  N  N   . ALA A 1 128 ? -2.791  21.254  -17.754 1.00 23.58 ?  121 ALA A N   1 
ATOM   948  C  CA  . ALA A 1 128 ? -2.337  22.586  -17.369 1.00 23.98 ?  121 ALA A CA  1 
ATOM   949  C  C   . ALA A 1 128 ? -2.560  23.589  -18.493 1.00 27.65 ?  121 ALA A C   1 
ATOM   950  O  O   . ALA A 1 128 ? -2.962  24.731  -18.242 1.00 26.13 ?  121 ALA A O   1 
ATOM   951  C  CB  . ALA A 1 128 ? -0.864  22.549  -16.975 1.00 25.78 ?  121 ALA A CB  1 
ATOM   952  N  N   . ARG A 1 129 ? -2.293  23.188  -19.737 1.00 21.25 ?  122 ARG A N   1 
ATOM   953  C  CA  . ARG A 1 129 ? -2.452  24.048  -20.899 1.00 22.20 ?  122 ARG A CA  1 
ATOM   954  C  C   . ARG A 1 129 ? -3.103  23.265  -22.029 1.00 24.48 ?  122 ARG A C   1 
ATOM   955  O  O   . ARG A 1 129 ? -3.056  22.034  -22.067 1.00 22.43 ?  122 ARG A O   1 
ATOM   956  C  CB  . ARG A 1 129 ? -1.113  24.578  -21.426 1.00 23.32 ?  122 ARG A CB  1 
ATOM   957  C  CG  . ARG A 1 129 ? -0.285  25.377  -20.429 1.00 25.27 ?  122 ARG A CG  1 
ATOM   958  C  CD  . ARG A 1 129 ? 1.058   25.786  -21.065 1.00 20.18 ?  122 ARG A CD  1 
ATOM   959  N  NE  . ARG A 1 129 ? 1.902   24.631  -21.374 1.00 24.11 ?  122 ARG A NE  1 
ATOM   960  C  CZ  . ARG A 1 129 ? 2.607   23.955  -20.467 1.00 25.81 ?  122 ARG A CZ  1 
ATOM   961  N  NH1 . ARG A 1 129 ? 2.588   24.326  -19.184 1.00 27.35 1  122 ARG A NH1 1 
ATOM   962  N  NH2 . ARG A 1 129 ? 3.335   22.910  -20.832 1.00 23.14 ?  122 ARG A NH2 1 
ATOM   963  N  N   . LEU A 1 130 ? -3.666  24.001  -22.979 1.00 23.03 ?  123 LEU A N   1 
ATOM   964  C  CA  . LEU A 1 130 ? -4.207  23.417  -24.198 1.00 24.03 ?  123 LEU A CA  1 
ATOM   965  C  C   . LEU A 1 130 ? -3.130  23.303  -25.275 1.00 22.67 ?  123 LEU A C   1 
ATOM   966  O  O   . LEU A 1 130 ? -2.388  24.255  -25.527 1.00 22.80 ?  123 LEU A O   1 
ATOM   967  C  CB  . LEU A 1 130 ? -5.375  24.261  -24.711 1.00 21.33 ?  123 LEU A CB  1 
ATOM   968  C  CG  . LEU A 1 130 ? -6.609  24.283  -23.816 1.00 27.93 ?  123 LEU A CG  1 
ATOM   969  C  CD1 . LEU A 1 130 ? -7.575  25.387  -24.225 1.00 30.15 ?  123 LEU A CD1 1 
ATOM   970  C  CD2 . LEU A 1 130 ? -7.307  22.906  -23.833 1.00 30.19 ?  123 LEU A CD2 1 
ATOM   971  N  N   . TYR A 1 131 ? -3.047  22.128  -25.901 1.00 18.96 ?  124 TYR A N   1 
ATOM   972  C  CA  . TYR A 1 131 ? -2.282  21.961  -27.130 1.00 20.07 ?  124 TYR A CA  1 
ATOM   973  C  C   . TYR A 1 131 ? -2.714  23.021  -28.145 1.00 21.19 ?  124 TYR A C   1 
ATOM   974  O  O   . TYR A 1 131 ? -3.864  23.457  -28.146 1.00 23.39 ?  124 TYR A O   1 
ATOM   975  C  CB  . TYR A 1 131 ? -2.534  20.531  -27.659 1.00 22.09 ?  124 TYR A CB  1 
ATOM   976  C  CG  . TYR A 1 131 ? -1.766  20.090  -28.882 1.00 20.71 ?  124 TYR A CG  1 
ATOM   977  C  CD1 . TYR A 1 131 ? -2.225  20.400  -30.155 1.00 23.00 ?  124 TYR A CD1 1 
ATOM   978  C  CD2 . TYR A 1 131 ? -0.620  19.306  -28.769 1.00 20.14 ?  124 TYR A CD2 1 
ATOM   979  C  CE1 . TYR A 1 131 ? -1.545  19.976  -31.276 1.00 24.27 ?  124 TYR A CE1 1 
ATOM   980  C  CE2 . TYR A 1 131 ? 0.076   18.881  -29.892 1.00 23.05 ?  124 TYR A CE2 1 
ATOM   981  C  CZ  . TYR A 1 131 ? -0.393  19.222  -31.140 1.00 26.03 ?  124 TYR A CZ  1 
ATOM   982  O  OH  . TYR A 1 131 ? 0.273   18.787  -32.260 1.00 24.26 ?  124 TYR A OH  1 
ATOM   983  N  N   . TYR A 1 132 ? -1.786  23.480  -28.991 1.00 20.42 ?  125 TYR A N   1 
ATOM   984  C  CA  . TYR A 1 132 ? -2.144  24.472  -30.022 1.00 23.28 ?  125 TYR A CA  1 
ATOM   985  C  C   . TYR A 1 132 ? -2.712  23.756  -31.246 1.00 21.49 ?  125 TYR A C   1 
ATOM   986  O  O   . TYR A 1 132 ? -1.983  23.349  -32.143 1.00 22.66 ?  125 TYR A O   1 
ATOM   987  C  CB  . TYR A 1 132 ? -0.938  25.339  -30.374 1.00 23.11 ?  125 TYR A CB  1 
ATOM   988  C  CG  . TYR A 1 132 ? -0.378  26.014  -29.130 1.00 25.18 ?  125 TYR A CG  1 
ATOM   989  C  CD1 . TYR A 1 132 ? -1.154  26.911  -28.402 1.00 29.34 ?  125 TYR A CD1 1 
ATOM   990  C  CD2 . TYR A 1 132 ? 0.904   25.725  -28.668 1.00 27.85 ?  125 TYR A CD2 1 
ATOM   991  C  CE1 . TYR A 1 132 ? -0.662  27.524  -27.242 1.00 27.07 ?  125 TYR A CE1 1 
ATOM   992  C  CE2 . TYR A 1 132 ? 1.404   26.333  -27.521 1.00 26.68 ?  125 TYR A CE2 1 
ATOM   993  C  CZ  . TYR A 1 132 ? 0.613   27.226  -26.811 1.00 27.12 ?  125 TYR A CZ  1 
ATOM   994  O  OH  . TYR A 1 132 ? 1.096   27.827  -25.668 1.00 30.48 ?  125 TYR A OH  1 
ATOM   995  N  N   . TYR A 1 133 ? -4.034  23.593  -31.276 1.00 23.64 ?  126 TYR A N   1 
ATOM   996  C  CA  . TYR A 1 133 ? -4.680  22.860  -32.362 1.00 25.79 ?  126 TYR A CA  1 
ATOM   997  C  C   . TYR A 1 133 ? -4.788  23.733  -33.605 1.00 29.51 ?  126 TYR A C   1 
ATOM   998  O  O   . TYR A 1 133 ? -4.933  24.951  -33.518 1.00 24.32 ?  126 TYR A O   1 
ATOM   999  C  CB  . TYR A 1 133 ? -6.076  22.385  -31.949 1.00 24.28 ?  126 TYR A CB  1 
ATOM   1000 C  CG  . TYR A 1 133 ? -6.023  21.403  -30.807 1.00 25.52 ?  126 TYR A CG  1 
ATOM   1001 C  CD1 . TYR A 1 133 ? -5.652  20.083  -31.022 1.00 27.01 ?  126 TYR A CD1 1 
ATOM   1002 C  CD2 . TYR A 1 133 ? -6.297  21.808  -29.514 1.00 23.52 ?  126 TYR A CD2 1 
ATOM   1003 C  CE1 . TYR A 1 133 ? -5.560  19.186  -29.974 1.00 23.96 ?  126 TYR A CE1 1 
ATOM   1004 C  CE2 . TYR A 1 133 ? -6.211  20.914  -28.453 1.00 23.51 ?  126 TYR A CE2 1 
ATOM   1005 C  CZ  . TYR A 1 133 ? -5.840  19.611  -28.688 1.00 19.82 ?  126 TYR A CZ  1 
ATOM   1006 O  OH  . TYR A 1 133 ? -5.756  18.729  -27.631 1.00 21.67 ?  126 TYR A OH  1 
ATOM   1007 N  N   . SER A 1 134 ? -4.707  23.092  -34.770 1.00 28.79 ?  127 SER A N   1 
ATOM   1008 C  CA  . SER A 1 134 ? -4.937  23.785  -36.029 1.00 25.66 ?  127 SER A CA  1 
ATOM   1009 C  C   . SER A 1 134 ? -6.407  24.177  -36.164 1.00 29.85 ?  127 SER A C   1 
ATOM   1010 O  O   . SER A 1 134 ? -7.276  23.715  -35.415 1.00 30.18 ?  127 SER A O   1 
ATOM   1011 C  CB  . SER A 1 134 ? -4.535  22.897  -37.205 1.00 33.08 ?  127 SER A CB  1 
ATOM   1012 O  OG  . SER A 1 134 ? -5.375  21.748  -37.237 1.00 29.21 ?  127 SER A OG  1 
ATOM   1013 N  N   . GLU A 1 135 ? -6.681  25.034  -37.156 1.00 32.05 ?  128 GLU A N   1 
ATOM   1014 C  CA  . GLU A 1 135 ? -8.057  25.443  -37.433 1.00 35.52 ?  128 GLU A CA  1 
ATOM   1015 C  C   . GLU A 1 135 ? -8.983  24.241  -37.576 1.00 32.30 ?  128 GLU A C   1 
ATOM   1016 O  O   . GLU A 1 135 ? -10.095 24.233  -37.030 1.00 33.76 ?  128 GLU A O   1 
ATOM   1017 C  CB  . GLU A 1 135 ? -8.106  26.289  -38.707 1.00 38.75 ?  128 GLU A CB  1 
ATOM   1018 C  CG  . GLU A 1 135 ? -7.365  27.617  -38.610 1.00 45.12 ?  128 GLU A CG  1 
ATOM   1019 C  CD  . GLU A 1 135 ? -7.549  28.480  -39.854 1.00 52.77 ?  128 GLU A CD  1 
ATOM   1020 O  OE1 . GLU A 1 135 ? -6.687  29.354  -40.108 1.00 50.00 ?  128 GLU A OE1 1 
ATOM   1021 O  OE2 . GLU A 1 135 ? -8.553  28.275  -40.577 1.00 55.03 -1 128 GLU A OE2 1 
ATOM   1022 N  N   . ARG A 1 136 ? -8.536  23.211  -38.302 1.00 31.09 ?  129 ARG A N   1 
ATOM   1023 C  CA  . ARG A 1 136 ? -9.382  22.040  -38.523 1.00 36.46 ?  129 ARG A CA  1 
ATOM   1024 C  C   . ARG A 1 136 ? -9.572  21.222  -37.244 1.00 38.55 ?  129 ARG A C   1 
ATOM   1025 O  O   . ARG A 1 136 ? -10.650 20.664  -37.022 1.00 33.87 ?  129 ARG A O   1 
ATOM   1026 C  CB  . ARG A 1 136 ? -8.799  21.172  -39.641 1.00 39.17 ?  129 ARG A CB  1 
ATOM   1027 C  CG  . ARG A 1 136 ? -7.612  20.307  -39.237 1.00 42.68 ?  129 ARG A CG  1 
ATOM   1028 C  CD  . ARG A 1 136 ? -7.001  19.587  -40.449 1.00 49.88 ?  129 ARG A CD  1 
ATOM   1029 N  NE  . ARG A 1 136 ? -5.681  19.029  -40.153 1.00 52.18 ?  129 ARG A NE  1 
ATOM   1030 C  CZ  . ARG A 1 136 ? -4.558  19.747  -40.098 1.00 57.73 ?  129 ARG A CZ  1 
ATOM   1031 N  NH1 . ARG A 1 136 ? -4.585  21.059  -40.309 1.00 49.13 1  129 ARG A NH1 1 
ATOM   1032 N  NH2 . ARG A 1 136 ? -3.402  19.156  -39.823 1.00 60.66 ?  129 ARG A NH2 1 
ATOM   1033 N  N   . ASP A 1 137 ? -8.549  21.140  -36.385 1.00 30.96 ?  130 ASP A N   1 
ATOM   1034 C  CA  . ASP A 1 137 ? -8.632  20.301  -35.190 1.00 31.49 ?  130 ASP A CA  1 
ATOM   1035 C  C   . ASP A 1 137 ? -9.229  21.023  -33.993 1.00 33.34 ?  130 ASP A C   1 
ATOM   1036 O  O   . ASP A 1 137 ? -9.634  20.366  -33.025 1.00 33.81 ?  130 ASP A O   1 
ATOM   1037 C  CB  . ASP A 1 137 ? -7.237  19.777  -34.807 1.00 28.56 ?  130 ASP A CB  1 
ATOM   1038 C  CG  . ASP A 1 137 ? -6.630  18.882  -35.887 1.00 37.08 ?  130 ASP A CG  1 
ATOM   1039 O  OD1 . ASP A 1 137 ? -7.323  17.951  -36.350 1.00 40.43 ?  130 ASP A OD1 1 
ATOM   1040 O  OD2 . ASP A 1 137 ? -5.468  19.114  -36.290 1.00 38.98 -1 130 ASP A OD2 1 
ATOM   1041 N  N   . TYR A 1 138 ? -9.293  22.358  -34.042 1.00 33.77 ?  131 TYR A N   1 
ATOM   1042 C  CA  . TYR A 1 138 ? -9.620  23.143  -32.853 1.00 29.47 ?  131 TYR A CA  1 
ATOM   1043 C  C   . TYR A 1 138 ? -10.948 22.705  -32.247 1.00 35.36 ?  131 TYR A C   1 
ATOM   1044 O  O   . TYR A 1 138 ? -11.019 22.364  -31.061 1.00 32.14 ?  131 TYR A O   1 
ATOM   1045 C  CB  . TYR A 1 138 ? -9.625  24.634  -33.217 1.00 33.77 ?  131 TYR A CB  1 
ATOM   1046 C  CG  . TYR A 1 138 ? -9.815  25.584  -32.055 1.00 36.28 ?  131 TYR A CG  1 
ATOM   1047 C  CD1 . TYR A 1 138 ? -8.778  25.874  -31.173 1.00 38.64 ?  131 TYR A CD1 1 
ATOM   1048 C  CD2 . TYR A 1 138 ? -11.032 26.213  -31.859 1.00 39.45 ?  131 TYR A CD2 1 
ATOM   1049 C  CE1 . TYR A 1 138 ? -8.970  26.762  -30.104 1.00 38.62 ?  131 TYR A CE1 1 
ATOM   1050 C  CE2 . TYR A 1 138 ? -11.230 27.090  -30.814 1.00 41.22 ?  131 TYR A CE2 1 
ATOM   1051 C  CZ  . TYR A 1 138 ? -10.204 27.364  -29.944 1.00 41.11 ?  131 TYR A CZ  1 
ATOM   1052 O  OH  . TYR A 1 138 ? -10.450 28.245  -28.921 1.00 53.59 ?  131 TYR A OH  1 
ATOM   1053 N  N   . ARG A 1 139 ? -12.009 22.677  -33.051 1.00 32.86 ?  132 ARG A N   1 
ATOM   1054 C  CA  . ARG A 1 139 ? -13.328 22.296  -32.567 1.00 38.03 ?  132 ARG A CA  1 
ATOM   1055 C  C   . ARG A 1 139 ? -13.663 20.840  -32.879 1.00 41.96 ?  132 ARG A C   1 
ATOM   1056 O  O   . ARG A 1 139 ? -14.839 20.456  -32.834 1.00 44.63 ?  132 ARG A O   1 
ATOM   1057 C  CB  . ARG A 1 139 ? -14.387 23.231  -33.158 1.00 44.18 ?  132 ARG A CB  1 
ATOM   1058 C  CG  . ARG A 1 139 ? -14.108 24.702  -32.871 1.00 50.34 ?  132 ARG A CG  1 
ATOM   1059 C  CD  . ARG A 1 139 ? -15.015 25.651  -33.651 1.00 56.99 ?  132 ARG A CD  1 
ATOM   1060 N  NE  . ARG A 1 139 ? -16.425 25.259  -33.604 1.00 61.82 ?  132 ARG A NE  1 
ATOM   1061 C  CZ  . ARG A 1 139 ? -17.181 25.262  -32.506 1.00 62.44 ?  132 ARG A CZ  1 
ATOM   1062 N  NH1 . ARG A 1 139 ? -16.677 25.620  -31.329 1.00 62.28 1  132 ARG A NH1 1 
ATOM   1063 N  NH2 . ARG A 1 139 ? -18.450 24.885  -32.580 1.00 64.66 ?  132 ARG A NH2 1 
ATOM   1064 N  N   . ARG A 1 140 ? -12.660 20.022  -33.197 1.00 31.05 ?  133 ARG A N   1 
ATOM   1065 C  CA  . ARG A 1 140 ? -12.889 18.615  -33.499 1.00 35.17 ?  133 ARG A CA  1 
ATOM   1066 C  C   . ARG A 1 140 ? -12.164 17.665  -32.558 1.00 32.10 ?  133 ARG A C   1 
ATOM   1067 O  O   . ARG A 1 140 ? -12.781 16.721  -32.057 1.00 31.57 ?  133 ARG A O   1 
ATOM   1068 C  CB  . ARG A 1 140 ? -12.478 18.319  -34.945 1.00 33.30 ?  133 ARG A CB  1 
ATOM   1069 C  CG  . ARG A 1 140 ? -13.476 18.818  -35.965 1.00 44.33 ?  133 ARG A CG  1 
ATOM   1070 C  CD  . ARG A 1 140 ? -13.036 18.428  -37.365 1.00 46.71 ?  133 ARG A CD  1 
ATOM   1071 N  NE  . ARG A 1 140 ? -14.038 18.754  -38.377 1.00 50.69 ?  133 ARG A NE  1 
ATOM   1072 C  CZ  . ARG A 1 140 ? -14.180 19.957  -38.927 1.00 54.28 ?  133 ARG A CZ  1 
ATOM   1073 N  NH1 . ARG A 1 140 ? -13.394 20.962  -38.552 1.00 51.19 1  133 ARG A NH1 1 
ATOM   1074 N  NH2 . ARG A 1 140 ? -15.114 20.159  -39.853 1.00 57.81 ?  133 ARG A NH2 1 
ATOM   1075 N  N   . ALA A 1 141 ? -10.873 17.885  -32.294 1.00 27.79 ?  134 ALA A N   1 
ATOM   1076 C  CA  . ALA A 1 141 ? -10.060 16.851  -31.646 1.00 28.23 ?  134 ALA A CA  1 
ATOM   1077 C  C   . ALA A 1 141 ? -10.557 16.542  -30.239 1.00 27.96 ?  134 ALA A C   1 
ATOM   1078 O  O   . ALA A 1 141 ? -10.903 15.396  -29.924 1.00 26.82 ?  134 ALA A O   1 
ATOM   1079 C  CB  . ALA A 1 141 ? -8.591  17.274  -31.625 1.00 32.59 ?  134 ALA A CB  1 
ATOM   1080 N  N   . LEU A 1 142 ? -10.591 17.548  -29.360 1.00 26.33 ?  135 LEU A N   1 
ATOM   1081 C  CA  . LEU A 1 142 ? -11.030 17.258  -27.998 1.00 25.00 ?  135 LEU A CA  1 
ATOM   1082 C  C   . LEU A 1 142 ? -12.516 16.943  -27.948 1.00 28.69 ?  135 LEU A C   1 
ATOM   1083 O  O   . LEU A 1 142 ? -12.960 16.201  -27.067 1.00 28.44 ?  135 LEU A O   1 
ATOM   1084 C  CB  . LEU A 1 142 ? -10.698 18.430  -27.068 1.00 29.85 ?  135 LEU A CB  1 
ATOM   1085 C  CG  . LEU A 1 142 ? -9.197  18.651  -26.853 1.00 29.46 ?  135 LEU A CG  1 
ATOM   1086 C  CD1 . LEU A 1 142 ? -8.937  19.813  -25.881 1.00 26.85 ?  135 LEU A CD1 1 
ATOM   1087 C  CD2 . LEU A 1 142 ? -8.500  17.380  -26.366 1.00 27.33 ?  135 LEU A CD2 1 
ATOM   1088 N  N   . CYS A 1 143 ? -13.299 17.506  -28.870 1.00 26.59 ?  136 CYS A N   1 
ATOM   1089 C  CA  . CYS A 1 143 ? -14.709 17.142  -28.953 1.00 26.73 ?  136 CYS A CA  1 
ATOM   1090 C  C   . CYS A 1 143 ? -14.874 15.651  -29.247 1.00 28.57 ?  136 CYS A C   1 
ATOM   1091 O  O   . CYS A 1 143 ? -15.718 14.979  -28.642 1.00 33.53 ?  136 CYS A O   1 
ATOM   1092 C  CB  . CYS A 1 143 ? -15.410 17.980  -30.024 1.00 36.06 ?  136 CYS A CB  1 
ATOM   1093 S  SG  . CYS A 1 143 ? -17.175 17.599  -30.150 1.00 41.95 ?  136 CYS A SG  1 
ATOM   1094 N  N   . ARG A 1 144 ? -14.062 15.111  -30.157 1.00 28.54 ?  137 ARG A N   1 
ATOM   1095 C  CA  . ARG A 1 144 ? -14.138 13.682  -30.466 1.00 27.49 ?  137 ARG A CA  1 
ATOM   1096 C  C   . ARG A 1 144 ? -13.779 12.835  -29.255 1.00 27.39 ?  137 ARG A C   1 
ATOM   1097 O  O   . ARG A 1 144 ? -14.393 11.790  -29.002 1.00 30.69 ?  137 ARG A O   1 
ATOM   1098 C  CB  . ARG A 1 144 ? -13.192 13.338  -31.610 1.00 29.52 ?  137 ARG A CB  1 
ATOM   1099 C  CG  . ARG A 1 144 ? -13.585 13.858  -32.958 1.00 34.78 ?  137 ARG A CG  1 
ATOM   1100 C  CD  . ARG A 1 144 ? -12.396 13.777  -33.892 1.00 37.01 ?  137 ARG A CD  1 
ATOM   1101 N  NE  . ARG A 1 144 ? -12.757 14.176  -35.245 1.00 39.41 ?  137 ARG A NE  1 
ATOM   1102 C  CZ  . ARG A 1 144 ? -11.884 14.534  -36.173 1.00 43.25 ?  137 ARG A CZ  1 
ATOM   1103 N  NH1 . ARG A 1 144 ? -10.586 14.553  -35.891 1.00 44.96 1  137 ARG A NH1 1 
ATOM   1104 N  NH2 . ARG A 1 144 ? -12.311 14.876  -37.377 1.00 43.91 ?  137 ARG A NH2 1 
ATOM   1105 N  N   . LEU A 1 145 ? -12.750 13.249  -28.520 1.00 26.47 ?  138 LEU A N   1 
ATOM   1106 C  CA  . LEU A 1 145 ? -12.332 12.504  -27.339 1.00 25.47 ?  138 LEU A CA  1 
ATOM   1107 C  C   . LEU A 1 145 ? -13.406 12.536  -26.263 1.00 28.62 ?  138 LEU A C   1 
ATOM   1108 O  O   . LEU A 1 145 ? -13.695 11.516  -25.621 1.00 26.68 ?  138 LEU A O   1 
ATOM   1109 C  CB  . LEU A 1 145 ? -11.022 13.091  -26.818 1.00 23.68 ?  138 LEU A CB  1 
ATOM   1110 C  CG  . LEU A 1 145 ? -10.436 12.350  -25.614 1.00 25.33 ?  138 LEU A CG  1 
ATOM   1111 C  CD1 . LEU A 1 145 ? -10.310 10.863  -25.934 1.00 26.48 ?  138 LEU A CD1 1 
ATOM   1112 C  CD2 . LEU A 1 145 ? -9.073  12.952  -25.272 1.00 26.23 ?  138 LEU A CD2 1 
ATOM   1113 N  N   . SER A 1 146 ? -14.017 13.702  -26.062 1.00 26.10 ?  139 SER A N   1 
ATOM   1114 C  CA  . SER A 1 146 ? -15.080 13.823  -25.077 1.00 28.55 ?  139 SER A CA  1 
ATOM   1115 C  C   . SER A 1 146 ? -16.298 12.994  -25.479 1.00 29.46 ?  139 SER A C   1 
ATOM   1116 O  O   . SER A 1 146 ? -16.963 12.395  -24.625 1.00 32.22 ?  139 SER A O   1 
ATOM   1117 C  CB  . SER A 1 146 ? -15.434 15.304  -24.914 1.00 30.71 ?  139 SER A CB  1 
ATOM   1118 O  OG  . SER A 1 146 ? -16.493 15.464  -24.001 1.00 39.93 ?  139 SER A OG  1 
ATOM   1119 N  N   . GLN A 1 147 ? -16.584 12.927  -26.781 1.00 31.00 ?  140 GLN A N   1 
ATOM   1120 C  CA  . GLN A 1 147 ? -17.690 12.120  -27.293 1.00 32.00 ?  140 GLN A CA  1 
ATOM   1121 C  C   . GLN A 1 147 ? -17.447 10.628  -27.114 1.00 34.58 ?  140 GLN A C   1 
ATOM   1122 O  O   . GLN A 1 147 ? -18.401 9.851   -27.014 1.00 32.94 ?  140 GLN A O   1 
ATOM   1123 C  CB  . GLN A 1 147 ? -17.910 12.430  -28.771 1.00 36.96 ?  140 GLN A CB  1 
ATOM   1124 C  CG  . GLN A 1 147 ? -18.758 13.656  -29.038 1.00 45.13 ?  140 GLN A CG  1 
ATOM   1125 C  CD  . GLN A 1 147 ? -20.239 13.389  -28.813 1.00 53.53 ?  140 GLN A CD  1 
ATOM   1126 O  OE1 . GLN A 1 147 ? -20.733 12.295  -29.095 1.00 52.68 ?  140 GLN A OE1 1 
ATOM   1127 N  NE2 . GLN A 1 147 ? -20.949 14.382  -28.291 1.00 59.58 ?  140 GLN A NE2 1 
ATOM   1128 N  N   . ALA A 1 148 ? -16.190 10.201  -27.118 1.00 30.15 ?  141 ALA A N   1 
ATOM   1129 C  CA  . ALA A 1 148 ? -15.896 8.811   -26.821 1.00 29.46 ?  141 ALA A CA  1 
ATOM   1130 C  C   . ALA A 1 148 ? -16.004 8.505   -25.334 1.00 32.20 ?  141 ALA A C   1 
ATOM   1131 O  O   . ALA A 1 148 ? -15.810 7.352   -24.951 1.00 30.16 ?  141 ALA A O   1 
ATOM   1132 C  CB  . ALA A 1 148 ? -14.501 8.449   -27.334 1.00 31.09 ?  141 ALA A CB  1 
ATOM   1133 N  N   . GLY A 1 149 ? -16.316 9.497   -24.499 1.00 29.46 ?  142 GLY A N   1 
ATOM   1134 C  CA  . GLY A 1 149 ? -16.581 9.284   -23.089 1.00 30.32 ?  142 GLY A CA  1 
ATOM   1135 C  C   . GLY A 1 149 ? -15.521 9.814   -22.146 1.00 31.88 ?  142 GLY A C   1 
ATOM   1136 O  O   . GLY A 1 149 ? -15.703 9.717   -20.924 1.00 31.16 ?  142 GLY A O   1 
ATOM   1137 N  N   . ALA A 1 150 ? -14.410 10.341  -22.654 1.00 27.00 ?  143 ALA A N   1 
ATOM   1138 C  CA  . ALA A 1 150 ? -13.380 10.870  -21.772 1.00 28.79 ?  143 ALA A CA  1 
ATOM   1139 C  C   . ALA A 1 150 ? -13.838 12.198  -21.196 1.00 29.04 ?  143 ALA A C   1 
ATOM   1140 O  O   . ALA A 1 150 ? -14.502 12.986  -21.874 1.00 31.19 ?  143 ALA A O   1 
ATOM   1141 C  CB  . ALA A 1 150 ? -12.058 11.067  -22.511 1.00 24.58 ?  143 ALA A CB  1 
ATOM   1142 N  N   . ARG A 1 151 ? -13.481 12.441  -19.943 1.00 28.18 ?  144 ARG A N   1 
ATOM   1143 C  CA  . ARG A 1 151 ? -13.689 13.747  -19.330 1.00 30.18 ?  144 ARG A CA  1 
ATOM   1144 C  C   . ARG A 1 151 ? -12.426 14.576  -19.515 1.00 28.71 ?  144 ARG A C   1 
ATOM   1145 O  O   . ARG A 1 151 ? -11.346 14.182  -19.060 1.00 29.92 ?  144 ARG A O   1 
ATOM   1146 C  CB  . ARG A 1 151 ? -14.026 13.604  -17.847 1.00 30.53 ?  144 ARG A CB  1 
ATOM   1147 C  CG  . ARG A 1 151 ? -14.302 14.923  -17.149 1.00 41.70 ?  144 ARG A CG  1 
ATOM   1148 C  CD  . ARG A 1 151 ? -14.803 14.668  -15.736 1.00 51.95 ?  144 ARG A CD  1 
ATOM   1149 N  NE  . ARG A 1 151 ? -14.609 15.818  -14.857 1.00 57.39 ?  144 ARG A NE  1 
ATOM   1150 C  CZ  . ARG A 1 151 ? -15.443 16.850  -14.791 1.00 62.54 ?  144 ARG A CZ  1 
ATOM   1151 N  NH1 . ARG A 1 151 ? -16.525 16.877  -15.562 1.00 63.74 1  144 ARG A NH1 1 
ATOM   1152 N  NH2 . ARG A 1 151 ? -15.193 17.858  -13.958 1.00 61.07 ?  144 ARG A NH2 1 
ATOM   1153 N  N   . VAL A 1 152 ? -12.561 15.721  -20.173 1.00 25.94 ?  145 VAL A N   1 
ATOM   1154 C  CA  . VAL A 1 152 ? -11.435 16.600  -20.481 1.00 26.18 ?  145 VAL A CA  1 
ATOM   1155 C  C   . VAL A 1 152 ? -11.685 17.913  -19.751 1.00 27.88 ?  145 VAL A C   1 
ATOM   1156 O  O   . VAL A 1 152 ? -12.732 18.533  -19.945 1.00 25.88 ?  145 VAL A O   1 
ATOM   1157 C  CB  . VAL A 1 152 ? -11.300 16.832  -21.992 1.00 26.37 ?  145 VAL A CB  1 
ATOM   1158 C  CG1 . VAL A 1 152 ? -10.096 17.712  -22.301 1.00 28.18 ?  145 VAL A CG1 1 
ATOM   1159 C  CG2 . VAL A 1 152 ? -11.224 15.487  -22.742 1.00 29.59 ?  145 VAL A CG2 1 
ATOM   1160 N  N   . LYS A 1 153 ? -10.750 18.318  -18.896 1.00 26.42 ?  146 LYS A N   1 
ATOM   1161 C  CA  . LYS A 1 153 ? -10.934 19.534  -18.108 1.00 29.01 ?  146 LYS A CA  1 
ATOM   1162 C  C   . LYS A 1 153 ? -9.591  20.236  -17.921 1.00 28.53 ?  146 LYS A C   1 
ATOM   1163 O  O   . LYS A 1 153 ? -8.521  19.682  -18.201 1.00 24.08 ?  146 LYS A O   1 
ATOM   1164 C  CB  . LYS A 1 153 ? -11.596 19.235  -16.753 1.00 30.59 ?  146 LYS A CB  1 
ATOM   1165 C  CG  . LYS A 1 153 ? -10.856 18.220  -15.906 1.00 36.75 ?  146 LYS A CG  1 
ATOM   1166 C  CD  . LYS A 1 153 ? -11.636 17.860  -14.636 1.00 44.34 ?  146 LYS A CD  1 
ATOM   1167 C  CE  . LYS A 1 153 ? -11.826 19.071  -13.743 1.00 41.56 ?  146 LYS A CE  1 
ATOM   1168 N  NZ  . LYS A 1 153 ? -10.516 19.570  -13.231 1.00 47.55 1  146 LYS A NZ  1 
ATOM   1169 N  N   . ILE A 1 154 ? -9.664  21.499  -17.493 1.00 25.46 ?  147 ILE A N   1 
ATOM   1170 C  CA  . ILE A 1 154 ? -8.480  22.274  -17.136 1.00 24.60 ?  147 ILE A CA  1 
ATOM   1171 C  C   . ILE A 1 154 ? -8.111  21.972  -15.687 1.00 26.27 ?  147 ILE A C   1 
ATOM   1172 O  O   . ILE A 1 154 ? -8.984  21.850  -14.818 1.00 31.56 ?  147 ILE A O   1 
ATOM   1173 C  CB  . ILE A 1 154 ? -8.730  23.780  -17.356 1.00 26.69 ?  147 ILE A CB  1 
ATOM   1174 C  CG1 . ILE A 1 154 ? -9.139  24.038  -18.810 1.00 23.68 ?  147 ILE A CG1 1 
ATOM   1175 C  CG2 . ILE A 1 154 ? -7.493  24.614  -16.971 1.00 23.74 ?  147 ILE A CG2 1 
ATOM   1176 C  CD1 . ILE A 1 154 ? -8.088  23.557  -19.870 1.00 25.54 ?  147 ILE A CD1 1 
ATOM   1177 N  N   . MET A 1 155 ? -6.816  21.818  -15.429 1.00 24.88 ?  148 MET A N   1 
ATOM   1178 C  CA  . MET A 1 155 ? -6.344  21.576  -14.072 1.00 27.53 ?  148 MET A CA  1 
ATOM   1179 C  C   . MET A 1 155 ? -6.631  22.788  -13.194 1.00 34.38 ?  148 MET A C   1 
ATOM   1180 O  O   . MET A 1 155 ? -6.231  23.903  -13.531 1.00 29.61 ?  148 MET A O   1 
ATOM   1181 C  CB  . MET A 1 155 ? -4.841  21.300  -14.072 1.00 29.01 ?  148 MET A CB  1 
ATOM   1182 C  CG  . MET A 1 155 ? -4.432  19.864  -14.291 1.00 31.24 ?  148 MET A CG  1 
ATOM   1183 S  SD  . MET A 1 155 ? -2.639  19.652  -14.225 1.00 30.87 ?  148 MET A SD  1 
ATOM   1184 C  CE  . MET A 1 155 ? -2.278  19.764  -12.476 1.00 29.24 ?  148 MET A CE  1 
ATOM   1185 N  N   . ASP A 1 156 ? -7.312  22.567  -12.064 1.00 33.90 ?  149 ASP A N   1 
ATOM   1186 C  CA  . ASP A 1 156 ? -7.602  23.639  -11.117 1.00 36.69 ?  149 ASP A CA  1 
ATOM   1187 C  C   . ASP A 1 156 ? -6.613  23.600  -9.948  1.00 30.51 ?  149 ASP A C   1 
ATOM   1188 O  O   . ASP A 1 156 ? -5.763  22.715  -9.849  1.00 31.94 ?  149 ASP A O   1 
ATOM   1189 C  CB  . ASP A 1 156 ? -9.064  23.588  -10.644 1.00 38.99 ?  149 ASP A CB  1 
ATOM   1190 C  CG  . ASP A 1 156 ? -9.412  22.338  -9.847  1.00 41.84 ?  149 ASP A CG  1 
ATOM   1191 O  OD1 . ASP A 1 156 ? -8.525  21.641  -9.302  1.00 38.76 ?  149 ASP A OD1 1 
ATOM   1192 O  OD2 . ASP A 1 156 ? -10.619 22.062  -9.742  1.00 48.34 -1 149 ASP A OD2 1 
ATOM   1193 N  N   . TYR A 1 157 ? -6.722  24.587  -9.047  1.00 34.05 ?  150 TYR A N   1 
ATOM   1194 C  CA  . TYR A 1 157 ? -5.730  24.699  -7.983  1.00 34.28 ?  150 TYR A CA  1 
ATOM   1195 C  C   . TYR A 1 157 ? -5.620  23.410  -7.176  1.00 31.04 ?  150 TYR A C   1 
ATOM   1196 O  O   . TYR A 1 157 ? -4.510  22.965  -6.857  1.00 32.94 ?  150 TYR A O   1 
ATOM   1197 C  CB  . TYR A 1 157 ? -6.056  25.873  -7.057  1.00 38.35 ?  150 TYR A CB  1 
ATOM   1198 C  CG  . TYR A 1 157 ? -5.130  25.891  -5.861  1.00 41.02 ?  150 TYR A CG  1 
ATOM   1199 C  CD1 . TYR A 1 157 ? -3.821  26.346  -5.980  1.00 44.91 ?  150 TYR A CD1 1 
ATOM   1200 C  CD2 . TYR A 1 157 ? -5.543  25.405  -4.630  1.00 43.76 ?  150 TYR A CD2 1 
ATOM   1201 C  CE1 . TYR A 1 157 ? -2.953  26.337  -4.892  1.00 46.22 ?  150 TYR A CE1 1 
ATOM   1202 C  CE2 . TYR A 1 157 ? -4.686  25.392  -3.536  1.00 47.14 ?  150 TYR A CE2 1 
ATOM   1203 C  CZ  . TYR A 1 157 ? -3.394  25.857  -3.674  1.00 49.92 ?  150 TYR A CZ  1 
ATOM   1204 O  OH  . TYR A 1 157 ? -2.544  25.843  -2.585  1.00 60.01 ?  150 TYR A OH  1 
ATOM   1205 N  N   . GLU A 1 158 ? -6.756  22.796  -6.837  1.00 35.55 ?  151 GLU A N   1 
ATOM   1206 C  CA  . GLU A 1 158 ? -6.724  21.586  -6.019  1.00 38.64 ?  151 GLU A CA  1 
ATOM   1207 C  C   . GLU A 1 158 ? -5.930  20.482  -6.702  1.00 35.20 ?  151 GLU A C   1 
ATOM   1208 O  O   . GLU A 1 158 ? -5.232  19.702  -6.041  1.00 35.44 ?  151 GLU A O   1 
ATOM   1209 C  CB  . GLU A 1 158 ? -8.147  21.113  -5.715  1.00 40.58 ?  151 GLU A CB  1 
ATOM   1210 C  CG  . GLU A 1 158 ? -9.061  22.208  -5.143  1.00 48.40 ?  151 GLU A CG  1 
ATOM   1211 C  CD  . GLU A 1 158 ? -9.715  23.054  -6.236  1.00 54.63 ?  151 GLU A CD  1 
ATOM   1212 O  OE1 . GLU A 1 158 ? -10.909 22.815  -6.546  1.00 60.22 ?  151 GLU A OE1 1 
ATOM   1213 O  OE2 . GLU A 1 158 ? -9.025  23.941  -6.804  1.00 49.84 -1 151 GLU A OE2 1 
ATOM   1214 N  N   . GLU A 1 159 ? -6.002  20.417  -8.031  1.00 38.09 ?  152 GLU A N   1 
ATOM   1215 C  CA  . GLU A 1 159 ? -5.288  19.374  -8.761  1.00 34.77 ?  152 GLU A CA  1 
ATOM   1216 C  C   . GLU A 1 159 ? -3.792  19.658  -8.826  1.00 30.06 ?  152 GLU A C   1 
ATOM   1217 O  O   . GLU A 1 159 ? -2.976  18.735  -8.699  1.00 33.69 ?  152 GLU A O   1 
ATOM   1218 C  CB  . GLU A 1 159 ? -5.900  19.226  -10.151 1.00 32.96 ?  152 GLU A CB  1 
ATOM   1219 C  CG  . GLU A 1 159 ? -7.316  18.638  -10.095 1.00 35.19 ?  152 GLU A CG  1 
ATOM   1220 C  CD  . GLU A 1 159 ? -8.042  18.676  -11.433 1.00 43.14 ?  152 GLU A CD  1 
ATOM   1221 O  OE1 . GLU A 1 159 ? -8.079  19.754  -12.069 1.00 41.26 ?  152 GLU A OE1 1 
ATOM   1222 O  OE2 . GLU A 1 159 ? -8.590  17.630  -11.855 1.00 49.46 -1 152 GLU A OE2 1 
ATOM   1223 N  N   . PHE A 1 160 ? -3.404  20.926  -9.013  1.00 31.23 ?  153 PHE A N   1 
ATOM   1224 C  CA  . PHE A 1 160 ? -1.990  21.286  -8.898  1.00 29.55 ?  153 PHE A CA  1 
ATOM   1225 C  C   . PHE A 1 160 ? -1.422  20.915  -7.536  1.00 31.50 ?  153 PHE A C   1 
ATOM   1226 O  O   . PHE A 1 160 ? -0.301  20.395  -7.440  1.00 35.37 ?  153 PHE A O   1 
ATOM   1227 C  CB  . PHE A 1 160 ? -1.797  22.779  -9.148  1.00 30.84 ?  153 PHE A CB  1 
ATOM   1228 C  CG  . PHE A 1 160 ? -1.750  23.137  -10.587 1.00 28.51 ?  153 PHE A CG  1 
ATOM   1229 C  CD1 . PHE A 1 160 ? -0.557  23.112  -11.280 1.00 28.63 ?  153 PHE A CD1 1 
ATOM   1230 C  CD2 . PHE A 1 160 ? -2.904  23.481  -11.258 1.00 27.05 ?  153 PHE A CD2 1 
ATOM   1231 C  CE1 . PHE A 1 160 ? -0.523  23.424  -12.628 1.00 29.57 ?  153 PHE A CE1 1 
ATOM   1232 C  CE2 . PHE A 1 160 ? -2.867  23.806  -12.610 1.00 31.54 ?  153 PHE A CE2 1 
ATOM   1233 C  CZ  . PHE A 1 160 ? -1.675  23.781  -13.283 1.00 26.93 ?  153 PHE A CZ  1 
ATOM   1234 N  N   . ALA A 1 161 ? -2.165  21.200  -6.469  1.00 35.24 ?  154 ALA A N   1 
ATOM   1235 C  CA  . ALA A 1 161 ? -1.693  20.843  -5.136  1.00 36.30 ?  154 ALA A CA  1 
ATOM   1236 C  C   . ALA A 1 161 ? -1.614  19.329  -4.972  1.00 36.01 ?  154 ALA A C   1 
ATOM   1237 O  O   . ALA A 1 161 ? -0.653  18.811  -4.393  1.00 34.02 ?  154 ALA A O   1 
ATOM   1238 C  CB  . ALA A 1 161 ? -2.608  21.460  -4.082  1.00 38.01 ?  154 ALA A CB  1 
ATOM   1239 N  N   . TYR A 1 162 ? -2.613  18.607  -5.486  1.00 35.01 ?  155 TYR A N   1 
ATOM   1240 C  CA  . TYR A 1 162 ? -2.589  17.148  -5.441  1.00 36.90 ?  155 TYR A CA  1 
ATOM   1241 C  C   . TYR A 1 162 ? -1.395  16.588  -6.205  1.00 39.04 ?  155 TYR A C   1 
ATOM   1242 O  O   . TYR A 1 162 ? -0.789  15.592  -5.784  1.00 38.52 ?  155 TYR A O   1 
ATOM   1243 C  CB  . TYR A 1 162 ? -3.896  16.591  -6.007  1.00 36.86 ?  155 TYR A CB  1 
ATOM   1244 C  CG  . TYR A 1 162 ? -4.002  15.091  -5.872  1.00 42.59 ?  155 TYR A CG  1 
ATOM   1245 C  CD1 . TYR A 1 162 ? -4.500  14.515  -4.707  1.00 43.75 ?  155 TYR A CD1 1 
ATOM   1246 C  CD2 . TYR A 1 162 ? -3.580  14.252  -6.889  1.00 40.25 ?  155 TYR A CD2 1 
ATOM   1247 C  CE1 . TYR A 1 162 ? -4.582  13.146  -4.571  1.00 46.27 ?  155 TYR A CE1 1 
ATOM   1248 C  CE2 . TYR A 1 162 ? -3.659  12.882  -6.763  1.00 45.06 ?  155 TYR A CE2 1 
ATOM   1249 C  CZ  . TYR A 1 162 ? -4.163  12.333  -5.601  1.00 47.26 ?  155 TYR A CZ  1 
ATOM   1250 O  OH  . TYR A 1 162 ? -4.252  10.964  -5.474  1.00 46.93 ?  155 TYR A OH  1 
ATOM   1251 N  N   . CYS A 1 163 ? -1.042  17.211  -7.334  1.00 38.55 ?  156 CYS A N   1 
ATOM   1252 C  CA  . CYS A 1 163 ? 0.132   16.768  -8.083  1.00 33.45 ?  156 CYS A CA  1 
ATOM   1253 C  C   . CYS A 1 163 ? 1.414   17.065  -7.336  1.00 35.57 ?  156 CYS A C   1 
ATOM   1254 O  O   . CYS A 1 163 ? 2.338   16.245  -7.328  1.00 35.01 ?  156 CYS A O   1 
ATOM   1255 C  CB  . CYS A 1 163 ? 0.178   17.440  -9.445  1.00 37.96 ?  156 CYS A CB  1 
ATOM   1256 S  SG  . CYS A 1 163 ? -0.944  16.698  -10.561 1.00 42.19 ?  156 CYS A SG  1 
ATOM   1257 N  N   . TRP A 1 164 ? 1.501   18.250  -6.732  1.00 34.58 ?  157 TRP A N   1 
ATOM   1258 C  CA  . TRP A 1 164 ? 2.675   18.595  -5.946  1.00 37.55 ?  157 TRP A CA  1 
ATOM   1259 C  C   . TRP A 1 164 ? 2.916   17.557  -4.859  1.00 36.97 ?  157 TRP A C   1 
ATOM   1260 O  O   . TRP A 1 164 ? 4.055   17.132  -4.625  1.00 38.27 ?  157 TRP A O   1 
ATOM   1261 C  CB  . TRP A 1 164 ? 2.484   19.982  -5.331  1.00 43.15 ?  157 TRP A CB  1 
ATOM   1262 C  CG  . TRP A 1 164 ? 3.658   20.464  -4.543  1.00 42.85 ?  157 TRP A CG  1 
ATOM   1263 C  CD1 . TRP A 1 164 ? 3.804   20.442  -3.182  1.00 42.77 ?  157 TRP A CD1 1 
ATOM   1264 C  CD2 . TRP A 1 164 ? 4.855   21.050  -5.069  1.00 43.80 ?  157 TRP A CD2 1 
ATOM   1265 N  NE1 . TRP A 1 164 ? 5.021   20.978  -2.832  1.00 46.82 ?  157 TRP A NE1 1 
ATOM   1266 C  CE2 . TRP A 1 164 ? 5.685   21.362  -3.969  1.00 47.69 ?  157 TRP A CE2 1 
ATOM   1267 C  CE3 . TRP A 1 164 ? 5.303   21.348  -6.362  1.00 39.43 ?  157 TRP A CE3 1 
ATOM   1268 C  CZ2 . TRP A 1 164 ? 6.942   21.951  -4.126  1.00 47.41 ?  157 TRP A CZ2 1 
ATOM   1269 C  CZ3 . TRP A 1 164 ? 6.546   21.927  -6.516  1.00 42.51 ?  157 TRP A CZ3 1 
ATOM   1270 C  CH2 . TRP A 1 164 ? 7.353   22.230  -5.401  1.00 45.60 ?  157 TRP A CH2 1 
ATOM   1271 N  N   . GLU A 1 165 ? 1.840   17.115  -4.219  1.00 36.34 ?  158 GLU A N   1 
ATOM   1272 C  CA  . GLU A 1 165 ? 1.937   16.152  -3.129  1.00 41.34 ?  158 GLU A CA  1 
ATOM   1273 C  C   . GLU A 1 165 ? 2.410   14.792  -3.632  1.00 47.66 ?  158 GLU A C   1 
ATOM   1274 O  O   . GLU A 1 165 ? 3.313   14.180  -3.045  1.00 42.32 ?  158 GLU A O   1 
ATOM   1275 C  CB  . GLU A 1 165 ? 0.575   16.031  -2.445  1.00 40.33 ?  158 GLU A CB  1 
ATOM   1276 C  CG  . GLU A 1 165 ? 0.571   15.185  -1.189  1.00 51.54 ?  158 GLU A CG  1 
ATOM   1277 C  CD  . GLU A 1 165 ? 1.354   15.824  -0.048  1.00 59.62 ?  158 GLU A CD  1 
ATOM   1278 O  OE1 . GLU A 1 165 ? 1.579   17.055  -0.084  1.00 61.39 ?  158 GLU A OE1 1 
ATOM   1279 O  OE2 . GLU A 1 165 ? 1.746   15.093  0.888   1.00 71.63 -1 158 GLU A OE2 1 
ATOM   1280 N  N   . ASN A 1 166 ? 1.835   14.313  -4.737  1.00 40.20 ?  159 ASN A N   1 
ATOM   1281 C  CA  . ASN A 1 166 ? 1.995   12.916  -5.117  1.00 42.38 ?  159 ASN A CA  1 
ATOM   1282 C  C   . ASN A 1 166 ? 2.963   12.671  -6.272  1.00 42.70 ?  159 ASN A C   1 
ATOM   1283 O  O   . ASN A 1 166 ? 3.534   11.576  -6.355  1.00 44.46 ?  159 ASN A O   1 
ATOM   1284 C  CB  . ASN A 1 166 ? 0.628   12.316  -5.453  1.00 38.91 ?  159 ASN A CB  1 
ATOM   1285 C  CG  . ASN A 1 166 ? -0.264  12.197  -4.228  1.00 48.06 ?  159 ASN A CG  1 
ATOM   1286 O  OD1 . ASN A 1 166 ? -0.129  11.254  -3.450  1.00 51.10 ?  159 ASN A OD1 1 
ATOM   1287 N  ND2 . ASN A 1 166 ? -1.174  13.152  -4.047  1.00 38.89 ?  159 ASN A ND2 1 
ATOM   1288 N  N   . PHE A 1 167 ? 3.189   13.637  -7.163  1.00 38.06 ?  160 PHE A N   1 
ATOM   1289 C  CA  . PHE A 1 167 ? 4.049   13.374  -8.311  1.00 36.49 ?  160 PHE A CA  1 
ATOM   1290 C  C   . PHE A 1 167 ? 5.324   14.214  -8.312  1.00 35.84 ?  160 PHE A C   1 
ATOM   1291 O  O   . PHE A 1 167 ? 6.099   14.142  -9.271  1.00 35.64 ?  160 PHE A O   1 
ATOM   1292 C  CB  . PHE A 1 167 ? 3.252   13.569  -9.614  1.00 33.02 ?  160 PHE A CB  1 
ATOM   1293 C  CG  . PHE A 1 167 ? 1.984   12.744  -9.683  1.00 29.78 ?  160 PHE A CG  1 
ATOM   1294 C  CD1 . PHE A 1 167 ? 2.036   11.376  -9.933  1.00 35.53 ?  160 PHE A CD1 1 
ATOM   1295 C  CD2 . PHE A 1 167 ? 0.747   13.332  -9.488  1.00 31.62 ?  160 PHE A CD2 1 
ATOM   1296 C  CE1 . PHE A 1 167 ? 0.865   10.616  -9.989  1.00 34.52 ?  160 PHE A CE1 1 
ATOM   1297 C  CE2 . PHE A 1 167 ? -0.422  12.588  -9.531  1.00 32.92 ?  160 PHE A CE2 1 
ATOM   1298 C  CZ  . PHE A 1 167 ? -0.362  11.220  -9.787  1.00 33.51 ?  160 PHE A CZ  1 
ATOM   1299 N  N   . VAL A 1 168 ? 5.587   14.978  -7.252  1.00 35.44 ?  161 VAL A N   1 
ATOM   1300 C  CA  . VAL A 1 168 ? 6.765   15.834  -7.170  1.00 36.81 ?  161 VAL A CA  1 
ATOM   1301 C  C   . VAL A 1 168 ? 7.581   15.452  -5.939  1.00 42.15 ?  161 VAL A C   1 
ATOM   1302 O  O   . VAL A 1 168 ? 7.022   15.224  -4.860  1.00 40.05 ?  161 VAL A O   1 
ATOM   1303 C  CB  . VAL A 1 168 ? 6.366   17.325  -7.123  1.00 37.11 ?  161 VAL A CB  1 
ATOM   1304 C  CG1 . VAL A 1 168 ? 7.590   18.211  -7.100  1.00 40.46 ?  161 VAL A CG1 1 
ATOM   1305 C  CG2 . VAL A 1 168 ? 5.489   17.677  -8.342  1.00 35.83 ?  161 VAL A CG2 1 
ATOM   1306 N  N   . ASP A 1 169 ? 8.902   15.358  -6.112  1.00 45.58 ?  162 ASP A N   1 
ATOM   1307 C  CA  . ASP A 1 169 ? 9.825   15.258  -4.985  1.00 46.04 ?  162 ASP A CA  1 
ATOM   1308 C  C   . ASP A 1 169 ? 9.873   16.592  -4.259  1.00 47.11 ?  162 ASP A C   1 
ATOM   1309 O  O   . ASP A 1 169 ? 10.861  17.331  -4.362  1.00 48.96 ?  162 ASP A O   1 
ATOM   1310 C  CB  . ASP A 1 169 ? 11.225  14.857  -5.454  1.00 48.24 ?  162 ASP A CB  1 
ATOM   1311 C  CG  . ASP A 1 169 ? 11.302  13.402  -5.862  1.00 58.59 ?  162 ASP A CG  1 
ATOM   1312 O  OD1 . ASP A 1 169 ? 10.667  12.566  -5.182  1.00 59.40 ?  162 ASP A OD1 1 
ATOM   1313 O  OD2 . ASP A 1 169 ? 11.990  13.092  -6.865  1.00 65.15 -1 162 ASP A OD2 1 
ATOM   1314 N  N   . ASN A 1 170 ? 8.794   16.921  -3.544  1.00 40.21 ?  163 ASN A N   1 
ATOM   1315 C  CA  . ASN A 1 170 ? 8.670   18.256  -2.984  1.00 47.19 ?  163 ASN A CA  1 
ATOM   1316 C  C   . ASN A 1 170 ? 9.586   18.462  -1.782  1.00 50.92 ?  163 ASN A C   1 
ATOM   1317 O  O   . ASN A 1 170 ? 9.906   19.610  -1.460  1.00 50.05 ?  163 ASN A O   1 
ATOM   1318 C  CB  . ASN A 1 170 ? 7.213   18.532  -2.606  1.00 45.21 ?  163 ASN A CB  1 
ATOM   1319 C  CG  . ASN A 1 170 ? 6.651   17.501  -1.654  1.00 49.63 ?  163 ASN A CG  1 
ATOM   1320 O  OD1 . ASN A 1 170 ? 7.059   17.427  -0.492  1.00 49.63 ?  163 ASN A OD1 1 
ATOM   1321 N  ND2 . ASN A 1 170 ? 5.695   16.711  -2.129  1.00 43.12 ?  163 ASN A ND2 1 
ATOM   1322 N  N   . GLU A 1 171 ? 10.021  17.380  -1.138  1.00 54.00 ?  164 GLU A N   1 
ATOM   1323 C  CA  . GLU A 1 171 ? 10.966  17.437  -0.016  1.00 53.53 ?  164 GLU A CA  1 
ATOM   1324 C  C   . GLU A 1 171 ? 10.487  18.404  1.065   1.00 50.98 ?  164 GLU A C   1 
ATOM   1325 O  O   . GLU A 1 171 ? 11.260  19.199  1.602   1.00 58.60 ?  164 GLU A O   1 
ATOM   1326 C  CB  . GLU A 1 171 ? 12.373  17.808  -0.496  1.00 53.93 ?  164 GLU A CB  1 
ATOM   1327 C  CG  . GLU A 1 171 ? 12.824  17.043  -1.740  1.00 59.05 ?  164 GLU A CG  1 
ATOM   1328 C  CD  . GLU A 1 171 ? 14.326  17.112  -1.978  1.00 66.47 ?  164 GLU A CD  1 
ATOM   1329 O  OE1 . GLU A 1 171 ? 15.087  16.592  -1.134  1.00 71.33 ?  164 GLU A OE1 1 
ATOM   1330 O  OE2 . GLU A 1 171 ? 14.749  17.682  -3.008  1.00 72.65 -1 164 GLU A OE2 1 
ATOM   1331 N  N   . GLY A 1 172 ? 9.191   18.338  1.378   1.00 48.49 ?  165 GLY A N   1 
ATOM   1332 C  CA  . GLY A 1 172 ? 8.597   19.158  2.411   1.00 52.70 ?  165 GLY A CA  1 
ATOM   1333 C  C   . GLY A 1 172 ? 8.098   20.517  1.961   1.00 58.24 ?  165 GLY A C   1 
ATOM   1334 O  O   . GLY A 1 172 ? 7.247   21.103  2.642   1.00 61.73 ?  165 GLY A O   1 
ATOM   1335 N  N   . GLN A 1 173 ? 8.596   21.033  0.839   1.00 55.78 ?  166 GLN A N   1 
ATOM   1336 C  CA  . GLN A 1 173 ? 8.177   22.338  0.350   1.00 56.36 ?  166 GLN A CA  1 
ATOM   1337 C  C   . GLN A 1 173 ? 6.680   22.356  0.039   1.00 58.07 ?  166 GLN A C   1 
ATOM   1338 O  O   . GLN A 1 173 ? 6.035   21.317  -0.138  1.00 55.03 ?  166 GLN A O   1 
ATOM   1339 C  CB  . GLN A 1 173 ? 8.968   22.718  -0.902  1.00 59.93 ?  166 GLN A CB  1 
ATOM   1340 C  CG  . GLN A 1 173 ? 10.474  22.698  -0.715  1.00 59.15 ?  166 GLN A CG  1 
ATOM   1341 C  CD  . GLN A 1 173 ? 10.946  23.793  0.208   1.00 71.10 ?  166 GLN A CD  1 
ATOM   1342 O  OE1 . GLN A 1 173 ? 10.479  24.929  0.120   1.00 74.35 ?  166 GLN A OE1 1 
ATOM   1343 N  NE2 . GLN A 1 173 ? 11.868  23.461  1.108   1.00 73.78 ?  166 GLN A NE2 1 
ATOM   1344 N  N   . GLN A 1 174 ? 6.130   23.564  -0.019  1.00 56.87 ?  167 GLN A N   1 
ATOM   1345 C  CA  . GLN A 1 174 ? 4.747   23.779  -0.418  1.00 56.69 ?  167 GLN A CA  1 
ATOM   1346 C  C   . GLN A 1 174 ? 4.688   24.180  -1.888  1.00 52.74 ?  167 GLN A C   1 
ATOM   1347 O  O   . GLN A 1 174 ? 5.674   24.637  -2.473  1.00 48.78 ?  167 GLN A O   1 
ATOM   1348 C  CB  . GLN A 1 174 ? 4.088   24.867  0.432   1.00 61.40 ?  167 GLN A CB  1 
ATOM   1349 C  CG  . GLN A 1 174 ? 4.486   24.853  1.896   1.00 73.12 ?  167 GLN A CG  1 
ATOM   1350 C  CD  . GLN A 1 174 ? 4.333   26.217  2.543   1.00 80.98 ?  167 GLN A CD  1 
ATOM   1351 O  OE1 . GLN A 1 174 ? 5.319   26.836  2.954   1.00 85.06 ?  167 GLN A OE1 1 
ATOM   1352 N  NE2 . GLN A 1 174 ? 3.094   26.698  2.628   1.00 81.43 ?  167 GLN A NE2 1 
ATOM   1353 N  N   . PHE A 1 175 ? 3.514   24.003  -2.484  1.00 49.16 ?  168 PHE A N   1 
ATOM   1354 C  CA  . PHE A 1 175 ? 3.299   24.451  -3.853  1.00 46.71 ?  168 PHE A CA  1 
ATOM   1355 C  C   . PHE A 1 175 ? 3.021   25.949  -3.844  1.00 46.81 ?  168 PHE A C   1 
ATOM   1356 O  O   . PHE A 1 175 ? 2.082   26.403  -3.181  1.00 49.46 ?  168 PHE A O   1 
ATOM   1357 C  CB  . PHE A 1 175 ? 2.144   23.686  -4.496  1.00 45.34 ?  168 PHE A CB  1 
ATOM   1358 C  CG  . PHE A 1 175 ? 1.630   24.312  -5.763  1.00 42.16 ?  168 PHE A CG  1 
ATOM   1359 C  CD1 . PHE A 1 175 ? 2.468   24.501  -6.852  1.00 41.89 ?  168 PHE A CD1 1 
ATOM   1360 C  CD2 . PHE A 1 175 ? 0.306   24.704  -5.866  1.00 41.24 ?  168 PHE A CD2 1 
ATOM   1361 C  CE1 . PHE A 1 175 ? 1.991   25.077  -8.030  1.00 40.57 ?  168 PHE A CE1 1 
ATOM   1362 C  CE2 . PHE A 1 175 ? -0.178  25.274  -7.024  1.00 40.95 ?  168 PHE A CE2 1 
ATOM   1363 C  CZ  . PHE A 1 175 ? 0.666   25.460  -8.113  1.00 36.35 ?  168 PHE A CZ  1 
ATOM   1364 N  N   . MET A 1 176 ? 3.852   26.717  -4.562  1.00 45.42 ?  169 MET A N   1 
ATOM   1365 C  CA  . MET A 1 176 ? 3.668   28.157  -4.690  1.00 47.21 ?  169 MET A CA  1 
ATOM   1366 C  C   . MET A 1 176 ? 3.108   28.482  -6.069  1.00 45.14 ?  169 MET A C   1 
ATOM   1367 O  O   . MET A 1 176 ? 3.855   28.423  -7.063  1.00 39.59 ?  169 MET A O   1 
ATOM   1368 C  CB  . MET A 1 176 ? 4.985   28.899  -4.467  1.00 45.84 ?  169 MET A CB  1 
ATOM   1369 C  CG  . MET A 1 176 ? 5.460   28.960  -3.005  1.00 55.08 ?  169 MET A CG  1 
ATOM   1370 S  SD  . MET A 1 176 ? 4.251   29.677  -1.859  1.00 68.32 ?  169 MET A SD  1 
ATOM   1371 C  CE  . MET A 1 176 ? 3.615   31.070  -2.812  1.00 55.74 ?  169 MET A CE  1 
ATOM   1372 N  N   . PRO A 1 177 ? 1.838   28.860  -6.178  1.00 42.87 ?  170 PRO A N   1 
ATOM   1373 C  CA  . PRO A 1 177 ? 1.226   29.049  -7.497  1.00 39.85 ?  170 PRO A CA  1 
ATOM   1374 C  C   . PRO A 1 177 ? 1.685   30.330  -8.168  1.00 40.57 ?  170 PRO A C   1 
ATOM   1375 O  O   . PRO A 1 177 ? 2.025   31.318  -7.515  1.00 37.34 ?  170 PRO A O   1 
ATOM   1376 C  CB  . PRO A 1 177 ? -0.276  29.116  -7.188  1.00 39.44 ?  170 PRO A CB  1 
ATOM   1377 C  CG  . PRO A 1 177 ? -0.411  28.832  -5.699  1.00 44.16 ?  170 PRO A CG  1 
ATOM   1378 C  CD  . PRO A 1 177 ? 0.899   29.156  -5.088  1.00 41.94 ?  170 PRO A CD  1 
ATOM   1379 N  N   . TRP A 1 178 ? 1.656   30.304  -9.502  1.00 37.41 ?  171 TRP A N   1 
ATOM   1380 C  CA  . TRP A 1 178 ? 2.036   31.465  -10.294 1.00 36.19 ?  171 TRP A CA  1 
ATOM   1381 C  C   . TRP A 1 178 ? 1.063   32.615  -10.056 1.00 33.04 ?  171 TRP A C   1 
ATOM   1382 O  O   . TRP A 1 178 ? -0.125  32.412  -9.803  1.00 31.36 ?  171 TRP A O   1 
ATOM   1383 C  CB  . TRP A 1 178 ? 2.091   31.093  -11.788 1.00 33.48 ?  171 TRP A CB  1 
ATOM   1384 C  CG  . TRP A 1 178 ? 2.994   29.926  -12.019 1.00 35.90 ?  171 TRP A CG  1 
ATOM   1385 C  CD1 . TRP A 1 178 ? 4.340   29.960  -12.253 1.00 38.32 ?  171 TRP A CD1 1 
ATOM   1386 C  CD2 . TRP A 1 178 ? 2.626   28.543  -11.990 1.00 32.19 ?  171 TRP A CD2 1 
ATOM   1387 N  NE1 . TRP A 1 178 ? 4.830   28.682  -12.387 1.00 38.32 ?  171 TRP A NE1 1 
ATOM   1388 C  CE2 . TRP A 1 178 ? 3.798   27.794  -12.225 1.00 34.01 ?  171 TRP A CE2 1 
ATOM   1389 C  CE3 . TRP A 1 178 ? 1.418   27.864  -11.794 1.00 31.25 ?  171 TRP A CE3 1 
ATOM   1390 C  CZ2 . TRP A 1 178 ? 3.799   26.399  -12.262 1.00 33.21 ?  171 TRP A CZ2 1 
ATOM   1391 C  CZ3 . TRP A 1 178 ? 1.419   26.481  -11.844 1.00 28.41 ?  171 TRP A CZ3 1 
ATOM   1392 C  CH2 . TRP A 1 178 ? 2.604   25.764  -12.070 1.00 30.91 ?  171 TRP A CH2 1 
ATOM   1393 N  N   . TYR A 1 179 ? 1.587   33.843  -10.130 1.00 36.32 ?  172 TYR A N   1 
ATOM   1394 C  CA  . TYR A 1 179 ? 0.776   35.018  -9.823  1.00 33.56 ?  172 TYR A CA  1 
ATOM   1395 C  C   . TYR A 1 179 ? -0.429  35.133  -10.753 1.00 37.41 ?  172 TYR A C   1 
ATOM   1396 O  O   . TYR A 1 179 ? -1.507  35.578  -10.339 1.00 33.06 ?  172 TYR A O   1 
ATOM   1397 C  CB  . TYR A 1 179 ? 1.649   36.275  -9.894  1.00 38.64 ?  172 TYR A CB  1 
ATOM   1398 C  CG  . TYR A 1 179 ? 2.657   36.367  -8.751  1.00 40.87 ?  172 TYR A CG  1 
ATOM   1399 C  CD1 . TYR A 1 179 ? 2.227   36.403  -7.430  1.00 37.48 ?  172 TYR A CD1 1 
ATOM   1400 C  CD2 . TYR A 1 179 ? 4.031   36.421  -8.993  1.00 41.00 ?  172 TYR A CD2 1 
ATOM   1401 C  CE1 . TYR A 1 179 ? 3.123   36.490  -6.385  1.00 37.08 ?  172 TYR A CE1 1 
ATOM   1402 C  CE2 . TYR A 1 179 ? 4.944   36.511  -7.947  1.00 42.11 ?  172 TYR A CE2 1 
ATOM   1403 C  CZ  . TYR A 1 179 ? 4.475   36.548  -6.637  1.00 43.57 ?  172 TYR A CZ  1 
ATOM   1404 O  OH  . TYR A 1 179 ? 5.353   36.631  -5.568  1.00 42.88 ?  172 TYR A OH  1 
ATOM   1405 N  N   . LYS A 1 180 ? -0.277  34.726  -12.013 1.00 31.47 ?  173 LYS A N   1 
ATOM   1406 C  CA  . LYS A 1 180 ? -1.383  34.785  -12.958 1.00 35.29 ?  173 LYS A CA  1 
ATOM   1407 C  C   . LYS A 1 180 ? -2.234  33.517  -12.964 1.00 37.12 ?  173 LYS A C   1 
ATOM   1408 O  O   . LYS A 1 180 ? -3.030  33.329  -13.895 1.00 35.41 ?  173 LYS A O   1 
ATOM   1409 C  CB  . LYS A 1 180 ? -0.859  35.072  -14.372 1.00 39.74 ?  173 LYS A CB  1 
ATOM   1410 C  CG  . LYS A 1 180 ? -0.634  36.559  -14.657 1.00 45.26 ?  173 LYS A CG  1 
ATOM   1411 C  CD  . LYS A 1 180 ? -0.349  36.828  -16.140 1.00 53.28 ?  173 LYS A CD  1 
ATOM   1412 C  CE  . LYS A 1 180 ? -0.132  38.315  -16.426 1.00 63.08 ?  173 LYS A CE  1 
ATOM   1413 N  NZ  . LYS A 1 180 ? 1.041   38.898  -15.705 1.00 67.51 1  173 LYS A NZ  1 
ATOM   1414 N  N   . PHE A 1 181 ? -2.096  32.655  -11.949 1.00 37.79 ?  174 PHE A N   1 
ATOM   1415 C  CA  . PHE A 1 181 ? -2.790  31.368  -11.973 1.00 37.13 ?  174 PHE A CA  1 
ATOM   1416 C  C   . PHE A 1 181 ? -4.281  31.542  -12.224 1.00 36.98 ?  174 PHE A C   1 
ATOM   1417 O  O   . PHE A 1 181 ? -4.857  30.892  -13.105 1.00 33.32 ?  174 PHE A O   1 
ATOM   1418 C  CB  . PHE A 1 181 ? -2.571  30.596  -10.667 1.00 33.56 ?  174 PHE A CB  1 
ATOM   1419 C  CG  . PHE A 1 181 ? -3.190  29.216  -10.682 1.00 33.92 ?  174 PHE A CG  1 
ATOM   1420 C  CD1 . PHE A 1 181 ? -4.523  29.028  -10.342 1.00 34.73 ?  174 PHE A CD1 1 
ATOM   1421 C  CD2 . PHE A 1 181 ? -2.447  28.121  -11.079 1.00 37.33 ?  174 PHE A CD2 1 
ATOM   1422 C  CE1 . PHE A 1 181 ? -5.101  27.770  -10.379 1.00 37.92 ?  174 PHE A CE1 1 
ATOM   1423 C  CE2 . PHE A 1 181 ? -3.019  26.853  -11.127 1.00 36.73 ?  174 PHE A CE2 1 
ATOM   1424 C  CZ  . PHE A 1 181 ? -4.350  26.677  -10.770 1.00 35.49 ?  174 PHE A CZ  1 
ATOM   1425 N  N   . ASP A 1 182 ? -4.920  32.436  -11.467 1.00 39.61 ?  175 ASP A N   1 
ATOM   1426 C  CA  . ASP A 1 182 ? -6.376  32.543  -11.509 1.00 38.50 ?  175 ASP A CA  1 
ATOM   1427 C  C   . ASP A 1 182 ? -6.868  33.020  -12.873 1.00 36.33 ?  175 ASP A C   1 
ATOM   1428 O  O   . ASP A 1 182 ? -7.821  32.462  -13.427 1.00 40.53 ?  175 ASP A O   1 
ATOM   1429 C  CB  . ASP A 1 182 ? -6.876  33.478  -10.400 1.00 46.28 ?  175 ASP A CB  1 
ATOM   1430 C  CG  . ASP A 1 182 ? -6.828  32.838  -9.013  1.00 51.18 ?  175 ASP A CG  1 
ATOM   1431 O  OD1 . ASP A 1 182 ? -6.635  31.604  -8.916  1.00 50.60 ?  175 ASP A OD1 1 
ATOM   1432 O  OD2 . ASP A 1 182 ? -7.001  33.579  -8.014  1.00 58.09 -1 175 ASP A OD2 1 
ATOM   1433 N  N   . GLU A 1 183 ? -6.254  34.064  -13.435 1.00 36.96 ?  176 GLU A N   1 
ATOM   1434 C  CA  . GLU A 1 183 ? -6.778  34.525  -14.718 1.00 40.09 ?  176 GLU A CA  1 
ATOM   1435 C  C   . GLU A 1 183 ? -6.382  33.589  -15.856 1.00 32.44 ?  176 GLU A C   1 
ATOM   1436 O  O   . GLU A 1 183 ? -7.099  33.501  -16.855 1.00 33.99 ?  176 GLU A O   1 
ATOM   1437 C  CB  . GLU A 1 183 ? -6.326  35.957  -15.028 1.00 41.61 ?  176 GLU A CB  1 
ATOM   1438 C  CG  . GLU A 1 183 ? -4.856  36.125  -15.356 1.00 44.79 ?  176 GLU A CG  1 
ATOM   1439 C  CD  . GLU A 1 183 ? -4.420  37.586  -15.319 1.00 55.20 ?  176 GLU A CD  1 
ATOM   1440 O  OE1 . GLU A 1 183 ? -5.027  38.378  -14.553 1.00 59.93 ?  176 GLU A OE1 1 
ATOM   1441 O  OE2 . GLU A 1 183 ? -3.474  37.937  -16.056 1.00 61.09 -1 176 GLU A OE2 1 
ATOM   1442 N  N   . ASN A 1 184 ? -5.250  32.897  -15.732 1.00 33.63 ?  177 ASN A N   1 
ATOM   1443 C  CA  . ASN A 1 184 ? -4.910  31.885  -16.725 1.00 34.56 ?  177 ASN A CA  1 
ATOM   1444 C  C   . ASN A 1 184 ? -5.925  30.759  -16.708 1.00 29.62 ?  177 ASN A C   1 
ATOM   1445 O  O   . ASN A 1 184 ? -6.414  30.334  -17.761 1.00 33.83 ?  177 ASN A O   1 
ATOM   1446 C  CB  . ASN A 1 184 ? -3.507  31.352  -16.475 1.00 31.84 ?  177 ASN A CB  1 
ATOM   1447 C  CG  . ASN A 1 184 ? -2.454  32.315  -16.933 1.00 30.21 ?  177 ASN A CG  1 
ATOM   1448 O  OD1 . ASN A 1 184 ? -2.752  33.253  -17.655 1.00 28.89 ?  177 ASN A OD1 1 
ATOM   1449 N  ND2 . ASN A 1 184 ? -1.223  32.090  -16.524 1.00 33.51 ?  177 ASN A ND2 1 
ATOM   1450 N  N   . TYR A 1 185 ? -6.269  30.275  -15.511 1.00 32.40 ?  178 TYR A N   1 
ATOM   1451 C  CA  . TYR A 1 185 ? -7.273  29.225  -15.402 1.00 34.90 ?  178 TYR A CA  1 
ATOM   1452 C  C   . TYR A 1 185 ? -8.587  29.665  -16.039 1.00 36.47 ?  178 TYR A C   1 
ATOM   1453 O  O   . TYR A 1 185 ? -9.208  28.913  -16.804 1.00 33.77 ?  178 TYR A O   1 
ATOM   1454 C  CB  . TYR A 1 185 ? -7.487  28.842  -13.937 1.00 30.10 ?  178 TYR A CB  1 
ATOM   1455 C  CG  . TYR A 1 185 ? -8.598  27.834  -13.785 1.00 37.03 ?  178 TYR A CG  1 
ATOM   1456 C  CD1 . TYR A 1 185 ? -8.358  26.475  -13.976 1.00 32.54 ?  178 TYR A CD1 1 
ATOM   1457 C  CD2 . TYR A 1 185 ? -9.893  28.238  -13.487 1.00 37.68 ?  178 TYR A CD2 1 
ATOM   1458 C  CE1 . TYR A 1 185 ? -9.375  25.555  -13.865 1.00 35.85 ?  178 TYR A CE1 1 
ATOM   1459 C  CE2 . TYR A 1 185 ? -10.916 27.324  -13.382 1.00 41.83 ?  178 TYR A CE2 1 
ATOM   1460 C  CZ  . TYR A 1 185 ? -10.651 25.983  -13.568 1.00 38.23 ?  178 TYR A CZ  1 
ATOM   1461 O  OH  . TYR A 1 185 ? -11.667 25.068  -13.453 1.00 40.62 ?  178 TYR A OH  1 
ATOM   1462 N  N   . ALA A 1 186 ? -9.018  30.893  -15.746 1.00 36.51 ?  179 ALA A N   1 
ATOM   1463 C  CA  . ALA A 1 186 ? -10.300 31.360  -16.260 1.00 39.43 ?  179 ALA A CA  1 
ATOM   1464 C  C   . ALA A 1 186 ? -10.301 31.428  -17.780 1.00 32.98 ?  179 ALA A C   1 
ATOM   1465 O  O   . ALA A 1 186 ? -11.295 31.074  -18.425 1.00 41.00 ?  179 ALA A O   1 
ATOM   1466 C  CB  . ALA A 1 186 ? -10.647 32.723  -15.651 1.00 42.65 ?  179 ALA A CB  1 
ATOM   1467 N  N   . PHE A 1 187 ? -9.208  31.896  -18.379 1.00 35.24 ?  180 PHE A N   1 
ATOM   1468 C  CA  . PHE A 1 187 ? -9.145  31.929  -19.832 1.00 32.75 ?  180 PHE A CA  1 
ATOM   1469 C  C   . PHE A 1 187 ? -9.149  30.522  -20.414 1.00 36.57 ?  180 PHE A C   1 
ATOM   1470 O  O   . PHE A 1 187 ? -9.838  30.256  -21.401 1.00 31.23 ?  180 PHE A O   1 
ATOM   1471 C  CB  . PHE A 1 187 ? -7.901  32.681  -20.295 1.00 36.08 ?  180 PHE A CB  1 
ATOM   1472 C  CG  . PHE A 1 187 ? -7.703  32.662  -21.775 1.00 36.82 ?  180 PHE A CG  1 
ATOM   1473 C  CD1 . PHE A 1 187 ? -8.381  33.554  -22.592 1.00 42.65 ?  180 PHE A CD1 1 
ATOM   1474 C  CD2 . PHE A 1 187 ? -6.843  31.743  -22.361 1.00 38.69 ?  180 PHE A CD2 1 
ATOM   1475 C  CE1 . PHE A 1 187 ? -8.206  33.533  -23.957 1.00 40.64 ?  180 PHE A CE1 1 
ATOM   1476 C  CE2 . PHE A 1 187 ? -6.666  31.719  -23.729 1.00 42.49 ?  180 PHE A CE2 1 
ATOM   1477 C  CZ  . PHE A 1 187 ? -7.350  32.622  -24.528 1.00 41.29 ?  180 PHE A CZ  1 
ATOM   1478 N  N   . LEU A 1 188 ? -8.373  29.615  -19.824 1.00 32.92 ?  181 LEU A N   1 
ATOM   1479 C  CA  . LEU A 1 188 ? -8.306  28.251  -20.344 1.00 32.06 ?  181 LEU A CA  1 
ATOM   1480 C  C   . LEU A 1 188 ? -9.648  27.538  -20.216 1.00 31.41 ?  181 LEU A C   1 
ATOM   1481 O  O   . LEU A 1 188 ? -10.069 26.829  -21.140 1.00 30.39 ?  181 LEU A O   1 
ATOM   1482 C  CB  . LEU A 1 188 ? -7.200  27.485  -19.616 1.00 24.54 ?  181 LEU A CB  1 
ATOM   1483 C  CG  . LEU A 1 188 ? -5.773  27.881  -20.003 1.00 25.88 ?  181 LEU A CG  1 
ATOM   1484 C  CD1 . LEU A 1 188 ? -4.767  27.379  -18.965 1.00 26.89 ?  181 LEU A CD1 1 
ATOM   1485 C  CD2 . LEU A 1 188 ? -5.412  27.354  -21.400 1.00 26.53 ?  181 LEU A CD2 1 
ATOM   1486 N  N   . HIS A 1 189 ? -10.337 27.720  -19.087 1.00 29.83 ?  182 HIS A N   1 
ATOM   1487 C  CA  . HIS A 1 189 ? -11.617 27.047  -18.872 1.00 33.81 ?  182 HIS A CA  1 
ATOM   1488 C  C   . HIS A 1 189 ? -12.657 27.523  -19.882 1.00 37.14 ?  182 HIS A C   1 
ATOM   1489 O  O   . HIS A 1 189 ? -13.461 26.727  -20.384 1.00 36.99 ?  182 HIS A O   1 
ATOM   1490 C  CB  . HIS A 1 189 ? -12.078 27.287  -17.426 1.00 38.72 ?  182 HIS A CB  1 
ATOM   1491 C  CG  . HIS A 1 189 ? -13.385 26.640  -17.071 1.00 40.96 ?  182 HIS A CG  1 
ATOM   1492 N  ND1 . HIS A 1 189 ? -14.604 27.172  -17.432 1.00 43.61 ?  182 HIS A ND1 1 
ATOM   1493 C  CD2 . HIS A 1 189 ? -13.662 25.524  -16.356 1.00 42.19 ?  182 HIS A CD2 1 
ATOM   1494 C  CE1 . HIS A 1 189 ? -15.574 26.401  -16.975 1.00 41.71 ?  182 HIS A CE1 1 
ATOM   1495 N  NE2 . HIS A 1 189 ? -15.030 25.395  -16.316 1.00 47.26 ?  182 HIS A NE2 1 
ATOM   1496 N  N   . ARG A 1 190 ? -12.635 28.816  -20.210 1.00 37.47 ?  183 ARG A N   1 
ATOM   1497 C  CA  . ARG A 1 190 ? -13.576 29.356  -21.184 1.00 38.14 ?  183 ARG A CA  1 
ATOM   1498 C  C   . ARG A 1 190 ? -13.260 28.857  -22.587 1.00 36.01 ?  183 ARG A C   1 
ATOM   1499 O  O   . ARG A 1 190 ? -14.169 28.547  -23.365 1.00 37.38 ?  183 ARG A O   1 
ATOM   1500 C  CB  . ARG A 1 190 ? -13.553 30.887  -21.126 1.00 41.62 ?  183 ARG A CB  1 
ATOM   1501 C  CG  . ARG A 1 190 ? -14.309 31.594  -22.246 1.00 44.69 ?  183 ARG A CG  1 
ATOM   1502 C  CD  . ARG A 1 190 ? -14.580 33.078  -21.898 1.00 58.65 ?  183 ARG A CD  1 
ATOM   1503 N  NE  . ARG A 1 190 ? -13.358 33.823  -21.579 1.00 55.77 ?  183 ARG A NE  1 
ATOM   1504 C  CZ  . ARG A 1 190 ? -12.948 34.106  -20.342 1.00 56.94 ?  183 ARG A CZ  1 
ATOM   1505 N  NH1 . ARG A 1 190 ? -13.668 33.717  -19.291 1.00 58.09 1  183 ARG A NH1 1 
ATOM   1506 N  NH2 . ARG A 1 190 ? -11.815 34.776  -20.148 1.00 56.20 ?  183 ARG A NH2 1 
ATOM   1507 N  N   . THR A 1 191 ? -11.973 28.772  -22.927 1.00 33.46 ?  184 THR A N   1 
ATOM   1508 C  CA  . THR A 1 191 ? -11.574 28.284  -24.246 1.00 33.37 ?  184 THR A CA  1 
ATOM   1509 C  C   . THR A 1 191 ? -11.923 26.811  -24.422 1.00 32.68 ?  184 THR A C   1 
ATOM   1510 O  O   . THR A 1 191 ? -12.376 26.392  -25.492 1.00 32.24 ?  184 THR A O   1 
ATOM   1511 C  CB  . THR A 1 191 ? -10.076 28.498  -24.435 1.00 35.67 ?  184 THR A CB  1 
ATOM   1512 O  OG1 . THR A 1 191 ? -9.766  29.878  -24.203 1.00 37.48 ?  184 THR A OG1 1 
ATOM   1513 C  CG2 . THR A 1 191 ? -9.640  28.111  -25.824 1.00 36.23 ?  184 THR A CG2 1 
ATOM   1514 N  N   . LEU A 1 192 ? -11.703 26.004  -23.387 1.00 29.07 ?  185 LEU A N   1 
ATOM   1515 C  CA  . LEU A 1 192 ? -12.043 24.594  -23.500 1.00 31.79 ?  185 LEU A CA  1 
ATOM   1516 C  C   . LEU A 1 192 ? -13.551 24.410  -23.624 1.00 33.53 ?  185 LEU A C   1 
ATOM   1517 O  O   . LEU A 1 192 ? -14.021 23.630  -24.461 1.00 32.20 ?  185 LEU A O   1 
ATOM   1518 C  CB  . LEU A 1 192 ? -11.479 23.828  -22.307 1.00 27.99 ?  185 LEU A CB  1 
ATOM   1519 C  CG  . LEU A 1 192 ? -11.823 22.341  -22.291 1.00 27.91 ?  185 LEU A CG  1 
ATOM   1520 C  CD1 . LEU A 1 192 ? -11.312 21.665  -23.568 1.00 28.30 ?  185 LEU A CD1 1 
ATOM   1521 C  CD2 . LEU A 1 192 ? -11.268 21.676  -21.040 1.00 30.53 ?  185 LEU A CD2 1 
ATOM   1522 N  N   . LYS A 1 193 ? -14.327 25.143  -22.827 1.00 35.57 ?  186 LYS A N   1 
ATOM   1523 C  CA  . LYS A 1 193 ? -15.780 25.091  -22.960 1.00 39.59 ?  186 LYS A CA  1 
ATOM   1524 C  C   . LYS A 1 193 ? -16.220 25.360  -24.398 1.00 40.99 ?  186 LYS A C   1 
ATOM   1525 O  O   . LYS A 1 193 ? -17.131 24.703  -24.913 1.00 46.87 ?  186 LYS A O   1 
ATOM   1526 C  CB  . LYS A 1 193 ? -16.418 26.093  -21.997 1.00 41.09 ?  186 LYS A CB  1 
ATOM   1527 C  CG  . LYS A 1 193 ? -17.932 26.123  -22.021 1.00 50.10 ?  186 LYS A CG  1 
ATOM   1528 C  CD  . LYS A 1 193 ? -18.466 27.194  -21.069 1.00 53.15 ?  186 LYS A CD  1 
ATOM   1529 C  CE  . LYS A 1 193 ? -18.145 26.864  -19.618 1.00 54.59 ?  186 LYS A CE  1 
ATOM   1530 N  NZ  . LYS A 1 193 ? -18.975 25.733  -19.089 1.00 62.89 1  186 LYS A NZ  1 
ATOM   1531 N  N   . GLU A 1 194 ? -15.567 26.304  -25.074 1.00 41.79 ?  187 GLU A N   1 
ATOM   1532 C  CA  . GLU A 1 194 ? -15.907 26.586  -26.465 1.00 41.02 ?  187 GLU A CA  1 
ATOM   1533 C  C   . GLU A 1 194 ? -15.512 25.431  -27.379 1.00 45.85 ?  187 GLU A C   1 
ATOM   1534 O  O   . GLU A 1 194 ? -16.258 25.067  -28.297 1.00 45.01 ?  187 GLU A O   1 
ATOM   1535 C  CB  . GLU A 1 194 ? -15.224 27.880  -26.899 1.00 45.69 ?  187 GLU A CB  1 
ATOM   1536 C  CG  . GLU A 1 194 ? -15.256 28.150  -28.384 1.00 47.29 ?  187 GLU A CG  1 
ATOM   1537 C  CD  . GLU A 1 194 ? -14.078 29.000  -28.831 1.00 60.34 ?  187 GLU A CD  1 
ATOM   1538 O  OE1 . GLU A 1 194 ? -13.083 29.078  -28.071 1.00 61.30 ?  187 GLU A OE1 1 
ATOM   1539 O  OE2 . GLU A 1 194 ? -14.143 29.585  -29.938 1.00 63.67 -1 187 GLU A OE2 1 
ATOM   1540 N  N   . ILE A 1 195 ? -14.340 24.845  -27.132 1.00 35.88 ?  188 ILE A N   1 
ATOM   1541 C  CA  . ILE A 1 195 ? -13.831 23.722  -27.910 1.00 37.33 ?  188 ILE A CA  1 
ATOM   1542 C  C   . ILE A 1 195 ? -14.746 22.503  -27.803 1.00 37.46 ?  188 ILE A C   1 
ATOM   1543 O  O   . ILE A 1 195 ? -14.886 21.735  -28.763 1.00 40.00 ?  188 ILE A O   1 
ATOM   1544 C  CB  . ILE A 1 195 ? -12.392 23.420  -27.432 1.00 33.90 ?  188 ILE A CB  1 
ATOM   1545 C  CG1 . ILE A 1 195 ? -11.416 24.440  -28.012 1.00 36.24 ?  188 ILE A CG1 1 
ATOM   1546 C  CG2 . ILE A 1 195 ? -11.976 21.991  -27.737 1.00 35.83 ?  188 ILE A CG2 1 
ATOM   1547 C  CD1 . ILE A 1 195 ? -9.964  24.158  -27.660 1.00 36.74 ?  188 ILE A CD1 1 
ATOM   1548 N  N   . LEU A 1 196 ? -15.383 22.306  -26.654 1.00 37.89 ?  189 LEU A N   1 
ATOM   1549 C  CA  . LEU A 1 196 ? -16.236 21.148  -26.410 1.00 40.05 ?  189 LEU A CA  1 
ATOM   1550 C  C   . LEU A 1 196 ? -17.707 21.410  -26.709 1.00 48.78 ?  189 LEU A C   1 
ATOM   1551 O  O   . LEU A 1 196 ? -18.531 20.522  -26.463 1.00 52.93 ?  189 LEU A O   1 
ATOM   1552 C  CB  . LEU A 1 196 ? -16.104 20.688  -24.951 1.00 35.50 ?  189 LEU A CB  1 
ATOM   1553 C  CG  . LEU A 1 196 ? -14.710 20.308  -24.460 1.00 36.92 ?  189 LEU A CG  1 
ATOM   1554 C  CD1 . LEU A 1 196 ? -14.765 19.869  -23.012 1.00 36.07 ?  189 LEU A CD1 1 
ATOM   1555 C  CD2 . LEU A 1 196 ? -14.107 19.215  -25.355 1.00 31.58 ?  189 LEU A CD2 1 
ATOM   1556 N  N   . ARG A 1 197 ? -18.042 22.591  -27.238 1.00 48.40 ?  190 ARG A N   1 
ATOM   1557 C  CA  . ARG A 1 197 ? -19.411 23.145  -27.356 1.00 54.25 ?  190 ARG A CA  1 
ATOM   1558 C  C   . ARG A 1 197 ? -19.849 23.738  -26.019 1.00 55.66 ?  190 ARG A C   1 
ATOM   1559 O  O   . ARG A 1 197 ? -19.715 23.108  -24.962 1.00 61.51 ?  190 ARG A O   1 
ATOM   1560 C  CB  . ARG A 1 197 ? -20.465 22.117  -27.819 1.00 55.42 ?  190 ARG A CB  1 
ATOM   1561 C  CG  . ARG A 1 197 ? -20.091 21.274  -29.030 1.00 59.79 ?  190 ARG A CG  1 
ATOM   1562 C  CD  . ARG A 1 197 ? -19.228 22.040  -30.000 1.00 56.97 ?  190 ARG A CD  1 
ATOM   1563 N  NE  . ARG A 1 197 ? -19.012 21.299  -31.235 1.00 64.23 ?  190 ARG A NE  1 
ATOM   1564 C  CZ  . ARG A 1 197 ? -17.981 21.511  -32.041 1.00 62.19 ?  190 ARG A CZ  1 
ATOM   1565 N  NH1 . ARG A 1 197 ? -17.080 22.426  -31.705 1.00 65.31 1  190 ARG A NH1 1 
ATOM   1566 N  NH2 . ARG A 1 197 ? -17.838 20.809  -33.160 1.00 59.12 ?  190 ARG A NH2 1 
ATOM   1567 N  N   . ASN B 1 14  ? -43.733 55.245  -11.342 1.00 54.76 ?  7   ASN B N   1 
ATOM   1568 C  CA  . ASN B 1 14  ? -42.895 55.110  -10.154 1.00 51.11 ?  7   ASN B CA  1 
ATOM   1569 C  C   . ASN B 1 14  ? -41.504 54.504  -10.463 1.00 43.69 ?  7   ASN B C   1 
ATOM   1570 O  O   . ASN B 1 14  ? -40.497 55.018  -9.973  1.00 50.00 ?  7   ASN B O   1 
ATOM   1571 C  CB  . ASN B 1 14  ? -43.626 54.290  -9.098  1.00 54.04 ?  7   ASN B CB  1 
ATOM   1572 C  CG  . ASN B 1 14  ? -42.856 54.197  -7.819  1.00 54.02 ?  7   ASN B CG  1 
ATOM   1573 O  OD1 . ASN B 1 14  ? -42.150 55.132  -7.439  1.00 60.19 ?  7   ASN B OD1 1 
ATOM   1574 N  ND2 . ASN B 1 14  ? -42.978 53.063  -7.141  1.00 47.35 ?  7   ASN B ND2 1 
ATOM   1575 N  N   . PRO B 1 15  ? -41.431 53.433  -11.255 1.00 38.88 ?  8   PRO B N   1 
ATOM   1576 C  CA  . PRO B 1 15  ? -40.153 53.074  -11.875 1.00 37.94 ?  8   PRO B CA  1 
ATOM   1577 C  C   . PRO B 1 15  ? -39.920 53.887  -13.141 1.00 41.02 ?  8   PRO B C   1 
ATOM   1578 O  O   . PRO B 1 15  ? -40.854 54.376  -13.773 1.00 38.45 ?  8   PRO B O   1 
ATOM   1579 C  CB  . PRO B 1 15  ? -40.328 51.590  -12.211 1.00 33.84 ?  8   PRO B CB  1 
ATOM   1580 C  CG  . PRO B 1 15  ? -41.773 51.470  -12.505 1.00 39.25 ?  8   PRO B CG  1 
ATOM   1581 C  CD  . PRO B 1 15  ? -42.452 52.396  -11.526 1.00 41.02 ?  8   PRO B CD  1 
ATOM   1582 N  N   . MET B 1 16  ? -38.647 54.021  -13.504 1.00 35.97 ?  9   MET B N   1 
ATOM   1583 C  CA  . MET B 1 16  ? -38.268 54.663  -14.758 1.00 36.39 ?  9   MET B CA  1 
ATOM   1584 C  C   . MET B 1 16  ? -38.201 53.636  -15.890 1.00 33.87 ?  9   MET B C   1 
ATOM   1585 O  O   . MET B 1 16  ? -38.284 52.426  -15.677 1.00 33.91 ?  9   MET B O   1 
ATOM   1586 C  CB  . MET B 1 16  ? -36.918 55.358  -14.607 1.00 40.98 ?  9   MET B CB  1 
ATOM   1587 C  CG  . MET B 1 16  ? -36.808 56.266  -13.400 1.00 46.78 ?  9   MET B CG  1 
ATOM   1588 S  SD  . MET B 1 16  ? -35.127 56.309  -12.731 1.00 57.63 ?  9   MET B SD  1 
ATOM   1589 C  CE  . MET B 1 16  ? -34.166 56.285  -14.240 1.00 38.66 ?  9   MET B CE  1 
ATOM   1590 N  N   . GLU B 1 17  ? -38.064 54.126  -17.121 1.00 36.79 ?  10  GLU B N   1 
ATOM   1591 C  CA  . GLU B 1 17  ? -37.866 53.186  -18.216 1.00 34.90 ?  10  GLU B CA  1 
ATOM   1592 C  C   . GLU B 1 17  ? -36.403 52.800  -18.377 1.00 33.18 ?  10  GLU B C   1 
ATOM   1593 O  O   . GLU B 1 17  ? -36.097 51.626  -18.601 1.00 38.70 ?  10  GLU B O   1 
ATOM   1594 C  CB  . GLU B 1 17  ? -38.396 53.770  -19.530 1.00 38.56 ?  10  GLU B CB  1 
ATOM   1595 C  CG  . GLU B 1 17  ? -39.897 53.902  -19.549 1.00 45.46 ?  10  GLU B CG  1 
ATOM   1596 C  CD  . GLU B 1 17  ? -40.407 54.530  -20.826 1.00 60.04 ?  10  GLU B CD  1 
ATOM   1597 O  OE1 . GLU B 1 17  ? -39.903 55.611  -21.205 1.00 59.88 ?  10  GLU B OE1 1 
ATOM   1598 O  OE2 . GLU B 1 17  ? -41.315 53.937  -21.450 1.00 64.78 -1 10  GLU B OE2 1 
ATOM   1599 N  N   . ARG B 1 18  ? -35.498 53.766  -18.262 1.00 36.25 ?  11  ARG B N   1 
ATOM   1600 C  CA  . ARG B 1 18  ? -34.084 53.552  -18.537 1.00 36.72 ?  11  ARG B CA  1 
ATOM   1601 C  C   . ARG B 1 18  ? -33.267 54.517  -17.694 1.00 38.21 ?  11  ARG B C   1 
ATOM   1602 O  O   . ARG B 1 18  ? -33.769 55.546  -17.235 1.00 42.86 ?  11  ARG B O   1 
ATOM   1603 C  CB  . ARG B 1 18  ? -33.756 53.756  -20.031 1.00 41.08 ?  11  ARG B CB  1 
ATOM   1604 C  CG  . ARG B 1 18  ? -34.336 52.711  -20.993 1.00 40.25 ?  11  ARG B CG  1 
ATOM   1605 C  CD  . ARG B 1 18  ? -34.171 53.141  -22.468 1.00 41.94 ?  11  ARG B CD  1 
ATOM   1606 N  NE  . ARG B 1 18  ? -33.343 52.214  -23.236 1.00 49.59 ?  11  ARG B NE  1 
ATOM   1607 C  CZ  . ARG B 1 18  ? -33.809 51.197  -23.957 1.00 45.73 ?  11  ARG B CZ  1 
ATOM   1608 N  NH1 . ARG B 1 18  ? -35.110 50.958  -24.032 1.00 45.71 1  11  ARG B NH1 1 
ATOM   1609 N  NH2 . ARG B 1 18  ? -32.964 50.413  -24.602 1.00 48.36 ?  11  ARG B NH2 1 
ATOM   1610 N  N   . MET B 1 19  ? -31.995 54.185  -17.499 1.00 38.10 ?  12  MET B N   1 
ATOM   1611 C  CA  . MET B 1 19  ? -31.052 55.095  -16.864 1.00 37.80 ?  12  MET B CA  1 
ATOM   1612 C  C   . MET B 1 19  ? -30.072 55.626  -17.909 1.00 39.74 ?  12  MET B C   1 
ATOM   1613 O  O   . MET B 1 19  ? -29.893 55.042  -18.979 1.00 40.94 ?  12  MET B O   1 
ATOM   1614 C  CB  . MET B 1 19  ? -30.300 54.402  -15.712 1.00 39.18 ?  12  MET B CB  1 
ATOM   1615 C  CG  . MET B 1 19  ? -29.263 53.389  -16.163 1.00 39.69 ?  12  MET B CG  1 
ATOM   1616 S  SD  . MET B 1 19  ? -28.588 52.342  -14.842 1.00 38.76 ?  12  MET B SD  1 
ATOM   1617 C  CE  . MET B 1 19  ? -29.657 50.923  -14.974 1.00 32.42 ?  12  MET B CE  1 
ATOM   1618 N  N   . ASP B 1 20  ? -29.449 56.758  -17.608 1.00 41.17 ?  13  ASP B N   1 
ATOM   1619 C  CA  . ASP B 1 20  ? -28.510 57.290  -18.580 1.00 44.74 ?  13  ASP B CA  1 
ATOM   1620 C  C   . ASP B 1 20  ? -27.187 56.526  -18.504 1.00 47.64 ?  13  ASP B C   1 
ATOM   1621 O  O   . ASP B 1 20  ? -26.941 55.744  -17.578 1.00 41.70 ?  13  ASP B O   1 
ATOM   1622 C  CB  . ASP B 1 20  ? -28.305 58.793  -18.374 1.00 44.24 ?  13  ASP B CB  1 
ATOM   1623 C  CG  . ASP B 1 20  ? -27.864 59.137  -16.973 1.00 52.99 ?  13  ASP B CG  1 
ATOM   1624 O  OD1 . ASP B 1 20  ? -26.778 58.678  -16.554 1.00 52.47 ?  13  ASP B OD1 1 
ATOM   1625 O  OD2 . ASP B 1 20  ? -28.590 59.889  -16.287 1.00 63.43 -1 13  ASP B OD2 1 
ATOM   1626 N  N   . ARG B 1 21  ? -26.328 56.758  -19.506 1.00 39.07 ?  14  ARG B N   1 
ATOM   1627 C  CA  . ARG B 1 21  ? -25.078 56.003  -19.624 1.00 42.22 ?  14  ARG B CA  1 
ATOM   1628 C  C   . ARG B 1 21  ? -24.145 56.252  -18.443 1.00 41.80 ?  14  ARG B C   1 
ATOM   1629 O  O   . ARG B 1 21  ? -23.487 55.322  -17.960 1.00 39.28 ?  14  ARG B O   1 
ATOM   1630 C  CB  . ARG B 1 21  ? -24.361 56.360  -20.930 1.00 45.81 ?  14  ARG B CB  1 
ATOM   1631 C  CG  . ARG B 1 21  ? -25.115 55.968  -22.195 1.00 48.89 ?  14  ARG B CG  1 
ATOM   1632 C  CD  . ARG B 1 21  ? -24.274 56.257  -23.443 1.00 51.80 ?  14  ARG B CD  1 
ATOM   1633 N  NE  . ARG B 1 21  ? -23.767 57.629  -23.448 1.00 55.27 ?  14  ARG B NE  1 
ATOM   1634 C  CZ  . ARG B 1 21  ? -24.409 58.657  -23.989 1.00 57.73 ?  14  ARG B CZ  1 
ATOM   1635 N  NH1 . ARG B 1 21  ? -25.583 58.464  -24.568 1.00 56.79 1  14  ARG B NH1 1 
ATOM   1636 N  NH2 . ARG B 1 21  ? -23.884 59.876  -23.952 1.00 57.67 ?  14  ARG B NH2 1 
ATOM   1637 N  N   . ASP B 1 22  ? -24.034 57.509  -18.004 1.00 40.25 ?  15  ASP B N   1 
ATOM   1638 C  CA  . ASP B 1 22  ? -23.184 57.834  -16.861 1.00 43.87 ?  15  ASP B CA  1 
ATOM   1639 C  C   . ASP B 1 22  ? -23.604 57.044  -15.630 1.00 40.86 ?  15  ASP B C   1 
ATOM   1640 O  O   . ASP B 1 22  ? -22.767 56.442  -14.950 1.00 37.29 ?  15  ASP B O   1 
ATOM   1641 C  CB  . ASP B 1 22  ? -23.243 59.335  -16.563 1.00 47.22 ?  15  ASP B CB  1 
ATOM   1642 C  CG  . ASP B 1 22  ? -22.327 60.159  -17.463 1.00 57.09 ?  15  ASP B CG  1 
ATOM   1643 O  OD1 . ASP B 1 22  ? -21.722 59.588  -18.398 1.00 55.87 ?  15  ASP B OD1 1 
ATOM   1644 O  OD2 . ASP B 1 22  ? -22.224 61.386  -17.234 1.00 59.22 -1 15  ASP B OD2 1 
ATOM   1645 N  N   . THR B 1 23  ? -24.907 57.040  -15.335 1.00 39.95 ?  16  THR B N   1 
ATOM   1646 C  CA  . THR B 1 23  ? -25.422 56.296  -14.191 1.00 38.55 ?  16  THR B CA  1 
ATOM   1647 C  C   . THR B 1 23  ? -25.069 54.817  -14.290 1.00 35.07 ?  16  THR B C   1 
ATOM   1648 O  O   . THR B 1 23  ? -24.569 54.223  -13.326 1.00 34.56 ?  16  THR B O   1 
ATOM   1649 C  CB  . THR B 1 23  ? -26.932 56.493  -14.087 1.00 38.72 ?  16  THR B CB  1 
ATOM   1650 O  OG1 . THR B 1 23  ? -27.205 57.876  -13.839 1.00 43.61 ?  16  THR B OG1 1 
ATOM   1651 C  CG2 . THR B 1 23  ? -27.513 55.668  -12.944 1.00 41.57 ?  16  THR B CG2 1 
ATOM   1652 N  N   . PHE B 1 24  ? -25.309 54.207  -15.455 1.00 31.79 ?  17  PHE B N   1 
ATOM   1653 C  CA  . PHE B 1 24  ? -25.020 52.784  -15.611 1.00 33.88 ?  17  PHE B CA  1 
ATOM   1654 C  C   . PHE B 1 24  ? -23.553 52.486  -15.335 1.00 35.05 ?  17  PHE B C   1 
ATOM   1655 O  O   . PHE B 1 24  ? -23.229 51.554  -14.593 1.00 32.12 ?  17  PHE B O   1 
ATOM   1656 C  CB  . PHE B 1 24  ? -25.410 52.301  -17.008 1.00 32.98 ?  17  PHE B CB  1 
ATOM   1657 C  CG  . PHE B 1 24  ? -25.083 50.847  -17.259 1.00 32.27 ?  17  PHE B CG  1 
ATOM   1658 C  CD1 . PHE B 1 24  ? -25.970 49.844  -16.880 1.00 36.08 ?  17  PHE B CD1 1 
ATOM   1659 C  CD2 . PHE B 1 24  ? -23.896 50.483  -17.872 1.00 35.62 ?  17  PHE B CD2 1 
ATOM   1660 C  CE1 . PHE B 1 24  ? -25.675 48.513  -17.100 1.00 34.33 ?  17  PHE B CE1 1 
ATOM   1661 C  CE2 . PHE B 1 24  ? -23.595 49.146  -18.102 1.00 38.63 ?  17  PHE B CE2 1 
ATOM   1662 C  CZ  . PHE B 1 24  ? -24.486 48.159  -17.715 1.00 32.87 ?  17  PHE B CZ  1 
ATOM   1663 N  N   . TYR B 1 25  ? -22.643 53.261  -15.936 1.00 32.67 ?  18  TYR B N   1 
ATOM   1664 C  CA  . TYR B 1 25  ? -21.222 53.002  -15.725 1.00 31.88 ?  18  TYR B CA  1 
ATOM   1665 C  C   . TYR B 1 25  ? -20.835 53.206  -14.262 1.00 33.93 ?  18  TYR B C   1 
ATOM   1666 O  O   . TYR B 1 25  ? -20.080 52.409  -13.699 1.00 34.16 ?  18  TYR B O   1 
ATOM   1667 C  CB  . TYR B 1 25  ? -20.389 53.894  -16.645 1.00 37.94 ?  18  TYR B CB  1 
ATOM   1668 C  CG  . TYR B 1 25  ? -20.248 53.330  -18.040 1.00 37.48 ?  18  TYR B CG  1 
ATOM   1669 C  CD1 . TYR B 1 25  ? -19.867 52.018  -18.223 1.00 34.93 ?  18  TYR B CD1 1 
ATOM   1670 C  CD2 . TYR B 1 25  ? -20.508 54.105  -19.173 1.00 41.07 ?  18  TYR B CD2 1 
ATOM   1671 C  CE1 . TYR B 1 25  ? -19.732 51.481  -19.478 1.00 40.80 ?  18  TYR B CE1 1 
ATOM   1672 C  CE2 . TYR B 1 25  ? -20.374 53.567  -20.452 1.00 40.78 ?  18  TYR B CE2 1 
ATOM   1673 C  CZ  . TYR B 1 25  ? -19.986 52.254  -20.586 1.00 42.09 ?  18  TYR B CZ  1 
ATOM   1674 O  OH  . TYR B 1 25  ? -19.843 51.672  -21.813 1.00 43.30 ?  18  TYR B OH  1 
ATOM   1675 N  N   . ASP B 1 26  ? -21.367 54.254  -13.625 1.00 29.31 ?  19  ASP B N   1 
ATOM   1676 C  CA  . ASP B 1 26  ? -20.980 54.569  -12.255 1.00 33.07 ?  19  ASP B CA  1 
ATOM   1677 C  C   . ASP B 1 26  ? -21.480 53.518  -11.266 1.00 33.12 ?  19  ASP B C   1 
ATOM   1678 O  O   . ASP B 1 26  ? -20.871 53.322  -10.209 1.00 34.27 ?  19  ASP B O   1 
ATOM   1679 C  CB  . ASP B 1 26  ? -21.511 55.954  -11.882 1.00 36.66 ?  19  ASP B CB  1 
ATOM   1680 C  CG  . ASP B 1 26  ? -21.090 56.392  -10.491 1.00 42.56 ?  19  ASP B CG  1 
ATOM   1681 O  OD1 . ASP B 1 26  ? -19.929 56.141  -10.113 1.00 43.54 ?  19  ASP B OD1 1 
ATOM   1682 O  OD2 . ASP B 1 26  ? -21.920 56.987  -9.766  1.00 47.80 -1 19  ASP B OD2 1 
ATOM   1683 N  N   . ASN B 1 27  ? -22.578 52.833  -11.582 1.00 29.20 ?  20  ASN B N   1 
ATOM   1684 C  CA  . ASN B 1 27  ? -23.223 51.975  -10.600 1.00 31.76 ?  20  ASN B CA  1 
ATOM   1685 C  C   . ASN B 1 27  ? -23.077 50.489  -10.859 1.00 25.93 ?  20  ASN B C   1 
ATOM   1686 O  O   . ASN B 1 27  ? -23.242 49.704  -9.920  1.00 26.89 ?  20  ASN B O   1 
ATOM   1687 C  CB  . ASN B 1 27  ? -24.714 52.316  -10.497 1.00 28.17 ?  20  ASN B CB  1 
ATOM   1688 C  CG  . ASN B 1 27  ? -24.955 53.542  -9.652  1.00 30.08 ?  20  ASN B CG  1 
ATOM   1689 O  OD1 . ASN B 1 27  ? -24.948 53.469  -8.414  1.00 29.84 ?  20  ASN B OD1 1 
ATOM   1690 N  ND2 . ASN B 1 27  ? -25.157 54.682  -10.303 1.00 31.03 ?  20  ASN B ND2 1 
ATOM   1691 N  N   . PHE B 1 28  ? -22.769 50.069  -12.082 1.00 26.10 ?  21  PHE B N   1 
ATOM   1692 C  CA  . PHE B 1 28  ? -22.728 48.643  -12.375 1.00 25.17 ?  21  PHE B CA  1 
ATOM   1693 C  C   . PHE B 1 28  ? -21.325 48.073  -12.548 1.00 24.16 ?  21  PHE B C   1 
ATOM   1694 O  O   . PHE B 1 28  ? -21.191 46.872  -12.814 1.00 28.15 ?  21  PHE B O   1 
ATOM   1695 C  CB  . PHE B 1 28  ? -23.592 48.344  -13.604 1.00 24.41 ?  21  PHE B CB  1 
ATOM   1696 C  CG  . PHE B 1 28  ? -25.053 48.217  -13.273 1.00 23.94 ?  21  PHE B CG  1 
ATOM   1697 C  CD1 . PHE B 1 28  ? -25.855 49.340  -13.170 1.00 26.90 ?  21  PHE B CD1 1 
ATOM   1698 C  CD2 . PHE B 1 28  ? -25.608 46.978  -13.028 1.00 23.29 ?  21  PHE B CD2 1 
ATOM   1699 C  CE1 . PHE B 1 28  ? -27.190 49.228  -12.839 1.00 28.14 ?  21  PHE B CE1 1 
ATOM   1700 C  CE2 . PHE B 1 28  ? -26.955 46.861  -12.711 1.00 24.48 ?  21  PHE B CE2 1 
ATOM   1701 C  CZ  . PHE B 1 28  ? -27.735 47.982  -12.617 1.00 25.83 ?  21  PHE B CZ  1 
ATOM   1702 N  N   . GLU B 1 29  ? -20.281 48.880  -12.373 1.00 28.69 ?  22  GLU B N   1 
ATOM   1703 C  CA  . GLU B 1 29  ? -18.910 48.372  -12.398 1.00 27.83 ?  22  GLU B CA  1 
ATOM   1704 C  C   . GLU B 1 29  ? -18.730 47.278  -11.358 1.00 28.41 ?  22  GLU B C   1 
ATOM   1705 O  O   . GLU B 1 29  ? -18.991 47.497  -10.170 1.00 28.81 ?  22  GLU B O   1 
ATOM   1706 C  CB  . GLU B 1 29  ? -17.922 49.505  -12.138 1.00 32.25 ?  22  GLU B CB  1 
ATOM   1707 C  CG  . GLU B 1 29  ? -16.473 49.043  -12.215 1.00 33.49 ?  22  GLU B CG  1 
ATOM   1708 C  CD  . GLU B 1 29  ? -15.480 50.140  -11.877 1.00 40.81 ?  22  GLU B CD  1 
ATOM   1709 O  OE1 . GLU B 1 29  ? -15.908 51.273  -11.552 1.00 42.55 ?  22  GLU B OE1 1 
ATOM   1710 O  OE2 . GLU B 1 29  ? -14.268 49.851  -11.930 1.00 41.53 -1 22  GLU B OE2 1 
ATOM   1711 N  N   . ASN B 1 30  ? -18.295 46.099  -11.799 1.00 26.96 ?  23  ASN B N   1 
ATOM   1712 C  CA  . ASN B 1 30  ? -18.278 44.931  -10.919 1.00 28.23 ?  23  ASN B CA  1 
ATOM   1713 C  C   . ASN B 1 30  ? -16.988 44.813  -10.108 1.00 27.01 ?  23  ASN B C   1 
ATOM   1714 O  O   . ASN B 1 30  ? -16.466 43.712  -9.952  1.00 25.61 ?  23  ASN B O   1 
ATOM   1715 C  CB  . ASN B 1 30  ? -18.555 43.656  -11.723 1.00 25.79 ?  23  ASN B CB  1 
ATOM   1716 C  CG  . ASN B 1 30  ? -17.511 43.388  -12.820 1.00 32.17 ?  23  ASN B CG  1 
ATOM   1717 O  OD1 . ASN B 1 30  ? -16.726 44.261  -13.167 1.00 29.23 ?  23  ASN B OD1 1 
ATOM   1718 N  ND2 . ASN B 1 30  ? -17.521 42.178  -13.366 1.00 31.81 ?  23  ASN B ND2 1 
ATOM   1719 N  N   . GLU B 1 31  ? -16.465 45.923  -9.560  1.00 25.50 ?  24  GLU B N   1 
ATOM   1720 C  CA  . GLU B 1 31  ? -15.363 45.850  -8.589  1.00 28.63 ?  24  GLU B CA  1 
ATOM   1721 C  C   . GLU B 1 31  ? -15.874 45.220  -7.307  1.00 25.68 ?  24  GLU B C   1 
ATOM   1722 O  O   . GLU B 1 31  ? -16.856 45.716  -6.743  1.00 25.83 ?  24  GLU B O   1 
ATOM   1723 C  CB  . GLU B 1 31  ? -14.804 47.236  -8.260  1.00 32.32 ?  24  GLU B CB  1 
ATOM   1724 C  CG  . GLU B 1 31  ? -13.867 47.832  -9.291  1.00 35.64 ?  24  GLU B CG  1 
ATOM   1725 C  CD  . GLU B 1 31  ? -12.537 47.101  -9.367  1.00 38.74 ?  24  GLU B CD  1 
ATOM   1726 O  OE1 . GLU B 1 31  ? -11.998 46.677  -8.314  1.00 40.76 ?  24  GLU B OE1 1 
ATOM   1727 O  OE2 . GLU B 1 31  ? -12.032 46.940  -10.492 1.00 42.57 -1 24  GLU B OE2 1 
ATOM   1728 N  N   . PRO B 1 32  ? -15.259 44.148  -6.808  1.00 27.25 ?  25  PRO B N   1 
ATOM   1729 C  CA  . PRO B 1 32  ? -15.758 43.558  -5.555  1.00 28.82 ?  25  PRO B CA  1 
ATOM   1730 C  C   . PRO B 1 32  ? -15.743 44.540  -4.406  1.00 30.83 ?  25  PRO B C   1 
ATOM   1731 O  O   . PRO B 1 32  ? -16.720 44.615  -3.652  1.00 28.34 ?  25  PRO B O   1 
ATOM   1732 C  CB  . PRO B 1 32  ? -14.806 42.381  -5.320  1.00 28.24 ?  25  PRO B CB  1 
ATOM   1733 C  CG  . PRO B 1 32  ? -14.371 42.015  -6.715  1.00 31.20 ?  25  PRO B CG  1 
ATOM   1734 C  CD  . PRO B 1 32  ? -14.202 43.325  -7.422  1.00 31.05 ?  25  PRO B CD  1 
ATOM   1735 N  N   . ILE B 1 33  ? -14.664 45.305  -4.268  1.00 27.57 ?  26  ILE B N   1 
ATOM   1736 C  CA  . ILE B 1 33  ? -14.540 46.351  -3.261  1.00 27.16 ?  26  ILE B CA  1 
ATOM   1737 C  C   . ILE B 1 33  ? -14.771 47.685  -3.946  1.00 29.03 ?  26  ILE B C   1 
ATOM   1738 O  O   . ILE B 1 33  ? -13.980 48.098  -4.801  1.00 31.24 ?  26  ILE B O   1 
ATOM   1739 C  CB  . ILE B 1 33  ? -13.161 46.320  -2.582  1.00 29.90 ?  26  ILE B CB  1 
ATOM   1740 C  CG1 . ILE B 1 33  ? -12.966 45.032  -1.789  1.00 33.98 ?  26  ILE B CG1 1 
ATOM   1741 C  CG2 . ILE B 1 33  ? -12.982 47.547  -1.693  1.00 31.01 ?  26  ILE B CG2 1 
ATOM   1742 C  CD1 . ILE B 1 33  ? -13.905 44.902  -0.589  1.00 36.23 ?  26  ILE B CD1 1 
ATOM   1743 N  N   . LEU B 1 34  ? -15.839 48.375  -3.569  1.00 26.50 ?  27  LEU B N   1 
ATOM   1744 C  CA  . LEU B 1 34  ? -16.205 49.605  -4.255  1.00 30.59 ?  27  LEU B CA  1 
ATOM   1745 C  C   . LEU B 1 34  ? -16.866 50.525  -3.245  1.00 32.02 ?  27  LEU B C   1 
ATOM   1746 O  O   . LEU B 1 34  ? -17.830 50.118  -2.586  1.00 31.05 ?  27  LEU B O   1 
ATOM   1747 C  CB  . LEU B 1 34  ? -17.157 49.330  -5.428  1.00 25.86 ?  27  LEU B CB  1 
ATOM   1748 C  CG  . LEU B 1 34  ? -17.404 50.524  -6.359  1.00 29.93 ?  27  LEU B CG  1 
ATOM   1749 C  CD1 . LEU B 1 34  ? -16.123 50.835  -7.124  1.00 30.57 ?  27  LEU B CD1 1 
ATOM   1750 C  CD2 . LEU B 1 34  ? -18.564 50.257  -7.333  1.00 29.93 ?  27  LEU B CD2 1 
ATOM   1751 N  N   . SER B 1 35  ? -16.352 51.750  -3.123  1.00 26.72 ?  28  SER B N   1 
ATOM   1752 C  CA  . SER B 1 35  ? -16.872 52.730  -2.180  1.00 29.49 ?  28  SER B CA  1 
ATOM   1753 C  C   . SER B 1 35  ? -17.667 53.809  -2.908  1.00 31.04 ?  28  SER B C   1 
ATOM   1754 O  O   . SER B 1 35  ? -17.419 54.103  -4.081  1.00 30.45 ?  28  SER B O   1 
ATOM   1755 C  CB  . SER B 1 35  ? -15.734 53.382  -1.384  1.00 30.36 ?  28  SER B CB  1 
ATOM   1756 O  OG  . SER B 1 35  ? -14.991 52.399  -0.672  1.00 31.89 ?  28  SER B OG  1 
ATOM   1757 N  N   . GLY B 1 36  ? -18.637 54.390  -2.205  1.00 27.74 ?  29  GLY B N   1 
ATOM   1758 C  CA  . GLY B 1 36  ? -19.373 55.528  -2.722  1.00 32.45 ?  29  GLY B CA  1 
ATOM   1759 C  C   . GLY B 1 36  ? -20.633 55.216  -3.511  1.00 37.32 ?  29  GLY B C   1 
ATOM   1760 O  O   . GLY B 1 36  ? -21.318 56.151  -3.954  1.00 33.99 ?  29  GLY B O   1 
ATOM   1761 N  N   . ARG B 1 37  ? -20.972 53.946  -3.705  1.00 30.86 ?  30  ARG B N   1 
ATOM   1762 C  CA  . ARG B 1 37  ? -22.180 53.594  -4.450  1.00 28.30 ?  30  ARG B CA  1 
ATOM   1763 C  C   . ARG B 1 37  ? -23.277 53.305  -3.429  1.00 26.68 ?  30  ARG B C   1 
ATOM   1764 O  O   . ARG B 1 37  ? -23.623 52.154  -3.144  1.00 24.38 ?  30  ARG B O   1 
ATOM   1765 C  CB  . ARG B 1 37  ? -21.922 52.419  -5.378  1.00 25.83 ?  30  ARG B CB  1 
ATOM   1766 C  CG  . ARG B 1 37  ? -21.320 52.826  -6.725  1.00 29.88 ?  30  ARG B CG  1 
ATOM   1767 C  CD  . ARG B 1 37  ? -19.941 53.469  -6.565  1.00 33.13 ?  30  ARG B CD  1 
ATOM   1768 N  NE  . ARG B 1 37  ? -19.300 53.683  -7.858  1.00 35.56 ?  30  ARG B NE  1 
ATOM   1769 C  CZ  . ARG B 1 37  ? -18.041 54.082  -8.021  1.00 37.41 ?  30  ARG B CZ  1 
ATOM   1770 N  NH1 . ARG B 1 37  ? -17.275 54.321  -6.965  1.00 34.88 1  30  ARG B NH1 1 
ATOM   1771 N  NH2 . ARG B 1 37  ? -17.554 54.245  -9.247  1.00 34.03 ?  30  ARG B NH2 1 
ATOM   1772 N  N   . SER B 1 38  ? -23.814 54.383  -2.867  1.00 26.14 ?  31  SER B N   1 
ATOM   1773 C  CA  . SER B 1 38  ? -24.791 54.302  -1.789  1.00 31.60 ?  31  SER B CA  1 
ATOM   1774 C  C   . SER B 1 38  ? -26.192 53.960  -2.281  1.00 28.16 ?  31  SER B C   1 
ATOM   1775 O  O   . SER B 1 38  ? -27.098 53.815  -1.457  1.00 27.59 ?  31  SER B O   1 
ATOM   1776 C  CB  . SER B 1 38  ? -24.826 55.623  -1.022  1.00 34.71 ?  31  SER B CB  1 
ATOM   1777 O  OG  . SER B 1 38  ? -25.354 56.648  -1.841  1.00 46.31 ?  31  SER B OG  1 
ATOM   1778 N  N   . TYR B 1 39  ? -26.393 53.833  -3.591  1.00 27.02 ?  32  TYR B N   1 
ATOM   1779 C  CA  . TYR B 1 39  ? -27.667 53.405  -4.150  1.00 25.21 ?  32  TYR B CA  1 
ATOM   1780 C  C   . TYR B 1 39  ? -27.561 51.990  -4.689  1.00 27.40 ?  32  TYR B C   1 
ATOM   1781 O  O   . TYR B 1 39  ? -26.486 51.521  -5.071  1.00 25.33 ?  32  TYR B O   1 
ATOM   1782 C  CB  . TYR B 1 39  ? -28.120 54.317  -5.296  1.00 32.29 ?  32  TYR B CB  1 
ATOM   1783 C  CG  . TYR B 1 39  ? -28.398 55.735  -4.884  1.00 36.38 ?  32  TYR B CG  1 
ATOM   1784 C  CD1 . TYR B 1 39  ? -29.551 56.059  -4.183  1.00 36.35 ?  32  TYR B CD1 1 
ATOM   1785 C  CD2 . TYR B 1 39  ? -27.511 56.754  -5.206  1.00 40.47 ?  32  TYR B CD2 1 
ATOM   1786 C  CE1 . TYR B 1 39  ? -29.810 57.363  -3.806  1.00 43.99 ?  32  TYR B CE1 1 
ATOM   1787 C  CE2 . TYR B 1 39  ? -27.761 58.056  -4.837  1.00 43.43 ?  32  TYR B CE2 1 
ATOM   1788 C  CZ  . TYR B 1 39  ? -28.910 58.359  -4.136  1.00 48.71 ?  32  TYR B CZ  1 
ATOM   1789 O  OH  . TYR B 1 39  ? -29.156 59.668  -3.766  1.00 52.22 ?  32  TYR B OH  1 
ATOM   1790 N  N   . THR B 1 40  ? -28.709 51.326  -4.743  1.00 26.46 ?  33  THR B N   1 
ATOM   1791 C  CA  . THR B 1 40  ? -28.878 50.109  -5.510  1.00 23.41 ?  33  THR B CA  1 
ATOM   1792 C  C   . THR B 1 40  ? -29.780 50.416  -6.692  1.00 25.11 ?  33  THR B C   1 
ATOM   1793 O  O   . THR B 1 40  ? -30.865 50.969  -6.512  1.00 26.19 ?  33  THR B O   1 
ATOM   1794 C  CB  . THR B 1 40  ? -29.492 49.006  -4.653  1.00 26.75 ?  33  THR B CB  1 
ATOM   1795 O  OG1 . THR B 1 40  ? -28.545 48.632  -3.641  1.00 26.30 ?  33  THR B OG1 1 
ATOM   1796 C  CG2 . THR B 1 40  ? -29.850 47.788  -5.516  1.00 24.27 ?  33  THR B CG2 1 
ATOM   1797 N  N   . TRP B 1 41  ? -29.323 50.082  -7.891  1.00 23.60 ?  34  TRP B N   1 
ATOM   1798 C  CA  . TRP B 1 41  ? -30.127 50.210  -9.097  1.00 27.79 ?  34  TRP B CA  1 
ATOM   1799 C  C   . TRP B 1 41  ? -30.637 48.828  -9.465  1.00 25.30 ?  34  TRP B C   1 
ATOM   1800 O  O   . TRP B 1 41  ? -29.881 47.857  -9.423  1.00 25.19 ?  34  TRP B O   1 
ATOM   1801 C  CB  . TRP B 1 41  ? -29.316 50.830  -10.240 1.00 25.88 ?  34  TRP B CB  1 
ATOM   1802 C  CG  . TRP B 1 41  ? -29.170 52.299  -10.069 1.00 27.89 ?  34  TRP B CG  1 
ATOM   1803 C  CD1 . TRP B 1 41  ? -28.267 52.947  -9.280  1.00 28.81 ?  34  TRP B CD1 1 
ATOM   1804 C  CD2 . TRP B 1 41  ? -29.977 53.304  -10.667 1.00 29.87 ?  34  TRP B CD2 1 
ATOM   1805 N  NE1 . TRP B 1 41  ? -28.455 54.308  -9.366  1.00 32.47 ?  34  TRP B NE1 1 
ATOM   1806 C  CE2 . TRP B 1 41  ? -29.500 54.551  -10.215 1.00 31.92 ?  34  TRP B CE2 1 
ATOM   1807 C  CE3 . TRP B 1 41  ? -31.045 53.279  -11.564 1.00 31.89 ?  34  TRP B CE3 1 
ATOM   1808 C  CZ2 . TRP B 1 41  ? -30.066 55.759  -10.622 1.00 35.86 ?  34  TRP B CZ2 1 
ATOM   1809 C  CZ3 . TRP B 1 41  ? -31.611 54.488  -11.963 1.00 35.95 ?  34  TRP B CZ3 1 
ATOM   1810 C  CH2 . TRP B 1 41  ? -31.116 55.704  -11.499 1.00 35.36 ?  34  TRP B CH2 1 
ATOM   1811 N  N   . LEU B 1 42  ? -31.930 48.726  -9.777  1.00 21.90 ?  35  LEU B N   1 
ATOM   1812 C  CA  . LEU B 1 42  ? -32.555 47.427  -9.997  1.00 20.70 ?  35  LEU B CA  1 
ATOM   1813 C  C   . LEU B 1 42  ? -33.298 47.505  -11.323 1.00 22.17 ?  35  LEU B C   1 
ATOM   1814 O  O   . LEU B 1 42  ? -34.314 48.201  -11.427 1.00 24.95 ?  35  LEU B O   1 
ATOM   1815 C  CB  . LEU B 1 42  ? -33.496 47.057  -8.838  1.00 20.11 ?  35  LEU B CB  1 
ATOM   1816 C  CG  . LEU B 1 42  ? -34.143 45.668  -8.763  1.00 23.06 ?  35  LEU B CG  1 
ATOM   1817 C  CD1 . LEU B 1 42  ? -34.712 45.427  -7.359  1.00 24.69 ?  35  LEU B CD1 1 
ATOM   1818 C  CD2 . LEU B 1 42  ? -35.269 45.474  -9.770  1.00 22.32 ?  35  LEU B CD2 1 
ATOM   1819 N  N   . CYS B 1 43  ? -32.773 46.820  -12.330 1.00 24.21 ?  36  CYS B N   1 
ATOM   1820 C  CA  . CYS B 1 43  ? -33.456 46.644  -13.609 1.00 27.73 ?  36  CYS B CA  1 
ATOM   1821 C  C   . CYS B 1 43  ? -34.280 45.369  -13.559 1.00 24.93 ?  36  CYS B C   1 
ATOM   1822 O  O   . CYS B 1 43  ? -33.774 44.317  -13.168 1.00 24.95 ?  36  CYS B O   1 
ATOM   1823 C  CB  . CYS B 1 43  ? -32.452 46.551  -14.757 1.00 28.82 ?  36  CYS B CB  1 
ATOM   1824 S  SG  . CYS B 1 43  ? -31.266 47.862  -14.796 1.00 32.58 ?  36  CYS B SG  1 
ATOM   1825 N  N   . TYR B 1 44  ? -35.537 45.442  -13.984 1.00 25.78 ?  37  TYR B N   1 
ATOM   1826 C  CA  . TYR B 1 44  ? -36.391 44.271  -13.894 1.00 25.19 ?  37  TYR B CA  1 
ATOM   1827 C  C   . TYR B 1 44  ? -37.066 43.979  -15.225 1.00 26.24 ?  37  TYR B C   1 
ATOM   1828 O  O   . TYR B 1 44  ? -37.356 44.881  -16.016 1.00 26.76 ?  37  TYR B O   1 
ATOM   1829 C  CB  . TYR B 1 44  ? -37.471 44.412  -12.792 1.00 25.55 ?  37  TYR B CB  1 
ATOM   1830 C  CG  . TYR B 1 44  ? -38.486 45.503  -13.030 1.00 26.98 ?  37  TYR B CG  1 
ATOM   1831 C  CD1 . TYR B 1 44  ? -39.645 45.264  -13.767 1.00 28.29 ?  37  TYR B CD1 1 
ATOM   1832 C  CD2 . TYR B 1 44  ? -38.290 46.768  -12.510 1.00 28.14 ?  37  TYR B CD2 1 
ATOM   1833 C  CE1 . TYR B 1 44  ? -40.570 46.276  -13.991 1.00 30.04 ?  37  TYR B CE1 1 
ATOM   1834 C  CE2 . TYR B 1 44  ? -39.211 47.776  -12.718 1.00 30.23 ?  37  TYR B CE2 1 
ATOM   1835 C  CZ  . TYR B 1 44  ? -40.338 47.530  -13.449 1.00 30.44 ?  37  TYR B CZ  1 
ATOM   1836 O  OH  . TYR B 1 44  ? -41.232 48.555  -13.636 1.00 35.50 ?  37  TYR B OH  1 
ATOM   1837 N  N   . GLU B 1 45  ? -37.298 42.696  -15.450 1.00 28.50 ?  38  GLU B N   1 
ATOM   1838 C  CA  . GLU B 1 45  ? -38.208 42.209  -16.473 1.00 31.29 ?  38  GLU B CA  1 
ATOM   1839 C  C   . GLU B 1 45  ? -39.209 41.299  -15.794 1.00 30.21 ?  38  GLU B C   1 
ATOM   1840 O  O   . GLU B 1 45  ? -38.826 40.399  -15.036 1.00 33.15 ?  38  GLU B O   1 
ATOM   1841 C  CB  . GLU B 1 45  ? -37.473 41.461  -17.587 1.00 31.85 ?  38  GLU B CB  1 
ATOM   1842 C  CG  . GLU B 1 45  ? -36.665 42.366  -18.459 1.00 30.05 ?  38  GLU B CG  1 
ATOM   1843 C  CD  . GLU B 1 45  ? -36.216 41.696  -19.757 1.00 37.47 ?  38  GLU B CD  1 
ATOM   1844 O  OE1 . GLU B 1 45  ? -36.280 40.452  -19.853 1.00 40.59 ?  38  GLU B OE1 1 
ATOM   1845 O  OE2 . GLU B 1 45  ? -35.810 42.426  -20.682 1.00 42.74 -1 38  GLU B OE2 1 
ATOM   1846 N  N   . VAL B 1 46  ? -40.488 41.582  -16.004 1.00 28.41 ?  39  VAL B N   1 
ATOM   1847 C  CA  . VAL B 1 46  ? -41.562 40.694  -15.595 1.00 26.99 ?  39  VAL B CA  1 
ATOM   1848 C  C   . VAL B 1 46  ? -42.060 39.990  -16.848 1.00 32.84 ?  39  VAL B C   1 
ATOM   1849 O  O   . VAL B 1 46  ? -42.475 40.646  -17.813 1.00 27.91 ?  39  VAL B O   1 
ATOM   1850 C  CB  . VAL B 1 46  ? -42.693 41.466  -14.900 1.00 31.43 ?  39  VAL B CB  1 
ATOM   1851 C  CG1 . VAL B 1 46  ? -43.876 40.544  -14.633 1.00 30.85 ?  39  VAL B CG1 1 
ATOM   1852 C  CG2 . VAL B 1 46  ? -42.180 42.114  -13.597 1.00 26.72 ?  39  VAL B CG2 1 
ATOM   1853 N  N   . LYS B 1 47  ? -41.967 38.667  -16.857 1.00 31.70 ?  40  LYS B N   1 
ATOM   1854 C  CA  . LYS B 1 47  ? -42.414 37.858  -17.975 1.00 34.81 ?  40  LYS B CA  1 
ATOM   1855 C  C   . LYS B 1 47  ? -43.511 36.908  -17.522 1.00 37.01 ?  40  LYS B C   1 
ATOM   1856 O  O   . LYS B 1 47  ? -43.538 36.463  -16.369 1.00 33.02 ?  40  LYS B O   1 
ATOM   1857 C  CB  . LYS B 1 47  ? -41.260 37.054  -18.586 1.00 35.13 ?  40  LYS B CB  1 
ATOM   1858 C  CG  . LYS B 1 47  ? -40.146 37.911  -19.128 1.00 36.42 ?  40  LYS B CG  1 
ATOM   1859 C  CD  . LYS B 1 47  ? -39.009 37.039  -19.602 1.00 44.01 ?  40  LYS B CD  1 
ATOM   1860 C  CE  . LYS B 1 47  ? -38.009 37.834  -20.415 1.00 51.06 ?  40  LYS B CE  1 
ATOM   1861 N  NZ  . LYS B 1 47  ? -37.390 36.976  -21.475 1.00 56.47 1  40  LYS B NZ  1 
ATOM   1862 N  N   . ILE B 1 48  ? -44.436 36.626  -18.435 1.00 32.72 ?  41  ILE B N   1 
ATOM   1863 C  CA  . ILE B 1 48  ? -45.394 35.541  -18.256 1.00 35.00 ?  41  ILE B CA  1 
ATOM   1864 C  C   . ILE B 1 48  ? -44.783 34.317  -18.913 1.00 37.39 ?  41  ILE B C   1 
ATOM   1865 O  O   . ILE B 1 48  ? -44.534 34.316  -20.122 1.00 39.80 ?  41  ILE B O   1 
ATOM   1866 C  CB  . ILE B 1 48  ? -46.757 35.878  -18.874 1.00 40.24 ?  41  ILE B CB  1 
ATOM   1867 C  CG1 . ILE B 1 48  ? -47.198 37.282  -18.469 1.00 40.85 ?  41  ILE B CG1 1 
ATOM   1868 C  CG2 . ILE B 1 48  ? -47.788 34.822  -18.492 1.00 42.45 ?  41  ILE B CG2 1 
ATOM   1869 C  CD1 . ILE B 1 48  ? -47.297 37.473  -16.975 1.00 41.14 ?  41  ILE B CD1 1 
ATOM   1870 N  N   . LYS B 1 49  ? -44.492 33.294  -18.121 1.00 38.27 ?  42  LYS B N   1 
ATOM   1871 C  CA  . LYS B 1 49  ? -43.697 32.175  -18.599 1.00 43.85 ?  42  LYS B CA  1 
ATOM   1872 C  C   . LYS B 1 49  ? -44.444 30.876  -18.366 1.00 49.99 ?  42  LYS B C   1 
ATOM   1873 O  O   . LYS B 1 49  ? -45.014 30.653  -17.294 1.00 52.48 ?  42  LYS B O   1 
ATOM   1874 C  CB  . LYS B 1 49  ? -42.319 32.119  -17.913 1.00 49.96 ?  42  LYS B CB  1 
ATOM   1875 C  CG  . LYS B 1 49  ? -41.537 30.834  -18.188 1.00 54.50 ?  42  LYS B CG  1 
ATOM   1876 C  CD  . LYS B 1 49  ? -40.080 30.933  -17.734 1.00 59.40 ?  42  LYS B CD  1 
ATOM   1877 C  CE  . LYS B 1 49  ? -39.138 31.165  -18.922 1.00 58.29 ?  42  LYS B CE  1 
ATOM   1878 N  NZ  . LYS B 1 49  ? -39.124 30.019  -19.876 1.00 55.85 1  42  LYS B NZ  1 
ATOM   1879 N  N   . ARG B 1 50  ? -44.442 30.026  -19.388 1.00 47.55 ?  43  ARG B N   1 
ATOM   1880 C  CA  . ARG B 1 50  ? -45.140 28.747  -19.316 1.00 52.19 ?  43  ARG B CA  1 
ATOM   1881 C  C   . ARG B 1 50  ? -44.457 27.840  -20.343 1.00 53.75 ?  43  ARG B C   1 
ATOM   1882 O  O   . ARG B 1 50  ? -44.848 27.812  -21.508 1.00 55.81 ?  43  ARG B O   1 
ATOM   1883 C  CB  . ARG B 1 50  ? -46.622 28.898  -19.592 1.00 51.29 ?  43  ARG B CB  1 
ATOM   1884 C  CG  . ARG B 1 50  ? -47.377 27.616  -19.405 1.00 49.09 ?  43  ARG B CG  1 
ATOM   1885 C  CD  . ARG B 1 50  ? -48.767 27.656  -19.997 1.00 48.18 ?  43  ARG B CD  1 
ATOM   1886 N  NE  . ARG B 1 50  ? -49.279 26.295  -20.050 1.00 41.48 ?  43  ARG B NE  1 
ATOM   1887 C  CZ  . ARG B 1 50  ? -49.165 25.506  -21.108 1.00 43.19 ?  43  ARG B CZ  1 
ATOM   1888 N  NH1 . ARG B 1 50  ? -48.586 25.962  -22.214 1.00 45.17 1  43  ARG B NH1 1 
ATOM   1889 N  NH2 . ARG B 1 50  ? -49.639 24.264  -21.065 1.00 44.94 ?  43  ARG B NH2 1 
ATOM   1890 N  N   . GLY B 1 51  ? -43.419 27.133  -19.896 1.00 58.83 ?  44  GLY B N   1 
ATOM   1891 C  CA  . GLY B 1 51  ? -42.614 26.314  -20.781 1.00 59.18 ?  44  GLY B CA  1 
ATOM   1892 C  C   . GLY B 1 51  ? -41.939 27.111  -21.881 1.00 65.12 ?  44  GLY B C   1 
ATOM   1893 O  O   . GLY B 1 51  ? -41.022 27.901  -21.627 1.00 68.44 ?  44  GLY B O   1 
ATOM   1894 N  N   . ARG B 1 52  ? -42.398 26.923  -23.114 1.00 62.55 ?  45  ARG B N   1 
ATOM   1895 C  CA  . ARG B 1 52  ? -41.779 27.568  -24.265 1.00 67.94 ?  45  ARG B CA  1 
ATOM   1896 C  C   . ARG B 1 52  ? -42.342 28.961  -24.537 1.00 65.28 ?  45  ARG B C   1 
ATOM   1897 O  O   . ARG B 1 52  ? -41.679 29.769  -25.201 1.00 64.62 ?  45  ARG B O   1 
ATOM   1898 C  CB  . ARG B 1 52  ? -41.944 26.677  -25.502 1.00 74.19 ?  45  ARG B CB  1 
ATOM   1899 C  CG  . ARG B 1 52  ? -41.765 25.170  -25.218 1.00 77.28 ?  45  ARG B CG  1 
ATOM   1900 C  CD  . ARG B 1 52  ? -40.475 24.861  -24.433 1.00 74.60 ?  45  ARG B CD  1 
ATOM   1901 N  NE  . ARG B 1 52  ? -40.269 23.424  -24.244 1.00 76.67 ?  45  ARG B NE  1 
ATOM   1902 C  CZ  . ARG B 1 52  ? -39.291 22.895  -23.514 1.00 74.99 ?  45  ARG B CZ  1 
ATOM   1903 N  NH1 . ARG B 1 52  ? -38.423 23.682  -22.887 1.00 73.44 1  45  ARG B NH1 1 
ATOM   1904 N  NH2 . ARG B 1 52  ? -39.179 21.576  -23.407 1.00 72.81 ?  45  ARG B NH2 1 
ATOM   1905 N  N   . SER B 1 53  ? -43.544 29.251  -24.049 1.00 54.21 ?  46  SER B N   1 
ATOM   1906 C  CA  . SER B 1 53  ? -44.066 30.607  -24.079 1.00 52.22 ?  46  SER B CA  1 
ATOM   1907 C  C   . SER B 1 53  ? -43.283 31.479  -23.104 1.00 54.86 ?  46  SER B C   1 
ATOM   1908 O  O   . SER B 1 53  ? -42.982 31.069  -21.978 1.00 50.62 ?  46  SER B O   1 
ATOM   1909 C  CB  . SER B 1 53  ? -45.557 30.602  -23.723 1.00 50.05 ?  46  SER B CB  1 
ATOM   1910 O  OG  . SER B 1 53  ? -46.090 31.913  -23.621 1.00 51.03 ?  46  SER B OG  1 
ATOM   1911 N  N   . ASN B 1 54  ? -42.944 32.689  -23.541 1.00 50.31 ?  47  ASN B N   1 
ATOM   1912 C  CA  . ASN B 1 54  ? -42.105 33.558  -22.721 1.00 47.92 ?  47  ASN B CA  1 
ATOM   1913 C  C   . ASN B 1 54  ? -42.375 35.000  -23.163 1.00 46.73 ?  47  ASN B C   1 
ATOM   1914 O  O   . ASN B 1 54  ? -41.677 35.532  -24.025 1.00 52.40 ?  47  ASN B O   1 
ATOM   1915 C  CB  . ASN B 1 54  ? -40.644 33.198  -22.854 1.00 53.81 ?  47  ASN B CB  1 
ATOM   1916 C  CG  . ASN B 1 54  ? -39.754 34.088  -22.021 1.00 56.68 ?  47  ASN B CG  1 
ATOM   1917 O  OD1 . ASN B 1 54  ? -38.952 34.863  -22.554 1.00 64.91 ?  47  ASN B OD1 1 
ATOM   1918 N  ND2 . ASN B 1 54  ? -39.902 34.001  -20.704 1.00 55.70 ?  47  ASN B ND2 1 
ATOM   1919 N  N   . LEU B 1 55  ? -43.380 35.612  -22.550 1.00 39.60 ?  48  LEU B N   1 
ATOM   1920 C  CA  . LEU B 1 55  ? -43.877 36.917  -22.960 1.00 37.07 ?  48  LEU B CA  1 
ATOM   1921 C  C   . LEU B 1 55  ? -43.297 37.991  -22.063 1.00 35.86 ?  48  LEU B C   1 
ATOM   1922 O  O   . LEU B 1 55  ? -43.524 37.973  -20.851 1.00 35.85 ?  48  LEU B O   1 
ATOM   1923 C  CB  . LEU B 1 55  ? -45.402 36.971  -22.882 1.00 38.64 ?  48  LEU B CB  1 
ATOM   1924 C  CG  . LEU B 1 55  ? -46.218 36.244  -23.934 1.00 40.38 ?  48  LEU B CG  1 
ATOM   1925 C  CD1 . LEU B 1 55  ? -47.689 36.314  -23.547 1.00 39.02 ?  48  LEU B CD1 1 
ATOM   1926 C  CD2 . LEU B 1 55  ? -45.968 36.887  -25.282 1.00 35.69 ?  48  LEU B CD2 1 
ATOM   1927 N  N   . LEU B 1 56  ? -42.585 38.936  -22.658 1.00 36.23 ?  49  LEU B N   1 
ATOM   1928 C  CA  . LEU B 1 56  ? -42.197 40.131  -21.931 1.00 34.89 ?  49  LEU B CA  1 
ATOM   1929 C  C   . LEU B 1 56  ? -43.446 40.918  -21.565 1.00 40.71 ?  49  LEU B C   1 
ATOM   1930 O  O   . LEU B 1 56  ? -44.248 41.275  -22.437 1.00 34.43 ?  49  LEU B O   1 
ATOM   1931 C  CB  . LEU B 1 56  ? -41.244 40.980  -22.771 1.00 35.28 ?  49  LEU B CB  1 
ATOM   1932 C  CG  . LEU B 1 56  ? -40.664 42.190  -22.038 1.00 37.83 ?  49  LEU B CG  1 
ATOM   1933 C  CD1 . LEU B 1 56  ? -39.835 41.717  -20.849 1.00 38.23 ?  49  LEU B CD1 1 
ATOM   1934 C  CD2 . LEU B 1 56  ? -39.833 43.065  -22.972 1.00 39.99 ?  49  LEU B CD2 1 
ATOM   1935 N  N   . TRP B 1 57  ? -43.625 41.169  -20.270 1.00 35.52 ?  50  TRP B N   1 
ATOM   1936 C  CA  . TRP B 1 57  ? -44.840 41.792  -19.776 1.00 34.15 ?  50  TRP B CA  1 
ATOM   1937 C  C   . TRP B 1 57  ? -44.618 43.180  -19.210 1.00 36.68 ?  50  TRP B C   1 
ATOM   1938 O  O   . TRP B 1 57  ? -45.438 44.070  -19.432 1.00 34.51 ?  50  TRP B O   1 
ATOM   1939 C  CB  . TRP B 1 57  ? -45.484 40.896  -18.715 1.00 37.01 ?  50  TRP B CB  1 
ATOM   1940 C  CG  . TRP B 1 57  ? -46.953 41.095  -18.624 1.00 40.18 ?  50  TRP B CG  1 
ATOM   1941 C  CD1 . TRP B 1 57  ? -47.670 41.466  -17.524 1.00 44.58 ?  50  TRP B CD1 1 
ATOM   1942 C  CD2 . TRP B 1 57  ? -47.895 40.954  -19.694 1.00 41.00 ?  50  TRP B CD2 1 
ATOM   1943 N  NE1 . TRP B 1 57  ? -49.010 41.562  -17.845 1.00 47.49 ?  50  TRP B NE1 1 
ATOM   1944 C  CE2 . TRP B 1 57  ? -49.169 41.254  -19.172 1.00 42.45 ?  50  TRP B CE2 1 
ATOM   1945 C  CE3 . TRP B 1 57  ? -47.780 40.607  -21.048 1.00 41.53 ?  50  TRP B CE3 1 
ATOM   1946 C  CZ2 . TRP B 1 57  ? -50.324 41.205  -19.950 1.00 44.56 ?  50  TRP B CZ2 1 
ATOM   1947 C  CZ3 . TRP B 1 57  ? -48.930 40.567  -21.825 1.00 41.88 ?  50  TRP B CZ3 1 
ATOM   1948 C  CH2 . TRP B 1 57  ? -50.183 40.867  -21.273 1.00 43.28 ?  50  TRP B CH2 1 
ATOM   1949 N  N   . ASP B 1 58  ? -43.521 43.395  -18.495 1.00 30.91 ?  51  ASP B N   1 
ATOM   1950 C  CA  . ASP B 1 58  ? -43.239 44.698  -17.918 1.00 36.22 ?  51  ASP B CA  1 
ATOM   1951 C  C   . ASP B 1 58  ? -41.734 44.802  -17.722 1.00 33.37 ?  51  ASP B C   1 
ATOM   1952 O  O   . ASP B 1 58  ? -41.067 43.796  -17.477 1.00 33.44 ?  51  ASP B O   1 
ATOM   1953 C  CB  . ASP B 1 58  ? -43.993 44.886  -16.596 1.00 34.60 ?  51  ASP B CB  1 
ATOM   1954 C  CG  . ASP B 1 58  ? -44.922 46.071  -16.628 1.00 43.69 ?  51  ASP B CG  1 
ATOM   1955 O  OD1 . ASP B 1 58  ? -44.496 47.139  -17.111 1.00 46.10 ?  51  ASP B OD1 1 
ATOM   1956 O  OD2 . ASP B 1 58  ? -46.083 45.934  -16.194 1.00 45.39 -1 51  ASP B OD2 1 
ATOM   1957 N  N   . THR B 1 59  ? -41.205 46.013  -17.899 1.00 29.91 ?  52  THR B N   1 
ATOM   1958 C  CA  . THR B 1 59  ? -39.791 46.306  -17.691 1.00 30.71 ?  52  THR B CA  1 
ATOM   1959 C  C   . THR B 1 59  ? -39.671 47.685  -17.071 1.00 34.53 ?  52  THR B C   1 
ATOM   1960 O  O   . THR B 1 59  ? -40.560 48.531  -17.205 1.00 34.55 ?  52  THR B O   1 
ATOM   1961 C  CB  . THR B 1 59  ? -38.971 46.287  -18.999 1.00 35.90 ?  52  THR B CB  1 
ATOM   1962 O  OG1 . THR B 1 59  ? -39.478 47.288  -19.896 1.00 43.48 ?  52  THR B OG1 1 
ATOM   1963 C  CG2 . THR B 1 59  ? -39.043 44.948  -19.674 1.00 38.54 ?  52  THR B CG2 1 
ATOM   1964 N  N   . GLY B 1 60  ? -38.543 47.925  -16.420 1.00 26.75 ?  53  GLY B N   1 
ATOM   1965 C  CA  . GLY B 1 60  ? -38.321 49.218  -15.814 1.00 28.98 ?  53  GLY B CA  1 
ATOM   1966 C  C   . GLY B 1 60  ? -37.101 49.180  -14.918 1.00 29.55 ?  53  GLY B C   1 
ATOM   1967 O  O   . GLY B 1 60  ? -36.366 48.188  -14.870 1.00 27.35 ?  53  GLY B O   1 
ATOM   1968 N  N   . VAL B 1 61  ? -36.898 50.292  -14.218 1.00 27.69 ?  54  VAL B N   1 
ATOM   1969 C  CA  . VAL B 1 61  ? -35.713 50.497  -13.395 1.00 31.14 ?  54  VAL B CA  1 
ATOM   1970 C  C   . VAL B 1 61  ? -36.135 51.183  -12.104 1.00 29.66 ?  54  VAL B C   1 
ATOM   1971 O  O   . VAL B 1 61  ? -36.853 52.187  -12.136 1.00 30.84 ?  54  VAL B O   1 
ATOM   1972 C  CB  . VAL B 1 61  ? -34.654 51.341  -14.138 1.00 31.06 ?  54  VAL B CB  1 
ATOM   1973 C  CG1 . VAL B 1 61  ? -33.444 51.593  -13.245 1.00 32.06 ?  54  VAL B CG1 1 
ATOM   1974 C  CG2 . VAL B 1 61  ? -34.224 50.657  -15.429 1.00 29.74 ?  54  VAL B CG2 1 
ATOM   1975 N  N   . PHE B 1 62  ? -35.710 50.634  -10.967 1.00 28.81 ?  55  PHE B N   1 
ATOM   1976 C  CA  . PHE B 1 62  ? -35.864 51.277  -9.674  1.00 25.59 ?  55  PHE B CA  1 
ATOM   1977 C  C   . PHE B 1 62  ? -34.492 51.666  -9.142  1.00 26.76 ?  55  PHE B C   1 
ATOM   1978 O  O   . PHE B 1 62  ? -33.495 50.986  -9.401  1.00 25.13 ?  55  PHE B O   1 
ATOM   1979 C  CB  . PHE B 1 62  ? -36.532 50.358  -8.639  1.00 26.86 ?  55  PHE B CB  1 
ATOM   1980 C  CG  . PHE B 1 62  ? -38.010 50.173  -8.834  1.00 30.07 ?  55  PHE B CG  1 
ATOM   1981 C  CD1 . PHE B 1 62  ? -38.909 51.098  -8.340  1.00 32.10 ?  55  PHE B CD1 1 
ATOM   1982 C  CD2 . PHE B 1 62  ? -38.500 49.052  -9.480  1.00 26.90 ?  55  PHE B CD2 1 
ATOM   1983 C  CE1 . PHE B 1 62  ? -40.272 50.922  -8.518  1.00 31.97 ?  55  PHE B CE1 1 
ATOM   1984 C  CE2 . PHE B 1 62  ? -39.863 48.875  -9.657  1.00 31.47 ?  55  PHE B CE2 1 
ATOM   1985 C  CZ  . PHE B 1 62  ? -40.745 49.815  -9.173  1.00 29.55 ?  55  PHE B CZ  1 
ATOM   1986 N  N   . ARG B 1 63  ? -34.454 52.765  -8.396  1.00 27.21 ?  56  ARG B N   1 
ATOM   1987 C  CA  . ARG B 1 63  ? -33.300 53.135  -7.597  1.00 30.67 ?  56  ARG B CA  1 
ATOM   1988 C  C   . ARG B 1 63  ? -33.728 53.244  -6.142  1.00 30.33 ?  56  ARG B C   1 
ATOM   1989 O  O   . ARG B 1 63  ? -34.777 53.815  -5.828  1.00 31.21 ?  56  ARG B O   1 
ATOM   1990 C  CB  . ARG B 1 63  ? -32.667 54.453  -8.043  1.00 32.64 ?  56  ARG B CB  1 
ATOM   1991 C  CG  . ARG B 1 63  ? -31.394 54.763  -7.255  1.00 35.99 ?  56  ARG B CG  1 
ATOM   1992 C  CD  . ARG B 1 63  ? -30.876 56.177  -7.451  1.00 38.91 ?  56  ARG B CD  1 
ATOM   1993 N  NE  . ARG B 1 63  ? -31.730 57.197  -6.856  1.00 43.36 ?  56  ARG B NE  1 
ATOM   1994 C  CZ  . ARG B 1 63  ? -31.440 58.496  -6.866  1.00 51.60 ?  56  ARG B CZ  1 
ATOM   1995 N  NH1 . ARG B 1 63  ? -30.316 58.917  -7.437  1.00 45.47 1  56  ARG B NH1 1 
ATOM   1996 N  NH2 . ARG B 1 63  ? -32.267 59.367  -6.302  1.00 49.15 ?  56  ARG B NH2 1 
ATOM   1997 N  N   . GLY B 1 64  ? -32.917 52.689  -5.255  1.00 29.45 ?  57  GLY B N   1 
ATOM   1998 C  CA  . GLY B 1 64  ? -33.162 52.791  -3.835  1.00 24.57 ?  57  GLY B CA  1 
ATOM   1999 C  C   . GLY B 1 64  ? -31.842 52.960  -3.115  1.00 28.71 ?  57  GLY B C   1 
ATOM   2000 O  O   . GLY B 1 64  ? -30.795 53.064  -3.740  1.00 27.13 ?  57  GLY B O   1 
ATOM   2001 N  N   . GLN B 1 65  ? -31.919 53.013  -1.794  1.00 27.41 ?  58  GLN B N   1 
ATOM   2002 C  CA  . GLN B 1 65  ? -30.729 53.088  -0.960  1.00 30.03 ?  58  GLN B CA  1 
ATOM   2003 C  C   . GLN B 1 65  ? -30.187 51.691  -0.694  1.00 26.45 ?  58  GLN B C   1 
ATOM   2004 O  O   . GLN B 1 65  ? -30.942 50.726  -0.623  1.00 24.82 ?  58  GLN B O   1 
ATOM   2005 C  CB  . GLN B 1 65  ? -31.057 53.769  0.368   1.00 30.38 ?  58  GLN B CB  1 
ATOM   2006 C  CG  . GLN B 1 65  ? -31.631 55.152  0.203   1.00 33.89 ?  58  GLN B CG  1 
ATOM   2007 C  CD  . GLN B 1 65  ? -30.559 56.180  -0.043  1.00 39.15 ?  58  GLN B CD  1 
ATOM   2008 O  OE1 . GLN B 1 65  ? -29.388 55.959  0.283   1.00 37.99 ?  58  GLN B OE1 1 
ATOM   2009 N  NE2 . GLN B 1 65  ? -30.943 57.312  -0.630  1.00 41.47 ?  58  GLN B NE2 1 
ATOM   2010 N  N   . VAL B 1 66  ? -28.866 51.593  -0.547  1.00 26.00 ?  59  VAL B N   1 
ATOM   2011 C  CA  . VAL B 1 66  ? -28.268 50.343  -0.075  1.00 28.96 ?  59  VAL B CA  1 
ATOM   2012 C  C   . VAL B 1 66  ? -28.468 50.195  1.421   1.00 27.32 ?  59  VAL B C   1 
ATOM   2013 O  O   . VAL B 1 66  ? -28.739 49.096  1.926   1.00 25.27 ?  59  VAL B O   1 
ATOM   2014 C  CB  . VAL B 1 66  ? -26.771 50.281  -0.433  1.00 26.40 ?  59  VAL B CB  1 
ATOM   2015 C  CG1 . VAL B 1 66  ? -26.195 48.932  -0.037  1.00 31.43 ?  59  VAL B CG1 1 
ATOM   2016 C  CG2 . VAL B 1 66  ? -26.591 50.484  -1.873  1.00 30.13 ?  59  VAL B CG2 1 
ATOM   2017 N  N   . TYR B 1 67  ? -28.308 51.288  2.160   1.00 29.64 ?  60  TYR B N   1 
ATOM   2018 C  CA  . TYR B 1 67  ? -28.484 51.282  3.590   1.00 28.40 ?  60  TYR B CA  1 
ATOM   2019 C  C   . TYR B 1 67  ? -29.745 52.090  3.911   1.00 32.12 ?  60  TYR B C   1 
ATOM   2020 O  O   . TYR B 1 67  ? -30.629 52.217  3.039   1.00 29.39 ?  60  TYR B O   1 
ATOM   2021 C  CB  . TYR B 1 67  ? -27.199 51.782  4.247   1.00 35.44 ?  60  TYR B CB  1 
ATOM   2022 C  CG  . TYR B 1 67  ? -26.015 50.841  4.000   1.00 33.57 ?  60  TYR B CG  1 
ATOM   2023 C  CD1 . TYR B 1 67  ? -26.055 49.517  4.437   1.00 33.09 ?  60  TYR B CD1 1 
ATOM   2024 C  CD2 . TYR B 1 67  ? -24.878 51.270  3.328   1.00 32.20 ?  60  TYR B CD2 1 
ATOM   2025 C  CE1 . TYR B 1 67  ? -24.987 48.644  4.223   1.00 31.46 ?  60  TYR B CE1 1 
ATOM   2026 C  CE2 . TYR B 1 67  ? -23.801 50.402  3.106   1.00 30.95 ?  60  TYR B CE2 1 
ATOM   2027 C  CZ  . TYR B 1 67  ? -23.868 49.093  3.555   1.00 32.29 ?  60  TYR B CZ  1 
ATOM   2028 O  OH  . TYR B 1 67  ? -22.817 48.214  3.345   1.00 34.92 ?  60  TYR B OH  1 
ATOM   2029 N  N   . PHE B 1 68  ? -29.834 52.618  5.138   1.00 32.67 ?  61  PHE B N   1 
ATOM   2030 C  CA  . PHE B 1 68  ? -31.071 53.168  5.685   1.00 32.77 ?  61  PHE B CA  1 
ATOM   2031 C  C   . PHE B 1 68  ? -32.090 52.052  5.863   1.00 36.57 ?  61  PHE B C   1 
ATOM   2032 O  O   . PHE B 1 68  ? -31.771 50.873  5.656   1.00 30.15 ?  61  PHE B O   1 
ATOM   2033 C  CB  . PHE B 1 68  ? -31.626 54.293  4.802   1.00 36.85 ?  61  PHE B CB  1 
ATOM   2034 C  CG  . PHE B 1 68  ? -30.724 55.489  4.722   1.00 35.37 ?  61  PHE B CG  1 
ATOM   2035 C  CD1 . PHE B 1 68  ? -30.780 56.483  5.691   1.00 41.12 ?  61  PHE B CD1 1 
ATOM   2036 C  CD2 . PHE B 1 68  ? -29.799 55.607  3.701   1.00 37.31 ?  61  PHE B CD2 1 
ATOM   2037 C  CE1 . PHE B 1 68  ? -29.939 57.588  5.626   1.00 38.04 ?  61  PHE B CE1 1 
ATOM   2038 C  CE2 . PHE B 1 68  ? -28.966 56.705  3.622   1.00 41.22 ?  61  PHE B CE2 1 
ATOM   2039 C  CZ  . PHE B 1 68  ? -29.032 57.698  4.591   1.00 44.24 ?  61  PHE B CZ  1 
ATOM   2040 N  N   . LYS B 1 69  ? -33.304 52.405  6.283   1.00 36.61 ?  62  LYS B N   1 
ATOM   2041 C  CA  . LYS B 1 69  ? -34.297 51.393  6.599   1.00 36.96 ?  62  LYS B CA  1 
ATOM   2042 C  C   . LYS B 1 69  ? -34.796 50.717  5.319   1.00 34.29 ?  62  LYS B C   1 
ATOM   2043 O  O   . LYS B 1 69  ? -34.797 51.327  4.247   1.00 34.15 ?  62  LYS B O   1 
ATOM   2044 C  CB  . LYS B 1 69  ? -35.462 52.017  7.369   1.00 39.34 ?  62  LYS B CB  1 
ATOM   2045 C  CG  . LYS B 1 69  ? -35.132 52.340  8.835   1.00 41.16 ?  62  LYS B CG  1 
ATOM   2046 C  CD  . LYS B 1 69  ? -34.797 51.082  9.624   1.00 46.87 ?  62  LYS B CD  1 
ATOM   2047 C  CE  . LYS B 1 69  ? -34.395 51.410  11.066  1.00 58.24 ?  62  LYS B CE  1 
ATOM   2048 N  NZ  . LYS B 1 69  ? -35.346 52.362  11.726  1.00 53.10 1  62  LYS B NZ  1 
ATOM   2049 N  N   . PRO B 1 70  ? -35.229 49.453  5.409   1.00 33.92 ?  63  PRO B N   1 
ATOM   2050 C  CA  . PRO B 1 70  ? -35.540 48.692  4.183   1.00 34.46 ?  63  PRO B CA  1 
ATOM   2051 C  C   . PRO B 1 70  ? -36.670 49.284  3.358   1.00 34.19 ?  63  PRO B C   1 
ATOM   2052 O  O   . PRO B 1 70  ? -36.752 48.997  2.156   1.00 30.32 ?  63  PRO B O   1 
ATOM   2053 C  CB  . PRO B 1 70  ? -35.905 47.298  4.714   1.00 33.33 ?  63  PRO B CB  1 
ATOM   2054 C  CG  . PRO B 1 70  ? -35.299 47.227  6.078   1.00 38.92 ?  63  PRO B CG  1 
ATOM   2055 C  CD  . PRO B 1 70  ? -35.303 48.616  6.619   1.00 35.68 ?  63  PRO B CD  1 
ATOM   2056 N  N   . GLN B 1 71  ? -37.522 50.123  3.951   1.00 34.74 ?  64  GLN B N   1 
ATOM   2057 C  CA  . GLN B 1 71  ? -38.550 50.806  3.168   1.00 40.75 ?  64  GLN B CA  1 
ATOM   2058 C  C   . GLN B 1 71  ? -37.946 51.632  2.034   1.00 36.01 ?  64  GLN B C   1 
ATOM   2059 O  O   . GLN B 1 71  ? -38.602 51.850  1.006   1.00 42.99 ?  64  GLN B O   1 
ATOM   2060 C  CB  . GLN B 1 71  ? -39.397 51.707  4.072   1.00 41.48 ?  64  GLN B CB  1 
ATOM   2061 C  CG  . GLN B 1 71  ? -39.878 51.029  5.342   1.00 45.45 ?  64  GLN B CG  1 
ATOM   2062 C  CD  . GLN B 1 71  ? -38.893 51.184  6.487   1.00 51.87 ?  64  GLN B CD  1 
ATOM   2063 O  OE1 . GLN B 1 71  ? -38.606 52.306  6.923   1.00 51.99 ?  64  GLN B OE1 1 
ATOM   2064 N  NE2 . GLN B 1 71  ? -38.364 50.059  6.977   1.00 45.32 ?  64  GLN B NE2 1 
ATOM   2065 N  N   . TYR B 1 72  ? -36.712 52.101  2.199   1.00 35.53 ?  65  TYR B N   1 
ATOM   2066 C  CA  . TYR B 1 72  ? -36.046 52.898  1.181   1.00 34.99 ?  65  TYR B CA  1 
ATOM   2067 C  C   . TYR B 1 72  ? -35.276 52.060  0.165   1.00 30.37 ?  65  TYR B C   1 
ATOM   2068 O  O   . TYR B 1 72  ? -34.622 52.632  -0.710  1.00 27.16 ?  65  TYR B O   1 
ATOM   2069 C  CB  . TYR B 1 72  ? -35.082 53.900  1.834   1.00 37.22 ?  65  TYR B CB  1 
ATOM   2070 C  CG  . TYR B 1 72  ? -35.729 54.844  2.832   1.00 49.07 ?  65  TYR B CG  1 
ATOM   2071 C  CD1 . TYR B 1 72  ? -36.569 55.871  2.408   1.00 51.99 ?  65  TYR B CD1 1 
ATOM   2072 C  CD2 . TYR B 1 72  ? -35.490 54.714  4.202   1.00 47.77 ?  65  TYR B CD2 1 
ATOM   2073 C  CE1 . TYR B 1 72  ? -37.165 56.738  3.322   1.00 53.68 ?  65  TYR B CE1 1 
ATOM   2074 C  CE2 . TYR B 1 72  ? -36.082 55.575  5.121   1.00 53.17 ?  65  TYR B CE2 1 
ATOM   2075 C  CZ  . TYR B 1 72  ? -36.918 56.585  4.674   1.00 57.62 ?  65  TYR B CZ  1 
ATOM   2076 O  OH  . TYR B 1 72  ? -37.507 57.445  5.579   1.00 57.80 ?  65  TYR B OH  1 
ATOM   2077 N  N   . HIS B 1 73  ? -35.320 50.737  0.256   1.00 25.81 ?  66  HIS B N   1 
ATOM   2078 C  CA  . HIS B 1 73  ? -34.470 49.908  -0.588  1.00 25.77 ?  66  HIS B CA  1 
ATOM   2079 C  C   . HIS B 1 73  ? -35.139 49.599  -1.916  1.00 23.67 ?  66  HIS B C   1 
ATOM   2080 O  O   . HIS B 1 73  ? -36.363 49.512  -2.007  1.00 25.76 ?  66  HIS B O   1 
ATOM   2081 C  CB  . HIS B 1 73  ? -34.112 48.604  0.123   1.00 24.80 ?  66  HIS B CB  1 
ATOM   2082 C  CG  . HIS B 1 73  ? -33.274 48.809  1.340   1.00 26.44 ?  66  HIS B CG  1 
ATOM   2083 N  ND1 . HIS B 1 73  ? -32.747 47.766  2.066   1.00 21.27 ?  66  HIS B ND1 1 
ATOM   2084 C  CD2 . HIS B 1 73  ? -32.861 49.946  1.947   1.00 25.01 ?  66  HIS B CD2 1 
ATOM   2085 C  CE1 . HIS B 1 73  ? -32.056 48.257  3.084   1.00 29.49 ?  66  HIS B CE1 1 
ATOM   2086 N  NE2 . HIS B 1 73  ? -32.104 49.576  3.028   1.00 28.71 ?  66  HIS B NE2 1 
ATOM   2087 N  N   . ALA B 1 74  ? -34.307 49.428  -2.947  1.00 22.93 ?  67  ALA B N   1 
ATOM   2088 C  CA  . ALA B 1 74  ? -34.810 49.139  -4.292  1.00 23.81 ?  67  ALA B CA  1 
ATOM   2089 C  C   . ALA B 1 74  ? -35.694 47.900  -4.304  1.00 24.97 ?  67  ALA B C   1 
ATOM   2090 O  O   . ALA B 1 74  ? -36.708 47.848  -5.014  1.00 24.03 ?  67  ALA B O   1 
ATOM   2091 C  CB  . ALA B 1 74  ? -33.629 48.950  -5.250  1.00 21.97 ?  67  ALA B CB  1 
ATOM   2092 N  N   . GLU B 1 75  ? -35.311 46.880  -3.539  1.00 21.11 ?  68  GLU B N   1 
ATOM   2093 C  CA  . GLU B 1 75  ? -36.027 45.611  -3.539  1.00 22.14 ?  68  GLU B CA  1 
ATOM   2094 C  C   . GLU B 1 75  ? -37.439 45.760  -2.973  1.00 22.63 ?  68  GLU B C   1 
ATOM   2095 O  O   . GLU B 1 75  ? -38.371 45.099  -3.442  1.00 24.55 ?  68  GLU B O   1 
ATOM   2096 C  CB  . GLU B 1 75  ? -35.235 44.576  -2.726  1.00 24.69 ?  68  GLU B CB  1 
ATOM   2097 C  CG  . GLU B 1 75  ? -33.852 44.235  -3.313  1.00 22.11 ?  68  GLU B CG  1 
ATOM   2098 C  CD  . GLU B 1 75  ? -32.736 45.156  -2.803  1.00 26.33 ?  68  GLU B CD  1 
ATOM   2099 O  OE1 . GLU B 1 75  ? -33.025 46.144  -2.094  1.00 24.82 ?  68  GLU B OE1 1 
ATOM   2100 O  OE2 . GLU B 1 75  ? -31.556 44.885  -3.123  1.00 25.07 -1 68  GLU B OE2 1 
ATOM   2101 N  N   . MET B 1 76  ? -37.612 46.606  -1.953  1.00 24.56 ?  69  MET B N   1 
ATOM   2102 C  CA  . MET B 1 76  ? -38.946 46.888  -1.432  1.00 25.09 ?  69  MET B CA  1 
ATOM   2103 C  C   . MET B 1 76  ? -39.710 47.870  -2.313  1.00 27.00 ?  69  MET B C   1 
ATOM   2104 O  O   . MET B 1 76  ? -40.943 47.783  -2.387  1.00 28.05 ?  69  MET B O   1 
ATOM   2105 C  CB  . MET B 1 76  ? -38.850 47.418  0.002   1.00 26.84 ?  69  MET B CB  1 
ATOM   2106 C  CG  . MET B 1 76  ? -38.270 46.408  1.002   1.00 28.98 ?  69  MET B CG  1 
ATOM   2107 S  SD  . MET B 1 76  ? -39.170 44.844  1.045   1.00 31.44 ?  69  MET B SD  1 
ATOM   2108 C  CE  . MET B 1 76  ? -38.215 43.816  -0.086  1.00 33.48 ?  69  MET B CE  1 
ATOM   2109 N  N   . CYS B 1 77  ? -39.011 48.803  -2.972  1.00 27.13 ?  70  CYS B N   1 
ATOM   2110 C  CA  . CYS B 1 77  ? -39.650 49.608  -4.014  1.00 29.09 ?  70  CYS B CA  1 
ATOM   2111 C  C   . CYS B 1 77  ? -40.269 48.706  -5.066  1.00 29.79 ?  70  CYS B C   1 
ATOM   2112 O  O   . CYS B 1 77  ? -41.429 48.888  -5.455  1.00 27.84 ?  70  CYS B O   1 
ATOM   2113 C  CB  . CYS B 1 77  ? -38.645 50.545  -4.680  1.00 31.06 ?  70  CYS B CB  1 
ATOM   2114 S  SG  . CYS B 1 77  ? -38.024 51.867  -3.633  1.00 42.66 ?  70  CYS B SG  1 
ATOM   2115 N  N   . PHE B 1 78  ? -39.503 47.719  -5.532  1.00 23.66 ?  71  PHE B N   1 
ATOM   2116 C  CA  . PHE B 1 78  ? -40.024 46.787  -6.519  1.00 22.64 ?  71  PHE B CA  1 
ATOM   2117 C  C   . PHE B 1 78  ? -41.188 45.978  -5.970  1.00 25.99 ?  71  PHE B C   1 
ATOM   2118 O  O   . PHE B 1 78  ? -42.179 45.743  -6.674  1.00 23.47 ?  71  PHE B O   1 
ATOM   2119 C  CB  . PHE B 1 78  ? -38.926 45.840  -7.004  1.00 25.46 ?  71  PHE B CB  1 
ATOM   2120 C  CG  . PHE B 1 78  ? -39.439 44.803  -7.946  1.00 23.54 ?  71  PHE B CG  1 
ATOM   2121 C  CD1 . PHE B 1 78  ? -39.990 43.622  -7.460  1.00 23.62 ?  71  PHE B CD1 1 
ATOM   2122 C  CD2 . PHE B 1 78  ? -39.462 45.045  -9.310  1.00 26.37 ?  71  PHE B CD2 1 
ATOM   2123 C  CE1 . PHE B 1 78  ? -40.522 42.690  -8.296  1.00 23.49 ?  71  PHE B CE1 1 
ATOM   2124 C  CE2 . PHE B 1 78  ? -39.986 44.100  -10.170 1.00 25.96 ?  71  PHE B CE2 1 
ATOM   2125 C  CZ  . PHE B 1 78  ? -40.519 42.922  -9.663  1.00 26.96 ?  71  PHE B CZ  1 
ATOM   2126 N  N   . LEU B 1 79  ? -41.045 45.444  -4.748  1.00 23.02 ?  72  LEU B N   1 
ATOM   2127 C  CA  . LEU B 1 79  ? -42.077 44.546  -4.244  1.00 24.07 ?  72  LEU B CA  1 
ATOM   2128 C  C   . LEU B 1 79  ? -43.386 45.294  -4.031  1.00 23.05 ?  72  LEU B C   1 
ATOM   2129 O  O   . LEU B 1 79  ? -44.467 44.761  -4.309  1.00 22.80 ?  72  LEU B O   1 
ATOM   2130 C  CB  . LEU B 1 79  ? -41.607 43.894  -2.948  1.00 25.23 ?  72  LEU B CB  1 
ATOM   2131 C  CG  . LEU B 1 79  ? -42.116 42.506  -2.586  1.00 34.28 ?  72  LEU B CG  1 
ATOM   2132 C  CD1 . LEU B 1 79  ? -41.789 41.517  -3.686  1.00 29.68 ?  72  LEU B CD1 1 
ATOM   2133 C  CD2 . LEU B 1 79  ? -41.489 42.065  -1.258  1.00 31.33 ?  72  LEU B CD2 1 
ATOM   2134 N  N   . SER B 1 80  ? -43.305 46.531  -3.534  1.00 24.11 ?  73  SER B N   1 
ATOM   2135 C  CA  . SER B 1 80  ? -44.515 47.329  -3.333  1.00 29.36 ?  73  SER B CA  1 
ATOM   2136 C  C   . SER B 1 80  ? -45.185 47.658  -4.666  1.00 29.29 ?  73  SER B C   1 
ATOM   2137 O  O   . SER B 1 80  ? -46.411 47.568  -4.795  1.00 27.83 ?  73  SER B O   1 
ATOM   2138 C  CB  . SER B 1 80  ? -44.173 48.613  -2.578  1.00 34.17 ?  73  SER B CB  1 
ATOM   2139 O  OG  . SER B 1 80  ? -45.337 49.405  -2.401  1.00 42.68 ?  73  SER B OG  1 
ATOM   2140 N  N   . TRP B 1 81  ? -44.394 48.022  -5.671  1.00 23.22 ?  74  TRP B N   1 
ATOM   2141 C  CA  . TRP B 1 81  ? -44.946 48.254  -7.006  1.00 26.26 ?  74  TRP B CA  1 
ATOM   2142 C  C   . TRP B 1 81  ? -45.562 46.983  -7.597  1.00 25.25 ?  74  TRP B C   1 
ATOM   2143 O  O   . TRP B 1 81  ? -46.647 47.029  -8.195  1.00 25.22 ?  74  TRP B O   1 
ATOM   2144 C  CB  . TRP B 1 81  ? -43.858 48.801  -7.928  1.00 28.75 ?  74  TRP B CB  1 
ATOM   2145 C  CG  . TRP B 1 81  ? -44.271 48.826  -9.376  1.00 28.28 ?  74  TRP B CG  1 
ATOM   2146 C  CD1 . TRP B 1 81  ? -44.945 49.825  -10.025 1.00 32.34 ?  74  TRP B CD1 1 
ATOM   2147 C  CD2 . TRP B 1 81  ? -44.047 47.798  -10.345 1.00 28.59 ?  74  TRP B CD2 1 
ATOM   2148 N  NE1 . TRP B 1 81  ? -45.145 49.483  -11.343 1.00 29.42 ?  74  TRP B NE1 1 
ATOM   2149 C  CE2 . TRP B 1 81  ? -44.602 48.245  -11.565 1.00 35.18 ?  74  TRP B CE2 1 
ATOM   2150 C  CE3 . TRP B 1 81  ? -43.411 46.552  -10.307 1.00 27.57 ?  74  TRP B CE3 1 
ATOM   2151 C  CZ2 . TRP B 1 81  ? -44.556 47.482  -12.729 1.00 32.63 ?  74  TRP B CZ2 1 
ATOM   2152 C  CZ3 . TRP B 1 81  ? -43.365 45.791  -11.460 1.00 35.02 ?  74  TRP B CZ3 1 
ATOM   2153 C  CH2 . TRP B 1 81  ? -43.938 46.259  -12.659 1.00 33.72 ?  74  TRP B CH2 1 
ATOM   2154 N  N   . PHE B 1 82  ? -44.881 45.838  -7.457  1.00 23.55 ?  75  PHE B N   1 
ATOM   2155 C  CA  . PHE B 1 82  ? -45.362 44.594  -8.058  1.00 23.79 ?  75  PHE B CA  1 
ATOM   2156 C  C   . PHE B 1 82  ? -46.682 44.148  -7.436  1.00 25.94 ?  75  PHE B C   1 
ATOM   2157 O  O   . PHE B 1 82  ? -47.620 43.765  -8.145  1.00 24.87 ?  75  PHE B O   1 
ATOM   2158 C  CB  . PHE B 1 82  ? -44.292 43.498  -7.921  1.00 24.08 ?  75  PHE B CB  1 
ATOM   2159 C  CG  . PHE B 1 82  ? -44.655 42.194  -8.586  1.00 26.80 ?  75  PHE B CG  1 
ATOM   2160 C  CD1 . PHE B 1 82  ? -44.387 41.984  -9.936  1.00 28.15 ?  75  PHE B CD1 1 
ATOM   2161 C  CD2 . PHE B 1 82  ? -45.249 41.175  -7.868  1.00 29.73 ?  75  PHE B CD2 1 
ATOM   2162 C  CE1 . PHE B 1 82  ? -44.729 40.789  -10.548 1.00 27.45 ?  75  PHE B CE1 1 
ATOM   2163 C  CE2 . PHE B 1 82  ? -45.594 39.974  -8.483  1.00 29.63 ?  75  PHE B CE2 1 
ATOM   2164 C  CZ  . PHE B 1 82  ? -45.324 39.788  -9.824  1.00 29.45 ?  75  PHE B CZ  1 
ATOM   2165 N  N   . CYS B 1 83  ? -46.777 44.181  -6.105  1.00 22.65 ?  76  CYS B N   1 
ATOM   2166 C  CA  . CYS B 1 83  ? -48.035 43.803  -5.469  1.00 26.51 ?  76  CYS B CA  1 
ATOM   2167 C  C   . CYS B 1 83  ? -49.172 44.755  -5.820  1.00 25.88 ?  76  CYS B C   1 
ATOM   2168 O  O   . CYS B 1 83  ? -50.321 44.325  -5.916  1.00 29.77 ?  76  CYS B O   1 
ATOM   2169 C  CB  . CYS B 1 83  ? -47.852 43.739  -3.959  1.00 28.86 ?  76  CYS B CB  1 
ATOM   2170 S  SG  . CYS B 1 83  ? -46.799 42.364  -3.532  1.00 33.66 ?  76  CYS B SG  1 
ATOM   2171 N  N   . GLY B 1 84  ? -48.878 46.046  -6.000  1.00 26.01 ?  77  GLY B N   1 
ATOM   2172 C  CA  . GLY B 1 84  ? -49.923 47.003  -6.307  1.00 28.27 ?  77  GLY B CA  1 
ATOM   2173 C  C   . GLY B 1 84  ? -50.320 47.058  -7.766  1.00 28.78 ?  77  GLY B C   1 
ATOM   2174 O  O   . GLY B 1 84  ? -51.431 47.493  -8.075  1.00 26.42 ?  77  GLY B O   1 
ATOM   2175 N  N   . ASN B 1 85  ? -49.456 46.604  -8.666  1.00 26.47 ?  78  ASN B N   1 
ATOM   2176 C  CA  . ASN B 1 85  ? -49.652 46.847  -10.090 1.00 27.19 ?  78  ASN B CA  1 
ATOM   2177 C  C   . ASN B 1 85  ? -49.622 45.604  -10.950 1.00 31.00 ?  78  ASN B C   1 
ATOM   2178 O  O   . ASN B 1 85  ? -50.161 45.646  -12.060 1.00 34.49 ?  78  ASN B O   1 
ATOM   2179 C  CB  . ASN B 1 85  ? -48.606 47.837  -10.606 1.00 27.52 ?  78  ASN B CB  1 
ATOM   2180 C  CG  . ASN B 1 85  ? -48.786 49.215  -10.014 1.00 30.70 ?  78  ASN B CG  1 
ATOM   2181 O  OD1 . ASN B 1 85  ? -49.614 50.000  -10.480 1.00 29.90 ?  78  ASN B OD1 1 
ATOM   2182 N  ND2 . ASN B 1 85  ? -48.048 49.502  -8.952  1.00 28.19 ?  78  ASN B ND2 1 
ATOM   2183 N  N   . GLN B 1 86  ? -49.023 44.508  -10.494 1.00 29.88 ?  79  GLN B N   1 
ATOM   2184 C  CA  . GLN B 1 86  ? -49.058 43.251  -11.227 1.00 29.88 ?  79  GLN B CA  1 
ATOM   2185 C  C   . GLN B 1 86  ? -49.971 42.227  -10.588 1.00 35.38 ?  79  GLN B C   1 
ATOM   2186 O  O   . GLN B 1 86  ? -50.414 41.304  -11.275 1.00 37.36 ?  79  GLN B O   1 
ATOM   2187 C  CB  . GLN B 1 86  ? -47.655 42.641  -11.332 1.00 30.62 ?  79  GLN B CB  1 
ATOM   2188 C  CG  . GLN B 1 86  ? -46.662 43.472  -12.109 1.00 32.11 ?  79  GLN B CG  1 
ATOM   2189 C  CD  . GLN B 1 86  ? -47.087 43.681  -13.544 1.00 41.22 ?  79  GLN B CD  1 
ATOM   2190 O  OE1 . GLN B 1 86  ? -47.743 42.824  -14.141 1.00 41.31 ?  79  GLN B OE1 1 
ATOM   2191 N  NE2 . GLN B 1 86  ? -46.734 44.837  -14.103 1.00 42.92 ?  79  GLN B NE2 1 
ATOM   2192 N  N   . LEU B 1 87  ? -50.249 42.374  -9.299  1.00 35.62 ?  80  LEU B N   1 
ATOM   2193 C  CA  . LEU B 1 87  ? -51.143 41.503  -8.554  1.00 35.98 ?  80  LEU B CA  1 
ATOM   2194 C  C   . LEU B 1 87  ? -52.366 42.336  -8.169  1.00 37.35 ?  80  LEU B C   1 
ATOM   2195 O  O   . LEU B 1 87  ? -52.265 43.559  -8.033  1.00 41.42 ?  80  LEU B O   1 
ATOM   2196 C  CB  . LEU B 1 87  ? -50.438 40.942  -7.305  1.00 36.63 ?  80  LEU B CB  1 
ATOM   2197 C  CG  . LEU B 1 87  ? -49.117 40.202  -7.506  1.00 33.86 ?  80  LEU B CG  1 
ATOM   2198 C  CD1 . LEU B 1 87  ? -48.516 39.763  -6.162  1.00 34.58 ?  80  LEU B CD1 1 
ATOM   2199 C  CD2 . LEU B 1 87  ? -49.308 39.011  -8.426  1.00 34.49 ?  80  LEU B CD2 1 
ATOM   2200 N  N   . PRO B 1 88  ? -53.521 41.693  -7.973  1.00 38.49 ?  81  PRO B N   1 
ATOM   2201 C  CA  . PRO B 1 88  ? -53.748 40.245  -8.014  1.00 39.39 ?  81  PRO B CA  1 
ATOM   2202 C  C   . PRO B 1 88  ? -53.769 39.702  -9.431  1.00 38.49 ?  81  PRO B C   1 
ATOM   2203 O  O   . PRO B 1 88  ? -54.335 40.339  -10.319 1.00 42.04 ?  81  PRO B O   1 
ATOM   2204 C  CB  . PRO B 1 88  ? -55.119 40.093  -7.356  1.00 39.58 ?  81  PRO B CB  1 
ATOM   2205 C  CG  . PRO B 1 88  ? -55.823 41.363  -7.721  1.00 42.15 ?  81  PRO B CG  1 
ATOM   2206 C  CD  . PRO B 1 88  ? -54.762 42.435  -7.684  1.00 39.16 ?  81  PRO B CD  1 
ATOM   2207 N  N   . ALA B 1 89  ? -53.143 38.545  -9.626  1.00 37.76 ?  82  ALA B N   1 
ATOM   2208 C  CA  . ALA B 1 89  ? -53.170 37.853  -10.906 1.00 42.94 ?  82  ALA B CA  1 
ATOM   2209 C  C   . ALA B 1 89  ? -52.753 36.410  -10.675 1.00 46.06 ?  82  ALA B C   1 
ATOM   2210 O  O   . ALA B 1 89  ? -52.000 36.107  -9.743  1.00 50.12 ?  82  ALA B O   1 
ATOM   2211 C  CB  . ALA B 1 89  ? -52.260 38.521  -11.945 1.00 41.81 ?  82  ALA B CB  1 
ATOM   2212 N  N   . ASP B 1 90  ? -53.259 35.531  -11.534 1.00 45.25 ?  83  ASP B N   1 
ATOM   2213 C  CA  . ASP B 1 90  ? -53.032 34.095  -11.448 1.00 46.08 ?  83  ASP B CA  1 
ATOM   2214 C  C   . ASP B 1 90  ? -51.905 33.615  -12.347 1.00 47.88 ?  83  ASP B C   1 
ATOM   2215 O  O   . ASP B 1 90  ? -51.545 32.437  -12.287 1.00 56.83 ?  83  ASP B O   1 
ATOM   2216 C  CB  . ASP B 1 90  ? -54.318 33.346  -11.808 1.00 50.69 ?  83  ASP B CB  1 
ATOM   2217 C  CG  . ASP B 1 90  ? -55.384 33.492  -10.753 1.00 47.70 ?  83  ASP B CG  1 
ATOM   2218 O  OD1 . ASP B 1 90  ? -55.055 33.292  -9.562  1.00 54.22 ?  83  ASP B OD1 1 
ATOM   2219 O  OD2 . ASP B 1 90  ? -56.539 33.825  -11.107 1.00 45.51 -1 83  ASP B OD2 1 
ATOM   2220 N  N   . LYS B 1 91  ? -51.349 34.492  -13.176 1.00 41.92 ?  84  LYS B N   1 
ATOM   2221 C  CA  . LYS B 1 91  ? -50.344 34.107  -14.148 1.00 41.38 ?  84  LYS B CA  1 
ATOM   2222 C  C   . LYS B 1 91  ? -49.105 33.534  -13.464 1.00 41.68 ?  84  LYS B C   1 
ATOM   2223 O  O   . LYS B 1 91  ? -48.830 33.793  -12.289 1.00 39.26 ?  84  LYS B O   1 
ATOM   2224 C  CB  . LYS B 1 91  ? -49.968 35.317  -15.001 1.00 43.57 ?  84  LYS B CB  1 
ATOM   2225 C  CG  . LYS B 1 91  ? -51.093 35.815  -15.889 1.00 45.22 ?  84  LYS B CG  1 
ATOM   2226 C  CD  . LYS B 1 91  ? -51.478 34.722  -16.856 1.00 47.45 ?  84  LYS B CD  1 
ATOM   2227 C  CE  . LYS B 1 91  ? -52.495 35.195  -17.887 1.00 56.09 ?  84  LYS B CE  1 
ATOM   2228 N  NZ  . LYS B 1 91  ? -52.596 34.199  -18.997 1.00 53.26 1  84  LYS B NZ  1 
ATOM   2229 N  N   . CYS B 1 92  ? -48.373 32.712  -14.214 1.00 40.30 ?  85  CYS B N   1 
ATOM   2230 C  CA  . CYS B 1 92  ? -47.018 32.327  -13.836 1.00 42.11 ?  85  CYS B CA  1 
ATOM   2231 C  C   . CYS B 1 92  ? -46.080 33.459  -14.219 1.00 38.14 ?  85  CYS B C   1 
ATOM   2232 O  O   . CYS B 1 92  ? -45.945 33.782  -15.402 1.00 37.84 ?  85  CYS B O   1 
ATOM   2233 C  CB  . CYS B 1 92  ? -46.597 31.032  -14.528 1.00 43.36 ?  85  CYS B CB  1 
ATOM   2234 S  SG  . CYS B 1 92  ? -47.114 29.508  -13.707 1.00 68.20 ?  85  CYS B SG  1 
ATOM   2235 N  N   . PHE B 1 93  ? -45.452 34.075  -13.228 1.00 33.48 ?  86  PHE B N   1 
ATOM   2236 C  CA  . PHE B 1 93  ? -44.540 35.178  -13.465 1.00 32.34 ?  86  PHE B CA  1 
ATOM   2237 C  C   . PHE B 1 93  ? -43.109 34.689  -13.315 1.00 31.57 ?  86  PHE B C   1 
ATOM   2238 O  O   . PHE B 1 93  ? -42.779 33.979  -12.360 1.00 35.30 ?  86  PHE B O   1 
ATOM   2239 C  CB  . PHE B 1 93  ? -44.777 36.329  -12.486 1.00 34.99 ?  86  PHE B CB  1 
ATOM   2240 C  CG  . PHE B 1 93  ? -46.102 37.023  -12.638 1.00 31.90 ?  86  PHE B CG  1 
ATOM   2241 C  CD1 . PHE B 1 93  ? -46.307 37.940  -13.647 1.00 36.17 ?  86  PHE B CD1 1 
ATOM   2242 C  CD2 . PHE B 1 93  ? -47.120 36.807  -11.715 1.00 37.82 ?  86  PHE B CD2 1 
ATOM   2243 C  CE1 . PHE B 1 93  ? -47.514 38.608  -13.765 1.00 39.59 ?  86  PHE B CE1 1 
ATOM   2244 C  CE2 . PHE B 1 93  ? -48.325 37.472  -11.824 1.00 37.33 ?  86  PHE B CE2 1 
ATOM   2245 C  CZ  . PHE B 1 93  ? -48.522 38.375  -12.854 1.00 36.91 ?  86  PHE B CZ  1 
ATOM   2246 N  N   . GLN B 1 94  ? -42.262 35.060  -14.257 1.00 27.45 ?  87  GLN B N   1 
ATOM   2247 C  CA  . GLN B 1 94  ? -40.824 34.943  -14.068 1.00 31.63 ?  87  GLN B CA  1 
ATOM   2248 C  C   . GLN B 1 94  ? -40.263 36.350  -13.949 1.00 33.36 ?  87  GLN B C   1 
ATOM   2249 O  O   . GLN B 1 94  ? -40.340 37.133  -14.901 1.00 32.55 ?  87  GLN B O   1 
ATOM   2250 C  CB  . GLN B 1 94  ? -40.155 34.186  -15.212 1.00 38.28 ?  87  GLN B CB  1 
ATOM   2251 C  CG  . GLN B 1 94  ? -38.637 34.157  -15.072 1.00 43.32 ?  87  GLN B CG  1 
ATOM   2252 C  CD  . GLN B 1 94  ? -37.926 33.980  -16.397 1.00 53.84 ?  87  GLN B CD  1 
ATOM   2253 O  OE1 . GLN B 1 94  ? -37.635 32.855  -16.810 1.00 61.41 ?  87  GLN B OE1 1 
ATOM   2254 N  NE2 . GLN B 1 94  ? -37.640 35.094  -17.073 1.00 52.10 ?  87  GLN B NE2 1 
ATOM   2255 N  N   . ILE B 1 95  ? -39.713 36.673  -12.781 1.00 26.78 ?  88  ILE B N   1 
ATOM   2256 C  CA  . ILE B 1 95  ? -39.125 37.982  -12.534 1.00 24.86 ?  88  ILE B CA  1 
ATOM   2257 C  C   . ILE B 1 95  ? -37.617 37.859  -12.668 1.00 29.82 ?  88  ILE B C   1 
ATOM   2258 O  O   . ILE B 1 95  ? -36.998 36.999  -12.028 1.00 26.52 ?  88  ILE B O   1 
ATOM   2259 C  CB  . ILE B 1 95  ? -39.494 38.523  -11.143 1.00 24.77 ?  88  ILE B CB  1 
ATOM   2260 C  CG1 . ILE B 1 95  ? -41.013 38.541  -10.940 1.00 30.20 ?  88  ILE B CG1 1 
ATOM   2261 C  CG2 . ILE B 1 95  ? -38.906 39.919  -10.981 1.00 25.78 ?  88  ILE B CG2 1 
ATOM   2262 C  CD1 . ILE B 1 95  ? -41.419 39.002  -9.543  1.00 29.10 ?  88  ILE B CD1 1 
ATOM   2263 N  N   . THR B 1 96  ? -37.026 38.713  -13.495 1.00 26.73 ?  89  THR B N   1 
ATOM   2264 C  CA  . THR B 1 96  ? -35.579 38.794  -13.644 1.00 26.10 ?  89  THR B CA  1 
ATOM   2265 C  C   . THR B 1 96  ? -35.118 40.159  -13.171 1.00 24.12 ?  89  THR B C   1 
ATOM   2266 O  O   . THR B 1 96  ? -35.657 41.182  -13.600 1.00 26.53 ?  89  THR B O   1 
ATOM   2267 C  CB  . THR B 1 96  ? -35.167 38.566  -15.100 1.00 31.32 ?  89  THR B CB  1 
ATOM   2268 O  OG1 . THR B 1 96  ? -35.421 37.200  -15.430 1.00 34.63 ?  89  THR B OG1 1 
ATOM   2269 C  CG2 . THR B 1 96  ? -33.691 38.847  -15.287 1.00 33.48 ?  89  THR B CG2 1 
ATOM   2270 N  N   . TRP B 1 97  ? -34.148 40.179  -12.262 1.00 23.11 ?  90  TRP B N   1 
ATOM   2271 C  CA  . TRP B 1 97  ? -33.532 41.420  -11.824 1.00 23.00 ?  90  TRP B CA  1 
ATOM   2272 C  C   . TRP B 1 97  ? -32.094 41.488  -12.303 1.00 25.03 ?  90  TRP B C   1 
ATOM   2273 O  O   . TRP B 1 97  ? -31.366 40.488  -12.280 1.00 24.58 ?  90  TRP B O   1 
ATOM   2274 C  CB  . TRP B 1 97  ? -33.499 41.570  -10.297 1.00 23.16 ?  90  TRP B CB  1 
ATOM   2275 C  CG  . TRP B 1 97  ? -34.780 41.803  -9.608  1.00 24.48 ?  90  TRP B CG  1 
ATOM   2276 C  CD1 . TRP B 1 97  ? -36.013 42.003  -10.172 1.00 24.51 ?  90  TRP B CD1 1 
ATOM   2277 C  CD2 . TRP B 1 97  ? -34.966 41.867  -8.191  1.00 21.18 ?  90  TRP B CD2 1 
ATOM   2278 N  NE1 . TRP B 1 97  ? -36.959 42.186  -9.175  1.00 25.47 ?  90  TRP B NE1 1 
ATOM   2279 C  CE2 . TRP B 1 97  ? -36.338 42.109  -7.954  1.00 24.09 ?  90  TRP B CE2 1 
ATOM   2280 C  CE3 . TRP B 1 97  ? -34.099 41.753  -7.094  1.00 24.04 ?  90  TRP B CE3 1 
ATOM   2281 C  CZ2 . TRP B 1 97  ? -36.866 42.228  -6.662  1.00 22.63 ?  90  TRP B CZ2 1 
ATOM   2282 C  CZ3 . TRP B 1 97  ? -34.624 41.871  -5.815  1.00 24.34 ?  90  TRP B CZ3 1 
ATOM   2283 C  CH2 . TRP B 1 97  ? -35.993 42.100  -5.608  1.00 24.69 ?  90  TRP B CH2 1 
ATOM   2284 N  N   . PHE B 1 98  ? -31.682 42.686  -12.690 1.00 24.16 ?  91  PHE B N   1 
ATOM   2285 C  CA  . PHE B 1 98  ? -30.276 43.013  -12.876 1.00 27.99 ?  91  PHE B CA  1 
ATOM   2286 C  C   . PHE B 1 98  ? -29.962 44.107  -11.877 1.00 22.03 ?  91  PHE B C   1 
ATOM   2287 O  O   . PHE B 1 98  ? -30.442 45.234  -12.025 1.00 27.61 ?  91  PHE B O   1 
ATOM   2288 C  CB  . PHE B 1 98  ? -30.016 43.459  -14.307 1.00 29.26 ?  91  PHE B CB  1 
ATOM   2289 C  CG  . PHE B 1 98  ? -30.421 42.440  -15.315 1.00 29.00 ?  91  PHE B CG  1 
ATOM   2290 C  CD1 . PHE B 1 98  ? -29.639 41.330  -15.536 1.00 30.05 ?  91  PHE B CD1 1 
ATOM   2291 C  CD2 . PHE B 1 98  ? -31.604 42.572  -16.013 1.00 34.78 ?  91  PHE B CD2 1 
ATOM   2292 C  CE1 . PHE B 1 98  ? -30.008 40.381  -16.466 1.00 32.77 ?  91  PHE B CE1 1 
ATOM   2293 C  CE2 . PHE B 1 98  ? -31.985 41.626  -16.935 1.00 37.98 ?  91  PHE B CE2 1 
ATOM   2294 C  CZ  . PHE B 1 98  ? -31.176 40.528  -17.165 1.00 34.33 ?  91  PHE B CZ  1 
ATOM   2295 N  N   . VAL B 1 99  ? -29.182 43.779  -10.853 1.00 24.99 ?  92  VAL B N   1 
ATOM   2296 C  CA  . VAL B 1 99  ? -29.030 44.675  -9.712  1.00 22.17 ?  92  VAL B CA  1 
ATOM   2297 C  C   . VAL B 1 99  ? -27.562 45.019  -9.523  1.00 19.87 ?  92  VAL B C   1 
ATOM   2298 O  O   . VAL B 1 99  ? -26.673 44.211  -9.787  1.00 23.02 ?  92  VAL B O   1 
ATOM   2299 C  CB  . VAL B 1 99  ? -29.597 44.074  -8.408  1.00 26.05 ?  92  VAL B CB  1 
ATOM   2300 C  CG1 . VAL B 1 99  ? -31.079 43.837  -8.529  1.00 28.46 ?  92  VAL B CG1 1 
ATOM   2301 C  CG2 . VAL B 1 99  ? -28.872 42.790  -8.047  1.00 23.04 ?  92  VAL B CG2 1 
ATOM   2302 N  N   . SER B 1 100 ? -27.316 46.223  -9.031  1.00 21.17 ?  93  SER B N   1 
ATOM   2303 C  CA  . SER B 1 100 ? -25.934 46.632  -8.833  1.00 20.62 ?  93  SER B CA  1 
ATOM   2304 C  C   . SER B 1 100 ? -25.367 46.066  -7.536  1.00 23.72 ?  93  SER B C   1 
ATOM   2305 O  O   . SER B 1 100 ? -24.162 45.810  -7.462  1.00 23.46 ?  93  SER B O   1 
ATOM   2306 C  CB  . SER B 1 100 ? -25.830 48.157  -8.888  1.00 22.20 ?  93  SER B CB  1 
ATOM   2307 O  OG  . SER B 1 100 ? -26.650 48.809  -7.924  1.00 23.10 ?  93  SER B OG  1 
ATOM   2308 N  N   . TRP B 1 101 ? -26.219 45.826  -6.529  1.00 21.64 ?  94  TRP B N   1 
ATOM   2309 C  CA  . TRP B 1 101 ? -25.838 45.119  -5.306  1.00 21.99 ?  94  TRP B CA  1 
ATOM   2310 C  C   . TRP B 1 101 ? -26.862 44.025  -5.035  1.00 21.28 ?  94  TRP B C   1 
ATOM   2311 O  O   . TRP B 1 101 ? -28.039 44.191  -5.356  1.00 20.18 ?  94  TRP B O   1 
ATOM   2312 C  CB  . TRP B 1 101 ? -25.819 46.035  -4.078  1.00 19.68 ?  94  TRP B CB  1 
ATOM   2313 C  CG  . TRP B 1 101 ? -24.903 47.217  -4.074  1.00 21.81 ?  94  TRP B CG  1 
ATOM   2314 C  CD1 . TRP B 1 101 ? -25.249 48.521  -4.282  1.00 22.89 ?  94  TRP B CD1 1 
ATOM   2315 C  CD2 . TRP B 1 101 ? -23.498 47.218  -3.772  1.00 23.53 ?  94  TRP B CD2 1 
ATOM   2316 N  NE1 . TRP B 1 101 ? -24.144 49.334  -4.150  1.00 25.25 ?  94  TRP B NE1 1 
ATOM   2317 C  CE2 . TRP B 1 101 ? -23.058 48.562  -3.831  1.00 24.73 ?  94  TRP B CE2 1 
ATOM   2318 C  CE3 . TRP B 1 101 ? -22.566 46.213  -3.482  1.00 20.80 ?  94  TRP B CE3 1 
ATOM   2319 C  CZ2 . TRP B 1 101 ? -21.722 48.927  -3.602  1.00 20.44 ?  94  TRP B CZ2 1 
ATOM   2320 C  CZ3 . TRP B 1 101 ? -21.223 46.585  -3.251  1.00 22.02 ?  94  TRP B CZ3 1 
ATOM   2321 C  CH2 . TRP B 1 101 ? -20.827 47.921  -3.310  1.00 21.16 ?  94  TRP B CH2 1 
ATOM   2322 N  N   . THR B 1 102 ? -26.439 42.927  -4.394  1.00 21.09 ?  95  THR B N   1 
ATOM   2323 C  CA  . THR B 1 102 ? -27.415 41.932  -3.913  1.00 24.10 ?  95  THR B CA  1 
ATOM   2324 C  C   . THR B 1 102 ? -28.206 42.511  -2.729  1.00 24.35 ?  95  THR B C   1 
ATOM   2325 O  O   . THR B 1 102 ? -27.862 43.578  -2.205  1.00 21.62 ?  95  THR B O   1 
ATOM   2326 C  CB  . THR B 1 102 ? -26.727 40.609  -3.537  1.00 22.22 ?  95  THR B CB  1 
ATOM   2327 O  OG1 . THR B 1 102 ? -25.668 40.826  -2.602  1.00 21.75 ?  95  THR B OG1 1 
ATOM   2328 C  CG2 . THR B 1 102 ? -26.165 39.890  -4.776  1.00 24.80 ?  95  THR B CG2 1 
ATOM   2329 N  N   . PRO B 1 103 ? -29.306 41.853  -2.316  1.00 22.04 ?  96  PRO B N   1 
ATOM   2330 C  CA  . PRO B 1 103 ? -30.168 42.427  -1.270  1.00 21.54 ?  96  PRO B CA  1 
ATOM   2331 C  C   . PRO B 1 103 ? -29.590 42.303  0.129   1.00 24.48 ?  96  PRO B C   1 
ATOM   2332 O  O   . PRO B 1 103 ? -28.845 41.373  0.444   1.00 25.00 ?  96  PRO B O   1 
ATOM   2333 C  CB  . PRO B 1 103 ? -31.455 41.589  -1.368  1.00 21.90 ?  96  PRO B CB  1 
ATOM   2334 C  CG  . PRO B 1 103 ? -31.451 41.019  -2.767  1.00 24.21 ?  96  PRO B CG  1 
ATOM   2335 C  CD  . PRO B 1 103 ? -29.977 40.724  -2.986  1.00 23.58 ?  96  PRO B CD  1 
ATOM   2336 N  N   . CYS B 1 104 ? -29.972 43.261  0.974   1.00 23.17 ?  97  CYS B N   1 
ATOM   2337 C  CA  . CYS B 1 104 ? -29.639 43.216  2.389   1.00 23.10 ?  97  CYS B CA  1 
ATOM   2338 C  C   . CYS B 1 104 ? -30.390 42.067  3.056   1.00 25.32 ?  97  CYS B C   1 
ATOM   2339 O  O   . CYS B 1 104 ? -31.340 41.520  2.483   1.00 22.52 ?  97  CYS B O   1 
ATOM   2340 C  CB  . CYS B 1 104 ? -29.980 44.551  3.049   1.00 22.18 ?  97  CYS B CB  1 
ATOM   2341 S  SG  . CYS B 1 104 ? -31.710 44.795  3.582   1.00 22.84 ?  97  CYS B SG  1 
ATOM   2342 N  N   . PRO B 1 105 ? -29.969 41.667  4.265   1.00 23.29 ?  98  PRO B N   1 
ATOM   2343 C  CA  . PRO B 1 105 ? -30.615 40.515  4.914   1.00 26.67 ?  98  PRO B CA  1 
ATOM   2344 C  C   . PRO B 1 105 ? -32.083 40.729  5.212   1.00 24.11 ?  98  PRO B C   1 
ATOM   2345 O  O   . PRO B 1 105 ? -32.856 39.767  5.157   1.00 24.88 ?  98  PRO B O   1 
ATOM   2346 C  CB  . PRO B 1 105 ? -29.798 40.337  6.201   1.00 27.54 ?  98  PRO B CB  1 
ATOM   2347 C  CG  . PRO B 1 105 ? -28.436 40.836  5.819   1.00 28.96 ?  98  PRO B CG  1 
ATOM   2348 C  CD  . PRO B 1 105 ? -28.728 42.060  4.956   1.00 25.95 ?  98  PRO B CD  1 
ATOM   2349 N  N   . ASP B 1 106 ? -32.500 41.954  5.532   1.00 22.43 ?  99  ASP B N   1 
ATOM   2350 C  CA  . ASP B 1 106 ? -33.919 42.180  5.783   1.00 27.33 ?  99  ASP B CA  1 
ATOM   2351 C  C   . ASP B 1 106 ? -34.736 42.036  4.501   1.00 25.15 ?  99  ASP B C   1 
ATOM   2352 O  O   . ASP B 1 106 ? -35.842 41.483  4.520   1.00 23.85 ?  99  ASP B O   1 
ATOM   2353 C  CB  . ASP B 1 106 ? -34.136 43.554  6.406   1.00 28.04 ?  99  ASP B CB  1 
ATOM   2354 C  CG  . ASP B 1 106 ? -33.671 43.624  7.851   1.00 42.24 ?  99  ASP B CG  1 
ATOM   2355 O  OD1 . ASP B 1 106 ? -33.791 42.612  8.585   1.00 43.39 ?  99  ASP B OD1 1 
ATOM   2356 O  OD2 . ASP B 1 106 ? -33.193 44.702  8.251   1.00 45.68 -1 99  ASP B OD2 1 
ATOM   2357 N  N   . CYS B 1 107 ? -34.208 42.500  3.366   1.00 22.93 ?  100 CYS B N   1 
ATOM   2358 C  CA  . CYS B 1 107 ? -34.954 42.304  2.127   1.00 23.43 ?  100 CYS B CA  1 
ATOM   2359 C  C   . CYS B 1 107 ? -34.917 40.847  1.678   1.00 25.25 ?  100 CYS B C   1 
ATOM   2360 O  O   . CYS B 1 107 ? -35.879 40.364  1.084   1.00 23.79 ?  100 CYS B O   1 
ATOM   2361 C  CB  . CYS B 1 107 ? -34.438 43.238  1.029   1.00 22.72 ?  100 CYS B CB  1 
ATOM   2362 S  SG  . CYS B 1 107 ? -34.881 44.996  1.355   1.00 24.82 ?  100 CYS B SG  1 
ATOM   2363 N  N   . VAL B 1 108 ? -33.857 40.108  2.007   1.00 21.53 ?  101 VAL B N   1 
ATOM   2364 C  CA  . VAL B 1 108 ? -33.865 38.670  1.747   1.00 23.78 ?  101 VAL B CA  1 
ATOM   2365 C  C   . VAL B 1 108 ? -35.038 38.008  2.452   1.00 24.86 ?  101 VAL B C   1 
ATOM   2366 O  O   . VAL B 1 108 ? -35.726 37.154  1.879   1.00 24.44 ?  101 VAL B O   1 
ATOM   2367 C  CB  . VAL B 1 108 ? -32.537 38.029  2.185   1.00 26.27 ?  101 VAL B CB  1 
ATOM   2368 C  CG1 . VAL B 1 108 ? -32.736 36.517  2.368   1.00 25.52 ?  101 VAL B CG1 1 
ATOM   2369 C  CG2 . VAL B 1 108 ? -31.477 38.286  1.151   1.00 23.45 ?  101 VAL B CG2 1 
ATOM   2370 N  N   . ALA B 1 109 ? -35.262 38.370  3.715   1.00 26.11 ?  102 ALA B N   1 
ATOM   2371 C  CA  . ALA B 1 109 ? -36.356 37.774  4.472   1.00 30.58 ?  102 ALA B CA  1 
ATOM   2372 C  C   . ALA B 1 109 ? -37.700 38.095  3.834   1.00 26.31 ?  102 ALA B C   1 
ATOM   2373 O  O   . ALA B 1 109 ? -38.537 37.206  3.663   1.00 27.92 ?  102 ALA B O   1 
ATOM   2374 C  CB  . ALA B 1 109 ? -36.308 38.246  5.928   1.00 28.48 ?  102 ALA B CB  1 
ATOM   2375 N  N   . LYS B 1 110 ? -37.935 39.368  3.483   1.00 25.51 ?  103 LYS B N   1 
ATOM   2376 C  CA  . LYS B 1 110 ? -39.206 39.726  2.851   1.00 24.45 ?  103 LYS B CA  1 
ATOM   2377 C  C   . LYS B 1 110 ? -39.379 39.028  1.510   1.00 25.29 ?  103 LYS B C   1 
ATOM   2378 O  O   . LYS B 1 110 ? -40.490 38.610  1.157   1.00 22.48 ?  103 LYS B O   1 
ATOM   2379 C  CB  . LYS B 1 110 ? -39.314 41.237  2.643   1.00 25.80 ?  103 LYS B CB  1 
ATOM   2380 C  CG  . LYS B 1 110 ? -39.510 42.056  3.888   1.00 35.91 ?  103 LYS B CG  1 
ATOM   2381 C  CD  . LYS B 1 110 ? -40.919 41.881  4.433   1.00 34.96 ?  103 LYS B CD  1 
ATOM   2382 C  CE  . LYS B 1 110 ? -41.139 42.771  5.637   1.00 33.10 ?  103 LYS B CE  1 
ATOM   2383 N  NZ  . LYS B 1 110 ? -42.291 42.240  6.413   1.00 35.24 1  103 LYS B NZ  1 
ATOM   2384 N  N   . LEU B 1 111 ? -38.306 38.953  0.713   1.00 23.86 ?  104 LEU B N   1 
ATOM   2385 C  CA  . LEU B 1 111 ? -38.401 38.298  -0.590  1.00 24.90 ?  104 LEU B CA  1 
ATOM   2386 C  C   . LEU B 1 111 ? -38.638 36.806  -0.438  1.00 25.04 ?  104 LEU B C   1 
ATOM   2387 O  O   . LEU B 1 111 ? -39.425 36.214  -1.189  1.00 23.46 ?  104 LEU B O   1 
ATOM   2388 C  CB  . LEU B 1 111 ? -37.129 38.546  -1.405  1.00 21.65 ?  104 LEU B CB  1 
ATOM   2389 C  CG  . LEU B 1 111 ? -36.905 40.013  -1.798  1.00 26.97 ?  104 LEU B CG  1 
ATOM   2390 C  CD1 . LEU B 1 111 ? -35.488 40.259  -2.346  1.00 25.15 ?  104 LEU B CD1 1 
ATOM   2391 C  CD2 . LEU B 1 111 ? -37.961 40.446  -2.827  1.00 27.33 ?  104 LEU B CD2 1 
ATOM   2392 N  N   . ALA B 1 112 ? -37.948 36.176  0.521   1.00 24.18 ?  105 ALA B N   1 
ATOM   2393 C  CA  . ALA B 1 112 ? -38.155 34.751  0.760   1.00 24.99 ?  105 ALA B CA  1 
ATOM   2394 C  C   . ALA B 1 112 ? -39.588 34.474  1.198   1.00 23.75 ?  105 ALA B C   1 
ATOM   2395 O  O   . ALA B 1 112 ? -40.206 33.500  0.750   1.00 26.84 ?  105 ALA B O   1 
ATOM   2396 C  CB  . ALA B 1 112 ? -37.168 34.244  1.822   1.00 24.67 ?  105 ALA B CB  1 
ATOM   2397 N  N   . GLU B 1 113 ? -40.129 35.310  2.085   1.00 26.09 ?  106 GLU B N   1 
ATOM   2398 C  CA  . GLU B 1 113 ? -41.523 35.143  2.489   1.00 28.34 ?  106 GLU B CA  1 
ATOM   2399 C  C   . GLU B 1 113 ? -42.461 35.322  1.305   1.00 28.18 ?  106 GLU B C   1 
ATOM   2400 O  O   . GLU B 1 113 ? -43.421 34.558  1.132   1.00 27.03 ?  106 GLU B O   1 
ATOM   2401 C  CB  . GLU B 1 113 ? -41.879 36.144  3.582   1.00 30.31 ?  106 GLU B CB  1 
ATOM   2402 C  CG  . GLU B 1 113 ? -41.087 36.015  4.858   1.00 35.29 ?  106 GLU B CG  1 
ATOM   2403 C  CD  . GLU B 1 113 ? -41.364 37.189  5.795   1.00 45.53 ?  106 GLU B CD  1 
ATOM   2404 O  OE1 . GLU B 1 113 ? -42.558 37.505  6.017   1.00 56.05 ?  106 GLU B OE1 1 
ATOM   2405 O  OE2 . GLU B 1 113 ? -40.402 37.818  6.285   1.00 47.55 -1 106 GLU B OE2 1 
ATOM   2406 N  N   . PHE B 1 114 ? -42.212 36.355  0.492   1.00 23.93 ?  107 PHE B N   1 
ATOM   2407 C  CA  . PHE B 1 114 ? -43.031 36.595  -0.693  1.00 24.33 ?  107 PHE B CA  1 
ATOM   2408 C  C   . PHE B 1 114 ? -43.032 35.383  -1.621  1.00 25.47 ?  107 PHE B C   1 
ATOM   2409 O  O   . PHE B 1 114 ? -44.088 34.941  -2.088  1.00 27.11 ?  107 PHE B O   1 
ATOM   2410 C  CB  . PHE B 1 114 ? -42.524 37.847  -1.412  1.00 22.00 ?  107 PHE B CB  1 
ATOM   2411 C  CG  . PHE B 1 114 ? -43.158 38.073  -2.750  1.00 27.75 ?  107 PHE B CG  1 
ATOM   2412 C  CD1 . PHE B 1 114 ? -44.438 38.606  -2.845  1.00 29.83 ?  107 PHE B CD1 1 
ATOM   2413 C  CD2 . PHE B 1 114 ? -42.466 37.768  -3.918  1.00 30.37 ?  107 PHE B CD2 1 
ATOM   2414 C  CE1 . PHE B 1 114 ? -45.032 38.810  -4.089  1.00 30.76 ?  107 PHE B CE1 1 
ATOM   2415 C  CE2 . PHE B 1 114 ? -43.055 37.984  -5.170  1.00 30.30 ?  107 PHE B CE2 1 
ATOM   2416 C  CZ  . PHE B 1 114 ? -44.341 38.503  -5.243  1.00 28.14 ?  107 PHE B CZ  1 
ATOM   2417 N  N   . LEU B 1 115 ? -41.855 34.819  -1.889  1.00 25.59 ?  108 LEU B N   1 
ATOM   2418 C  CA  . LEU B 1 115 ? -41.771 33.663  -2.778  1.00 24.05 ?  108 LEU B CA  1 
ATOM   2419 C  C   . LEU B 1 115 ? -42.476 32.441  -2.197  1.00 25.93 ?  108 LEU B C   1 
ATOM   2420 O  O   . LEU B 1 115 ? -43.103 31.674  -2.938  1.00 28.67 ?  108 LEU B O   1 
ATOM   2421 C  CB  . LEU B 1 115 ? -40.313 33.326  -3.064  1.00 24.05 ?  108 LEU B CB  1 
ATOM   2422 C  CG  . LEU B 1 115 ? -39.581 34.300  -3.975  1.00 29.49 ?  108 LEU B CG  1 
ATOM   2423 C  CD1 . LEU B 1 115 ? -38.126 33.858  -4.039  1.00 26.13 ?  108 LEU B CD1 1 
ATOM   2424 C  CD2 . LEU B 1 115 ? -40.213 34.342  -5.380  1.00 27.22 ?  108 LEU B CD2 1 
ATOM   2425 N  N   . SER B 1 116 ? -42.369 32.228  -0.885  1.00 26.89 ?  109 SER B N   1 
ATOM   2426 C  CA  . SER B 1 116 ? -43.025 31.072  -0.286  1.00 29.04 ?  109 SER B CA  1 
ATOM   2427 C  C   . SER B 1 116 ? -44.544 31.199  -0.332  1.00 31.56 ?  109 SER B C   1 
ATOM   2428 O  O   . SER B 1 116 ? -45.241 30.183  -0.378  1.00 33.61 ?  109 SER B O   1 
ATOM   2429 C  CB  . SER B 1 116 ? -42.530 30.855  1.148   1.00 32.56 ?  109 SER B CB  1 
ATOM   2430 O  OG  . SER B 1 116 ? -42.994 31.865  2.031   1.00 42.18 ?  109 SER B OG  1 
ATOM   2431 N  N   . GLU B 1 117 ? -45.077 32.421  -0.356  1.00 32.09 ?  110 GLU B N   1 
ATOM   2432 C  CA  . GLU B 1 117 ? -46.520 32.618  -0.407  1.00 29.86 ?  110 GLU B CA  1 
ATOM   2433 C  C   . GLU B 1 117 ? -47.055 32.767  -1.822  1.00 35.34 ?  110 GLU B C   1 
ATOM   2434 O  O   . GLU B 1 117 ? -48.276 32.807  -2.003  1.00 33.22 ?  110 GLU B O   1 
ATOM   2435 C  CB  . GLU B 1 117 ? -46.934 33.856  0.405   1.00 32.52 ?  110 GLU B CB  1 
ATOM   2436 C  CG  . GLU B 1 117 ? -46.610 33.811  1.885   1.00 30.35 ?  110 GLU B CG  1 
ATOM   2437 C  CD  . GLU B 1 117 ? -47.596 32.987  2.710   1.00 38.35 ?  110 GLU B CD  1 
ATOM   2438 O  OE1 . GLU B 1 117 ? -48.596 32.481  2.154   1.00 37.87 ?  110 GLU B OE1 1 
ATOM   2439 O  OE2 . GLU B 1 117 ? -47.370 32.864  3.933   1.00 44.95 -1 110 GLU B OE2 1 
ATOM   2440 N  N   . HIS B 1 118 ? -46.187 32.870  -2.826  1.00 29.32 ?  111 HIS B N   1 
ATOM   2441 C  CA  . HIS B 1 118 ? -46.603 33.027  -4.214  1.00 28.93 ?  111 HIS B CA  1 
ATOM   2442 C  C   . HIS B 1 118 ? -45.861 31.989  -5.034  1.00 33.04 ?  111 HIS B C   1 
ATOM   2443 O  O   . HIS B 1 118 ? -44.856 32.300  -5.685  1.00 33.98 ?  111 HIS B O   1 
ATOM   2444 C  CB  . HIS B 1 118 ? -46.328 34.444  -4.717  1.00 30.54 ?  111 HIS B CB  1 
ATOM   2445 C  CG  . HIS B 1 118 ? -47.162 35.487  -4.046  1.00 33.08 ?  111 HIS B CG  1 
ATOM   2446 N  ND1 . HIS B 1 118 ? -46.796 36.084  -2.862  1.00 33.88 ?  111 HIS B ND1 1 
ATOM   2447 C  CD2 . HIS B 1 118 ? -48.356 36.027  -4.385  1.00 36.94 ?  111 HIS B CD2 1 
ATOM   2448 C  CE1 . HIS B 1 118 ? -47.721 36.956  -2.504  1.00 34.23 ?  111 HIS B CE1 1 
ATOM   2449 N  NE2 . HIS B 1 118 ? -48.679 36.941  -3.413  1.00 34.87 ?  111 HIS B NE2 1 
ATOM   2450 N  N   . PRO B 1 119 ? -46.319 30.734  -5.015  1.00 35.93 ?  112 PRO B N   1 
ATOM   2451 C  CA  . PRO B 1 119 ? -45.624 29.696  -5.788  1.00 36.90 ?  112 PRO B CA  1 
ATOM   2452 C  C   . PRO B 1 119 ? -45.709 29.907  -7.293  1.00 35.78 ?  112 PRO B C   1 
ATOM   2453 O  O   . PRO B 1 119 ? -44.915 29.305  -8.024  1.00 39.04 ?  112 PRO B O   1 
ATOM   2454 C  CB  . PRO B 1 119 ? -46.330 28.406  -5.354  1.00 42.77 ?  112 PRO B CB  1 
ATOM   2455 C  CG  . PRO B 1 119 ? -47.688 28.859  -4.900  1.00 40.15 ?  112 PRO B CG  1 
ATOM   2456 C  CD  . PRO B 1 119 ? -47.497 30.211  -4.299  1.00 37.93 ?  112 PRO B CD  1 
ATOM   2457 N  N   . ASN B 1 120 ? -46.605 30.766  -7.771  1.00 35.33 ?  113 ASN B N   1 
ATOM   2458 C  CA  . ASN B 1 120 ? -46.676 31.097  -9.192  1.00 37.81 ?  113 ASN B CA  1 
ATOM   2459 C  C   . ASN B 1 120 ? -45.624 32.113  -9.631  1.00 38.20 ?  113 ASN B C   1 
ATOM   2460 O  O   . ASN B 1 120 ? -45.588 32.472  -10.818 1.00 37.57 ?  113 ASN B O   1 
ATOM   2461 C  CB  . ASN B 1 120 ? -48.070 31.624  -9.546  1.00 39.90 ?  113 ASN B CB  1 
ATOM   2462 C  CG  . ASN B 1 120 ? -48.419 32.907  -8.819  1.00 43.06 ?  113 ASN B CG  1 
ATOM   2463 O  OD1 . ASN B 1 120 ? -48.158 33.053  -7.615  1.00 45.57 ?  113 ASN B OD1 1 
ATOM   2464 N  ND2 . ASN B 1 120 ? -49.013 33.850  -9.544  1.00 43.10 ?  113 ASN B ND2 1 
ATOM   2465 N  N   . VAL B 1 121 ? -44.769 32.581  -8.726  1.00 31.44 ?  114 VAL B N   1 
ATOM   2466 C  CA  . VAL B 1 121 ? -43.730 33.555  -9.045  1.00 29.48 ?  114 VAL B CA  1 
ATOM   2467 C  C   . VAL B 1 121 ? -42.371 32.884  -8.882  1.00 29.76 ?  114 VAL B C   1 
ATOM   2468 O  O   . VAL B 1 121 ? -42.129 32.199  -7.883  1.00 32.54 ?  114 VAL B O   1 
ATOM   2469 C  CB  . VAL B 1 121 ? -43.837 34.807  -8.152  1.00 32.73 ?  114 VAL B CB  1 
ATOM   2470 C  CG1 . VAL B 1 121 ? -42.707 35.783  -8.459  1.00 29.19 ?  114 VAL B CG1 1 
ATOM   2471 C  CG2 . VAL B 1 121 ? -45.196 35.490  -8.336  1.00 32.24 ?  114 VAL B CG2 1 
ATOM   2472 N  N   . THR B 1 122 ? -41.490 33.066  -9.866  1.00 28.13 ?  115 THR B N   1 
ATOM   2473 C  CA  . THR B 1 122 ? -40.082 32.720  -9.723  1.00 28.84 ?  115 THR B CA  1 
ATOM   2474 C  C   . THR B 1 122 ? -39.258 33.984  -9.898  1.00 27.80 ?  115 THR B C   1 
ATOM   2475 O  O   . THR B 1 122 ? -39.633 34.886  -10.652 1.00 30.50 ?  115 THR B O   1 
ATOM   2476 C  CB  . THR B 1 122 ? -39.614 31.668  -10.736 1.00 33.45 ?  115 THR B CB  1 
ATOM   2477 O  OG1 . THR B 1 122 ? -39.769 32.179  -12.064 1.00 40.27 ?  115 THR B OG1 1 
ATOM   2478 C  CG2 . THR B 1 122 ? -40.403 30.380  -10.588 1.00 36.88 ?  115 THR B CG2 1 
ATOM   2479 N  N   . LEU B 1 123 ? -38.141 34.057  -9.184  1.00 25.01 ?  116 LEU B N   1 
ATOM   2480 C  CA  . LEU B 1 123 ? -37.281 35.230  -9.227  1.00 22.93 ?  116 LEU B CA  1 
ATOM   2481 C  C   . LEU B 1 123 ? -35.855 34.809  -9.537  1.00 25.24 ?  116 LEU B C   1 
ATOM   2482 O  O   . LEU B 1 123 ? -35.342 33.858  -8.936  1.00 27.89 ?  116 LEU B O   1 
ATOM   2483 C  CB  . LEU B 1 123 ? -37.312 35.983  -7.897  1.00 25.69 ?  116 LEU B CB  1 
ATOM   2484 C  CG  . LEU B 1 123 ? -36.326 37.137  -7.681  1.00 25.08 ?  116 LEU B CG  1 
ATOM   2485 C  CD1 . LEU B 1 123 ? -36.637 38.303  -8.606  1.00 22.76 ?  116 LEU B CD1 1 
ATOM   2486 C  CD2 . LEU B 1 123 ? -36.410 37.574  -6.230  1.00 30.35 ?  116 LEU B CD2 1 
ATOM   2487 N  N   . THR B 1 124 ? -35.220 35.532  -10.453 1.00 23.87 ?  117 THR B N   1 
ATOM   2488 C  CA  . THR B 1 124 ? -33.792 35.413  -10.727 1.00 25.67 ?  117 THR B CA  1 
ATOM   2489 C  C   . THR B 1 124 ? -33.148 36.758  -10.463 1.00 22.87 ?  117 THR B C   1 
ATOM   2490 O  O   . THR B 1 124 ? -33.634 37.788  -10.944 1.00 26.87 ?  117 THR B O   1 
ATOM   2491 C  CB  . THR B 1 124 ? -33.522 34.992  -12.181 1.00 31.03 ?  117 THR B CB  1 
ATOM   2492 O  OG1 . THR B 1 124 ? -34.089 33.703  -12.412 1.00 31.58 ?  117 THR B OG1 1 
ATOM   2493 C  CG2 . THR B 1 124 ? -32.009 34.938  -12.458 1.00 33.91 ?  117 THR B CG2 1 
ATOM   2494 N  N   . ILE B 1 125 ? -32.081 36.757  -9.673  1.00 22.69 ?  118 ILE B N   1 
ATOM   2495 C  CA  . ILE B 1 125 ? -31.326 37.963  -9.378  1.00 24.19 ?  118 ILE B CA  1 
ATOM   2496 C  C   . ILE B 1 125 ? -29.927 37.772  -9.946  1.00 25.50 ?  118 ILE B C   1 
ATOM   2497 O  O   . ILE B 1 125 ? -29.242 36.807  -9.590  1.00 26.05 ?  118 ILE B O   1 
ATOM   2498 C  CB  . ILE B 1 125 ? -31.280 38.247  -7.870  1.00 24.86 ?  118 ILE B CB  1 
ATOM   2499 C  CG1 . ILE B 1 125 ? -32.710 38.366  -7.316  1.00 21.09 ?  118 ILE B CG1 1 
ATOM   2500 C  CG2 . ILE B 1 125 ? -30.465 39.500  -7.593  1.00 23.76 ?  118 ILE B CG2 1 
ATOM   2501 C  CD1 . ILE B 1 125 ? -32.773 38.508  -5.792  1.00 27.24 ?  118 ILE B CD1 1 
ATOM   2502 N  N   . SER B 1 126 ? -29.530 38.654  -10.864 1.00 25.19 ?  119 SER B N   1 
ATOM   2503 C  CA  . SER B 1 126 ? -28.159 38.723  -11.375 1.00 24.33 ?  119 SER B CA  1 
ATOM   2504 C  C   . SER B 1 126 ? -27.570 40.034  -10.890 1.00 22.03 ?  119 SER B C   1 
ATOM   2505 O  O   . SER B 1 126 ? -28.122 41.101  -11.167 1.00 25.76 ?  119 SER B O   1 
ATOM   2506 C  CB  . SER B 1 126 ? -28.101 38.655  -12.909 1.00 29.94 ?  119 SER B CB  1 
ATOM   2507 O  OG  . SER B 1 126 ? -28.553 37.408  -13.385 1.00 38.01 ?  119 SER B OG  1 
ATOM   2508 N  N   . ALA B 1 127 ? -26.464 39.957  -10.158 1.00 22.90 ?  120 ALA B N   1 
ATOM   2509 C  CA  . ALA B 1 127 ? -25.916 41.109  -9.461  1.00 19.30 ?  120 ALA B CA  1 
ATOM   2510 C  C   . ALA B 1 127 ? -24.564 41.501  -10.041 1.00 23.77 ?  120 ALA B C   1 
ATOM   2511 O  O   . ALA B 1 127 ? -23.758 40.637  -10.388 1.00 25.28 ?  120 ALA B O   1 
ATOM   2512 C  CB  . ALA B 1 127 ? -25.760 40.804  -7.975  1.00 22.91 ?  120 ALA B CB  1 
ATOM   2513 N  N   . ALA B 1 128 ? -24.313 42.805  -10.123 1.00 23.33 ?  121 ALA B N   1 
ATOM   2514 C  CA  . ALA B 1 128 ? -22.981 43.259  -10.508 1.00 22.70 ?  121 ALA B CA  1 
ATOM   2515 C  C   . ALA B 1 128 ? -21.978 43.036  -9.384  1.00 27.02 ?  121 ALA B C   1 
ATOM   2516 O  O   . ALA B 1 128 ? -20.836 42.635  -9.635  1.00 26.33 ?  121 ALA B O   1 
ATOM   2517 C  CB  . ALA B 1 128 ? -23.018 44.732  -10.902 1.00 24.75 ?  121 ALA B CB  1 
ATOM   2518 N  N   . ARG B 1 129 ? -22.379 43.303  -8.140  1.00 22.72 ?  122 ARG B N   1 
ATOM   2519 C  CA  . ARG B 1 129 ? -21.520 43.144  -6.978  1.00 22.08 ?  122 ARG B CA  1 
ATOM   2520 C  C   . ARG B 1 129 ? -22.303 42.493  -5.848  1.00 24.00 ?  122 ARG B C   1 
ATOM   2521 O  O   . ARG B 1 129 ? -23.534 42.540  -5.810  1.00 22.27 ?  122 ARG B O   1 
ATOM   2522 C  CB  . ARG B 1 129 ? -20.990 44.483  -6.451  1.00 23.27 ?  122 ARG B CB  1 
ATOM   2523 C  CG  . ARG B 1 129 ? -20.191 45.311  -7.447  1.00 25.05 ?  122 ARG B CG  1 
ATOM   2524 C  CD  . ARG B 1 129 ? -19.782 46.654  -6.811  1.00 20.30 ?  122 ARG B CD  1 
ATOM   2525 N  NE  . ARG B 1 129 ? -20.937 47.498  -6.502  1.00 24.45 ?  122 ARG B NE  1 
ATOM   2526 C  CZ  . ARG B 1 129 ? -21.613 48.203  -7.410  1.00 26.79 ?  122 ARG B CZ  1 
ATOM   2527 N  NH1 . ARG B 1 129 ? -21.242 48.184  -8.692  1.00 28.18 1  122 ARG B NH1 1 
ATOM   2528 N  NH2 . ARG B 1 129 ? -22.658 48.931  -7.045  1.00 22.34 ?  122 ARG B NH2 1 
ATOM   2529 N  N   . LEU B 1 130 ? -21.567 41.930  -4.898  1.00 23.32 ?  123 LEU B N   1 
ATOM   2530 C  CA  . LEU B 1 130 ? -22.151 41.389  -3.679  1.00 24.84 ?  123 LEU B CA  1 
ATOM   2531 C  C   . LEU B 1 130 ? -22.266 42.466  -2.602  1.00 21.64 ?  123 LEU B C   1 
ATOM   2532 O  O   . LEU B 1 130 ? -21.314 43.208  -2.350  1.00 22.75 ?  123 LEU B O   1 
ATOM   2533 C  CB  . LEU B 1 130 ? -21.307 40.221  -3.166  1.00 21.99 ?  123 LEU B CB  1 
ATOM   2534 C  CG  . LEU B 1 130 ? -21.285 38.987  -4.061  1.00 26.95 ?  123 LEU B CG  1 
ATOM   2535 C  CD1 . LEU B 1 130 ? -20.181 38.021  -3.652  1.00 29.27 ?  123 LEU B CD1 1 
ATOM   2536 C  CD2 . LEU B 1 130 ? -22.662 38.289  -4.044  1.00 30.39 ?  123 LEU B CD2 1 
ATOM   2537 N  N   . TYR B 1 131 ? -23.441 42.549  -1.976  1.00 19.04 ?  124 TYR B N   1 
ATOM   2538 C  CA  . TYR B 1 131 ? -23.608 43.314  -0.747  1.00 19.68 ?  124 TYR B CA  1 
ATOM   2539 C  C   . TYR B 1 131 ? -22.548 42.882  0.268   1.00 20.88 ?  124 TYR B C   1 
ATOM   2540 O  O   . TYR B 1 131 ? -22.112 41.732  0.269   1.00 23.09 ?  124 TYR B O   1 
ATOM   2541 C  CB  . TYR B 1 131 ? -25.038 43.062  -0.219  1.00 20.78 ?  124 TYR B CB  1 
ATOM   2542 C  CG  . TYR B 1 131 ? -25.480 43.830  1.004   1.00 20.95 ?  124 TYR B CG  1 
ATOM   2543 C  CD1 . TYR B 1 131 ? -25.170 43.371  2.277   1.00 22.93 ?  124 TYR B CD1 1 
ATOM   2544 C  CD2 . TYR B 1 131 ? -26.264 44.976  0.891   1.00 19.78 ?  124 TYR B CD2 1 
ATOM   2545 C  CE1 . TYR B 1 131 ? -25.594 44.050  3.398   1.00 24.38 ?  124 TYR B CE1 1 
ATOM   2546 C  CE2 . TYR B 1 131 ? -26.689 45.672  2.014   1.00 22.76 ?  124 TYR B CE2 1 
ATOM   2547 C  CZ  . TYR B 1 131 ? -26.348 45.202  3.262   1.00 24.76 ?  124 TYR B CZ  1 
ATOM   2548 O  OH  . TYR B 1 131 ? -26.784 45.868  4.382   1.00 24.64 ?  124 TYR B OH  1 
ATOM   2549 N  N   . TYR B 1 132 ? -22.090 43.810  1.114   1.00 19.82 ?  125 TYR B N   1 
ATOM   2550 C  CA  . TYR B 1 132 ? -21.098 43.452  2.145   1.00 22.75 ?  125 TYR B CA  1 
ATOM   2551 C  C   . TYR B 1 132 ? -21.814 42.884  3.369   1.00 21.79 ?  125 TYR B C   1 
ATOM   2552 O  O   . TYR B 1 132 ? -22.221 43.613  4.266   1.00 22.21 ?  125 TYR B O   1 
ATOM   2553 C  CB  . TYR B 1 132 ? -20.231 44.658  2.498   1.00 22.81 ?  125 TYR B CB  1 
ATOM   2554 C  CG  . TYR B 1 132 ? -19.556 45.218  1.254   1.00 24.40 ?  125 TYR B CG  1 
ATOM   2555 C  CD1 . TYR B 1 132 ? -18.659 44.442  0.526   1.00 28.72 ?  125 TYR B CD1 1 
ATOM   2556 C  CD2 . TYR B 1 132 ? -19.845 46.500  0.792   1.00 27.54 ?  125 TYR B CD2 1 
ATOM   2557 C  CE1 . TYR B 1 132 ? -18.045 44.934  -0.634  1.00 28.59 ?  125 TYR B CE1 1 
ATOM   2558 C  CE2 . TYR B 1 132 ? -19.237 47.000  -0.355  1.00 26.06 ?  125 TYR B CE2 1 
ATOM   2559 C  CZ  . TYR B 1 132 ? -18.343 46.209  -1.065  1.00 28.55 ?  125 TYR B CZ  1 
ATOM   2560 O  OH  . TYR B 1 132 ? -17.742 46.692  -2.208  1.00 29.49 ?  125 TYR B OH  1 
ATOM   2561 N  N   . TYR B 1 133 ? -21.977 41.562  3.399   1.00 23.55 ?  126 TYR B N   1 
ATOM   2562 C  CA  . TYR B 1 133 ? -22.710 40.916  4.485   1.00 25.01 ?  126 TYR B CA  1 
ATOM   2563 C  C   . TYR B 1 133 ? -21.838 40.808  5.728   1.00 28.98 ?  126 TYR B C   1 
ATOM   2564 O  O   . TYR B 1 133 ? -20.620 40.663  5.641   1.00 24.18 ?  126 TYR B O   1 
ATOM   2565 C  CB  . TYR B 1 133 ? -23.185 39.520  4.072   1.00 24.68 ?  126 TYR B CB  1 
ATOM   2566 C  CG  . TYR B 1 133 ? -24.167 39.573  2.929   1.00 25.67 ?  126 TYR B CG  1 
ATOM   2567 C  CD1 . TYR B 1 133 ? -25.487 39.944  3.144   1.00 26.40 ?  126 TYR B CD1 1 
ATOM   2568 C  CD2 . TYR B 1 133 ? -23.762 39.299  1.636   1.00 23.88 ?  126 TYR B CD2 1 
ATOM   2569 C  CE1 . TYR B 1 133 ? -26.384 40.036  2.096   1.00 24.37 ?  126 TYR B CE1 1 
ATOM   2570 C  CE2 . TYR B 1 133 ? -24.655 39.385  0.575   1.00 23.30 ?  126 TYR B CE2 1 
ATOM   2571 C  CZ  . TYR B 1 133 ? -25.958 39.756  0.810   1.00 20.56 ?  126 TYR B CZ  1 
ATOM   2572 O  OH  . TYR B 1 133 ? -26.840 39.840  -0.247  1.00 21.13 ?  126 TYR B OH  1 
ATOM   2573 N  N   . SER B 1 134 ? -22.479 40.888  6.893   1.00 28.22 ?  127 SER B N   1 
ATOM   2574 C  CA  . SER B 1 134 ? -21.786 40.658  8.152   1.00 25.74 ?  127 SER B CA  1 
ATOM   2575 C  C   . SER B 1 134 ? -21.394 39.188  8.287   1.00 29.93 ?  127 SER B C   1 
ATOM   2576 O  O   . SER B 1 134 ? -21.856 38.319  7.538   1.00 29.91 ?  127 SER B O   1 
ATOM   2577 C  CB  . SER B 1 134 ? -22.675 41.060  9.328   1.00 32.21 ?  127 SER B CB  1 
ATOM   2578 O  OG  . SER B 1 134 ? -23.823 40.220  9.359   1.00 28.73 ?  127 SER B OG  1 
ATOM   2579 N  N   . GLU B 1 135 ? -20.537 38.914  9.279   1.00 31.87 ?  128 GLU B N   1 
ATOM   2580 C  CA  . GLU B 1 135 ? -20.128 37.538  9.556   1.00 33.84 ?  128 GLU B CA  1 
ATOM   2581 C  C   . GLU B 1 135 ? -21.330 36.612  9.699   1.00 29.88 ?  128 GLU B C   1 
ATOM   2582 O  O   . GLU B 1 135 ? -21.338 35.500  9.153   1.00 32.06 ?  128 GLU B O   1 
ATOM   2583 C  CB  . GLU B 1 135 ? -19.283 37.489  10.830  1.00 38.29 ?  128 GLU B CB  1 
ATOM   2584 C  CG  . GLU B 1 135 ? -17.955 38.231  10.734  1.00 44.32 ?  128 GLU B CG  1 
ATOM   2585 C  CD  . GLU B 1 135 ? -17.092 38.047  11.978  1.00 50.38 ?  128 GLU B CD  1 
ATOM   2586 O  OE1 . GLU B 1 135 ? -16.218 38.909  12.232  1.00 49.95 ?  128 GLU B OE1 1 
ATOM   2587 O  OE2 . GLU B 1 135 ? -17.297 37.042  12.701  1.00 53.98 -1 128 GLU B OE2 1 
ATOM   2588 N  N   . ARG B 1 136 ? -22.361 37.059  10.425  1.00 30.47 ?  129 ARG B N   1 
ATOM   2589 C  CA  . ARG B 1 136 ? -23.532 36.213  10.645  1.00 36.23 ?  129 ARG B CA  1 
ATOM   2590 C  C   . ARG B 1 136 ? -24.349 36.023  9.366   1.00 37.87 ?  129 ARG B C   1 
ATOM   2591 O  O   . ARG B 1 136 ? -24.907 34.945  9.144   1.00 33.96 ?  129 ARG B O   1 
ATOM   2592 C  CB  . ARG B 1 136 ? -24.400 36.796  11.763  1.00 37.34 ?  129 ARG B CB  1 
ATOM   2593 C  CG  . ARG B 1 136 ? -25.265 37.983  11.359  1.00 40.92 ?  129 ARG B CG  1 
ATOM   2594 C  CD  . ARG B 1 136 ? -25.985 38.594  12.571  1.00 47.93 ?  129 ARG B CD  1 
ATOM   2595 N  NE  . ARG B 1 136 ? -26.543 39.914  12.275  1.00 51.67 ?  129 ARG B NE  1 
ATOM   2596 C  CZ  . ARG B 1 136 ? -25.825 41.037  12.220  1.00 56.77 ?  129 ARG B CZ  1 
ATOM   2597 N  NH1 . ARG B 1 136 ? -24.513 41.010  12.431  1.00 48.82 1  129 ARG B NH1 1 
ATOM   2598 N  NH2 . ARG B 1 136 ? -26.416 42.193  11.945  1.00 59.37 ?  129 ARG B NH2 1 
ATOM   2599 N  N   . ASP B 1 137 ? -24.431 37.046  8.507   1.00 31.63 ?  130 ASP B N   1 
ATOM   2600 C  CA  . ASP B 1 137 ? -25.270 36.963  7.312   1.00 32.17 ?  130 ASP B CA  1 
ATOM   2601 C  C   . ASP B 1 137 ? -24.547 36.366  6.115   1.00 33.09 ?  130 ASP B C   1 
ATOM   2602 O  O   . ASP B 1 137 ? -25.204 35.961  5.147   1.00 35.06 ?  130 ASP B O   1 
ATOM   2603 C  CB  . ASP B 1 137 ? -25.794 38.358  6.929   1.00 27.86 ?  130 ASP B CB  1 
ATOM   2604 C  CG  . ASP B 1 137 ? -26.689 38.965  8.009   1.00 36.73 ?  130 ASP B CG  1 
ATOM   2605 O  OD1 . ASP B 1 137 ? -27.620 38.272  8.471   1.00 39.99 ?  130 ASP B OD1 1 
ATOM   2606 O  OD2 . ASP B 1 137 ? -26.457 40.127  8.412   1.00 39.59 -1 130 ASP B OD2 1 
ATOM   2607 N  N   . TYR B 1 138 ? -23.212 36.302  6.164   1.00 33.45 ?  131 TYR B N   1 
ATOM   2608 C  CA  . TYR B 1 138 ? -22.427 35.976  4.976   1.00 29.39 ?  131 TYR B CA  1 
ATOM   2609 C  C   . TYR B 1 138 ? -22.865 34.648  4.369   1.00 35.50 ?  131 TYR B C   1 
ATOM   2610 O  O   . TYR B 1 138 ? -23.206 34.577  3.183   1.00 32.36 ?  131 TYR B O   1 
ATOM   2611 C  CB  . TYR B 1 138 ? -20.936 35.971  5.340   1.00 33.34 ?  131 TYR B CB  1 
ATOM   2612 C  CG  . TYR B 1 138 ? -19.986 35.781  4.178   1.00 34.21 ?  131 TYR B CG  1 
ATOM   2613 C  CD1 . TYR B 1 138 ? -19.696 36.818  3.296   1.00 39.24 ?  131 TYR B CD1 1 
ATOM   2614 C  CD2 . TYR B 1 138 ? -19.357 34.564  3.982   1.00 38.76 ?  131 TYR B CD2 1 
ATOM   2615 C  CE1 . TYR B 1 138 ? -18.808 36.626  2.228   1.00 40.58 ?  131 TYR B CE1 1 
ATOM   2616 C  CE2 . TYR B 1 138 ? -18.480 34.366  2.937   1.00 42.06 ?  131 TYR B CE2 1 
ATOM   2617 C  CZ  . TYR B 1 138 ? -18.205 35.392  2.068   1.00 42.16 ?  131 TYR B CZ  1 
ATOM   2618 O  OH  . TYR B 1 138 ? -17.324 35.146  1.045   1.00 53.30 ?  131 TYR B OH  1 
ATOM   2619 N  N   . ARG B 1 139 ? -22.893 33.587  5.173   1.00 33.72 ?  132 ARG B N   1 
ATOM   2620 C  CA  . ARG B 1 139 ? -23.274 32.268  4.689   1.00 37.59 ?  132 ARG B CA  1 
ATOM   2621 C  C   . ARG B 1 139 ? -24.730 31.932  5.001   1.00 42.65 ?  132 ARG B C   1 
ATOM   2622 O  O   . ARG B 1 139 ? -25.114 30.756  4.956   1.00 43.82 ?  132 ARG B O   1 
ATOM   2623 C  CB  . ARG B 1 139 ? -22.339 31.209  5.280   1.00 44.38 ?  132 ARG B CB  1 
ATOM   2624 C  CG  . ARG B 1 139 ? -20.868 31.488  4.994   1.00 50.26 ?  132 ARG B CG  1 
ATOM   2625 C  CD  . ARG B 1 139 ? -19.919 30.581  5.774   1.00 56.64 ?  132 ARG B CD  1 
ATOM   2626 N  NE  . ARG B 1 139 ? -20.311 29.171  5.727   1.00 62.13 ?  132 ARG B NE  1 
ATOM   2627 C  CZ  . ARG B 1 139 ? -20.308 28.415  4.629   1.00 62.51 ?  132 ARG B CZ  1 
ATOM   2628 N  NH1 . ARG B 1 139 ? -19.949 28.919  3.452   1.00 62.04 1  132 ARG B NH1 1 
ATOM   2629 N  NH2 . ARG B 1 139 ? -20.685 27.146  4.703   1.00 63.48 ?  132 ARG B NH2 1 
ATOM   2630 N  N   . ARG B 1 140 ? -25.548 32.935  5.319   1.00 30.34 ?  133 ARG B N   1 
ATOM   2631 C  CA  . ARG B 1 140 ? -26.955 32.706  5.620   1.00 35.51 ?  133 ARG B CA  1 
ATOM   2632 C  C   . ARG B 1 140 ? -27.905 33.431  4.679   1.00 31.24 ?  133 ARG B C   1 
ATOM   2633 O  O   . ARG B 1 140 ? -28.849 32.814  4.178   1.00 32.17 ?  133 ARG B O   1 
ATOM   2634 C  CB  . ARG B 1 140 ? -27.251 33.117  7.066   1.00 32.59 ?  133 ARG B CB  1 
ATOM   2635 C  CG  . ARG B 1 140 ? -26.753 32.119  8.086   1.00 42.13 ?  133 ARG B CG  1 
ATOM   2636 C  CD  . ARG B 1 140 ? -27.143 32.559  9.486   1.00 45.03 ?  133 ARG B CD  1 
ATOM   2637 N  NE  . ARG B 1 140 ? -26.817 31.557  10.498  1.00 49.90 ?  133 ARG B NE  1 
ATOM   2638 C  CZ  . ARG B 1 140 ? -25.614 31.415  11.049  1.00 53.92 ?  133 ARG B CZ  1 
ATOM   2639 N  NH1 . ARG B 1 140 ? -24.609 32.201  10.674  1.00 49.58 1  133 ARG B NH1 1 
ATOM   2640 N  NH2 . ARG B 1 140 ? -25.413 30.481  11.975  1.00 56.71 ?  133 ARG B NH2 1 
ATOM   2641 N  N   . ALA B 1 141 ? -27.685 34.722  4.415   1.00 28.49 ?  134 ALA B N   1 
ATOM   2642 C  CA  . ALA B 1 141 ? -28.719 35.535  3.767   1.00 28.16 ?  134 ALA B CA  1 
ATOM   2643 C  C   . ALA B 1 141 ? -29.027 35.038  2.360   1.00 28.57 ?  134 ALA B C   1 
ATOM   2644 O  O   . ALA B 1 141 ? -30.173 34.692  2.045   1.00 27.69 ?  134 ALA B O   1 
ATOM   2645 C  CB  . ALA B 1 141 ? -28.296 37.004  3.746   1.00 31.51 ?  134 ALA B CB  1 
ATOM   2646 N  N   . LEU B 1 142 ? -28.021 35.004  1.481   1.00 27.21 ?  135 LEU B N   1 
ATOM   2647 C  CA  . LEU B 1 142 ? -28.311 34.566  0.119   1.00 24.89 ?  135 LEU B CA  1 
ATOM   2648 C  C   . LEU B 1 142 ? -28.626 33.079  0.069   1.00 28.47 ?  135 LEU B C   1 
ATOM   2649 O  O   . LEU B 1 142 ? -29.368 32.635  -0.812  1.00 28.01 ?  135 LEU B O   1 
ATOM   2650 C  CB  . LEU B 1 142 ? -27.139 34.898  -0.811  1.00 29.54 ?  135 LEU B CB  1 
ATOM   2651 C  CG  . LEU B 1 142 ? -26.918 36.399  -1.025  1.00 29.40 ?  135 LEU B CG  1 
ATOM   2652 C  CD1 . LEU B 1 142 ? -25.756 36.659  -1.997  1.00 27.25 ?  135 LEU B CD1 1 
ATOM   2653 C  CD2 . LEU B 1 142 ? -28.189 37.096  -1.513  1.00 27.03 ?  135 LEU B CD2 1 
ATOM   2654 N  N   . CYS B 1 143 ? -28.063 32.296  0.991   1.00 26.73 ?  136 CYS B N   1 
ATOM   2655 C  CA  . CYS B 1 143 ? -28.427 30.886  1.074   1.00 28.07 ?  136 CYS B CA  1 
ATOM   2656 C  C   . CYS B 1 143 ? -29.918 30.721  1.367   1.00 27.33 ?  136 CYS B C   1 
ATOM   2657 O  O   . CYS B 1 143 ? -30.590 29.877  0.762   1.00 34.08 ?  136 CYS B O   1 
ATOM   2658 C  CB  . CYS B 1 143 ? -27.589 30.185  2.145   1.00 36.54 ?  136 CYS B CB  1 
ATOM   2659 S  SG  . CYS B 1 143 ? -27.970 28.420  2.271   1.00 42.40 ?  136 CYS B SG  1 
ATOM   2660 N  N   . ARG B 1 144 ? -30.458 31.533  2.277   1.00 28.61 ?  137 ARG B N   1 
ATOM   2661 C  CA  . ARG B 1 144 ? -31.887 31.457  2.586   1.00 28.72 ?  137 ARG B CA  1 
ATOM   2662 C  C   . ARG B 1 144 ? -32.734 31.816  1.375   1.00 27.65 ?  137 ARG B C   1 
ATOM   2663 O  O   . ARG B 1 144 ? -33.779 31.202  1.122   1.00 29.42 ?  137 ARG B O   1 
ATOM   2664 C  CB  . ARG B 1 144 ? -32.232 32.403  3.730   1.00 29.68 ?  137 ARG B CB  1 
ATOM   2665 C  CG  . ARG B 1 144 ? -31.712 32.010  5.078   1.00 35.71 ?  137 ARG B CG  1 
ATOM   2666 C  CD  . ARG B 1 144 ? -31.793 33.199  6.012   1.00 37.31 ?  137 ARG B CD  1 
ATOM   2667 N  NE  . ARG B 1 144 ? -31.395 32.838  7.365   1.00 40.19 ?  137 ARG B NE  1 
ATOM   2668 C  CZ  . ARG B 1 144 ? -31.037 33.711  8.293   1.00 43.58 ?  137 ARG B CZ  1 
ATOM   2669 N  NH1 . ARG B 1 144 ? -31.018 35.009  8.011   1.00 46.28 1  137 ARG B NH1 1 
ATOM   2670 N  NH2 . ARG B 1 144 ? -30.695 33.284  9.497   1.00 43.67 ?  137 ARG B NH2 1 
ATOM   2671 N  N   . LEU B 1 145 ? -32.320 32.845  0.640   1.00 27.18 ?  138 LEU B N   1 
ATOM   2672 C  CA  . LEU B 1 145 ? -33.065 33.263  -0.541  1.00 25.49 ?  138 LEU B CA  1 
ATOM   2673 C  C   . LEU B 1 145 ? -33.032 32.189  -1.617  1.00 27.45 ?  138 LEU B C   1 
ATOM   2674 O  O   . LEU B 1 145 ? -34.052 31.900  -2.259  1.00 26.56 ?  138 LEU B O   1 
ATOM   2675 C  CB  . LEU B 1 145 ? -32.478 34.573  -1.062  1.00 23.38 ?  138 LEU B CB  1 
ATOM   2676 C  CG  . LEU B 1 145 ? -33.218 35.159  -2.266  1.00 24.25 ?  138 LEU B CG  1 
ATOM   2677 C  CD1 . LEU B 1 145 ? -34.705 35.285  -1.946  1.00 27.18 ?  138 LEU B CD1 1 
ATOM   2678 C  CD2 . LEU B 1 145 ? -32.616 36.522  -2.608  1.00 26.26 ?  138 LEU B CD2 1 
ATOM   2679 N  N   . SER B 1 146 ? -31.866 31.578  -1.818  1.00 25.39 ?  139 SER B N   1 
ATOM   2680 C  CA  . SER B 1 146 ? -31.745 30.515  -2.803  1.00 28.74 ?  139 SER B CA  1 
ATOM   2681 C  C   . SER B 1 146 ? -32.574 29.297  -2.401  1.00 29.24 ?  139 SER B C   1 
ATOM   2682 O  O   . SER B 1 146 ? -33.173 28.632  -3.255  1.00 31.63 ?  139 SER B O   1 
ATOM   2683 C  CB  . SER B 1 146 ? -30.264 30.162  -2.966  1.00 30.33 ?  139 SER B CB  1 
ATOM   2684 O  OG  . SER B 1 146 ? -30.104 29.103  -3.879  1.00 38.64 ?  139 SER B OG  1 
ATOM   2685 N  N   . GLN B 1 147 ? -32.641 29.011  -1.099  1.00 30.17 ?  140 GLN B N   1 
ATOM   2686 C  CA  . GLN B 1 147 ? -33.448 27.905  -0.588  1.00 31.93 ?  140 GLN B CA  1 
ATOM   2687 C  C   . GLN B 1 147 ? -34.940 28.148  -0.767  1.00 34.82 ?  140 GLN B C   1 
ATOM   2688 O  O   . GLN B 1 147 ? -35.717 27.194  -0.867  1.00 33.77 ?  140 GLN B O   1 
ATOM   2689 C  CB  . GLN B 1 147 ? -33.139 27.685  0.891   1.00 36.34 ?  140 GLN B CB  1 
ATOM   2690 C  CG  . GLN B 1 147 ? -31.913 26.837  1.158   1.00 45.22 ?  140 GLN B CG  1 
ATOM   2691 C  CD  . GLN B 1 147 ? -32.180 25.356  0.933   1.00 51.78 ?  140 GLN B CD  1 
ATOM   2692 O  OE1 . GLN B 1 147 ? -33.274 24.862  1.214   1.00 51.60 ?  140 GLN B OE1 1 
ATOM   2693 N  NE2 . GLN B 1 147 ? -31.186 24.646  0.411   1.00 56.55 ?  140 GLN B NE2 1 
ATOM   2694 N  N   . ALA B 1 148 ? -35.367 29.405  -0.763  1.00 31.03 ?  141 ALA B N   1 
ATOM   2695 C  CA  . ALA B 1 148 ? -36.757 29.699  -1.060  1.00 29.65 ?  141 ALA B CA  1 
ATOM   2696 C  C   . ALA B 1 148 ? -37.063 29.591  -2.547  1.00 31.62 ?  141 ALA B C   1 
ATOM   2697 O  O   . ALA B 1 148 ? -38.216 29.785  -2.931  1.00 29.43 ?  141 ALA B O   1 
ATOM   2698 C  CB  . ALA B 1 148 ? -37.120 31.094  -0.547  1.00 31.27 ?  141 ALA B CB  1 
ATOM   2699 N  N   . GLY B 1 149 ? -36.071 29.279  -3.382  1.00 31.42 ?  142 GLY B N   1 
ATOM   2700 C  CA  . GLY B 1 149 ? -36.283 29.014  -4.792  1.00 31.06 ?  142 GLY B CA  1 
ATOM   2701 C  C   . GLY B 1 149 ? -35.753 30.074  -5.735  1.00 31.76 ?  142 GLY B C   1 
ATOM   2702 O  O   . GLY B 1 149 ? -35.850 29.892  -6.957  1.00 31.89 ?  142 GLY B O   1 
ATOM   2703 N  N   . ALA B 1 150 ? -35.226 31.185  -5.227  1.00 27.80 ?  143 ALA B N   1 
ATOM   2704 C  CA  . ALA B 1 150 ? -34.697 32.215  -6.109  1.00 28.72 ?  143 ALA B CA  1 
ATOM   2705 C  C   . ALA B 1 150 ? -33.369 31.758  -6.684  1.00 30.11 ?  143 ALA B C   1 
ATOM   2706 O  O   . ALA B 1 150 ? -32.581 31.094  -6.006  1.00 31.53 ?  143 ALA B O   1 
ATOM   2707 C  CB  . ALA B 1 150 ? -34.501 33.537  -5.369  1.00 24.03 ?  143 ALA B CB  1 
ATOM   2708 N  N   . ARG B 1 151 ? -33.126 32.115  -7.937  1.00 27.53 ?  144 ARG B N   1 
ATOM   2709 C  CA  . ARG B 1 151 ? -31.820 31.907  -8.550  1.00 31.08 ?  144 ARG B CA  1 
ATOM   2710 C  C   . ARG B 1 151 ? -30.991 33.170  -8.365  1.00 27.85 ?  144 ARG B C   1 
ATOM   2711 O  O   . ARG B 1 151 ? -31.385 34.250  -8.820  1.00 29.98 ?  144 ARG B O   1 
ATOM   2712 C  CB  . ARG B 1 151 ? -31.962 31.570  -10.033 1.00 31.66 ?  144 ARG B CB  1 
ATOM   2713 C  CG  . ARG B 1 151 ? -30.643 31.294  -10.731 1.00 41.75 ?  144 ARG B CG  1 
ATOM   2714 C  CD  . ARG B 1 151 ? -30.898 30.793  -12.144 1.00 52.63 ?  144 ARG B CD  1 
ATOM   2715 N  NE  . ARG B 1 151 ? -29.747 30.987  -13.022 1.00 57.90 ?  144 ARG B NE  1 
ATOM   2716 C  CZ  . ARG B 1 151 ? -28.715 30.153  -13.088 1.00 63.16 ?  144 ARG B CZ  1 
ATOM   2717 N  NH1 . ARG B 1 151 ? -28.689 29.071  -12.317 1.00 64.29 1  144 ARG B NH1 1 
ATOM   2718 N  NH2 . ARG B 1 151 ? -27.707 30.403  -13.921 1.00 59.77 ?  144 ARG B NH2 1 
ATOM   2719 N  N   . VAL B 1 152 ? -29.846 33.035  -7.706  1.00 27.25 ?  145 VAL B N   1 
ATOM   2720 C  CA  . VAL B 1 152 ? -28.967 34.161  -7.398  1.00 27.24 ?  145 VAL B CA  1 
ATOM   2721 C  C   . VAL B 1 152 ? -27.654 33.911  -8.128  1.00 28.96 ?  145 VAL B C   1 
ATOM   2722 O  O   . VAL B 1 152 ? -27.034 32.864  -7.934  1.00 27.91 ?  145 VAL B O   1 
ATOM   2723 C  CB  . VAL B 1 152 ? -28.735 34.296  -5.887  1.00 27.87 ?  145 VAL B CB  1 
ATOM   2724 C  CG1 . VAL B 1 152 ? -27.856 35.500  -5.578  1.00 29.53 ?  145 VAL B CG1 1 
ATOM   2725 C  CG2 . VAL B 1 152 ? -30.081 34.372  -5.137  1.00 29.54 ?  145 VAL B CG2 1 
ATOM   2726 N  N   . LYS B 1 153 ? -27.249 34.846  -8.983  1.00 27.25 ?  146 LYS B N   1 
ATOM   2727 C  CA  . LYS B 1 153 ? -26.033 34.662  -9.770  1.00 30.19 ?  146 LYS B CA  1 
ATOM   2728 C  C   . LYS B 1 153 ? -25.331 36.005  -9.957  1.00 28.71 ?  146 LYS B C   1 
ATOM   2729 O  O   . LYS B 1 153 ? -25.885 37.075  -9.677  1.00 25.34 ?  146 LYS B O   1 
ATOM   2730 C  CB  . LYS B 1 153 ? -26.331 34.000  -11.125 1.00 31.87 ?  146 LYS B CB  1 
ATOM   2731 C  CG  . LYS B 1 153 ? -27.346 34.740  -11.973 1.00 37.39 ?  146 LYS B CG  1 
ATOM   2732 C  CD  . LYS B 1 153 ? -27.706 33.960  -13.243 1.00 43.65 ?  146 LYS B CD  1 
ATOM   2733 C  CE  . LYS B 1 153 ? -26.494 33.770  -14.136 1.00 42.10 ?  146 LYS B CE  1 
ATOM   2734 N  NZ  . LYS B 1 153 ? -25.995 35.080  -14.647 1.00 47.48 1  146 LYS B NZ  1 
ATOM   2735 N  N   . ILE B 1 154 ? -24.067 35.932  -10.385 1.00 26.32 ?  147 ILE B N   1 
ATOM   2736 C  CA  . ILE B 1 154 ? -23.292 37.116  -10.742 1.00 24.93 ?  147 ILE B CA  1 
ATOM   2737 C  C   . ILE B 1 154 ? -23.594 37.485  -12.191 1.00 26.97 ?  147 ILE B C   1 
ATOM   2738 O  O   . ILE B 1 154 ? -23.716 36.613  -13.060 1.00 31.81 ?  147 ILE B O   1 
ATOM   2739 C  CB  . ILE B 1 154 ? -21.786 36.866  -10.521 1.00 26.60 ?  147 ILE B CB  1 
ATOM   2740 C  CG1 . ILE B 1 154 ? -21.529 36.457  -9.067  1.00 23.37 ?  147 ILE B CG1 1 
ATOM   2741 C  CG2 . ILE B 1 154 ? -20.952 38.104  -10.906 1.00 23.96 ?  147 ILE B CG2 1 
ATOM   2742 C  CD1 . ILE B 1 154 ? -22.010 37.508  -8.007  1.00 24.56 ?  147 ILE B CD1 1 
ATOM   2743 N  N   . MET B 1 155 ? -23.748 38.780  -12.449 1.00 26.32 ?  148 MET B N   1 
ATOM   2744 C  CA  . MET B 1 155 ? -23.990 39.253  -13.806 1.00 27.66 ?  148 MET B CA  1 
ATOM   2745 C  C   . MET B 1 155 ? -22.778 38.966  -14.683 1.00 34.06 ?  148 MET B C   1 
ATOM   2746 O  O   . MET B 1 155 ? -21.663 39.366  -14.346 1.00 29.56 ?  148 MET B O   1 
ATOM   2747 C  CB  . MET B 1 155 ? -24.266 40.756  -13.806 1.00 28.78 ?  148 MET B CB  1 
ATOM   2748 C  CG  . MET B 1 155 ? -25.702 41.164  -13.587 1.00 32.70 ?  148 MET B CG  1 
ATOM   2749 S  SD  . MET B 1 155 ? -25.914 42.957  -13.653 1.00 31.20 ?  148 MET B SD  1 
ATOM   2750 C  CE  . MET B 1 155 ? -25.802 43.319  -15.402 1.00 29.55 ?  148 MET B CE  1 
ATOM   2751 N  N   . ASP B 1 156 ? -22.998 38.285  -15.813 1.00 32.19 ?  149 ASP B N   1 
ATOM   2752 C  CA  . ASP B 1 156 ? -21.926 37.995  -16.760 1.00 36.78 ?  149 ASP B CA  1 
ATOM   2753 C  C   . ASP B 1 156 ? -21.965 38.984  -17.929 1.00 30.61 ?  149 ASP B C   1 
ATOM   2754 O  O   . ASP B 1 156 ? -22.850 39.834  -18.028 1.00 31.42 ?  149 ASP B O   1 
ATOM   2755 C  CB  . ASP B 1 156 ? -21.977 36.533  -17.233 1.00 38.16 ?  149 ASP B CB  1 
ATOM   2756 C  CG  . ASP B 1 156 ? -23.227 36.185  -18.031 1.00 39.41 ?  149 ASP B CG  1 
ATOM   2757 O  OD1 . ASP B 1 156 ? -23.924 37.072  -18.576 1.00 39.56 ?  149 ASP B OD1 1 
ATOM   2758 O  OD2 . ASP B 1 156 ? -23.503 34.978  -18.136 1.00 46.73 -1 149 ASP B OD2 1 
ATOM   2759 N  N   . TYR B 1 157 ? -20.978 38.875  -18.830 1.00 34.44 ?  150 TYR B N   1 
ATOM   2760 C  CA  . TYR B 1 157 ? -20.865 39.867  -19.894 1.00 36.00 ?  150 TYR B CA  1 
ATOM   2761 C  C   . TYR B 1 157 ? -22.154 39.977  -20.701 1.00 31.64 ?  150 TYR B C   1 
ATOM   2762 O  O   . TYR B 1 157 ? -22.599 41.087  -21.020 1.00 32.59 ?  150 TYR B O   1 
ATOM   2763 C  CB  . TYR B 1 157 ? -19.691 39.541  -20.820 1.00 37.88 ?  150 TYR B CB  1 
ATOM   2764 C  CG  . TYR B 1 157 ? -19.673 40.467  -22.015 1.00 40.45 ?  150 TYR B CG  1 
ATOM   2765 C  CD1 . TYR B 1 157 ? -19.218 41.776  -21.896 1.00 44.80 ?  150 TYR B CD1 1 
ATOM   2766 C  CD2 . TYR B 1 157 ? -20.159 40.054  -23.247 1.00 43.36 ?  150 TYR B CD2 1 
ATOM   2767 C  CE1 . TYR B 1 157 ? -19.227 42.644  -22.984 1.00 45.40 ?  150 TYR B CE1 1 
ATOM   2768 C  CE2 . TYR B 1 157 ? -20.171 40.911  -24.341 1.00 47.80 ?  150 TYR B CE2 1 
ATOM   2769 C  CZ  . TYR B 1 157 ? -19.706 42.203  -24.202 1.00 50.24 ?  150 TYR B CZ  1 
ATOM   2770 O  OH  . TYR B 1 157 ? -19.720 43.053  -25.291 1.00 59.36 ?  150 TYR B OH  1 
ATOM   2771 N  N   . GLU B 1 158 ? -22.768 38.841  -21.040 1.00 34.73 ?  151 GLU B N   1 
ATOM   2772 C  CA  . GLU B 1 158 ? -23.978 38.873  -21.859 1.00 38.01 ?  151 GLU B CA  1 
ATOM   2773 C  C   . GLU B 1 158 ? -25.082 39.667  -21.176 1.00 35.34 ?  151 GLU B C   1 
ATOM   2774 O  O   . GLU B 1 158 ? -25.862 40.365  -21.837 1.00 34.97 ?  151 GLU B O   1 
ATOM   2775 C  CB  . GLU B 1 158 ? -24.451 37.450  -22.163 1.00 41.32 ?  151 GLU B CB  1 
ATOM   2776 C  CG  . GLU B 1 158 ? -23.355 36.536  -22.735 1.00 48.22 ?  151 GLU B CG  1 
ATOM   2777 C  CD  . GLU B 1 158 ? -22.510 35.882  -21.641 1.00 54.61 ?  151 GLU B CD  1 
ATOM   2778 O  OE1 . GLU B 1 158 ? -22.749 34.688  -21.332 1.00 60.20 ?  151 GLU B OE1 1 
ATOM   2779 O  OE2 . GLU B 1 158 ? -21.623 36.572  -21.073 1.00 50.45 -1 151 GLU B OE2 1 
ATOM   2780 N  N   . GLU B 1 159 ? -25.147 39.595  -19.847 1.00 36.43 ?  152 GLU B N   1 
ATOM   2781 C  CA  . GLU B 1 159 ? -26.191 40.309  -19.117 1.00 35.02 ?  152 GLU B CA  1 
ATOM   2782 C  C   . GLU B 1 159 ? -25.907 41.805  -19.052 1.00 28.68 ?  152 GLU B C   1 
ATOM   2783 O  O   . GLU B 1 159 ? -26.830 42.621  -19.179 1.00 34.35 ?  152 GLU B O   1 
ATOM   2784 C  CB  . GLU B 1 159 ? -26.339 39.697  -17.727 1.00 31.19 ?  152 GLU B CB  1 
ATOM   2785 C  CG  . GLU B 1 159 ? -26.927 38.281  -17.783 1.00 35.00 ?  152 GLU B CG  1 
ATOM   2786 C  CD  . GLU B 1 159 ? -26.889 37.555  -16.445 1.00 42.44 ?  152 GLU B CD  1 
ATOM   2787 O  OE1 . GLU B 1 159 ? -25.811 37.518  -15.809 1.00 43.51 ?  152 GLU B OE1 1 
ATOM   2788 O  OE2 . GLU B 1 159 ? -27.935 37.006  -16.024 1.00 49.65 -1 152 GLU B OE2 1 
ATOM   2789 N  N   . PHE B 1 160 ? -24.639 42.193  -18.865 1.00 30.65 ?  153 PHE B N   1 
ATOM   2790 C  CA  . PHE B 1 160 ? -24.279 43.607  -18.979 1.00 28.77 ?  153 PHE B CA  1 
ATOM   2791 C  C   . PHE B 1 160 ? -24.650 44.175  -20.341 1.00 31.90 ?  153 PHE B C   1 
ATOM   2792 O  O   . PHE B 1 160 ? -25.170 45.296  -20.438 1.00 34.67 ?  153 PHE B O   1 
ATOM   2793 C  CB  . PHE B 1 160 ? -22.786 43.800  -18.729 1.00 30.90 ?  153 PHE B CB  1 
ATOM   2794 C  CG  . PHE B 1 160 ? -22.428 43.847  -17.290 1.00 27.49 ?  153 PHE B CG  1 
ATOM   2795 C  CD1 . PHE B 1 160 ? -22.453 45.040  -16.597 1.00 28.28 ?  153 PHE B CD1 1 
ATOM   2796 C  CD2 . PHE B 1 160 ? -22.084 42.693  -16.619 1.00 28.31 ?  153 PHE B CD2 1 
ATOM   2797 C  CE1 . PHE B 1 160 ? -22.142 45.074  -15.249 1.00 29.69 ?  153 PHE B CE1 1 
ATOM   2798 C  CE2 . PHE B 1 160 ? -21.760 42.730  -15.267 1.00 30.34 ?  153 PHE B CE2 1 
ATOM   2799 C  CZ  . PHE B 1 160 ? -21.785 43.922  -14.594 1.00 26.03 ?  153 PHE B CZ  1 
ATOM   2800 N  N   . ALA B 1 161 ? -24.364 43.432  -21.408 1.00 33.48 ?  154 ALA B N   1 
ATOM   2801 C  CA  . ALA B 1 161 ? -24.721 43.904  -22.742 1.00 37.31 ?  154 ALA B CA  1 
ATOM   2802 C  C   . ALA B 1 161 ? -26.235 43.983  -22.906 1.00 34.87 ?  154 ALA B C   1 
ATOM   2803 O  O   . ALA B 1 161 ? -26.753 44.944  -23.485 1.00 35.63 ?  154 ALA B O   1 
ATOM   2804 C  CB  . ALA B 1 161 ? -24.104 42.989  -23.795 1.00 38.04 ?  154 ALA B CB  1 
ATOM   2805 N  N   . TYR B 1 162 ? -26.957 42.984  -22.392 1.00 35.36 ?  155 TYR B N   1 
ATOM   2806 C  CA  . TYR B 1 162 ? -28.416 43.008  -22.437 1.00 36.35 ?  155 TYR B CA  1 
ATOM   2807 C  C   . TYR B 1 162 ? -28.976 44.202  -21.674 1.00 39.20 ?  155 TYR B C   1 
ATOM   2808 O  O   . TYR B 1 162 ? -29.972 44.808  -22.095 1.00 38.00 ?  155 TYR B O   1 
ATOM   2809 C  CB  . TYR B 1 162 ? -28.973 41.701  -21.872 1.00 37.03 ?  155 TYR B CB  1 
ATOM   2810 C  CG  . TYR B 1 162 ? -30.473 41.595  -22.007 1.00 40.65 ?  155 TYR B CG  1 
ATOM   2811 C  CD1 . TYR B 1 162 ? -31.049 41.097  -23.172 1.00 42.80 ?  155 TYR B CD1 1 
ATOM   2812 C  CD2 . TYR B 1 162 ? -31.312 42.016  -20.990 1.00 37.88 ?  155 TYR B CD2 1 
ATOM   2813 C  CE1 . TYR B 1 162 ? -32.418 41.015  -23.309 1.00 44.45 ?  155 TYR B CE1 1 
ATOM   2814 C  CE2 . TYR B 1 162 ? -32.682 41.937  -21.117 1.00 42.23 ?  155 TYR B CE2 1 
ATOM   2815 C  CZ  . TYR B 1 162 ? -33.231 41.433  -22.279 1.00 44.87 ?  155 TYR B CZ  1 
ATOM   2816 O  OH  . TYR B 1 162 ? -34.600 41.344  -22.406 1.00 44.27 ?  155 TYR B OH  1 
ATOM   2817 N  N   . CYS B 1 163 ? -28.354 44.555  -20.544 1.00 37.41 ?  156 CYS B N   1 
ATOM   2818 C  CA  . CYS B 1 163 ? -28.797 45.729  -19.795 1.00 33.34 ?  156 CYS B CA  1 
ATOM   2819 C  C   . CYS B 1 163 ? -28.500 47.011  -20.542 1.00 36.11 ?  156 CYS B C   1 
ATOM   2820 O  O   . CYS B 1 163 ? -29.320 47.935  -20.550 1.00 35.24 ?  156 CYS B O   1 
ATOM   2821 C  CB  . CYS B 1 163 ? -28.125 45.775  -18.433 1.00 38.10 ?  156 CYS B CB  1 
ATOM   2822 S  SG  . CYS B 1 163 ? -28.867 44.652  -17.317 1.00 42.15 ?  156 CYS B SG  1 
ATOM   2823 N  N   . TRP B 1 164 ? -27.315 47.098  -21.146 1.00 35.88 ?  157 TRP B N   1 
ATOM   2824 C  CA  . TRP B 1 164 ? -26.969 48.272  -21.932 1.00 37.85 ?  157 TRP B CA  1 
ATOM   2825 C  C   . TRP B 1 164 ? -28.007 48.513  -23.019 1.00 38.04 ?  157 TRP B C   1 
ATOM   2826 O  O   . TRP B 1 164 ? -28.432 49.652  -23.253 1.00 38.85 ?  157 TRP B O   1 
ATOM   2827 C  CB  . TRP B 1 164 ? -25.582 48.081  -22.546 1.00 42.32 ?  157 TRP B CB  1 
ATOM   2828 C  CG  . TRP B 1 164 ? -25.100 49.255  -23.334 1.00 44.31 ?  157 TRP B CG  1 
ATOM   2829 C  CD1 . TRP B 1 164 ? -25.122 49.401  -24.695 1.00 40.74 ?  157 TRP B CD1 1 
ATOM   2830 C  CD2 . TRP B 1 164 ? -24.514 50.452  -22.808 1.00 43.77 ?  157 TRP B CD2 1 
ATOM   2831 N  NE1 . TRP B 1 164 ? -24.586 50.618  -25.045 1.00 45.55 ?  157 TRP B NE1 1 
ATOM   2832 C  CE2 . TRP B 1 164 ? -24.202 51.282  -23.908 1.00 47.50 ?  157 TRP B CE2 1 
ATOM   2833 C  CE3 . TRP B 1 164 ? -24.217 50.900  -21.515 1.00 39.32 ?  157 TRP B CE3 1 
ATOM   2834 C  CZ2 . TRP B 1 164 ? -23.613 52.539  -23.751 1.00 48.01 ?  157 TRP B CZ2 1 
ATOM   2835 C  CZ3 . TRP B 1 164 ? -23.638 52.143  -21.361 1.00 42.91 ?  157 TRP B CZ3 1 
ATOM   2836 C  CH2 . TRP B 1 164 ? -23.335 52.950  -22.476 1.00 45.29 ?  157 TRP B CH2 1 
ATOM   2837 N  N   . GLU B 1 165 ? -28.449 47.437  -23.659 1.00 37.91 ?  158 GLU B N   1 
ATOM   2838 C  CA  . GLU B 1 165 ? -29.412 47.534  -24.749 1.00 42.40 ?  158 GLU B CA  1 
ATOM   2839 C  C   . GLU B 1 165 ? -30.772 48.007  -24.247 1.00 47.17 ?  158 GLU B C   1 
ATOM   2840 O  O   . GLU B 1 165 ? -31.384 48.910  -24.834 1.00 41.24 ?  158 GLU B O   1 
ATOM   2841 C  CB  . GLU B 1 165 ? -29.532 46.172  -25.434 1.00 39.27 ?  158 GLU B CB  1 
ATOM   2842 C  CG  . GLU B 1 165 ? -30.378 46.168  -26.690 1.00 51.35 ?  158 GLU B CG  1 
ATOM   2843 C  CD  . GLU B 1 165 ? -29.739 46.951  -27.831 1.00 59.80 ?  158 GLU B CD  1 
ATOM   2844 O  OE1 . GLU B 1 165 ? -28.508 47.176  -27.794 1.00 60.67 ?  158 GLU B OE1 1 
ATOM   2845 O  OE2 . GLU B 1 165 ? -30.470 47.343  -28.767 1.00 72.14 -1 158 GLU B OE2 1 
ATOM   2846 N  N   . ASN B 1 166 ? -31.251 47.432  -23.142 1.00 40.45 ?  159 ASN B N   1 
ATOM   2847 C  CA  . ASN B 1 166 ? -32.648 47.592  -22.762 1.00 41.80 ?  159 ASN B CA  1 
ATOM   2848 C  C   . ASN B 1 166 ? -32.893 48.559  -21.607 1.00 42.31 ?  159 ASN B C   1 
ATOM   2849 O  O   . ASN B 1 166 ? -33.989 49.130  -21.524 1.00 44.30 ?  159 ASN B O   1 
ATOM   2850 C  CB  . ASN B 1 166 ? -33.248 46.224  -22.426 1.00 39.40 ?  159 ASN B CB  1 
ATOM   2851 C  CG  . ASN B 1 166 ? -33.367 45.333  -23.652 1.00 47.27 ?  159 ASN B CG  1 
ATOM   2852 O  OD1 . ASN B 1 166 ? -34.310 45.468  -24.430 1.00 51.61 ?  159 ASN B OD1 1 
ATOM   2853 N  ND2 . ASN B 1 166 ? -32.412 44.423  -23.832 1.00 38.41 ?  159 ASN B ND2 1 
ATOM   2854 N  N   . PHE B 1 167 ? -31.928 48.785  -20.716 1.00 37.15 ?  160 PHE B N   1 
ATOM   2855 C  CA  . PHE B 1 167 ? -32.191 49.645  -19.568 1.00 37.16 ?  160 PHE B CA  1 
ATOM   2856 C  C   . PHE B 1 167 ? -31.351 50.920  -19.567 1.00 35.91 ?  160 PHE B C   1 
ATOM   2857 O  O   . PHE B 1 167 ? -31.423 51.695  -18.608 1.00 35.52 ?  160 PHE B O   1 
ATOM   2858 C  CB  . PHE B 1 167 ? -31.996 48.848  -18.265 1.00 33.49 ?  160 PHE B CB  1 
ATOM   2859 C  CG  . PHE B 1 167 ? -32.821 47.580  -18.196 1.00 29.46 ?  160 PHE B CG  1 
ATOM   2860 C  CD1 . PHE B 1 167 ? -34.189 47.632  -17.947 1.00 34.87 ?  160 PHE B CD1 1 
ATOM   2861 C  CD2 . PHE B 1 167 ? -32.233 46.343  -18.391 1.00 31.47 ?  160 PHE B CD2 1 
ATOM   2862 C  CE1 . PHE B 1 167 ? -34.949 46.461  -17.891 1.00 33.29 ?  160 PHE B CE1 1 
ATOM   2863 C  CE2 . PHE B 1 167 ? -32.977 45.174  -18.348 1.00 31.57 ?  160 PHE B CE2 1 
ATOM   2864 C  CZ  . PHE B 1 167 ? -34.345 45.234  -18.093 1.00 33.39 ?  160 PHE B CZ  1 
ATOM   2865 N  N   . VAL B 1 168 ? -30.587 51.184  -20.627 1.00 35.18 ?  161 VAL B N   1 
ATOM   2866 C  CA  . VAL B 1 168 ? -29.731 52.362  -20.708 1.00 37.78 ?  161 VAL B CA  1 
ATOM   2867 C  C   . VAL B 1 168 ? -30.113 53.178  -21.939 1.00 42.34 ?  161 VAL B C   1 
ATOM   2868 O  O   . VAL B 1 168 ? -30.340 52.619  -23.018 1.00 40.67 ?  161 VAL B O   1 
ATOM   2869 C  CB  . VAL B 1 168 ? -28.240 51.963  -20.755 1.00 37.62 ?  161 VAL B CB  1 
ATOM   2870 C  CG1 . VAL B 1 168 ? -27.354 53.187  -20.778 1.00 41.27 ?  161 VAL B CG1 1 
ATOM   2871 C  CG2 . VAL B 1 168 ? -27.888 51.086  -19.536 1.00 36.23 ?  161 VAL B CG2 1 
ATOM   2872 N  N   . ASP B 1 169 ? -30.207 54.499  -21.766 1.00 45.47 ?  162 ASP B N   1 
ATOM   2873 C  CA  . ASP B 1 169 ? -30.307 55.422  -22.893 1.00 47.63 ?  162 ASP B CA  1 
ATOM   2874 C  C   . ASP B 1 169 ? -28.972 55.470  -23.619 1.00 47.07 ?  162 ASP B C   1 
ATOM   2875 O  O   . ASP B 1 169 ? -28.234 56.458  -23.516 1.00 47.80 ?  162 ASP B O   1 
ATOM   2876 C  CB  . ASP B 1 169 ? -30.708 56.822  -22.424 1.00 48.59 ?  162 ASP B CB  1 
ATOM   2877 C  CG  . ASP B 1 169 ? -32.163 56.899  -22.017 1.00 59.39 ?  162 ASP B CG  1 
ATOM   2878 O  OD1 . ASP B 1 169 ? -32.999 56.263  -22.697 1.00 60.14 ?  162 ASP B OD1 1 
ATOM   2879 O  OD2 . ASP B 1 169 ? -32.473 57.586  -21.014 1.00 64.85 -1 162 ASP B OD2 1 
ATOM   2880 N  N   . ASN B 1 170 ? -28.643 54.391  -24.334 1.00 41.21 ?  163 ASN B N   1 
ATOM   2881 C  CA  . ASN B 1 170 ? -27.308 54.267  -24.894 1.00 47.51 ?  163 ASN B CA  1 
ATOM   2882 C  C   . ASN B 1 170 ? -27.102 55.183  -26.095 1.00 51.45 ?  163 ASN B C   1 
ATOM   2883 O  O   . ASN B 1 170 ? -25.954 55.503  -26.417 1.00 50.27 ?  163 ASN B O   1 
ATOM   2884 C  CB  . ASN B 1 170 ? -27.032 52.810  -25.272 1.00 45.84 ?  163 ASN B CB  1 
ATOM   2885 C  CG  . ASN B 1 170 ? -28.063 52.248  -26.224 1.00 50.41 ?  163 ASN B CG  1 
ATOM   2886 O  OD1 . ASN B 1 170 ? -28.136 52.656  -27.386 1.00 50.43 ?  163 ASN B OD1 1 
ATOM   2887 N  ND2 . ASN B 1 170 ? -28.853 51.292  -25.749 1.00 44.76 ?  163 ASN B ND2 1 
ATOM   2888 N  N   . GLU B 1 171 ? -28.184 55.618  -26.740 1.00 54.09 ?  164 GLU B N   1 
ATOM   2889 C  CA  . GLU B 1 171 ? -28.126 56.563  -27.862 1.00 53.74 ?  164 GLU B CA  1 
ATOM   2890 C  C   . GLU B 1 171 ? -27.159 56.084  -28.942 1.00 51.06 ?  164 GLU B C   1 
ATOM   2891 O  O   . GLU B 1 171 ? -26.364 56.857  -29.479 1.00 58.03 ?  164 GLU B O   1 
ATOM   2892 C  CB  . GLU B 1 171 ? -27.756 57.970  -27.381 1.00 53.43 ?  164 GLU B CB  1 
ATOM   2893 C  CG  . GLU B 1 171 ? -28.521 58.421  -26.138 1.00 59.12 ?  164 GLU B CG  1 
ATOM   2894 C  CD  . GLU B 1 171 ? -28.452 59.923  -25.900 1.00 65.78 ?  164 GLU B CD  1 
ATOM   2895 O  OE1 . GLU B 1 171 ? -28.972 60.684  -26.744 1.00 71.13 ?  164 GLU B OE1 1 
ATOM   2896 O  OE2 . GLU B 1 171 ? -27.882 60.346  -24.869 1.00 70.40 -1 164 GLU B OE2 1 
ATOM   2897 N  N   . GLY B 1 172 ? -27.225 54.788  -29.256 1.00 48.36 ?  165 GLY B N   1 
ATOM   2898 C  CA  . GLY B 1 172 ? -26.405 54.194  -30.288 1.00 53.56 ?  165 GLY B CA  1 
ATOM   2899 C  C   . GLY B 1 172 ? -25.046 53.695  -29.838 1.00 57.91 ?  165 GLY B C   1 
ATOM   2900 O  O   . GLY B 1 172 ? -24.460 52.844  -30.519 1.00 60.70 ?  165 GLY B O   1 
ATOM   2901 N  N   . GLN B 1 173 ? -24.530 54.193  -28.716 1.00 56.65 ?  166 GLN B N   1 
ATOM   2902 C  CA  . GLN B 1 173 ? -23.225 53.774  -28.227 1.00 57.24 ?  166 GLN B CA  1 
ATOM   2903 C  C   . GLN B 1 173 ? -23.207 52.277  -27.916 1.00 56.86 ?  166 GLN B C   1 
ATOM   2904 O  O   . GLN B 1 173 ? -24.246 51.632  -27.739 1.00 53.82 ?  166 GLN B O   1 
ATOM   2905 C  CB  . GLN B 1 173 ? -22.846 54.565  -26.974 1.00 58.86 ?  166 GLN B CB  1 
ATOM   2906 C  CG  . GLN B 1 173 ? -22.866 56.071  -27.161 1.00 58.17 ?  166 GLN B CG  1 
ATOM   2907 C  CD  . GLN B 1 173 ? -21.770 56.543  -28.084 1.00 70.58 ?  166 GLN B CD  1 
ATOM   2908 O  OE1 . GLN B 1 173 ? -20.634 56.077  -27.996 1.00 74.90 ?  166 GLN B OE1 1 
ATOM   2909 N  NE2 . GLN B 1 173 ? -22.102 57.466  -28.984 1.00 73.92 ?  166 GLN B NE2 1 
ATOM   2910 N  N   . GLN B 1 174 ? -21.999 51.727  -27.857 1.00 54.66 ?  167 GLN B N   1 
ATOM   2911 C  CA  . GLN B 1 174 ? -21.784 50.344  -27.458 1.00 54.97 ?  167 GLN B CA  1 
ATOM   2912 C  C   . GLN B 1 174 ? -21.384 50.285  -25.988 1.00 52.53 ?  167 GLN B C   1 
ATOM   2913 O  O   . GLN B 1 174 ? -20.927 51.271  -25.403 1.00 48.33 ?  167 GLN B O   1 
ATOM   2914 C  CB  . GLN B 1 174 ? -20.696 49.686  -28.308 1.00 58.84 ?  167 GLN B CB  1 
ATOM   2915 C  CG  . GLN B 1 174 ? -20.710 50.084  -29.772 1.00 68.82 ?  167 GLN B CG  1 
ATOM   2916 C  CD  . GLN B 1 174 ? -19.345 49.931  -30.419 1.00 71.99 ?  167 GLN B CD  1 
ATOM   2917 O  OE1 . GLN B 1 174 ? -18.726 50.917  -30.830 1.00 72.91 ?  167 GLN B OE1 1 
ATOM   2918 N  NE2 . GLN B 1 174 ? -18.864 48.692  -30.504 1.00 74.21 ?  167 GLN B NE2 1 
ATOM   2919 N  N   . PHE B 1 175 ? -21.561 49.111  -25.392 1.00 47.80 ?  168 PHE B N   1 
ATOM   2920 C  CA  . PHE B 1 175 ? -21.113 48.896  -24.023 1.00 46.30 ?  168 PHE B CA  1 
ATOM   2921 C  C   . PHE B 1 175 ? -19.615 48.618  -24.032 1.00 46.49 ?  168 PHE B C   1 
ATOM   2922 O  O   . PHE B 1 175 ? -19.161 47.679  -24.695 1.00 49.87 ?  168 PHE B O   1 
ATOM   2923 C  CB  . PHE B 1 175 ? -21.878 47.741  -23.381 1.00 44.50 ?  168 PHE B CB  1 
ATOM   2924 C  CG  . PHE B 1 175 ? -21.252 47.227  -22.113 1.00 40.96 ?  168 PHE B CG  1 
ATOM   2925 C  CD1 . PHE B 1 175 ? -21.064 48.065  -21.024 1.00 41.56 ?  168 PHE B CD1 1 
ATOM   2926 C  CD2 . PHE B 1 175 ? -20.860 45.903  -22.010 1.00 40.67 ?  168 PHE B CD2 1 
ATOM   2927 C  CE1 . PHE B 1 175 ? -20.488 47.588  -19.846 1.00 40.33 ?  168 PHE B CE1 1 
ATOM   2928 C  CE2 . PHE B 1 175 ? -20.290 45.419  -20.852 1.00 40.71 ?  168 PHE B CE2 1 
ATOM   2929 C  CZ  . PHE B 1 175 ? -20.105 46.263  -19.763 1.00 35.17 ?  168 PHE B CZ  1 
ATOM   2930 N  N   . MET B 1 176 ? -18.847 49.449  -23.314 1.00 45.79 ?  169 MET B N   1 
ATOM   2931 C  CA  . MET B 1 176 ? -17.407 49.265  -23.185 1.00 46.53 ?  169 MET B CA  1 
ATOM   2932 C  C   . MET B 1 176 ? -17.082 48.705  -21.806 1.00 43.72 ?  169 MET B C   1 
ATOM   2933 O  O   . MET B 1 176 ? -17.142 49.452  -20.812 1.00 39.87 ?  169 MET B O   1 
ATOM   2934 C  CB  . MET B 1 176 ? -16.665 50.583  -23.408 1.00 46.19 ?  169 MET B CB  1 
ATOM   2935 C  CG  . MET B 1 176 ? -16.604 51.058  -24.870 1.00 54.84 ?  169 MET B CG  1 
ATOM   2936 S  SD  . MET B 1 176 ? -15.887 49.849  -26.016 1.00 69.33 ?  169 MET B SD  1 
ATOM   2937 C  CE  . MET B 1 176 ? -14.494 49.213  -25.063 1.00 54.97 ?  169 MET B CE  1 
ATOM   2938 N  N   . PRO B 1 177 ? -16.704 47.435  -21.697 1.00 40.91 ?  170 PRO B N   1 
ATOM   2939 C  CA  . PRO B 1 177 ? -16.516 46.823  -20.378 1.00 38.66 ?  170 PRO B CA  1 
ATOM   2940 C  C   . PRO B 1 177 ? -15.235 47.282  -19.707 1.00 40.73 ?  170 PRO B C   1 
ATOM   2941 O  O   . PRO B 1 177 ? -14.247 47.623  -20.360 1.00 37.32 ?  170 PRO B O   1 
ATOM   2942 C  CB  . PRO B 1 177 ? -16.449 45.321  -20.687 1.00 38.10 ?  170 PRO B CB  1 
ATOM   2943 C  CG  . PRO B 1 177 ? -16.732 45.186  -22.177 1.00 44.19 ?  170 PRO B CG  1 
ATOM   2944 C  CD  . PRO B 1 177 ? -16.408 46.497  -22.787 1.00 41.43 ?  170 PRO B CD  1 
ATOM   2945 N  N   . TRP B 1 178 ? -15.261 47.253  -18.373 1.00 37.50 ?  171 TRP B N   1 
ATOM   2946 C  CA  . TRP B 1 178 ? -14.100 47.633  -17.581 1.00 35.73 ?  171 TRP B CA  1 
ATOM   2947 C  C   . TRP B 1 178 ? -12.950 46.660  -17.819 1.00 32.98 ?  171 TRP B C   1 
ATOM   2948 O  O   . TRP B 1 178 ? -13.153 45.472  -18.072 1.00 32.04 ?  171 TRP B O   1 
ATOM   2949 C  CB  . TRP B 1 178 ? -14.473 47.688  -16.087 1.00 32.48 ?  171 TRP B CB  1 
ATOM   2950 C  CG  . TRP B 1 178 ? -15.640 48.591  -15.856 1.00 35.17 ?  171 TRP B CG  1 
ATOM   2951 C  CD1 . TRP B 1 178 ? -15.606 49.937  -15.622 1.00 36.55 ?  171 TRP B CD1 1 
ATOM   2952 C  CD2 . TRP B 1 178 ? -17.023 48.223  -15.885 1.00 31.74 ?  171 TRP B CD2 1 
ATOM   2953 N  NE1 . TRP B 1 178 ? -16.884 50.427  -15.488 1.00 37.77 ?  171 TRP B NE1 1 
ATOM   2954 C  CE2 . TRP B 1 178 ? -17.772 49.395  -15.651 1.00 32.75 ?  171 TRP B CE2 1 
ATOM   2955 C  CE3 . TRP B 1 178 ? -17.702 47.015  -16.082 1.00 31.01 ?  171 TRP B CE3 1 
ATOM   2956 C  CZ2 . TRP B 1 178 ? -19.167 49.396  -15.614 1.00 32.21 ?  171 TRP B CZ2 1 
ATOM   2957 C  CZ3 . TRP B 1 178 ? -19.085 47.016  -16.032 1.00 28.76 ?  171 TRP B CZ3 1 
ATOM   2958 C  CH2 . TRP B 1 178 ? -19.802 48.201  -15.806 1.00 29.30 ?  171 TRP B CH2 1 
ATOM   2959 N  N   . TYR B 1 179 ? -11.722 47.185  -17.744 1.00 36.09 ?  172 TYR B N   1 
ATOM   2960 C  CA  . TYR B 1 179 ? -10.547 46.374  -18.051 1.00 33.67 ?  172 TYR B CA  1 
ATOM   2961 C  C   . TYR B 1 179 ? -10.432 45.169  -17.121 1.00 36.34 ?  172 TYR B C   1 
ATOM   2962 O  O   . TYR B 1 179 ? -9.987  44.091  -17.535 1.00 32.00 ?  172 TYR B O   1 
ATOM   2963 C  CB  . TYR B 1 179 ? -9.290  47.247  -17.980 1.00 38.30 ?  172 TYR B CB  1 
ATOM   2964 C  CG  . TYR B 1 179 ? -9.198  48.255  -19.123 1.00 39.13 ?  172 TYR B CG  1 
ATOM   2965 C  CD1 . TYR B 1 179 ? -9.162  47.825  -20.444 1.00 38.38 ?  172 TYR B CD1 1 
ATOM   2966 C  CD2 . TYR B 1 179 ? -9.144  49.629  -18.880 1.00 39.70 ?  172 TYR B CD2 1 
ATOM   2967 C  CE1 . TYR B 1 179 ? -9.075  48.721  -21.488 1.00 35.18 ?  172 TYR B CE1 1 
ATOM   2968 C  CE2 . TYR B 1 179 ? -9.054  50.542  -19.926 1.00 41.55 ?  172 TYR B CE2 1 
ATOM   2969 C  CZ  . TYR B 1 179 ? -9.017  50.073  -21.236 1.00 43.47 ?  172 TYR B CZ  1 
ATOM   2970 O  OH  . TYR B 1 179 ? -8.933  50.951  -22.305 1.00 43.68 ?  172 TYR B OH  1 
ATOM   2971 N  N   . LYS B 1 180 ? -10.840 45.320  -15.861 1.00 31.97 ?  173 LYS B N   1 
ATOM   2972 C  CA  . LYS B 1 180 ? -10.781 44.214  -14.916 1.00 35.17 ?  173 LYS B CA  1 
ATOM   2973 C  C   . LYS B 1 180 ? -12.049 43.363  -14.910 1.00 37.20 ?  173 LYS B C   1 
ATOM   2974 O  O   . LYS B 1 180 ? -12.237 42.567  -13.980 1.00 35.01 ?  173 LYS B O   1 
ATOM   2975 C  CB  . LYS B 1 180 ? -10.494 44.738  -13.502 1.00 40.46 ?  173 LYS B CB  1 
ATOM   2976 C  CG  . LYS B 1 180 ? -9.007  44.963  -13.217 1.00 45.31 ?  173 LYS B CG  1 
ATOM   2977 C  CD  . LYS B 1 180 ? -8.739  45.248  -11.734 1.00 52.79 ?  173 LYS B CD  1 
ATOM   2978 C  CE  . LYS B 1 180 ? -7.252  45.465  -11.447 1.00 63.08 ?  173 LYS B CE  1 
ATOM   2979 N  NZ  . LYS B 1 180 ? -6.669  46.639  -12.168 1.00 65.19 1  173 LYS B NZ  1 
ATOM   2980 N  N   . PHE B 1 181 ? -12.911 43.501  -15.926 1.00 36.95 ?  174 PHE B N   1 
ATOM   2981 C  CA  . PHE B 1 181 ? -14.198 42.807  -15.902 1.00 37.58 ?  174 PHE B CA  1 
ATOM   2982 C  C   . PHE B 1 181 ? -14.023 41.316  -15.651 1.00 37.12 ?  174 PHE B C   1 
ATOM   2983 O  O   . PHE B 1 181 ? -14.674 40.740  -14.770 1.00 33.94 ?  174 PHE B O   1 
ATOM   2984 C  CB  . PHE B 1 181 ? -14.969 43.026  -17.208 1.00 33.22 ?  174 PHE B CB  1 
ATOM   2985 C  CG  . PHE B 1 181 ? -16.349 42.407  -17.194 1.00 33.61 ?  174 PHE B CG  1 
ATOM   2986 C  CD1 . PHE B 1 181 ? -16.537 41.074  -17.534 1.00 33.44 ?  174 PHE B CD1 1 
ATOM   2987 C  CD2 . PHE B 1 181 ? -17.444 43.150  -16.797 1.00 37.29 ?  174 PHE B CD2 1 
ATOM   2988 C  CE1 . PHE B 1 181 ? -17.795 40.496  -17.497 1.00 38.69 ?  174 PHE B CE1 1 
ATOM   2989 C  CE2 . PHE B 1 181 ? -18.712 42.578  -16.749 1.00 36.81 ?  174 PHE B CE2 1 
ATOM   2990 C  CZ  . PHE B 1 181 ? -18.888 41.247  -17.106 1.00 36.84 ?  174 PHE B CZ  1 
ATOM   2991 N  N   . ASP B 1 182 ? -13.129 40.677  -16.408 1.00 39.44 ?  175 ASP B N   1 
ATOM   2992 C  CA  . ASP B 1 182 ? -13.022 39.221  -16.366 1.00 38.54 ?  175 ASP B CA  1 
ATOM   2993 C  C   . ASP B 1 182 ? -12.545 38.729  -15.002 1.00 35.97 ?  175 ASP B C   1 
ATOM   2994 O  O   . ASP B 1 182 ? -13.104 37.776  -14.448 1.00 40.15 ?  175 ASP B O   1 
ATOM   2995 C  CB  . ASP B 1 182 ? -12.087 38.721  -17.475 1.00 48.10 ?  175 ASP B CB  1 
ATOM   2996 C  CG  . ASP B 1 182 ? -12.727 38.770  -18.862 1.00 53.02 ?  175 ASP B CG  1 
ATOM   2997 O  OD1 . ASP B 1 182 ? -13.961 38.962  -18.959 1.00 51.34 ?  175 ASP B OD1 1 
ATOM   2998 O  OD2 . ASP B 1 182 ? -11.985 38.597  -19.861 1.00 60.38 -1 175 ASP B OD2 1 
ATOM   2999 N  N   . GLU B 1 183 ? -11.502 39.343  -14.440 1.00 35.62 ?  176 GLU B N   1 
ATOM   3000 C  CA  . GLU B 1 183 ? -11.041 38.819  -13.156 1.00 39.29 ?  176 GLU B CA  1 
ATOM   3001 C  C   . GLU B 1 183 ? -11.977 39.215  -12.019 1.00 32.26 ?  176 GLU B C   1 
ATOM   3002 O  O   . GLU B 1 183 ? -12.065 38.498  -11.020 1.00 34.70 ?  176 GLU B O   1 
ATOM   3003 C  CB  . GLU B 1 183 ? -9.609  39.271  -12.846 1.00 41.31 ?  176 GLU B CB  1 
ATOM   3004 C  CG  . GLU B 1 183 ? -9.441  40.741  -12.518 1.00 42.97 ?  176 GLU B CG  1 
ATOM   3005 C  CD  . GLU B 1 183 ? -7.980  41.177  -12.555 1.00 53.83 ?  176 GLU B CD  1 
ATOM   3006 O  OE1 . GLU B 1 183 ? -7.188  40.571  -13.320 1.00 58.42 ?  176 GLU B OE1 1 
ATOM   3007 O  OE2 . GLU B 1 183 ? -7.629  42.123  -11.817 1.00 58.76 -1 176 GLU B OE2 1 
ATOM   3008 N  N   . ASN B 1 184 ? -12.669 40.347  -12.143 1.00 32.31 ?  177 ASN B N   1 
ATOM   3009 C  CA  . ASN B 1 184 ? -13.682 40.687  -11.150 1.00 33.59 ?  177 ASN B CA  1 
ATOM   3010 C  C   . ASN B 1 184 ? -14.807 39.672  -11.167 1.00 29.68 ?  177 ASN B C   1 
ATOM   3011 O  O   . ASN B 1 184 ? -15.233 39.183  -10.114 1.00 33.09 ?  177 ASN B O   1 
ATOM   3012 C  CB  . ASN B 1 184 ? -14.215 42.090  -11.400 1.00 30.43 ?  177 ASN B CB  1 
ATOM   3013 C  CG  . ASN B 1 184 ? -13.252 43.143  -10.942 1.00 29.89 ?  177 ASN B CG  1 
ATOM   3014 O  OD1 . ASN B 1 184 ? -12.314 42.845  -10.220 1.00 27.59 ?  177 ASN B OD1 1 
ATOM   3015 N  ND2 . ASN B 1 184 ? -13.477 44.374  -11.351 1.00 32.76 ?  177 ASN B ND2 1 
ATOM   3016 N  N   . TYR B 1 185 ? -15.291 39.328  -12.364 1.00 31.26 ?  178 TYR B N   1 
ATOM   3017 C  CA  . TYR B 1 185 ? -16.341 38.324  -12.474 1.00 34.20 ?  178 TYR B CA  1 
ATOM   3018 C  C   . TYR B 1 185 ? -15.901 37.010  -11.837 1.00 36.49 ?  178 TYR B C   1 
ATOM   3019 O  O   . TYR B 1 185 ? -16.653 36.389  -11.072 1.00 34.49 ?  178 TYR B O   1 
ATOM   3020 C  CB  . TYR B 1 185 ? -16.724 38.110  -13.939 1.00 31.59 ?  178 TYR B CB  1 
ATOM   3021 C  CG  . TYR B 1 185 ? -17.732 36.999  -14.091 1.00 37.22 ?  178 TYR B CG  1 
ATOM   3022 C  CD1 . TYR B 1 185 ? -19.091 37.239  -13.901 1.00 33.46 ?  178 TYR B CD1 1 
ATOM   3023 C  CD2 . TYR B 1 185 ? -17.327 35.704  -14.389 1.00 36.11 ?  178 TYR B CD2 1 
ATOM   3024 C  CE1 . TYR B 1 185 ? -20.011 36.222  -14.012 1.00 36.50 ?  178 TYR B CE1 1 
ATOM   3025 C  CE2 . TYR B 1 185 ? -18.241 34.681  -14.494 1.00 40.93 ?  178 TYR B CE2 1 
ATOM   3026 C  CZ  . TYR B 1 185 ? -19.582 34.946  -14.309 1.00 39.22 ?  178 TYR B CZ  1 
ATOM   3027 O  OH  . TYR B 1 185 ? -20.497 33.930  -14.424 1.00 40.74 ?  178 TYR B OH  1 
ATOM   3028 N  N   . ALA B 1 186 ? -14.673 36.579  -12.129 1.00 36.76 ?  179 ALA B N   1 
ATOM   3029 C  CA  . ALA B 1 186 ? -14.206 35.297  -11.615 1.00 38.11 ?  179 ALA B CA  1 
ATOM   3030 C  C   . ALA B 1 186 ? -14.138 35.296  -10.095 1.00 32.35 ?  179 ALA B C   1 
ATOM   3031 O  O   . ALA B 1 186 ? -14.493 34.302  -9.451  1.00 40.66 ?  179 ALA B O   1 
ATOM   3032 C  CB  . ALA B 1 186 ? -12.843 34.950  -12.224 1.00 42.00 ?  179 ALA B CB  1 
ATOM   3033 N  N   . PHE B 1 187 ? -13.671 36.389  -9.496  1.00 34.33 ?  180 PHE B N   1 
ATOM   3034 C  CA  . PHE B 1 187 ? -13.638 36.452  -8.043  1.00 31.78 ?  180 PHE B CA  1 
ATOM   3035 C  C   . PHE B 1 187 ? -15.045 36.448  -7.462  1.00 36.73 ?  180 PHE B C   1 
ATOM   3036 O  O   . PHE B 1 187 ? -15.311 35.759  -6.475  1.00 30.71 ?  180 PHE B O   1 
ATOM   3037 C  CB  . PHE B 1 187 ? -12.886 37.696  -7.580  1.00 35.37 ?  180 PHE B CB  1 
ATOM   3038 C  CG  . PHE B 1 187 ? -12.906 37.894  -6.100  1.00 36.67 ?  180 PHE B CG  1 
ATOM   3039 C  CD1 . PHE B 1 187 ? -12.014 37.216  -5.283  1.00 40.62 ?  180 PHE B CD1 1 
ATOM   3040 C  CD2 . PHE B 1 187 ? -13.825 38.754  -5.514  1.00 38.96 ?  180 PHE B CD2 1 
ATOM   3041 C  CE1 . PHE B 1 187 ? -12.035 37.391  -3.918  1.00 38.95 ?  180 PHE B CE1 1 
ATOM   3042 C  CE2 . PHE B 1 187 ? -13.849 38.931  -4.146  1.00 41.95 ?  180 PHE B CE2 1 
ATOM   3043 C  CZ  . PHE B 1 187 ? -12.946 38.247  -3.347  1.00 41.45 ?  180 PHE B CZ  1 
ATOM   3044 N  N   . LEU B 1 188 ? -15.952 37.224  -8.052  1.00 32.88 ?  181 LEU B N   1 
ATOM   3045 C  CA  . LEU B 1 188 ? -17.316 37.291  -7.532  1.00 32.42 ?  181 LEU B CA  1 
ATOM   3046 C  C   . LEU B 1 188 ? -18.029 35.949  -7.660  1.00 30.73 ?  181 LEU B C   1 
ATOM   3047 O  O   . LEU B 1 188 ? -18.738 35.527  -6.737  1.00 30.56 ?  181 LEU B O   1 
ATOM   3048 C  CB  . LEU B 1 188 ? -18.082 38.397  -8.260  1.00 25.07 ?  181 LEU B CB  1 
ATOM   3049 C  CG  . LEU B 1 188 ? -17.686 39.824  -7.873  1.00 25.67 ?  181 LEU B CG  1 
ATOM   3050 C  CD1 . LEU B 1 188 ? -18.188 40.830  -8.911  1.00 26.90 ?  181 LEU B CD1 1 
ATOM   3051 C  CD2 . LEU B 1 188 ? -18.214 40.184  -6.476  1.00 26.25 ?  181 LEU B CD2 1 
ATOM   3052 N  N   . HIS B 1 189 ? -17.847 35.260  -8.789  1.00 29.95 ?  182 HIS B N   1 
ATOM   3053 C  CA  . HIS B 1 189 ? -18.520 33.980  -9.005  1.00 33.99 ?  182 HIS B CA  1 
ATOM   3054 C  C   . HIS B 1 189 ? -18.044 32.940  -7.995  1.00 36.75 ?  182 HIS B C   1 
ATOM   3055 O  O   . HIS B 1 189 ? -18.840 32.136  -7.493  1.00 37.43 ?  182 HIS B O   1 
ATOM   3056 C  CB  . HIS B 1 189 ? -18.279 33.519  -10.451 1.00 39.91 ?  182 HIS B CB  1 
ATOM   3057 C  CG  . HIS B 1 189 ? -18.926 32.212  -10.806 1.00 42.00 ?  182 HIS B CG  1 
ATOM   3058 N  ND1 . HIS B 1 189 ? -18.394 30.993  -10.445 1.00 45.45 ?  182 HIS B ND1 1 
ATOM   3059 C  CD2 . HIS B 1 189 ? -20.042 31.935  -11.521 1.00 43.05 ?  182 HIS B CD2 1 
ATOM   3060 C  CE1 . HIS B 1 189 ? -19.165 30.023  -10.902 1.00 42.77 ?  182 HIS B CE1 1 
ATOM   3061 N  NE2 . HIS B 1 189 ? -20.171 30.567  -11.561 1.00 46.59 ?  182 HIS B NE2 1 
ATOM   3062 N  N   . ARG B 1 190 ? -16.751 32.962  -7.666  1.00 38.23 ?  183 ARG B N   1 
ATOM   3063 C  CA  . ARG B 1 190 ? -16.211 32.021  -6.692  1.00 39.54 ?  183 ARG B CA  1 
ATOM   3064 C  C   . ARG B 1 190 ? -16.710 32.337  -5.289  1.00 35.48 ?  183 ARG B C   1 
ATOM   3065 O  O   . ARG B 1 190 ? -17.021 31.427  -4.511  1.00 36.80 ?  183 ARG B O   1 
ATOM   3066 C  CB  . ARG B 1 190 ? -14.680 32.044  -6.750  1.00 41.24 ?  183 ARG B CB  1 
ATOM   3067 C  CG  . ARG B 1 190 ? -13.973 31.288  -5.630  1.00 46.25 ?  183 ARG B CG  1 
ATOM   3068 C  CD  . ARG B 1 190 ? -12.489 31.017  -5.977  1.00 58.91 ?  183 ARG B CD  1 
ATOM   3069 N  NE  . ARG B 1 190 ? -11.744 32.239  -6.296  1.00 54.81 ?  183 ARG B NE  1 
ATOM   3070 C  CZ  . ARG B 1 190 ? -11.461 32.649  -7.533  1.00 57.29 ?  183 ARG B CZ  1 
ATOM   3071 N  NH1 . ARG B 1 190 ? -11.850 31.929  -8.584  1.00 58.20 1  183 ARG B NH1 1 
ATOM   3072 N  NH2 . ARG B 1 190 ? -10.791 33.782  -7.727  1.00 56.26 ?  183 ARG B NH2 1 
ATOM   3073 N  N   . THR B 1 191 ? -16.796 33.623  -4.949  1.00 33.95 ?  184 THR B N   1 
ATOM   3074 C  CA  . THR B 1 191 ? -17.284 34.022  -3.630  1.00 33.73 ?  184 THR B CA  1 
ATOM   3075 C  C   . THR B 1 191 ? -18.757 33.673  -3.455  1.00 33.07 ?  184 THR B C   1 
ATOM   3076 O  O   . THR B 1 191 ? -19.176 33.220  -2.385  1.00 33.09 ?  184 THR B O   1 
ATOM   3077 C  CB  . THR B 1 191 ? -17.070 35.520  -3.441  1.00 35.51 ?  184 THR B CB  1 
ATOM   3078 O  OG1 . THR B 1 191 ? -15.690 35.830  -3.673  1.00 36.05 ?  184 THR B OG1 1 
ATOM   3079 C  CG2 . THR B 1 191 ? -17.457 35.956  -2.052  1.00 35.14 ?  184 THR B CG2 1 
ATOM   3080 N  N   . LEU B 1 192 ? -19.564 33.893  -4.490  1.00 29.67 ?  185 LEU B N   1 
ATOM   3081 C  CA  . LEU B 1 192 ? -20.974 33.553  -4.377  1.00 32.35 ?  185 LEU B CA  1 
ATOM   3082 C  C   . LEU B 1 192 ? -21.158 32.045  -4.253  1.00 35.53 ?  185 LEU B C   1 
ATOM   3083 O  O   . LEU B 1 192 ? -21.938 31.575  -3.417  1.00 31.79 ?  185 LEU B O   1 
ATOM   3084 C  CB  . LEU B 1 192 ? -21.739 34.117  -5.570  1.00 28.91 ?  185 LEU B CB  1 
ATOM   3085 C  CG  . LEU B 1 192 ? -23.226 33.773  -5.587  1.00 27.99 ?  185 LEU B CG  1 
ATOM   3086 C  CD1 . LEU B 1 192 ? -23.903 34.284  -4.310  1.00 27.40 ?  185 LEU B CD1 1 
ATOM   3087 C  CD2 . LEU B 1 192 ? -23.891 34.328  -6.838  1.00 31.01 ?  185 LEU B CD2 1 
ATOM   3088 N  N   . LYS B 1 193 ? -20.424 31.269  -5.050  1.00 36.29 ?  186 LYS B N   1 
ATOM   3089 C  CA  . LYS B 1 193 ? -20.476 29.816  -4.917  1.00 40.57 ?  186 LYS B CA  1 
ATOM   3090 C  C   . LYS B 1 193 ? -20.208 29.376  -3.479  1.00 40.33 ?  186 LYS B C   1 
ATOM   3091 O  O   . LYS B 1 193 ? -20.865 28.465  -2.964  1.00 46.42 ?  186 LYS B O   1 
ATOM   3092 C  CB  . LYS B 1 193 ? -19.474 29.178  -5.880  1.00 40.28 ?  186 LYS B CB  1 
ATOM   3093 C  CG  . LYS B 1 193 ? -19.444 27.664  -5.856  1.00 50.37 ?  186 LYS B CG  1 
ATOM   3094 C  CD  . LYS B 1 193 ? -18.373 27.131  -6.808  1.00 52.71 ?  186 LYS B CD  1 
ATOM   3095 C  CE  . LYS B 1 193 ? -18.702 27.452  -8.259  1.00 56.05 ?  186 LYS B CE  1 
ATOM   3096 N  NZ  . LYS B 1 193 ? -19.833 26.622  -8.788  1.00 63.15 1  186 LYS B NZ  1 
ATOM   3097 N  N   . GLU B 1 194 ? -19.264 30.029  -2.803  1.00 41.84 ?  187 GLU B N   1 
ATOM   3098 C  CA  . GLU B 1 194 ? -18.982 29.689  -1.412  1.00 41.50 ?  187 GLU B CA  1 
ATOM   3099 C  C   . GLU B 1 194 ? -20.137 30.084  -0.498  1.00 45.33 ?  187 GLU B C   1 
ATOM   3100 O  O   . GLU B 1 194 ? -20.502 29.338  0.420   1.00 45.10 ?  187 GLU B O   1 
ATOM   3101 C  CB  . GLU B 1 194 ? -17.688 30.372  -0.978  1.00 44.97 ?  187 GLU B CB  1 
ATOM   3102 C  CG  . GLU B 1 194 ? -17.419 30.340  0.507   1.00 48.39 ?  187 GLU B CG  1 
ATOM   3103 C  CD  . GLU B 1 194 ? -16.569 31.518  0.955   1.00 61.67 ?  187 GLU B CD  1 
ATOM   3104 O  OE1 . GLU B 1 194 ? -16.491 32.513  0.195   1.00 61.95 ?  187 GLU B OE1 1 
ATOM   3105 O  OE2 . GLU B 1 194 ? -15.984 31.453  2.062   1.00 65.53 -1 187 GLU B OE2 1 
ATOM   3106 N  N   . ILE B 1 195 ? -20.723 31.256  -0.745  1.00 36.56 ?  188 ILE B N   1 
ATOM   3107 C  CA  . ILE B 1 195 ? -21.847 31.765  0.033   1.00 36.53 ?  188 ILE B CA  1 
ATOM   3108 C  C   . ILE B 1 195 ? -23.066 30.850  -0.075  1.00 37.17 ?  188 ILE B C   1 
ATOM   3109 O  O   . ILE B 1 195 ? -23.834 30.710  0.885   1.00 39.81 ?  188 ILE B O   1 
ATOM   3110 C  CB  . ILE B 1 195 ? -22.149 33.204  -0.445  1.00 33.67 ?  188 ILE B CB  1 
ATOM   3111 C  CG1 . ILE B 1 195 ? -21.129 34.180  0.135   1.00 37.37 ?  188 ILE B CG1 1 
ATOM   3112 C  CG2 . ILE B 1 195 ? -23.578 33.620  -0.141  1.00 35.19 ?  188 ILE B CG2 1 
ATOM   3113 C  CD1 . ILE B 1 195 ? -21.411 35.632  -0.217  1.00 35.64 ?  188 ILE B CD1 1 
ATOM   3114 N  N   . LEU B 1 196 ? -23.262 30.213  -1.224  1.00 37.77 ?  189 LEU B N   1 
ATOM   3115 C  CA  . LEU B 1 196 ? -24.420 29.360  -1.468  1.00 39.46 ?  189 LEU B CA  1 
ATOM   3116 C  C   . LEU B 1 196 ? -24.158 27.889  -1.169  1.00 49.01 ?  189 LEU B C   1 
ATOM   3117 O  O   . LEU B 1 196 ? -25.046 27.065  -1.416  1.00 52.84 ?  189 LEU B O   1 
ATOM   3118 C  CB  . LEU B 1 196 ? -24.880 29.492  -2.927  1.00 36.12 ?  189 LEU B CB  1 
ATOM   3119 C  CG  . LEU B 1 196 ? -25.260 30.886  -3.418  1.00 36.09 ?  189 LEU B CG  1 
ATOM   3120 C  CD1 . LEU B 1 196 ? -25.698 30.831  -4.866  1.00 36.96 ?  189 LEU B CD1 1 
ATOM   3121 C  CD2 . LEU B 1 196 ? -26.353 31.489  -2.524  1.00 31.19 ?  189 LEU B CD2 1 
ATOM   3122 N  N   . ARG B 1 197 ? -22.977 27.554  -0.640  1.00 47.89 ?  190 ARG B N   1 
ATOM   3123 C  CA  . ARG B 1 197 ? -22.423 26.185  -0.522  1.00 53.60 ?  190 ARG B CA  1 
ATOM   3124 C  C   . ARG B 1 197 ? -21.830 25.747  -1.859  1.00 57.00 ?  190 ARG B C   1 
ATOM   3125 O  O   . ARG B 1 197 ? -22.460 25.881  -2.916  1.00 62.50 ?  190 ARG B O   1 
ATOM   3126 C  CB  . ARG B 1 197 ? -23.451 25.131  -0.059  1.00 53.62 ?  190 ARG B CB  1 
ATOM   3127 C  CG  . ARG B 1 197 ? -24.295 25.505  1.152   1.00 59.25 ?  190 ARG B CG  1 
ATOM   3128 C  CD  . ARG B 1 197 ? -23.529 26.368  2.122   1.00 55.57 ?  190 ARG B CD  1 
ATOM   3129 N  NE  . ARG B 1 197 ? -24.270 26.584  3.357   1.00 62.61 ?  190 ARG B NE  1 
ATOM   3130 C  CZ  . ARG B 1 197 ? -24.058 27.615  4.163   1.00 60.77 ?  190 ARG B CZ  1 
ATOM   3131 N  NH1 . ARG B 1 197 ? -23.143 28.516  3.827   1.00 64.18 1  190 ARG B NH1 1 
ATOM   3132 N  NH2 . ARG B 1 197 ? -24.761 27.757  5.282   1.00 57.78 ?  190 ARG B NH2 1 
HETATM 3133 ZN ZN  . ZN  C 2 .   ? 0.223   12.715  -29.791 1.00 24.71 ?  401 ZN  A ZN  1 
HETATM 3134 ZN ZN  . ZN  D 2 .   ? -32.855 45.818  1.912   1.00 24.43 ?  401 ZN  B ZN  1 
HETATM 3135 O  O   . HOH E 3 .   ? -10.102 35.208  -19.796 1.00 54.57 ?  501 HOH A O   1 
HETATM 3136 O  O   . HOH E 3 .   ? 8.424   6.484   -34.385 1.00 53.13 ?  502 HOH A O   1 
HETATM 3137 O  O   . HOH E 3 .   ? -5.173  29.560  -41.218 1.00 47.50 ?  503 HOH A O   1 
HETATM 3138 O  O   . HOH E 3 .   ? -6.038  6.033   -35.330 1.00 44.35 ?  504 HOH A O   1 
HETATM 3139 O  O   . HOH E 3 .   ? 2.273   32.328  -15.261 1.00 38.44 ?  505 HOH A O   1 
HETATM 3140 O  O   . HOH E 3 .   ? -7.066  1.430   -32.514 1.00 38.11 ?  506 HOH A O   1 
HETATM 3141 O  O   . HOH E 3 .   ? 3.665   24.825  -31.890 1.00 40.76 ?  507 HOH A O   1 
HETATM 3142 O  O   . HOH E 3 .   ? -13.384 31.005  -26.642 1.00 51.22 ?  508 HOH A O   1 
HETATM 3143 O  O   . HOH E 3 .   ? -5.668  2.782   -34.813 1.00 45.01 ?  509 HOH A O   1 
HETATM 3144 O  O   . HOH E 3 .   ? 5.888   3.063   -22.551 1.00 36.39 ?  510 HOH A O   1 
HETATM 3145 O  O   . HOH E 3 .   ? 1.977   22.513  -1.258  1.00 50.38 ?  511 HOH A O   1 
HETATM 3146 O  O   . HOH E 3 .   ? 3.813   -0.764  -27.767 1.00 47.15 ?  512 HOH A O   1 
HETATM 3147 O  O   . HOH E 3 .   ? 3.272   2.548   -12.505 1.00 42.34 ?  513 HOH A O   1 
HETATM 3148 O  O   . HOH E 3 .   ? 3.989   8.278   -8.408  1.00 43.30 ?  514 HOH A O   1 
HETATM 3149 O  O   . HOH E 3 .   ? -8.869  15.953  -34.687 1.00 43.50 ?  515 HOH A O   1 
HETATM 3150 O  O   . HOH E 3 .   ? 4.340   -5.353  -15.217 1.00 40.83 ?  516 HOH A O   1 
HETATM 3151 O  O   . HOH E 3 .   ? -4.041  20.467  -34.593 1.00 25.97 ?  517 HOH A O   1 
HETATM 3152 O  O   . HOH E 3 .   ? 3.282   13.912  -25.554 1.00 25.79 ?  518 HOH A O   1 
HETATM 3153 O  O   . HOH E 3 .   ? 9.022   20.686  -21.823 1.00 32.35 ?  519 HOH A O   1 
HETATM 3154 O  O   . HOH E 3 .   ? 5.481   20.530  -20.650 1.00 26.18 ?  520 HOH A O   1 
HETATM 3155 O  O   . HOH E 3 .   ? -5.077  26.400  -31.315 1.00 37.80 ?  521 HOH A O   1 
HETATM 3156 O  O   . HOH E 3 .   ? 1.983   16.778  -31.995 1.00 26.71 ?  522 HOH A O   1 
HETATM 3157 O  O   . HOH E 3 .   ? -14.492 3.429   -22.417 1.00 29.90 ?  523 HOH A O   1 
HETATM 3158 O  O   . HOH E 3 .   ? 7.475   27.771  -15.819 1.00 41.64 ?  524 HOH A O   1 
HETATM 3159 O  O   . HOH E 3 .   ? -16.267 5.275   -26.546 1.00 36.10 ?  525 HOH A O   1 
HETATM 3160 O  O   . HOH E 3 .   ? 0.068   13.914  -28.024 1.00 22.10 ?  526 HOH A O   1 
HETATM 3161 O  O   . HOH E 3 .   ? -12.699 19.793  -30.108 1.00 33.53 ?  527 HOH A O   1 
HETATM 3162 O  O   . HOH E 3 .   ? -5.458  19.022  -3.467  1.00 43.81 ?  528 HOH A O   1 
HETATM 3163 O  O   . HOH E 3 .   ? -8.539  26.581  -42.653 1.00 47.49 ?  529 HOH A O   1 
HETATM 3164 O  O   . HOH E 3 .   ? -11.750 22.597  -14.506 1.00 38.56 ?  530 HOH A O   1 
HETATM 3165 O  O   . HOH E 3 .   ? -5.002  0.692   -2.916  1.00 33.72 ?  531 HOH A O   1 
HETATM 3166 O  O   . HOH E 3 .   ? -0.675  9.247   -6.322  1.00 52.65 ?  532 HOH A O   1 
HETATM 3167 O  O   . HOH E 3 .   ? 0.363   16.445  -25.520 1.00 24.46 ?  533 HOH A O   1 
HETATM 3168 O  O   . HOH E 3 .   ? -2.639  40.229  -14.897 1.00 57.64 ?  534 HOH A O   1 
HETATM 3169 O  O   . HOH E 3 .   ? -13.956 24.220  -19.492 1.00 41.54 ?  535 HOH A O   1 
HETATM 3170 O  O   . HOH E 3 .   ? -0.509  19.696  -34.692 1.00 41.22 ?  536 HOH A O   1 
HETATM 3171 O  O   . HOH E 3 .   ? -16.659 23.367  -15.535 1.00 55.93 ?  537 HOH A O   1 
HETATM 3172 O  O   . HOH E 3 .   ? 12.704  15.402  -13.145 1.00 46.72 ?  538 HOH A O   1 
HETATM 3173 O  O   . HOH E 3 .   ? -2.389  14.961  -22.818 1.00 24.45 ?  539 HOH A O   1 
HETATM 3174 O  O   . HOH E 3 .   ? 0.597   22.866  -33.061 1.00 34.16 ?  540 HOH A O   1 
HETATM 3175 O  O   . HOH E 3 .   ? 1.496   16.100  -28.084 1.00 26.73 ?  541 HOH A O   1 
HETATM 3176 O  O   . HOH E 3 .   ? 0.860   22.239  -29.175 1.00 27.06 ?  542 HOH A O   1 
HETATM 3177 O  O   . HOH E 3 .   ? 4.965   36.081  -2.904  1.00 43.20 ?  543 HOH A O   1 
HETATM 3178 O  O   . HOH E 3 .   ? -3.771  8.351   -34.757 1.00 36.50 ?  544 HOH A O   1 
HETATM 3179 O  O   . HOH E 3 .   ? 6.061   25.481  -25.635 1.00 30.47 ?  545 HOH A O   1 
HETATM 3180 O  O   . HOH E 3 .   ? 8.982   12.014  -35.854 1.00 48.25 ?  546 HOH A O   1 
HETATM 3181 O  O   . HOH E 3 .   ? -13.504 -3.628  -11.101 1.00 47.77 ?  547 HOH A O   1 
HETATM 3182 O  O   . HOH E 3 .   ? 8.413   18.090  -29.166 1.00 32.49 ?  548 HOH A O   1 
HETATM 3183 O  O   . HOH E 3 .   ? -11.281 -12.738 -14.679 1.00 39.09 ?  549 HOH A O   1 
HETATM 3184 O  O   . HOH E 3 .   ? -12.538 23.344  -35.708 1.00 42.33 ?  550 HOH A O   1 
HETATM 3185 O  O   . HOH E 3 .   ? 7.615   29.022  -12.540 1.00 59.40 ?  551 HOH A O   1 
HETATM 3186 O  O   . HOH E 3 .   ? -2.786  26.682  -24.166 1.00 23.75 ?  552 HOH A O   1 
HETATM 3187 O  O   . HOH E 3 .   ? -9.671  0.687   -33.747 1.00 62.48 ?  553 HOH A O   1 
HETATM 3188 O  O   . HOH E 3 .   ? -14.704 20.263  -18.901 1.00 44.03 ?  554 HOH A O   1 
HETATM 3189 O  O   . HOH E 3 .   ? -0.287  33.337  -22.020 1.00 33.90 ?  555 HOH A O   1 
HETATM 3190 O  O   . HOH E 3 .   ? -5.730  25.446  -28.879 1.00 32.76 ?  556 HOH A O   1 
HETATM 3191 O  O   . HOH E 3 .   ? -3.929  34.067  -9.380  1.00 41.10 ?  557 HOH A O   1 
HETATM 3192 O  O   . HOH E 3 .   ? -15.194 6.153   -22.459 1.00 32.23 ?  558 HOH A O   1 
HETATM 3193 O  O   . HOH E 3 .   ? -6.482  23.291  -40.255 1.00 36.50 ?  559 HOH A O   1 
HETATM 3194 O  O   . HOH E 3 .   ? -5.690  27.580  -42.089 1.00 51.68 ?  560 HOH A O   1 
HETATM 3195 O  O   . HOH E 3 .   ? -13.804 7.634   -20.542 1.00 31.09 ?  561 HOH A O   1 
HETATM 3196 O  O   . HOH E 3 .   ? -10.206 31.924  -11.972 1.00 45.26 ?  562 HOH A O   1 
HETATM 3197 O  O   . HOH E 3 .   ? -6.088  2.544   -29.975 1.00 29.64 ?  563 HOH A O   1 
HETATM 3198 O  O   . HOH E 3 .   ? -4.100  -4.800  -13.761 1.00 49.15 ?  564 HOH A O   1 
HETATM 3199 O  O   . HOH E 3 .   ? -8.242  13.500  -34.343 1.00 38.90 ?  565 HOH A O   1 
HETATM 3200 O  O   . HOH E 3 .   ? -9.563  20.150  -29.989 1.00 29.57 ?  566 HOH A O   1 
HETATM 3201 O  O   . HOH E 3 .   ? -23.707 -3.636  -5.271  1.00 48.53 ?  567 HOH A O   1 
HETATM 3202 O  O   . HOH E 3 .   ? -17.604 13.190  -21.937 1.00 48.16 ?  568 HOH A O   1 
HETATM 3203 O  O   . HOH E 3 .   ? -8.876  35.547  -17.833 1.00 44.14 ?  569 HOH A O   1 
HETATM 3204 O  O   . HOH E 3 .   ? 3.222   2.575   -8.947  1.00 49.83 ?  570 HOH A O   1 
HETATM 3205 O  O   . HOH E 3 .   ? -12.361 22.580  -17.526 1.00 31.44 ?  571 HOH A O   1 
HETATM 3206 O  O   . HOH E 3 .   ? -5.971  27.444  -34.622 1.00 41.67 ?  572 HOH A O   1 
HETATM 3207 O  O   . HOH E 3 .   ? 8.519   26.069  -28.451 1.00 37.69 ?  573 HOH A O   1 
HETATM 3208 O  O   . HOH E 3 .   ? 11.542  21.809  -22.638 1.00 48.37 ?  574 HOH A O   1 
HETATM 3209 O  O   . HOH E 3 .   ? -13.798 30.854  -16.904 1.00 43.49 ?  575 HOH A O   1 
HETATM 3210 O  O   . HOH E 3 .   ? -15.112 16.351  -21.496 1.00 38.95 ?  576 HOH A O   1 
HETATM 3211 O  O   . HOH E 3 .   ? -6.669  2.943   -2.281  1.00 38.66 ?  577 HOH A O   1 
HETATM 3212 O  O   . HOH E 3 .   ? -14.537 2.349   -15.354 1.00 39.40 ?  578 HOH A O   1 
HETATM 3213 O  O   . HOH E 3 .   ? -9.042  14.816  -11.030 1.00 54.98 ?  579 HOH A O   1 
HETATM 3214 O  O   . HOH E 3 .   ? 9.788   8.890   -23.757 1.00 51.24 ?  580 HOH A O   1 
HETATM 3215 O  O   . HOH E 3 .   ? -4.522  25.397  -15.510 1.00 29.26 ?  581 HOH A O   1 
HETATM 3216 O  O   . HOH E 3 .   ? 5.482   23.219  -27.245 1.00 34.16 ?  582 HOH A O   1 
HETATM 3217 O  O   . HOH E 3 .   ? 3.712   8.569   -6.636  1.00 70.48 ?  583 HOH A O   1 
HETATM 3218 O  O   . HOH E 3 .   ? 3.345   16.024  -34.268 1.00 39.98 ?  584 HOH A O   1 
HETATM 3219 O  O   . HOH E 3 .   ? 8.160   37.480  -6.398  1.00 46.04 ?  585 HOH A O   1 
HETATM 3220 O  O   . HOH E 3 .   ? -4.493  35.464  -11.355 1.00 45.09 ?  586 HOH A O   1 
HETATM 3221 O  O   . HOH E 3 .   ? 0.767   14.314  -34.434 1.00 45.48 ?  587 HOH A O   1 
HETATM 3222 O  O   . HOH E 3 .   ? 5.891   16.924  -35.637 1.00 39.51 ?  588 HOH A O   1 
HETATM 3223 O  O   . HOH E 3 .   ? 14.455  20.587  -8.367  1.00 53.34 ?  589 HOH A O   1 
HETATM 3224 O  O   . HOH E 3 .   ? -20.442 9.258   -29.661 1.00 45.99 ?  590 HOH A O   1 
HETATM 3225 O  O   . HOH E 3 .   ? -7.189  -5.815  -23.937 1.00 47.87 ?  591 HOH A O   1 
HETATM 3226 O  O   . HOH E 3 .   ? 14.373  23.970  -19.006 1.00 48.59 ?  592 HOH A O   1 
HETATM 3227 O  O   . HOH E 3 .   ? -9.243  2.751   -1.038  1.00 45.61 ?  593 HOH A O   1 
HETATM 3228 O  O   . HOH E 3 .   ? -8.927  26.779  -9.636  1.00 42.10 ?  594 HOH A O   1 
HETATM 3229 O  O   . HOH E 3 .   ? -1.537  15.194  -34.826 1.00 38.66 ?  595 HOH A O   1 
HETATM 3230 O  O   . HOH E 3 .   ? -14.247 -5.584  -8.195  1.00 50.69 ?  596 HOH A O   1 
HETATM 3231 O  O   . HOH E 3 .   ? -4.305  4.400   -37.292 1.00 54.53 ?  597 HOH A O   1 
HETATM 3232 O  O   . HOH E 3 .   ? -3.416  17.761  -2.189  1.00 46.32 ?  598 HOH A O   1 
HETATM 3233 O  O   . HOH E 3 .   ? -8.959  24.105  -41.770 1.00 39.33 ?  599 HOH A O   1 
HETATM 3234 O  O   . HOH E 3 .   ? -6.744  12.578  -36.652 1.00 50.08 ?  600 HOH A O   1 
HETATM 3235 O  O   . HOH E 3 .   ? 6.368   -1.503  -23.361 1.00 58.73 ?  601 HOH A O   1 
HETATM 3236 O  O   . HOH E 3 .   ? 2.761   22.932  -27.459 1.00 31.28 ?  602 HOH A O   1 
HETATM 3237 O  O   . HOH E 3 .   ? -16.630 35.783  -18.098 1.00 57.16 ?  603 HOH A O   1 
HETATM 3238 O  O   . HOH E 3 .   ? -15.588 -7.484  -18.108 1.00 55.78 ?  604 HOH A O   1 
HETATM 3239 O  O   . HOH E 3 .   ? 5.826   14.523  -37.233 1.00 45.85 ?  605 HOH A O   1 
HETATM 3240 O  O   . HOH E 3 .   ? -0.386  39.128  -11.384 1.00 49.01 ?  606 HOH A O   1 
HETATM 3241 O  O   . HOH E 3 .   ? 4.837   27.823  -29.165 1.00 44.18 ?  607 HOH A O   1 
HETATM 3242 O  O   . HOH E 3 .   ? -11.584 1.964   -35.290 1.00 49.64 ?  608 HOH A O   1 
HETATM 3243 O  O   . HOH E 3 .   ? -17.422 6.124   -20.970 1.00 44.75 ?  609 HOH A O   1 
HETATM 3244 O  O   . HOH E 3 .   ? 5.571   -2.375  -28.001 1.00 56.65 ?  610 HOH A O   1 
HETATM 3245 O  O   . HOH E 3 .   ? -17.818 3.633   -25.042 1.00 53.03 ?  611 HOH A O   1 
HETATM 3246 O  O   . HOH E 3 .   ? 11.961  20.278  -30.114 1.00 56.53 ?  612 HOH A O   1 
HETATM 3247 O  O   . HOH E 3 .   ? -4.919  28.162  -25.552 1.00 42.62 ?  613 HOH A O   1 
HETATM 3248 O  O   . HOH E 3 .   ? 7.535   23.470  -28.816 1.00 42.86 ?  614 HOH A O   1 
HETATM 3249 O  O   . HOH E 3 .   ? -17.344 -2.150  -16.560 1.00 58.10 ?  615 HOH A O   1 
HETATM 3250 O  O   . HOH E 3 .   ? -0.853  7.840   -34.828 1.00 45.29 ?  616 HOH A O   1 
HETATM 3251 O  O   . HOH F 3 .   ? -10.176 38.861  -19.839 1.00 72.27 ?  501 HOH B O   1 
HETATM 3252 O  O   . HOH F 3 .   ? -26.287 53.843  -27.154 1.00 56.76 ?  502 HOH B O   1 
HETATM 3253 O  O   . HOH F 3 .   ? -6.489  47.328  -14.012 1.00 59.37 ?  503 HOH B O   1 
HETATM 3254 O  O   . HOH F 3 .   ? -39.123 54.203  6.689   1.00 50.89 ?  504 HOH B O   1 
HETATM 3255 O  O   . HOH F 3 .   ? -42.858 54.808  -5.618  1.00 57.36 ?  505 HOH B O   1 
HETATM 3256 O  O   . HOH F 3 .   ? -41.990 56.463  -5.955  1.00 58.73 ?  506 HOH B O   1 
HETATM 3257 O  O   . HOH F 3 .   ? -16.134 40.535  13.475  1.00 49.74 ?  507 HOH B O   1 
HETATM 3258 O  O   . HOH F 3 .   ? -39.620 39.609  7.369   1.00 44.13 ?  508 HOH B O   1 
HETATM 3259 O  O   . HOH F 3 .   ? -13.297 47.917  -12.631 1.00 38.27 ?  509 HOH B O   1 
HETATM 3260 O  O   . HOH F 3 .   ? -44.148 38.545  4.691   1.00 38.49 ?  510 HOH B O   1 
HETATM 3261 O  O   . HOH F 3 .   ? -19.909 53.094  -24.365 1.00 47.91 ?  511 HOH B O   1 
HETATM 3262 O  O   . HOH F 3 .   ? -46.281 49.360  -0.216  1.00 43.95 ?  512 HOH B O   1 
HETATM 3263 O  O   . HOH F 3 .   ? -37.302 49.739  -19.469 1.00 44.78 ?  513 HOH B O   1 
HETATM 3264 O  O   . HOH F 3 .   ? -42.543 51.549  -5.321  1.00 38.54 ?  514 HOH B O   1 
HETATM 3265 O  O   . HOH F 3 .   ? -20.748 49.228  4.080   1.00 38.39 ?  515 HOH B O   1 
HETATM 3266 O  O   . HOH F 3 .   ? -42.715 39.889  7.008   1.00 47.33 ?  516 HOH B O   1 
HETATM 3267 O  O   . HOH F 3 .   ? -43.000 48.940  -15.368 1.00 43.24 ?  517 HOH B O   1 
HETATM 3268 O  O   . HOH F 3 .   ? -36.314 44.810  -21.531 1.00 51.72 ?  518 HOH B O   1 
HETATM 3269 O  O   . HOH F 3 .   ? -50.971 49.885  -12.678 1.00 40.63 ?  519 HOH B O   1 
HETATM 3270 O  O   . HOH F 3 .   ? -24.992 51.120  -7.278  1.00 26.93 ?  520 HOH B O   1 
HETATM 3271 O  O   . HOH F 3 .   ? -31.658 48.816  -2.269  1.00 26.04 ?  521 HOH B O   1 
HETATM 3272 O  O   . HOH F 3 .   ? -54.421 32.334  -18.691 1.00 52.12 ?  522 HOH B O   1 
HETATM 3273 O  O   . HOH F 3 .   ? -24.997 41.618  6.679   1.00 26.49 ?  523 HOH B O   1 
HETATM 3274 O  O   . HOH F 3 .   ? -31.664 45.715  0.135   1.00 21.77 ?  524 HOH B O   1 
HETATM 3275 O  O   . HOH F 3 .   ? -22.148 29.071  -12.493 1.00 54.44 ?  525 HOH B O   1 
HETATM 3276 O  O   . HOH F 3 .   ? -24.891 54.652  -6.039  1.00 31.60 ?  526 HOH B O   1 
HETATM 3277 O  O   . HOH F 3 .   ? -28.803 47.584  4.156   1.00 26.16 ?  527 HOH B O   1 
HETATM 3278 O  O   . HOH F 3 .   ? -26.602 40.122  -24.392 1.00 42.16 ?  528 HOH B O   1 
HETATM 3279 O  O   . HOH F 3 .   ? -42.171 31.142  -5.428  1.00 30.68 ?  529 HOH B O   1 
HETATM 3280 O  O   . HOH F 3 .   ? -40.346 29.369  -1.364  1.00 34.41 ?  530 HOH B O   1 
HETATM 3281 O  O   . HOH F 3 .   ? -29.470 47.133  0.230   1.00 27.06 ?  531 HOH B O   1 
HETATM 3282 O  O   . HOH F 3 .   ? -22.954 33.796  -13.318 1.00 39.20 ?  532 HOH B O   1 
HETATM 3283 O  O   . HOH F 3 .   ? -21.320 31.611  -8.424  1.00 40.75 ?  533 HOH B O   1 
HETATM 3284 O  O   . HOH F 3 .   ? -12.774 51.724  -2.082  1.00 29.12 ?  534 HOH B O   1 
HETATM 3285 O  O   . HOH F 3 .   ? -19.176 36.959  14.656  1.00 45.82 ?  535 HOH B O   1 
HETATM 3286 O  O   . HOH F 3 .   ? -29.107 45.987  -2.389  1.00 24.39 ?  536 HOH B O   1 
HETATM 3287 O  O   . HOH F 3 .   ? -23.311 46.475  1.302   1.00 27.45 ?  537 HOH B O   1 
HETATM 3288 O  O   . HOH F 3 .   ? -30.629 43.178  -5.047  1.00 24.28 ?  538 HOH B O   1 
HETATM 3289 O  O   . HOH F 3 .   ? -25.700 32.903  2.227   1.00 34.05 ?  539 HOH B O   1 
HETATM 3290 O  O   . HOH F 3 .   ? -25.842 44.959  6.792   1.00 39.57 ?  540 HOH B O   1 
HETATM 3291 O  O   . HOH F 3 .   ? -20.112 51.624  -2.256  1.00 28.77 ?  541 HOH B O   1 
HETATM 3292 O  O   . HOH F 3 .   ? -44.759 40.579  -25.053 1.00 33.60 ?  542 HOH B O   1 
HETATM 3293 O  O   . HOH F 3 .   ? -49.050 32.026  -16.807 1.00 47.47 ?  543 HOH B O   1 
HETATM 3294 O  O   . HOH F 3 .   ? -50.379 41.468  -14.045 1.00 49.67 ?  544 HOH B O   1 
HETATM 3295 O  O   . HOH F 3 .   ? -22.753 46.181  5.249   1.00 33.76 ?  545 HOH B O   1 
HETATM 3296 O  O   . HOH F 3 .   ? -25.367 35.978  2.107   1.00 28.51 ?  546 HOH B O   1 
HETATM 3297 O  O   . HOH F 3 .   ? -30.242 58.187  -14.813 1.00 44.73 ?  547 HOH B O   1 
HETATM 3298 O  O   . HOH F 3 .   ? -33.639 54.702  7.836   1.00 46.92 ?  548 HOH B O   1 
HETATM 3299 O  O   . HOH F 3 .   ? -12.157 45.343  -5.856  1.00 33.65 ?  549 HOH B O   1 
HETATM 3300 O  O   . HOH F 3 .   ? -20.159 39.861  1.004   1.00 33.12 ?  550 HOH B O   1 
HETATM 3301 O  O   . HOH F 3 .   ? -19.033 40.512  3.334   1.00 40.10 ?  551 HOH B O   1 
HETATM 3302 O  O   . HOH F 3 .   ? -37.378 41.699  6.861   1.00 35.72 ?  552 HOH B O   1 
HETATM 3303 O  O   . HOH F 3 .   ? -18.869 42.785  -3.667  1.00 23.02 ?  553 HOH B O   1 
HETATM 3304 O  O   . HOH F 3 .   ? -22.288 33.015  7.856   1.00 42.34 ?  554 HOH B O   1 
HETATM 3305 O  O   . HOH F 3 .   ? -27.201 58.605  -21.439 1.00 51.00 ?  555 HOH B O   1 
HETATM 3306 O  O   . HOH F 3 .   ? -11.561 41.712  -18.503 1.00 42.54 ?  556 HOH B O   1 
HETATM 3307 O  O   . HOH F 3 .   ? -43.159 31.193  -12.500 1.00 38.89 ?  557 HOH B O   1 
HETATM 3308 O  O   . HOH F 3 .   ? -25.258 30.966  -9.026  1.00 43.50 ?  558 HOH B O   1 
HETATM 3309 O  O   . HOH F 3 .   ? -43.072 48.807  -18.886 1.00 48.86 ?  559 HOH B O   1 
HETATM 3310 O  O   . HOH F 3 .   ? -16.069 29.855  -9.321  1.00 48.01 ?  560 HOH B O   1 
HETATM 3311 O  O   . HOH F 3 .   ? -32.379 28.141  -5.919  1.00 46.57 ?  561 HOH B O   1 
HETATM 3312 O  O   . HOH F 3 .   ? -37.911 31.787  -7.361  1.00 30.23 ?  562 HOH B O   1 
HETATM 3313 O  O   . HOH F 3 .   ? -16.526 53.230  -15.244 1.00 51.14 ?  563 HOH B O   1 
HETATM 3314 O  O   . HOH F 3 .   ? -18.049 39.682  14.263  1.00 48.54 ?  564 HOH B O   1 
HETATM 3315 O  O   . HOH F 3 .   ? -9.573  50.513  -25.040 1.00 42.42 ?  565 HOH B O   1 
HETATM 3316 O  O   . HOH F 3 .   ? -27.507 54.074  1.345   1.00 32.95 ?  566 HOH B O   1 
HETATM 3317 O  O   . HOH F 3 .   ? -58.405 34.387  -13.185 1.00 38.51 ?  567 HOH B O   1 
HETATM 3318 O  O   . HOH F 3 .   ? -22.285 39.222  12.355  1.00 36.36 ?  568 HOH B O   1 
HETATM 3319 O  O   . HOH F 3 .   ? -29.308 30.497  -6.477  1.00 38.19 ?  569 HOH B O   1 
HETATM 3320 O  O   . HOH F 3 .   ? -9.962  36.764  -10.060 1.00 43.92 ?  570 HOH B O   1 
HETATM 3321 O  O   . HOH F 3 .   ? -19.510 54.132  0.542   1.00 37.00 ?  571 HOH B O   1 
HETATM 3322 O  O   . HOH F 3 .   ? -14.796 31.881  -11.030 1.00 45.03 ?  572 HOH B O   1 
HETATM 3323 O  O   . HOH F 3 .   ? -32.219 37.290  6.539   1.00 39.72 ?  573 HOH B O   1 
HETATM 3324 O  O   . HOH F 3 .   ? -13.757 35.263  -15.784 1.00 44.95 ?  574 HOH B O   1 
HETATM 3325 O  O   . HOH F 3 .   ? -39.501 30.428  -5.477  1.00 32.30 ?  575 HOH B O   1 
HETATM 3326 O  O   . HOH F 3 .   ? -10.243 41.149  -16.652 1.00 45.54 ?  576 HOH B O   1 
HETATM 3327 O  O   . HOH F 3 .   ? -18.127 39.580  6.748   1.00 41.82 ?  577 HOH B O   1 
HETATM 3328 O  O   . HOH F 3 .   ? -22.986 33.181  -10.395 1.00 33.34 ?  578 HOH B O   1 
HETATM 3329 O  O   . HOH F 3 .   ? -36.172 25.031  1.813   1.00 46.80 ?  579 HOH B O   1 
HETATM 3330 O  O   . HOH F 3 .   ? -22.296 51.099  -0.681  1.00 33.86 ?  580 HOH B O   1 
HETATM 3331 O  O   . HOH F 3 .   ? -45.029 35.823  5.884   1.00 62.54 ?  581 HOH B O   1 
HETATM 3332 O  O   . HOH F 3 .   ? -42.540 38.842  -25.656 1.00 39.19 ?  582 HOH B O   1 
HETATM 3333 O  O   . HOH F 3 .   ? -51.379 38.176  -3.853  1.00 46.59 ?  583 HOH B O   1 
HETATM 3334 O  O   . HOH F 3 .   ? -20.189 41.150  -12.383 1.00 28.20 ?  584 HOH B O   1 
HETATM 3335 O  O   . HOH F 3 .   ? -24.880 60.044  -19.512 1.00 55.30 ?  585 HOH B O   1 
HETATM 3336 O  O   . HOH F 3 .   ? -28.745 51.415  7.775   1.00 42.79 ?  586 HOH B O   1 
HETATM 3337 O  O   . HOH F 3 .   ? -31.258 46.430  6.559   1.00 47.69 ?  587 HOH B O   1 
HETATM 3338 O  O   . HOH F 3 .   ? -29.516 48.915  6.501   1.00 41.85 ?  588 HOH B O   1 
HETATM 3339 O  O   . HOH F 3 .   ? -18.849 36.675  -18.288 1.00 41.08 ?  589 HOH B O   1 
HETATM 3340 O  O   . HOH F 3 .   ? -37.320 45.679  -23.449 1.00 56.78 ?  590 HOH B O   1 
HETATM 3341 O  O   . HOH F 3 .   ? -37.223 54.322  -8.319  1.00 39.55 ?  591 HOH B O   1 
HETATM 3342 O  O   . HOH F 3 .   ? -52.562 47.611  -12.848 1.00 52.29 ?  592 HOH B O   1 
HETATM 3343 O  O   . HOH F 3 .   ? -42.901 36.369  -26.887 1.00 44.17 ?  593 HOH B O   1 
HETATM 3344 O  O   . HOH F 3 .   ? -42.396 33.450  -26.633 1.00 47.96 ?  594 HOH B O   1 
HETATM 3345 O  O   . HOH F 3 .   ? -51.187 31.373  -19.734 1.00 51.46 ?  595 HOH B O   1 
HETATM 3346 O  O   . HOH F 3 .   ? -30.244 44.027  7.048   1.00 39.29 ?  596 HOH B O   1 
HETATM 3347 O  O   . HOH F 3 .   ? -41.351 41.173  9.347   1.00 52.66 ?  597 HOH B O   1 
HETATM 3348 O  O   . HOH F 3 .   ? -47.447 27.782  -9.409  1.00 56.80 ?  598 HOH B O   1 
HETATM 3349 O  O   . HOH F 3 .   ? -27.843 42.259  -25.768 1.00 44.86 ?  599 HOH B O   1 
HETATM 3350 O  O   . HOH F 3 .   ? -32.989 38.826  8.742   1.00 47.11 ?  600 HOH B O   1 
HETATM 3351 O  O   . HOH F 3 .   ? -17.572 50.502  1.237   1.00 40.52 ?  601 HOH B O   1 
HETATM 3352 O  O   . HOH F 3 .   ? -22.658 48.236  -0.459  1.00 30.22 ?  602 HOH B O   1 
HETATM 3353 O  O   . HOH F 3 .   ? -9.590  29.117  -9.806  1.00 56.89 ?  603 HOH B O   1 
HETATM 3354 O  O   . HOH F 3 .   ? -6.493  45.262  -16.499 1.00 49.99 ?  604 HOH B O   1 
HETATM 3355 O  O   . HOH F 3 .   ? -43.473 34.020  7.479   1.00 49.56 ?  605 HOH B O   1 
HETATM 3356 O  O   . HOH F 3 .   ? -39.739 53.087  -2.516  1.00 53.66 ?  606 HOH B O   1 
HETATM 3357 O  O   . HOH F 3 .   ? -9.341  52.439  -25.895 1.00 47.45 ?  607 HOH B O   1 
HETATM 3358 O  O   . HOH F 3 .   ? -53.007 29.866  -9.727  1.00 57.25 ?  608 HOH B O   1 
HETATM 3359 O  O   . HOH F 3 .   ? -39.366 28.148  -6.815  1.00 42.59 ?  609 HOH B O   1 
HETATM 3360 O  O   . HOH F 3 .   ? -30.989 51.507  9.466   1.00 47.07 ?  610 HOH B O   1 
HETATM 3361 O  O   . HOH F 3 .   ? -47.989 51.144  0.049   1.00 58.75 ?  611 HOH B O   1 
HETATM 3362 O  O   . HOH F 3 .   ? -16.134 48.979  1.394   1.00 44.21 ?  612 HOH B O   1 
HETATM 3363 O  O   . HOH F 3 .   ? -25.165 57.829  2.150   1.00 57.77 ?  613 HOH B O   1 
HETATM 3364 O  O   . HOH F 3 .   ? -17.444 40.605  -2.554  1.00 40.57 ?  614 HOH B O   1 
HETATM 3365 O  O   . HOH F 3 .   ? -32.332 48.849  9.445   1.00 60.70 ?  615 HOH B O   1 
HETATM 3366 O  O   . HOH F 3 .   ? -22.247 53.126  1.017   1.00 43.57 ?  616 HOH B O   1 
HETATM 3367 O  O   . HOH F 3 .   ? -37.686 44.743  7.068   1.00 47.31 ?  617 HOH B O   1 
HETATM 3368 O  O   . HOH F 3 .   ? -47.711 28.279  -11.506 1.00 53.61 ?  618 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -6  ?   ?   ?   A . n 
A 1 2   PRO 2   -5  ?   ?   ?   A . n 
A 1 3   GLY 3   -4  ?   ?   ?   A . n 
A 1 4   GLY 4   -3  ?   ?   ?   A . n 
A 1 5   SER 5   -2  ?   ?   ?   A . n 
A 1 6   GLY 6   -1  ?   ?   ?   A . n 
A 1 7   GLY 7   0   ?   ?   ?   A . n 
A 1 8   MET 8   1   ?   ?   ?   A . n 
A 1 9   ASN 9   2   ?   ?   ?   A . n 
A 1 10  PRO 10  3   ?   ?   ?   A . n 
A 1 11  GLN 11  4   ?   ?   ?   A . n 
A 1 12  ILE 12  5   ?   ?   ?   A . n 
A 1 13  ARG 13  6   ?   ?   ?   A . n 
A 1 14  ASN 14  7   7   ASN ASN A . n 
A 1 15  PRO 15  8   8   PRO PRO A . n 
A 1 16  MET 16  9   9   MET MET A . n 
A 1 17  GLU 17  10  10  GLU GLU A . n 
A 1 18  ARG 18  11  11  ARG ARG A . n 
A 1 19  MET 19  12  12  MET MET A . n 
A 1 20  ASP 20  13  13  ASP ASP A . n 
A 1 21  ARG 21  14  14  ARG ARG A . n 
A 1 22  ASP 22  15  15  ASP ASP A . n 
A 1 23  THR 23  16  16  THR THR A . n 
A 1 24  PHE 24  17  17  PHE PHE A . n 
A 1 25  TYR 25  18  18  TYR TYR A . n 
A 1 26  ASP 26  19  19  ASP ASP A . n 
A 1 27  ASN 27  20  20  ASN ASN A . n 
A 1 28  PHE 28  21  21  PHE PHE A . n 
A 1 29  GLU 29  22  22  GLU GLU A . n 
A 1 30  ASN 30  23  23  ASN ASN A . n 
A 1 31  GLU 31  24  24  GLU GLU A . n 
A 1 32  PRO 32  25  25  PRO PRO A . n 
A 1 33  ILE 33  26  26  ILE ILE A . n 
A 1 34  LEU 34  27  27  LEU LEU A . n 
A 1 35  SER 35  28  28  SER SER A . n 
A 1 36  GLY 36  29  29  GLY GLY A . n 
A 1 37  ARG 37  30  30  ARG ARG A . n 
A 1 38  SER 38  31  31  SER SER A . n 
A 1 39  TYR 39  32  32  TYR TYR A . n 
A 1 40  THR 40  33  33  THR THR A . n 
A 1 41  TRP 41  34  34  TRP TRP A . n 
A 1 42  LEU 42  35  35  LEU LEU A . n 
A 1 43  CYS 43  36  36  CYS CYS A . n 
A 1 44  TYR 44  37  37  TYR TYR A . n 
A 1 45  GLU 45  38  38  GLU GLU A . n 
A 1 46  VAL 46  39  39  VAL VAL A . n 
A 1 47  LYS 47  40  40  LYS LYS A . n 
A 1 48  ILE 48  41  41  ILE ILE A . n 
A 1 49  LYS 49  42  42  LYS LYS A . n 
A 1 50  ARG 50  43  43  ARG ARG A . n 
A 1 51  GLY 51  44  44  GLY GLY A . n 
A 1 52  ARG 52  45  45  ARG ARG A . n 
A 1 53  SER 53  46  46  SER SER A . n 
A 1 54  ASN 54  47  47  ASN ASN A . n 
A 1 55  LEU 55  48  48  LEU LEU A . n 
A 1 56  LEU 56  49  49  LEU LEU A . n 
A 1 57  TRP 57  50  50  TRP TRP A . n 
A 1 58  ASP 58  51  51  ASP ASP A . n 
A 1 59  THR 59  52  52  THR THR A . n 
A 1 60  GLY 60  53  53  GLY GLY A . n 
A 1 61  VAL 61  54  54  VAL VAL A . n 
A 1 62  PHE 62  55  55  PHE PHE A . n 
A 1 63  ARG 63  56  56  ARG ARG A . n 
A 1 64  GLY 64  57  57  GLY GLY A . n 
A 1 65  GLN 65  58  58  GLN GLN A . n 
A 1 66  VAL 66  59  59  VAL VAL A . n 
A 1 67  TYR 67  60  60  TYR TYR A . n 
A 1 68  PHE 68  61  61  PHE PHE A . n 
A 1 69  LYS 69  62  62  LYS LYS A . n 
A 1 70  PRO 70  63  63  PRO PRO A . n 
A 1 71  GLN 71  64  64  GLN GLN A . n 
A 1 72  TYR 72  65  65  TYR TYR A . n 
A 1 73  HIS 73  66  66  HIS HIS A . n 
A 1 74  ALA 74  67  67  ALA ALA A . n 
A 1 75  GLU 75  68  68  GLU GLU A . n 
A 1 76  MET 76  69  69  MET MET A . n 
A 1 77  CYS 77  70  70  CYS CYS A . n 
A 1 78  PHE 78  71  71  PHE PHE A . n 
A 1 79  LEU 79  72  72  LEU LEU A . n 
A 1 80  SER 80  73  73  SER SER A . n 
A 1 81  TRP 81  74  74  TRP TRP A . n 
A 1 82  PHE 82  75  75  PHE PHE A . n 
A 1 83  CYS 83  76  76  CYS CYS A . n 
A 1 84  GLY 84  77  77  GLY GLY A . n 
A 1 85  ASN 85  78  78  ASN ASN A . n 
A 1 86  GLN 86  79  79  GLN GLN A . n 
A 1 87  LEU 87  80  80  LEU LEU A . n 
A 1 88  PRO 88  81  81  PRO PRO A . n 
A 1 89  ALA 89  82  82  ALA ALA A . n 
A 1 90  ASP 90  83  83  ASP ASP A . n 
A 1 91  LYS 91  84  84  LYS LYS A . n 
A 1 92  CYS 92  85  85  CYS CYS A . n 
A 1 93  PHE 93  86  86  PHE PHE A . n 
A 1 94  GLN 94  87  87  GLN GLN A . n 
A 1 95  ILE 95  88  88  ILE ILE A . n 
A 1 96  THR 96  89  89  THR THR A . n 
A 1 97  TRP 97  90  90  TRP TRP A . n 
A 1 98  PHE 98  91  91  PHE PHE A . n 
A 1 99  VAL 99  92  92  VAL VAL A . n 
A 1 100 SER 100 93  93  SER SER A . n 
A 1 101 TRP 101 94  94  TRP TRP A . n 
A 1 102 THR 102 95  95  THR THR A . n 
A 1 103 PRO 103 96  96  PRO PRO A . n 
A 1 104 CYS 104 97  97  CYS CYS A . n 
A 1 105 PRO 105 98  98  PRO PRO A . n 
A 1 106 ASP 106 99  99  ASP ASP A . n 
A 1 107 CYS 107 100 100 CYS CYS A . n 
A 1 108 VAL 108 101 101 VAL VAL A . n 
A 1 109 ALA 109 102 102 ALA ALA A . n 
A 1 110 LYS 110 103 103 LYS LYS A . n 
A 1 111 LEU 111 104 104 LEU LEU A . n 
A 1 112 ALA 112 105 105 ALA ALA A . n 
A 1 113 GLU 113 106 106 GLU GLU A . n 
A 1 114 PHE 114 107 107 PHE PHE A . n 
A 1 115 LEU 115 108 108 LEU LEU A . n 
A 1 116 SER 116 109 109 SER SER A . n 
A 1 117 GLU 117 110 110 GLU GLU A . n 
A 1 118 HIS 118 111 111 HIS HIS A . n 
A 1 119 PRO 119 112 112 PRO PRO A . n 
A 1 120 ASN 120 113 113 ASN ASN A . n 
A 1 121 VAL 121 114 114 VAL VAL A . n 
A 1 122 THR 122 115 115 THR THR A . n 
A 1 123 LEU 123 116 116 LEU LEU A . n 
A 1 124 THR 124 117 117 THR THR A . n 
A 1 125 ILE 125 118 118 ILE ILE A . n 
A 1 126 SER 126 119 119 SER SER A . n 
A 1 127 ALA 127 120 120 ALA ALA A . n 
A 1 128 ALA 128 121 121 ALA ALA A . n 
A 1 129 ARG 129 122 122 ARG ARG A . n 
A 1 130 LEU 130 123 123 LEU LEU A . n 
A 1 131 TYR 131 124 124 TYR TYR A . n 
A 1 132 TYR 132 125 125 TYR TYR A . n 
A 1 133 TYR 133 126 126 TYR TYR A . n 
A 1 134 SER 134 127 127 SER SER A . n 
A 1 135 GLU 135 128 128 GLU GLU A . n 
A 1 136 ARG 136 129 129 ARG ARG A . n 
A 1 137 ASP 137 130 130 ASP ASP A . n 
A 1 138 TYR 138 131 131 TYR TYR A . n 
A 1 139 ARG 139 132 132 ARG ARG A . n 
A 1 140 ARG 140 133 133 ARG ARG A . n 
A 1 141 ALA 141 134 134 ALA ALA A . n 
A 1 142 LEU 142 135 135 LEU LEU A . n 
A 1 143 CYS 143 136 136 CYS CYS A . n 
A 1 144 ARG 144 137 137 ARG ARG A . n 
A 1 145 LEU 145 138 138 LEU LEU A . n 
A 1 146 SER 146 139 139 SER SER A . n 
A 1 147 GLN 147 140 140 GLN GLN A . n 
A 1 148 ALA 148 141 141 ALA ALA A . n 
A 1 149 GLY 149 142 142 GLY GLY A . n 
A 1 150 ALA 150 143 143 ALA ALA A . n 
A 1 151 ARG 151 144 144 ARG ARG A . n 
A 1 152 VAL 152 145 145 VAL VAL A . n 
A 1 153 LYS 153 146 146 LYS LYS A . n 
A 1 154 ILE 154 147 147 ILE ILE A . n 
A 1 155 MET 155 148 148 MET MET A . n 
A 1 156 ASP 156 149 149 ASP ASP A . n 
A 1 157 TYR 157 150 150 TYR TYR A . n 
A 1 158 GLU 158 151 151 GLU GLU A . n 
A 1 159 GLU 159 152 152 GLU GLU A . n 
A 1 160 PHE 160 153 153 PHE PHE A . n 
A 1 161 ALA 161 154 154 ALA ALA A . n 
A 1 162 TYR 162 155 155 TYR TYR A . n 
A 1 163 CYS 163 156 156 CYS CYS A . n 
A 1 164 TRP 164 157 157 TRP TRP A . n 
A 1 165 GLU 165 158 158 GLU GLU A . n 
A 1 166 ASN 166 159 159 ASN ASN A . n 
A 1 167 PHE 167 160 160 PHE PHE A . n 
A 1 168 VAL 168 161 161 VAL VAL A . n 
A 1 169 ASP 169 162 162 ASP ASP A . n 
A 1 170 ASN 170 163 163 ASN ASN A . n 
A 1 171 GLU 171 164 164 GLU GLU A . n 
A 1 172 GLY 172 165 165 GLY GLY A . n 
A 1 173 GLN 173 166 166 GLN GLN A . n 
A 1 174 GLN 174 167 167 GLN GLN A . n 
A 1 175 PHE 175 168 168 PHE PHE A . n 
A 1 176 MET 176 169 169 MET MET A . n 
A 1 177 PRO 177 170 170 PRO PRO A . n 
A 1 178 TRP 178 171 171 TRP TRP A . n 
A 1 179 TYR 179 172 172 TYR TYR A . n 
A 1 180 LYS 180 173 173 LYS LYS A . n 
A 1 181 PHE 181 174 174 PHE PHE A . n 
A 1 182 ASP 182 175 175 ASP ASP A . n 
A 1 183 GLU 183 176 176 GLU GLU A . n 
A 1 184 ASN 184 177 177 ASN ASN A . n 
A 1 185 TYR 185 178 178 TYR TYR A . n 
A 1 186 ALA 186 179 179 ALA ALA A . n 
A 1 187 PHE 187 180 180 PHE PHE A . n 
A 1 188 LEU 188 181 181 LEU LEU A . n 
A 1 189 HIS 189 182 182 HIS HIS A . n 
A 1 190 ARG 190 183 183 ARG ARG A . n 
A 1 191 THR 191 184 184 THR THR A . n 
A 1 192 LEU 192 185 185 LEU LEU A . n 
A 1 193 LYS 193 186 186 LYS LYS A . n 
A 1 194 GLU 194 187 187 GLU GLU A . n 
A 1 195 ILE 195 188 188 ILE ILE A . n 
A 1 196 LEU 196 189 189 LEU LEU A . n 
A 1 197 ARG 197 190 190 ARG ARG A . n 
A 1 198 HIS 198 191 ?   ?   ?   A . n 
B 1 1   GLY 1   -6  ?   ?   ?   B . n 
B 1 2   PRO 2   -5  ?   ?   ?   B . n 
B 1 3   GLY 3   -4  ?   ?   ?   B . n 
B 1 4   GLY 4   -3  ?   ?   ?   B . n 
B 1 5   SER 5   -2  ?   ?   ?   B . n 
B 1 6   GLY 6   -1  ?   ?   ?   B . n 
B 1 7   GLY 7   0   ?   ?   ?   B . n 
B 1 8   MET 8   1   ?   ?   ?   B . n 
B 1 9   ASN 9   2   ?   ?   ?   B . n 
B 1 10  PRO 10  3   ?   ?   ?   B . n 
B 1 11  GLN 11  4   ?   ?   ?   B . n 
B 1 12  ILE 12  5   ?   ?   ?   B . n 
B 1 13  ARG 13  6   ?   ?   ?   B . n 
B 1 14  ASN 14  7   7   ASN ASN B . n 
B 1 15  PRO 15  8   8   PRO PRO B . n 
B 1 16  MET 16  9   9   MET MET B . n 
B 1 17  GLU 17  10  10  GLU GLU B . n 
B 1 18  ARG 18  11  11  ARG ARG B . n 
B 1 19  MET 19  12  12  MET MET B . n 
B 1 20  ASP 20  13  13  ASP ASP B . n 
B 1 21  ARG 21  14  14  ARG ARG B . n 
B 1 22  ASP 22  15  15  ASP ASP B . n 
B 1 23  THR 23  16  16  THR THR B . n 
B 1 24  PHE 24  17  17  PHE PHE B . n 
B 1 25  TYR 25  18  18  TYR TYR B . n 
B 1 26  ASP 26  19  19  ASP ASP B . n 
B 1 27  ASN 27  20  20  ASN ASN B . n 
B 1 28  PHE 28  21  21  PHE PHE B . n 
B 1 29  GLU 29  22  22  GLU GLU B . n 
B 1 30  ASN 30  23  23  ASN ASN B . n 
B 1 31  GLU 31  24  24  GLU GLU B . n 
B 1 32  PRO 32  25  25  PRO PRO B . n 
B 1 33  ILE 33  26  26  ILE ILE B . n 
B 1 34  LEU 34  27  27  LEU LEU B . n 
B 1 35  SER 35  28  28  SER SER B . n 
B 1 36  GLY 36  29  29  GLY GLY B . n 
B 1 37  ARG 37  30  30  ARG ARG B . n 
B 1 38  SER 38  31  31  SER SER B . n 
B 1 39  TYR 39  32  32  TYR TYR B . n 
B 1 40  THR 40  33  33  THR THR B . n 
B 1 41  TRP 41  34  34  TRP TRP B . n 
B 1 42  LEU 42  35  35  LEU LEU B . n 
B 1 43  CYS 43  36  36  CYS CYS B . n 
B 1 44  TYR 44  37  37  TYR TYR B . n 
B 1 45  GLU 45  38  38  GLU GLU B . n 
B 1 46  VAL 46  39  39  VAL VAL B . n 
B 1 47  LYS 47  40  40  LYS LYS B . n 
B 1 48  ILE 48  41  41  ILE ILE B . n 
B 1 49  LYS 49  42  42  LYS LYS B . n 
B 1 50  ARG 50  43  43  ARG ARG B . n 
B 1 51  GLY 51  44  44  GLY GLY B . n 
B 1 52  ARG 52  45  45  ARG ARG B . n 
B 1 53  SER 53  46  46  SER SER B . n 
B 1 54  ASN 54  47  47  ASN ASN B . n 
B 1 55  LEU 55  48  48  LEU LEU B . n 
B 1 56  LEU 56  49  49  LEU LEU B . n 
B 1 57  TRP 57  50  50  TRP TRP B . n 
B 1 58  ASP 58  51  51  ASP ASP B . n 
B 1 59  THR 59  52  52  THR THR B . n 
B 1 60  GLY 60  53  53  GLY GLY B . n 
B 1 61  VAL 61  54  54  VAL VAL B . n 
B 1 62  PHE 62  55  55  PHE PHE B . n 
B 1 63  ARG 63  56  56  ARG ARG B . n 
B 1 64  GLY 64  57  57  GLY GLY B . n 
B 1 65  GLN 65  58  58  GLN GLN B . n 
B 1 66  VAL 66  59  59  VAL VAL B . n 
B 1 67  TYR 67  60  60  TYR TYR B . n 
B 1 68  PHE 68  61  61  PHE PHE B . n 
B 1 69  LYS 69  62  62  LYS LYS B . n 
B 1 70  PRO 70  63  63  PRO PRO B . n 
B 1 71  GLN 71  64  64  GLN GLN B . n 
B 1 72  TYR 72  65  65  TYR TYR B . n 
B 1 73  HIS 73  66  66  HIS HIS B . n 
B 1 74  ALA 74  67  67  ALA ALA B . n 
B 1 75  GLU 75  68  68  GLU GLU B . n 
B 1 76  MET 76  69  69  MET MET B . n 
B 1 77  CYS 77  70  70  CYS CYS B . n 
B 1 78  PHE 78  71  71  PHE PHE B . n 
B 1 79  LEU 79  72  72  LEU LEU B . n 
B 1 80  SER 80  73  73  SER SER B . n 
B 1 81  TRP 81  74  74  TRP TRP B . n 
B 1 82  PHE 82  75  75  PHE PHE B . n 
B 1 83  CYS 83  76  76  CYS CYS B . n 
B 1 84  GLY 84  77  77  GLY GLY B . n 
B 1 85  ASN 85  78  78  ASN ASN B . n 
B 1 86  GLN 86  79  79  GLN GLN B . n 
B 1 87  LEU 87  80  80  LEU LEU B . n 
B 1 88  PRO 88  81  81  PRO PRO B . n 
B 1 89  ALA 89  82  82  ALA ALA B . n 
B 1 90  ASP 90  83  83  ASP ASP B . n 
B 1 91  LYS 91  84  84  LYS LYS B . n 
B 1 92  CYS 92  85  85  CYS CYS B . n 
B 1 93  PHE 93  86  86  PHE PHE B . n 
B 1 94  GLN 94  87  87  GLN GLN B . n 
B 1 95  ILE 95  88  88  ILE ILE B . n 
B 1 96  THR 96  89  89  THR THR B . n 
B 1 97  TRP 97  90  90  TRP TRP B . n 
B 1 98  PHE 98  91  91  PHE PHE B . n 
B 1 99  VAL 99  92  92  VAL VAL B . n 
B 1 100 SER 100 93  93  SER SER B . n 
B 1 101 TRP 101 94  94  TRP TRP B . n 
B 1 102 THR 102 95  95  THR THR B . n 
B 1 103 PRO 103 96  96  PRO PRO B . n 
B 1 104 CYS 104 97  97  CYS CYS B . n 
B 1 105 PRO 105 98  98  PRO PRO B . n 
B 1 106 ASP 106 99  99  ASP ASP B . n 
B 1 107 CYS 107 100 100 CYS CYS B . n 
B 1 108 VAL 108 101 101 VAL VAL B . n 
B 1 109 ALA 109 102 102 ALA ALA B . n 
B 1 110 LYS 110 103 103 LYS LYS B . n 
B 1 111 LEU 111 104 104 LEU LEU B . n 
B 1 112 ALA 112 105 105 ALA ALA B . n 
B 1 113 GLU 113 106 106 GLU GLU B . n 
B 1 114 PHE 114 107 107 PHE PHE B . n 
B 1 115 LEU 115 108 108 LEU LEU B . n 
B 1 116 SER 116 109 109 SER SER B . n 
B 1 117 GLU 117 110 110 GLU GLU B . n 
B 1 118 HIS 118 111 111 HIS HIS B . n 
B 1 119 PRO 119 112 112 PRO PRO B . n 
B 1 120 ASN 120 113 113 ASN ASN B . n 
B 1 121 VAL 121 114 114 VAL VAL B . n 
B 1 122 THR 122 115 115 THR THR B . n 
B 1 123 LEU 123 116 116 LEU LEU B . n 
B 1 124 THR 124 117 117 THR THR B . n 
B 1 125 ILE 125 118 118 ILE ILE B . n 
B 1 126 SER 126 119 119 SER SER B . n 
B 1 127 ALA 127 120 120 ALA ALA B . n 
B 1 128 ALA 128 121 121 ALA ALA B . n 
B 1 129 ARG 129 122 122 ARG ARG B . n 
B 1 130 LEU 130 123 123 LEU LEU B . n 
B 1 131 TYR 131 124 124 TYR TYR B . n 
B 1 132 TYR 132 125 125 TYR TYR B . n 
B 1 133 TYR 133 126 126 TYR TYR B . n 
B 1 134 SER 134 127 127 SER SER B . n 
B 1 135 GLU 135 128 128 GLU GLU B . n 
B 1 136 ARG 136 129 129 ARG ARG B . n 
B 1 137 ASP 137 130 130 ASP ASP B . n 
B 1 138 TYR 138 131 131 TYR TYR B . n 
B 1 139 ARG 139 132 132 ARG ARG B . n 
B 1 140 ARG 140 133 133 ARG ARG B . n 
B 1 141 ALA 141 134 134 ALA ALA B . n 
B 1 142 LEU 142 135 135 LEU LEU B . n 
B 1 143 CYS 143 136 136 CYS CYS B . n 
B 1 144 ARG 144 137 137 ARG ARG B . n 
B 1 145 LEU 145 138 138 LEU LEU B . n 
B 1 146 SER 146 139 139 SER SER B . n 
B 1 147 GLN 147 140 140 GLN GLN B . n 
B 1 148 ALA 148 141 141 ALA ALA B . n 
B 1 149 GLY 149 142 142 GLY GLY B . n 
B 1 150 ALA 150 143 143 ALA ALA B . n 
B 1 151 ARG 151 144 144 ARG ARG B . n 
B 1 152 VAL 152 145 145 VAL VAL B . n 
B 1 153 LYS 153 146 146 LYS LYS B . n 
B 1 154 ILE 154 147 147 ILE ILE B . n 
B 1 155 MET 155 148 148 MET MET B . n 
B 1 156 ASP 156 149 149 ASP ASP B . n 
B 1 157 TYR 157 150 150 TYR TYR B . n 
B 1 158 GLU 158 151 151 GLU GLU B . n 
B 1 159 GLU 159 152 152 GLU GLU B . n 
B 1 160 PHE 160 153 153 PHE PHE B . n 
B 1 161 ALA 161 154 154 ALA ALA B . n 
B 1 162 TYR 162 155 155 TYR TYR B . n 
B 1 163 CYS 163 156 156 CYS CYS B . n 
B 1 164 TRP 164 157 157 TRP TRP B . n 
B 1 165 GLU 165 158 158 GLU GLU B . n 
B 1 166 ASN 166 159 159 ASN ASN B . n 
B 1 167 PHE 167 160 160 PHE PHE B . n 
B 1 168 VAL 168 161 161 VAL VAL B . n 
B 1 169 ASP 169 162 162 ASP ASP B . n 
B 1 170 ASN 170 163 163 ASN ASN B . n 
B 1 171 GLU 171 164 164 GLU GLU B . n 
B 1 172 GLY 172 165 165 GLY GLY B . n 
B 1 173 GLN 173 166 166 GLN GLN B . n 
B 1 174 GLN 174 167 167 GLN GLN B . n 
B 1 175 PHE 175 168 168 PHE PHE B . n 
B 1 176 MET 176 169 169 MET MET B . n 
B 1 177 PRO 177 170 170 PRO PRO B . n 
B 1 178 TRP 178 171 171 TRP TRP B . n 
B 1 179 TYR 179 172 172 TYR TYR B . n 
B 1 180 LYS 180 173 173 LYS LYS B . n 
B 1 181 PHE 181 174 174 PHE PHE B . n 
B 1 182 ASP 182 175 175 ASP ASP B . n 
B 1 183 GLU 183 176 176 GLU GLU B . n 
B 1 184 ASN 184 177 177 ASN ASN B . n 
B 1 185 TYR 185 178 178 TYR TYR B . n 
B 1 186 ALA 186 179 179 ALA ALA B . n 
B 1 187 PHE 187 180 180 PHE PHE B . n 
B 1 188 LEU 188 181 181 LEU LEU B . n 
B 1 189 HIS 189 182 182 HIS HIS B . n 
B 1 190 ARG 190 183 183 ARG ARG B . n 
B 1 191 THR 191 184 184 THR THR B . n 
B 1 192 LEU 192 185 185 LEU LEU B . n 
B 1 193 LYS 193 186 186 LYS LYS B . n 
B 1 194 GLU 194 187 187 GLU GLU B . n 
B 1 195 ILE 195 188 188 ILE ILE B . n 
B 1 196 LEU 196 189 189 LEU LEU B . n 
B 1 197 ARG 197 190 190 ARG ARG B . n 
B 1 198 HIS 198 191 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1   401 401 ZN  ZN  A . 
D 2 ZN  1   401 401 ZN  ZN  B . 
E 3 HOH 1   501 227 HOH HOH A . 
E 3 HOH 2   502 218 HOH HOH A . 
E 3 HOH 3   503 177 HOH HOH A . 
E 3 HOH 4   504 94  HOH HOH A . 
E 3 HOH 5   505 57  HOH HOH A . 
E 3 HOH 6   506 65  HOH HOH A . 
E 3 HOH 7   507 117 HOH HOH A . 
E 3 HOH 8   508 220 HOH HOH A . 
E 3 HOH 9   509 80  HOH HOH A . 
E 3 HOH 10  510 58  HOH HOH A . 
E 3 HOH 11  511 155 HOH HOH A . 
E 3 HOH 12  512 75  HOH HOH A . 
E 3 HOH 13  513 90  HOH HOH A . 
E 3 HOH 14  514 85  HOH HOH A . 
E 3 HOH 15  515 222 HOH HOH A . 
E 3 HOH 16  516 136 HOH HOH A . 
E 3 HOH 17  517 19  HOH HOH A . 
E 3 HOH 18  518 10  HOH HOH A . 
E 3 HOH 19  519 24  HOH HOH A . 
E 3 HOH 20  520 12  HOH HOH A . 
E 3 HOH 21  521 89  HOH HOH A . 
E 3 HOH 22  522 25  HOH HOH A . 
E 3 HOH 23  523 28  HOH HOH A . 
E 3 HOH 24  524 74  HOH HOH A . 
E 3 HOH 25  525 71  HOH HOH A . 
E 3 HOH 26  526 1   HOH HOH A . 
E 3 HOH 27  527 36  HOH HOH A . 
E 3 HOH 28  528 107 HOH HOH A . 
E 3 HOH 29  529 151 HOH HOH A . 
E 3 HOH 30  530 166 HOH HOH A . 
E 3 HOH 31  531 38  HOH HOH A . 
E 3 HOH 32  532 146 HOH HOH A . 
E 3 HOH 33  533 5   HOH HOH A . 
E 3 HOH 34  534 158 HOH HOH A . 
E 3 HOH 35  535 133 HOH HOH A . 
E 3 HOH 36  536 135 HOH HOH A . 
E 3 HOH 37  537 215 HOH HOH A . 
E 3 HOH 38  538 194 HOH HOH A . 
E 3 HOH 39  539 6   HOH HOH A . 
E 3 HOH 40  540 54  HOH HOH A . 
E 3 HOH 41  541 18  HOH HOH A . 
E 3 HOH 42  542 8   HOH HOH A . 
E 3 HOH 43  543 140 HOH HOH A . 
E 3 HOH 44  544 91  HOH HOH A . 
E 3 HOH 45  545 22  HOH HOH A . 
E 3 HOH 46  546 198 HOH HOH A . 
E 3 HOH 47  547 214 HOH HOH A . 
E 3 HOH 48  548 30  HOH HOH A . 
E 3 HOH 49  549 61  HOH HOH A . 
E 3 HOH 50  550 128 HOH HOH A . 
E 3 HOH 51  551 204 HOH HOH A . 
E 3 HOH 52  552 7   HOH HOH A . 
E 3 HOH 53  553 150 HOH HOH A . 
E 3 HOH 54  554 143 HOH HOH A . 
E 3 HOH 55  555 31  HOH HOH A . 
E 3 HOH 56  556 42  HOH HOH A . 
E 3 HOH 57  557 180 HOH HOH A . 
E 3 HOH 58  558 39  HOH HOH A . 
E 3 HOH 59  559 55  HOH HOH A . 
E 3 HOH 60  560 201 HOH HOH A . 
E 3 HOH 61  561 32  HOH HOH A . 
E 3 HOH 62  562 114 HOH HOH A . 
E 3 HOH 63  563 27  HOH HOH A . 
E 3 HOH 64  564 153 HOH HOH A . 
E 3 HOH 65  565 100 HOH HOH A . 
E 3 HOH 66  566 44  HOH HOH A . 
E 3 HOH 67  567 127 HOH HOH A . 
E 3 HOH 68  568 104 HOH HOH A . 
E 3 HOH 69  569 73  HOH HOH A . 
E 3 HOH 70  570 190 HOH HOH A . 
E 3 HOH 71  571 52  HOH HOH A . 
E 3 HOH 72  572 72  HOH HOH A . 
E 3 HOH 73  573 56  HOH HOH A . 
E 3 HOH 74  574 197 HOH HOH A . 
E 3 HOH 75  575 84  HOH HOH A . 
E 3 HOH 76  576 188 HOH HOH A . 
E 3 HOH 77  577 76  HOH HOH A . 
E 3 HOH 78  578 129 HOH HOH A . 
E 3 HOH 79  579 156 HOH HOH A . 
E 3 HOH 80  580 159 HOH HOH A . 
E 3 HOH 81  581 51  HOH HOH A . 
E 3 HOH 82  582 63  HOH HOH A . 
E 3 HOH 83  583 224 HOH HOH A . 
E 3 HOH 84  584 111 HOH HOH A . 
E 3 HOH 85  585 179 HOH HOH A . 
E 3 HOH 86  586 178 HOH HOH A . 
E 3 HOH 87  587 184 HOH HOH A . 
E 3 HOH 88  588 88  HOH HOH A . 
E 3 HOH 89  589 193 HOH HOH A . 
E 3 HOH 90  590 199 HOH HOH A . 
E 3 HOH 91  591 223 HOH HOH A . 
E 3 HOH 92  592 181 HOH HOH A . 
E 3 HOH 93  593 162 HOH HOH A . 
E 3 HOH 94  594 225 HOH HOH A . 
E 3 HOH 95  595 152 HOH HOH A . 
E 3 HOH 96  596 131 HOH HOH A . 
E 3 HOH 97  597 216 HOH HOH A . 
E 3 HOH 98  598 208 HOH HOH A . 
E 3 HOH 99  599 83  HOH HOH A . 
E 3 HOH 100 600 191 HOH HOH A . 
E 3 HOH 101 601 119 HOH HOH A . 
E 3 HOH 102 602 81  HOH HOH A . 
E 3 HOH 103 603 163 HOH HOH A . 
E 3 HOH 104 604 192 HOH HOH A . 
E 3 HOH 105 605 169 HOH HOH A . 
E 3 HOH 106 606 210 HOH HOH A . 
E 3 HOH 107 607 226 HOH HOH A . 
E 3 HOH 108 608 137 HOH HOH A . 
E 3 HOH 109 609 138 HOH HOH A . 
E 3 HOH 110 610 160 HOH HOH A . 
E 3 HOH 111 611 219 HOH HOH A . 
E 3 HOH 112 612 200 HOH HOH A . 
E 3 HOH 113 613 68  HOH HOH A . 
E 3 HOH 114 614 139 HOH HOH A . 
E 3 HOH 115 615 230 HOH HOH A . 
E 3 HOH 116 616 185 HOH HOH A . 
F 3 HOH 1   501 233 HOH HOH B . 
F 3 HOH 2   502 202 HOH HOH B . 
F 3 HOH 3   503 234 HOH HOH B . 
F 3 HOH 4   504 217 HOH HOH B . 
F 3 HOH 5   505 228 HOH HOH B . 
F 3 HOH 6   506 231 HOH HOH B . 
F 3 HOH 7   507 123 HOH HOH B . 
F 3 HOH 8   508 141 HOH HOH B . 
F 3 HOH 9   509 45  HOH HOH B . 
F 3 HOH 10  510 62  HOH HOH B . 
F 3 HOH 11  511 154 HOH HOH B . 
F 3 HOH 12  512 59  HOH HOH B . 
F 3 HOH 13  513 108 HOH HOH B . 
F 3 HOH 14  514 60  HOH HOH B . 
F 3 HOH 15  515 122 HOH HOH B . 
F 3 HOH 16  516 96  HOH HOH B . 
F 3 HOH 17  517 86  HOH HOH B . 
F 3 HOH 18  518 207 HOH HOH B . 
F 3 HOH 19  519 113 HOH HOH B . 
F 3 HOH 20  520 14  HOH HOH B . 
F 3 HOH 21  521 9   HOH HOH B . 
F 3 HOH 22  522 213 HOH HOH B . 
F 3 HOH 23  523 13  HOH HOH B . 
F 3 HOH 24  524 2   HOH HOH B . 
F 3 HOH 25  525 183 HOH HOH B . 
F 3 HOH 26  526 23  HOH HOH B . 
F 3 HOH 27  527 15  HOH HOH B . 
F 3 HOH 28  528 121 HOH HOH B . 
F 3 HOH 29  529 33  HOH HOH B . 
F 3 HOH 30  530 67  HOH HOH B . 
F 3 HOH 31  531 21  HOH HOH B . 
F 3 HOH 32  532 102 HOH HOH B . 
F 3 HOH 33  533 116 HOH HOH B . 
F 3 HOH 34  534 20  HOH HOH B . 
F 3 HOH 35  535 147 HOH HOH B . 
F 3 HOH 36  536 4   HOH HOH B . 
F 3 HOH 37  537 16  HOH HOH B . 
F 3 HOH 38  538 3   HOH HOH B . 
F 3 HOH 39  539 37  HOH HOH B . 
F 3 HOH 40  540 97  HOH HOH B . 
F 3 HOH 41  541 17  HOH HOH B . 
F 3 HOH 42  542 43  HOH HOH B . 
F 3 HOH 43  543 157 HOH HOH B . 
F 3 HOH 44  544 149 HOH HOH B . 
F 3 HOH 45  545 49  HOH HOH B . 
F 3 HOH 46  546 35  HOH HOH B . 
F 3 HOH 47  547 148 HOH HOH B . 
F 3 HOH 48  548 167 HOH HOH B . 
F 3 HOH 49  549 26  HOH HOH B . 
F 3 HOH 50  550 41  HOH HOH B . 
F 3 HOH 51  551 98  HOH HOH B . 
F 3 HOH 52  552 95  HOH HOH B . 
F 3 HOH 53  553 11  HOH HOH B . 
F 3 HOH 54  554 195 HOH HOH B . 
F 3 HOH 55  555 110 HOH HOH B . 
F 3 HOH 56  556 196 HOH HOH B . 
F 3 HOH 57  557 99  HOH HOH B . 
F 3 HOH 58  558 124 HOH HOH B . 
F 3 HOH 59  559 118 HOH HOH B . 
F 3 HOH 60  560 87  HOH HOH B . 
F 3 HOH 61  561 109 HOH HOH B . 
F 3 HOH 62  562 29  HOH HOH B . 
F 3 HOH 63  563 186 HOH HOH B . 
F 3 HOH 64  564 126 HOH HOH B . 
F 3 HOH 65  565 69  HOH HOH B . 
F 3 HOH 66  566 34  HOH HOH B . 
F 3 HOH 67  567 53  HOH HOH B . 
F 3 HOH 68  568 46  HOH HOH B . 
F 3 HOH 69  569 70  HOH HOH B . 
F 3 HOH 70  570 106 HOH HOH B . 
F 3 HOH 71  571 50  HOH HOH B . 
F 3 HOH 72  572 92  HOH HOH B . 
F 3 HOH 73  573 101 HOH HOH B . 
F 3 HOH 74  574 120 HOH HOH B . 
F 3 HOH 75  575 48  HOH HOH B . 
F 3 HOH 76  576 112 HOH HOH B . 
F 3 HOH 77  577 64  HOH HOH B . 
F 3 HOH 78  578 47  HOH HOH B . 
F 3 HOH 79  579 142 HOH HOH B . 
F 3 HOH 80  580 82  HOH HOH B . 
F 3 HOH 81  581 145 HOH HOH B . 
F 3 HOH 82  582 78  HOH HOH B . 
F 3 HOH 83  583 130 HOH HOH B . 
F 3 HOH 84  584 40  HOH HOH B . 
F 3 HOH 85  585 175 HOH HOH B . 
F 3 HOH 86  586 105 HOH HOH B . 
F 3 HOH 87  587 176 HOH HOH B . 
F 3 HOH 88  588 93  HOH HOH B . 
F 3 HOH 89  589 161 HOH HOH B . 
F 3 HOH 90  590 187 HOH HOH B . 
F 3 HOH 91  591 171 HOH HOH B . 
F 3 HOH 92  592 164 HOH HOH B . 
F 3 HOH 93  593 103 HOH HOH B . 
F 3 HOH 94  594 79  HOH HOH B . 
F 3 HOH 95  595 125 HOH HOH B . 
F 3 HOH 96  596 172 HOH HOH B . 
F 3 HOH 97  597 211 HOH HOH B . 
F 3 HOH 98  598 221 HOH HOH B . 
F 3 HOH 99  599 115 HOH HOH B . 
F 3 HOH 100 600 209 HOH HOH B . 
F 3 HOH 101 601 173 HOH HOH B . 
F 3 HOH 102 602 66  HOH HOH B . 
F 3 HOH 103 603 232 HOH HOH B . 
F 3 HOH 104 604 170 HOH HOH B . 
F 3 HOH 105 605 168 HOH HOH B . 
F 3 HOH 106 606 182 HOH HOH B . 
F 3 HOH 107 607 144 HOH HOH B . 
F 3 HOH 108 608 212 HOH HOH B . 
F 3 HOH 109 609 132 HOH HOH B . 
F 3 HOH 110 610 206 HOH HOH B . 
F 3 HOH 111 611 165 HOH HOH B . 
F 3 HOH 112 612 205 HOH HOH B . 
F 3 HOH 113 613 203 HOH HOH B . 
F 3 HOH 114 614 77  HOH HOH B . 
F 3 HOH 115 615 229 HOH HOH B . 
F 3 HOH 116 616 134 HOH HOH B . 
F 3 HOH 117 617 174 HOH HOH B . 
F 3 HOH 118 618 189 HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E 
2 1 B,D,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 73  ? A HIS 66  ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 104 ? A CYS 97  ? 1_555 111.3 ? 
2  ND1 ? A HIS 73  ? A HIS 66  ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 107 ? A CYS 100 ? 1_555 115.6 ? 
3  SG  ? A CYS 104 ? A CYS 97  ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 SG ? A CYS 107 ? A CYS 100 ? 1_555 118.1 ? 
4  ND1 ? A HIS 73  ? A HIS 66  ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 O  ? E HOH .   ? A HOH 526 ? 1_555 96.1  ? 
5  SG  ? A CYS 104 ? A CYS 97  ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 O  ? E HOH .   ? A HOH 526 ? 1_555 107.0 ? 
6  SG  ? A CYS 107 ? A CYS 100 ? 1_555 ZN ? C ZN . ? A ZN 401 ? 1_555 O  ? E HOH .   ? A HOH 526 ? 1_555 105.9 ? 
7  ND1 ? B HIS 73  ? B HIS 66  ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 104 ? B CYS 97  ? 1_555 111.3 ? 
8  ND1 ? B HIS 73  ? B HIS 66  ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 107 ? B CYS 100 ? 1_555 115.6 ? 
9  SG  ? B CYS 104 ? B CYS 97  ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 SG ? B CYS 107 ? B CYS 100 ? 1_555 118.1 ? 
10 ND1 ? B HIS 73  ? B HIS 66  ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 O  ? F HOH .   ? B HOH 524 ? 1_555 94.7  ? 
11 SG  ? B CYS 104 ? B CYS 97  ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 O  ? F HOH .   ? B HOH 524 ? 1_555 108.0 ? 
12 SG  ? B CYS 107 ? B CYS 100 ? 1_555 ZN ? D ZN . ? B ZN 401 ? 1_555 O  ? F HOH .   ? B HOH 524 ? 1_555 106.1 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-06-14 
2 'Structure model' 1 1 2017-09-20 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Database references'        
3 2 'Structure model' 'Refinement description'     
4 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' pdbx_audit_support 
3 2 'Structure model' software           
4 3 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                 
2 2 'Structure model' '_citation.page_first'                     
3 2 'Structure model' '_citation.page_last'                      
4 2 'Structure model' '_pdbx_audit_support.funding_organization' 
5 3 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement     ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? 1.10.1_2155 1 
? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .           2 
? phasing        ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .           3 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 NH2 A ARG 183 ? ? O A HOH 501 ? ? 1.80 
2  1 O   A HOH 514 ? ? O A HOH 583 ? ? 1.82 
3  1 OE1 A GLN 64  ? ? O A HOH 502 ? ? 1.83 
4  1 OD2 B ASP 175 ? ? O B HOH 501 ? ? 1.83 
5  1 O   B ASN 163 ? ? O B HOH 502 ? ? 1.85 
6  1 OE1 A GLU 128 ? ? O A HOH 503 ? ? 1.89 
7  1 C   B ASN 163 ? ? O B HOH 502 ? ? 1.89 
8  1 O   B HOH 505 ? ? O B HOH 506 ? ? 1.90 
9  1 NZ  B LYS 173 ? ? O B HOH 503 ? ? 1.98 
10 1 OE1 B GLN 64  ? ? O B HOH 504 ? ? 1.98 
11 1 OD1 B ASN 7   ? ? O B HOH 505 ? ? 1.98 
12 1 OD1 B ASN 7   ? ? O B HOH 506 ? ? 2.00 
13 1 OE1 B GLU 128 ? ? O B HOH 507 ? ? 2.05 
14 1 O   B HOH 601 ? ? O B HOH 612 ? ? 2.10 
15 1 O   B HOH 565 ? ? O B HOH 607 ? ? 2.12 
16 1 O   B HOH 598 ? ? O B HOH 618 ? ? 2.17 
17 1 NH2 A ARG 11  ? ? O A GLU 158 ? ? 2.19 
18 1 NH2 B ARG 11  ? ? O B GLU 158 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O  A HOH 606 ? ? 1_555 O B HOH 610 ? ? 4_565 2.01 
2 1 O  A HOH 605 ? ? 1_555 O B HOH 604 ? ? 3_544 2.16 
3 1 SG B CYS 76  ? ? 1_555 O B HOH 612 ? ? 4_465 2.16 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 23 ? ? -87.71  42.16   
2  1 ARG A 43 ? ? -156.55 89.33   
3  1 ASN A 47 ? ? -156.44 87.96   
4  1 TYR A 60 ? ? -110.96 -156.41 
5  1 PHE A 61 ? ? 65.93   -176.19 
6  1 ASN B 23 ? ? -87.71  42.20   
7  1 ARG B 43 ? ? -156.55 89.33   
8  1 ASN B 47 ? ? -156.44 87.99   
9  1 TYR B 60 ? ? -110.94 -156.39 
10 1 PHE B 61 ? ? 65.95   -176.22 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -6  ? A GLY 1   
2  1 Y 1 A PRO -5  ? A PRO 2   
3  1 Y 1 A GLY -4  ? A GLY 3   
4  1 Y 1 A GLY -3  ? A GLY 4   
5  1 Y 1 A SER -2  ? A SER 5   
6  1 Y 1 A GLY -1  ? A GLY 6   
7  1 Y 1 A GLY 0   ? A GLY 7   
8  1 Y 1 A MET 1   ? A MET 8   
9  1 Y 1 A ASN 2   ? A ASN 9   
10 1 Y 1 A PRO 3   ? A PRO 10  
11 1 Y 1 A GLN 4   ? A GLN 11  
12 1 Y 1 A ILE 5   ? A ILE 12  
13 1 Y 1 A ARG 6   ? A ARG 13  
14 1 Y 1 A HIS 191 ? A HIS 198 
15 1 Y 1 B GLY -6  ? B GLY 1   
16 1 Y 1 B PRO -5  ? B PRO 2   
17 1 Y 1 B GLY -4  ? B GLY 3   
18 1 Y 1 B GLY -3  ? B GLY 4   
19 1 Y 1 B SER -2  ? B SER 5   
20 1 Y 1 B GLY -1  ? B GLY 6   
21 1 Y 1 B GLY 0   ? B GLY 7   
22 1 Y 1 B MET 1   ? B MET 8   
23 1 Y 1 B ASN 2   ? B ASN 9   
24 1 Y 1 B PRO 3   ? B PRO 10  
25 1 Y 1 B GLN 4   ? B GLN 11  
26 1 Y 1 B ILE 5   ? B ILE 12  
27 1 Y 1 B ARG 6   ? B ARG 13  
28 1 Y 1 B HIS 191 ? B HIS 198 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           R01GM087986 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
#