data_5TO5
# 
_entry.id   5TO5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.309 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TO5         
WWPDB D_1000223447 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5TO6 PDB . 
unspecified 5TO7 PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TO5 
_pdbx_database_status.recvd_initial_deposition_date   2016-10-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pal, K.'     1 
'Xu, Q.'      2 
'Zhou, X.E.'  3 
'Melcher, K.' 4 
'Xu, H.E.'    5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Structure 
_citation.journal_id_ASTM           STRUE6 
_citation.journal_id_CSD            2005 
_citation.journal_id_ISSN           0969-2126 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            25 
_citation.language                  ? 
_citation.page_first                867 
_citation.page_last                 877.e3 
_citation.title                     'Structural Basis of TPR-Mediated Oligomerization and Activation of Oncogenic Fusion Kinases.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.str.2017.04.015 
_citation.pdbx_database_id_PubMed   28528776 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Pal, K.'           1  ? 
primary 'Bandyopadhyay, A.' 2  ? 
primary 'Zhou, X.E.'        3  ? 
primary 'Xu, Q.'            4  ? 
primary 'Marciano, D.P.'    5  ? 
primary 'Brunzelle, J.S.'   6  ? 
primary 'Yerrum, S.'        7  ? 
primary 'Griffin, P.R.'     8  ? 
primary 'Vande Woude, G.'   9  ? 
primary 'Melcher, K.'       10 ? 
primary 'Xu, H.E.'          11 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   107.830 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5TO5 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     74.177 
_cell.length_a_esd                 ? 
_cell.length_b                     51.551 
_cell.length_b_esd                 ? 
_cell.length_c                     94.980 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5TO5 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Nucleoprotein TPR' 16747.922 2   ? ? 'UNP residues 2-142' ? 
2 water   nat water               18.015    126 ? ? ?                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Megator,NPC-associated intranuclear protein,Translocated promoter region protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;AAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYMEIEKRLSHSQERLVNETRECQSLRLE
LEKLNNQLKALTEKNKELEIAQDRNIAIQSQMTRTKEELEAEKRDLIRTNERLSQELEYLT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;AAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYMEIEKRLSHSQERLVNETRECQSLRLE
LEKLNNQLKALTEKNKELEIAQDRNIAIQSQMTRTKEELEAEKRDLIRTNERLSQELEYLT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ALA n 
1 3   VAL n 
1 4   LEU n 
1 5   GLN n 
1 6   GLN n 
1 7   VAL n 
1 8   LEU n 
1 9   GLU n 
1 10  ARG n 
1 11  THR n 
1 12  GLU n 
1 13  LEU n 
1 14  ASN n 
1 15  LYS n 
1 16  LEU n 
1 17  PRO n 
1 18  LYS n 
1 19  SER n 
1 20  VAL n 
1 21  GLN n 
1 22  ASN n 
1 23  LYS n 
1 24  LEU n 
1 25  GLU n 
1 26  LYS n 
1 27  PHE n 
1 28  LEU n 
1 29  ALA n 
1 30  ASP n 
1 31  GLN n 
1 32  GLN n 
1 33  SER n 
1 34  GLU n 
1 35  ILE n 
1 36  ASP n 
1 37  GLY n 
1 38  LEU n 
1 39  LYS n 
1 40  GLY n 
1 41  ARG n 
1 42  HIS n 
1 43  GLU n 
1 44  LYS n 
1 45  PHE n 
1 46  LYS n 
1 47  VAL n 
1 48  GLU n 
1 49  SER n 
1 50  GLU n 
1 51  GLN n 
1 52  GLN n 
1 53  TYR n 
1 54  MET n 
1 55  GLU n 
1 56  ILE n 
1 57  GLU n 
1 58  LYS n 
1 59  ARG n 
1 60  LEU n 
1 61  SER n 
1 62  HIS n 
1 63  SER n 
1 64  GLN n 
1 65  GLU n 
1 66  ARG n 
1 67  LEU n 
1 68  VAL n 
1 69  ASN n 
1 70  GLU n 
1 71  THR n 
1 72  ARG n 
1 73  GLU n 
1 74  CYS n 
1 75  GLN n 
1 76  SER n 
1 77  LEU n 
1 78  ARG n 
1 79  LEU n 
1 80  GLU n 
1 81  LEU n 
1 82  GLU n 
1 83  LYS n 
1 84  LEU n 
1 85  ASN n 
1 86  ASN n 
1 87  GLN n 
1 88  LEU n 
1 89  LYS n 
1 90  ALA n 
1 91  LEU n 
1 92  THR n 
1 93  GLU n 
1 94  LYS n 
1 95  ASN n 
1 96  LYS n 
1 97  GLU n 
1 98  LEU n 
1 99  GLU n 
1 100 ILE n 
1 101 ALA n 
1 102 GLN n 
1 103 ASP n 
1 104 ARG n 
1 105 ASN n 
1 106 ILE n 
1 107 ALA n 
1 108 ILE n 
1 109 GLN n 
1 110 SER n 
1 111 GLN n 
1 112 MET n 
1 113 THR n 
1 114 ARG n 
1 115 THR n 
1 116 LYS n 
1 117 GLU n 
1 118 GLU n 
1 119 LEU n 
1 120 GLU n 
1 121 ALA n 
1 122 GLU n 
1 123 LYS n 
1 124 ARG n 
1 125 ASP n 
1 126 LEU n 
1 127 ILE n 
1 128 ARG n 
1 129 THR n 
1 130 ASN n 
1 131 GLU n 
1 132 ARG n 
1 133 LEU n 
1 134 SER n 
1 135 GLN n 
1 136 GLU n 
1 137 LEU n 
1 138 GLU n 
1 139 TYR n 
1 140 LEU n 
1 141 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   141 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 TPR 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TPR_HUMAN 
_struct_ref.pdbx_db_accession          P12270 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;AAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLE
LEKLNNQLKALTEKNKELEIAQDRNIAIQSQFTRTKEELEAEKRDLIRTNERLSQELEYLT
;
_struct_ref.pdbx_align_begin           2 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5TO5 A 1 ? 141 ? P12270 2 ? 142 ? 2 142 
2 1 5TO5 B 1 ? 141 ? P12270 2 ? 142 ? 2 142 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5TO5 MET A 54  ? UNP P12270 PHE 55  'engineered mutation' 55  1 
1 5TO5 MET A 112 ? UNP P12270 PHE 113 'engineered mutation' 113 2 
2 5TO5 MET B 54  ? UNP P12270 PHE 55  'engineered mutation' 55  3 
2 5TO5 MET B 112 ? UNP P12270 PHE 113 'engineered mutation' 113 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TO5 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.57 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.07 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.25 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '16% PEG1.5K, 0.1M Bistris (6.25)' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'RAYONIX MX300-HS' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-03-16 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.07812 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 21-ID-D' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.07812 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   21-ID-D 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5TO5 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.18 
_reflns.d_resolution_low                 21.85 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17251 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             96 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.7 
_reflns.pdbx_Rmerge_I_obs                0.079 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.8 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                125.410 
_refine.B_iso_mean                               37.5525 
_refine.B_iso_min                                18.010 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5TO5 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.5000 
_refine.ls_d_res_low                             21.4110 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     11481 
_refine.ls_number_reflns_R_free                  544 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    95.8500 
_refine.ls_percent_reflns_R_free                 4.7400 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2318 
_refine.ls_R_factor_R_free                       0.2820 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2294 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.940 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1000 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             1.0000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 29.9600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3500 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.5000 
_refine_hist.d_res_low                        21.4110 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             126 
_refine_hist.number_atoms_total               2463 
_refine_hist.pdbx_number_residues_total       281 
_refine_hist.pdbx_B_iso_mean_solvent          42.24 
_refine_hist.pdbx_number_atoms_protein        2337 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 2349 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.722  ? 3135 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.026  ? 355  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 415  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 17.522 ? 973  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.5001 2.7512  2883 . 140 2743 98.0000 . . . 0.3450 . 0.2722 . . . . . . 4 . . . 
'X-RAY DIFFRACTION' 2.7512 3.1482  2927 . 137 2790 98.0000 . . . 0.2981 . 0.2543 . . . . . . 4 . . . 
'X-RAY DIFFRACTION' 3.1482 3.9623  2872 . 138 2734 96.0000 . . . 0.2731 . 0.2273 . . . . . . 4 . . . 
'X-RAY DIFFRACTION' 3.9623 21.4123 2799 . 129 2670 92.0000 . . . 0.2572 . 0.2020 . . . . . . 4 . . . 
# 
_struct.entry_id                     5TO5 
_struct.title                        'Structure of the TPR oligomerization domain' 
_struct.pdbx_descriptor              'Nucleoprotein TPR' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TO5 
_struct_keywords.text            'TPR oligomerization domain, Receptor tyrosine kinase, MET, Oncogenic Fusion kinases, CELL CYCLE' 
_struct_keywords.pdbx_keywords   'CELL CYCLE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 VAL A 3  ? LEU A 8   ? VAL A 4  LEU A 9   1 ? 6   
HELX_P HELX_P2 AA2 GLU A 9  ? ASN A 14  ? GLU A 10 ASN A 15  1 ? 6   
HELX_P HELX_P3 AA3 PRO A 17 ? LEU A 140 ? PRO A 18 LEU A 141 1 ? 124 
HELX_P HELX_P4 AA4 VAL B 3  ? LEU B 8   ? VAL B 4  LEU B 9   1 ? 6   
HELX_P HELX_P5 AA5 GLU B 9  ? ASN B 14  ? GLU B 10 ASN B 15  1 ? 6   
HELX_P HELX_P6 AA6 PRO B 17 ? THR B 141 ? PRO B 18 THR B 142 1 ? 125 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_atom_sites.entry_id                    5TO5 
_atom_sites.fract_transf_matrix[1][1]   0.013481 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004337 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019398 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011060 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 1   ? 54.413  -25.602 80.630 1.00 51.52  ? 2   ALA A N   1 
ATOM   2    C CA  . ALA A 1 1   ? 53.451  -24.770 79.925 1.00 69.67  ? 2   ALA A CA  1 
ATOM   3    C C   . ALA A 1 1   ? 53.782  -23.291 80.108 1.00 64.42  ? 2   ALA A C   1 
ATOM   4    O O   . ALA A 1 1   ? 53.035  -22.416 79.658 1.00 68.64  ? 2   ALA A O   1 
ATOM   5    C CB  . ALA A 1 1   ? 52.036  -25.060 80.394 1.00 66.51  ? 2   ALA A CB  1 
ATOM   6    N N   . ALA A 1 2   ? 54.937  -23.024 80.708 1.00 55.89  ? 3   ALA A N   1 
ATOM   7    C CA  . ALA A 1 2   ? 55.363  -21.666 81.009 1.00 54.16  ? 3   ALA A CA  1 
ATOM   8    C C   . ALA A 1 2   ? 55.853  -20.922 79.772 1.00 45.56  ? 3   ALA A C   1 
ATOM   9    O O   . ALA A 1 2   ? 56.580  -21.470 78.945 1.00 50.39  ? 3   ALA A O   1 
ATOM   10   C CB  . ALA A 1 2   ? 56.449  -21.695 82.068 1.00 55.92  ? 3   ALA A CB  1 
ATOM   11   N N   . VAL A 1 3   ? 55.442  -19.665 79.655 1.00 42.12  ? 4   VAL A N   1 
ATOM   12   C CA  . VAL A 1 3   ? 55.833  -18.824 78.533 1.00 40.34  ? 4   VAL A CA  1 
ATOM   13   C C   . VAL A 1 3   ? 57.225  -18.221 78.737 1.00 35.18  ? 4   VAL A C   1 
ATOM   14   O O   . VAL A 1 3   ? 57.928  -17.914 77.772 1.00 33.55  ? 4   VAL A O   1 
ATOM   15   C CB  . VAL A 1 3   ? 54.803  -17.701 78.311 1.00 39.53  ? 4   VAL A CB  1 
ATOM   16   C CG1 . VAL A 1 3   ? 55.028  -17.024 76.972 1.00 35.05  ? 4   VAL A CG1 1 
ATOM   17   C CG2 . VAL A 1 3   ? 53.397  -18.272 78.373 1.00 43.55  ? 4   VAL A CG2 1 
ATOM   18   N N   . LEU A 1 4   ? 57.621  -18.064 79.997 1.00 37.97  ? 5   LEU A N   1 
ATOM   19   C CA  . LEU A 1 4   ? 58.862  -17.371 80.322 1.00 39.50  ? 5   LEU A CA  1 
ATOM   20   C C   . LEU A 1 4   ? 60.094  -18.214 80.020 1.00 35.00  ? 5   LEU A C   1 
ATOM   21   O O   . LEU A 1 4   ? 61.139  -17.685 79.641 1.00 35.93  ? 5   LEU A O   1 
ATOM   22   C CB  . LEU A 1 4   ? 58.867  -16.956 81.791 1.00 34.44  ? 5   LEU A CB  1 
ATOM   23   C CG  . LEU A 1 4   ? 59.671  -15.700 82.127 1.00 29.60  ? 5   LEU A CG  1 
ATOM   24   C CD1 . LEU A 1 4   ? 59.346  -14.584 81.145 1.00 27.00  ? 5   LEU A CD1 1 
ATOM   25   C CD2 . LEU A 1 4   ? 59.352  -15.262 83.543 1.00 32.15  ? 5   LEU A CD2 1 
ATOM   26   N N   . GLN A 1 5   ? 59.976  -19.525 80.188 1.00 35.51  ? 6   GLN A N   1 
ATOM   27   C CA  . GLN A 1 5   ? 61.092  -20.410 79.893 1.00 32.24  ? 6   GLN A CA  1 
ATOM   28   C C   . GLN A 1 5   ? 61.299  -20.502 78.379 1.00 37.47  ? 6   GLN A C   1 
ATOM   29   O O   . GLN A 1 5   ? 62.345  -20.963 77.920 1.00 43.28  ? 6   GLN A O   1 
ATOM   30   C CB  . GLN A 1 5   ? 60.856  -21.795 80.495 1.00 36.34  ? 6   GLN A CB  1 
ATOM   31   C CG  . GLN A 1 5   ? 59.850  -22.612 79.723 1.00 52.76  ? 6   GLN A CG  1 
ATOM   32   C CD  . GLN A 1 5   ? 59.199  -23.699 80.551 1.00 63.03  ? 6   GLN A CD  1 
ATOM   33   O OE1 . GLN A 1 5   ? 59.646  -24.018 81.650 1.00 62.29  ? 6   GLN A OE1 1 
ATOM   34   N NE2 . GLN A 1 5   ? 58.126  -24.271 80.023 1.00 57.79  ? 6   GLN A NE2 1 
ATOM   35   N N   . GLN A 1 6   ? 60.303  -20.061 77.610 1.00 36.11  ? 7   GLN A N   1 
ATOM   36   C CA  . GLN A 1 6   ? 60.418  -20.023 76.155 1.00 31.19  ? 7   GLN A CA  1 
ATOM   37   C C   . GLN A 1 6   ? 61.283  -18.854 75.685 1.00 36.44  ? 7   GLN A C   1 
ATOM   38   O O   . GLN A 1 6   ? 62.104  -19.001 74.781 1.00 33.79  ? 7   GLN A O   1 
ATOM   39   C CB  . GLN A 1 6   ? 59.041  -19.918 75.495 1.00 34.93  ? 7   GLN A CB  1 
ATOM   40   C CG  . GLN A 1 6   ? 58.000  -20.934 75.938 1.00 32.76  ? 7   GLN A CG  1 
ATOM   41   C CD  . GLN A 1 6   ? 56.644  -20.658 75.311 1.00 42.15  ? 7   GLN A CD  1 
ATOM   42   O OE1 . GLN A 1 6   ? 56.548  -19.952 74.308 1.00 37.30  ? 7   GLN A OE1 1 
ATOM   43   N NE2 . GLN A 1 6   ? 55.589  -21.201 75.907 1.00 43.42  ? 7   GLN A NE2 1 
ATOM   44   N N   . VAL A 1 7   ? 61.079  -17.684 76.283 1.00 31.26  ? 8   VAL A N   1 
ATOM   45   C CA  . VAL A 1 7   ? 61.791  -16.488 75.849 1.00 28.47  ? 8   VAL A CA  1 
ATOM   46   C C   . VAL A 1 7   ? 63.208  -16.411 76.419 1.00 35.21  ? 8   VAL A C   1 
ATOM   47   O O   . VAL A 1 7   ? 64.149  -16.082 75.700 1.00 31.15  ? 8   VAL A O   1 
ATOM   48   C CB  . VAL A 1 7   ? 60.999  -15.203 76.209 1.00 28.01  ? 8   VAL A CB  1 
ATOM   49   C CG1 . VAL A 1 7   ? 59.657  -15.232 75.531 1.00 36.62  ? 8   VAL A CG1 1 
ATOM   50   C CG2 . VAL A 1 7   ? 60.800  -15.064 77.707 1.00 37.64  ? 8   VAL A CG2 1 
ATOM   51   N N   . LEU A 1 8   ? 63.368  -16.744 77.697 1.00 30.77  ? 9   LEU A N   1 
ATOM   52   C CA  . LEU A 1 8   ? 64.673  -16.649 78.344 1.00 33.14  ? 9   LEU A CA  1 
ATOM   53   C C   . LEU A 1 8   ? 65.327  -18.016 78.502 1.00 36.71  ? 9   LEU A C   1 
ATOM   54   O O   . LEU A 1 8   ? 64.699  -19.047 78.253 1.00 41.69  ? 9   LEU A O   1 
ATOM   55   C CB  . LEU A 1 8   ? 64.541  -15.988 79.721 1.00 28.78  ? 9   LEU A CB  1 
ATOM   56   C CG  . LEU A 1 8   ? 63.950  -14.582 79.838 1.00 31.45  ? 9   LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 8   ? 63.716  -14.245 81.297 1.00 21.20  ? 9   LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 8   ? 64.865  -13.550 79.196 1.00 28.62  ? 9   LEU A CD2 1 
ATOM   59   N N   . GLU A 1 9   ? 66.572  -18.020 78.972 1.00 41.01  ? 10  GLU A N   1 
ATOM   60   C CA  . GLU A 1 9   ? 67.292  -19.266 79.195 1.00 38.69  ? 10  GLU A CA  1 
ATOM   61   C C   . GLU A 1 9   ? 67.121  -19.689 80.641 1.00 36.47  ? 10  GLU A C   1 
ATOM   62   O O   . GLU A 1 9   ? 66.589  -18.927 81.444 1.00 46.49  ? 10  GLU A O   1 
ATOM   63   C CB  . GLU A 1 9   ? 68.774  -19.097 78.870 1.00 37.78  ? 10  GLU A CB  1 
ATOM   64   C CG  . GLU A 1 9   ? 69.027  -18.560 77.481 1.00 42.70  ? 10  GLU A CG  1 
ATOM   65   C CD  . GLU A 1 9   ? 70.346  -17.823 77.371 1.00 47.08  ? 10  GLU A CD  1 
ATOM   66   O OE1 . GLU A 1 9   ? 71.232  -18.051 78.221 1.00 45.47  ? 10  GLU A OE1 1 
ATOM   67   O OE2 . GLU A 1 9   ? 70.491  -17.007 76.439 1.00 45.53  ? 10  GLU A OE2 1 
ATOM   68   N N   . ARG A 1 10  ? 67.619  -20.870 80.990 1.00 33.51  ? 11  ARG A N   1 
ATOM   69   C CA  . ARG A 1 10  ? 67.480  -21.360 82.356 1.00 37.13  ? 11  ARG A CA  1 
ATOM   70   C C   . ARG A 1 10  ? 68.410  -20.605 83.291 1.00 36.90  ? 11  ARG A C   1 
ATOM   71   O O   . ARG A 1 10  ? 68.166  -20.525 84.492 1.00 42.26  ? 11  ARG A O   1 
ATOM   72   C CB  . ARG A 1 10  ? 67.758  -22.864 82.430 1.00 45.13  ? 11  ARG A CB  1 
ATOM   73   C CG  . ARG A 1 10  ? 66.550  -23.743 82.122 1.00 42.44  ? 11  ARG A CG  1 
ATOM   74   C CD  . ARG A 1 10  ? 65.493  -23.648 83.215 1.00 56.19  ? 11  ARG A CD  1 
ATOM   75   N NE  . ARG A 1 10  ? 64.302  -24.430 82.893 1.00 62.22  ? 11  ARG A NE  1 
ATOM   76   C CZ  . ARG A 1 10  ? 63.272  -24.600 83.716 1.00 59.15  ? 11  ARG A CZ  1 
ATOM   77   N NH1 . ARG A 1 10  ? 63.284  -24.046 84.921 1.00 59.73  ? 11  ARG A NH1 1 
ATOM   78   N NH2 . ARG A 1 10  ? 62.229  -25.327 83.336 1.00 54.99  ? 11  ARG A NH2 1 
ATOM   79   N N   . THR A 1 11  ? 69.476  -20.043 82.738 1.00 34.10  ? 12  THR A N   1 
ATOM   80   C CA  . THR A 1 11  ? 70.429  -19.302 83.550 1.00 43.28  ? 12  THR A CA  1 
ATOM   81   C C   . THR A 1 11  ? 69.926  -17.901 83.872 1.00 39.64  ? 12  THR A C   1 
ATOM   82   O O   . THR A 1 11  ? 70.115  -17.409 84.982 1.00 38.44  ? 12  THR A O   1 
ATOM   83   C CB  . THR A 1 11  ? 71.797  -19.186 82.862 1.00 38.81  ? 12  THR A CB  1 
ATOM   84   O OG1 . THR A 1 11  ? 71.647  -18.516 81.603 1.00 37.22  ? 12  THR A OG1 1 
ATOM   85   C CG2 . THR A 1 11  ? 72.405  -20.561 82.634 1.00 41.53  ? 12  THR A CG2 1 
ATOM   86   N N   . GLU A 1 12  ? 69.306  -17.245 82.896 1.00 33.60  ? 13  GLU A N   1 
ATOM   87   C CA  . GLU A 1 12  ? 68.862  -15.872 83.104 1.00 37.97  ? 13  GLU A CA  1 
ATOM   88   C C   . GLU A 1 12  ? 67.433  -15.777 83.633 1.00 34.38  ? 13  GLU A C   1 
ATOM   89   O O   . GLU A 1 12  ? 67.028  -14.731 84.145 1.00 31.12  ? 13  GLU A O   1 
ATOM   90   C CB  . GLU A 1 12  ? 68.996  -15.070 81.808 1.00 36.58  ? 13  GLU A CB  1 
ATOM   91   C CG  . GLU A 1 12  ? 68.448  -15.751 80.568 1.00 43.63  ? 13  GLU A CG  1 
ATOM   92   C CD  . GLU A 1 12  ? 68.880  -15.046 79.299 1.00 46.90  ? 13  GLU A CD  1 
ATOM   93   O OE1 . GLU A 1 12  ? 68.271  -15.296 78.241 1.00 45.22  ? 13  GLU A OE1 1 
ATOM   94   O OE2 . GLU A 1 12  ? 69.834  -14.243 79.363 1.00 45.01  ? 13  GLU A OE2 1 
ATOM   95   N N   . LEU A 1 13  ? 66.685  -16.872 83.545 1.00 30.93  ? 14  LEU A N   1 
ATOM   96   C CA  . LEU A 1 13  ? 65.361  -16.915 84.145 1.00 28.51  ? 14  LEU A CA  1 
ATOM   97   C C   . LEU A 1 13  ? 65.523  -17.080 85.646 1.00 30.58  ? 14  LEU A C   1 
ATOM   98   O O   . LEU A 1 13  ? 64.780  -16.495 86.431 1.00 33.09  ? 14  LEU A O   1 
ATOM   99   C CB  . LEU A 1 13  ? 64.520  -18.052 83.561 1.00 29.84  ? 14  LEU A CB  1 
ATOM   100  C CG  . LEU A 1 13  ? 63.168  -18.371 84.204 1.00 26.38  ? 14  LEU A CG  1 
ATOM   101  C CD1 . LEU A 1 13  ? 62.334  -17.112 84.361 1.00 31.78  ? 14  LEU A CD1 1 
ATOM   102  C CD2 . LEU A 1 13  ? 62.419  -19.396 83.368 1.00 32.71  ? 14  LEU A CD2 1 
ATOM   103  N N   . ASN A 1 14  ? 66.517  -17.864 86.043 1.00 31.48  ? 15  ASN A N   1 
ATOM   104  C CA  . ASN A 1 14  ? 66.736  -18.125 87.456 1.00 31.80  ? 15  ASN A CA  1 
ATOM   105  C C   . ASN A 1 14  ? 67.367  -16.928 88.166 1.00 28.38  ? 15  ASN A C   1 
ATOM   106  O O   . ASN A 1 14  ? 67.388  -16.871 89.395 1.00 27.22  ? 15  ASN A O   1 
ATOM   107  C CB  . ASN A 1 14  ? 67.593  -19.379 87.637 1.00 30.54  ? 15  ASN A CB  1 
ATOM   108  C CG  . ASN A 1 14  ? 66.872  -20.645 87.203 1.00 32.34  ? 15  ASN A CG  1 
ATOM   109  O OD1 . ASN A 1 14  ? 65.644  -20.715 87.234 1.00 42.31  ? 15  ASN A OD1 1 
ATOM   110  N ND2 . ASN A 1 14  ? 67.635  -21.650 86.794 1.00 26.96  ? 15  ASN A ND2 1 
ATOM   111  N N   . LYS A 1 15  ? 67.866  -15.967 87.391 1.00 27.74  ? 16  LYS A N   1 
ATOM   112  C CA  . LYS A 1 15  ? 68.393  -14.728 87.957 1.00 26.98  ? 16  LYS A CA  1 
ATOM   113  C C   . LYS A 1 15  ? 67.272  -13.738 88.277 1.00 28.11  ? 16  LYS A C   1 
ATOM   114  O O   . LYS A 1 15  ? 67.505  -12.719 88.924 1.00 37.09  ? 16  LYS A O   1 
ATOM   115  C CB  . LYS A 1 15  ? 69.406  -14.081 87.006 1.00 36.84  ? 16  LYS A CB  1 
ATOM   116  C CG  . LYS A 1 15  ? 70.744  -14.803 86.909 1.00 33.45  ? 16  LYS A CG  1 
ATOM   117  C CD  . LYS A 1 15  ? 71.628  -14.169 85.842 1.00 39.22  ? 16  LYS A CD  1 
ATOM   118  C CE  . LYS A 1 15  ? 72.950  -14.912 85.679 1.00 50.57  ? 16  LYS A CE  1 
ATOM   119  N NZ  . LYS A 1 15  ? 73.815  -14.822 86.888 1.00 54.41  ? 16  LYS A NZ  1 
ATOM   120  N N   . LEU A 1 16  ? 66.060  -14.034 87.818 1.00 28.26  ? 17  LEU A N   1 
ATOM   121  C CA  . LEU A 1 16  ? 64.917  -13.184 88.125 1.00 26.73  ? 17  LEU A CA  1 
ATOM   122  C C   . LEU A 1 16  ? 64.290  -13.575 89.462 1.00 24.89  ? 17  LEU A C   1 
ATOM   123  O O   . LEU A 1 16  ? 64.082  -14.756 89.729 1.00 24.76  ? 17  LEU A O   1 
ATOM   124  C CB  . LEU A 1 16  ? 63.870  -13.264 87.012 1.00 27.38  ? 17  LEU A CB  1 
ATOM   125  C CG  . LEU A 1 16  ? 64.249  -12.840 85.591 1.00 26.42  ? 17  LEU A CG  1 
ATOM   126  C CD1 . LEU A 1 16  ? 63.108  -13.154 84.645 1.00 33.54  ? 17  LEU A CD1 1 
ATOM   127  C CD2 . LEU A 1 16  ? 64.582  -11.366 85.544 1.00 26.55  ? 17  LEU A CD2 1 
ATOM   128  N N   . PRO A 1 17  ? 63.993  -12.578 90.313 1.00 25.47  ? 18  PRO A N   1 
ATOM   129  C CA  . PRO A 1 17  ? 63.243  -12.828 91.550 1.00 24.37  ? 18  PRO A CA  1 
ATOM   130  C C   . PRO A 1 17  ? 61.912  -13.522 91.292 1.00 24.33  ? 18  PRO A C   1 
ATOM   131  O O   . PRO A 1 17  ? 61.387  -13.424 90.182 1.00 24.49  ? 18  PRO A O   1 
ATOM   132  C CB  . PRO A 1 17  ? 63.021  -11.421 92.111 1.00 23.77  ? 18  PRO A CB  1 
ATOM   133  C CG  . PRO A 1 17  ? 64.203  -10.661 91.649 1.00 26.56  ? 18  PRO A CG  1 
ATOM   134  C CD  . PRO A 1 17  ? 64.557  -11.215 90.285 1.00 26.49  ? 18  PRO A CD  1 
ATOM   135  N N   . LYS A 1 18  ? 61.400  -14.238 92.289 1.00 23.78  ? 19  LYS A N   1 
ATOM   136  C CA  . LYS A 1 18  ? 60.115  -14.916 92.157 1.00 26.73  ? 19  LYS A CA  1 
ATOM   137  C C   . LYS A 1 18  ? 59.030  -13.917 91.761 1.00 24.95  ? 19  LYS A C   1 
ATOM   138  O O   . LYS A 1 18  ? 58.275  -14.155 90.822 1.00 26.79  ? 19  LYS A O   1 
ATOM   139  C CB  . LYS A 1 18  ? 59.723  -15.620 93.460 1.00 25.06  ? 19  LYS A CB  1 
ATOM   140  C CG  . LYS A 1 18  ? 58.865  -16.866 93.257 1.00 23.01  ? 19  LYS A CG  1 
ATOM   141  C CD  . LYS A 1 18  ? 58.124  -17.271 94.526 1.00 23.92  ? 19  LYS A CD  1 
ATOM   142  C CE  . LYS A 1 18  ? 59.058  -17.349 95.721 1.00 37.02  ? 19  LYS A CE  1 
ATOM   143  N NZ  . LYS A 1 18  ? 58.336  -17.756 96.959 1.00 39.61  ? 19  LYS A NZ  1 
ATOM   144  N N   . SER A 1 19  ? 58.982  -12.795 92.476 1.00 24.83  ? 20  SER A N   1 
ATOM   145  C CA  . SER A 1 19  ? 57.979  -11.755 92.255 1.00 27.77  ? 20  SER A CA  1 
ATOM   146  C C   . SER A 1 19  ? 57.981  -11.292 90.810 1.00 27.09  ? 20  SER A C   1 
ATOM   147  O O   . SER A 1 19  ? 56.944  -11.243 90.150 1.00 24.85  ? 20  SER A O   1 
ATOM   148  C CB  . SER A 1 19  ? 58.232  -10.560 93.178 1.00 27.69  ? 20  SER A CB  1 
ATOM   149  O OG  . SER A 1 19  ? 59.408  -9.866  92.801 1.00 31.29  ? 20  SER A OG  1 
ATOM   150  N N   . VAL A 1 20  ? 59.172  -10.953 90.337 1.00 25.47  ? 21  VAL A N   1 
ATOM   151  C CA  . VAL A 1 20  ? 59.391  -10.537 88.963 1.00 20.38  ? 21  VAL A CA  1 
ATOM   152  C C   . VAL A 1 20  ? 58.948  -11.601 87.959 1.00 23.48  ? 21  VAL A C   1 
ATOM   153  O O   . VAL A 1 20  ? 58.302  -11.276 86.959 1.00 23.13  ? 21  VAL A O   1 
ATOM   154  C CB  . VAL A 1 20  ? 60.874  -10.193 88.740 1.00 29.17  ? 21  VAL A CB  1 
ATOM   155  C CG1 . VAL A 1 20  ? 61.154  -9.912  87.276 1.00 26.64  ? 21  VAL A CG1 1 
ATOM   156  C CG2 . VAL A 1 20  ? 61.264  -9.002  89.606 1.00 29.87  ? 21  VAL A CG2 1 
ATOM   157  N N   . GLN A 1 21  ? 59.279  -12.866 88.220 1.00 25.77  ? 22  GLN A N   1 
ATOM   158  C CA  . GLN A 1 21  ? 58.861  -13.938 87.319 1.00 19.43  ? 22  GLN A CA  1 
ATOM   159  C C   . GLN A 1 21  ? 57.336  -14.009 87.300 1.00 27.87  ? 22  GLN A C   1 
ATOM   160  O O   . GLN A 1 21  ? 56.724  -14.047 86.236 1.00 30.70  ? 22  GLN A O   1 
ATOM   161  C CB  . GLN A 1 21  ? 59.470  -15.291 87.726 1.00 23.58  ? 22  GLN A CB  1 
ATOM   162  C CG  . GLN A 1 21  ? 60.993  -15.364 87.596 1.00 28.89  ? 22  GLN A CG  1 
ATOM   163  C CD  . GLN A 1 21  ? 61.588  -16.706 88.029 1.00 24.49  ? 22  GLN A CD  1 
ATOM   164  O OE1 . GLN A 1 21  ? 60.934  -17.745 87.957 1.00 28.47  ? 22  GLN A OE1 1 
ATOM   165  N NE2 . GLN A 1 21  ? 62.841  -16.679 88.478 1.00 29.12  ? 22  GLN A NE2 1 
ATOM   166  N N   . ASN A 1 22  ? 56.733  -13.995 88.486 1.00 28.64  ? 23  ASN A N   1 
ATOM   167  C CA  . ASN A 1 22  ? 55.282  -14.062 88.622 1.00 25.66  ? 23  ASN A CA  1 
ATOM   168  C C   . ASN A 1 22  ? 54.547  -12.955 87.861 1.00 26.09  ? 23  ASN A C   1 
ATOM   169  O O   . ASN A 1 22  ? 53.518  -13.214 87.241 1.00 30.90  ? 23  ASN A O   1 
ATOM   170  C CB  . ASN A 1 22  ? 54.887  -14.030 90.103 1.00 33.51  ? 23  ASN A CB  1 
ATOM   171  C CG  . ASN A 1 22  ? 55.238  -15.317 90.827 1.00 33.55  ? 23  ASN A CG  1 
ATOM   172  O OD1 . ASN A 1 22  ? 55.499  -16.341 90.197 1.00 36.49  ? 23  ASN A OD1 1 
ATOM   173  N ND2 . ASN A 1 22  ? 55.238  -15.273 92.155 1.00 31.46  ? 23  ASN A ND2 1 
ATOM   174  N N   . LYS A 1 23  ? 55.067  -11.731 87.896 1.00 22.75  ? 24  LYS A N   1 
ATOM   175  C CA  . LYS A 1 23  ? 54.456  -10.634 87.145 1.00 23.18  ? 24  LYS A CA  1 
ATOM   176  C C   . LYS A 1 23  ? 54.530  -10.857 85.638 1.00 26.29  ? 24  LYS A C   1 
ATOM   177  O O   . LYS A 1 23  ? 53.524  -10.738 84.941 1.00 27.81  ? 24  LYS A O   1 
ATOM   178  C CB  . LYS A 1 23  ? 55.118  -9.304  87.495 1.00 22.84  ? 24  LYS A CB  1 
ATOM   179  C CG  . LYS A 1 23  ? 54.778  -8.788  88.877 1.00 24.16  ? 24  LYS A CG  1 
ATOM   180  C CD  . LYS A 1 23  ? 55.510  -7.495  89.150 1.00 32.18  ? 24  LYS A CD  1 
ATOM   181  C CE  . LYS A 1 23  ? 55.203  -6.973  90.537 1.00 39.27  ? 24  LYS A CE  1 
ATOM   182  N NZ  . LYS A 1 23  ? 55.878  -5.669  90.770 1.00 46.18  ? 24  LYS A NZ  1 
ATOM   183  N N   . LEU A 1 24  ? 55.723  -11.170 85.141 1.00 19.77  ? 25  LEU A N   1 
ATOM   184  C CA  . LEU A 1 24  ? 55.917  -11.394 83.711 1.00 28.77  ? 25  LEU A CA  1 
ATOM   185  C C   . LEU A 1 24  ? 55.024  -12.520 83.196 1.00 28.81  ? 25  LEU A C   1 
ATOM   186  O O   . LEU A 1 24  ? 54.302  -12.339 82.219 1.00 29.53  ? 25  LEU A O   1 
ATOM   187  C CB  . LEU A 1 24  ? 57.388  -11.697 83.410 1.00 23.72  ? 25  LEU A CB  1 
ATOM   188  C CG  . LEU A 1 24  ? 58.336  -10.507 83.594 1.00 24.53  ? 25  LEU A CG  1 
ATOM   189  C CD1 . LEU A 1 24  ? 59.785  -10.961 83.635 1.00 28.10  ? 25  LEU A CD1 1 
ATOM   190  C CD2 . LEU A 1 24  ? 58.123  -9.488  82.483 1.00 21.01  ? 25  LEU A CD2 1 
ATOM   191  N N   . GLU A 1 25  ? 55.059  -13.673 83.861 1.00 26.31  ? 26  GLU A N   1 
ATOM   192  C CA  . GLU A 1 25  ? 54.246  -14.814 83.440 1.00 26.91  ? 26  GLU A CA  1 
ATOM   193  C C   . GLU A 1 25  ? 52.759  -14.484 83.486 1.00 30.51  ? 26  GLU A C   1 
ATOM   194  O O   . GLU A 1 25  ? 52.001  -14.917 82.626 1.00 33.06  ? 26  GLU A O   1 
ATOM   195  C CB  . GLU A 1 25  ? 54.528  -16.046 84.308 1.00 27.35  ? 26  GLU A CB  1 
ATOM   196  C CG  . GLU A 1 25  ? 55.898  -16.680 84.088 1.00 45.19  ? 26  GLU A CG  1 
ATOM   197  C CD  . GLU A 1 25  ? 55.854  -17.915 83.197 1.00 44.28  ? 26  GLU A CD  1 
ATOM   198  O OE1 . GLU A 1 25  ? 55.232  -17.864 82.115 1.00 43.51  ? 26  GLU A OE1 1 
ATOM   199  O OE2 . GLU A 1 25  ? 56.458  -18.937 83.581 1.00 49.13  ? 26  GLU A OE2 1 
ATOM   200  N N   . LYS A 1 26  ? 52.349  -13.722 84.496 1.00 26.18  ? 27  LYS A N   1 
ATOM   201  C CA  . LYS A 1 26  ? 50.966  -13.281 84.610 1.00 31.37  ? 27  LYS A CA  1 
ATOM   202  C C   . LYS A 1 26  ? 50.559  -12.492 83.372 1.00 32.53  ? 27  LYS A C   1 
ATOM   203  O O   . LYS A 1 26  ? 49.522  -12.763 82.760 1.00 32.99  ? 27  LYS A O   1 
ATOM   204  C CB  . LYS A 1 26  ? 50.772  -12.434 85.871 1.00 33.16  ? 27  LYS A CB  1 
ATOM   205  C CG  . LYS A 1 26  ? 49.433  -11.713 85.955 1.00 38.57  ? 27  LYS A CG  1 
ATOM   206  C CD  . LYS A 1 26  ? 48.266  -12.687 85.962 1.00 43.31  ? 27  LYS A CD  1 
ATOM   207  C CE  . LYS A 1 26  ? 46.946  -11.959 86.164 1.00 38.87  ? 27  LYS A CE  1 
ATOM   208  N NZ  . LYS A 1 26  ? 45.774  -12.835 85.888 1.00 32.02  ? 27  LYS A NZ  1 
ATOM   209  N N   . PHE A 1 27  ? 51.394  -11.528 83.000 1.00 29.50  ? 28  PHE A N   1 
ATOM   210  C CA  . PHE A 1 27  ? 51.109  -10.660 81.865 1.00 27.12  ? 28  PHE A CA  1 
ATOM   211  C C   . PHE A 1 27  ? 51.223  -11.417 80.542 1.00 32.37  ? 28  PHE A C   1 
ATOM   212  O O   . PHE A 1 27  ? 50.402  -11.230 79.648 1.00 31.91  ? 28  PHE A O   1 
ATOM   213  C CB  . PHE A 1 27  ? 52.050  -9.454  81.884 1.00 29.30  ? 28  PHE A CB  1 
ATOM   214  C CG  . PHE A 1 27  ? 51.706  -8.384  80.881 1.00 30.36  ? 28  PHE A CG  1 
ATOM   215  C CD1 . PHE A 1 27  ? 50.910  -7.305  81.238 1.00 36.74  ? 28  PHE A CD1 1 
ATOM   216  C CD2 . PHE A 1 27  ? 52.214  -8.434  79.593 1.00 29.99  ? 28  PHE A CD2 1 
ATOM   217  C CE1 . PHE A 1 27  ? 50.609  -6.311  80.319 1.00 27.80  ? 28  PHE A CE1 1 
ATOM   218  C CE2 . PHE A 1 27  ? 51.916  -7.444  78.673 1.00 38.78  ? 28  PHE A CE2 1 
ATOM   219  C CZ  . PHE A 1 27  ? 51.112  -6.382  79.037 1.00 32.93  ? 28  PHE A CZ  1 
ATOM   220  N N   . LEU A 1 28  ? 52.233  -12.274 80.414 1.00 29.23  ? 29  LEU A N   1 
ATOM   221  C CA  . LEU A 1 28  ? 52.402  -13.042 79.183 1.00 28.79  ? 29  LEU A CA  1 
ATOM   222  C C   . LEU A 1 28  ? 51.244  -14.017 79.000 1.00 36.70  ? 29  LEU A C   1 
ATOM   223  O O   . LEU A 1 28  ? 50.817  -14.279 77.881 1.00 37.09  ? 29  LEU A O   1 
ATOM   224  C CB  . LEU A 1 28  ? 53.745  -13.788 79.172 1.00 29.68  ? 29  LEU A CB  1 
ATOM   225  C CG  . LEU A 1 28  ? 54.942  -13.036 78.571 1.00 38.70  ? 29  LEU A CG  1 
ATOM   226  C CD1 . LEU A 1 28  ? 55.264  -11.775 79.355 1.00 42.21  ? 29  LEU A CD1 1 
ATOM   227  C CD2 . LEU A 1 28  ? 56.170  -13.926 78.480 1.00 32.22  ? 29  LEU A CD2 1 
ATOM   228  N N   . ALA A 1 29  ? 50.730  -14.537 80.110 1.00 30.69  ? 30  ALA A N   1 
ATOM   229  C CA  . ALA A 1 29  ? 49.589  -15.445 80.077 1.00 34.34  ? 30  ALA A CA  1 
ATOM   230  C C   . ALA A 1 29  ? 48.351  -14.729 79.570 1.00 34.83  ? 30  ALA A C   1 
ATOM   231  O O   . ALA A 1 29  ? 47.617  -15.250 78.728 1.00 40.39  ? 30  ALA A O   1 
ATOM   232  C CB  . ALA A 1 29  ? 49.326  -16.026 81.457 1.00 31.12  ? 30  ALA A CB  1 
ATOM   233  N N   . ASP A 1 30  ? 48.129  -13.530 80.096 1.00 33.42  ? 31  ASP A N   1 
ATOM   234  C CA  . ASP A 1 30  ? 46.968  -12.733 79.737 1.00 35.40  ? 31  ASP A CA  1 
ATOM   235  C C   . ASP A 1 30  ? 46.979  -12.390 78.252 1.00 33.78  ? 31  ASP A C   1 
ATOM   236  O O   . ASP A 1 30  ? 45.933  -12.370 77.606 1.00 33.47  ? 31  ASP A O   1 
ATOM   237  C CB  . ASP A 1 30  ? 46.916  -11.461 80.589 1.00 37.60  ? 31  ASP A CB  1 
ATOM   238  C CG  . ASP A 1 30  ? 46.582  -11.747 82.040 1.00 46.54  ? 31  ASP A CG  1 
ATOM   239  O OD1 . ASP A 1 30  ? 46.512  -12.936 82.411 1.00 40.19  ? 31  ASP A OD1 1 
ATOM   240  O OD2 . ASP A 1 30  ? 46.393  -10.784 82.809 1.00 52.40  ? 31  ASP A OD2 1 
ATOM   241  N N   . GLN A 1 31  ? 48.166  -12.131 77.714 1.00 33.68  ? 32  GLN A N   1 
ATOM   242  C CA  . GLN A 1 31  ? 48.308  -11.826 76.297 1.00 29.37  ? 32  GLN A CA  1 
ATOM   243  C C   . GLN A 1 31  ? 47.965  -13.034 75.443 1.00 29.70  ? 32  GLN A C   1 
ATOM   244  O O   . GLN A 1 31  ? 47.326  -12.907 74.400 1.00 33.02  ? 32  GLN A O   1 
ATOM   245  C CB  . GLN A 1 31  ? 49.726  -11.351 75.983 1.00 33.88  ? 32  GLN A CB  1 
ATOM   246  C CG  . GLN A 1 31  ? 49.970  -9.888  76.290 1.00 32.18  ? 32  GLN A CG  1 
ATOM   247  C CD  . GLN A 1 31  ? 51.319  -9.421  75.797 1.00 38.20  ? 32  GLN A CD  1 
ATOM   248  O OE1 . GLN A 1 31  ? 52.250  -10.214 75.660 1.00 35.25  ? 32  GLN A OE1 1 
ATOM   249  N NE2 . GLN A 1 31  ? 51.432  -8.129  75.517 1.00 38.37  ? 32  GLN A NE2 1 
ATOM   250  N N   . GLN A 1 32  ? 48.400  -14.205 75.893 1.00 29.10  ? 33  GLN A N   1 
ATOM   251  C CA  . GLN A 1 32  ? 48.051  -15.456 75.238 1.00 29.41  ? 33  GLN A CA  1 
ATOM   252  C C   . GLN A 1 32  ? 46.540  -15.671 75.257 1.00 31.49  ? 33  GLN A C   1 
ATOM   253  O O   . GLN A 1 32  ? 45.948  -16.075 74.258 1.00 33.18  ? 33  GLN A O   1 
ATOM   254  C CB  . GLN A 1 32  ? 48.762  -16.628 75.915 1.00 35.74  ? 33  GLN A CB  1 
ATOM   255  C CG  . GLN A 1 32  ? 50.278  -16.534 75.896 1.00 41.46  ? 33  GLN A CG  1 
ATOM   256  C CD  . GLN A 1 32  ? 50.874  -16.963 74.576 1.00 38.15  ? 33  GLN A CD  1 
ATOM   257  O OE1 . GLN A 1 32  ? 50.158  -17.372 73.665 1.00 50.05  ? 33  GLN A OE1 1 
ATOM   258  N NE2 . GLN A 1 32  ? 52.195  -16.882 74.468 1.00 32.23  ? 33  GLN A NE2 1 
ATOM   259  N N   . SER A 1 33  ? 45.918  -15.389 76.398 1.00 25.75  ? 34  SER A N   1 
ATOM   260  C CA  . SER A 1 33  ? 44.481  -15.587 76.546 1.00 31.27  ? 34  SER A CA  1 
ATOM   261  C C   . SER A 1 33  ? 43.675  -14.623 75.678 1.00 31.18  ? 34  SER A C   1 
ATOM   262  O O   . SER A 1 33  ? 42.698  -15.025 75.046 1.00 32.16  ? 34  SER A O   1 
ATOM   263  C CB  . SER A 1 33  ? 44.072  -15.440 78.011 1.00 30.38  ? 34  SER A CB  1 
ATOM   264  O OG  . SER A 1 33  ? 44.815  -16.324 78.833 1.00 36.38  ? 34  SER A OG  1 
ATOM   265  N N   . GLU A 1 34  ? 44.085  -13.357 75.644 1.00 30.40  ? 35  GLU A N   1 
ATOM   266  C CA  . GLU A 1 34  ? 43.380  -12.358 74.844 1.00 31.12  ? 35  GLU A CA  1 
ATOM   267  C C   . GLU A 1 34  ? 43.433  -12.722 73.364 1.00 30.41  ? 35  GLU A C   1 
ATOM   268  O O   . GLU A 1 34  ? 42.449  -12.547 72.644 1.00 30.81  ? 35  GLU A O   1 
ATOM   269  C CB  . GLU A 1 34  ? 43.959  -10.954 75.062 1.00 27.39  ? 35  GLU A CB  1 
ATOM   270  C CG  . GLU A 1 34  ? 43.169  -9.847  74.356 1.00 34.43  ? 35  GLU A CG  1 
ATOM   271  C CD  . GLU A 1 34  ? 43.681  -8.452  74.674 1.00 40.29  ? 35  GLU A CD  1 
ATOM   272  O OE1 . GLU A 1 34  ? 44.673  -8.337  75.421 1.00 49.97  ? 35  GLU A OE1 1 
ATOM   273  O OE2 . GLU A 1 34  ? 43.090  -7.468  74.177 1.00 35.71  ? 35  GLU A OE2 1 
ATOM   274  N N   . ILE A 1 35  ? 44.578  -13.234 72.917 1.00 31.53  ? 36  ILE A N   1 
ATOM   275  C CA  . ILE A 1 35  ? 44.725  -13.686 71.535 1.00 29.74  ? 36  ILE A CA  1 
ATOM   276  C C   . ILE A 1 35  ? 43.690  -14.756 71.201 1.00 32.29  ? 36  ILE A C   1 
ATOM   277  O O   . ILE A 1 35  ? 42.996  -14.671 70.187 1.00 31.89  ? 36  ILE A O   1 
ATOM   278  C CB  . ILE A 1 35  ? 46.139  -14.236 71.271 1.00 28.36  ? 36  ILE A CB  1 
ATOM   279  C CG1 . ILE A 1 35  ? 47.135  -13.083 71.163 1.00 27.19  ? 36  ILE A CG1 1 
ATOM   280  C CG2 . ILE A 1 35  ? 46.167  -15.079 70.002 1.00 25.64  ? 36  ILE A CG2 1 
ATOM   281  C CD1 . ILE A 1 35  ? 48.581  -13.511 71.251 1.00 33.58  ? 36  ILE A CD1 1 
ATOM   282  N N   . ASP A 1 36  ? 43.585  -15.755 72.071 1.00 35.63  ? 37  ASP A N   1 
ATOM   283  C CA  . ASP A 1 36  ? 42.632  -16.842 71.885 1.00 34.99  ? 37  ASP A CA  1 
ATOM   284  C C   . ASP A 1 36  ? 41.198  -16.361 72.055 1.00 33.53  ? 37  ASP A C   1 
ATOM   285  O O   . ASP A 1 36  ? 40.286  -16.857 71.398 1.00 35.95  ? 37  ASP A O   1 
ATOM   286  C CB  . ASP A 1 36  ? 42.923  -17.976 72.868 1.00 32.13  ? 37  ASP A CB  1 
ATOM   287  C CG  . ASP A 1 36  ? 44.196  -18.722 72.532 1.00 42.97  ? 37  ASP A CG  1 
ATOM   288  O OD1 . ASP A 1 36  ? 44.477  -19.740 73.196 1.00 47.64  ? 37  ASP A OD1 1 
ATOM   289  O OD2 . ASP A 1 36  ? 44.908  -18.297 71.597 1.00 47.71  ? 37  ASP A OD2 1 
ATOM   290  N N   . GLY A 1 37  ? 41.007  -15.397 72.948 1.00 31.90  ? 38  GLY A N   1 
ATOM   291  C CA  . GLY A 1 37  ? 39.694  -14.835 73.200 1.00 29.74  ? 38  GLY A CA  1 
ATOM   292  C C   . GLY A 1 37  ? 39.200  -14.046 72.008 1.00 31.51  ? 38  GLY A C   1 
ATOM   293  O O   . GLY A 1 37  ? 38.018  -14.081 71.669 1.00 33.54  ? 38  GLY A O   1 
ATOM   294  N N   . LEU A 1 38  ? 40.117  -13.330 71.368 1.00 29.78  ? 39  LEU A N   1 
ATOM   295  C CA  . LEU A 1 38  ? 39.794  -12.568 70.170 1.00 32.82  ? 39  LEU A CA  1 
ATOM   296  C C   . LEU A 1 38  ? 39.484  -13.488 69.000 1.00 33.47  ? 39  LEU A C   1 
ATOM   297  O O   . LEU A 1 38  ? 38.569  -13.227 68.219 1.00 30.79  ? 39  LEU A O   1 
ATOM   298  C CB  . LEU A 1 38  ? 40.943  -11.626 69.806 1.00 22.40  ? 39  LEU A CB  1 
ATOM   299  C CG  . LEU A 1 38  ? 41.110  -10.381 70.679 1.00 22.57  ? 39  LEU A CG  1 
ATOM   300  C CD1 . LEU A 1 38  ? 42.445  -9.724  70.401 1.00 27.86  ? 39  LEU A CD1 1 
ATOM   301  C CD2 . LEU A 1 38  ? 39.966  -9.415  70.409 1.00 22.31  ? 39  LEU A CD2 1 
ATOM   302  N N   . LYS A 1 39  ? 40.258  -14.561 68.877 1.00 32.43  ? 40  LYS A N   1 
ATOM   303  C CA  . LYS A 1 39  ? 40.033  -15.537 67.821 1.00 32.04  ? 40  LYS A CA  1 
ATOM   304  C C   . LYS A 1 39  ? 38.727  -16.289 68.062 1.00 30.64  ? 40  LYS A C   1 
ATOM   305  O O   . LYS A 1 39  ? 38.021  -16.638 67.113 1.00 30.50  ? 40  LYS A O   1 
ATOM   306  C CB  . LYS A 1 39  ? 41.211  -16.508 67.721 1.00 29.57  ? 40  LYS A CB  1 
ATOM   307  C CG  . LYS A 1 39  ? 42.465  -15.861 67.137 1.00 34.99  ? 40  LYS A CG  1 
ATOM   308  C CD  . LYS A 1 39  ? 43.743  -16.562 67.574 1.00 38.30  ? 40  LYS A CD  1 
ATOM   309  C CE  . LYS A 1 39  ? 44.156  -17.645 66.597 1.00 35.67  ? 40  LYS A CE  1 
ATOM   310  N NZ  . LYS A 1 39  ? 45.618  -17.899 66.696 1.00 39.30  ? 40  LYS A NZ  1 
ATOM   311  N N   . GLY A 1 40  ? 38.397  -16.526 69.329 1.00 31.29  ? 41  GLY A N   1 
ATOM   312  C CA  . GLY A 1 40  ? 37.134  -17.158 69.664 1.00 32.50  ? 41  GLY A CA  1 
ATOM   313  C C   . GLY A 1 40  ? 35.964  -16.261 69.315 1.00 33.99  ? 41  GLY A C   1 
ATOM   314  O O   . GLY A 1 40  ? 34.996  -16.694 68.689 1.00 33.02  ? 41  GLY A O   1 
ATOM   315  N N   . ARG A 1 41  ? 36.076  -14.998 69.714 1.00 35.86  ? 42  ARG A N   1 
ATOM   316  C CA  . ARG A 1 41  ? 35.040  -14.000 69.477 1.00 28.07  ? 42  ARG A CA  1 
ATOM   317  C C   . ARG A 1 41  ? 34.806  -13.746 67.992 1.00 40.21  ? 42  ARG A C   1 
ATOM   318  O O   . ARG A 1 41  ? 33.686  -13.442 67.574 1.00 42.89  ? 42  ARG A O   1 
ATOM   319  C CB  . ARG A 1 41  ? 35.409  -12.686 70.172 1.00 37.17  ? 42  ARG A CB  1 
ATOM   320  C CG  . ARG A 1 41  ? 34.929  -12.571 71.609 1.00 41.77  ? 42  ARG A CG  1 
ATOM   321  C CD  . ARG A 1 41  ? 33.578  -11.879 71.666 1.00 52.95  ? 42  ARG A CD  1 
ATOM   322  N NE  . ARG A 1 41  ? 33.000  -11.892 73.006 1.00 47.23  ? 42  ARG A NE  1 
ATOM   323  C CZ  . ARG A 1 41  ? 31.726  -11.617 73.269 1.00 52.00  ? 42  ARG A CZ  1 
ATOM   324  N NH1 . ARG A 1 41  ? 30.894  -11.310 72.282 1.00 50.19  ? 42  ARG A NH1 1 
ATOM   325  N NH2 . ARG A 1 41  ? 31.282  -11.654 74.517 1.00 56.86  ? 42  ARG A NH2 1 
ATOM   326  N N   . HIS A 1 42  ? 35.865  -13.862 67.197 1.00 33.86  ? 43  HIS A N   1 
ATOM   327  C CA  . HIS A 1 42  ? 35.765  -13.581 65.771 1.00 33.74  ? 43  HIS A CA  1 
ATOM   328  C C   . HIS A 1 42  ? 34.955  -14.642 65.045 1.00 35.34  ? 43  HIS A C   1 
ATOM   329  O O   . HIS A 1 42  ? 34.217  -14.341 64.106 1.00 35.84  ? 43  HIS A O   1 
ATOM   330  C CB  . HIS A 1 42  ? 37.150  -13.475 65.139 1.00 33.57  ? 43  HIS A CB  1 
ATOM   331  C CG  . HIS A 1 42  ? 37.119  -13.267 63.661 1.00 39.25  ? 43  HIS A CG  1 
ATOM   332  N ND1 . HIS A 1 42  ? 36.719  -12.076 63.082 1.00 38.27  ? 43  HIS A ND1 1 
ATOM   333  C CD2 . HIS A 1 42  ? 37.429  -14.090 62.632 1.00 35.43  ? 43  HIS A CD2 1 
ATOM   334  C CE1 . HIS A 1 42  ? 36.789  -12.179 61.773 1.00 30.96  ? 43  HIS A CE1 1 
ATOM   335  N NE2 . HIS A 1 42  ? 37.218  -13.396 61.469 1.00 35.31  ? 43  HIS A NE2 1 
ATOM   336  N N   . GLU A 1 43  ? 35.102  -15.888 65.476 1.00 34.35  ? 44  GLU A N   1 
ATOM   337  C CA  . GLU A 1 43  ? 34.376  -16.982 64.851 1.00 43.50  ? 44  GLU A CA  1 
ATOM   338  C C   . GLU A 1 43  ? 32.893  -16.934 65.197 1.00 41.45  ? 44  GLU A C   1 
ATOM   339  O O   . GLU A 1 43  ? 32.051  -17.216 64.348 1.00 38.03  ? 44  GLU A O   1 
ATOM   340  C CB  . GLU A 1 43  ? 34.977  -18.326 65.260 1.00 33.91  ? 44  GLU A CB  1 
ATOM   341  C CG  . GLU A 1 43  ? 35.742  -19.006 64.147 1.00 50.08  ? 44  GLU A CG  1 
ATOM   342  C CD  . GLU A 1 43  ? 34.845  -19.467 63.012 1.00 49.79  ? 44  GLU A CD  1 
ATOM   343  O OE1 . GLU A 1 43  ? 35.167  -19.176 61.840 1.00 49.47  ? 44  GLU A OE1 1 
ATOM   344  O OE2 . GLU A 1 43  ? 33.823  -20.129 63.290 1.00 39.85  ? 44  GLU A OE2 1 
ATOM   345  N N   . LYS A 1 44  ? 32.581  -16.573 66.439 1.00 36.74  ? 45  LYS A N   1 
ATOM   346  C CA  . LYS A 1 44  ? 31.190  -16.459 66.874 1.00 43.23  ? 45  LYS A CA  1 
ATOM   347  C C   . LYS A 1 44  ? 30.464  -15.409 66.041 1.00 36.61  ? 45  LYS A C   1 
ATOM   348  O O   . LYS A 1 44  ? 29.301  -15.586 65.674 1.00 35.87  ? 45  LYS A O   1 
ATOM   349  C CB  . LYS A 1 44  ? 31.097  -16.098 68.362 1.00 45.98  ? 45  LYS A CB  1 
ATOM   350  C CG  . LYS A 1 44  ? 31.796  -17.063 69.312 1.00 46.60  ? 45  LYS A CG  1 
ATOM   351  C CD  . LYS A 1 44  ? 31.259  -18.485 69.192 1.00 53.18  ? 45  LYS A CD  1 
ATOM   352  C CE  . LYS A 1 44  ? 29.845  -18.608 69.724 1.00 57.87  ? 45  LYS A CE  1 
ATOM   353  N NZ  . LYS A 1 44  ? 29.339  -20.005 69.629 1.00 63.21  ? 45  LYS A NZ  1 
ATOM   354  N N   . PHE A 1 45  ? 31.163  -14.316 65.750 1.00 39.61  ? 46  PHE A N   1 
ATOM   355  C CA  . PHE A 1 45  ? 30.624  -13.241 64.928 1.00 31.56  ? 46  PHE A CA  1 
ATOM   356  C C   . PHE A 1 45  ? 30.483  -13.693 63.483 1.00 39.78  ? 46  PHE A C   1 
ATOM   357  O O   . PHE A 1 45  ? 29.497  -13.386 62.816 1.00 40.26  ? 46  PHE A O   1 
ATOM   358  C CB  . PHE A 1 45  ? 31.527  -12.008 65.004 1.00 26.58  ? 46  PHE A CB  1 
ATOM   359  C CG  . PHE A 1 45  ? 30.969  -10.797 64.310 1.00 27.26  ? 46  PHE A CG  1 
ATOM   360  C CD1 . PHE A 1 45  ? 30.185  -9.893  65.004 1.00 34.18  ? 46  PHE A CD1 1 
ATOM   361  C CD2 . PHE A 1 45  ? 31.236  -10.556 62.971 1.00 26.68  ? 46  PHE A CD2 1 
ATOM   362  C CE1 . PHE A 1 45  ? 29.671  -8.774  64.379 1.00 34.72  ? 46  PHE A CE1 1 
ATOM   363  C CE2 . PHE A 1 45  ? 30.723  -9.437  62.340 1.00 31.77  ? 46  PHE A CE2 1 
ATOM   364  C CZ  . PHE A 1 45  ? 29.942  -8.545  63.045 1.00 34.35  ? 46  PHE A CZ  1 
ATOM   365  N N   . LYS A 1 46  ? 31.488  -14.421 63.011 1.00 36.15  ? 47  LYS A N   1 
ATOM   366  C CA  . LYS A 1 46  ? 31.558  -14.855 61.623 1.00 35.56  ? 47  LYS A CA  1 
ATOM   367  C C   . LYS A 1 46  ? 30.392  -15.768 61.272 1.00 34.63  ? 47  LYS A C   1 
ATOM   368  O O   . LYS A 1 46  ? 29.718  -15.555 60.263 1.00 42.73  ? 47  LYS A O   1 
ATOM   369  C CB  . LYS A 1 46  ? 32.887  -15.567 61.353 1.00 39.95  ? 47  LYS A CB  1 
ATOM   370  C CG  . LYS A 1 46  ? 33.193  -15.807 59.883 1.00 37.31  ? 47  LYS A CG  1 
ATOM   371  C CD  . LYS A 1 46  ? 34.570  -16.433 59.732 1.00 43.48  ? 47  LYS A CD  1 
ATOM   372  C CE  . LYS A 1 46  ? 34.932  -16.666 58.274 1.00 49.25  ? 47  LYS A CE  1 
ATOM   373  N NZ  . LYS A 1 46  ? 33.996  -17.616 57.619 1.00 43.70  ? 47  LYS A NZ  1 
ATOM   374  N N   . VAL A 1 47  ? 30.156  -16.781 62.102 1.00 34.97  ? 48  VAL A N   1 
ATOM   375  C CA  . VAL A 1 47  ? 29.059  -17.706 61.852 1.00 40.83  ? 48  VAL A CA  1 
ATOM   376  C C   . VAL A 1 47  ? 27.712  -16.997 61.983 1.00 40.90  ? 48  VAL A C   1 
ATOM   377  O O   . VAL A 1 47  ? 26.786  -17.291 61.231 1.00 38.23  ? 48  VAL A O   1 
ATOM   378  C CB  . VAL A 1 47  ? 29.099  -18.932 62.801 1.00 36.56  ? 48  VAL A CB  1 
ATOM   379  C CG1 . VAL A 1 47  ? 30.348  -19.753 62.553 1.00 44.06  ? 48  VAL A CG1 1 
ATOM   380  C CG2 . VAL A 1 47  ? 29.022  -18.509 64.261 1.00 42.07  ? 48  VAL A CG2 1 
ATOM   381  N N   . GLU A 1 48  ? 27.610  -16.050 62.914 1.00 41.76  ? 49  GLU A N   1 
ATOM   382  C CA  . GLU A 1 48  ? 26.367  -15.311 63.116 1.00 40.16  ? 49  GLU A CA  1 
ATOM   383  C C   . GLU A 1 48  ? 26.050  -14.442 61.904 1.00 40.62  ? 49  GLU A C   1 
ATOM   384  O O   . GLU A 1 48  ? 24.911  -14.399 61.439 1.00 47.25  ? 49  GLU A O   1 
ATOM   385  C CB  . GLU A 1 48  ? 26.449  -14.446 64.377 1.00 43.99  ? 49  GLU A CB  1 
ATOM   386  C CG  . GLU A 1 48  ? 25.267  -13.501 64.585 1.00 42.65  ? 49  GLU A CG  1 
ATOM   387  C CD  . GLU A 1 48  ? 24.020  -14.200 65.103 1.00 50.33  ? 49  GLU A CD  1 
ATOM   388  O OE1 . GLU A 1 48  ? 23.568  -13.858 66.215 1.00 60.54  ? 49  GLU A OE1 1 
ATOM   389  O OE2 . GLU A 1 48  ? 23.489  -15.083 64.399 1.00 54.40  ? 49  GLU A OE2 1 
ATOM   390  N N   . SER A 1 49  ? 27.070  -13.757 61.399 1.00 39.70  ? 50  SER A N   1 
ATOM   391  C CA  . SER A 1 49  ? 26.934  -12.894 60.233 1.00 36.28  ? 50  SER A CA  1 
ATOM   392  C C   . SER A 1 49  ? 26.496  -13.680 59.002 1.00 36.12  ? 50  SER A C   1 
ATOM   393  O O   . SER A 1 49  ? 25.521  -13.320 58.338 1.00 34.08  ? 50  SER A O   1 
ATOM   394  C CB  . SER A 1 49  ? 28.254  -12.170 59.953 1.00 31.13  ? 50  SER A CB  1 
ATOM   395  O OG  . SER A 1 49  ? 28.162  -11.364 58.790 1.00 35.26  ? 50  SER A OG  1 
ATOM   396  N N   . GLU A 1 50  ? 27.223  -14.754 58.706 1.00 40.75  ? 51  GLU A N   1 
ATOM   397  C CA  . GLU A 1 50  ? 26.931  -15.584 57.544 1.00 35.24  ? 51  GLU A CA  1 
ATOM   398  C C   . GLU A 1 50  ? 25.556  -16.238 57.655 1.00 42.07  ? 51  GLU A C   1 
ATOM   399  O O   . GLU A 1 50  ? 24.853  -16.395 56.659 1.00 39.48  ? 51  GLU A O   1 
ATOM   400  C CB  . GLU A 1 50  ? 28.027  -16.642 57.367 1.00 33.44  ? 51  GLU A CB  1 
ATOM   401  C CG  . GLU A 1 50  ? 29.374  -16.049 56.987 1.00 43.97  ? 51  GLU A CG  1 
ATOM   402  C CD  . GLU A 1 50  ? 30.518  -17.048 57.042 1.00 48.12  ? 51  GLU A CD  1 
ATOM   403  O OE1 . GLU A 1 50  ? 30.412  -18.048 57.783 1.00 43.05  ? 51  GLU A OE1 1 
ATOM   404  O OE2 . GLU A 1 50  ? 31.531  -16.826 56.344 1.00 51.48  ? 51  GLU A OE2 1 
ATOM   405  N N   . GLN A 1 51  ? 25.180  -16.608 58.875 1.00 39.14  ? 52  GLN A N   1 
ATOM   406  C CA  . GLN A 1 51  ? 23.869  -17.190 59.139 1.00 43.84  ? 52  GLN A CA  1 
ATOM   407  C C   . GLN A 1 51  ? 22.759  -16.184 58.850 1.00 43.59  ? 52  GLN A C   1 
ATOM   408  O O   . GLN A 1 51  ? 21.763  -16.514 58.209 1.00 34.24  ? 52  GLN A O   1 
ATOM   409  C CB  . GLN A 1 51  ? 23.783  -17.670 60.589 1.00 45.59  ? 52  GLN A CB  1 
ATOM   410  C CG  . GLN A 1 51  ? 22.421  -18.188 61.018 1.00 46.56  ? 52  GLN A CG  1 
ATOM   411  C CD  . GLN A 1 51  ? 22.296  -18.276 62.527 1.00 68.81  ? 52  GLN A CD  1 
ATOM   412  O OE1 . GLN A 1 51  ? 21.912  -17.310 63.184 1.00 72.79  ? 52  GLN A OE1 1 
ATOM   413  N NE2 . GLN A 1 51  ? 22.633  -19.432 63.084 1.00 70.29  ? 52  GLN A NE2 1 
ATOM   414  N N   . GLN A 1 52  ? 22.939  -14.954 59.323 1.00 40.03  ? 53  GLN A N   1 
ATOM   415  C CA  . GLN A 1 52  ? 21.960  -13.899 59.094 1.00 38.93  ? 53  GLN A CA  1 
ATOM   416  C C   . GLN A 1 52  ? 21.888  -13.526 57.621 1.00 39.99  ? 53  GLN A C   1 
ATOM   417  O O   . GLN A 1 52  ? 20.813  -13.223 57.106 1.00 40.67  ? 53  GLN A O   1 
ATOM   418  C CB  . GLN A 1 52  ? 22.292  -12.661 59.930 1.00 41.09  ? 53  GLN A CB  1 
ATOM   419  C CG  . GLN A 1 52  ? 21.950  -12.800 61.403 1.00 44.21  ? 53  GLN A CG  1 
ATOM   420  C CD  . GLN A 1 52  ? 22.356  -11.586 62.217 1.00 54.96  ? 53  GLN A CD  1 
ATOM   421  O OE1 . GLN A 1 52  ? 23.526  -11.213 62.252 1.00 50.06  ? 53  GLN A OE1 1 
ATOM   422  N NE2 . GLN A 1 52  ? 21.389  -10.962 62.875 1.00 55.81  ? 53  GLN A NE2 1 
ATOM   423  N N   . TYR A 1 53  ? 23.031  -13.553 56.944 1.00 34.58  ? 54  TYR A N   1 
ATOM   424  C CA  . TYR A 1 53  ? 23.076  -13.155 55.547 1.00 37.11  ? 54  TYR A CA  1 
ATOM   425  C C   . TYR A 1 53  ? 22.306  -14.141 54.668 1.00 35.37  ? 54  TYR A C   1 
ATOM   426  O O   . TYR A 1 53  ? 21.586  -13.741 53.753 1.00 28.85  ? 54  TYR A O   1 
ATOM   427  C CB  . TYR A 1 53  ? 24.519  -13.030 55.068 1.00 37.69  ? 54  TYR A CB  1 
ATOM   428  C CG  . TYR A 1 53  ? 24.612  -12.438 53.688 1.00 36.35  ? 54  TYR A CG  1 
ATOM   429  C CD1 . TYR A 1 53  ? 24.479  -11.070 53.491 1.00 37.26  ? 54  TYR A CD1 1 
ATOM   430  C CD2 . TYR A 1 53  ? 24.809  -13.245 52.578 1.00 40.84  ? 54  TYR A CD2 1 
ATOM   431  C CE1 . TYR A 1 53  ? 24.548  -10.522 52.227 1.00 34.56  ? 54  TYR A CE1 1 
ATOM   432  C CE2 . TYR A 1 53  ? 24.879  -12.706 51.309 1.00 46.31  ? 54  TYR A CE2 1 
ATOM   433  C CZ  . TYR A 1 53  ? 24.749  -11.344 51.140 1.00 37.41  ? 54  TYR A CZ  1 
ATOM   434  O OH  . TYR A 1 53  ? 24.819  -10.801 49.880 1.00 37.12  ? 54  TYR A OH  1 
ATOM   435  N N   . MET A 1 54  ? 22.455  -15.429 54.961 1.00 41.07  ? 55  MET A N   1 
ATOM   436  C CA  . MET A 1 54  ? 21.756  -16.468 54.217 1.00 36.78  ? 55  MET A CA  1 
ATOM   437  C C   . MET A 1 54  ? 20.252  -16.324 54.285 1.00 42.67  ? 55  MET A C   1 
ATOM   438  O O   . MET A 1 54  ? 19.552  -16.504 53.295 1.00 42.61  ? 55  MET A O   1 
ATOM   439  C CB  . MET A 1 54  ? 22.122  -17.831 54.757 1.00 44.93  ? 55  MET A CB  1 
ATOM   440  C CG  . MET A 1 54  ? 23.468  -18.323 54.361 1.00 61.03  ? 55  MET A CG  1 
ATOM   441  S SD  . MET A 1 54  ? 23.562  -20.153 54.791 1.00 125.41 0 55  MET A SD  1 
ATOM   442  C CE  . MET A 1 54  ? 24.419  -20.084 56.507 1.00 66.80  ? 55  MET A CE  1 
ATOM   443  N N   . GLU A 1 55  ? 19.772  -16.029 55.479 1.00 39.17  ? 56  GLU A N   1 
ATOM   444  C CA  . GLU A 1 55  ? 18.349  -16.024 55.750 1.00 38.49  ? 56  GLU A CA  1 
ATOM   445  C C   . GLU A 1 55  ? 17.665  -14.792 55.184 1.00 37.53  ? 56  GLU A C   1 
ATOM   446  O O   . GLU A 1 55  ? 16.503  -14.862 54.780 1.00 40.47  ? 56  GLU A O   1 
ATOM   447  C CB  . GLU A 1 55  ? 18.095  -16.131 57.252 1.00 45.00  ? 56  GLU A CB  1 
ATOM   448  C CG  . GLU A 1 55  ? 18.539  -17.459 57.842 1.00 50.56  ? 56  GLU A CG  1 
ATOM   449  C CD  . GLU A 1 55  ? 18.116  -17.632 59.284 1.00 60.53  ? 56  GLU A CD  1 
ATOM   450  O OE1 . GLU A 1 55  ? 17.194  -16.918 59.725 1.00 64.93  ? 56  GLU A OE1 1 
ATOM   451  O OE2 . GLU A 1 55  ? 18.709  -18.484 59.977 1.00 62.52  ? 56  GLU A OE2 1 
ATOM   452  N N   . ILE A 1 56  ? 18.367  -13.664 55.155 1.00 31.96  ? 57  ILE A N   1 
ATOM   453  C CA  . ILE A 1 56  ? 17.781  -12.458 54.583 1.00 32.55  ? 57  ILE A CA  1 
ATOM   454  C C   . ILE A 1 56  ? 17.904  -12.486 53.057 1.00 38.73  ? 57  ILE A C   1 
ATOM   455  O O   . ILE A 1 56  ? 17.153  -11.817 52.348 1.00 40.97  ? 57  ILE A O   1 
ATOM   456  C CB  . ILE A 1 56  ? 18.433  -11.189 55.158 1.00 32.10  ? 57  ILE A CB  1 
ATOM   457  C CG1 . ILE A 1 56  ? 17.758  -9.932  54.600 1.00 36.35  ? 57  ILE A CG1 1 
ATOM   458  C CG2 . ILE A 1 56  ? 19.921  -11.204 54.882 1.00 41.90  ? 57  ILE A CG2 1 
ATOM   459  C CD1 . ILE A 1 56  ? 17.856  -8.728  55.503 1.00 29.84  ? 57  ILE A CD1 1 
ATOM   460  N N   . GLU A 1 57  ? 18.844  -13.280 52.553 1.00 32.31  ? 58  GLU A N   1 
ATOM   461  C CA  . GLU A 1 57  ? 18.977  -13.476 51.114 1.00 37.55  ? 58  GLU A CA  1 
ATOM   462  C C   . GLU A 1 57  ? 17.839  -14.377 50.646 1.00 39.15  ? 58  GLU A C   1 
ATOM   463  O O   . GLU A 1 57  ? 17.389  -14.293 49.502 1.00 36.86  ? 58  GLU A O   1 
ATOM   464  C CB  . GLU A 1 57  ? 20.342  -14.084 50.766 1.00 43.18  ? 58  GLU A CB  1 
ATOM   465  C CG  . GLU A 1 57  ? 20.874  -13.742 49.377 1.00 46.37  ? 58  GLU A CG  1 
ATOM   466  C CD  . GLU A 1 57  ? 22.339  -14.118 49.202 1.00 51.19  ? 58  GLU A CD  1 
ATOM   467  O OE1 . GLU A 1 57  ? 22.761  -15.153 49.759 1.00 49.58  ? 58  GLU A OE1 1 
ATOM   468  O OE2 . GLU A 1 57  ? 23.074  -13.374 48.517 1.00 52.08  ? 58  GLU A OE2 1 
ATOM   469  N N   . LYS A 1 58  ? 17.382  -15.234 51.554 1.00 36.13  ? 59  LYS A N   1 
ATOM   470  C CA  . LYS A 1 58  ? 16.238  -16.106 51.319 1.00 39.34  ? 59  LYS A CA  1 
ATOM   471  C C   . LYS A 1 58  ? 14.966  -15.279 51.145 1.00 36.92  ? 59  LYS A C   1 
ATOM   472  O O   . LYS A 1 58  ? 14.195  -15.490 50.208 1.00 37.45  ? 59  LYS A O   1 
ATOM   473  C CB  . LYS A 1 58  ? 16.074  -17.090 52.481 1.00 41.42  ? 59  LYS A CB  1 
ATOM   474  C CG  . LYS A 1 58  ? 15.860  -18.546 52.081 1.00 49.06  ? 59  LYS A CG  1 
ATOM   475  C CD  . LYS A 1 58  ? 17.130  -19.368 52.266 1.00 56.12  ? 59  LYS A CD  1 
ATOM   476  C CE  . LYS A 1 58  ? 16.818  -20.856 52.350 1.00 63.25  ? 59  LYS A CE  1 
ATOM   477  N NZ  . LYS A 1 58  ? 18.016  -21.673 52.696 1.00 57.05  ? 59  LYS A NZ  1 
ATOM   478  N N   . ARG A 1 59  ? 14.761  -14.332 52.058 1.00 35.02  ? 60  ARG A N   1 
ATOM   479  C CA  . ARG A 1 59  ? 13.598  -13.447 52.032 1.00 30.65  ? 60  ARG A CA  1 
ATOM   480  C C   . ARG A 1 59  ? 13.519  -12.625 50.750 1.00 37.44  ? 60  ARG A C   1 
ATOM   481  O O   . ARG A 1 59  ? 12.434  -12.394 50.220 1.00 34.94  ? 60  ARG A O   1 
ATOM   482  C CB  . ARG A 1 59  ? 13.619  -12.513 53.243 1.00 28.65  ? 60  ARG A CB  1 
ATOM   483  C CG  . ARG A 1 59  ? 13.290  -13.201 54.554 1.00 34.77  ? 60  ARG A CG  1 
ATOM   484  C CD  . ARG A 1 59  ? 13.866  -12.435 55.733 1.00 36.98  ? 60  ARG A CD  1 
ATOM   485  N NE  . ARG A 1 59  ? 13.262  -11.116 55.898 1.00 33.03  ? 60  ARG A NE  1 
ATOM   486  C CZ  . ARG A 1 59  ? 13.827  -10.118 56.570 1.00 42.61  ? 60  ARG A CZ  1 
ATOM   487  N NH1 . ARG A 1 59  ? 15.017  -10.285 57.127 1.00 36.35  ? 60  ARG A NH1 1 
ATOM   488  N NH2 . ARG A 1 59  ? 13.207  -8.952  56.676 1.00 40.70  ? 60  ARG A NH2 1 
ATOM   489  N N   . LEU A 1 60  ? 14.670  -12.179 50.260 1.00 38.55  ? 61  LEU A N   1 
ATOM   490  C CA  . LEU A 1 60  ? 14.713  -11.429 49.012 1.00 37.91  ? 61  LEU A CA  1 
ATOM   491  C C   . LEU A 1 60  ? 14.276  -12.307 47.852 1.00 34.44  ? 61  LEU A C   1 
ATOM   492  O O   . LEU A 1 60  ? 13.472  -11.890 47.016 1.00 34.97  ? 61  LEU A O   1 
ATOM   493  C CB  . LEU A 1 60  ? 16.112  -10.875 48.751 1.00 33.16  ? 61  LEU A CB  1 
ATOM   494  C CG  . LEU A 1 60  ? 16.292  -10.220 47.379 1.00 30.51  ? 61  LEU A CG  1 
ATOM   495  C CD1 . LEU A 1 60  ? 15.317  -9.070  47.193 1.00 39.23  ? 61  LEU A CD1 1 
ATOM   496  C CD2 . LEU A 1 60  ? 17.711  -9.738  47.209 1.00 31.20  ? 61  LEU A CD2 1 
ATOM   497  N N   . SER A 1 61  ? 14.811  -13.523 47.811 1.00 34.76  ? 62  SER A N   1 
ATOM   498  C CA  . SER A 1 61  ? 14.468  -14.484 46.772 1.00 32.81  ? 62  SER A CA  1 
ATOM   499  C C   . SER A 1 61  ? 12.959  -14.720 46.712 1.00 39.89  ? 62  SER A C   1 
ATOM   500  O O   . SER A 1 61  ? 12.366  -14.737 45.635 1.00 45.50  ? 62  SER A O   1 
ATOM   501  C CB  . SER A 1 61  ? 15.209  -15.800 47.013 1.00 39.00  ? 62  SER A CB  1 
ATOM   502  O OG  . SER A 1 61  ? 15.074  -16.679 45.911 1.00 46.04  ? 62  SER A OG  1 
ATOM   503  N N   . HIS A 1 62  ? 12.345  -14.880 47.880 1.00 37.08  ? 63  HIS A N   1 
ATOM   504  C CA  . HIS A 1 62  ? 10.905  -15.106 47.978 1.00 39.88  ? 63  HIS A CA  1 
ATOM   505  C C   . HIS A 1 62  ? 10.121  -13.872 47.541 1.00 40.65  ? 63  HIS A C   1 
ATOM   506  O O   . HIS A 1 62  ? 9.113   -13.981 46.843 1.00 39.27  ? 63  HIS A O   1 
ATOM   507  C CB  . HIS A 1 62  ? 10.525  -15.499 49.410 1.00 41.06  ? 63  HIS A CB  1 
ATOM   508  C CG  . HIS A 1 62  ? 9.085   -15.869 49.579 1.00 39.95  ? 63  HIS A CG  1 
ATOM   509  N ND1 . HIS A 1 62  ? 8.464   -16.831 48.813 1.00 50.46  ? 63  HIS A ND1 1 
ATOM   510  C CD2 . HIS A 1 62  ? 8.142   -15.415 50.443 1.00 46.65  ? 63  HIS A CD2 1 
ATOM   511  C CE1 . HIS A 1 62  ? 7.203   -16.950 49.188 1.00 47.27  ? 63  HIS A CE1 1 
ATOM   512  N NE2 . HIS A 1 62  ? 6.984   -16.100 50.177 1.00 51.52  ? 63  HIS A NE2 1 
ATOM   513  N N   . SER A 1 63  ? 10.600  -12.701 47.951 1.00 36.74  ? 64  SER A N   1 
ATOM   514  C CA  . SER A 1 63  ? 9.968   -11.438 47.592 1.00 33.76  ? 64  SER A CA  1 
ATOM   515  C C   . SER A 1 63  ? 9.983   -11.210 46.086 1.00 35.60  ? 64  SER A C   1 
ATOM   516  O O   . SER A 1 63  ? 8.981   -10.794 45.505 1.00 36.17  ? 64  SER A O   1 
ATOM   517  C CB  . SER A 1 63  ? 10.663  -10.274 48.299 1.00 26.08  ? 64  SER A CB  1 
ATOM   518  O OG  . SER A 1 63  ? 10.118  -9.031  47.888 1.00 29.58  ? 64  SER A OG  1 
ATOM   519  N N   . GLN A 1 64  ? 11.130  -11.476 45.467 1.00 32.52  ? 65  GLN A N   1 
ATOM   520  C CA  . GLN A 1 64  ? 11.278  -11.345 44.022 1.00 34.56  ? 65  GLN A CA  1 
ATOM   521  C C   . GLN A 1 64  ? 10.266  -12.218 43.288 1.00 35.30  ? 65  GLN A C   1 
ATOM   522  O O   . GLN A 1 64  ? 9.573   -11.754 42.379 1.00 33.71  ? 65  GLN A O   1 
ATOM   523  C CB  . GLN A 1 64  ? 12.699  -11.719 43.583 1.00 31.11  ? 65  GLN A CB  1 
ATOM   524  C CG  . GLN A 1 64  ? 13.807  -10.817 44.120 1.00 33.37  ? 65  GLN A CG  1 
ATOM   525  C CD  . GLN A 1 64  ? 13.925  -9.496  43.379 1.00 47.88  ? 65  GLN A CD  1 
ATOM   526  O OE1 . GLN A 1 64  ? 12.946  -8.970  42.857 1.00 45.76  ? 65  GLN A OE1 1 
ATOM   527  N NE2 . GLN A 1 64  ? 15.136  -8.957  43.327 1.00 46.99  ? 65  GLN A NE2 1 
ATOM   528  N N   . GLU A 1 65  ? 10.188  -13.482 43.699 1.00 37.45  ? 66  GLU A N   1 
ATOM   529  C CA  . GLU A 1 65  ? 9.286   -14.462 43.097 1.00 36.61  ? 66  GLU A CA  1 
ATOM   530  C C   . GLU A 1 65  ? 7.817   -14.070 43.276 1.00 40.39  ? 66  GLU A C   1 
ATOM   531  O O   . GLU A 1 65  ? 7.008   -14.228 42.366 1.00 37.34  ? 66  GLU A O   1 
ATOM   532  C CB  . GLU A 1 65  ? 9.547   -15.846 43.704 1.00 41.84  ? 66  GLU A CB  1 
ATOM   533  C CG  . GLU A 1 65  ? 8.980   -17.021 42.920 1.00 51.51  ? 66  GLU A CG  1 
ATOM   534  C CD  . GLU A 1 65  ? 9.516   -18.363 43.399 1.00 60.52  ? 66  GLU A CD  1 
ATOM   535  O OE1 . GLU A 1 65  ? 9.440   -19.347 42.633 1.00 64.73  ? 66  GLU A OE1 1 
ATOM   536  O OE2 . GLU A 1 65  ? 10.015  -18.433 44.540 1.00 63.05  ? 66  GLU A OE2 1 
ATOM   537  N N   . ARG A 1 66  ? 7.479   -13.553 44.453 1.00 35.69  ? 67  ARG A N   1 
ATOM   538  C CA  . ARG A 1 66  ? 6.118   -13.099 44.727 1.00 34.65  ? 67  ARG A CA  1 
ATOM   539  C C   . ARG A 1 66  ? 5.754   -11.897 43.861 1.00 40.16  ? 67  ARG A C   1 
ATOM   540  O O   . ARG A 1 66  ? 4.613   -11.761 43.425 1.00 37.41  ? 67  ARG A O   1 
ATOM   541  C CB  . ARG A 1 66  ? 5.950   -12.754 46.210 1.00 37.29  ? 67  ARG A CB  1 
ATOM   542  C CG  . ARG A 1 66  ? 5.958   -13.964 47.130 1.00 47.80  ? 67  ARG A CG  1 
ATOM   543  C CD  . ARG A 1 66  ? 4.660   -14.071 47.914 1.00 55.90  ? 67  ARG A CD  1 
ATOM   544  N NE  . ARG A 1 66  ? 4.504   -12.978 48.869 1.00 60.63  ? 67  ARG A NE  1 
ATOM   545  C CZ  . ARG A 1 66  ? 3.391   -12.740 49.553 1.00 69.35  ? 67  ARG A CZ  1 
ATOM   546  N NH1 . ARG A 1 66  ? 2.330   -13.515 49.384 1.00 74.43  ? 67  ARG A NH1 1 
ATOM   547  N NH2 . ARG A 1 66  ? 3.337   -11.725 50.403 1.00 60.52  ? 67  ARG A NH2 1 
ATOM   548  N N   . LEU A 1 67  ? 6.730   -11.033 43.611 1.00 35.21  ? 68  LEU A N   1 
ATOM   549  C CA  . LEU A 1 67  ? 6.519   -9.867  42.763 1.00 41.57  ? 68  LEU A CA  1 
ATOM   550  C C   . LEU A 1 67  ? 6.268   -10.283 41.318 1.00 35.71  ? 68  LEU A C   1 
ATOM   551  O O   . LEU A 1 67  ? 5.405   -9.716  40.638 1.00 37.38  ? 68  LEU A O   1 
ATOM   552  C CB  . LEU A 1 67  ? 7.720   -8.922  42.838 1.00 30.94  ? 68  LEU A CB  1 
ATOM   553  C CG  . LEU A 1 67  ? 7.723   -7.731  41.875 1.00 34.79  ? 68  LEU A CG  1 
ATOM   554  C CD1 . LEU A 1 67  ? 6.474   -6.879  42.058 1.00 33.26  ? 68  LEU A CD1 1 
ATOM   555  C CD2 . LEU A 1 67  ? 8.980   -6.901  42.067 1.00 27.74  ? 68  LEU A CD2 1 
ATOM   556  N N   . VAL A 1 68  ? 7.024   -11.275 40.855 1.00 33.76  ? 69  VAL A N   1 
ATOM   557  C CA  . VAL A 1 68  ? 6.879   -11.782 39.496 1.00 33.92  ? 69  VAL A CA  1 
ATOM   558  C C   . VAL A 1 68  ? 5.472   -12.334 39.257 1.00 39.43  ? 69  VAL A C   1 
ATOM   559  O O   . VAL A 1 68  ? 4.882   -12.113 38.200 1.00 46.49  ? 69  VAL A O   1 
ATOM   560  C CB  . VAL A 1 68  ? 7.936   -12.868 39.198 1.00 39.58  ? 69  VAL A CB  1 
ATOM   561  C CG1 . VAL A 1 68  ? 7.636   -13.578 37.888 1.00 30.69  ? 69  VAL A CG1 1 
ATOM   562  C CG2 . VAL A 1 68  ? 9.330   -12.255 39.181 1.00 38.89  ? 69  VAL A CG2 1 
ATOM   563  N N   . ASN A 1 69  ? 4.932   -13.033 40.251 1.00 37.06  ? 70  ASN A N   1 
ATOM   564  C CA  . ASN A 1 69  ? 3.587   -13.590 40.148 1.00 40.78  ? 70  ASN A CA  1 
ATOM   565  C C   . ASN A 1 69  ? 2.508   -12.516 40.177 1.00 37.53  ? 70  ASN A C   1 
ATOM   566  O O   . ASN A 1 69  ? 1.560   -12.557 39.392 1.00 43.29  ? 70  ASN A O   1 
ATOM   567  C CB  . ASN A 1 69  ? 3.335   -14.595 41.271 1.00 41.53  ? 70  ASN A CB  1 
ATOM   568  C CG  . ASN A 1 69  ? 4.267   -15.781 41.204 1.00 50.88  ? 70  ASN A CG  1 
ATOM   569  O OD1 . ASN A 1 69  ? 5.225   -15.785 40.434 1.00 48.21  ? 70  ASN A OD1 1 
ATOM   570  N ND2 . ASN A 1 69  ? 3.996   -16.794 42.015 1.00 59.19  ? 70  ASN A ND2 1 
ATOM   571  N N   . GLU A 1 70  ? 2.654   -11.562 41.091 1.00 38.82  ? 71  GLU A N   1 
ATOM   572  C CA  . GLU A 1 70  ? 1.691   -10.478 41.237 1.00 34.13  ? 71  GLU A CA  1 
ATOM   573  C C   . GLU A 1 70  ? 1.617   -9.634  39.970 1.00 35.30  ? 71  GLU A C   1 
ATOM   574  O O   . GLU A 1 70  ? 0.534   -9.222  39.547 1.00 39.44  ? 71  GLU A O   1 
ATOM   575  C CB  . GLU A 1 70  ? 2.055   -9.598  42.436 1.00 43.72  ? 71  GLU A CB  1 
ATOM   576  C CG  . GLU A 1 70  ? 0.879   -8.854  43.046 1.00 45.35  ? 71  GLU A CG  1 
ATOM   577  C CD  . GLU A 1 70  ? -0.083  -9.766  43.788 1.00 53.99  ? 71  GLU A CD  1 
ATOM   578  O OE1 . GLU A 1 70  ? 0.268   -10.937 44.041 1.00 52.82  ? 71  GLU A OE1 1 
ATOM   579  O OE2 . GLU A 1 70  ? -1.195  -9.307  44.123 1.00 57.94  ? 71  GLU A OE2 1 
ATOM   580  N N   . THR A 1 71  ? 2.777   -9.379  39.373 1.00 30.02  ? 72  THR A N   1 
ATOM   581  C CA  . THR A 1 71  ? 2.851   -8.629  38.125 1.00 33.92  ? 72  THR A CA  1 
ATOM   582  C C   . THR A 1 71  ? 2.132   -9.386  37.013 1.00 33.57  ? 72  THR A C   1 
ATOM   583  O O   . THR A 1 71  ? 1.484   -8.787  36.154 1.00 32.53  ? 72  THR A O   1 
ATOM   584  C CB  . THR A 1 71  ? 4.311   -8.367  37.718 1.00 34.85  ? 72  THR A CB  1 
ATOM   585  O OG1 . THR A 1 71  ? 4.998   -7.718  38.795 1.00 36.65  ? 72  THR A OG1 1 
ATOM   586  C CG2 . THR A 1 71  ? 4.385   -7.496  36.473 1.00 34.10  ? 72  THR A CG2 1 
ATOM   587  N N   . ARG A 1 72  ? 2.243   -10.709 37.052 1.00 32.48  ? 73  ARG A N   1 
ATOM   588  C CA  . ARG A 1 72  ? 1.629   -11.574 36.056 1.00 32.80  ? 73  ARG A CA  1 
ATOM   589  C C   . ARG A 1 72  ? 0.110   -11.611 36.225 1.00 33.38  ? 73  ARG A C   1 
ATOM   590  O O   . ARG A 1 72  ? -0.634  -11.691 35.243 1.00 32.90  ? 73  ARG A O   1 
ATOM   591  C CB  . ARG A 1 72  ? 2.224   -12.982 36.153 1.00 40.77  ? 73  ARG A CB  1 
ATOM   592  C CG  . ARG A 1 72  ? 1.886   -13.896 34.989 1.00 37.95  ? 73  ARG A CG  1 
ATOM   593  C CD  . ARG A 1 72  ? 2.923   -15.004 34.837 1.00 49.59  ? 73  ARG A CD  1 
ATOM   594  N NE  . ARG A 1 72  ? 3.253   -15.643 36.108 1.00 56.89  ? 73  ARG A NE  1 
ATOM   595  C CZ  . ARG A 1 72  ? 2.526   -16.597 36.679 1.00 58.39  ? 73  ARG A CZ  1 
ATOM   596  N NH1 . ARG A 1 72  ? 1.413   -17.023 36.102 1.00 45.54  ? 73  ARG A NH1 1 
ATOM   597  N NH2 . ARG A 1 72  ? 2.909   -17.120 37.834 1.00 56.68  ? 73  ARG A NH2 1 
ATOM   598  N N   . GLU A 1 73  ? -0.339  -11.545 37.475 1.00 35.16  ? 74  GLU A N   1 
ATOM   599  C CA  . GLU A 1 73  ? -1.763  -11.514 37.787 1.00 37.88  ? 74  GLU A CA  1 
ATOM   600  C C   . GLU A 1 73  ? -2.383  -10.176 37.393 1.00 34.65  ? 74  GLU A C   1 
ATOM   601  O O   . GLU A 1 73  ? -3.505  -10.125 36.885 1.00 33.25  ? 74  GLU A O   1 
ATOM   602  C CB  . GLU A 1 73  ? -1.983  -11.783 39.275 1.00 40.09  ? 74  GLU A CB  1 
ATOM   603  C CG  . GLU A 1 73  ? -3.434  -11.724 39.725 1.00 49.01  ? 74  GLU A CG  1 
ATOM   604  C CD  . GLU A 1 73  ? -4.178  -13.022 39.511 1.00 58.36  ? 74  GLU A CD  1 
ATOM   605  O OE1 . GLU A 1 73  ? -5.338  -13.118 39.958 1.00 57.70  ? 74  GLU A OE1 1 
ATOM   606  O OE2 . GLU A 1 73  ? -3.604  -13.945 38.901 1.00 53.63  ? 74  GLU A OE2 1 
ATOM   607  N N   . CYS A 1 74  ? -1.647  -9.095  37.636 1.00 35.86  ? 75  CYS A N   1 
ATOM   608  C CA  . CYS A 1 74  ? -2.074  -7.766  37.214 1.00 33.02  ? 75  CYS A CA  1 
ATOM   609  C C   . CYS A 1 74  ? -2.343  -7.718  35.720 1.00 35.51  ? 75  CYS A C   1 
ATOM   610  O O   . CYS A 1 74  ? -3.387  -7.237  35.281 1.00 37.70  ? 75  CYS A O   1 
ATOM   611  C CB  . CYS A 1 74  ? -1.021  -6.719  37.581 1.00 31.96  ? 75  CYS A CB  1 
ATOM   612  S SG  . CYS A 1 74  ? -1.292  -5.924  39.171 1.00 32.80  ? 75  CYS A SG  1 
ATOM   613  N N   . GLN A 1 75  ? -1.395  -8.228  34.944 1.00 31.36  ? 76  GLN A N   1 
ATOM   614  C CA  . GLN A 1 75  ? -1.509  -8.204  33.493 1.00 29.51  ? 76  GLN A CA  1 
ATOM   615  C C   . GLN A 1 75  ? -2.655  -9.072  32.986 1.00 27.30  ? 76  GLN A C   1 
ATOM   616  O O   . GLN A 1 75  ? -3.278  -8.745  31.977 1.00 34.75  ? 76  GLN A O   1 
ATOM   617  C CB  . GLN A 1 75  ? -0.195  -8.646  32.851 1.00 31.16  ? 76  GLN A CB  1 
ATOM   618  C CG  . GLN A 1 75  ? 0.872   -7.572  32.885 1.00 29.50  ? 76  GLN A CG  1 
ATOM   619  C CD  . GLN A 1 75  ? 2.272   -8.135  32.841 1.00 30.68  ? 76  GLN A CD  1 
ATOM   620  O OE1 . GLN A 1 75  ? 2.465   -9.349  32.820 1.00 32.22  ? 76  GLN A OE1 1 
ATOM   621  N NE2 . GLN A 1 75  ? 3.263   -7.251  32.834 1.00 35.37  ? 76  GLN A NE2 1 
ATOM   622  N N   . SER A 1 76  ? -2.940  -10.167 33.684 1.00 26.52  ? 77  SER A N   1 
ATOM   623  C CA  . SER A 1 76  ? -4.037  -11.042 33.283 1.00 27.84  ? 77  SER A CA  1 
ATOM   624  C C   . SER A 1 76  ? -5.378  -10.381 33.556 1.00 32.18  ? 77  SER A C   1 
ATOM   625  O O   . SER A 1 76  ? -6.333  -10.549 32.796 1.00 28.48  ? 77  SER A O   1 
ATOM   626  C CB  . SER A 1 76  ? -3.953  -12.387 34.003 1.00 33.36  ? 77  SER A CB  1 
ATOM   627  O OG  . SER A 1 76  ? -2.822  -13.123 33.565 1.00 41.22  ? 77  SER A OG  1 
ATOM   628  N N   . LEU A 1 77  ? -5.438  -9.628  34.648 1.00 35.80  ? 78  LEU A N   1 
ATOM   629  C CA  . LEU A 1 77  ? -6.640  -8.887  35.008 1.00 34.54  ? 78  LEU A CA  1 
ATOM   630  C C   . LEU A 1 77  ? -6.910  -7.744  34.042 1.00 32.89  ? 78  LEU A C   1 
ATOM   631  O O   . LEU A 1 77  ? -8.051  -7.493  33.669 1.00 31.95  ? 78  LEU A O   1 
ATOM   632  C CB  . LEU A 1 77  ? -6.522  -8.346  36.430 1.00 35.66  ? 78  LEU A CB  1 
ATOM   633  C CG  . LEU A 1 77  ? -6.813  -9.389  37.506 1.00 45.53  ? 78  LEU A CG  1 
ATOM   634  C CD1 . LEU A 1 77  ? -6.432  -8.876  38.881 1.00 40.64  ? 78  LEU A CD1 1 
ATOM   635  C CD2 . LEU A 1 77  ? -8.281  -9.768  37.465 1.00 41.67  ? 78  LEU A CD2 1 
ATOM   636  N N   . ARG A 1 78  ? -5.855  -7.048  33.637 1.00 27.93  ? 79  ARG A N   1 
ATOM   637  C CA  . ARG A 1 78  ? -6.011  -5.915  32.735 1.00 32.26  ? 79  ARG A CA  1 
ATOM   638  C C   . ARG A 1 78  ? -6.581  -6.356  31.397 1.00 37.19  ? 79  ARG A C   1 
ATOM   639  O O   . ARG A 1 78  ? -7.369  -5.639  30.784 1.00 26.09  ? 79  ARG A O   1 
ATOM   640  C CB  . ARG A 1 78  ? -4.677  -5.193  32.537 1.00 27.03  ? 79  ARG A CB  1 
ATOM   641  C CG  . ARG A 1 78  ? -4.279  -4.333  33.726 1.00 36.89  ? 79  ARG A CG  1 
ATOM   642  C CD  . ARG A 1 78  ? -3.097  -3.452  33.388 1.00 33.98  ? 79  ARG A CD  1 
ATOM   643  N NE  . ARG A 1 78  ? -2.366  -3.043  34.581 1.00 50.26  ? 79  ARG A NE  1 
ATOM   644  C CZ  . ARG A 1 78  ? -1.288  -3.669  35.043 1.00 43.86  ? 79  ARG A CZ  1 
ATOM   645  N NH1 . ARG A 1 78  ? -0.814  -4.735  34.409 1.00 42.90  ? 79  ARG A NH1 1 
ATOM   646  N NH2 . ARG A 1 78  ? -0.681  -3.233  36.138 1.00 39.15  ? 79  ARG A NH2 1 
ATOM   647  N N   . LEU A 1 79  ? -6.196  -7.549  30.957 1.00 29.11  ? 80  LEU A N   1 
ATOM   648  C CA  . LEU A 1 79  ? -6.687  -8.080  29.693 1.00 30.86  ? 80  LEU A CA  1 
ATOM   649  C C   . LEU A 1 79  ? -8.178  -8.403  29.752 1.00 30.64  ? 80  LEU A C   1 
ATOM   650  O O   . LEU A 1 79  ? -8.921  -8.058  28.833 1.00 30.40  ? 80  LEU A O   1 
ATOM   651  C CB  . LEU A 1 79  ? -5.906  -9.329  29.286 1.00 36.06  ? 80  LEU A CB  1 
ATOM   652  C CG  . LEU A 1 79  ? -6.349  -9.948  27.958 1.00 34.69  ? 80  LEU A CG  1 
ATOM   653  C CD1 . LEU A 1 79  ? -6.191  -8.948  26.822 1.00 35.37  ? 80  LEU A CD1 1 
ATOM   654  C CD2 . LEU A 1 79  ? -5.582  -11.228 27.658 1.00 27.76  ? 80  LEU A CD2 1 
ATOM   655  N N   . GLU A 1 80  ? -8.623  -9.064  30.819 1.00 31.78  ? 81  GLU A N   1 
ATOM   656  C CA  . GLU A 1 80  ? -10.031 -9.440  30.907 1.00 27.16  ? 81  GLU A CA  1 
ATOM   657  C C   . GLU A 1 80  ? -10.898 -8.216  31.186 1.00 31.60  ? 81  GLU A C   1 
ATOM   658  O O   . GLU A 1 80  ? -12.076 -8.193  30.831 1.00 34.06  ? 81  GLU A O   1 
ATOM   659  C CB  . GLU A 1 80  ? -10.260 -10.529 31.968 1.00 32.64  ? 81  GLU A CB  1 
ATOM   660  C CG  . GLU A 1 80  ? -9.426  -10.416 33.235 1.00 41.23  ? 81  GLU A CG  1 
ATOM   661  C CD  . GLU A 1 80  ? -9.584  -11.628 34.145 1.00 45.02  ? 81  GLU A CD  1 
ATOM   662  O OE1 . GLU A 1 80  ? -8.760  -11.795 35.068 1.00 47.36  ? 81  GLU A OE1 1 
ATOM   663  O OE2 . GLU A 1 80  ? -10.534 -12.414 33.939 1.00 53.79  ? 81  GLU A OE2 1 
ATOM   664  N N   . LEU A 1 81  ? -10.314 -7.194  31.801 1.00 32.47  ? 82  LEU A N   1 
ATOM   665  C CA  . LEU A 1 81  ? -11.021 -5.933  31.975 1.00 29.98  ? 82  LEU A CA  1 
ATOM   666  C C   . LEU A 1 81  ? -11.254 -5.263  30.622 1.00 29.30  ? 82  LEU A C   1 
ATOM   667  O O   . LEU A 1 81  ? -12.356 -4.784  30.345 1.00 30.52  ? 82  LEU A O   1 
ATOM   668  C CB  . LEU A 1 81  ? -10.251 -5.002  32.912 1.00 32.12  ? 82  LEU A CB  1 
ATOM   669  C CG  . LEU A 1 81  ? -10.557 -5.213  34.396 1.00 33.82  ? 82  LEU A CG  1 
ATOM   670  C CD1 . LEU A 1 81  ? -9.385  -4.800  35.262 1.00 34.57  ? 82  LEU A CD1 1 
ATOM   671  C CD2 . LEU A 1 81  ? -11.811 -4.447  34.794 1.00 39.49  ? 82  LEU A CD2 1 
ATOM   672  N N   . GLU A 1 82  ? -10.223 -5.247  29.780 1.00 25.49  ? 83  GLU A N   1 
ATOM   673  C CA  . GLU A 1 82  ? -10.321 -4.631  28.460 1.00 24.96  ? 83  GLU A CA  1 
ATOM   674  C C   . GLU A 1 82  ? -11.345 -5.355  27.586 1.00 29.73  ? 83  GLU A C   1 
ATOM   675  O O   . GLU A 1 82  ? -12.117 -4.719  26.870 1.00 26.41  ? 83  GLU A O   1 
ATOM   676  C CB  . GLU A 1 82  ? -8.950  -4.609  27.773 1.00 27.73  ? 83  GLU A CB  1 
ATOM   677  C CG  . GLU A 1 82  ? -8.903  -3.784  26.486 1.00 33.19  ? 83  GLU A CG  1 
ATOM   678  C CD  . GLU A 1 82  ? -7.486  -3.506  26.007 1.00 43.24  ? 83  GLU A CD  1 
ATOM   679  O OE1 . GLU A 1 82  ? -6.684  -2.958  26.791 1.00 43.48  ? 83  GLU A OE1 1 
ATOM   680  O OE2 . GLU A 1 82  ? -7.172  -3.832  24.843 1.00 38.68  ? 83  GLU A OE2 1 
ATOM   681  N N   . LYS A 1 83  ? -11.357 -6.682  27.650 1.00 28.64  ? 84  LYS A N   1 
ATOM   682  C CA  . LYS A 1 83  ? -12.315 -7.454  26.869 1.00 21.26  ? 84  LYS A CA  1 
ATOM   683  C C   . LYS A 1 83  ? -13.745 -7.260  27.376 1.00 30.53  ? 84  LYS A C   1 
ATOM   684  O O   . LYS A 1 83  ? -14.671 -7.123  26.579 1.00 34.22  ? 84  LYS A O   1 
ATOM   685  C CB  . LYS A 1 83  ? -11.938 -8.940  26.869 1.00 26.66  ? 84  LYS A CB  1 
ATOM   686  C CG  . LYS A 1 83  ? -10.659 -9.228  26.087 1.00 35.26  ? 84  LYS A CG  1 
ATOM   687  C CD  . LYS A 1 83  ? -10.320 -10.709 26.005 1.00 33.97  ? 84  LYS A CD  1 
ATOM   688  C CE  . LYS A 1 83  ? -9.043  -10.909 25.193 1.00 34.10  ? 84  LYS A CE  1 
ATOM   689  N NZ  . LYS A 1 83  ? -8.504  -12.295 25.273 1.00 38.07  ? 84  LYS A NZ  1 
ATOM   690  N N   . LEU A 1 84  ? -13.930 -7.225  28.693 1.00 27.28  ? 85  LEU A N   1 
ATOM   691  C CA  . LEU A 1 84  ? -15.275 -7.085  29.249 1.00 31.45  ? 85  LEU A CA  1 
ATOM   692  C C   . LEU A 1 84  ? -15.826 -5.673  29.080 1.00 35.17  ? 85  LEU A C   1 
ATOM   693  O O   . LEU A 1 84  ? -17.036 -5.490  28.926 1.00 36.17  ? 85  LEU A O   1 
ATOM   694  C CB  . LEU A 1 84  ? -15.303 -7.474  30.728 1.00 25.59  ? 85  LEU A CB  1 
ATOM   695  C CG  . LEU A 1 84  ? -15.221 -8.970  31.036 1.00 31.13  ? 85  LEU A CG  1 
ATOM   696  C CD1 . LEU A 1 84  ? -15.545 -9.225  32.497 1.00 36.95  ? 85  LEU A CD1 1 
ATOM   697  C CD2 . LEU A 1 84  ? -16.151 -9.774  30.139 1.00 31.48  ? 85  LEU A CD2 1 
ATOM   698  N N   . ASN A 1 85  ? -14.945 -4.676  29.112 1.00 27.09  ? 86  ASN A N   1 
ATOM   699  C CA  . ASN A 1 85  ? -15.365 -3.297  28.889 1.00 31.75  ? 86  ASN A CA  1 
ATOM   700  C C   . ASN A 1 85  ? -15.921 -3.110  27.478 1.00 33.05  ? 86  ASN A C   1 
ATOM   701  O O   . ASN A 1 85  ? -16.829 -2.307  27.262 1.00 35.87  ? 86  ASN A O   1 
ATOM   702  C CB  . ASN A 1 85  ? -14.204 -2.330  29.139 1.00 24.87  ? 86  ASN A CB  1 
ATOM   703  C CG  . ASN A 1 85  ? -14.072 -1.939  30.602 1.00 38.35  ? 86  ASN A CG  1 
ATOM   704  O OD1 . ASN A 1 85  ? -15.058 -1.605  31.259 1.00 44.01  ? 86  ASN A OD1 1 
ATOM   705  N ND2 . ASN A 1 85  ? -12.849 -1.976  31.118 1.00 27.10  ? 86  ASN A ND2 1 
ATOM   706  N N   . ASN A 1 86  ? -15.371 -3.853  26.521 1.00 31.23  ? 87  ASN A N   1 
ATOM   707  C CA  . ASN A 1 86  ? -15.884 -3.842  25.155 1.00 32.40  ? 87  ASN A CA  1 
ATOM   708  C C   . ASN A 1 86  ? -17.200 -4.602  25.078 1.00 34.96  ? 87  ASN A C   1 
ATOM   709  O O   . ASN A 1 86  ? -18.118 -4.209  24.359 1.00 32.95  ? 87  ASN A O   1 
ATOM   710  C CB  . ASN A 1 86  ? -14.870 -4.445  24.181 1.00 30.79  ? 87  ASN A CB  1 
ATOM   711  C CG  . ASN A 1 86  ? -13.686 -3.528  23.922 1.00 44.52  ? 87  ASN A CG  1 
ATOM   712  O OD1 . ASN A 1 86  ? -13.775 -2.314  24.096 1.00 46.73  ? 87  ASN A OD1 1 
ATOM   713  N ND2 . ASN A 1 86  ? -12.569 -4.109  23.497 1.00 35.70  ? 87  ASN A ND2 1 
ATOM   714  N N   . GLN A 1 87  ? -17.276 -5.698  25.827 1.00 32.77  ? 88  GLN A N   1 
ATOM   715  C CA  . GLN A 1 87  ? -18.510 -6.459  25.960 1.00 35.27  ? 88  GLN A CA  1 
ATOM   716  C C   . GLN A 1 87  ? -19.623 -5.591  26.523 1.00 31.53  ? 88  GLN A C   1 
ATOM   717  O O   . GLN A 1 87  ? -20.758 -5.621  26.037 1.00 26.64  ? 88  GLN A O   1 
ATOM   718  C CB  . GLN A 1 87  ? -18.310 -7.671  26.866 1.00 39.05  ? 88  GLN A CB  1 
ATOM   719  C CG  . GLN A 1 87  ? -17.866 -8.929  26.158 1.00 38.87  ? 88  GLN A CG  1 
ATOM   720  C CD  . GLN A 1 87  ? -18.262 -10.177 26.918 1.00 46.98  ? 88  GLN A CD  1 
ATOM   721  O OE1 . GLN A 1 87  ? -19.294 -10.205 27.589 1.00 43.44  ? 88  GLN A OE1 1 
ATOM   722  N NE2 . GLN A 1 87  ? -17.441 -11.215 26.823 1.00 51.29  ? 88  GLN A NE2 1 
ATOM   723  N N   . LEU A 1 88  ? -19.293 -4.822  27.556 1.00 30.28  ? 89  LEU A N   1 
ATOM   724  C CA  . LEU A 1 88  ? -20.282 -3.990  28.225 1.00 32.51  ? 89  LEU A CA  1 
ATOM   725  C C   . LEU A 1 88  ? -20.773 -2.869  27.319 1.00 36.48  ? 89  LEU A C   1 
ATOM   726  O O   . LEU A 1 88  ? -21.971 -2.603  27.251 1.00 35.08  ? 89  LEU A O   1 
ATOM   727  C CB  . LEU A 1 88  ? -19.705 -3.405  29.511 1.00 32.50  ? 89  LEU A CB  1 
ATOM   728  C CG  . LEU A 1 88  ? -20.692 -2.607  30.363 1.00 29.82  ? 89  LEU A CG  1 
ATOM   729  C CD1 . LEU A 1 88  ? -21.678 -3.537  31.058 1.00 35.70  ? 89  LEU A CD1 1 
ATOM   730  C CD2 . LEU A 1 88  ? -19.966 -1.727  31.371 1.00 38.70  ? 89  LEU A CD2 1 
ATOM   731  N N   . LYS A 1 89  ? -19.841 -2.217  26.627 1.00 31.75  ? 90  LYS A N   1 
ATOM   732  C CA  . LYS A 1 89  ? -20.178 -1.083  25.773 1.00 33.24  ? 90  LYS A CA  1 
ATOM   733  C C   . LYS A 1 89  ? -21.220 -1.489  24.738 1.00 36.99  ? 90  LYS A C   1 
ATOM   734  O O   . LYS A 1 89  ? -22.183 -0.758  24.496 1.00 40.50  ? 90  LYS A O   1 
ATOM   735  C CB  . LYS A 1 89  ? -18.934 -0.528  25.074 1.00 40.03  ? 90  LYS A CB  1 
ATOM   736  C CG  . LYS A 1 89  ? -19.065 0.931   24.652 1.00 46.79  ? 90  LYS A CG  1 
ATOM   737  C CD  . LYS A 1 89  ? -18.191 1.248   23.446 1.00 50.99  ? 90  LYS A CD  1 
ATOM   738  C CE  . LYS A 1 89  ? -16.741 0.857   23.681 1.00 51.15  ? 90  LYS A CE  1 
ATOM   739  N NZ  . LYS A 1 89  ? -15.961 0.837   22.410 1.00 40.37  ? 90  LYS A NZ  1 
ATOM   740  N N   . ALA A 1 90  ? -21.030 -2.666  24.146 1.00 30.68  ? 91  ALA A N   1 
ATOM   741  C CA  . ALA A 1 90  ? -21.971 -3.187  23.166 1.00 32.78  ? 91  ALA A CA  1 
ATOM   742  C C   . ALA A 1 90  ? -23.292 -3.589  23.816 1.00 36.35  ? 91  ALA A C   1 
ATOM   743  O O   . ALA A 1 90  ? -24.347 -3.499  23.186 1.00 34.50  ? 91  ALA A O   1 
ATOM   744  C CB  . ALA A 1 90  ? -21.363 -4.370  22.425 1.00 27.75  ? 91  ALA A CB  1 
ATOM   745  N N   . LEU A 1 91  ? -23.238 -4.034  25.069 1.00 34.82  ? 92  LEU A N   1 
ATOM   746  C CA  . LEU A 1 91  ? -24.455 -4.436  25.767 1.00 28.96  ? 92  LEU A CA  1 
ATOM   747  C C   . LEU A 1 91  ? -25.258 -3.213  26.209 1.00 29.91  ? 92  LEU A C   1 
ATOM   748  O O   . LEU A 1 91  ? -26.487 -3.263  26.278 1.00 33.99  ? 92  LEU A O   1 
ATOM   749  C CB  . LEU A 1 91  ? -24.126 -5.324  26.969 1.00 31.53  ? 92  LEU A CB  1 
ATOM   750  C CG  . LEU A 1 91  ? -25.238 -6.293  27.388 1.00 36.27  ? 92  LEU A CG  1 
ATOM   751  C CD1 . LEU A 1 91  ? -25.486 -7.335  26.306 1.00 33.39  ? 92  LEU A CD1 1 
ATOM   752  C CD2 . LEU A 1 91  ? -24.911 -6.967  28.707 1.00 40.29  ? 92  LEU A CD2 1 
ATOM   753  N N   . THR A 1 92  ? -24.559 -2.121  26.509 1.00 36.48  ? 93  THR A N   1 
ATOM   754  C CA  . THR A 1 92  ? -25.217 -0.856  26.814 1.00 31.68  ? 93  THR A CA  1 
ATOM   755  C C   . THR A 1 92  ? -25.926 -0.317  25.574 1.00 41.58  ? 93  THR A C   1 
ATOM   756  O O   . THR A 1 92  ? -27.096 0.069   25.634 1.00 49.51  ? 93  THR A O   1 
ATOM   757  C CB  . THR A 1 92  ? -24.220 0.204   27.332 1.00 35.36  ? 93  THR A CB  1 
ATOM   758  O OG1 . THR A 1 92  ? -23.101 0.288   26.442 1.00 47.17  ? 93  THR A OG1 1 
ATOM   759  C CG2 . THR A 1 92  ? -23.720 -0.153  28.727 1.00 25.58  ? 93  THR A CG2 1 
ATOM   760  N N   . GLU A 1 93  ? -25.212 -0.299  24.450 1.00 39.11  ? 94  GLU A N   1 
ATOM   761  C CA  . GLU A 1 93  ? -25.762 0.181   23.183 1.00 40.08  ? 94  GLU A CA  1 
ATOM   762  C C   . GLU A 1 93  ? -27.023 -0.570  22.783 1.00 41.43  ? 94  GLU A C   1 
ATOM   763  O O   . GLU A 1 93  ? -28.010 0.030   22.356 1.00 48.83  ? 94  GLU A O   1 
ATOM   764  C CB  . GLU A 1 93  ? -24.723 0.055   22.070 1.00 38.24  ? 94  GLU A CB  1 
ATOM   765  C CG  . GLU A 1 93  ? -23.644 1.116   22.093 1.00 51.41  ? 94  GLU A CG  1 
ATOM   766  C CD  . GLU A 1 93  ? -24.093 2.423   21.469 1.00 63.96  ? 94  GLU A CD  1 
ATOM   767  O OE1 . GLU A 1 93  ? -25.070 3.024   21.963 1.00 63.06  ? 94  GLU A OE1 1 
ATOM   768  O OE2 . GLU A 1 93  ? -23.470 2.848   20.473 1.00 70.69  ? 94  GLU A OE2 1 
ATOM   769  N N   . LYS A 1 94  ? -26.967 -1.890  22.914 1.00 39.94  ? 95  LYS A N   1 
ATOM   770  C CA  . LYS A 1 94  ? -28.103 -2.745  22.615 1.00 37.35  ? 95  LYS A CA  1 
ATOM   771  C C   . LYS A 1 94  ? -29.261 -2.434  23.557 1.00 42.26  ? 95  LYS A C   1 
ATOM   772  O O   . LYS A 1 94  ? -30.423 -2.425  23.149 1.00 37.65  ? 95  LYS A O   1 
ATOM   773  C CB  . LYS A 1 94  ? -27.691 -4.217  22.713 1.00 30.35  ? 95  LYS A CB  1 
ATOM   774  C CG  . LYS A 1 94  ? -28.842 -5.196  22.862 1.00 30.02  ? 95  LYS A CG  1 
ATOM   775  C CD  . LYS A 1 94  ? -28.376 -6.632  22.668 1.00 36.26  ? 95  LYS A CD  1 
ATOM   776  C CE  . LYS A 1 94  ? -27.823 -6.853  21.268 1.00 36.46  ? 95  LYS A CE  1 
ATOM   777  N NZ  . LYS A 1 94  ? -27.598 -8.300  20.988 1.00 35.04  ? 95  LYS A NZ  1 
ATOM   778  N N   . ASN A 1 95  ? -28.930 -2.160  24.815 1.00 31.08  ? 96  ASN A N   1 
ATOM   779  C CA  . ASN A 1 95  ? -29.929 -1.830  25.823 1.00 36.28  ? 96  ASN A CA  1 
ATOM   780  C C   . ASN A 1 95  ? -30.619 -0.505  25.535 1.00 42.05  ? 96  ASN A C   1 
ATOM   781  O O   . ASN A 1 95  ? -31.846 -0.415  25.568 1.00 39.00  ? 96  ASN A O   1 
ATOM   782  C CB  . ASN A 1 95  ? -29.295 -1.783  27.214 1.00 37.22  ? 96  ASN A CB  1 
ATOM   783  C CG  . ASN A 1 95  ? -30.270 -1.323  28.286 1.00 38.41  ? 96  ASN A CG  1 
ATOM   784  O OD1 . ASN A 1 95  ? -30.272 -0.156  28.679 1.00 41.44  ? 96  ASN A OD1 1 
ATOM   785  N ND2 . ASN A 1 95  ? -31.099 -2.243  28.768 1.00 32.71  ? 96  ASN A ND2 1 
ATOM   786  N N   . LYS A 1 96  ? -29.825 0.523   25.250 1.00 46.27  ? 97  LYS A N   1 
ATOM   787  C CA  . LYS A 1 96  ? -30.366 1.860   25.048 1.00 45.16  ? 97  LYS A CA  1 
ATOM   788  C C   . LYS A 1 96  ? -31.118 1.978   23.728 1.00 42.33  ? 97  LYS A C   1 
ATOM   789  O O   . LYS A 1 96  ? -31.852 2.944   23.516 1.00 47.48  ? 97  LYS A O   1 
ATOM   790  C CB  . LYS A 1 96  ? -29.255 2.912   25.118 1.00 43.77  ? 97  LYS A CB  1 
ATOM   791  C CG  . LYS A 1 96  ? -28.955 3.405   26.533 1.00 48.05  ? 97  LYS A CG  1 
ATOM   792  C CD  . LYS A 1 96  ? -28.226 2.357   27.357 1.00 45.68  ? 97  LYS A CD  1 
ATOM   793  C CE  . LYS A 1 96  ? -28.016 2.807   28.795 1.00 40.89  ? 97  LYS A CE  1 
ATOM   794  N NZ  . LYS A 1 96  ? -29.270 2.720   29.592 1.00 56.44  ? 97  LYS A NZ  1 
ATOM   795  N N   . GLU A 1 97  ? -30.919 1.020   22.828 1.00 41.35  ? 98  GLU A N   1 
ATOM   796  C CA  . GLU A 1 97  ? -31.753 0.949   21.633 1.00 39.42  ? 98  GLU A CA  1 
ATOM   797  C C   . GLU A 1 97  ? -33.010 0.114   21.876 1.00 40.53  ? 98  GLU A C   1 
ATOM   798  O O   . GLU A 1 97  ? -33.989 0.221   21.140 1.00 39.72  ? 98  GLU A O   1 
ATOM   799  C CB  . GLU A 1 97  ? -30.944 0.405   20.455 1.00 43.93  ? 98  GLU A CB  1 
ATOM   800  C CG  . GLU A 1 97  ? -30.173 1.506   19.736 1.00 58.90  ? 98  GLU A CG  1 
ATOM   801  C CD  . GLU A 1 97  ? -28.935 1.012   19.018 1.00 73.18  ? 98  GLU A CD  1 
ATOM   802  O OE1 . GLU A 1 97  ? -28.810 -0.209  18.803 1.00 70.55  ? 98  GLU A OE1 1 
ATOM   803  O OE2 . GLU A 1 97  ? -28.080 1.854   18.672 1.00 73.88  ? 98  GLU A OE2 1 
ATOM   804  N N   . LEU A 1 98  ? -32.988 -0.693  22.931 1.00 42.37  ? 99  LEU A N   1 
ATOM   805  C CA  . LEU A 1 98  ? -34.188 -1.387  23.374 1.00 34.71  ? 99  LEU A CA  1 
ATOM   806  C C   . LEU A 1 98  ? -35.057 -0.409  24.144 1.00 40.99  ? 99  LEU A C   1 
ATOM   807  O O   . LEU A 1 98  ? -36.281 -0.527  24.167 1.00 33.59  ? 99  LEU A O   1 
ATOM   808  C CB  . LEU A 1 98  ? -33.834 -2.599  24.233 1.00 30.57  ? 99  LEU A CB  1 
ATOM   809  C CG  . LEU A 1 98  ? -33.314 -3.795  23.436 1.00 27.98  ? 99  LEU A CG  1 
ATOM   810  C CD1 . LEU A 1 98  ? -32.721 -4.832  24.368 1.00 24.28  ? 99  LEU A CD1 1 
ATOM   811  C CD2 . LEU A 1 98  ? -34.445 -4.392  22.624 1.00 29.92  ? 99  LEU A CD2 1 
ATOM   812  N N   . GLU A 1 99  ? -34.401 0.562   24.774 1.00 38.32  ? 100 GLU A N   1 
ATOM   813  C CA  . GLU A 1 99  ? -35.090 1.651   25.454 1.00 38.39  ? 100 GLU A CA  1 
ATOM   814  C C   . GLU A 1 99  ? -35.876 2.467   24.445 1.00 36.60  ? 100 GLU A C   1 
ATOM   815  O O   . GLU A 1 99  ? -37.051 2.763   24.648 1.00 38.47  ? 100 GLU A O   1 
ATOM   816  C CB  . GLU A 1 99  ? -34.101 2.557   26.192 1.00 43.36  ? 100 GLU A CB  1 
ATOM   817  C CG  . GLU A 1 99  ? -33.290 1.866   27.266 1.00 43.87  ? 100 GLU A CG  1 
ATOM   818  C CD  . GLU A 1 99  ? -34.139 1.404   28.429 1.00 50.83  ? 100 GLU A CD  1 
ATOM   819  O OE1 . GLU A 1 99  ? -35.214 1.997   28.657 1.00 54.24  ? 100 GLU A OE1 1 
ATOM   820  O OE2 . GLU A 1 99  ? -33.728 0.445   29.113 1.00 60.07  ? 100 GLU A OE2 1 
ATOM   821  N N   . ILE A 1 100 ? -35.200 2.835   23.361 1.00 36.25  ? 101 ILE A N   1 
ATOM   822  C CA  . ILE A 1 100 ? -35.815 3.551   22.249 1.00 31.36  ? 101 ILE A CA  1 
ATOM   823  C C   . ILE A 1 100 ? -37.061 2.824   21.754 1.00 34.85  ? 101 ILE A C   1 
ATOM   824  O O   . ILE A 1 100 ? -38.119 3.431   21.570 1.00 36.32  ? 101 ILE A O   1 
ATOM   825  C CB  . ILE A 1 100 ? -34.812 3.722   21.086 1.00 34.76  ? 101 ILE A CB  1 
ATOM   826  C CG1 . ILE A 1 100 ? -33.800 4.820   21.405 1.00 35.69  ? 101 ILE A CG1 1 
ATOM   827  C CG2 . ILE A 1 100 ? -35.497 4.130   19.841 1.00 42.66  ? 101 ILE A CG2 1 
ATOM   828  C CD1 . ILE A 1 100 ? -32.666 4.906   20.403 1.00 33.47  ? 101 ILE A CD1 1 
ATOM   829  N N   . ALA A 1 101 ? -36.925 1.515   21.562 1.00 37.72  ? 102 ALA A N   1 
ATOM   830  C CA  . ALA A 1 101 ? -38.017 0.681   21.073 1.00 35.56  ? 102 ALA A CA  1 
ATOM   831  C C   . ALA A 1 101 ? -39.183 0.667   22.048 1.00 34.62  ? 102 ALA A C   1 
ATOM   832  O O   . ALA A 1 101 ? -40.345 0.713   21.642 1.00 36.98  ? 102 ALA A O   1 
ATOM   833  C CB  . ALA A 1 101 ? -37.529 -0.733  20.820 1.00 36.99  ? 102 ALA A CB  1 
ATOM   834  N N   . GLN A 1 102 ? -38.863 0.598   23.335 1.00 33.98  ? 103 GLN A N   1 
ATOM   835  C CA  . GLN A 1 102 ? -39.885 0.574   24.364 1.00 31.65  ? 103 GLN A CA  1 
ATOM   836  C C   . GLN A 1 102 ? -40.696 1.859   24.341 1.00 28.80  ? 103 GLN A C   1 
ATOM   837  O O   . GLN A 1 102 ? -41.925 1.819   24.351 1.00 29.85  ? 103 GLN A O   1 
ATOM   838  C CB  . GLN A 1 102 ? -39.263 0.368   25.741 1.00 31.47  ? 103 GLN A CB  1 
ATOM   839  C CG  . GLN A 1 102 ? -40.278 0.357   26.869 1.00 30.72  ? 103 GLN A CG  1 
ATOM   840  C CD  . GLN A 1 102 ? -39.646 0.048   28.207 1.00 43.84  ? 103 GLN A CD  1 
ATOM   841  O OE1 . GLN A 1 102 ? -38.676 0.685   28.611 1.00 43.25  ? 103 GLN A OE1 1 
ATOM   842  N NE2 . GLN A 1 102 ? -40.188 -0.942  28.901 1.00 48.29  ? 103 GLN A NE2 1 
ATOM   843  N N   . ASP A 1 103 ? -40.008 2.995   24.299 1.00 30.90  ? 104 ASP A N   1 
ATOM   844  C CA  . ASP A 1 103 ? -40.684 4.284   24.272 1.00 26.88  ? 104 ASP A CA  1 
ATOM   845  C C   . ASP A 1 103 ? -41.560 4.429   23.025 1.00 30.59  ? 104 ASP A C   1 
ATOM   846  O O   . ASP A 1 103 ? -42.666 4.968   23.105 1.00 26.25  ? 104 ASP A O   1 
ATOM   847  C CB  . ASP A 1 103 ? -39.668 5.426   24.349 1.00 31.86  ? 104 ASP A CB  1 
ATOM   848  C CG  . ASP A 1 103 ? -38.830 5.377   25.617 1.00 41.02  ? 104 ASP A CG  1 
ATOM   849  O OD1 . ASP A 1 103 ? -39.351 4.938   26.665 1.00 37.45  ? 104 ASP A OD1 1 
ATOM   850  O OD2 . ASP A 1 103 ? -37.648 5.776   25.566 1.00 42.52  ? 104 ASP A OD2 1 
ATOM   851  N N   . ARG A 1 104 ? -41.075 3.946   21.882 1.00 28.45  ? 105 ARG A N   1 
ATOM   852  C CA  . ARG A 1 104 ? -41.868 3.975   20.652 1.00 22.75  ? 105 ARG A CA  1 
ATOM   853  C C   . ARG A 1 104 ? -43.185 3.227   20.830 1.00 29.67  ? 105 ARG A C   1 
ATOM   854  O O   . ARG A 1 104 ? -44.250 3.723   20.470 1.00 26.99  ? 105 ARG A O   1 
ATOM   855  C CB  . ARG A 1 104 ? -41.085 3.375   19.482 1.00 24.89  ? 105 ARG A CB  1 
ATOM   856  C CG  . ARG A 1 104 ? -40.490 4.408   18.532 1.00 33.49  ? 105 ARG A CG  1 
ATOM   857  C CD  . ARG A 1 104 ? -40.294 3.826   17.138 1.00 42.56  ? 105 ARG A CD  1 
ATOM   858  N NE  . ARG A 1 104 ? -40.139 4.870   16.129 1.00 42.47  ? 105 ARG A NE  1 
ATOM   859  C CZ  . ARG A 1 104 ? -38.974 5.255   15.620 1.00 45.07  ? 105 ARG A CZ  1 
ATOM   860  N NH1 . ARG A 1 104 ? -37.851 4.676   16.019 1.00 48.29  ? 105 ARG A NH1 1 
ATOM   861  N NH2 . ARG A 1 104 ? -38.931 6.216   14.707 1.00 42.89  ? 105 ARG A NH2 1 
ATOM   862  N N   . ASN A 1 105 ? -43.102 2.030   21.398 1.00 25.17  ? 106 ASN A N   1 
ATOM   863  C CA  . ASN A 1 105 ? -44.291 1.228   21.652 1.00 25.05  ? 106 ASN A CA  1 
ATOM   864  C C   . ASN A 1 105 ? -45.216 1.900   22.660 1.00 28.87  ? 106 ASN A C   1 
ATOM   865  O O   . ASN A 1 105 ? -46.437 1.855   22.514 1.00 30.77  ? 106 ASN A O   1 
ATOM   866  C CB  . ASN A 1 105 ? -43.902 -0.168  22.137 1.00 27.32  ? 106 ASN A CB  1 
ATOM   867  C CG  . ASN A 1 105 ? -43.363 -1.038  21.019 1.00 36.58  ? 106 ASN A CG  1 
ATOM   868  O OD1 . ASN A 1 105 ? -43.759 -0.894  19.861 1.00 40.76  ? 106 ASN A OD1 1 
ATOM   869  N ND2 . ASN A 1 105 ? -42.453 -1.945  21.358 1.00 31.77  ? 106 ASN A ND2 1 
ATOM   870  N N   . ILE A 1 106 ? -44.634 2.535   23.672 1.00 28.03  ? 107 ILE A N   1 
ATOM   871  C CA  . ILE A 1 106 ? -45.425 3.269   24.652 1.00 27.04  ? 107 ILE A CA  1 
ATOM   872  C C   . ILE A 1 106 ? -46.127 4.460   23.997 1.00 23.34  ? 107 ILE A C   1 
ATOM   873  O O   . ILE A 1 106 ? -47.260 4.793   24.360 1.00 26.61  ? 107 ILE A O   1 
ATOM   874  C CB  . ILE A 1 106 ? -44.564 3.758   25.834 1.00 33.47  ? 107 ILE A CB  1 
ATOM   875  C CG1 . ILE A 1 106 ? -43.919 2.569   26.546 1.00 31.42  ? 107 ILE A CG1 1 
ATOM   876  C CG2 . ILE A 1 106 ? -45.404 4.543   26.826 1.00 24.88  ? 107 ILE A CG2 1 
ATOM   877  C CD1 . ILE A 1 106 ? -44.904 1.495   26.953 1.00 44.48  ? 107 ILE A CD1 1 
ATOM   878  N N   . ALA A 1 107 ? -45.467 5.094   23.031 1.00 21.48  ? 108 ALA A N   1 
ATOM   879  C CA  . ALA A 1 107 ? -46.077 6.209   22.313 1.00 22.16  ? 108 ALA A CA  1 
ATOM   880  C C   . ALA A 1 107 ? -47.229 5.723   21.445 1.00 25.24  ? 108 ALA A C   1 
ATOM   881  O O   . ALA A 1 107 ? -48.312 6.307   21.449 1.00 26.43  ? 108 ALA A O   1 
ATOM   882  C CB  . ALA A 1 107 ? -45.044 6.930   21.466 1.00 19.23  ? 108 ALA A CB  1 
ATOM   883  N N   . ILE A 1 108 ? -46.978 4.655   20.697 1.00 28.78  ? 109 ILE A N   1 
ATOM   884  C CA  . ILE A 1 108 ? -47.971 4.098   19.791 1.00 21.67  ? 109 ILE A CA  1 
ATOM   885  C C   . ILE A 1 108 ? -49.225 3.675   20.551 1.00 27.95  ? 109 ILE A C   1 
ATOM   886  O O   . ILE A 1 108 ? -50.336 4.086   20.210 1.00 25.28  ? 109 ILE A O   1 
ATOM   887  C CB  . ILE A 1 108 ? -47.402 2.897   19.008 1.00 24.83  ? 109 ILE A CB  1 
ATOM   888  C CG1 . ILE A 1 108 ? -46.381 3.377   17.974 1.00 26.55  ? 109 ILE A CG1 1 
ATOM   889  C CG2 . ILE A 1 108 ? -48.513 2.128   18.308 1.00 30.51  ? 109 ILE A CG2 1 
ATOM   890  C CD1 . ILE A 1 108 ? -45.812 2.270   17.116 1.00 29.92  ? 109 ILE A CD1 1 
ATOM   891  N N   . GLN A 1 109 ? -49.037 2.876   21.596 1.00 27.71  ? 110 GLN A N   1 
ATOM   892  C CA  . GLN A 1 109 ? -50.154 2.351   22.376 1.00 28.75  ? 110 GLN A CA  1 
ATOM   893  C C   . GLN A 1 109 ? -50.978 3.447   23.040 1.00 24.12  ? 110 GLN A C   1 
ATOM   894  O O   . GLN A 1 109 ? -52.199 3.341   23.131 1.00 25.62  ? 110 GLN A O   1 
ATOM   895  C CB  . GLN A 1 109 ? -49.642 1.363   23.422 1.00 30.67  ? 110 GLN A CB  1 
ATOM   896  C CG  . GLN A 1 109 ? -49.388 -0.012  22.842 1.00 38.09  ? 110 GLN A CG  1 
ATOM   897  C CD  . GLN A 1 109 ? -48.419 -0.833  23.664 1.00 36.83  ? 110 GLN A CD  1 
ATOM   898  O OE1 . GLN A 1 109 ? -47.477 -1.416  23.129 1.00 29.93  ? 110 GLN A OE1 1 
ATOM   899  N NE2 . GLN A 1 109 ? -48.646 -0.891  24.970 1.00 28.52  ? 110 GLN A NE2 1 
ATOM   900  N N   . SER A 1 110 ? -50.311 4.501   23.496 1.00 24.10  ? 111 SER A N   1 
ATOM   901  C CA  . SER A 1 110 ? -51.012 5.632   24.088 1.00 22.40  ? 111 SER A CA  1 
ATOM   902  C C   . SER A 1 110 ? -51.853 6.355   23.045 1.00 28.02  ? 111 SER A C   1 
ATOM   903  O O   . SER A 1 110 ? -52.953 6.821   23.337 1.00 23.87  ? 111 SER A O   1 
ATOM   904  C CB  . SER A 1 110 ? -50.029 6.607   24.731 1.00 23.31  ? 111 SER A CB  1 
ATOM   905  O OG  . SER A 1 110 ? -50.713 7.719   25.286 1.00 34.87  ? 111 SER A OG  1 
ATOM   906  N N   . GLN A 1 111 ? -51.333 6.446   21.826 1.00 24.28  ? 112 GLN A N   1 
ATOM   907  C CA  . GLN A 1 111 ? -52.039 7.139   20.759 1.00 24.88  ? 112 GLN A CA  1 
ATOM   908  C C   . GLN A 1 111 ? -53.258 6.346   20.303 1.00 25.55  ? 112 GLN A C   1 
ATOM   909  O O   . GLN A 1 111 ? -54.332 6.906   20.108 1.00 25.27  ? 112 GLN A O   1 
ATOM   910  C CB  . GLN A 1 111 ? -51.102 7.408   19.578 1.00 26.17  ? 112 GLN A CB  1 
ATOM   911  C CG  . GLN A 1 111 ? -51.764 8.153   18.429 1.00 24.80  ? 112 GLN A CG  1 
ATOM   912  C CD  . GLN A 1 111 ? -52.545 9.371   18.887 1.00 29.08  ? 112 GLN A CD  1 
ATOM   913  O OE1 . GLN A 1 111 ? -53.730 9.512   18.578 1.00 35.49  ? 112 GLN A OE1 1 
ATOM   914  N NE2 . GLN A 1 111 ? -51.883 10.263  19.619 1.00 26.13  ? 112 GLN A NE2 1 
ATOM   915  N N   . MET A 1 112 ? -53.093 5.039   20.142 1.00 24.93  ? 113 MET A N   1 
ATOM   916  C CA  . MET A 1 112 ? -54.199 4.196   19.711 1.00 24.77  ? 113 MET A CA  1 
ATOM   917  C C   . MET A 1 112 ? -55.302 4.149   20.761 1.00 28.10  ? 113 MET A C   1 
ATOM   918  O O   . MET A 1 112 ? -56.461 3.884   20.443 1.00 26.26  ? 113 MET A O   1 
ATOM   919  C CB  . MET A 1 112 ? -53.712 2.787   19.403 1.00 23.25  ? 113 MET A CB  1 
ATOM   920  C CG  . MET A 1 112 ? -52.671 2.724   18.308 1.00 30.90  ? 113 MET A CG  1 
ATOM   921  S SD  . MET A 1 112 ? -52.177 0.879   17.977 1.00 49.14  0 113 MET A SD  1 
ATOM   922  C CE  . MET A 1 112 ? -51.378 0.487   19.695 1.00 40.47  ? 113 MET A CE  1 
ATOM   923  N N   . THR A 1 113 ? -54.939 4.401   22.013 1.00 26.12  ? 114 THR A N   1 
ATOM   924  C CA  . THR A 1 113 ? -55.924 4.522   23.075 1.00 32.85  ? 114 THR A CA  1 
ATOM   925  C C   . THR A 1 113 ? -56.659 5.850   22.937 1.00 30.03  ? 114 THR A C   1 
ATOM   926  O O   . THR A 1 113 ? -57.867 5.939   23.180 1.00 34.31  ? 114 THR A O   1 
ATOM   927  C CB  . THR A 1 113 ? -55.269 4.412   24.464 1.00 25.01  ? 114 THR A CB  1 
ATOM   928  O OG1 . THR A 1 113 ? -54.864 3.056   24.690 1.00 34.97  ? 114 THR A OG1 1 
ATOM   929  C CG2 . THR A 1 113 ? -56.244 4.818   25.559 1.00 28.99  ? 114 THR A CG2 1 
ATOM   930  N N   . ARG A 1 114 ? -55.922 6.878   22.528 1.00 24.62  ? 115 ARG A N   1 
ATOM   931  C CA  . ARG A 1 114 ? -56.519 8.181   22.283 1.00 26.93  ? 115 ARG A CA  1 
ATOM   932  C C   . ARG A 1 114 ? -57.575 8.081   21.184 1.00 29.16  ? 115 ARG A C   1 
ATOM   933  O O   . ARG A 1 114 ? -58.670 8.625   21.316 1.00 28.16  ? 115 ARG A O   1 
ATOM   934  C CB  . ARG A 1 114 ? -55.444 9.198   21.906 1.00 31.30  ? 115 ARG A CB  1 
ATOM   935  C CG  . ARG A 1 114 ? -55.971 10.574  21.568 1.00 34.66  ? 115 ARG A CG  1 
ATOM   936  C CD  . ARG A 1 114 ? -56.432 11.314  22.809 1.00 39.03  ? 115 ARG A CD  1 
ATOM   937  N NE  . ARG A 1 114 ? -56.968 12.626  22.465 1.00 42.45  ? 115 ARG A NE  1 
ATOM   938  C CZ  . ARG A 1 114 ? -57.250 13.576  23.348 1.00 49.42  ? 115 ARG A CZ  1 
ATOM   939  N NH1 . ARG A 1 114 ? -57.041 13.370  24.640 1.00 41.76  ? 115 ARG A NH1 1 
ATOM   940  N NH2 . ARG A 1 114 ? -57.737 14.737  22.936 1.00 45.33  ? 115 ARG A NH2 1 
ATOM   941  N N   . THR A 1 115 ? -57.251 7.360   20.115 1.00 25.88  ? 116 THR A N   1 
ATOM   942  C CA  . THR A 1 115 ? -58.171 7.208   18.990 1.00 31.27  ? 116 THR A CA  1 
ATOM   943  C C   . THR A 1 115 ? -59.387 6.362   19.371 1.00 32.16  ? 116 THR A C   1 
ATOM   944  O O   . THR A 1 115 ? -60.502 6.628   18.916 1.00 31.75  ? 116 THR A O   1 
ATOM   945  C CB  . THR A 1 115 ? -57.456 6.587   17.764 1.00 32.10  ? 116 THR A CB  1 
ATOM   946  O OG1 . THR A 1 115 ? -56.393 7.453   17.346 1.00 37.44  ? 116 THR A OG1 1 
ATOM   947  C CG2 . THR A 1 115 ? -58.418 6.397   16.601 1.00 43.65  ? 116 THR A CG2 1 
ATOM   948  N N   . LYS A 1 116 ? -59.175 5.357   20.218 1.00 29.05  ? 117 LYS A N   1 
ATOM   949  C CA  . LYS A 1 116 ? -60.273 4.506   20.676 1.00 29.68  ? 117 LYS A CA  1 
ATOM   950  C C   . LYS A 1 116 ? -61.327 5.347   21.378 1.00 36.75  ? 117 LYS A C   1 
ATOM   951  O O   . LYS A 1 116 ? -62.520 5.205   21.129 1.00 35.49  ? 117 LYS A O   1 
ATOM   952  C CB  . LYS A 1 116 ? -59.770 3.402   21.617 1.00 31.45  ? 117 LYS A CB  1 
ATOM   953  C CG  . LYS A 1 116 ? -60.875 2.519   22.187 1.00 36.98  ? 117 LYS A CG  1 
ATOM   954  C CD  . LYS A 1 116 ? -60.327 1.399   23.068 1.00 47.18  ? 117 LYS A CD  1 
ATOM   955  C CE  . LYS A 1 116 ? -60.509 1.688   24.559 1.00 49.85  ? 117 LYS A CE  1 
ATOM   956  N NZ  . LYS A 1 116 ? -59.602 2.752   25.071 1.00 47.97  ? 117 LYS A NZ  1 
ATOM   957  N N   . GLU A 1 117 ? -60.867 6.240   22.244 1.00 35.44  ? 118 GLU A N   1 
ATOM   958  C CA  . GLU A 1 117 ? -61.763 7.103   22.992 1.00 35.59  ? 118 GLU A CA  1 
ATOM   959  C C   . GLU A 1 117 ? -62.439 8.122   22.069 1.00 32.39  ? 118 GLU A C   1 
ATOM   960  O O   . GLU A 1 117 ? -63.549 8.577   22.349 1.00 29.51  ? 118 GLU A O   1 
ATOM   961  C CB  . GLU A 1 117 ? -60.998 7.790   24.127 1.00 31.65  ? 118 GLU A CB  1 
ATOM   962  C CG  . GLU A 1 117 ? -60.405 6.792   25.127 1.00 35.34  ? 118 GLU A CG  1 
ATOM   963  C CD  . GLU A 1 117 ? -59.341 7.393   26.026 1.00 35.61  ? 118 GLU A CD  1 
ATOM   964  O OE1 . GLU A 1 117 ? -58.810 8.470   25.687 1.00 30.91  ? 118 GLU A OE1 1 
ATOM   965  O OE2 . GLU A 1 117 ? -59.034 6.781   27.071 1.00 44.72  ? 118 GLU A OE2 1 
ATOM   966  N N   . GLU A 1 118 ? -61.787 8.454   20.956 1.00 29.38  ? 119 GLU A N   1 
ATOM   967  C CA  . GLU A 1 118 ? -62.387 9.335   19.951 1.00 35.57  ? 119 GLU A CA  1 
ATOM   968  C C   . GLU A 1 118 ? -63.522 8.632   19.214 1.00 35.70  ? 119 GLU A C   1 
ATOM   969  O O   . GLU A 1 118 ? -64.586 9.211   19.002 1.00 30.41  ? 119 GLU A O   1 
ATOM   970  C CB  . GLU A 1 118 ? -61.342 9.816   18.939 1.00 30.90  ? 119 GLU A CB  1 
ATOM   971  C CG  . GLU A 1 118 ? -60.254 10.694  19.515 1.00 43.99  ? 119 GLU A CG  1 
ATOM   972  C CD  . GLU A 1 118 ? -60.797 11.888  20.268 1.00 56.90  ? 119 GLU A CD  1 
ATOM   973  O OE1 . GLU A 1 118 ? -61.749 12.528  19.777 1.00 55.77  ? 119 GLU A OE1 1 
ATOM   974  O OE2 . GLU A 1 118 ? -60.267 12.182  21.358 1.00 59.49  ? 119 GLU A OE2 1 
ATOM   975  N N   . LEU A 1 119 ? -63.270 7.390   18.809 1.00 32.79  ? 120 LEU A N   1 
ATOM   976  C CA  . LEU A 1 119 ? -64.285 6.549   18.181 1.00 30.62  ? 120 LEU A CA  1 
ATOM   977  C C   . LEU A 1 119 ? -65.412 6.294   19.166 1.00 28.52  ? 120 LEU A C   1 
ATOM   978  O O   . LEU A 1 119 ? -66.581 6.197   18.786 1.00 32.33  ? 120 LEU A O   1 
ATOM   979  C CB  . LEU A 1 119 ? -63.688 5.217   17.709 1.00 37.55  ? 120 LEU A CB  1 
ATOM   980  C CG  . LEU A 1 119 ? -63.078 5.142   16.307 1.00 40.47  ? 120 LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 119 ? -62.077 6.250   16.107 1.00 50.12  ? 120 LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 119 ? -62.422 3.791   16.065 1.00 37.74  ? 120 LEU A CD2 1 
ATOM   983  N N   . GLU A 1 120 ? -65.042 6.181   20.437 1.00 31.39  ? 121 GLU A N   1 
ATOM   984  C CA  . GLU A 1 120 ? -66.004 5.964   21.504 1.00 35.29  ? 121 GLU A CA  1 
ATOM   985  C C   . GLU A 1 120 ? -66.951 7.147   21.623 1.00 33.43  ? 121 GLU A C   1 
ATOM   986  O O   . GLU A 1 120 ? -68.170 6.983   21.677 1.00 28.36  ? 121 GLU A O   1 
ATOM   987  C CB  . GLU A 1 120 ? -65.283 5.739   22.830 1.00 34.51  ? 121 GLU A CB  1 
ATOM   988  C CG  . GLU A 1 120 ? -65.975 4.754   23.744 1.00 44.33  ? 121 GLU A CG  1 
ATOM   989  C CD  . GLU A 1 120 ? -65.626 3.323   23.408 1.00 53.61  ? 121 GLU A CD  1 
ATOM   990  O OE1 . GLU A 1 120 ? -64.420 3.010   23.354 1.00 47.83  ? 121 GLU A OE1 1 
ATOM   991  O OE2 . GLU A 1 120 ? -66.551 2.516   23.190 1.00 49.12  ? 121 GLU A OE2 1 
ATOM   992  N N   . ALA A 1 121 ? -66.371 8.342   21.667 1.00 30.90  ? 122 ALA A N   1 
ATOM   993  C CA  . ALA A 1 121 ? -67.141 9.568   21.823 1.00 31.81  ? 122 ALA A CA  1 
ATOM   994  C C   . ALA A 1 121 ? -68.063 9.787   20.629 1.00 26.08  ? 122 ALA A C   1 
ATOM   995  O O   . ALA A 1 121 ? -69.241 10.095  20.794 1.00 27.98  ? 122 ALA A O   1 
ATOM   996  C CB  . ALA A 1 121 ? -66.212 10.755  22.003 1.00 27.81  ? 122 ALA A CB  1 
ATOM   997  N N   . GLU A 1 122 ? -67.517 9.615   19.430 1.00 27.82  ? 123 GLU A N   1 
ATOM   998  C CA  . GLU A 1 122 ? -68.271 9.806   18.196 1.00 28.95  ? 123 GLU A CA  1 
ATOM   999  C C   . GLU A 1 122 ? -69.428 8.818   18.053 1.00 30.58  ? 123 GLU A C   1 
ATOM   1000 O O   . GLU A 1 122 ? -70.455 9.140   17.455 1.00 32.48  ? 123 GLU A O   1 
ATOM   1001 C CB  . GLU A 1 122 ? -67.330 9.698   16.993 1.00 27.66  ? 123 GLU A CB  1 
ATOM   1002 C CG  . GLU A 1 122 ? -66.323 10.835  16.910 1.00 36.13  ? 123 GLU A CG  1 
ATOM   1003 C CD  . GLU A 1 122 ? -65.125 10.517  16.033 1.00 43.16  ? 123 GLU A CD  1 
ATOM   1004 O OE1 . GLU A 1 122 ? -64.144 11.289  16.072 1.00 45.20  ? 123 GLU A OE1 1 
ATOM   1005 O OE2 . GLU A 1 122 ? -65.158 9.501   15.308 1.00 45.75  ? 123 GLU A OE2 1 
ATOM   1006 N N   . LYS A 1 123 ? -69.258 7.617   18.595 1.00 30.00  ? 124 LYS A N   1 
ATOM   1007 C CA  . LYS A 1 123 ? -70.318 6.616   18.574 1.00 26.92  ? 124 LYS A CA  1 
ATOM   1008 C C   . LYS A 1 123 ? -71.476 7.030   19.482 1.00 28.25  ? 124 LYS A C   1 
ATOM   1009 O O   . LYS A 1 123 ? -72.648 6.855   19.138 1.00 27.89  ? 124 LYS A O   1 
ATOM   1010 C CB  . LYS A 1 123 ? -69.776 5.253   19.002 1.00 25.99  ? 124 LYS A CB  1 
ATOM   1011 C CG  . LYS A 1 123 ? -70.858 4.268   19.394 1.00 33.55  ? 124 LYS A CG  1 
ATOM   1012 C CD  . LYS A 1 123 ? -70.297 3.064   20.123 1.00 34.21  ? 124 LYS A CD  1 
ATOM   1013 C CE  . LYS A 1 123 ? -69.450 2.201   19.209 1.00 37.01  ? 124 LYS A CE  1 
ATOM   1014 N NZ  . LYS A 1 123 ? -69.338 0.824   19.756 1.00 36.27  ? 124 LYS A NZ  1 
ATOM   1015 N N   . ARG A 1 124 ? -71.134 7.582   20.643 1.00 25.35  ? 125 ARG A N   1 
ATOM   1016 C CA  . ARG A 1 124 ? -72.130 8.048   21.603 1.00 27.54  ? 125 ARG A CA  1 
ATOM   1017 C C   . ARG A 1 124 ? -72.998 9.155   21.035 1.00 29.81  ? 125 ARG A C   1 
ATOM   1018 O O   . ARG A 1 124 ? -74.191 9.227   21.318 1.00 30.07  ? 125 ARG A O   1 
ATOM   1019 C CB  . ARG A 1 124 ? -71.455 8.546   22.879 1.00 29.82  ? 125 ARG A CB  1 
ATOM   1020 C CG  . ARG A 1 124 ? -70.941 7.450   23.782 1.00 35.34  ? 125 ARG A CG  1 
ATOM   1021 C CD  . ARG A 1 124 ? -70.685 7.983   25.182 1.00 35.57  ? 125 ARG A CD  1 
ATOM   1022 N NE  . ARG A 1 124 ? -69.611 8.972   25.230 1.00 44.00  ? 125 ARG A NE  1 
ATOM   1023 C CZ  . ARG A 1 124 ? -68.322 8.671   25.358 1.00 35.12  ? 125 ARG A CZ  1 
ATOM   1024 N NH1 . ARG A 1 124 ? -67.936 7.405   25.435 1.00 36.02  ? 125 ARG A NH1 1 
ATOM   1025 N NH2 . ARG A 1 124 ? -67.415 9.638   25.405 1.00 25.22  ? 125 ARG A NH2 1 
ATOM   1026 N N   . ASP A 1 125 ? -72.388 10.026  20.243 1.00 35.33  ? 126 ASP A N   1 
ATOM   1027 C CA  . ASP A 1 125 ? -73.120 11.121  19.635 1.00 34.75  ? 126 ASP A CA  1 
ATOM   1028 C C   . ASP A 1 125 ? -74.092 10.578  18.594 1.00 30.23  ? 126 ASP A C   1 
ATOM   1029 O O   . ASP A 1 125 ? -75.247 10.999  18.550 1.00 36.98  ? 126 ASP A O   1 
ATOM   1030 C CB  . ASP A 1 125 ? -72.165 12.138  19.006 1.00 31.35  ? 126 ASP A CB  1 
ATOM   1031 C CG  . ASP A 1 125 ? -71.264 12.791  20.025 1.00 45.03  ? 126 ASP A CG  1 
ATOM   1032 O OD1 . ASP A 1 125 ? -71.762 13.178  21.101 1.00 46.99  ? 126 ASP A OD1 1 
ATOM   1033 O OD2 . ASP A 1 125 ? -70.049 12.895  19.763 1.00 55.01  ? 126 ASP A OD2 1 
ATOM   1034 N N   . LEU A 1 126 ? -73.633 9.636   17.773 1.00 30.74  ? 127 LEU A N   1 
ATOM   1035 C CA  . LEU A 1 126 ? -74.495 9.041   16.756 1.00 31.76  ? 127 LEU A CA  1 
ATOM   1036 C C   . LEU A 1 126 ? -75.605 8.198   17.383 1.00 29.00  ? 127 LEU A C   1 
ATOM   1037 O O   . LEU A 1 126 ? -76.696 8.094   16.826 1.00 23.57  ? 127 LEU A O   1 
ATOM   1038 C CB  . LEU A 1 126 ? -73.679 8.190   15.777 1.00 27.25  ? 127 LEU A CB  1 
ATOM   1039 C CG  . LEU A 1 126 ? -72.734 8.909   14.808 1.00 33.17  ? 127 LEU A CG  1 
ATOM   1040 C CD1 . LEU A 1 126 ? -71.896 7.894   14.047 1.00 27.69  ? 127 LEU A CD1 1 
ATOM   1041 C CD2 . LEU A 1 126 ? -73.501 9.806   13.840 1.00 18.01  ? 127 LEU A CD2 1 
ATOM   1042 N N   . ILE A 1 127 ? -75.325 7.595   18.534 1.00 31.04  ? 128 ILE A N   1 
ATOM   1043 C CA  . ILE A 1 127 ? -76.330 6.804   19.239 1.00 27.63  ? 128 ILE A CA  1 
ATOM   1044 C C   . ILE A 1 127 ? -77.383 7.718   19.854 1.00 29.73  ? 128 ILE A C   1 
ATOM   1045 O O   . ILE A 1 127 ? -78.581 7.452   19.762 1.00 32.24  ? 128 ILE A O   1 
ATOM   1046 C CB  . ILE A 1 127 ? -75.700 5.924   20.339 1.00 29.41  ? 128 ILE A CB  1 
ATOM   1047 C CG1 . ILE A 1 127 ? -75.037 4.694   19.720 1.00 29.22  ? 128 ILE A CG1 1 
ATOM   1048 C CG2 . ILE A 1 127 ? -76.757 5.460   21.330 1.00 28.51  ? 128 ILE A CG2 1 
ATOM   1049 C CD1 . ILE A 1 127 ? -74.337 3.813   20.730 1.00 31.16  ? 128 ILE A CD1 1 
ATOM   1050 N N   . ARG A 1 128 ? -76.928 8.802   20.470 1.00 27.09  ? 129 ARG A N   1 
ATOM   1051 C CA  . ARG A 1 128 ? -77.829 9.797   21.035 1.00 29.94  ? 129 ARG A CA  1 
ATOM   1052 C C   . ARG A 1 128 ? -78.714 10.412  19.957 1.00 31.11  ? 129 ARG A C   1 
ATOM   1053 O O   . ARG A 1 128 ? -79.883 10.713  20.194 1.00 29.48  ? 129 ARG A O   1 
ATOM   1054 C CB  . ARG A 1 128 ? -77.035 10.887  21.743 1.00 30.49  ? 129 ARG A CB  1 
ATOM   1055 C CG  . ARG A 1 128 ? -77.816 11.639  22.796 1.00 36.07  ? 129 ARG A CG  1 
ATOM   1056 C CD  . ARG A 1 128 ? -76.867 12.404  23.690 1.00 31.77  ? 129 ARG A CD  1 
ATOM   1057 N NE  . ARG A 1 128 ? -76.030 13.301  22.903 1.00 41.37  ? 129 ARG A NE  1 
ATOM   1058 C CZ  . ARG A 1 128 ? -74.708 13.208  22.804 1.00 38.69  ? 129 ARG A CZ  1 
ATOM   1059 N NH1 . ARG A 1 128 ? -74.045 12.265  23.464 1.00 36.60  ? 129 ARG A NH1 1 
ATOM   1060 N NH2 . ARG A 1 128 ? -74.044 14.072  22.049 1.00 41.56  ? 129 ARG A NH2 1 
ATOM   1061 N N   . THR A 1 129 ? -78.145 10.601  18.773 1.00 28.99  ? 130 THR A N   1 
ATOM   1062 C CA  . THR A 1 129 ? -78.903 11.111  17.642 1.00 24.66  ? 130 THR A CA  1 
ATOM   1063 C C   . THR A 1 129 ? -79.903 10.061  17.190 1.00 29.38  ? 130 THR A C   1 
ATOM   1064 O O   . THR A 1 129 ? -81.051 10.373  16.885 1.00 31.21  ? 130 THR A O   1 
ATOM   1065 C CB  . THR A 1 129 ? -77.983 11.500  16.470 1.00 32.28  ? 130 THR A CB  1 
ATOM   1066 O OG1 . THR A 1 129 ? -76.988 12.423  16.933 1.00 35.19  ? 130 THR A OG1 1 
ATOM   1067 C CG2 . THR A 1 129 ? -78.785 12.144  15.354 1.00 25.42  ? 130 THR A CG2 1 
ATOM   1068 N N   . ASN A 1 130 ? -79.456 8.809   17.170 1.00 29.65  ? 131 ASN A N   1 
ATOM   1069 C CA  . ASN A 1 130 ? -80.299 7.690   16.770 1.00 25.33  ? 131 ASN A CA  1 
ATOM   1070 C C   . ASN A 1 130 ? -81.588 7.605   17.585 1.00 24.85  ? 131 ASN A C   1 
ATOM   1071 O O   . ASN A 1 130 ? -82.683 7.606   17.017 1.00 28.91  ? 131 ASN A O   1 
ATOM   1072 C CB  . ASN A 1 130 ? -79.521 6.377   16.884 1.00 31.87  ? 131 ASN A CB  1 
ATOM   1073 C CG  . ASN A 1 130 ? -80.330 5.176   16.442 1.00 27.16  ? 131 ASN A CG  1 
ATOM   1074 O OD1 . ASN A 1 130 ? -80.927 4.478   17.263 1.00 29.30  ? 131 ASN A OD1 1 
ATOM   1075 N ND2 . ASN A 1 130 ? -80.347 4.922   15.138 1.00 30.76  ? 131 ASN A ND2 1 
ATOM   1076 N N   . GLU A 1 131 ? -81.462 7.552   18.909 1.00 28.97  ? 132 GLU A N   1 
ATOM   1077 C CA  . GLU A 1 131 ? -82.637 7.421   19.765 1.00 30.74  ? 132 GLU A CA  1 
ATOM   1078 C C   . GLU A 1 131 ? -83.573 8.628   19.653 1.00 27.42  ? 132 GLU A C   1 
ATOM   1079 O O   . GLU A 1 131 ? -84.790 8.480   19.758 1.00 30.50  ? 132 GLU A O   1 
ATOM   1080 C CB  . GLU A 1 131 ? -82.225 7.194   21.227 1.00 24.32  ? 132 GLU A CB  1 
ATOM   1081 C CG  . GLU A 1 131 ? -81.078 8.055   21.725 1.00 32.60  ? 132 GLU A CG  1 
ATOM   1082 C CD  . GLU A 1 131 ? -80.559 7.625   23.085 1.00 47.19  ? 132 GLU A CD  1 
ATOM   1083 O OE1 . GLU A 1 131 ? -80.517 8.462   24.011 1.00 47.17  ? 132 GLU A OE1 1 
ATOM   1084 O OE2 . GLU A 1 131 ? -80.180 6.446   23.223 1.00 41.32  ? 132 GLU A OE2 1 
ATOM   1085 N N   . ARG A 1 132 ? -83.017 9.812   19.415 1.00 24.07  ? 133 ARG A N   1 
ATOM   1086 C CA  . ARG A 1 132 ? -83.840 11.008  19.242 1.00 26.60  ? 133 ARG A CA  1 
ATOM   1087 C C   . ARG A 1 132 ? -84.685 10.924  17.969 1.00 27.65  ? 133 ARG A C   1 
ATOM   1088 O O   . ARG A 1 132 ? -85.858 11.300  17.967 1.00 28.12  ? 133 ARG A O   1 
ATOM   1089 C CB  . ARG A 1 132 ? -82.975 12.270  19.211 1.00 26.05  ? 133 ARG A CB  1 
ATOM   1090 C CG  . ARG A 1 132 ? -83.753 13.520  18.833 1.00 33.50  ? 133 ARG A CG  1 
ATOM   1091 C CD  . ARG A 1 132 ? -82.927 14.784  18.991 1.00 30.81  ? 133 ARG A CD  1 
ATOM   1092 N NE  . ARG A 1 132 ? -81.687 14.740  18.223 1.00 33.31  ? 133 ARG A NE  1 
ATOM   1093 C CZ  . ARG A 1 132 ? -81.609 14.951  16.914 1.00 34.08  ? 133 ARG A CZ  1 
ATOM   1094 N NH1 . ARG A 1 132 ? -82.702 15.211  16.208 1.00 33.83  ? 133 ARG A NH1 1 
ATOM   1095 N NH2 . ARG A 1 132 ? -80.435 14.894  16.304 1.00 41.99  ? 133 ARG A NH2 1 
ATOM   1096 N N   . LEU A 1 133 ? -84.084 10.428  16.891 1.00 25.27  ? 134 LEU A N   1 
ATOM   1097 C CA  . LEU A 1 133 ? -84.799 10.246  15.630 1.00 27.45  ? 134 LEU A CA  1 
ATOM   1098 C C   . LEU A 1 133 ? -85.809 9.107   15.744 1.00 31.26  ? 134 LEU A C   1 
ATOM   1099 O O   . LEU A 1 133 ? -86.871 9.142   15.123 1.00 27.56  ? 134 LEU A O   1 
ATOM   1100 C CB  . LEU A 1 133 ? -83.822 9.968   14.482 1.00 27.04  ? 134 LEU A CB  1 
ATOM   1101 C CG  . LEU A 1 133 ? -82.794 11.024  14.060 1.00 26.91  ? 134 LEU A CG  1 
ATOM   1102 C CD1 . LEU A 1 133 ? -81.994 10.510  12.872 1.00 33.58  ? 134 LEU A CD1 1 
ATOM   1103 C CD2 . LEU A 1 133 ? -83.451 12.355  13.724 1.00 23.41  ? 134 LEU A CD2 1 
ATOM   1104 N N   . SER A 1 134 ? -85.460 8.098   16.538 1.00 31.77  ? 135 SER A N   1 
ATOM   1105 C CA  . SER A 1 134 ? -86.349 6.970   16.792 1.00 31.82  ? 135 SER A CA  1 
ATOM   1106 C C   . SER A 1 134 ? -87.618 7.441   17.491 1.00 30.85  ? 135 SER A C   1 
ATOM   1107 O O   . SER A 1 134 ? -88.724 7.037   17.133 1.00 36.96  ? 135 SER A O   1 
ATOM   1108 C CB  . SER A 1 134 ? -85.653 5.908   17.644 1.00 33.39  ? 135 SER A CB  1 
ATOM   1109 O OG  . SER A 1 134 ? -84.494 5.418   17.001 1.00 35.43  ? 135 SER A OG  1 
ATOM   1110 N N   . GLN A 1 135 ? -87.442 8.301   18.489 1.00 32.96  ? 136 GLN A N   1 
ATOM   1111 C CA  . GLN A 1 135 ? -88.555 8.846   19.257 1.00 36.15  ? 136 GLN A CA  1 
ATOM   1112 C C   . GLN A 1 135 ? -89.427 9.779   18.416 1.00 32.23  ? 136 GLN A C   1 
ATOM   1113 O O   . GLN A 1 135 ? -90.652 9.762   18.534 1.00 32.94  ? 136 GLN A O   1 
ATOM   1114 C CB  . GLN A 1 135 ? -88.029 9.580   20.495 1.00 30.89  ? 136 GLN A CB  1 
ATOM   1115 C CG  . GLN A 1 135 ? -89.083 10.335  21.290 1.00 39.16  ? 136 GLN A CG  1 
ATOM   1116 C CD  . GLN A 1 135 ? -90.167 9.430   21.847 1.00 40.61  ? 136 GLN A CD  1 
ATOM   1117 O OE1 . GLN A 1 135 ? -89.884 8.404   22.469 1.00 46.13  ? 136 GLN A OE1 1 
ATOM   1118 N NE2 . GLN A 1 135 ? -91.420 9.812   21.628 1.00 43.28  ? 136 GLN A NE2 1 
ATOM   1119 N N   . GLU A 1 136 ? -88.800 10.589  17.566 1.00 35.34  ? 137 GLU A N   1 
ATOM   1120 C CA  . GLU A 1 136 ? -89.545 11.487  16.685 1.00 34.01  ? 137 GLU A CA  1 
ATOM   1121 C C   . GLU A 1 136 ? -90.348 10.688  15.672 1.00 39.67  ? 137 GLU A C   1 
ATOM   1122 O O   . GLU A 1 136 ? -91.358 11.156  15.144 1.00 42.00  ? 137 GLU A O   1 
ATOM   1123 C CB  . GLU A 1 136 ? -88.603 12.450  15.964 1.00 33.19  ? 137 GLU A CB  1 
ATOM   1124 C CG  . GLU A 1 136 ? -88.170 13.647  16.797 1.00 41.86  ? 137 GLU A CG  1 
ATOM   1125 C CD  . GLU A 1 136 ? -86.933 14.315  16.239 1.00 50.39  ? 137 GLU A CD  1 
ATOM   1126 O OE1 . GLU A 1 136 ? -86.441 13.859  15.187 1.00 49.16  ? 137 GLU A OE1 1 
ATOM   1127 O OE2 . GLU A 1 136 ? -86.451 15.289  16.851 1.00 48.29  ? 137 GLU A OE2 1 
ATOM   1128 N N   . LEU A 1 137 ? -89.887 9.471   15.410 1.00 38.13  ? 138 LEU A N   1 
ATOM   1129 C CA  . LEU A 1 137 ? -90.582 8.568   14.509 1.00 37.26  ? 138 LEU A CA  1 
ATOM   1130 C C   . LEU A 1 137 ? -91.807 7.943   15.166 1.00 46.03  ? 138 LEU A C   1 
ATOM   1131 O O   . LEU A 1 137 ? -92.722 7.498   14.479 1.00 47.34  ? 138 LEU A O   1 
ATOM   1132 C CB  . LEU A 1 137 ? -89.637 7.470   14.021 1.00 38.66  ? 138 LEU A CB  1 
ATOM   1133 C CG  . LEU A 1 137 ? -89.179 7.602   12.571 1.00 45.94  ? 138 LEU A CG  1 
ATOM   1134 C CD1 . LEU A 1 137 ? -88.440 6.355   12.126 1.00 40.99  ? 138 LEU A CD1 1 
ATOM   1135 C CD2 . LEU A 1 137 ? -90.380 7.854   11.688 1.00 40.21  ? 138 LEU A CD2 1 
ATOM   1136 N N   . GLU A 1 138 ? -91.821 7.902   16.494 1.00 46.15  ? 139 GLU A N   1 
ATOM   1137 C CA  . GLU A 1 138 ? -92.932 7.285   17.208 1.00 49.55  ? 139 GLU A CA  1 
ATOM   1138 C C   . GLU A 1 138 ? -94.136 8.219   17.319 1.00 44.85  ? 139 GLU A C   1 
ATOM   1139 O O   . GLU A 1 138 ? -95.263 7.764   17.531 1.00 47.38  ? 139 GLU A O   1 
ATOM   1140 C CB  . GLU A 1 138 ? -92.482 6.822   18.595 1.00 46.57  ? 139 GLU A CB  1 
ATOM   1141 C CG  . GLU A 1 138 ? -91.442 5.714   18.534 1.00 50.22  ? 139 GLU A CG  1 
ATOM   1142 C CD  . GLU A 1 138 ? -91.300 4.960   19.837 1.00 65.73  ? 139 GLU A CD  1 
ATOM   1143 O OE1 . GLU A 1 138 ? -91.310 5.604   20.906 1.00 71.54  ? 139 GLU A OE1 1 
ATOM   1144 O OE2 . GLU A 1 138 ? -91.178 3.719   19.789 1.00 64.11  ? 139 GLU A OE2 1 
ATOM   1145 N N   . TYR A 1 139 ? -93.897 9.518   17.166 1.00 45.78  ? 140 TYR A N   1 
ATOM   1146 C CA  . TYR A 1 139 ? -94.978 10.499  17.122 1.00 46.61  ? 140 TYR A CA  1 
ATOM   1147 C C   . TYR A 1 139 ? -95.733 10.416  15.804 1.00 47.58  ? 140 TYR A C   1 
ATOM   1148 O O   . TYR A 1 139 ? -96.957 10.531  15.760 1.00 58.49  ? 140 TYR A O   1 
ATOM   1149 C CB  . TYR A 1 139 ? -94.432 11.915  17.301 1.00 46.64  ? 140 TYR A CB  1 
ATOM   1150 C CG  . TYR A 1 139 ? -93.833 12.191  18.656 1.00 41.89  ? 140 TYR A CG  1 
ATOM   1151 C CD1 . TYR A 1 139 ? -94.476 11.785  19.819 1.00 44.26  ? 140 TYR A CD1 1 
ATOM   1152 C CD2 . TYR A 1 139 ? -92.621 12.860  18.775 1.00 44.07  ? 140 TYR A CD2 1 
ATOM   1153 C CE1 . TYR A 1 139 ? -93.928 12.038  21.061 1.00 52.13  ? 140 TYR A CE1 1 
ATOM   1154 C CE2 . TYR A 1 139 ? -92.067 13.117  20.014 1.00 40.32  ? 140 TYR A CE2 1 
ATOM   1155 C CZ  . TYR A 1 139 ? -92.724 12.704  21.153 1.00 43.33  ? 140 TYR A CZ  1 
ATOM   1156 O OH  . TYR A 1 139 ? -92.176 12.959  22.389 1.00 60.59  ? 140 TYR A OH  1 
ATOM   1157 N N   . LEU A 1 140 ? -94.982 10.217  14.728 1.00 49.89  ? 141 LEU A N   1 
ATOM   1158 C CA  . LEU A 1 140 ? -95.530 10.288  13.381 1.00 44.51  ? 141 LEU A CA  1 
ATOM   1159 C C   . LEU A 1 140 ? -96.129 8.959   12.925 1.00 48.24  ? 141 LEU A C   1 
ATOM   1160 O O   . LEU A 1 140 ? -96.549 8.825   11.777 1.00 49.88  ? 141 LEU A O   1 
ATOM   1161 C CB  . LEU A 1 140 ? -94.451 10.757  12.404 1.00 43.20  ? 141 LEU A CB  1 
ATOM   1162 C CG  . LEU A 1 140 ? -93.820 12.099  12.791 1.00 40.03  ? 141 LEU A CG  1 
ATOM   1163 C CD1 . LEU A 1 140 ? -92.755 12.509  11.794 1.00 41.51  ? 141 LEU A CD1 1 
ATOM   1164 C CD2 . LEU A 1 140 ? -94.881 13.186  12.912 1.00 36.74  ? 141 LEU A CD2 1 
ATOM   1165 N N   . THR A 1 141 ? -96.150 7.972   13.815 1.00 38.90  ? 142 THR A N   1 
ATOM   1166 C CA  . THR A 1 141 ? -96.874 6.732   13.547 1.00 45.82  ? 142 THR A CA  1 
ATOM   1167 C C   . THR A 1 141 ? -97.922 6.459   14.622 1.00 55.67  ? 142 THR A C   1 
ATOM   1168 O O   . THR A 1 141 ? -97.954 7.123   15.659 1.00 54.23  ? 142 THR A O   1 
ATOM   1169 C CB  . THR A 1 141 ? -95.933 5.519   13.461 1.00 50.28  ? 142 THR A CB  1 
ATOM   1170 O OG1 . THR A 1 141 ? -95.320 5.289   14.737 1.00 58.20  ? 142 THR A OG1 1 
ATOM   1171 C CG2 . THR A 1 141 ? -94.860 5.745   12.406 1.00 48.52  ? 142 THR A CG2 1 
ATOM   1172 N N   . ALA B 1 2   ? 59.140  0.305   76.629 1.00 53.90  ? 3   ALA B N   1 
ATOM   1173 C CA  . ALA B 1 2   ? 57.790  0.420   76.089 1.00 51.54  ? 3   ALA B CA  1 
ATOM   1174 C C   . ALA B 1 2   ? 56.810  -0.476  76.843 1.00 56.33  ? 3   ALA B C   1 
ATOM   1175 O O   . ALA B 1 2   ? 55.988  0.007   77.619 1.00 59.15  ? 3   ALA B O   1 
ATOM   1176 C CB  . ALA B 1 2   ? 57.782  0.083   74.604 1.00 44.64  ? 3   ALA B CB  1 
ATOM   1177 N N   . VAL B 1 3   ? 56.875  -1.777  76.578 1.00 51.55  ? 4   VAL B N   1 
ATOM   1178 C CA  . VAL B 1 3   ? 55.986  -2.745  77.220 1.00 50.07  ? 4   VAL B CA  1 
ATOM   1179 C C   . VAL B 1 3   ? 56.472  -3.228  78.598 1.00 50.75  ? 4   VAL B C   1 
ATOM   1180 O O   . VAL B 1 3   ? 55.657  -3.518  79.477 1.00 55.99  ? 4   VAL B O   1 
ATOM   1181 C CB  . VAL B 1 3   ? 55.751  -3.956  76.300 1.00 51.74  ? 4   VAL B CB  1 
ATOM   1182 C CG1 . VAL B 1 3   ? 54.649  -4.838  76.861 1.00 48.48  ? 4   VAL B CG1 1 
ATOM   1183 C CG2 . VAL B 1 3   ? 55.370  -3.477  74.910 1.00 41.59  ? 4   VAL B CG2 1 
ATOM   1184 N N   . LEU B 1 4   ? 57.787  -3.317  78.790 1.00 52.87  ? 5   LEU B N   1 
ATOM   1185 C CA  . LEU B 1 4   ? 58.338  -3.778  80.068 1.00 49.34  ? 5   LEU B CA  1 
ATOM   1186 C C   . LEU B 1 4   ? 57.990  -2.854  81.232 1.00 54.87  ? 5   LEU B C   1 
ATOM   1187 O O   . LEU B 1 4   ? 58.159  -3.216  82.394 1.00 57.70  ? 5   LEU B O   1 
ATOM   1188 C CB  . LEU B 1 4   ? 59.857  -3.922  79.981 1.00 48.45  ? 5   LEU B CB  1 
ATOM   1189 C CG  . LEU B 1 4   ? 60.433  -5.321  79.750 1.00 41.08  ? 5   LEU B CG  1 
ATOM   1190 C CD1 . LEU B 1 4   ? 61.945  -5.280  79.853 1.00 38.30  ? 5   LEU B CD1 1 
ATOM   1191 C CD2 . LEU B 1 4   ? 59.866  -6.317  80.747 1.00 32.93  ? 5   LEU B CD2 1 
ATOM   1192 N N   . GLN B 1 5   ? 57.528  -1.650  80.916 1.00 57.56  ? 6   GLN B N   1 
ATOM   1193 C CA  . GLN B 1 5   ? 57.154  -0.687  81.942 1.00 55.62  ? 6   GLN B CA  1 
ATOM   1194 C C   . GLN B 1 5   ? 55.744  -0.940  82.458 1.00 53.49  ? 6   GLN B C   1 
ATOM   1195 O O   . GLN B 1 5   ? 55.395  -0.540  83.568 1.00 48.39  ? 6   GLN B O   1 
ATOM   1196 C CB  . GLN B 1 5   ? 57.267  0.736   81.393 1.00 58.49  ? 6   GLN B CB  1 
ATOM   1197 C CG  . GLN B 1 5   ? 58.686  1.163   81.082 1.00 50.89  ? 6   GLN B CG  1 
ATOM   1198 C CD  . GLN B 1 5   ? 58.744  2.459   80.302 1.00 56.82  ? 6   GLN B CD  1 
ATOM   1199 O OE1 . GLN B 1 5   ? 57.836  2.774   79.542 1.00 54.33  ? 6   GLN B OE1 1 
ATOM   1200 N NE2 . GLN B 1 5   ? 59.812  3.219   80.491 1.00 53.11  ? 6   GLN B NE2 1 
ATOM   1201 N N   . GLN B 1 6   ? 54.938  -1.608  81.641 1.00 54.23  ? 7   GLN B N   1 
ATOM   1202 C CA  . GLN B 1 6   ? 53.568  -1.920  82.011 1.00 51.72  ? 7   GLN B CA  1 
ATOM   1203 C C   . GLN B 1 6   ? 53.493  -3.178  82.870 1.00 52.19  ? 7   GLN B C   1 
ATOM   1204 O O   . GLN B 1 6   ? 52.497  -3.411  83.555 1.00 41.39  ? 7   GLN B O   1 
ATOM   1205 C CB  . GLN B 1 6   ? 52.712  -2.086  80.755 1.00 51.26  ? 7   GLN B CB  1 
ATOM   1206 C CG  . GLN B 1 6   ? 52.929  -1.000  79.714 1.00 52.65  ? 7   GLN B CG  1 
ATOM   1207 C CD  . GLN B 1 6   ? 52.462  -1.414  78.333 1.00 57.35  ? 7   GLN B CD  1 
ATOM   1208 O OE1 . GLN B 1 6   ? 52.976  -0.936  77.323 1.00 58.28  ? 7   GLN B OE1 1 
ATOM   1209 N NE2 . GLN B 1 6   ? 51.484  -2.308  78.283 1.00 53.71  ? 7   GLN B NE2 1 
ATOM   1210 N N   . VAL B 1 7   ? 54.513  -4.025  82.770 1.00 51.88  ? 8   VAL B N   1 
ATOM   1211 C CA  . VAL B 1 7   ? 54.606  -5.215  83.614 1.00 49.49  ? 8   VAL B CA  1 
ATOM   1212 C C   . VAL B 1 7   ? 55.318  -5.014  84.969 1.00 38.22  ? 8   VAL B C   1 
ATOM   1213 O O   . VAL B 1 7   ? 54.837  -5.486  86.001 1.00 37.11  ? 8   VAL B O   1 
ATOM   1214 C CB  . VAL B 1 7   ? 55.272  -6.367  82.831 1.00 49.31  ? 8   VAL B CB  1 
ATOM   1215 C CG1 . VAL B 1 7   ? 54.457  -6.670  81.602 1.00 44.12  ? 8   VAL B CG1 1 
ATOM   1216 C CG2 . VAL B 1 7   ? 56.677  -6.011  82.409 1.00 52.03  ? 8   VAL B CG2 1 
ATOM   1217 N N   . LEU B 1 8   ? 56.444  -4.301  84.962 1.00 39.73  ? 9   LEU B N   1 
ATOM   1218 C CA  . LEU B 1 8   ? 57.308  -4.190  86.138 1.00 42.99  ? 9   LEU B CA  1 
ATOM   1219 C C   . LEU B 1 8   ? 57.554  -2.733  86.499 1.00 43.63  ? 9   LEU B C   1 
ATOM   1220 O O   . LEU B 1 8   ? 57.597  -1.870  85.626 1.00 50.05  ? 9   LEU B O   1 
ATOM   1221 C CB  . LEU B 1 8   ? 58.649  -4.892  85.893 1.00 38.13  ? 9   LEU B CB  1 
ATOM   1222 C CG  . LEU B 1 8   ? 58.631  -6.351  85.431 1.00 39.84  ? 9   LEU B CG  1 
ATOM   1223 C CD1 . LEU B 1 8   ? 59.975  -6.730  84.826 1.00 35.86  ? 9   LEU B CD1 1 
ATOM   1224 C CD2 . LEU B 1 8   ? 58.280  -7.281  86.580 1.00 33.76  ? 9   LEU B CD2 1 
ATOM   1225 N N   . GLU B 1 9   ? 57.719  -2.465  87.789 1.00 40.32  ? 10  GLU B N   1 
ATOM   1226 C CA  . GLU B 1 9   ? 57.983  -1.109  88.257 1.00 40.50  ? 10  GLU B CA  1 
ATOM   1227 C C   . GLU B 1 9   ? 59.437  -0.710  87.985 1.00 48.43  ? 10  GLU B C   1 
ATOM   1228 O O   . GLU B 1 9   ? 60.297  -1.568  87.785 1.00 43.39  ? 10  GLU B O   1 
ATOM   1229 C CB  . GLU B 1 9   ? 57.647  -0.986  89.744 1.00 42.21  ? 10  GLU B CB  1 
ATOM   1230 C CG  . GLU B 1 9   ? 56.245  -1.490  90.103 1.00 48.68  ? 10  GLU B CG  1 
ATOM   1231 C CD  . GLU B 1 9   ? 55.141  -0.831  89.288 1.00 56.68  ? 10  GLU B CD  1 
ATOM   1232 O OE1 . GLU B 1 9   ? 54.563  -1.506  88.410 1.00 48.86  ? 10  GLU B OE1 1 
ATOM   1233 O OE2 . GLU B 1 9   ? 54.841  0.356   89.532 1.00 61.13  ? 10  GLU B OE2 1 
ATOM   1234 N N   . ARG B 1 10  ? 59.697  0.596   87.975 1.00 47.66  ? 11  ARG B N   1 
ATOM   1235 C CA  . ARG B 1 10  ? 60.979  1.149   87.529 1.00 43.07  ? 11  ARG B CA  1 
ATOM   1236 C C   . ARG B 1 10  ? 62.216  0.601   88.243 1.00 46.16  ? 11  ARG B C   1 
ATOM   1237 O O   . ARG B 1 10  ? 63.258  0.412   87.616 1.00 51.42  ? 11  ARG B O   1 
ATOM   1238 C CB  . ARG B 1 10  ? 60.973  2.675   87.676 1.00 49.33  ? 11  ARG B CB  1 
ATOM   1239 C CG  . ARG B 1 10  ? 62.214  3.355   87.100 1.00 42.73  ? 11  ARG B CG  1 
ATOM   1240 C CD  . ARG B 1 10  ? 62.358  4.784   87.606 1.00 37.88  ? 11  ARG B CD  1 
ATOM   1241 N NE  . ARG B 1 10  ? 61.126  5.545   87.433 1.00 38.06  ? 11  ARG B NE  1 
ATOM   1242 C CZ  . ARG B 1 10  ? 60.587  6.314   88.373 1.00 35.37  ? 11  ARG B CZ  1 
ATOM   1243 N NH1 . ARG B 1 10  ? 61.173  6.432   89.557 1.00 27.44  ? 11  ARG B NH1 1 
ATOM   1244 N NH2 . ARG B 1 10  ? 59.462  6.968   88.127 1.00 38.42  ? 11  ARG B NH2 1 
ATOM   1245 N N   . THR B 1 11  ? 62.121  0.360   89.545 1.00 39.97  ? 12  THR B N   1 
ATOM   1246 C CA  . THR B 1 11  ? 63.316  -0.006  90.293 1.00 47.94  ? 12  THR B CA  1 
ATOM   1247 C C   . THR B 1 11  ? 63.710  -1.470  90.086 1.00 48.10  ? 12  THR B C   1 
ATOM   1248 O O   . THR B 1 11  ? 64.885  -1.820  90.226 1.00 51.75  ? 12  THR B O   1 
ATOM   1249 C CB  . THR B 1 11  ? 63.149  0.270   91.801 1.00 51.92  ? 12  THR B CB  1 
ATOM   1250 O OG1 . THR B 1 11  ? 62.197  -0.639  92.362 1.00 57.21  ? 12  THR B OG1 1 
ATOM   1251 C CG2 . THR B 1 11  ? 62.689  1.704   92.037 1.00 38.84  ? 12  THR B CG2 1 
ATOM   1252 N N   . GLU B 1 12  ? 62.740  -2.333  89.789 1.00 40.63  ? 13  GLU B N   1 
ATOM   1253 C CA  . GLU B 1 12  ? 63.067  -3.734  89.534 1.00 42.34  ? 13  GLU B CA  1 
ATOM   1254 C C   . GLU B 1 12  ? 63.381  -4.076  88.072 1.00 45.63  ? 13  GLU B C   1 
ATOM   1255 O O   . GLU B 1 12  ? 64.020  -5.092  87.799 1.00 38.09  ? 13  GLU B O   1 
ATOM   1256 C CB  . GLU B 1 12  ? 61.927  -4.627  90.026 1.00 34.88  ? 13  GLU B CB  1 
ATOM   1257 C CG  . GLU B 1 12  ? 60.570  -4.320  89.409 1.00 43.41  ? 13  GLU B CG  1 
ATOM   1258 C CD  . GLU B 1 12  ? 59.463  -5.161  90.009 1.00 44.77  ? 13  GLU B CD  1 
ATOM   1259 O OE1 . GLU B 1 12  ? 58.299  -5.004  89.593 1.00 53.38  ? 13  GLU B OE1 1 
ATOM   1260 O OE2 . GLU B 1 12  ? 59.761  -5.978  90.902 1.00 49.66  ? 13  GLU B OE2 1 
ATOM   1261 N N   . LEU B 1 13  ? 62.951  -3.237  87.134 1.00 43.38  ? 14  LEU B N   1 
ATOM   1262 C CA  . LEU B 1 13  ? 63.205  -3.528  85.725 1.00 41.25  ? 14  LEU B CA  1 
ATOM   1263 C C   . LEU B 1 13  ? 64.600  -3.057  85.330 1.00 44.20  ? 14  LEU B C   1 
ATOM   1264 O O   . LEU B 1 13  ? 65.223  -3.618  84.426 1.00 43.02  ? 14  LEU B O   1 
ATOM   1265 C CB  . LEU B 1 13  ? 62.127  -2.914  84.833 1.00 48.70  ? 14  LEU B CB  1 
ATOM   1266 C CG  . LEU B 1 13  ? 62.057  -1.434  84.542 1.00 54.71  ? 14  LEU B CG  1 
ATOM   1267 C CD1 . LEU B 1 13  ? 62.797  -1.140  83.226 1.00 48.56  ? 14  LEU B CD1 1 
ATOM   1268 C CD2 . LEU B 1 13  ? 60.620  -0.942  84.485 1.00 54.95  ? 14  LEU B CD2 1 
ATOM   1269 N N   . ASN B 1 14  ? 65.091  -2.031  86.018 1.00 47.85  ? 15  ASN B N   1 
ATOM   1270 C CA  . ASN B 1 14  ? 66.446  -1.547  85.793 1.00 48.32  ? 15  ASN B CA  1 
ATOM   1271 C C   . ASN B 1 14  ? 67.478  -2.510  86.371 1.00 46.85  ? 15  ASN B C   1 
ATOM   1272 O O   . ASN B 1 14  ? 68.672  -2.395  86.092 1.00 51.02  ? 15  ASN B O   1 
ATOM   1273 C CB  . ASN B 1 14  ? 66.628  -0.152  86.396 1.00 46.91  ? 15  ASN B CB  1 
ATOM   1274 C CG  . ASN B 1 14  ? 66.001  0.941   85.547 1.00 51.95  ? 15  ASN B CG  1 
ATOM   1275 O OD1 . ASN B 1 14  ? 65.042  0.704   84.815 1.00 52.53  ? 15  ASN B OD1 1 
ATOM   1276 N ND2 . ASN B 1 14  ? 66.550  2.147   85.638 1.00 53.17  ? 15  ASN B ND2 1 
ATOM   1277 N N   . LYS B 1 15  ? 67.013  -3.458  87.180 1.00 48.72  ? 16  LYS B N   1 
ATOM   1278 C CA  . LYS B 1 15  ? 67.895  -4.449  87.783 1.00 38.11  ? 16  LYS B CA  1 
ATOM   1279 C C   . LYS B 1 15  ? 68.129  -5.615  86.824 1.00 34.33  ? 16  LYS B C   1 
ATOM   1280 O O   . LYS B 1 15  ? 68.973  -6.474  87.074 1.00 36.17  ? 16  LYS B O   1 
ATOM   1281 C CB  . LYS B 1 15  ? 67.313  -4.952  89.107 1.00 44.06  ? 16  LYS B CB  1 
ATOM   1282 C CG  . LYS B 1 15  ? 68.351  -5.523  90.065 1.00 55.51  ? 16  LYS B CG  1 
ATOM   1283 C CD  . LYS B 1 15  ? 67.789  -5.710  91.468 1.00 60.55  ? 16  LYS B CD  1 
ATOM   1284 C CE  . LYS B 1 15  ? 68.884  -6.078  92.459 1.00 64.87  ? 16  LYS B CE  1 
ATOM   1285 N NZ  . LYS B 1 15  ? 68.354  -6.293  93.836 1.00 63.26  ? 16  LYS B NZ  1 
ATOM   1286 N N   . LEU B 1 16  ? 67.381  -5.641  85.725 1.00 39.10  ? 17  LEU B N   1 
ATOM   1287 C CA  . LEU B 1 16  ? 67.552  -6.683  84.718 1.00 36.00  ? 17  LEU B CA  1 
ATOM   1288 C C   . LEU B 1 16  ? 68.652  -6.299  83.734 1.00 29.61  ? 17  LEU B C   1 
ATOM   1289 O O   . LEU B 1 16  ? 68.770  -5.132  83.358 1.00 30.72  ? 17  LEU B O   1 
ATOM   1290 C CB  . LEU B 1 16  ? 66.244  -6.937  83.962 1.00 33.04  ? 17  LEU B CB  1 
ATOM   1291 C CG  . LEU B 1 16  ? 64.921  -7.022  84.731 1.00 35.04  ? 17  LEU B CG  1 
ATOM   1292 C CD1 . LEU B 1 16  ? 63.810  -7.473  83.794 1.00 36.50  ? 17  LEU B CD1 1 
ATOM   1293 C CD2 . LEU B 1 16  ? 65.024  -7.943  85.935 1.00 35.87  ? 17  LEU B CD2 1 
ATOM   1294 N N   . PRO B 1 17  ? 69.464  -7.282  83.313 1.00 31.82  ? 18  PRO B N   1 
ATOM   1295 C CA  . PRO B 1 17  ? 70.497  -7.026  82.303 1.00 33.72  ? 18  PRO B CA  1 
ATOM   1296 C C   . PRO B 1 17  ? 69.885  -6.533  80.998 1.00 37.69  ? 18  PRO B C   1 
ATOM   1297 O O   . PRO B 1 17  ? 68.699  -6.755  80.763 1.00 38.22  ? 18  PRO B O   1 
ATOM   1298 C CB  . PRO B 1 17  ? 71.162  -8.394  82.122 1.00 29.93  ? 18  PRO B CB  1 
ATOM   1299 C CG  . PRO B 1 17  ? 70.894  -9.111  83.398 1.00 33.73  ? 18  PRO B CG  1 
ATOM   1300 C CD  . PRO B 1 17  ? 69.530  -8.658  83.831 1.00 37.07  ? 18  PRO B CD  1 
ATOM   1301 N N   . LYS B 1 18  ? 70.677  -5.871  80.164 1.00 40.63  ? 19  LYS B N   1 
ATOM   1302 C CA  . LYS B 1 18  ? 70.145  -5.283  78.943 1.00 35.92  ? 19  LYS B CA  1 
ATOM   1303 C C   . LYS B 1 18  ? 69.687  -6.339  77.945 1.00 36.78  ? 19  LYS B C   1 
ATOM   1304 O O   . LYS B 1 18  ? 68.665  -6.165  77.276 1.00 40.84  ? 19  LYS B O   1 
ATOM   1305 C CB  . LYS B 1 18  ? 71.178  -4.373  78.285 1.00 39.32  ? 19  LYS B CB  1 
ATOM   1306 C CG  . LYS B 1 18  ? 70.549  -3.337  77.379 1.00 40.50  ? 19  LYS B CG  1 
ATOM   1307 C CD  . LYS B 1 18  ? 69.739  -2.350  78.202 1.00 47.23  ? 19  LYS B CD  1 
ATOM   1308 C CE  . LYS B 1 18  ? 68.890  -1.445  77.328 1.00 47.07  ? 19  LYS B CE  1 
ATOM   1309 N NZ  . LYS B 1 18  ? 67.687  -2.147  76.803 1.00 52.40  ? 19  LYS B NZ  1 
ATOM   1310 N N   . SER B 1 19  ? 70.442  -7.429  77.841 1.00 29.74  ? 20  SER B N   1 
ATOM   1311 C CA  . SER B 1 19  ? 70.091  -8.496  76.913 1.00 35.70  ? 20  SER B CA  1 
ATOM   1312 C C   . SER B 1 19  ? 68.766  -9.131  77.313 1.00 34.51  ? 20  SER B C   1 
ATOM   1313 O O   . SER B 1 19  ? 67.935  -9.446  76.465 1.00 31.31  ? 20  SER B O   1 
ATOM   1314 C CB  . SER B 1 19  ? 71.186  -9.557  76.865 1.00 26.38  ? 20  SER B CB  1 
ATOM   1315 O OG  . SER B 1 19  ? 71.166  -10.351 78.037 1.00 35.21  ? 20  SER B OG  1 
ATOM   1316 N N   . VAL B 1 20  ? 68.575  -9.313  78.614 1.00 27.47  ? 21  VAL B N   1 
ATOM   1317 C CA  . VAL B 1 20  ? 67.334  -9.871  79.129 1.00 23.91  ? 21  VAL B CA  1 
ATOM   1318 C C   . VAL B 1 20  ? 66.166  -8.924  78.852 1.00 34.18  ? 21  VAL B C   1 
ATOM   1319 O O   . VAL B 1 20  ? 65.107  -9.355  78.399 1.00 32.90  ? 21  VAL B O   1 
ATOM   1320 C CB  . VAL B 1 20  ? 67.438  -10.168 80.639 1.00 31.61  ? 21  VAL B CB  1 
ATOM   1321 C CG1 . VAL B 1 20  ? 66.075  -10.502 81.212 1.00 29.10  ? 21  VAL B CG1 1 
ATOM   1322 C CG2 . VAL B 1 20  ? 68.415  -11.313 80.884 1.00 31.42  ? 21  VAL B CG2 1 
ATOM   1323 N N   . GLN B 1 21  ? 66.370  -7.633  79.103 1.00 31.02  ? 22  GLN B N   1 
ATOM   1324 C CA  . GLN B 1 21  ? 65.346  -6.631  78.818 1.00 28.68  ? 22  GLN B CA  1 
ATOM   1325 C C   . GLN B 1 21  ? 64.961  -6.630  77.342 1.00 30.75  ? 22  GLN B C   1 
ATOM   1326 O O   . GLN B 1 21  ? 63.779  -6.586  77.011 1.00 32.70  ? 22  GLN B O   1 
ATOM   1327 C CB  . GLN B 1 21  ? 65.812  -5.233  79.226 1.00 34.71  ? 22  GLN B CB  1 
ATOM   1328 C CG  . GLN B 1 21  ? 65.843  -4.993  80.724 1.00 33.85  ? 22  GLN B CG  1 
ATOM   1329 C CD  . GLN B 1 21  ? 66.200  -3.561  81.070 1.00 36.04  ? 22  GLN B CD  1 
ATOM   1330 O OE1 . GLN B 1 21  ? 65.865  -2.628  80.336 1.00 38.58  ? 22  GLN B OE1 1 
ATOM   1331 N NE2 . GLN B 1 21  ? 66.890  -3.380  82.192 1.00 38.43  ? 22  GLN B NE2 1 
ATOM   1332 N N   . ASN B 1 22  ? 65.958  -6.680  76.460 1.00 27.48  ? 23  ASN B N   1 
ATOM   1333 C CA  . ASN B 1 22  ? 65.698  -6.713  75.023 1.00 28.35  ? 23  ASN B CA  1 
ATOM   1334 C C   . ASN B 1 22  ? 64.919  -7.954  74.607 1.00 32.29  ? 23  ASN B C   1 
ATOM   1335 O O   . ASN B 1 22  ? 64.060  -7.894  73.730 1.00 29.10  ? 23  ASN B O   1 
ATOM   1336 C CB  . ASN B 1 22  ? 67.007  -6.650  74.231 1.00 26.52  ? 23  ASN B CB  1 
ATOM   1337 C CG  . ASN B 1 22  ? 67.710  -5.315  74.366 1.00 27.69  ? 23  ASN B CG  1 
ATOM   1338 O OD1 . ASN B 1 22  ? 67.082  -4.290  74.637 1.00 25.35  ? 23  ASN B OD1 1 
ATOM   1339 N ND2 . ASN B 1 22  ? 69.025  -5.319  74.168 1.00 29.59  ? 23  ASN B ND2 1 
ATOM   1340 N N   . LYS B 1 23  ? 65.227  -9.080  75.241 1.00 30.23  ? 24  LYS B N   1 
ATOM   1341 C CA  . LYS B 1 23  ? 64.592  -10.348 74.898 1.00 27.93  ? 24  LYS B CA  1 
ATOM   1342 C C   . LYS B 1 23  ? 63.117  -10.352 75.286 1.00 26.75  ? 24  LYS B C   1 
ATOM   1343 O O   . LYS B 1 23  ? 62.266  -10.781 74.503 1.00 29.49  ? 24  LYS B O   1 
ATOM   1344 C CB  . LYS B 1 23  ? 65.324  -11.514 75.566 1.00 34.18  ? 24  LYS B CB  1 
ATOM   1345 C CG  . LYS B 1 23  ? 66.614  -11.904 74.854 1.00 33.67  ? 24  LYS B CG  1 
ATOM   1346 C CD  . LYS B 1 23  ? 67.445  -12.902 75.652 1.00 36.74  ? 24  LYS B CD  1 
ATOM   1347 C CE  . LYS B 1 23  ? 68.765  -13.185 74.946 1.00 38.61  ? 24  LYS B CE  1 
ATOM   1348 N NZ  . LYS B 1 23  ? 69.569  -14.259 75.598 1.00 35.12  ? 24  LYS B NZ  1 
ATOM   1349 N N   . LEU B 1 24  ? 62.817  -9.862  76.486 1.00 27.92  ? 25  LEU B N   1 
ATOM   1350 C CA  . LEU B 1 24  ? 61.437  -9.766  76.948 1.00 29.25  ? 25  LEU B CA  1 
ATOM   1351 C C   . LEU B 1 24  ? 60.673  -8.727  76.146 1.00 29.35  ? 25  LEU B C   1 
ATOM   1352 O O   . LEU B 1 24  ? 59.539  -8.958  75.733 1.00 27.26  ? 25  LEU B O   1 
ATOM   1353 C CB  . LEU B 1 24  ? 61.377  -9.398  78.429 1.00 26.84  ? 25  LEU B CB  1 
ATOM   1354 C CG  . LEU B 1 24  ? 61.980  -10.354 79.452 1.00 26.98  ? 25  LEU B CG  1 
ATOM   1355 C CD1 . LEU B 1 24  ? 61.881  -9.739  80.837 1.00 30.35  ? 25  LEU B CD1 1 
ATOM   1356 C CD2 . LEU B 1 24  ? 61.277  -11.699 79.403 1.00 19.42  ? 25  LEU B CD2 1 
ATOM   1357 N N   . GLU B 1 25  ? 61.306  -7.576  75.945 1.00 32.95  ? 26  GLU B N   1 
ATOM   1358 C CA  . GLU B 1 25  ? 60.667  -6.454  75.270 1.00 35.93  ? 26  GLU B CA  1 
ATOM   1359 C C   . GLU B 1 25  ? 60.261  -6.825  73.850 1.00 33.80  ? 26  GLU B C   1 
ATOM   1360 O O   . GLU B 1 25  ? 59.174  -6.468  73.394 1.00 32.95  ? 26  GLU B O   1 
ATOM   1361 C CB  . GLU B 1 25  ? 61.595  -5.239  75.249 1.00 33.42  ? 26  GLU B CB  1 
ATOM   1362 C CG  . GLU B 1 25  ? 61.000  -4.011  74.584 1.00 44.00  ? 26  GLU B CG  1 
ATOM   1363 C CD  . GLU B 1 25  ? 59.796  -3.465  75.324 1.00 56.73  ? 26  GLU B CD  1 
ATOM   1364 O OE1 . GLU B 1 25  ? 58.861  -2.975  74.657 1.00 47.38  ? 26  GLU B OE1 1 
ATOM   1365 O OE2 . GLU B 1 25  ? 59.785  -3.521  76.570 1.00 51.34  ? 26  GLU B OE2 1 
ATOM   1366 N N   . LYS B 1 26  ? 61.136  -7.548  73.159 1.00 30.66  ? 27  LYS B N   1 
ATOM   1367 C CA  . LYS B 1 26  ? 60.850  -8.001  71.806 1.00 27.60  ? 27  LYS B CA  1 
ATOM   1368 C C   . LYS B 1 26  ? 59.642  -8.925  71.775 1.00 29.65  ? 27  LYS B C   1 
ATOM   1369 O O   . LYS B 1 26  ? 58.771  -8.801  70.918 1.00 30.24  ? 27  LYS B O   1 
ATOM   1370 C CB  . LYS B 1 26  ? 62.055  -8.724  71.206 1.00 27.85  ? 27  LYS B CB  1 
ATOM   1371 C CG  . LYS B 1 26  ? 61.751  -9.293  69.837 1.00 35.91  ? 27  LYS B CG  1 
ATOM   1372 C CD  . LYS B 1 26  ? 62.670  -10.431 69.474 1.00 44.08  ? 27  LYS B CD  1 
ATOM   1373 C CE  . LYS B 1 26  ? 62.175  -11.116 68.218 1.00 41.13  ? 27  LYS B CE  1 
ATOM   1374 N NZ  . LYS B 1 26  ? 62.121  -10.163 67.079 1.00 41.99  ? 27  LYS B NZ  1 
ATOM   1375 N N   . PHE B 1 27  ? 59.603  -9.858  72.720 1.00 28.47  ? 28  PHE B N   1 
ATOM   1376 C CA  . PHE B 1 27  ? 58.538  -10.852 72.773 1.00 21.07  ? 28  PHE B CA  1 
ATOM   1377 C C   . PHE B 1 27  ? 57.204  -10.218 73.128 1.00 31.76  ? 28  PHE B C   1 
ATOM   1378 O O   . PHE B 1 27  ? 56.181  -10.518 72.515 1.00 29.15  ? 28  PHE B O   1 
ATOM   1379 C CB  . PHE B 1 27  ? 58.872  -11.947 73.786 1.00 20.88  ? 28  PHE B CB  1 
ATOM   1380 C CG  . PHE B 1 27  ? 57.870  -13.060 73.820 1.00 31.04  ? 28  PHE B CG  1 
ATOM   1381 C CD1 . PHE B 1 27  ? 57.846  -14.011 72.815 1.00 32.90  ? 28  PHE B CD1 1 
ATOM   1382 C CD2 . PHE B 1 27  ? 56.960  -13.165 74.859 1.00 36.01  ? 28  PHE B CD2 1 
ATOM   1383 C CE1 . PHE B 1 27  ? 56.927  -15.045 72.840 1.00 31.37  ? 28  PHE B CE1 1 
ATOM   1384 C CE2 . PHE B 1 27  ? 56.040  -14.197 74.890 1.00 34.99  ? 28  PHE B CE2 1 
ATOM   1385 C CZ  . PHE B 1 27  ? 56.024  -15.137 73.879 1.00 27.48  ? 28  PHE B CZ  1 
ATOM   1386 N N   . LEU B 1 28  ? 57.227  -9.346  74.129 1.00 31.64  ? 29  LEU B N   1 
ATOM   1387 C CA  . LEU B 1 28  ? 56.038  -8.625  74.555 1.00 29.43  ? 29  LEU B CA  1 
ATOM   1388 C C   . LEU B 1 28  ? 55.438  -7.829  73.402 1.00 31.19  ? 29  LEU B C   1 
ATOM   1389 O O   . LEU B 1 28  ? 54.222  -7.752  73.259 1.00 29.90  ? 29  LEU B O   1 
ATOM   1390 C CB  . LEU B 1 28  ? 56.369  -7.695  75.723 1.00 32.57  ? 29  LEU B CB  1 
ATOM   1391 C CG  . LEU B 1 28  ? 56.528  -8.332  77.105 1.00 32.48  ? 29  LEU B CG  1 
ATOM   1392 C CD1 . LEU B 1 28  ? 57.335  -7.428  78.019 1.00 30.20  ? 29  LEU B CD1 1 
ATOM   1393 C CD2 . LEU B 1 28  ? 55.160  -8.596  77.702 1.00 31.24  ? 29  LEU B CD2 1 
ATOM   1394 N N   . ALA B 1 29  ? 56.300  -7.246  72.576 1.00 30.72  ? 30  ALA B N   1 
ATOM   1395 C CA  . ALA B 1 29  ? 55.848  -6.443  71.447 1.00 24.21  ? 30  ALA B CA  1 
ATOM   1396 C C   . ALA B 1 29  ? 55.239  -7.316  70.358 1.00 27.44  ? 30  ALA B C   1 
ATOM   1397 O O   . ALA B 1 29  ? 54.211  -6.965  69.776 1.00 26.53  ? 30  ALA B O   1 
ATOM   1398 C CB  . ALA B 1 29  ? 56.998  -5.624  70.885 1.00 22.77  ? 30  ALA B CB  1 
ATOM   1399 N N   . ASP B 1 30  ? 55.885  -8.448  70.085 1.00 24.68  ? 31  ASP B N   1 
ATOM   1400 C CA  . ASP B 1 30  ? 55.396  -9.407  69.100 1.00 26.99  ? 31  ASP B CA  1 
ATOM   1401 C C   . ASP B 1 30  ? 53.955  -9.824  69.396 1.00 24.80  ? 31  ASP B C   1 
ATOM   1402 O O   . ASP B 1 30  ? 53.130  -9.920  68.489 1.00 30.58  ? 31  ASP B O   1 
ATOM   1403 C CB  . ASP B 1 30  ? 56.300  -10.645 69.060 1.00 24.40  ? 31  ASP B CB  1 
ATOM   1404 C CG  . ASP B 1 30  ? 57.476  -10.490 68.110 1.00 39.46  ? 31  ASP B CG  1 
ATOM   1405 O OD1 . ASP B 1 30  ? 57.889  -9.346  67.836 1.00 37.17  ? 31  ASP B OD1 1 
ATOM   1406 O OD2 . ASP B 1 30  ? 57.991  -11.524 67.637 1.00 45.19  ? 31  ASP B OD2 1 
ATOM   1407 N N   . GLN B 1 31  ? 53.659  -10.062 70.670 1.00 26.09  ? 32  GLN B N   1 
ATOM   1408 C CA  . GLN B 1 31  ? 52.326  -10.485 71.080 1.00 27.28  ? 32  GLN B CA  1 
ATOM   1409 C C   . GLN B 1 31  ? 51.305  -9.359  70.980 1.00 28.62  ? 32  GLN B C   1 
ATOM   1410 O O   . GLN B 1 31  ? 50.170  -9.572  70.561 1.00 28.32  ? 32  GLN B O   1 
ATOM   1411 C CB  . GLN B 1 31  ? 52.362  -11.027 72.506 1.00 26.35  ? 32  GLN B CB  1 
ATOM   1412 C CG  . GLN B 1 31  ? 53.159  -12.305 72.644 1.00 24.52  ? 32  GLN B CG  1 
ATOM   1413 C CD  . GLN B 1 31  ? 52.658  -13.173 73.773 1.00 33.10  ? 32  GLN B CD  1 
ATOM   1414 O OE1 . GLN B 1 31  ? 52.292  -14.328 73.563 1.00 39.49  ? 32  GLN B OE1 1 
ATOM   1415 N NE2 . GLN B 1 31  ? 52.633  -12.622 74.979 1.00 35.96  ? 32  GLN B NE2 1 
ATOM   1416 N N   . GLN B 1 32  ? 51.715  -8.162  71.377 1.00 23.47  ? 33  GLN B N   1 
ATOM   1417 C CA  . GLN B 1 32  ? 50.853  -6.994  71.290 1.00 25.68  ? 33  GLN B CA  1 
ATOM   1418 C C   . GLN B 1 32  ? 50.605  -6.638  69.834 1.00 31.43  ? 33  GLN B C   1 
ATOM   1419 O O   . GLN B 1 32  ? 49.523  -6.173  69.466 1.00 25.60  ? 33  GLN B O   1 
ATOM   1420 C CB  . GLN B 1 32  ? 51.473  -5.815  72.035 1.00 21.56  ? 33  GLN B CB  1 
ATOM   1421 C CG  . GLN B 1 32  ? 50.641  -4.553  71.996 1.00 26.45  ? 33  GLN B CG  1 
ATOM   1422 C CD  . GLN B 1 32  ? 50.584  -3.869  73.340 1.00 52.74  ? 33  GLN B CD  1 
ATOM   1423 O OE1 . GLN B 1 32  ? 51.246  -2.859  73.563 1.00 61.75  ? 33  GLN B OE1 1 
ATOM   1424 N NE2 . GLN B 1 32  ? 49.790  -4.418  74.250 1.00 52.99  ? 33  GLN B NE2 1 
ATOM   1425 N N   . SER B 1 33  ? 51.619  -6.865  69.007 1.00 26.30  ? 34  SER B N   1 
ATOM   1426 C CA  . SER B 1 33  ? 51.481  -6.665  67.576 1.00 24.11  ? 34  SER B CA  1 
ATOM   1427 C C   . SER B 1 33  ? 50.467  -7.653  67.017 1.00 31.37  ? 34  SER B C   1 
ATOM   1428 O O   . SER B 1 33  ? 49.688  -7.321  66.128 1.00 28.16  ? 34  SER B O   1 
ATOM   1429 C CB  . SER B 1 33  ? 52.826  -6.824  66.871 1.00 28.49  ? 34  SER B CB  1 
ATOM   1430 O OG  . SER B 1 33  ? 52.676  -6.695  65.469 1.00 44.21  ? 34  SER B OG  1 
ATOM   1431 N N   . GLU B 1 34  ? 50.473  -8.868  67.554 1.00 21.53  ? 35  GLU B N   1 
ATOM   1432 C CA  . GLU B 1 34  ? 49.527  -9.893  67.126 1.00 26.65  ? 35  GLU B CA  1 
ATOM   1433 C C   . GLU B 1 34  ? 48.108  -9.589  67.609 1.00 27.38  ? 35  GLU B C   1 
ATOM   1434 O O   . GLU B 1 34  ? 47.140  -9.826  66.886 1.00 29.65  ? 35  GLU B O   1 
ATOM   1435 C CB  . GLU B 1 34  ? 49.965  -11.277 67.619 1.00 32.22  ? 35  GLU B CB  1 
ATOM   1436 C CG  . GLU B 1 34  ? 49.098  -12.410 67.088 1.00 38.23  ? 35  GLU B CG  1 
ATOM   1437 C CD  . GLU B 1 34  ? 49.705  -13.780 67.308 1.00 54.52  ? 35  GLU B CD  1 
ATOM   1438 O OE1 . GLU B 1 34  ? 50.753  -13.870 67.977 1.00 50.11  ? 35  GLU B OE1 1 
ATOM   1439 O OE2 . GLU B 1 34  ? 49.132  -14.768 66.805 1.00 61.00  ? 35  GLU B OE2 1 
ATOM   1440 N N   . ILE B 1 35  ? 47.990  -9.065  68.827 1.00 26.88  ? 36  ILE B N   1 
ATOM   1441 C CA  . ILE B 1 35  ? 46.693  -8.687  69.386 1.00 28.70  ? 36  ILE B CA  1 
ATOM   1442 C C   . ILE B 1 35  ? 46.050  -7.537  68.622 1.00 29.03  ? 36  ILE B C   1 
ATOM   1443 O O   . ILE B 1 35  ? 44.888  -7.624  68.210 1.00 27.63  ? 36  ILE B O   1 
ATOM   1444 C CB  . ILE B 1 35  ? 46.817  -8.283  70.866 1.00 29.08  ? 36  ILE B CB  1 
ATOM   1445 C CG1 . ILE B 1 35  ? 47.094  -9.515  71.726 1.00 30.33  ? 36  ILE B CG1 1 
ATOM   1446 C CG2 . ILE B 1 35  ? 45.559  -7.568  71.338 1.00 24.23  ? 36  ILE B CG2 1 
ATOM   1447 C CD1 . ILE B 1 35  ? 47.208  -9.210  73.198 1.00 28.78  ? 36  ILE B CD1 1 
ATOM   1448 N N   . ASP B 1 36  ? 46.810  -6.459  68.440 1.00 27.42  ? 37  ASP B N   1 
ATOM   1449 C CA  . ASP B 1 36  ? 46.338  -5.304  67.684 1.00 28.78  ? 37  ASP B CA  1 
ATOM   1450 C C   . ASP B 1 36  ? 46.007  -5.696  66.248 1.00 26.88  ? 37  ASP B C   1 
ATOM   1451 O O   . ASP B 1 36  ? 45.201  -5.045  65.587 1.00 27.63  ? 37  ASP B O   1 
ATOM   1452 C CB  . ASP B 1 36  ? 47.384  -4.185  67.692 1.00 30.47  ? 37  ASP B CB  1 
ATOM   1453 C CG  . ASP B 1 36  ? 47.731  -3.720  69.090 1.00 41.27  ? 37  ASP B CG  1 
ATOM   1454 O OD1 . ASP B 1 36  ? 46.830  -3.701  69.952 1.00 45.47  ? 37  ASP B OD1 1 
ATOM   1455 O OD2 . ASP B 1 36  ? 48.904  -3.374  69.327 1.00 41.83  ? 37  ASP B OD2 1 
ATOM   1456 N N   . GLY B 1 37  ? 46.650  -6.756  65.770 1.00 30.03  ? 38  GLY B N   1 
ATOM   1457 C CA  . GLY B 1 37  ? 46.406  -7.260  64.434 1.00 26.86  ? 38  GLY B CA  1 
ATOM   1458 C C   . GLY B 1 37  ? 45.058  -7.945  64.358 1.00 29.46  ? 38  GLY B C   1 
ATOM   1459 O O   . GLY B 1 37  ? 44.307  -7.760  63.401 1.00 26.01  ? 38  GLY B O   1 
ATOM   1460 N N   . LEU B 1 38  ? 44.754  -8.738  65.381 1.00 29.22  ? 39  LEU B N   1 
ATOM   1461 C CA  . LEU B 1 38  ? 43.477  -9.432  65.476 1.00 27.71  ? 39  LEU B CA  1 
ATOM   1462 C C   . LEU B 1 38  ? 42.326  -8.454  65.648 1.00 28.94  ? 39  LEU B C   1 
ATOM   1463 O O   . LEU B 1 38  ? 41.251  -8.639  65.074 1.00 32.45  ? 39  LEU B O   1 
ATOM   1464 C CB  . LEU B 1 38  ? 43.495  -10.426 66.638 1.00 26.92  ? 39  LEU B CB  1 
ATOM   1465 C CG  . LEU B 1 38  ? 44.243  -11.735 66.385 1.00 26.37  ? 39  LEU B CG  1 
ATOM   1466 C CD1 . LEU B 1 38  ? 44.505  -12.458 67.691 1.00 29.80  ? 39  LEU B CD1 1 
ATOM   1467 C CD2 . LEU B 1 38  ? 43.430  -12.613 65.446 1.00 24.46  ? 39  LEU B CD2 1 
ATOM   1468 N N   . LYS B 1 39  ? 42.553  -7.417  66.446 1.00 28.67  ? 40  LYS B N   1 
ATOM   1469 C CA  . LYS B 1 39  ? 41.541  -6.390  66.654 1.00 24.30  ? 40  LYS B CA  1 
ATOM   1470 C C   . LYS B 1 39  ? 41.249  -5.633  65.362 1.00 26.96  ? 40  LYS B C   1 
ATOM   1471 O O   . LYS B 1 39  ? 40.087  -5.390  65.030 1.00 30.31  ? 40  LYS B O   1 
ATOM   1472 C CB  . LYS B 1 39  ? 41.976  -5.424  67.753 1.00 24.04  ? 40  LYS B CB  1 
ATOM   1473 C CG  . LYS B 1 39  ? 41.649  -5.929  69.145 1.00 29.34  ? 40  LYS B CG  1 
ATOM   1474 C CD  . LYS B 1 39  ? 42.043  -4.924  70.209 1.00 31.96  ? 40  LYS B CD  1 
ATOM   1475 C CE  . LYS B 1 39  ? 41.746  -5.468  71.595 1.00 37.84  ? 40  LYS B CE  1 
ATOM   1476 N NZ  . LYS B 1 39  ? 42.292  -4.593  72.665 1.00 42.26  ? 40  LYS B NZ  1 
ATOM   1477 N N   . GLY B 1 40  ? 42.300  -5.269  64.634 1.00 25.50  ? 41  GLY B N   1 
ATOM   1478 C CA  . GLY B 1 40  ? 42.139  -4.621  63.344 1.00 27.86  ? 41  GLY B CA  1 
ATOM   1479 C C   . GLY B 1 40  ? 41.406  -5.511  62.354 1.00 26.43  ? 41  GLY B C   1 
ATOM   1480 O O   . GLY B 1 40  ? 40.542  -5.050  61.608 1.00 35.46  ? 41  GLY B O   1 
ATOM   1481 N N   . ARG B 1 41  ? 41.756  -6.793  62.358 1.00 25.57  ? 42  ARG B N   1 
ATOM   1482 C CA  . ARG B 1 41  ? 41.133  -7.785  61.488 1.00 32.22  ? 42  ARG B CA  1 
ATOM   1483 C C   . ARG B 1 41  ? 39.638  -7.887  61.758 1.00 28.38  ? 42  ARG B C   1 
ATOM   1484 O O   . ARG B 1 41  ? 38.824  -7.884  60.834 1.00 32.53  ? 42  ARG B O   1 
ATOM   1485 C CB  . ARG B 1 41  ? 41.809  -9.144  61.689 1.00 31.13  ? 42  ARG B CB  1 
ATOM   1486 C CG  . ARG B 1 41  ? 41.173  -10.325 60.964 1.00 40.17  ? 42  ARG B CG  1 
ATOM   1487 C CD  . ARG B 1 41  ? 41.405  -11.605 61.767 1.00 55.33  ? 42  ARG B CD  1 
ATOM   1488 N NE  . ARG B 1 41  ? 41.198  -12.825 60.991 1.00 61.01  ? 42  ARG B NE  1 
ATOM   1489 C CZ  . ARG B 1 41  ? 41.129  -14.044 61.519 1.00 59.25  ? 42  ARG B CZ  1 
ATOM   1490 N NH1 . ARG B 1 41  ? 40.942  -15.097 60.738 1.00 53.16  ? 42  ARG B NH1 1 
ATOM   1491 N NH2 . ARG B 1 41  ? 41.240  -14.211 62.830 1.00 52.49  ? 42  ARG B NH2 1 
ATOM   1492 N N   . HIS B 1 42  ? 39.282  -7.962  63.035 1.00 26.52  ? 43  HIS B N   1 
ATOM   1493 C CA  . HIS B 1 42  ? 37.887  -8.104  63.422 1.00 30.65  ? 43  HIS B CA  1 
ATOM   1494 C C   . HIS B 1 42  ? 37.066  -6.858  63.112 1.00 31.36  ? 43  HIS B C   1 
ATOM   1495 O O   . HIS B 1 42  ? 35.914  -6.960  62.690 1.00 31.78  ? 43  HIS B O   1 
ATOM   1496 C CB  . HIS B 1 42  ? 37.775  -8.428  64.907 1.00 32.20  ? 43  HIS B CB  1 
ATOM   1497 C CG  . HIS B 1 42  ? 36.364  -8.587  65.373 1.00 35.50  ? 43  HIS B CG  1 
ATOM   1498 N ND1 . HIS B 1 42  ? 35.452  -9.371  64.705 1.00 40.81  ? 43  HIS B ND1 1 
ATOM   1499 C CD2 . HIS B 1 42  ? 35.711  -8.059  66.434 1.00 37.24  ? 43  HIS B CD2 1 
ATOM   1500 C CE1 . HIS B 1 42  ? 34.290  -9.321  65.336 1.00 38.62  ? 43  HIS B CE1 1 
ATOM   1501 N NE2 . HIS B 1 42  ? 34.419  -8.530  66.384 1.00 47.02  ? 43  HIS B NE2 1 
ATOM   1502 N N   . GLU B 1 43  ? 37.656  -5.686  63.331 1.00 31.02  ? 44  GLU B N   1 
ATOM   1503 C CA  . GLU B 1 43  ? 36.956  -4.429  63.091 1.00 29.45  ? 44  GLU B CA  1 
ATOM   1504 C C   . GLU B 1 43  ? 36.611  -4.255  61.616 1.00 30.79  ? 44  GLU B C   1 
ATOM   1505 O O   . GLU B 1 43  ? 35.507  -3.825  61.284 1.00 32.95  ? 44  GLU B O   1 
ATOM   1506 C CB  . GLU B 1 43  ? 37.786  -3.237  63.565 1.00 33.05  ? 44  GLU B CB  1 
ATOM   1507 C CG  . GLU B 1 43  ? 37.030  -2.267  64.472 1.00 47.76  ? 44  GLU B CG  1 
ATOM   1508 C CD  . GLU B 1 43  ? 35.785  -1.676  63.828 1.00 54.62  ? 44  GLU B CD  1 
ATOM   1509 O OE1 . GLU B 1 43  ? 34.742  -1.592  64.514 1.00 48.29  ? 44  GLU B OE1 1 
ATOM   1510 O OE2 . GLU B 1 43  ? 35.846  -1.284  62.645 1.00 51.59  ? 44  GLU B OE2 1 
ATOM   1511 N N   . LYS B 1 44  ? 37.547  -4.585  60.730 1.00 30.47  ? 45  LYS B N   1 
ATOM   1512 C CA  . LYS B 1 44  ? 37.295  -4.437  59.302 1.00 32.97  ? 45  LYS B CA  1 
ATOM   1513 C C   . LYS B 1 44  ? 36.282  -5.469  58.820 1.00 25.58  ? 45  LYS B C   1 
ATOM   1514 O O   . LYS B 1 44  ? 35.469  -5.184  57.942 1.00 24.11  ? 45  LYS B O   1 
ATOM   1515 C CB  . LYS B 1 44  ? 38.592  -4.555  58.500 1.00 35.07  ? 45  LYS B CB  1 
ATOM   1516 C CG  . LYS B 1 44  ? 39.527  -3.357  58.633 1.00 53.06  ? 45  LYS B CG  1 
ATOM   1517 C CD  . LYS B 1 44  ? 40.739  -3.457  57.705 1.00 60.33  ? 45  LYS B CD  1 
ATOM   1518 C CE  . LYS B 1 44  ? 40.385  -3.173  56.245 1.00 57.21  ? 45  LYS B CE  1 
ATOM   1519 N NZ  . LYS B 1 44  ? 39.720  -4.313  55.550 1.00 41.66  ? 45  LYS B NZ  1 
ATOM   1520 N N   . PHE B 1 45  ? 36.332  -6.666  59.395 1.00 22.34  ? 46  PHE B N   1 
ATOM   1521 C CA  . PHE B 1 45  ? 35.398  -7.721  59.019 1.00 25.20  ? 46  PHE B CA  1 
ATOM   1522 C C   . PHE B 1 45  ? 33.998  -7.349  59.471 1.00 29.35  ? 46  PHE B C   1 
ATOM   1523 O O   . PHE B 1 45  ? 33.019  -7.633  58.786 1.00 29.64  ? 46  PHE B O   1 
ATOM   1524 C CB  . PHE B 1 45  ? 35.810  -9.065  59.625 1.00 30.80  ? 46  PHE B CB  1 
ATOM   1525 C CG  . PHE B 1 45  ? 34.953  -10.225 59.183 1.00 26.96  ? 46  PHE B CG  1 
ATOM   1526 C CD1 . PHE B 1 45  ? 35.389  -11.079 58.184 1.00 26.39  ? 46  PHE B CD1 1 
ATOM   1527 C CD2 . PHE B 1 45  ? 33.721  -10.469 59.773 1.00 30.20  ? 46  PHE B CD2 1 
ATOM   1528 C CE1 . PHE B 1 45  ? 34.611  -12.148 57.776 1.00 35.02  ? 46  PHE B CE1 1 
ATOM   1529 C CE2 . PHE B 1 45  ? 32.936  -11.532 59.365 1.00 33.87  ? 46  PHE B CE2 1 
ATOM   1530 C CZ  . PHE B 1 45  ? 33.382  -12.373 58.368 1.00 37.44  ? 46  PHE B CZ  1 
ATOM   1531 N N   . LYS B 1 46  ? 33.910  -6.723  60.636 1.00 28.55  ? 47  LYS B N   1 
ATOM   1532 C CA  . LYS B 1 46  ? 32.632  -6.290  61.173 1.00 31.07  ? 47  LYS B CA  1 
ATOM   1533 C C   . LYS B 1 46  ? 32.030  -5.212  60.275 1.00 30.41  ? 47  LYS B C   1 
ATOM   1534 O O   . LYS B 1 46  ? 30.836  -5.231  59.976 1.00 34.73  ? 47  LYS B O   1 
ATOM   1535 C CB  . LYS B 1 46  ? 32.812  -5.788  62.609 1.00 28.13  ? 47  LYS B CB  1 
ATOM   1536 C CG  . LYS B 1 46  ? 31.610  -5.089  63.211 1.00 35.38  ? 47  LYS B CG  1 
ATOM   1537 C CD  . LYS B 1 46  ? 31.931  -4.586  64.613 1.00 43.56  ? 47  LYS B CD  1 
ATOM   1538 C CE  . LYS B 1 46  ? 30.983  -3.478  65.038 1.00 50.91  ? 47  LYS B CE  1 
ATOM   1539 N NZ  . LYS B 1 46  ? 31.717  -2.248  65.456 1.00 56.79  ? 47  LYS B NZ  1 
ATOM   1540 N N   . VAL B 1 47  ? 32.877  -4.297  59.816 1.00 22.65  ? 48  VAL B N   1 
ATOM   1541 C CA  . VAL B 1 47  ? 32.435  -3.180  58.985 1.00 21.21  ? 48  VAL B CA  1 
ATOM   1542 C C   . VAL B 1 47  ? 31.989  -3.650  57.601 1.00 31.03  ? 48  VAL B C   1 
ATOM   1543 O O   . VAL B 1 47  ? 31.009  -3.147  57.051 1.00 30.51  ? 48  VAL B O   1 
ATOM   1544 C CB  . VAL B 1 47  ? 33.546  -2.118  58.845 1.00 28.87  ? 48  VAL B CB  1 
ATOM   1545 C CG1 . VAL B 1 47  ? 33.187  -1.087  57.791 1.00 27.53  ? 48  VAL B CG1 1 
ATOM   1546 C CG2 . VAL B 1 47  ? 33.789  -1.438  60.182 1.00 24.33  ? 48  VAL B CG2 1 
ATOM   1547 N N   . GLU B 1 48  ? 32.705  -4.622  57.042 1.00 26.55  ? 49  GLU B N   1 
ATOM   1548 C CA  . GLU B 1 48  ? 32.325  -5.198  55.755 1.00 29.68  ? 49  GLU B CA  1 
ATOM   1549 C C   . GLU B 1 48  ? 31.033  -5.993  55.893 1.00 29.56  ? 49  GLU B C   1 
ATOM   1550 O O   . GLU B 1 48  ? 30.133  -5.885  55.063 1.00 27.02  ? 49  GLU B O   1 
ATOM   1551 C CB  . GLU B 1 48  ? 33.436  -6.096  55.200 1.00 29.31  ? 49  GLU B CB  1 
ATOM   1552 C CG  . GLU B 1 48  ? 34.100  -5.567  53.932 1.00 33.81  ? 49  GLU B CG  1 
ATOM   1553 C CD  . GLU B 1 48  ? 33.182  -5.586  52.720 1.00 41.60  ? 49  GLU B CD  1 
ATOM   1554 O OE1 . GLU B 1 48  ? 32.643  -6.664  52.391 1.00 43.60  ? 49  GLU B OE1 1 
ATOM   1555 O OE2 . GLU B 1 48  ? 33.003  -4.520  52.093 1.00 55.61  ? 49  GLU B OE2 1 
ATOM   1556 N N   . SER B 1 49  ? 30.950  -6.787  56.955 1.00 27.55  ? 50  SER B N   1 
ATOM   1557 C CA  . SER B 1 49  ? 29.791  -7.636  57.213 1.00 26.30  ? 50  SER B CA  1 
ATOM   1558 C C   . SER B 1 49  ? 28.498  -6.838  57.337 1.00 32.39  ? 50  SER B C   1 
ATOM   1559 O O   . SER B 1 49  ? 27.462  -7.235  56.806 1.00 31.41  ? 50  SER B O   1 
ATOM   1560 C CB  . SER B 1 49  ? 30.019  -8.462  58.483 1.00 23.44  ? 50  SER B CB  1 
ATOM   1561 O OG  . SER B 1 49  ? 28.797  -8.965  58.990 1.00 36.24  ? 50  SER B OG  1 
ATOM   1562 N N   . GLU B 1 50  ? 28.563  -5.708  58.033 1.00 27.23  ? 51  GLU B N   1 
ATOM   1563 C CA  . GLU B 1 50  ? 27.386  -4.868  58.226 1.00 31.76  ? 51  GLU B CA  1 
ATOM   1564 C C   . GLU B 1 50  ? 26.997  -4.125  56.950 1.00 34.89  ? 51  GLU B C   1 
ATOM   1565 O O   . GLU B 1 50  ? 25.811  -3.951  56.668 1.00 32.95  ? 51  GLU B O   1 
ATOM   1566 C CB  . GLU B 1 50  ? 27.619  -3.880  59.373 1.00 31.09  ? 51  GLU B CB  1 
ATOM   1567 C CG  . GLU B 1 50  ? 27.657  -4.551  60.737 1.00 48.50  ? 51  GLU B CG  1 
ATOM   1568 C CD  . GLU B 1 50  ? 27.948  -3.591  61.875 1.00 56.61  ? 51  GLU B CD  1 
ATOM   1569 O OE1 . GLU B 1 50  ? 28.145  -2.387  61.611 1.00 62.11  ? 51  GLU B OE1 1 
ATOM   1570 O OE2 . GLU B 1 50  ? 27.983  -4.047  63.037 1.00 61.91  ? 51  GLU B OE2 1 
ATOM   1571 N N   . GLN B 1 51  ? 27.989  -3.694  56.178 1.00 31.70  ? 52  GLN B N   1 
ATOM   1572 C CA  . GLN B 1 51  ? 27.701  -3.014  54.922 1.00 32.00  ? 52  GLN B CA  1 
ATOM   1573 C C   . GLN B 1 51  ? 27.052  -3.969  53.920 1.00 33.55  ? 52  GLN B C   1 
ATOM   1574 O O   . GLN B 1 51  ? 26.083  -3.599  53.252 1.00 38.19  ? 52  GLN B O   1 
ATOM   1575 C CB  . GLN B 1 51  ? 28.968  -2.397  54.328 1.00 29.71  ? 52  GLN B CB  1 
ATOM   1576 C CG  . GLN B 1 51  ? 29.411  -1.107  55.011 1.00 48.55  ? 52  GLN B CG  1 
ATOM   1577 C CD  . GLN B 1 51  ? 28.461  0.058   54.767 1.00 56.07  ? 52  GLN B CD  1 
ATOM   1578 O OE1 . GLN B 1 51  ? 27.425  0.180   55.419 1.00 62.42  ? 52  GLN B OE1 1 
ATOM   1579 N NE2 . GLN B 1 51  ? 28.820  0.925   53.827 1.00 50.86  ? 52  GLN B NE2 1 
ATOM   1580 N N   . GLN B 1 52  ? 27.577  -5.188  53.822 1.00 30.26  ? 53  GLN B N   1 
ATOM   1581 C CA  . GLN B 1 52  ? 26.991  -6.193  52.942 1.00 31.98  ? 53  GLN B CA  1 
ATOM   1582 C C   . GLN B 1 52  ? 25.543  -6.478  53.342 1.00 28.41  ? 53  GLN B C   1 
ATOM   1583 O O   . GLN B 1 52  ? 24.674  -6.618  52.482 1.00 30.68  ? 53  GLN B O   1 
ATOM   1584 C CB  . GLN B 1 52  ? 27.818  -7.481  52.960 1.00 32.16  ? 53  GLN B CB  1 
ATOM   1585 C CG  . GLN B 1 52  ? 29.206  -7.341  52.350 1.00 40.91  ? 53  GLN B CG  1 
ATOM   1586 C CD  . GLN B 1 52  ? 29.165  -7.089  50.854 1.00 44.96  ? 53  GLN B CD  1 
ATOM   1587 O OE1 . GLN B 1 52  ? 28.470  -7.786  50.115 1.00 42.34  ? 53  GLN B OE1 1 
ATOM   1588 N NE2 . GLN B 1 52  ? 29.907  -6.084  50.402 1.00 39.89  ? 53  GLN B NE2 1 
ATOM   1589 N N   . TYR B 1 53  ? 25.286  -6.546  54.647 1.00 29.75  ? 54  TYR B N   1 
ATOM   1590 C CA  . TYR B 1 53  ? 23.929  -6.758  55.142 1.00 32.11  ? 54  TYR B CA  1 
ATOM   1591 C C   . TYR B 1 53  ? 23.047  -5.544  54.882 1.00 31.12  ? 54  TYR B C   1 
ATOM   1592 O O   . TYR B 1 53  ? 21.869  -5.681  54.573 1.00 32.69  ? 54  TYR B O   1 
ATOM   1593 C CB  . TYR B 1 53  ? 23.928  -7.069  56.640 1.00 29.39  ? 54  TYR B CB  1 
ATOM   1594 C CG  . TYR B 1 53  ? 22.578  -7.529  57.162 1.00 36.27  ? 54  TYR B CG  1 
ATOM   1595 C CD1 . TYR B 1 53  ? 22.285  -8.880  57.277 1.00 36.51  ? 54  TYR B CD1 1 
ATOM   1596 C CD2 . TYR B 1 53  ? 21.597  -6.615  57.531 1.00 36.07  ? 54  TYR B CD2 1 
ATOM   1597 C CE1 . TYR B 1 53  ? 21.057  -9.311  57.743 1.00 33.68  ? 54  TYR B CE1 1 
ATOM   1598 C CE2 . TYR B 1 53  ? 20.360  -7.037  57.995 1.00 31.31  ? 54  TYR B CE2 1 
ATOM   1599 C CZ  . TYR B 1 53  ? 20.099  -8.386  58.103 1.00 30.04  ? 54  TYR B CZ  1 
ATOM   1600 O OH  . TYR B 1 53  ? 18.880  -8.816  58.574 1.00 37.17  ? 54  TYR B OH  1 
ATOM   1601 N N   . MET B 1 54  ? 23.620  -4.356  55.037 1.00 29.26  ? 55  MET B N   1 
ATOM   1602 C CA  . MET B 1 54  ? 22.864  -3.123  54.861 1.00 30.87  ? 55  MET B CA  1 
ATOM   1603 C C   . MET B 1 54  ? 22.370  -2.968  53.432 1.00 37.64  ? 55  MET B C   1 
ATOM   1604 O O   . MET B 1 54  ? 21.241  -2.540  53.198 1.00 38.98  ? 55  MET B O   1 
ATOM   1605 C CB  . MET B 1 54  ? 23.717  -1.917  55.244 1.00 30.13  ? 55  MET B CB  1 
ATOM   1606 C CG  . MET B 1 54  ? 22.996  -0.588  55.118 1.00 49.35  ? 55  MET B CG  1 
ATOM   1607 S SD  . MET B 1 54  ? 24.015  0.872   55.873 1.00 112.99 0 55  MET B SD  1 
ATOM   1608 C CE  . MET B 1 54  ? 23.493  2.292   54.656 1.00 71.30  ? 55  MET B CE  1 
ATOM   1609 N N   . GLU B 1 55  ? 23.231  -3.317  52.486 1.00 32.55  ? 56  GLU B N   1 
ATOM   1610 C CA  . GLU B 1 55  ? 22.924  -3.192  51.068 1.00 33.78  ? 56  GLU B CA  1 
ATOM   1611 C C   . GLU B 1 55  ? 21.761  -4.087  50.661 1.00 36.71  ? 56  GLU B C   1 
ATOM   1612 O O   . GLU B 1 55  ? 20.792  -3.624  50.065 1.00 38.24  ? 56  GLU B O   1 
ATOM   1613 C CB  . GLU B 1 55  ? 24.155  -3.526  50.224 1.00 34.79  ? 56  GLU B CB  1 
ATOM   1614 C CG  . GLU B 1 55  ? 23.909  -3.489  48.725 1.00 44.09  ? 56  GLU B CG  1 
ATOM   1615 C CD  . GLU B 1 55  ? 24.679  -4.561  47.980 1.00 51.94  ? 56  GLU B CD  1 
ATOM   1616 O OE1 . GLU B 1 55  ? 24.234  -5.727  47.993 1.00 57.52  ? 56  GLU B OE1 1 
ATOM   1617 O OE2 . GLU B 1 55  ? 25.727  -4.240  47.385 1.00 49.95  ? 56  GLU B OE2 1 
ATOM   1618 N N   . ILE B 1 56  ? 21.860  -5.371  50.985 1.00 31.69  ? 57  ILE B N   1 
ATOM   1619 C CA  . ILE B 1 56  ? 20.834  -6.325  50.588 1.00 31.63  ? 57  ILE B CA  1 
ATOM   1620 C C   . ILE B 1 56  ? 19.524  -6.045  51.321 1.00 37.59  ? 57  ILE B C   1 
ATOM   1621 O O   . ILE B 1 56  ? 18.443  -6.385  50.836 1.00 38.44  ? 57  ILE B O   1 
ATOM   1622 C CB  . ILE B 1 56  ? 21.297  -7.774  50.835 1.00 28.13  ? 57  ILE B CB  1 
ATOM   1623 C CG1 . ILE B 1 56  ? 21.797  -7.960  52.267 1.00 37.06  ? 57  ILE B CG1 1 
ATOM   1624 C CG2 . ILE B 1 56  ? 22.439  -8.118  49.908 1.00 49.54  ? 57  ILE B CG2 1 
ATOM   1625 C CD1 . ILE B 1 56  ? 20.738  -8.334  53.256 1.00 41.29  ? 57  ILE B CD1 1 
ATOM   1626 N N   . GLU B 1 57  ? 19.631  -5.417  52.489 1.00 34.56  ? 58  GLU B N   1 
ATOM   1627 C CA  . GLU B 1 57  ? 18.460  -5.028  53.262 1.00 34.50  ? 58  GLU B CA  1 
ATOM   1628 C C   . GLU B 1 57  ? 17.690  -3.947  52.516 1.00 32.34  ? 58  GLU B C   1 
ATOM   1629 O O   . GLU B 1 57  ? 16.461  -3.945  52.497 1.00 32.96  ? 58  GLU B O   1 
ATOM   1630 C CB  . GLU B 1 57  ? 18.863  -4.538  54.656 1.00 39.80  ? 58  GLU B CB  1 
ATOM   1631 C CG  . GLU B 1 57  ? 17.693  -4.381  55.613 1.00 40.93  ? 58  GLU B CG  1 
ATOM   1632 C CD  . GLU B 1 57  ? 18.120  -3.980  57.013 1.00 51.51  ? 58  GLU B CD  1 
ATOM   1633 O OE1 . GLU B 1 57  ? 18.854  -2.980  57.156 1.00 37.21  ? 58  GLU B OE1 1 
ATOM   1634 O OE2 . GLU B 1 57  ? 17.715  -4.668  57.973 1.00 49.72  ? 58  GLU B OE2 1 
ATOM   1635 N N   . LYS B 1 58  ? 18.426  -3.027  51.899 1.00 34.59  ? 59  LYS B N   1 
ATOM   1636 C CA  . LYS B 1 58  ? 17.818  -2.000  51.063 1.00 31.71  ? 59  LYS B CA  1 
ATOM   1637 C C   . LYS B 1 58  ? 17.203  -2.633  49.821 1.00 35.03  ? 59  LYS B C   1 
ATOM   1638 O O   . LYS B 1 58  ? 16.164  -2.194  49.338 1.00 37.16  ? 59  LYS B O   1 
ATOM   1639 C CB  . LYS B 1 58  ? 18.849  -0.937  50.670 1.00 32.52  ? 59  LYS B CB  1 
ATOM   1640 C CG  . LYS B 1 58  ? 18.581  0.435   51.279 1.00 40.99  ? 59  LYS B CG  1 
ATOM   1641 C CD  . LYS B 1 58  ? 19.721  1.408   51.010 1.00 50.07  ? 59  LYS B CD  1 
ATOM   1642 C CE  . LYS B 1 58  ? 20.490  1.732   52.282 1.00 53.02  ? 59  LYS B CE  1 
ATOM   1643 N NZ  . LYS B 1 58  ? 21.573  2.727   52.040 1.00 63.09  ? 59  LYS B NZ  1 
ATOM   1644 N N   . ARG B 1 59  ? 17.848  -3.676  49.314 1.00 32.31  ? 60  ARG B N   1 
ATOM   1645 C CA  . ARG B 1 59  ? 17.346  -4.393  48.147 1.00 31.75  ? 60  ARG B CA  1 
ATOM   1646 C C   . ARG B 1 59  ? 16.051  -5.134  48.461 1.00 38.66  ? 60  ARG B C   1 
ATOM   1647 O O   . ARG B 1 59  ? 15.143  -5.182  47.635 1.00 32.06  ? 60  ARG B O   1 
ATOM   1648 C CB  . ARG B 1 59  ? 18.404  -5.366  47.618 1.00 38.65  ? 60  ARG B CB  1 
ATOM   1649 C CG  . ARG B 1 59  ? 19.646  -4.671  47.086 1.00 38.04  ? 60  ARG B CG  1 
ATOM   1650 C CD  . ARG B 1 59  ? 20.590  -5.638  46.400 1.00 49.07  ? 60  ARG B CD  1 
ATOM   1651 N NE  . ARG B 1 59  ? 20.807  -6.854  47.180 1.00 52.03  ? 60  ARG B NE  1 
ATOM   1652 C CZ  . ARG B 1 59  ? 20.645  -8.080  46.695 1.00 50.00  ? 60  ARG B CZ  1 
ATOM   1653 N NH1 . ARG B 1 59  ? 20.269  -8.248  45.436 1.00 36.58  ? 60  ARG B NH1 1 
ATOM   1654 N NH2 . ARG B 1 59  ? 20.857  -9.141  47.459 1.00 59.06  ? 60  ARG B NH2 1 
ATOM   1655 N N   . LEU B 1 60  ? 15.970  -5.709  49.655 1.00 42.20  ? 61  LEU B N   1 
ATOM   1656 C CA  . LEU B 1 60  ? 14.738  -6.346  50.097 1.00 28.51  ? 61  LEU B CA  1 
ATOM   1657 C C   . LEU B 1 60  ? 13.658  -5.299  50.330 1.00 36.81  ? 61  LEU B C   1 
ATOM   1658 O O   . LEU B 1 60  ? 12.540  -5.426  49.826 1.00 35.99  ? 61  LEU B O   1 
ATOM   1659 C CB  . LEU B 1 60  ? 14.965  -7.155  51.373 1.00 30.10  ? 61  LEU B CB  1 
ATOM   1660 C CG  . LEU B 1 60  ? 13.704  -7.789  51.968 1.00 32.83  ? 61  LEU B CG  1 
ATOM   1661 C CD1 . LEU B 1 60  ? 13.096  -8.791  50.999 1.00 36.52  ? 61  LEU B CD1 1 
ATOM   1662 C CD2 . LEU B 1 60  ? 14.017  -8.440  53.304 1.00 31.67  ? 61  LEU B CD2 1 
ATOM   1663 N N   . SER B 1 61  ? 14.000  -4.266  51.096 1.00 28.79  ? 62  SER B N   1 
ATOM   1664 C CA  . SER B 1 61  ? 13.077  -3.171  51.379 1.00 28.16  ? 62  SER B CA  1 
ATOM   1665 C C   . SER B 1 61  ? 12.492  -2.593  50.091 1.00 35.11  ? 62  SER B C   1 
ATOM   1666 O O   . SER B 1 61  ? 11.282  -2.392  49.990 1.00 31.43  ? 62  SER B O   1 
ATOM   1667 C CB  . SER B 1 61  ? 13.777  -2.071  52.177 1.00 30.53  ? 62  SER B CB  1 
ATOM   1668 O OG  . SER B 1 61  ? 12.895  -0.997  52.445 1.00 35.84  ? 62  SER B OG  1 
ATOM   1669 N N   . HIS B 1 62  ? 13.354  -2.343  49.108 1.00 38.17  ? 63  HIS B N   1 
ATOM   1670 C CA  . HIS B 1 62  ? 12.914  -1.858  47.802 1.00 36.55  ? 63  HIS B CA  1 
ATOM   1671 C C   . HIS B 1 62  ? 11.981  -2.865  47.123 1.00 36.80  ? 63  HIS B C   1 
ATOM   1672 O O   . HIS B 1 62  ? 10.972  -2.483  46.533 1.00 34.95  ? 63  HIS B O   1 
ATOM   1673 C CB  . HIS B 1 62  ? 14.118  -1.563  46.897 1.00 35.96  ? 63  HIS B CB  1 
ATOM   1674 C CG  . HIS B 1 62  ? 14.567  -0.130  46.917 1.00 51.89  ? 63  HIS B CG  1 
ATOM   1675 N ND1 . HIS B 1 62  ? 14.043  0.825   46.075 1.00 52.83  ? 63  HIS B ND1 1 
ATOM   1676 C CD2 . HIS B 1 62  ? 15.510  0.499   47.661 1.00 55.40  ? 63  HIS B CD2 1 
ATOM   1677 C CE1 . HIS B 1 62  ? 14.633  1.988   46.307 1.00 60.36  ? 63  HIS B CE1 1 
ATOM   1678 N NE2 . HIS B 1 62  ? 15.525  1.815   47.264 1.00 69.09  ? 63  HIS B NE2 1 
ATOM   1679 N N   . SER B 1 63  ? 12.315  -4.151  47.214 1.00 32.67  ? 64  SER B N   1 
ATOM   1680 C CA  . SER B 1 63  ? 11.494  -5.194  46.601 1.00 26.78  ? 64  SER B CA  1 
ATOM   1681 C C   . SER B 1 63  ? 10.152  -5.374  47.299 1.00 34.13  ? 64  SER B C   1 
ATOM   1682 O O   . SER B 1 63  ? 9.138   -5.606  46.644 1.00 31.33  ? 64  SER B O   1 
ATOM   1683 C CB  . SER B 1 63  ? 12.232  -6.535  46.583 1.00 27.33  ? 64  SER B CB  1 
ATOM   1684 O OG  . SER B 1 63  ? 11.342  -7.585  46.236 1.00 25.69  ? 64  SER B OG  1 
ATOM   1685 N N   . GLN B 1 64  ? 10.145  -5.290  48.625 1.00 36.25  ? 65  GLN B N   1 
ATOM   1686 C CA  . GLN B 1 64  ? 8.901   -5.457  49.366 1.00 28.30  ? 65  GLN B CA  1 
ATOM   1687 C C   . GLN B 1 64  ? 7.959   -4.285  49.121 1.00 34.33  ? 65  GLN B C   1 
ATOM   1688 O O   . GLN B 1 64  ? 6.749   -4.469  49.026 1.00 36.72  ? 65  GLN B O   1 
ATOM   1689 C CB  . GLN B 1 64  ? 9.179   -5.627  50.862 1.00 27.72  ? 65  GLN B CB  1 
ATOM   1690 C CG  . GLN B 1 64  ? 9.552   -7.052  51.243 1.00 33.60  ? 65  GLN B CG  1 
ATOM   1691 C CD  . GLN B 1 64  ? 8.446   -8.043  50.920 1.00 31.15  ? 65  GLN B CD  1 
ATOM   1692 O OE1 . GLN B 1 64  ? 8.690   -9.100  50.343 1.00 32.33  ? 65  GLN B OE1 1 
ATOM   1693 N NE2 . GLN B 1 64  ? 7.220   -7.705  51.299 1.00 44.22  ? 65  GLN B NE2 1 
ATOM   1694 N N   . GLU B 1 65  ? 8.519   -3.087  49.003 1.00 35.25  ? 66  GLU B N   1 
ATOM   1695 C CA  . GLU B 1 65  ? 7.728   -1.906  48.682 1.00 28.30  ? 66  GLU B CA  1 
ATOM   1696 C C   . GLU B 1 65  ? 7.024   -2.077  47.342 1.00 39.95  ? 66  GLU B C   1 
ATOM   1697 O O   . GLU B 1 65  ? 5.854   -1.728  47.195 1.00 42.30  ? 66  GLU B O   1 
ATOM   1698 C CB  . GLU B 1 65  ? 8.597   -0.646  48.647 1.00 30.42  ? 66  GLU B CB  1 
ATOM   1699 C CG  . GLU B 1 65  ? 7.792   0.621   48.392 1.00 41.30  ? 66  GLU B CG  1 
ATOM   1700 C CD  . GLU B 1 65  ? 8.654   1.793   47.977 1.00 48.52  ? 66  GLU B CD  1 
ATOM   1701 O OE1 . GLU B 1 65  ? 9.750   1.967   48.550 1.00 48.95  ? 66  GLU B OE1 1 
ATOM   1702 O OE2 . GLU B 1 65  ? 8.233   2.542   47.072 1.00 52.28  ? 66  GLU B OE2 1 
ATOM   1703 N N   . ARG B 1 66  ? 7.744   -2.620  46.367 1.00 39.15  ? 67  ARG B N   1 
ATOM   1704 C CA  . ARG B 1 66  ? 7.184   -2.824  45.039 1.00 35.16  ? 67  ARG B CA  1 
ATOM   1705 C C   . ARG B 1 66  ? 6.189   -3.981  45.024 1.00 38.63  ? 67  ARG B C   1 
ATOM   1706 O O   . ARG B 1 66  ? 5.266   -3.996  44.212 1.00 41.07  ? 67  ARG B O   1 
ATOM   1707 C CB  . ARG B 1 66  ? 8.298   -3.062  44.022 1.00 27.10  ? 67  ARG B CB  1 
ATOM   1708 C CG  . ARG B 1 66  ? 9.264   -1.900  43.910 1.00 41.25  ? 67  ARG B CG  1 
ATOM   1709 C CD  . ARG B 1 66  ? 10.357  -2.204  42.915 1.00 43.65  ? 67  ARG B CD  1 
ATOM   1710 N NE  . ARG B 1 66  ? 9.810   -2.305  41.564 1.00 42.58  ? 67  ARG B NE  1 
ATOM   1711 C CZ  . ARG B 1 66  ? 10.271  -3.135  40.636 1.00 44.22  ? 67  ARG B CZ  1 
ATOM   1712 N NH1 . ARG B 1 66  ? 9.713   -3.173  39.433 1.00 46.96  ? 67  ARG B NH1 1 
ATOM   1713 N NH2 . ARG B 1 66  ? 11.289  -3.933  40.918 1.00 42.85  ? 67  ARG B NH2 1 
ATOM   1714 N N   . LEU B 1 67  ? 6.375   -4.944  45.921 1.00 34.34  ? 68  LEU B N   1 
ATOM   1715 C CA  . LEU B 1 67  ? 5.403   -6.020  46.077 1.00 39.16  ? 68  LEU B CA  1 
ATOM   1716 C C   . LEU B 1 67  ? 4.111   -5.483  46.690 1.00 34.86  ? 68  LEU B C   1 
ATOM   1717 O O   . LEU B 1 67  ? 3.021   -5.949  46.366 1.00 38.02  ? 68  LEU B O   1 
ATOM   1718 C CB  . LEU B 1 67  ? 5.973   -7.151  46.937 1.00 37.44  ? 68  LEU B CB  1 
ATOM   1719 C CG  . LEU B 1 67  ? 5.022   -8.319  47.223 1.00 41.04  ? 68  LEU B CG  1 
ATOM   1720 C CD1 . LEU B 1 67  ? 4.525   -8.946  45.927 1.00 36.95  ? 68  LEU B CD1 1 
ATOM   1721 C CD2 . LEU B 1 67  ? 5.700   -9.360  48.099 1.00 34.69  ? 68  LEU B CD2 1 
ATOM   1722 N N   . VAL B 1 68  ? 4.242   -4.501  47.577 1.00 39.01  ? 69  VAL B N   1 
ATOM   1723 C CA  . VAL B 1 68  ? 3.081   -3.865  48.186 1.00 40.68  ? 69  VAL B CA  1 
ATOM   1724 C C   . VAL B 1 68  ? 2.334   -3.025  47.153 1.00 38.49  ? 69  VAL B C   1 
ATOM   1725 O O   . VAL B 1 68  ? 1.106   -3.054  47.088 1.00 41.23  ? 69  VAL B O   1 
ATOM   1726 C CB  . VAL B 1 68  ? 3.481   -2.982  49.385 1.00 39.58  ? 69  VAL B CB  1 
ATOM   1727 C CG1 . VAL B 1 68  ? 2.306   -2.124  49.839 1.00 34.88  ? 69  VAL B CG1 1 
ATOM   1728 C CG2 . VAL B 1 68  ? 3.981   -3.846  50.530 1.00 39.53  ? 69  VAL B CG2 1 
ATOM   1729 N N   . ASN B 1 69  ? 3.084   -2.286  46.341 1.00 36.41  ? 70  ASN B N   1 
ATOM   1730 C CA  . ASN B 1 69  ? 2.497   -1.494  45.266 1.00 43.12  ? 70  ASN B CA  1 
ATOM   1731 C C   . ASN B 1 69  ? 1.725   -2.361  44.279 1.00 38.87  ? 70  ASN B C   1 
ATOM   1732 O O   . ASN B 1 69  ? 0.605   -2.030  43.888 1.00 42.83  ? 70  ASN B O   1 
ATOM   1733 C CB  . ASN B 1 69  ? 3.581   -0.706  44.524 1.00 39.40  ? 70  ASN B CB  1 
ATOM   1734 C CG  . ASN B 1 69  ? 4.232   0.352   45.391 1.00 31.57  ? 70  ASN B CG  1 
ATOM   1735 O OD1 . ASN B 1 69  ? 3.807   0.590   46.520 1.00 34.19  ? 70  ASN B OD1 1 
ATOM   1736 N ND2 . ASN B 1 69  ? 5.260   1.004   44.860 1.00 42.66  ? 70  ASN B ND2 1 
ATOM   1737 N N   . GLU B 1 70  ? 2.326   -3.482  43.894 1.00 40.31  ? 71  GLU B N   1 
ATOM   1738 C CA  . GLU B 1 70  ? 1.756   -4.347  42.871 1.00 41.09  ? 71  GLU B CA  1 
ATOM   1739 C C   . GLU B 1 70  ? 0.557   -5.126  43.388 1.00 41.07  ? 71  GLU B C   1 
ATOM   1740 O O   . GLU B 1 70  ? -0.368  -5.429  42.639 1.00 41.88  ? 71  GLU B O   1 
ATOM   1741 C CB  . GLU B 1 70  ? 2.816   -5.315  42.345 1.00 37.47  ? 71  GLU B CB  1 
ATOM   1742 C CG  . GLU B 1 70  ? 2.522   -5.874  40.961 1.00 37.22  ? 71  GLU B CG  1 
ATOM   1743 C CD  . GLU B 1 70  ? 2.798   -4.882  39.840 1.00 37.85  ? 71  GLU B CD  1 
ATOM   1744 O OE1 . GLU B 1 70  ? 3.001   -5.333  38.695 1.00 40.39  ? 71  GLU B OE1 1 
ATOM   1745 O OE2 . GLU B 1 70  ? 2.815   -3.658  40.088 1.00 37.54  ? 71  GLU B OE2 1 
ATOM   1746 N N   . THR B 1 71  ? 0.582   -5.457  44.673 1.00 38.90  ? 72  THR B N   1 
ATOM   1747 C CA  . THR B 1 71  ? -0.503  -6.211  45.277 1.00 45.70  ? 72  THR B CA  1 
ATOM   1748 C C   . THR B 1 71  ? -1.754  -5.346  45.367 1.00 39.53  ? 72  THR B C   1 
ATOM   1749 O O   . THR B 1 71  ? -2.861  -5.814  45.108 1.00 40.10  ? 72  THR B O   1 
ATOM   1750 C CB  . THR B 1 71  ? -0.117  -6.728  46.671 1.00 40.02  ? 72  THR B CB  1 
ATOM   1751 O OG1 . THR B 1 71  ? 1.142   -7.407  46.592 1.00 43.10  ? 72  THR B OG1 1 
ATOM   1752 C CG2 . THR B 1 71  ? -1.176  -7.685  47.203 1.00 35.91  ? 72  THR B CG2 1 
ATOM   1753 N N   . ARG B 1 72  ? -1.569  -4.079  45.722 1.00 38.57  ? 73  ARG B N   1 
ATOM   1754 C CA  . ARG B 1 72  ? -2.678  -3.137  45.800 1.00 44.83  ? 73  ARG B CA  1 
ATOM   1755 C C   . ARG B 1 72  ? -3.326  -2.917  44.440 1.00 48.51  ? 73  ARG B C   1 
ATOM   1756 O O   . ARG B 1 72  ? -4.550  -2.941  44.319 1.00 44.89  ? 73  ARG B O   1 
ATOM   1757 C CB  . ARG B 1 72  ? -2.206  -1.802  46.370 1.00 41.87  ? 73  ARG B CB  1 
ATOM   1758 C CG  . ARG B 1 72  ? -2.341  -1.692  47.871 1.00 51.10  ? 73  ARG B CG  1 
ATOM   1759 C CD  . ARG B 1 72  ? -3.044  -0.402  48.237 1.00 51.82  ? 73  ARG B CD  1 
ATOM   1760 N NE  . ARG B 1 72  ? -3.117  -0.199  49.678 1.00 48.67  ? 73  ARG B NE  1 
ATOM   1761 C CZ  . ARG B 1 72  ? -3.605  0.898   50.243 1.00 59.32  ? 73  ARG B CZ  1 
ATOM   1762 N NH1 . ARG B 1 72  ? -4.060  1.886   49.485 1.00 61.37  ? 73  ARG B NH1 1 
ATOM   1763 N NH2 . ARG B 1 72  ? -3.637  1.009   51.563 1.00 59.42  ? 73  ARG B NH2 1 
ATOM   1764 N N   . GLU B 1 73  ? -2.500  -2.697  43.422 1.00 42.65  ? 74  GLU B N   1 
ATOM   1765 C CA  . GLU B 1 73  ? -2.997  -2.503  42.067 1.00 43.94  ? 74  GLU B CA  1 
ATOM   1766 C C   . GLU B 1 73  ? -3.762  -3.733  41.596 1.00 44.87  ? 74  GLU B C   1 
ATOM   1767 O O   . GLU B 1 73  ? -4.823  -3.617  40.983 1.00 44.74  ? 74  GLU B O   1 
ATOM   1768 C CB  . GLU B 1 73  ? -1.847  -2.186  41.108 1.00 49.01  ? 74  GLU B CB  1 
ATOM   1769 C CG  . GLU B 1 73  ? -1.708  -0.706  40.794 1.00 54.41  ? 74  GLU B CG  1 
ATOM   1770 C CD  . GLU B 1 73  ? -2.919  -0.157  40.064 1.00 63.58  ? 74  GLU B CD  1 
ATOM   1771 O OE1 . GLU B 1 73  ? -3.422  -0.845  39.152 1.00 57.91  ? 74  GLU B OE1 1 
ATOM   1772 O OE2 . GLU B 1 73  ? -3.375  0.955   40.404 1.00 65.51  ? 74  GLU B OE2 1 
ATOM   1773 N N   . CYS B 1 74  ? -3.221  -4.906  41.902 1.00 45.48  ? 75  CYS B N   1 
ATOM   1774 C CA  . CYS B 1 74  ? -3.852  -6.169  41.547 1.00 34.93  ? 75  CYS B CA  1 
ATOM   1775 C C   . CYS B 1 74  ? -5.193  -6.340  42.245 1.00 42.23  ? 75  CYS B C   1 
ATOM   1776 O O   . CYS B 1 74  ? -6.165  -6.797  41.645 1.00 47.48  ? 75  CYS B O   1 
ATOM   1777 C CB  . CYS B 1 74  ? -2.929  -7.332  41.899 1.00 40.88  ? 75  CYS B CB  1 
ATOM   1778 S SG  . CYS B 1 74  ? -3.684  -8.951  41.702 1.00 45.08  ? 75  CYS B SG  1 
ATOM   1779 N N   . GLN B 1 75  ? -5.226  -5.981  43.524 1.00 46.80  ? 76  GLN B N   1 
ATOM   1780 C CA  . GLN B 1 75  ? -6.440  -6.069  44.324 1.00 45.01  ? 76  GLN B CA  1 
ATOM   1781 C C   . GLN B 1 75  ? -7.502  -5.121  43.781 1.00 32.34  ? 76  GLN B C   1 
ATOM   1782 O O   . GLN B 1 75  ? -8.673  -5.484  43.654 1.00 37.06  ? 76  GLN B O   1 
ATOM   1783 C CB  . GLN B 1 75  ? -6.137  -5.755  45.791 1.00 36.17  ? 76  GLN B CB  1 
ATOM   1784 C CG  . GLN B 1 75  ? -5.420  -6.887  46.522 1.00 37.07  ? 76  GLN B CG  1 
ATOM   1785 C CD  . GLN B 1 75  ? -4.834  -6.457  47.857 1.00 35.00  ? 76  GLN B CD  1 
ATOM   1786 O OE1 . GLN B 1 75  ? -4.635  -5.270  48.110 1.00 38.82  ? 76  GLN B OE1 1 
ATOM   1787 N NE2 . GLN B 1 75  ? -4.554  -7.428  48.718 1.00 24.90  ? 76  GLN B NE2 1 
ATOM   1788 N N   . SER B 1 76  ? -7.074  -3.908  43.450 1.00 34.98  ? 77  SER B N   1 
ATOM   1789 C CA  . SER B 1 76  ? -7.950  -2.901  42.864 1.00 33.70  ? 77  SER B CA  1 
ATOM   1790 C C   . SER B 1 76  ? -8.419  -3.309  41.469 1.00 45.21  ? 77  SER B C   1 
ATOM   1791 O O   . SER B 1 76  ? -9.482  -2.892  41.016 1.00 43.62  ? 77  SER B O   1 
ATOM   1792 C CB  . SER B 1 76  ? -7.227  -1.554  42.813 1.00 39.63  ? 77  SER B CB  1 
ATOM   1793 O OG  . SER B 1 76  ? -7.921  -0.622  42.007 1.00 45.82  ? 77  SER B OG  1 
ATOM   1794 N N   . LEU B 1 77  ? -7.621  -4.129  40.792 1.00 43.22  ? 78  LEU B N   1 
ATOM   1795 C CA  . LEU B 1 77  ? -7.972  -4.607  39.457 1.00 41.66  ? 78  LEU B CA  1 
ATOM   1796 C C   . LEU B 1 77  ? -9.077  -5.651  39.519 1.00 42.35  ? 78  LEU B C   1 
ATOM   1797 O O   . LEU B 1 77  ? -9.986  -5.658  38.691 1.00 31.41  ? 78  LEU B O   1 
ATOM   1798 C CB  . LEU B 1 77  ? -6.749  -5.186  38.747 1.00 36.94  ? 78  LEU B CB  1 
ATOM   1799 C CG  . LEU B 1 77  ? -5.828  -4.177  38.059 1.00 36.99  ? 78  LEU B CG  1 
ATOM   1800 C CD1 . LEU B 1 77  ? -4.591  -4.879  37.528 1.00 33.07  ? 78  LEU B CD1 1 
ATOM   1801 C CD2 . LEU B 1 77  ? -6.563  -3.451  36.943 1.00 31.69  ? 78  LEU B CD2 1 
ATOM   1802 N N   . ARG B 1 78  ? -8.983  -6.542  40.500 1.00 35.80  ? 79  ARG B N   1 
ATOM   1803 C CA  . ARG B 1 78  ? -10.057 -7.489  40.766 1.00 43.35  ? 79  ARG B CA  1 
ATOM   1804 C C   . ARG B 1 78  ? -11.310 -6.727  41.145 1.00 47.52  ? 79  ARG B C   1 
ATOM   1805 O O   . ARG B 1 78  ? -12.417 -7.075  40.740 1.00 45.38  ? 79  ARG B O   1 
ATOM   1806 C CB  . ARG B 1 78  ? -9.672  -8.458  41.882 1.00 50.34  ? 79  ARG B CB  1 
ATOM   1807 C CG  . ARG B 1 78  ? -9.143  -9.765  41.379 1.00 60.64  ? 79  ARG B CG  1 
ATOM   1808 C CD  . ARG B 1 78  ? -10.132 -10.906 41.568 1.00 67.74  ? 79  ARG B CD  1 
ATOM   1809 N NE  . ARG B 1 78  ? -9.943  -11.978 40.592 1.00 73.53  ? 79  ARG B NE  1 
ATOM   1810 C CZ  . ARG B 1 78  ? -8.804  -12.625 40.373 1.00 71.08  ? 79  ARG B CZ  1 
ATOM   1811 N NH1 . ARG B 1 78  ? -7.717  -12.335 41.059 1.00 67.04  ? 79  ARG B NH1 1 
ATOM   1812 N NH2 . ARG B 1 78  ? -8.755  -13.572 39.453 1.00 71.24  ? 79  ARG B NH2 1 
ATOM   1813 N N   . LEU B 1 79  ? -11.110 -5.689  41.943 1.00 42.90  ? 80  LEU B N   1 
ATOM   1814 C CA  . LEU B 1 79  ? -12.177 -4.808  42.372 1.00 45.21  ? 80  LEU B CA  1 
ATOM   1815 C C   . LEU B 1 79  ? -12.943 -4.233  41.183 1.00 38.39  ? 80  LEU B C   1 
ATOM   1816 O O   . LEU B 1 79  ? -14.172 -4.281  41.131 1.00 45.17  ? 80  LEU B O   1 
ATOM   1817 C CB  . LEU B 1 79  ? -11.587 -3.677  43.218 1.00 49.27  ? 80  LEU B CB  1 
ATOM   1818 C CG  . LEU B 1 79  ? -12.544 -2.566  43.593 1.00 55.53  ? 80  LEU B CG  1 
ATOM   1819 C CD1 . LEU B 1 79  ? -13.354 -3.421  44.390 1.00 56.74  ? 80  LEU B CD1 1 
ATOM   1820 C CD2 . LEU B 1 79  ? -11.962 -1.525  44.511 1.00 40.77  ? 80  LEU B CD2 1 
ATOM   1821 N N   . GLU B 1 80  ? -12.199 -3.676  40.235 1.00 36.58  ? 81  GLU B N   1 
ATOM   1822 C CA  . GLU B 1 80  ? -12.783 -3.135  39.017 1.00 37.88  ? 81  GLU B CA  1 
ATOM   1823 C C   . GLU B 1 80  ? -13.492 -4.219  38.214 1.00 40.45  ? 81  GLU B C   1 
ATOM   1824 O O   . GLU B 1 80  ? -14.523 -3.967  37.591 1.00 37.03  ? 81  GLU B O   1 
ATOM   1825 C CB  . GLU B 1 80  ? -11.705 -2.471  38.154 1.00 43.84  ? 81  GLU B CB  1 
ATOM   1826 C CG  . GLU B 1 80  ? -11.089 -1.227  38.763 1.00 50.51  ? 81  GLU B CG  1 
ATOM   1827 C CD  . GLU B 1 80  ? -9.985  -0.643  37.907 1.00 59.03  ? 81  GLU B CD  1 
ATOM   1828 O OE1 . GLU B 1 80  ? -9.558  -1.314  36.948 1.00 60.47  ? 81  GLU B OE1 1 
ATOM   1829 O OE2 . GLU B 1 80  ? -9.544  0.487   38.194 1.00 67.25  ? 81  GLU B OE2 1 
ATOM   1830 N N   . LEU B 1 81  ? -12.932 -5.424  38.233 1.00 43.14  ? 82  LEU B N   1 
ATOM   1831 C CA  . LEU B 1 81  ? -13.440 -6.515  37.413 1.00 36.30  ? 82  LEU B CA  1 
ATOM   1832 C C   . LEU B 1 81  ? -14.698 -7.135  38.007 1.00 41.92  ? 82  LEU B C   1 
ATOM   1833 O O   . LEU B 1 81  ? -15.524 -7.704  37.290 1.00 43.47  ? 82  LEU B O   1 
ATOM   1834 C CB  . LEU B 1 81  ? -12.365 -7.586  37.233 1.00 39.84  ? 82  LEU B CB  1 
ATOM   1835 C CG  . LEU B 1 81  ? -12.766 -8.828  36.435 1.00 37.75  ? 82  LEU B CG  1 
ATOM   1836 C CD1 . LEU B 1 81  ? -13.120 -8.453  35.008 1.00 42.33  ? 82  LEU B CD1 1 
ATOM   1837 C CD2 . LEU B 1 81  ? -11.667 -9.866  36.456 1.00 47.29  ? 82  LEU B CD2 1 
ATOM   1838 N N   . GLU B 1 82  ? -14.844 -7.024  39.321 1.00 39.45  ? 83  GLU B N   1 
ATOM   1839 C CA  . GLU B 1 82  ? -16.016 -7.558  40.001 1.00 34.81  ? 83  GLU B CA  1 
ATOM   1840 C C   . GLU B 1 82  ? -17.232 -6.684  39.728 1.00 39.81  ? 83  GLU B C   1 
ATOM   1841 O O   . GLU B 1 82  ? -18.305 -7.179  39.383 1.00 40.02  ? 83  GLU B O   1 
ATOM   1842 C CB  . GLU B 1 82  ? -15.757 -7.662  41.506 1.00 45.72  ? 83  GLU B CB  1 
ATOM   1843 C CG  . GLU B 1 82  ? -16.866 -8.343  42.288 1.00 43.29  ? 83  GLU B CG  1 
ATOM   1844 C CD  . GLU B 1 82  ? -16.762 -9.857  42.265 1.00 53.48  ? 83  GLU B CD  1 
ATOM   1845 O OE1 . GLU B 1 82  ? -16.616 -10.437 41.169 1.00 59.92  ? 83  GLU B OE1 1 
ATOM   1846 O OE2 . GLU B 1 82  ? -16.821 -10.469 43.351 1.00 60.68  ? 83  GLU B OE2 1 
ATOM   1847 N N   . LYS B 1 83  ? -17.045 -5.379  39.889 1.00 33.88  ? 84  LYS B N   1 
ATOM   1848 C CA  . LYS B 1 83  ? -18.090 -4.399  39.623 1.00 37.73  ? 84  LYS B CA  1 
ATOM   1849 C C   . LYS B 1 83  ? -18.531 -4.467  38.165 1.00 38.64  ? 84  LYS B C   1 
ATOM   1850 O O   . LYS B 1 83  ? -19.708 -4.300  37.849 1.00 41.35  ? 84  LYS B O   1 
ATOM   1851 C CB  . LYS B 1 83  ? -17.589 -2.994  39.972 1.00 40.72  ? 84  LYS B CB  1 
ATOM   1852 C CG  . LYS B 1 83  ? -18.613 -1.881  39.796 1.00 54.58  ? 84  LYS B CG  1 
ATOM   1853 C CD  . LYS B 1 83  ? -18.351 -1.070  38.536 1.00 51.89  ? 84  LYS B CD  1 
ATOM   1854 C CE  . LYS B 1 83  ? -19.208 0.186   38.504 1.00 55.75  ? 84  LYS B CE  1 
ATOM   1855 N NZ  . LYS B 1 83  ? -18.926 1.069   39.670 1.00 68.15  ? 84  LYS B NZ  1 
ATOM   1856 N N   . LEU B 1 84  ? -17.574 -4.730  37.285 1.00 35.97  ? 85  LEU B N   1 
ATOM   1857 C CA  . LEU B 1 84  ? -17.833 -4.816  35.853 1.00 39.30  ? 85  LEU B CA  1 
ATOM   1858 C C   . LEU B 1 84  ? -18.605 -6.084  35.486 1.00 38.85  ? 85  LEU B C   1 
ATOM   1859 O O   . LEU B 1 84  ? -19.469 -6.058  34.616 1.00 33.60  ? 85  LEU B O   1 
ATOM   1860 C CB  . LEU B 1 84  ? -16.510 -4.750  35.083 1.00 39.67  ? 85  LEU B CB  1 
ATOM   1861 C CG  . LEU B 1 84  ? -16.539 -4.800  33.558 1.00 36.80  ? 85  LEU B CG  1 
ATOM   1862 C CD1 . LEU B 1 84  ? -17.565 -3.830  33.009 1.00 41.23  ? 85  LEU B CD1 1 
ATOM   1863 C CD2 . LEU B 1 84  ? -15.161 -4.468  33.015 1.00 36.18  ? 85  LEU B CD2 1 
ATOM   1864 N N   . ASN B 1 85  ? -18.294 -7.192  36.151 1.00 30.83  ? 86  ASN B N   1 
ATOM   1865 C CA  . ASN B 1 85  ? -19.021 -8.439  35.926 1.00 30.26  ? 86  ASN B CA  1 
ATOM   1866 C C   . ASN B 1 85  ? -20.476 -8.353  36.376 1.00 35.38  ? 86  ASN B C   1 
ATOM   1867 O O   . ASN B 1 85  ? -21.357 -8.953  35.762 1.00 32.95  ? 86  ASN B O   1 
ATOM   1868 C CB  . ASN B 1 85  ? -18.332 -9.601  36.640 1.00 32.18  ? 86  ASN B CB  1 
ATOM   1869 C CG  . ASN B 1 85  ? -17.403 -10.377 35.728 1.00 33.83  ? 86  ASN B CG  1 
ATOM   1870 O OD1 . ASN B 1 85  ? -17.661 -10.517 34.529 1.00 34.35  ? 86  ASN B OD1 1 
ATOM   1871 N ND2 . ASN B 1 85  ? -16.316 -10.893 36.292 1.00 33.90  ? 86  ASN B ND2 1 
ATOM   1872 N N   . ASN B 1 86  ? -20.722 -7.612  37.453 1.00 39.16  ? 87  ASN B N   1 
ATOM   1873 C CA  . ASN B 1 86  ? -22.079 -7.425  37.957 1.00 34.57  ? 87  ASN B CA  1 
ATOM   1874 C C   . ASN B 1 86  ? -22.907 -6.532  37.041 1.00 37.31  ? 87  ASN B C   1 
ATOM   1875 O O   . ASN B 1 86  ? -24.121 -6.703  36.921 1.00 35.91  ? 87  ASN B O   1 
ATOM   1876 C CB  . ASN B 1 86  ? -22.052 -6.838  39.369 1.00 37.38  ? 87  ASN B CB  1 
ATOM   1877 C CG  . ASN B 1 86  ? -21.494 -7.806  40.395 1.00 40.01  ? 87  ASN B CG  1 
ATOM   1878 O OD1 . ASN B 1 86  ? -21.543 -9.020  40.208 1.00 41.33  ? 87  ASN B OD1 1 
ATOM   1879 N ND2 . ASN B 1 86  ? -20.967 -7.271  41.491 1.00 32.45  ? 87  ASN B ND2 1 
ATOM   1880 N N   . GLN B 1 87  ? -22.243 -5.574  36.402 1.00 32.79  ? 88  GLN B N   1 
ATOM   1881 C CA  . GLN B 1 87  ? -22.892 -4.712  35.422 1.00 33.95  ? 88  GLN B CA  1 
ATOM   1882 C C   . GLN B 1 87  ? -23.401 -5.523  34.237 1.00 35.37  ? 88  GLN B C   1 
ATOM   1883 O O   . GLN B 1 87  ? -24.546 -5.378  33.818 1.00 33.49  ? 88  GLN B O   1 
ATOM   1884 C CB  . GLN B 1 87  ? -21.926 -3.630  34.944 1.00 34.69  ? 88  GLN B CB  1 
ATOM   1885 C CG  . GLN B 1 87  ? -22.284 -2.237  35.419 1.00 39.62  ? 88  GLN B CG  1 
ATOM   1886 C CD  . GLN B 1 87  ? -21.204 -1.225  35.107 1.00 51.74  ? 88  GLN B CD  1 
ATOM   1887 O OE1 . GLN B 1 87  ? -20.081 -1.328  35.600 1.00 44.87  ? 88  GLN B OE1 1 
ATOM   1888 N NE2 . GLN B 1 87  ? -21.536 -0.241  34.280 1.00 42.56  ? 88  GLN B NE2 1 
ATOM   1889 N N   . LEU B 1 88  ? -22.533 -6.377  33.705 1.00 31.36  ? 89  LEU B N   1 
ATOM   1890 C CA  . LEU B 1 88  ? -22.894 -7.283  32.621 1.00 39.74  ? 89  LEU B CA  1 
ATOM   1891 C C   . LEU B 1 88  ? -24.093 -8.142  32.987 1.00 36.58  ? 89  LEU B C   1 
ATOM   1892 O O   . LEU B 1 88  ? -25.075 -8.196  32.252 1.00 36.50  ? 89  LEU B O   1 
ATOM   1893 C CB  . LEU B 1 88  ? -21.714 -8.184  32.259 1.00 35.99  ? 89  LEU B CB  1 
ATOM   1894 C CG  . LEU B 1 88  ? -20.800 -7.712  31.132 1.00 36.21  ? 89  LEU B CG  1 
ATOM   1895 C CD1 . LEU B 1 88  ? -19.664 -8.696  30.960 1.00 41.83  ? 89  LEU B CD1 1 
ATOM   1896 C CD2 . LEU B 1 88  ? -21.581 -7.579  29.839 1.00 36.06  ? 89  LEU B CD2 1 
ATOM   1897 N N   . LYS B 1 89  ? -24.000 -8.810  34.132 1.00 35.78  ? 90  LYS B N   1 
ATOM   1898 C CA  . LYS B 1 89  ? -25.053 -9.705  34.596 1.00 33.31  ? 90  LYS B CA  1 
ATOM   1899 C C   . LYS B 1 89  ? -26.397 -8.996  34.716 1.00 37.82  ? 90  LYS B C   1 
ATOM   1900 O O   . LYS B 1 89  ? -27.424 -9.513  34.266 1.00 33.09  ? 90  LYS B O   1 
ATOM   1901 C CB  . LYS B 1 89  ? -24.670 -10.322 35.943 1.00 32.18  ? 90  LYS B CB  1 
ATOM   1902 C CG  . LYS B 1 89  ? -25.755 -11.196 36.540 1.00 44.54  ? 90  LYS B CG  1 
ATOM   1903 C CD  . LYS B 1 89  ? -25.344 -11.803 37.870 1.00 45.45  ? 90  LYS B CD  1 
ATOM   1904 C CE  . LYS B 1 89  ? -26.430 -12.727 38.396 1.00 59.33  ? 90  LYS B CE  1 
ATOM   1905 N NZ  . LYS B 1 89  ? -26.206 -13.135 39.810 1.00 48.46  ? 90  LYS B NZ  1 
ATOM   1906 N N   . ALA B 1 90  ? -26.383 -7.808  35.314 1.00 38.82  ? 91  ALA B N   1 
ATOM   1907 C CA  . ALA B 1 90  ? -27.610 -7.054  35.539 1.00 28.65  ? 91  ALA B CA  1 
ATOM   1908 C C   . ALA B 1 90  ? -28.179 -6.510  34.231 1.00 31.58  ? 91  ALA B C   1 
ATOM   1909 O O   . ALA B 1 90  ? -29.393 -6.369  34.085 1.00 35.05  ? 91  ALA B O   1 
ATOM   1910 C CB  . ALA B 1 90  ? -27.362 -5.924  36.519 1.00 29.04  ? 91  ALA B CB  1 
ATOM   1911 N N   . LEU B 1 91  ? -27.301 -6.206  33.282 1.00 32.82  ? 92  LEU B N   1 
ATOM   1912 C CA  . LEU B 1 91  ? -27.744 -5.680  31.998 1.00 33.13  ? 92  LEU B CA  1 
ATOM   1913 C C   . LEU B 1 91  ? -28.320 -6.774  31.101 1.00 28.09  ? 92  LEU B C   1 
ATOM   1914 O O   . LEU B 1 91  ? -29.220 -6.507  30.303 1.00 27.77  ? 92  LEU B O   1 
ATOM   1915 C CB  . LEU B 1 91  ? -26.601 -4.968  31.278 1.00 25.36  ? 92  LEU B CB  1 
ATOM   1916 C CG  . LEU B 1 91  ? -26.826 -3.473  31.040 1.00 22.00  ? 92  LEU B CG  1 
ATOM   1917 C CD1 . LEU B 1 91  ? -25.677 -2.886  30.238 1.00 32.03  ? 92  LEU B CD1 1 
ATOM   1918 C CD2 . LEU B 1 91  ? -28.153 -3.230  30.340 1.00 32.18  ? 92  LEU B CD2 1 
ATOM   1919 N N   . THR B 1 92  ? -27.806 -7.996  31.218 1.00 29.33  ? 93  THR B N   1 
ATOM   1920 C CA  . THR B 1 92  ? -28.353 -9.107  30.442 1.00 32.74  ? 93  THR B CA  1 
ATOM   1921 C C   . THR B 1 92  ? -29.767 -9.417  30.913 1.00 31.37  ? 93  THR B C   1 
ATOM   1922 O O   . THR B 1 92  ? -30.656 -9.684  30.107 1.00 37.87  ? 93  THR B O   1 
ATOM   1923 C CB  . THR B 1 92  ? -27.496 -10.384 30.554 1.00 29.99  ? 93  THR B CB  1 
ATOM   1924 O OG1 . THR B 1 92  ? -27.440 -10.812 31.921 1.00 44.43  ? 93  THR B OG1 1 
ATOM   1925 C CG2 . THR B 1 92  ? -26.088 -10.141 30.031 1.00 27.79  ? 93  THR B CG2 1 
ATOM   1926 N N   . GLU B 1 93  ? -29.964 -9.381  32.227 1.00 26.49  ? 94  GLU B N   1 
ATOM   1927 C CA  . GLU B 1 93  ? -31.283 -9.579  32.817 1.00 35.39  ? 94  GLU B CA  1 
ATOM   1928 C C   . GLU B 1 93  ? -32.271 -8.518  32.341 1.00 30.07  ? 94  GLU B C   1 
ATOM   1929 O O   . GLU B 1 93  ? -33.398 -8.833  31.964 1.00 32.59  ? 94  GLU B O   1 
ATOM   1930 C CB  . GLU B 1 93  ? -31.194 -9.564  34.347 1.00 33.19  ? 94  GLU B CB  1 
ATOM   1931 C CG  . GLU B 1 93  ? -30.389 -10.715 34.939 1.00 51.15  ? 94  GLU B CG  1 
ATOM   1932 C CD  . GLU B 1 93  ? -30.307 -10.654 36.453 1.00 60.75  ? 94  GLU B CD  1 
ATOM   1933 O OE1 . GLU B 1 93  ? -30.917 -9.742  37.048 1.00 65.37  ? 94  GLU B OE1 1 
ATOM   1934 O OE2 . GLU B 1 93  ? -29.632 -11.518 37.050 1.00 54.21  ? 94  GLU B OE2 1 
ATOM   1935 N N   . LYS B 1 94  ? -31.839 -7.262  32.355 1.00 28.48  ? 95  LYS B N   1 
ATOM   1936 C CA  . LYS B 1 94  ? -32.698 -6.157  31.951 1.00 26.41  ? 95  LYS B CA  1 
ATOM   1937 C C   . LYS B 1 94  ? -33.011 -6.191  30.457 1.00 31.59  ? 95  LYS B C   1 
ATOM   1938 O O   . LYS B 1 94  ? -34.138 -5.907  30.049 1.00 32.13  ? 95  LYS B O   1 
ATOM   1939 C CB  . LYS B 1 94  ? -32.059 -4.819  32.319 1.00 25.01  ? 95  LYS B CB  1 
ATOM   1940 C CG  . LYS B 1 94  ? -32.932 -3.617  32.010 1.00 37.29  ? 95  LYS B CG  1 
ATOM   1941 C CD  . LYS B 1 94  ? -32.458 -2.399  32.775 1.00 50.20  ? 95  LYS B CD  1 
ATOM   1942 C CE  . LYS B 1 94  ? -33.293 -1.174  32.449 1.00 45.55  ? 95  LYS B CE  1 
ATOM   1943 N NZ  . LYS B 1 94  ? -33.099 -0.739  31.039 1.00 39.58  ? 95  LYS B NZ  1 
ATOM   1944 N N   . ASN B 1 95  ? -32.013 -6.529  29.646 1.00 27.62  ? 96  ASN B N   1 
ATOM   1945 C CA  . ASN B 1 95  ? -32.225 -6.665  28.210 1.00 29.85  ? 96  ASN B CA  1 
ATOM   1946 C C   . ASN B 1 95  ? -33.194 -7.793  27.904 1.00 29.18  ? 96  ASN B C   1 
ATOM   1947 O O   . ASN B 1 95  ? -34.006 -7.689  26.981 1.00 30.05  ? 96  ASN B O   1 
ATOM   1948 C CB  . ASN B 1 95  ? -30.903 -6.902  27.480 1.00 23.90  ? 96  ASN B CB  1 
ATOM   1949 C CG  . ASN B 1 95  ? -30.097 -5.635  27.325 1.00 27.89  ? 96  ASN B CG  1 
ATOM   1950 O OD1 . ASN B 1 95  ? -30.425 -4.608  27.915 1.00 28.93  ? 96  ASN B OD1 1 
ATOM   1951 N ND2 . ASN B 1 95  ? -29.037 -5.696  26.528 1.00 37.68  ? 96  ASN B ND2 1 
ATOM   1952 N N   . LYS B 1 96  ? -33.100 -8.869  28.682 1.00 31.06  ? 97  LYS B N   1 
ATOM   1953 C CA  . LYS B 1 96  ? -33.995 -10.008 28.527 1.00 32.22  ? 97  LYS B CA  1 
ATOM   1954 C C   . LYS B 1 96  ? -35.436 -9.589  28.752 1.00 36.12  ? 97  LYS B C   1 
ATOM   1955 O O   . LYS B 1 96  ? -36.328 -9.961  27.995 1.00 38.23  ? 97  LYS B O   1 
ATOM   1956 C CB  . LYS B 1 96  ? -33.626 -11.128 29.500 1.00 36.29  ? 97  LYS B CB  1 
ATOM   1957 C CG  . LYS B 1 96  ? -32.527 -12.045 29.010 1.00 41.52  ? 97  LYS B CG  1 
ATOM   1958 C CD  . LYS B 1 96  ? -32.048 -12.963 30.122 1.00 46.03  ? 97  LYS B CD  1 
ATOM   1959 C CE  . LYS B 1 96  ? -31.187 -14.087 29.576 1.00 46.39  ? 97  LYS B CE  1 
ATOM   1960 N NZ  . LYS B 1 96  ? -31.974 -14.979 28.680 1.00 40.92  ? 97  LYS B NZ  1 
ATOM   1961 N N   . GLU B 1 97  ? -35.658 -8.805  29.798 1.00 37.10  ? 98  GLU B N   1 
ATOM   1962 C CA  . GLU B 1 97  ? -37.003 -8.380  30.148 1.00 34.41  ? 98  GLU B CA  1 
ATOM   1963 C C   . GLU B 1 97  ? -37.556 -7.375  29.140 1.00 32.19  ? 98  GLU B C   1 
ATOM   1964 O O   . GLU B 1 97  ? -38.746 -7.385  28.839 1.00 32.49  ? 98  GLU B O   1 
ATOM   1965 C CB  . GLU B 1 97  ? -37.025 -7.794  31.559 1.00 35.37  ? 98  GLU B CB  1 
ATOM   1966 C CG  . GLU B 1 97  ? -38.297 -8.131  32.322 1.00 53.33  ? 98  GLU B CG  1 
ATOM   1967 C CD  . GLU B 1 97  ? -38.621 -9.616  32.295 1.00 58.62  ? 98  GLU B CD  1 
ATOM   1968 O OE1 . GLU B 1 97  ? -39.806 -9.962  32.124 1.00 49.78  ? 98  GLU B OE1 1 
ATOM   1969 O OE2 . GLU B 1 97  ? -37.694 -10.437 32.449 1.00 59.23  ? 98  GLU B OE2 1 
ATOM   1970 N N   . LEU B 1 98  ? -36.692 -6.515  28.613 1.00 25.38  ? 99  LEU B N   1 
ATOM   1971 C CA  . LEU B 1 98  ? -37.107 -5.561  27.588 1.00 28.00  ? 99  LEU B CA  1 
ATOM   1972 C C   . LEU B 1 98  ? -37.592 -6.279  26.331 1.00 34.17  ? 99  LEU B C   1 
ATOM   1973 O O   . LEU B 1 98  ? -38.611 -5.906  25.751 1.00 31.47  ? 99  LEU B O   1 
ATOM   1974 C CB  . LEU B 1 98  ? -35.964 -4.602  27.243 1.00 27.70  ? 99  LEU B CB  1 
ATOM   1975 C CG  . LEU B 1 98  ? -35.733 -3.488  28.266 1.00 39.48  ? 99  LEU B CG  1 
ATOM   1976 C CD1 . LEU B 1 98  ? -34.596 -2.577  27.829 1.00 33.82  ? 99  LEU B CD1 1 
ATOM   1977 C CD2 . LEU B 1 98  ? -37.013 -2.698  28.477 1.00 35.04  ? 99  LEU B CD2 1 
ATOM   1978 N N   . GLU B 1 99  ? -36.861 -7.311  25.922 1.00 24.54  ? 100 GLU B N   1 
ATOM   1979 C CA  . GLU B 1 99  ? -37.246 -8.123  24.771 1.00 35.35  ? 100 GLU B CA  1 
ATOM   1980 C C   . GLU B 1 99  ? -38.620 -8.758  24.953 1.00 35.01  ? 100 GLU B C   1 
ATOM   1981 O O   . GLU B 1 99  ? -39.437 -8.771  24.029 1.00 30.71  ? 100 GLU B O   1 
ATOM   1982 C CB  . GLU B 1 99  ? -36.209 -9.219  24.518 1.00 39.58  ? 100 GLU B CB  1 
ATOM   1983 C CG  . GLU B 1 99  ? -34.844 -8.703  24.101 1.00 35.01  ? 100 GLU B CG  1 
ATOM   1984 C CD  . GLU B 1 99  ? -33.871 -9.820  23.793 1.00 45.25  ? 100 GLU B CD  1 
ATOM   1985 O OE1 . GLU B 1 99  ? -34.092 -10.956 24.264 1.00 41.20  ? 100 GLU B OE1 1 
ATOM   1986 O OE2 . GLU B 1 99  ? -32.884 -9.562  23.076 1.00 50.10  ? 100 GLU B OE2 1 
ATOM   1987 N N   . ILE B 1 100 ? -38.868 -9.287  26.148 1.00 32.94  ? 101 ILE B N   1 
ATOM   1988 C CA  . ILE B 1 100 ? -40.135 -9.950  26.451 1.00 36.21  ? 101 ILE B CA  1 
ATOM   1989 C C   . ILE B 1 100 ? -41.284 -8.944  26.397 1.00 34.42  ? 101 ILE B C   1 
ATOM   1990 O O   . ILE B 1 100 ? -42.368 -9.242  25.890 1.00 39.10  ? 101 ILE B O   1 
ATOM   1991 C CB  . ILE B 1 100 ? -40.092 -10.639 27.839 1.00 34.52  ? 101 ILE B CB  1 
ATOM   1992 C CG1 . ILE B 1 100 ? -39.586 -12.082 27.730 1.00 36.87  ? 101 ILE B CG1 1 
ATOM   1993 C CG2 . ILE B 1 100 ? -41.467 -10.670 28.477 1.00 32.50  ? 101 ILE B CG2 1 
ATOM   1994 C CD1 . ILE B 1 100 ? -38.238 -12.255 27.064 1.00 34.67  ? 101 ILE B CD1 1 
ATOM   1995 N N   . ALA B 1 101 ? -41.022 -7.743  26.903 1.00 38.39  ? 102 ALA B N   1 
ATOM   1996 C CA  . ALA B 1 101 ? -42.012 -6.673  26.930 1.00 30.03  ? 102 ALA B CA  1 
ATOM   1997 C C   . ALA B 1 101 ? -42.306 -6.166  25.526 1.00 35.22  ? 102 ALA B C   1 
ATOM   1998 O O   . ALA B 1 101 ? -43.442 -5.811  25.206 1.00 31.32  ? 102 ALA B O   1 
ATOM   1999 C CB  . ALA B 1 101 ? -41.533 -5.533  27.818 1.00 30.63  ? 102 ALA B CB  1 
ATOM   2000 N N   . GLN B 1 102 ? -41.269 -6.134  24.695 1.00 32.52  ? 103 GLN B N   1 
ATOM   2001 C CA  . GLN B 1 102 ? -41.401 -5.711  23.307 1.00 30.48  ? 103 GLN B CA  1 
ATOM   2002 C C   . GLN B 1 102 ? -42.325 -6.653  22.547 1.00 35.35  ? 103 GLN B C   1 
ATOM   2003 O O   . GLN B 1 102 ? -43.196 -6.217  21.792 1.00 36.06  ? 103 GLN B O   1 
ATOM   2004 C CB  . GLN B 1 102 ? -40.027 -5.656  22.635 1.00 32.78  ? 103 GLN B CB  1 
ATOM   2005 C CG  . GLN B 1 102 ? -40.050 -5.184  21.192 1.00 36.10  ? 103 GLN B CG  1 
ATOM   2006 C CD  . GLN B 1 102 ? -38.658 -4.908  20.653 1.00 45.42  ? 103 GLN B CD  1 
ATOM   2007 O OE1 . GLN B 1 102 ? -37.655 -5.232  21.293 1.00 41.08  ? 103 GLN B OE1 1 
ATOM   2008 N NE2 . GLN B 1 102 ? -38.591 -4.301  19.474 1.00 41.94  ? 103 GLN B NE2 1 
ATOM   2009 N N   . ASP B 1 103 ? -42.125 -7.948  22.762 1.00 35.16  ? 104 ASP B N   1 
ATOM   2010 C CA  . ASP B 1 103 ? -42.932 -8.976  22.124 1.00 31.04  ? 104 ASP B CA  1 
ATOM   2011 C C   . ASP B 1 103 ? -44.385 -8.845  22.567 1.00 35.89  ? 104 ASP B C   1 
ATOM   2012 O O   . ASP B 1 103 ? -45.298 -8.831  21.742 1.00 33.02  ? 104 ASP B O   1 
ATOM   2013 C CB  . ASP B 1 103 ? -42.376 -10.362 22.460 1.00 39.21  ? 104 ASP B CB  1 
ATOM   2014 C CG  . ASP B 1 103 ? -43.013 -11.462 21.644 1.00 44.02  ? 104 ASP B CG  1 
ATOM   2015 O OD1 . ASP B 1 103 ? -42.783 -11.502 20.419 1.00 41.53  ? 104 ASP B OD1 1 
ATOM   2016 O OD2 . ASP B 1 103 ? -43.728 -12.296 22.235 1.00 43.12  ? 104 ASP B OD2 1 
ATOM   2017 N N   . ARG B 1 104 ? -44.580 -8.735  23.877 1.00 32.18  ? 105 ARG B N   1 
ATOM   2018 C CA  . ARG B 1 104 ? -45.900 -8.535  24.454 1.00 30.07  ? 105 ARG B CA  1 
ATOM   2019 C C   . ARG B 1 104 ? -46.572 -7.266  23.929 1.00 29.00  ? 105 ARG B C   1 
ATOM   2020 O O   . ARG B 1 104 ? -47.786 -7.252  23.686 1.00 30.59  ? 105 ARG B O   1 
ATOM   2021 C CB  . ARG B 1 104 ? -45.804 -8.479  25.980 1.00 34.15  ? 105 ARG B CB  1 
ATOM   2022 C CG  . ARG B 1 104 ? -47.037 -7.893  26.643 1.00 36.93  ? 105 ARG B CG  1 
ATOM   2023 C CD  . ARG B 1 104 ? -46.861 -7.727  28.137 1.00 33.88  ? 105 ARG B CD  1 
ATOM   2024 N NE  . ARG B 1 104 ? -47.840 -6.780  28.654 1.00 32.24  ? 105 ARG B NE  1 
ATOM   2025 C CZ  . ARG B 1 104 ? -49.081 -7.103  29.001 1.00 38.14  ? 105 ARG B CZ  1 
ATOM   2026 N NH1 . ARG B 1 104 ? -49.496 -8.360  28.902 1.00 37.54  ? 105 ARG B NH1 1 
ATOM   2027 N NH2 . ARG B 1 104 ? -49.909 -6.169  29.449 1.00 47.56  ? 105 ARG B NH2 1 
ATOM   2028 N N   . ASN B 1 105 ? -45.784 -6.206  23.756 1.00 28.38  ? 106 ASN B N   1 
ATOM   2029 C CA  . ASN B 1 105 ? -46.314 -4.935  23.271 1.00 26.48  ? 106 ASN B CA  1 
ATOM   2030 C C   . ASN B 1 105 ? -46.880 -5.034  21.856 1.00 31.21  ? 106 ASN B C   1 
ATOM   2031 O O   . ASN B 1 105 ? -47.936 -4.478  21.569 1.00 33.60  ? 106 ASN B O   1 
ATOM   2032 C CB  . ASN B 1 105 ? -45.236 -3.850  23.327 1.00 29.88  ? 106 ASN B CB  1 
ATOM   2033 C CG  . ASN B 1 105 ? -45.077 -3.254  24.717 1.00 28.69  ? 106 ASN B CG  1 
ATOM   2034 O OD1 . ASN B 1 105 ? -46.041 -3.140  25.471 1.00 33.57  ? 106 ASN B OD1 1 
ATOM   2035 N ND2 . ASN B 1 105 ? -43.857 -2.864  25.056 1.00 31.37  ? 106 ASN B ND2 1 
ATOM   2036 N N   . ILE B 1 106 ? -46.176 -5.741  20.977 1.00 31.10  ? 107 ILE B N   1 
ATOM   2037 C CA  . ILE B 1 106 ? -46.642 -5.944  19.606 1.00 30.08  ? 107 ILE B CA  1 
ATOM   2038 C C   . ILE B 1 106 ? -47.971 -6.703  19.597 1.00 29.63  ? 107 ILE B C   1 
ATOM   2039 O O   . ILE B 1 106 ? -48.875 -6.383  18.814 1.00 26.03  ? 107 ILE B O   1 
ATOM   2040 C CB  . ILE B 1 106 ? -45.586 -6.698  18.747 1.00 33.06  ? 107 ILE B CB  1 
ATOM   2041 C CG1 . ILE B 1 106 ? -44.672 -5.708  18.019 1.00 39.93  ? 107 ILE B CG1 1 
ATOM   2042 C CG2 . ILE B 1 106 ? -46.247 -7.569  17.695 1.00 36.14  ? 107 ILE B CG2 1 
ATOM   2043 C CD1 . ILE B 1 106 ? -43.891 -4.788  18.925 1.00 40.75  ? 107 ILE B CD1 1 
ATOM   2044 N N   . ALA B 1 107 ? -48.098 -7.685  20.487 1.00 28.55  ? 108 ALA B N   1 
ATOM   2045 C CA  . ALA B 1 107 ? -49.329 -8.465  20.596 1.00 28.96  ? 108 ALA B CA  1 
ATOM   2046 C C   . ALA B 1 107 ? -50.505 -7.572  20.984 1.00 33.43  ? 108 ALA B C   1 
ATOM   2047 O O   . ALA B 1 107 ? -51.614 -7.729  20.479 1.00 31.02  ? 108 ALA B O   1 
ATOM   2048 C CB  . ALA B 1 107 ? -49.155 -9.586  21.605 1.00 28.90  ? 108 ALA B CB  1 
ATOM   2049 N N   . ILE B 1 108 ? -50.242 -6.630  21.880 1.00 33.43  ? 109 ILE B N   1 
ATOM   2050 C CA  . ILE B 1 108 ? -51.244 -5.669  22.317 1.00 27.32  ? 109 ILE B CA  1 
ATOM   2051 C C   . ILE B 1 108 ? -51.642 -4.730  21.182 1.00 27.73  ? 109 ILE B C   1 
ATOM   2052 O O   . ILE B 1 108 ? -52.815 -4.376  21.039 1.00 32.03  ? 109 ILE B O   1 
ATOM   2053 C CB  . ILE B 1 108 ? -50.735 -4.844  23.515 1.00 32.72  ? 109 ILE B CB  1 
ATOM   2054 C CG1 . ILE B 1 108 ? -50.617 -5.732  24.752 1.00 29.49  ? 109 ILE B CG1 1 
ATOM   2055 C CG2 . ILE B 1 108 ? -51.663 -3.675  23.807 1.00 35.89  ? 109 ILE B CG2 1 
ATOM   2056 C CD1 . ILE B 1 108 ? -49.786 -5.121  25.847 1.00 31.71  ? 109 ILE B CD1 1 
ATOM   2057 N N   . GLN B 1 109 ? -50.666 -4.335  20.370 1.00 27.15  ? 110 GLN B N   1 
ATOM   2058 C CA  . GLN B 1 109 ? -50.924 -3.390  19.290 1.00 26.57  ? 110 GLN B CA  1 
ATOM   2059 C C   . GLN B 1 109 ? -51.799 -4.012  18.208 1.00 23.96  ? 110 GLN B C   1 
ATOM   2060 O O   . GLN B 1 109 ? -52.659 -3.340  17.634 1.00 25.17  ? 110 GLN B O   1 
ATOM   2061 C CB  . GLN B 1 109 ? -49.615 -2.891  18.685 1.00 25.43  ? 110 GLN B CB  1 
ATOM   2062 C CG  . GLN B 1 109 ? -48.778 -2.062  19.642 1.00 30.54  ? 110 GLN B CG  1 
ATOM   2063 C CD  . GLN B 1 109 ? -47.517 -1.536  18.990 1.00 35.84  ? 110 GLN B CD  1 
ATOM   2064 O OE1 . GLN B 1 109 ? -47.433 -1.441  17.767 1.00 32.72  ? 110 GLN B OE1 1 
ATOM   2065 N NE2 . GLN B 1 109 ? -46.528 -1.194  19.803 1.00 30.02  ? 110 GLN B NE2 1 
ATOM   2066 N N   . SER B 1 110 ? -51.583 -5.294  17.933 1.00 23.03  ? 111 SER B N   1 
ATOM   2067 C CA  . SER B 1 110 ? -52.410 -6.006  16.969 1.00 26.72  ? 111 SER B CA  1 
ATOM   2068 C C   . SER B 1 110 ? -53.816 -6.224  17.529 1.00 27.21  ? 111 SER B C   1 
ATOM   2069 O O   . SER B 1 110 ? -54.788 -6.299  16.777 1.00 29.24  ? 111 SER B O   1 
ATOM   2070 C CB  . SER B 1 110 ? -51.760 -7.338  16.586 1.00 26.10  ? 111 SER B CB  1 
ATOM   2071 O OG  . SER B 1 110 ? -51.448 -8.110  17.734 1.00 34.23  ? 111 SER B OG  1 
ATOM   2072 N N   . GLN B 1 111 ? -53.919 -6.309  18.854 1.00 29.65  ? 112 GLN B N   1 
ATOM   2073 C CA  . GLN B 1 111 ? -55.217 -6.412  19.520 1.00 24.49  ? 112 GLN B CA  1 
ATOM   2074 C C   . GLN B 1 111 ? -55.974 -5.088  19.447 1.00 30.53  ? 112 GLN B C   1 
ATOM   2075 O O   . GLN B 1 111 ? -57.169 -5.061  19.162 1.00 27.97  ? 112 GLN B O   1 
ATOM   2076 C CB  . GLN B 1 111 ? -55.052 -6.839  20.983 1.00 30.03  ? 112 GLN B CB  1 
ATOM   2077 C CG  . GLN B 1 111 ? -56.373 -7.074  21.711 1.00 32.54  ? 112 GLN B CG  1 
ATOM   2078 C CD  . GLN B 1 111 ? -56.239 -7.024  23.226 1.00 52.03  ? 112 GLN B CD  1 
ATOM   2079 O OE1 . GLN B 1 111 ? -55.571 -7.862  23.833 1.00 59.91  ? 112 GLN B OE1 1 
ATOM   2080 N NE2 . GLN B 1 111 ? -56.880 -6.037  23.843 1.00 46.64  ? 112 GLN B NE2 1 
ATOM   2081 N N   . MET B 1 112 ? -55.274 -3.988  19.702 1.00 33.32  ? 113 MET B N   1 
ATOM   2082 C CA  . MET B 1 112 ? -55.896 -2.667  19.661 1.00 27.21  ? 113 MET B CA  1 
ATOM   2083 C C   . MET B 1 112 ? -56.325 -2.295  18.243 1.00 28.87  ? 113 MET B C   1 
ATOM   2084 O O   . MET B 1 112 ? -57.261 -1.515  18.055 1.00 32.28  ? 113 MET B O   1 
ATOM   2085 C CB  . MET B 1 112 ? -54.945 -1.602  20.215 1.00 24.16  ? 113 MET B CB  1 
ATOM   2086 C CG  . MET B 1 112 ? -54.676 -1.702  21.709 1.00 34.87  ? 113 MET B CG  1 
ATOM   2087 S SD  . MET B 1 112 ? -53.499 -0.292  22.343 1.00 43.50  0 113 MET B SD  1 
ATOM   2088 C CE  . MET B 1 112 ? -53.598 -0.632  24.251 1.00 36.89  ? 113 MET B CE  1 
ATOM   2089 N N   . THR B 1 113 ? -55.634 -2.851  17.252 1.00 24.28  ? 114 THR B N   1 
ATOM   2090 C CA  . THR B 1 113 ? -55.995 -2.630  15.858 1.00 26.33  ? 114 THR B CA  1 
ATOM   2091 C C   . THR B 1 113 ? -57.343 -3.274  15.570 1.00 32.65  ? 114 THR B C   1 
ATOM   2092 O O   . THR B 1 113 ? -58.181 -2.709  14.863 1.00 31.63  ? 114 THR B O   1 
ATOM   2093 C CB  . THR B 1 113 ? -54.934 -3.199  14.892 1.00 30.71  ? 114 THR B CB  1 
ATOM   2094 O OG1 . THR B 1 113 ? -53.744 -2.404  14.961 1.00 26.33  ? 114 THR B OG1 1 
ATOM   2095 C CG2 . THR B 1 113 ? -55.450 -3.196  13.460 1.00 25.39  ? 114 THR B CG2 1 
ATOM   2096 N N   . ARG B 1 114 ? -57.542 -4.459  16.134 1.00 36.90  ? 115 ARG B N   1 
ATOM   2097 C CA  . ARG B 1 114 ? -58.782 -5.193  15.948 1.00 31.99  ? 115 ARG B CA  1 
ATOM   2098 C C   . ARG B 1 114 ? -59.965 -4.425  16.519 1.00 27.66  ? 115 ARG B C   1 
ATOM   2099 O O   . ARG B 1 114 ? -61.005 -4.305  15.868 1.00 34.79  ? 115 ARG B O   1 
ATOM   2100 C CB  . ARG B 1 114 ? -58.688 -6.575  16.591 1.00 37.08  ? 115 ARG B CB  1 
ATOM   2101 C CG  . ARG B 1 114 ? -58.554 -7.693  15.577 1.00 39.92  ? 115 ARG B CG  1 
ATOM   2102 C CD  . ARG B 1 114 ? -58.271 -9.029  16.237 1.00 42.43  ? 115 ARG B CD  1 
ATOM   2103 N NE  . ARG B 1 114 ? -56.842 -9.257  16.430 1.00 46.68  ? 115 ARG B NE  1 
ATOM   2104 C CZ  . ARG B 1 114 ? -56.289 -9.618  17.583 1.00 40.84  ? 115 ARG B CZ  1 
ATOM   2105 N NH1 . ARG B 1 114 ? -57.047 -9.793  18.656 1.00 44.38  ? 115 ARG B NH1 1 
ATOM   2106 N NH2 . ARG B 1 114 ? -54.979 -9.806  17.661 1.00 36.73  ? 115 ARG B NH2 1 
ATOM   2107 N N   . THR B 1 115 ? -59.800 -3.894  17.727 1.00 27.41  ? 116 THR B N   1 
ATOM   2108 C CA  . THR B 1 115 ? -60.871 -3.144  18.367 1.00 35.69  ? 116 THR B CA  1 
ATOM   2109 C C   . THR B 1 115 ? -61.184 -1.867  17.588 1.00 29.68  ? 116 THR B C   1 
ATOM   2110 O O   . THR B 1 115 ? -62.336 -1.437  17.533 1.00 26.39  ? 116 THR B O   1 
ATOM   2111 C CB  . THR B 1 115 ? -60.527 -2.793  19.830 1.00 31.09  ? 116 THR B CB  1 
ATOM   2112 O OG1 . THR B 1 115 ? -59.462 -1.835  19.871 1.00 37.34  ? 116 THR B OG1 1 
ATOM   2113 C CG2 . THR B 1 115 ? -60.108 -4.045  20.594 1.00 36.67  ? 116 THR B CG2 1 
ATOM   2114 N N   . LYS B 1 116 ? -60.165 -1.275  16.968 1.00 32.20  ? 117 LYS B N   1 
ATOM   2115 C CA  . LYS B 1 116 ? -60.362 -0.063  16.177 1.00 35.12  ? 117 LYS B CA  1 
ATOM   2116 C C   . LYS B 1 116 ? -61.228 -0.320  14.951 1.00 30.06  ? 117 LYS B C   1 
ATOM   2117 O O   . LYS B 1 116 ? -62.204 0.394   14.710 1.00 30.54  ? 117 LYS B O   1 
ATOM   2118 C CB  . LYS B 1 116 ? -59.022 0.525   15.737 1.00 29.22  ? 117 LYS B CB  1 
ATOM   2119 C CG  . LYS B 1 116 ? -59.165 1.734   14.826 1.00 37.59  ? 117 LYS B CG  1 
ATOM   2120 C CD  . LYS B 1 116 ? -57.813 2.285   14.433 1.00 39.78  ? 117 LYS B CD  1 
ATOM   2121 C CE  . LYS B 1 116 ? -57.947 3.564   13.630 1.00 35.26  ? 117 LYS B CE  1 
ATOM   2122 N NZ  . LYS B 1 116 ? -56.612 4.195   13.447 1.00 35.92  ? 117 LYS B NZ  1 
ATOM   2123 N N   . GLU B 1 117 ? -60.856 -1.333  14.173 1.00 30.50  ? 118 GLU B N   1 
ATOM   2124 C CA  . GLU B 1 117 ? -61.611 -1.713  12.982 1.00 33.73  ? 118 GLU B CA  1 
ATOM   2125 C C   . GLU B 1 117 ? -63.055 -2.043  13.340 1.00 35.77  ? 118 GLU B C   1 
ATOM   2126 O O   . GLU B 1 117 ? -63.992 -1.664  12.642 1.00 32.96  ? 118 GLU B O   1 
ATOM   2127 C CB  . GLU B 1 117 ? -60.958 -2.915  12.299 1.00 26.25  ? 118 GLU B CB  1 
ATOM   2128 C CG  . GLU B 1 117 ? -59.529 -2.691  11.829 1.00 34.02  ? 118 GLU B CG  1 
ATOM   2129 C CD  . GLU B 1 117 ? -58.823 -3.994  11.507 1.00 44.85  ? 118 GLU B CD  1 
ATOM   2130 O OE1 . GLU B 1 117 ? -59.135 -5.011  12.160 1.00 45.24  ? 118 GLU B OE1 1 
ATOM   2131 O OE2 . GLU B 1 117 ? -57.964 -4.007  10.601 1.00 50.10  ? 118 GLU B OE2 1 
ATOM   2132 N N   . GLU B 1 118 ? -63.210 -2.754  14.448 1.00 37.45  ? 119 GLU B N   1 
ATOM   2133 C CA  . GLU B 1 118 ? -64.513 -3.167  14.951 1.00 30.86  ? 119 GLU B CA  1 
ATOM   2134 C C   . GLU B 1 118 ? -65.381 -1.969  15.340 1.00 30.43  ? 119 GLU B C   1 
ATOM   2135 O O   . GLU B 1 118 ? -66.583 -1.954  15.074 1.00 30.31  ? 119 GLU B O   1 
ATOM   2136 C CB  . GLU B 1 118 ? -64.319 -4.107  16.141 1.00 38.69  ? 119 GLU B CB  1 
ATOM   2137 C CG  . GLU B 1 118 ? -65.572 -4.480  16.894 1.00 45.21  ? 119 GLU B CG  1 
ATOM   2138 C CD  . GLU B 1 118 ? -65.258 -5.305  18.122 1.00 55.52  ? 119 GLU B CD  1 
ATOM   2139 O OE1 . GLU B 1 118 ? -64.219 -5.999  18.119 1.00 48.02  ? 119 GLU B OE1 1 
ATOM   2140 O OE2 . GLU B 1 118 ? -66.038 -5.252  19.093 1.00 60.04  ? 119 GLU B OE2 1 
ATOM   2141 N N   . LEU B 1 119 ? -64.769 -0.966  15.962 1.00 27.27  ? 120 LEU B N   1 
ATOM   2142 C CA  . LEU B 1 119 ? -65.477 0.262   16.320 1.00 27.05  ? 120 LEU B CA  1 
ATOM   2143 C C   . LEU B 1 119 ? -65.853 1.085   15.094 1.00 28.23  ? 120 LEU B C   1 
ATOM   2144 O O   . LEU B 1 119 ? -66.932 1.677   15.043 1.00 24.48  ? 120 LEU B O   1 
ATOM   2145 C CB  . LEU B 1 119 ? -64.630 1.116   17.265 1.00 25.32  ? 120 LEU B CB  1 
ATOM   2146 C CG  . LEU B 1 119 ? -64.507 0.665   18.720 1.00 35.99  ? 120 LEU B CG  1 
ATOM   2147 C CD1 . LEU B 1 119 ? -63.377 1.417   19.392 1.00 34.48  ? 120 LEU B CD1 1 
ATOM   2148 C CD2 . LEU B 1 119 ? -65.814 0.896   19.458 1.00 40.03  ? 120 LEU B CD2 1 
ATOM   2149 N N   . GLU B 1 120 ? -64.950 1.138   14.118 1.00 27.02  ? 121 GLU B N   1 
ATOM   2150 C CA  . GLU B 1 120 ? -65.203 1.879   12.885 1.00 26.03  ? 121 GLU B CA  1 
ATOM   2151 C C   . GLU B 1 120 ? -66.340 1.245   12.091 1.00 24.86  ? 121 GLU B C   1 
ATOM   2152 O O   . GLU B 1 120 ? -67.074 1.940   11.389 1.00 31.00  ? 121 GLU B O   1 
ATOM   2153 C CB  . GLU B 1 120 ? -63.944 1.955   12.018 1.00 27.81  ? 121 GLU B CB  1 
ATOM   2154 C CG  . GLU B 1 120 ? -62.950 3.020   12.437 1.00 34.48  ? 121 GLU B CG  1 
ATOM   2155 C CD  . GLU B 1 120 ? -61.883 3.251   11.385 1.00 35.19  ? 121 GLU B CD  1 
ATOM   2156 O OE1 . GLU B 1 120 ? -60.689 3.056   11.690 1.00 45.99  ? 121 GLU B OE1 1 
ATOM   2157 O OE2 . GLU B 1 120 ? -62.242 3.625   10.250 1.00 36.44  ? 121 GLU B OE2 1 
ATOM   2158 N N   . ALA B 1 121 ? -66.470 -0.075  12.199 1.00 28.11  ? 122 ALA B N   1 
ATOM   2159 C CA  . ALA B 1 121 ? -67.553 -0.803  11.547 1.00 32.79  ? 122 ALA B CA  1 
ATOM   2160 C C   . ALA B 1 121 ? -68.887 -0.532  12.194 1.00 28.11  ? 122 ALA B C   1 
ATOM   2161 O O   . ALA B 1 121 ? -69.914 -0.474  11.514 1.00 33.32  ? 122 ALA B O   1 
ATOM   2162 C CB  . ALA B 1 121 ? -67.257 -2.307  11.545 1.00 26.90  ? 122 ALA B CB  1 
ATOM   2163 N N   . GLU B 1 122 ? -68.864 -0.376  13.511 1.00 27.82  ? 123 GLU B N   1 
ATOM   2164 C CA  . GLU B 1 122 ? -70.073 -0.080  14.264 1.00 34.43  ? 123 GLU B CA  1 
ATOM   2165 C C   . GLU B 1 122 ? -70.518 1.348   13.994 1.00 31.92  ? 123 GLU B C   1 
ATOM   2166 O O   . GLU B 1 122 ? -71.705 1.626   13.858 1.00 32.96  ? 123 GLU B O   1 
ATOM   2167 C CB  . GLU B 1 122 ? -69.838 -0.292  15.760 1.00 33.73  ? 123 GLU B CB  1 
ATOM   2168 C CG  . GLU B 1 122 ? -69.599 -1.740  16.155 1.00 44.16  ? 123 GLU B CG  1 
ATOM   2169 C CD  . GLU B 1 122 ? -69.086 -1.876  17.575 1.00 41.67  ? 123 GLU B CD  1 
ATOM   2170 O OE1 . GLU B 1 122 ? -68.382 -2.866  17.864 1.00 48.72  ? 123 GLU B OE1 1 
ATOM   2171 O OE2 . GLU B 1 122 ? -69.385 -0.992  18.403 1.00 44.65  ? 123 GLU B OE2 1 
ATOM   2172 N N   . LYS B 1 123 ? -69.543 2.248   13.921 1.00 24.18  ? 124 LYS B N   1 
ATOM   2173 C CA  . LYS B 1 123 ? -69.784 3.644   13.586 1.00 28.58  ? 124 LYS B CA  1 
ATOM   2174 C C   . LYS B 1 123 ? -70.372 3.789   12.185 1.00 30.59  ? 124 LYS B C   1 
ATOM   2175 O O   . LYS B 1 123 ? -71.307 4.566   11.977 1.00 32.06  ? 124 LYS B O   1 
ATOM   2176 C CB  . LYS B 1 123 ? -68.483 4.446   13.698 1.00 31.37  ? 124 LYS B CB  1 
ATOM   2177 C CG  . LYS B 1 123 ? -68.564 5.863   13.145 1.00 29.79  ? 124 LYS B CG  1 
ATOM   2178 C CD  . LYS B 1 123 ? -67.212 6.555   13.250 1.00 33.63  ? 124 LYS B CD  1 
ATOM   2179 C CE  . LYS B 1 123 ? -66.767 6.660   14.702 1.00 49.53  ? 124 LYS B CE  1 
ATOM   2180 N NZ  . LYS B 1 123 ? -65.363 7.118   14.865 1.00 54.18  ? 124 LYS B NZ  1 
ATOM   2181 N N   . ARG B 1 124 ? -69.819 3.041   11.231 1.00 30.39  ? 125 ARG B N   1 
ATOM   2182 C CA  . ARG B 1 124 ? -70.283 3.086   9.847  1.00 25.82  ? 125 ARG B CA  1 
ATOM   2183 C C   . ARG B 1 124 ? -71.752 2.690   9.760  1.00 29.08  ? 125 ARG B C   1 
ATOM   2184 O O   . ARG B 1 124 ? -72.536 3.310   9.039  1.00 33.51  ? 125 ARG B O   1 
ATOM   2185 C CB  . ARG B 1 124 ? -69.446 2.163   8.961  1.00 29.71  ? 125 ARG B CB  1 
ATOM   2186 C CG  . ARG B 1 124 ? -69.898 2.116   7.505  1.00 39.70  ? 125 ARG B CG  1 
ATOM   2187 C CD  . ARG B 1 124 ? -69.609 0.759   6.872  1.00 43.97  ? 125 ARG B CD  1 
ATOM   2188 N NE  . ARG B 1 124 ? -68.189 0.422   6.904  1.00 45.01  ? 125 ARG B NE  1 
ATOM   2189 C CZ  . ARG B 1 124 ? -67.716 -0.799  7.125  1.00 51.49  ? 125 ARG B CZ  1 
ATOM   2190 N NH1 . ARG B 1 124 ? -68.548 -1.807  7.338  1.00 55.24  ? 125 ARG B NH1 1 
ATOM   2191 N NH2 . ARG B 1 124 ? -66.408 -1.011  7.136  1.00 45.14  ? 125 ARG B NH2 1 
ATOM   2192 N N   . ASP B 1 125 ? -72.109 1.648   10.505 1.00 26.93  ? 126 ASP B N   1 
ATOM   2193 C CA  . ASP B 1 125 ? -73.477 1.153   10.555 1.00 35.72  ? 126 ASP B CA  1 
ATOM   2194 C C   . ASP B 1 125 ? -74.405 2.143   11.259 1.00 34.31  ? 126 ASP B C   1 
ATOM   2195 O O   . ASP B 1 125 ? -75.559 2.305   10.865 1.00 29.31  ? 126 ASP B O   1 
ATOM   2196 C CB  . ASP B 1 125 ? -73.522 -0.205  11.258 1.00 40.55  ? 126 ASP B CB  1 
ATOM   2197 C CG  . ASP B 1 125 ? -72.746 -1.273  10.513 1.00 48.69  ? 126 ASP B CG  1 
ATOM   2198 O OD1 . ASP B 1 125 ? -72.646 -1.180  9.274  1.00 48.50  ? 126 ASP B OD1 1 
ATOM   2199 O OD2 . ASP B 1 125 ? -72.238 -2.206  11.167 1.00 48.62  ? 126 ASP B OD2 1 
ATOM   2200 N N   . LEU B 1 126 ? -73.899 2.793   12.304 1.00 31.44  ? 127 LEU B N   1 
ATOM   2201 C CA  . LEU B 1 126 ? -74.657 3.818   13.016 1.00 29.28  ? 127 LEU B CA  1 
ATOM   2202 C C   . LEU B 1 126 ? -75.024 4.973   12.087 1.00 26.48  ? 127 LEU B C   1 
ATOM   2203 O O   . LEU B 1 126 ? -76.095 5.567   12.205 1.00 24.22  ? 127 LEU B O   1 
ATOM   2204 C CB  . LEU B 1 126 ? -73.860 4.342   14.211 1.00 27.12  ? 127 LEU B CB  1 
ATOM   2205 C CG  . LEU B 1 126 ? -74.198 3.823   15.611 1.00 36.28  ? 127 LEU B CG  1 
ATOM   2206 C CD1 . LEU B 1 126 ? -74.307 2.309   15.638 1.00 49.16  ? 127 LEU B CD1 1 
ATOM   2207 C CD2 . LEU B 1 126 ? -73.136 4.288   16.590 1.00 32.53  ? 127 LEU B CD2 1 
ATOM   2208 N N   . ILE B 1 127 ? -74.122 5.288   11.166 1.00 24.06  ? 128 ILE B N   1 
ATOM   2209 C CA  . ILE B 1 127 ? -74.350 6.360   10.210 1.00 25.12  ? 128 ILE B CA  1 
ATOM   2210 C C   . ILE B 1 127 ? -75.389 5.914   9.184  1.00 27.18  ? 128 ILE B C   1 
ATOM   2211 O O   . ILE B 1 127 ? -76.260 6.691   8.780  1.00 26.94  ? 128 ILE B O   1 
ATOM   2212 C CB  . ILE B 1 127 ? -73.031 6.771   9.531  1.00 23.68  ? 128 ILE B CB  1 
ATOM   2213 C CG1 . ILE B 1 127 ? -72.179 7.556   10.528 1.00 21.50  ? 128 ILE B CG1 1 
ATOM   2214 C CG2 . ILE B 1 127 ? -73.282 7.595   8.282  1.00 25.68  ? 128 ILE B CG2 1 
ATOM   2215 C CD1 . ILE B 1 127 ? -70.926 8.147   9.950  1.00 21.39  ? 128 ILE B CD1 1 
ATOM   2216 N N   . ARG B 1 128 ? -75.306 4.643   8.801  1.00 26.80  ? 129 ARG B N   1 
ATOM   2217 C CA  . ARG B 1 128 ? -76.258 4.040   7.878  1.00 23.72  ? 129 ARG B CA  1 
ATOM   2218 C C   . ARG B 1 128 ? -77.677 4.016   8.444  1.00 28.90  ? 129 ARG B C   1 
ATOM   2219 O O   . ARG B 1 128 ? -78.631 4.354   7.742  1.00 31.15  ? 129 ARG B O   1 
ATOM   2220 C CB  . ARG B 1 128 ? -75.816 2.620   7.516  1.00 36.94  ? 129 ARG B CB  1 
ATOM   2221 C CG  . ARG B 1 128 ? -76.912 1.786   6.875  1.00 29.62  ? 129 ARG B CG  1 
ATOM   2222 C CD  . ARG B 1 128 ? -76.421 0.420   6.418  1.00 34.50  ? 129 ARG B CD  1 
ATOM   2223 N NE  . ARG B 1 128 ? -77.536 -0.511  6.262  1.00 51.77  ? 129 ARG B NE  1 
ATOM   2224 C CZ  . ARG B 1 128 ? -78.430 -0.459  5.279  1.00 49.88  ? 129 ARG B CZ  1 
ATOM   2225 N NH1 . ARG B 1 128 ? -78.350 0.480   4.345  1.00 47.88  ? 129 ARG B NH1 1 
ATOM   2226 N NH2 . ARG B 1 128 ? -79.411 -1.351  5.230  1.00 46.71  ? 129 ARG B NH2 1 
ATOM   2227 N N   . THR B 1 129 ? -77.826 3.620   9.706  1.00 32.76  ? 130 THR B N   1 
ATOM   2228 C CA  . THR B 1 129 ? -79.160 3.578   10.298 1.00 25.67  ? 130 THR B CA  1 
ATOM   2229 C C   . THR B 1 129 ? -79.696 4.990   10.518 1.00 26.22  ? 130 THR B C   1 
ATOM   2230 O O   . THR B 1 129 ? -80.890 5.232   10.344 1.00 29.05  ? 130 THR B O   1 
ATOM   2231 C CB  . THR B 1 129 ? -79.202 2.793   11.637 1.00 31.64  ? 130 THR B CB  1 
ATOM   2232 O OG1 . THR B 1 129 ? -80.474 2.992   12.267 1.00 35.54  ? 130 THR B OG1 1 
ATOM   2233 C CG2 . THR B 1 129 ? -78.123 3.254   12.582 1.00 38.08  ? 130 THR B CG2 1 
ATOM   2234 N N   . ASN B 1 130 ? -78.820 5.927   10.875 1.00 21.85  ? 131 ASN B N   1 
ATOM   2235 C CA  . ASN B 1 130 ? -79.256 7.298   11.121 1.00 25.09  ? 131 ASN B CA  1 
ATOM   2236 C C   . ASN B 1 130 ? -79.685 8.017   9.841  1.00 27.86  ? 131 ASN B C   1 
ATOM   2237 O O   . ASN B 1 130 ? -80.605 8.838   9.870  1.00 28.88  ? 131 ASN B O   1 
ATOM   2238 C CB  . ASN B 1 130 ? -78.157 8.092   11.834 1.00 29.77  ? 131 ASN B CB  1 
ATOM   2239 C CG  . ASN B 1 130 ? -78.058 7.749   13.310 1.00 31.10  ? 131 ASN B CG  1 
ATOM   2240 O OD1 . ASN B 1 130 ? -78.932 7.080   13.859 1.00 32.52  ? 131 ASN B OD1 1 
ATOM   2241 N ND2 . ASN B 1 130 ? -76.997 8.216   13.961 1.00 25.59  ? 131 ASN B ND2 1 
ATOM   2242 N N   . GLU B 1 131 ? -79.032 7.710   8.722  1.00 27.44  ? 132 GLU B N   1 
ATOM   2243 C CA  . GLU B 1 131 ? -79.440 8.269   7.436  1.00 24.50  ? 132 GLU B CA  1 
ATOM   2244 C C   . GLU B 1 131 ? -80.794 7.703   7.017  1.00 28.84  ? 132 GLU B C   1 
ATOM   2245 O O   . GLU B 1 131 ? -81.672 8.436   6.561  1.00 29.04  ? 132 GLU B O   1 
ATOM   2246 C CB  . GLU B 1 131 ? -78.388 7.989   6.359  1.00 28.23  ? 132 GLU B CB  1 
ATOM   2247 C CG  . GLU B 1 131 ? -77.424 9.144   6.118  1.00 40.80  ? 132 GLU B CG  1 
ATOM   2248 C CD  . GLU B 1 131 ? -76.023 8.686   5.743  1.00 46.67  ? 132 GLU B CD  1 
ATOM   2249 O OE1 . GLU B 1 131 ? -75.889 7.684   5.010  1.00 38.04  ? 132 GLU B OE1 1 
ATOM   2250 O OE2 . GLU B 1 131 ? -75.053 9.330   6.193  1.00 40.67  ? 132 GLU B OE2 1 
ATOM   2251 N N   . ARG B 1 132 ? -80.952 6.394   7.177  1.00 27.12  ? 133 ARG B N   1 
ATOM   2252 C CA  . ARG B 1 132 ? -82.210 5.718   6.880  1.00 25.36  ? 133 ARG B CA  1 
ATOM   2253 C C   . ARG B 1 132 ? -83.359 6.300   7.702  1.00 30.45  ? 133 ARG B C   1 
ATOM   2254 O O   . ARG B 1 132 ? -84.450 6.536   7.182  1.00 32.96  ? 133 ARG B O   1 
ATOM   2255 C CB  . ARG B 1 132 ? -82.064 4.214   7.134  1.00 26.55  ? 133 ARG B CB  1 
ATOM   2256 C CG  . ARG B 1 132 ? -83.364 3.458   7.361  1.00 35.37  ? 133 ARG B CG  1 
ATOM   2257 C CD  . ARG B 1 132 ? -84.262 3.453   6.129  1.00 46.94  ? 133 ARG B CD  1 
ATOM   2258 N NE  . ARG B 1 132 ? -85.202 2.336   6.155  1.00 50.93  ? 133 ARG B NE  1 
ATOM   2259 C CZ  . ARG B 1 132 ? -86.435 2.378   5.664  1.00 56.58  ? 133 ARG B CZ  1 
ATOM   2260 N NH1 . ARG B 1 132 ? -86.893 3.489   5.113  1.00 58.68  ? 133 ARG B NH1 1 
ATOM   2261 N NH2 . ARG B 1 132 ? -87.211 1.308   5.731  1.00 48.95  ? 133 ARG B NH2 1 
ATOM   2262 N N   . LEU B 1 133 ? -83.102 6.541   8.984  1.00 31.14  ? 134 LEU B N   1 
ATOM   2263 C CA  . LEU B 1 133 ? -84.092 7.140   9.872  1.00 25.33  ? 134 LEU B CA  1 
ATOM   2264 C C   . LEU B 1 133 ? -84.446 8.566   9.466  1.00 28.88  ? 134 LEU B C   1 
ATOM   2265 O O   . LEU B 1 133 ? -85.585 9.001   9.637  1.00 35.10  ? 134 LEU B O   1 
ATOM   2266 C CB  . LEU B 1 133 ? -83.589 7.132   11.316 1.00 33.09  ? 134 LEU B CB  1 
ATOM   2267 C CG  . LEU B 1 133 ? -83.557 5.778   12.021 1.00 33.84  ? 134 LEU B CG  1 
ATOM   2268 C CD1 . LEU B 1 133 ? -82.866 5.904   13.362 1.00 27.17  ? 134 LEU B CD1 1 
ATOM   2269 C CD2 . LEU B 1 133 ? -84.962 5.228   12.185 1.00 35.00  ? 134 LEU B CD2 1 
ATOM   2270 N N   . SER B 1 134 ? -83.467 9.297   8.947  1.00 25.01  ? 135 SER B N   1 
ATOM   2271 C CA  . SER B 1 134 ? -83.696 10.676  8.543  1.00 27.23  ? 135 SER B CA  1 
ATOM   2272 C C   . SER B 1 134 ? -84.624 10.743  7.339  1.00 38.94  ? 135 SER B C   1 
ATOM   2273 O O   . SER B 1 134 ? -85.593 11.502  7.332  1.00 34.00  ? 135 SER B O   1 
ATOM   2274 C CB  . SER B 1 134 ? -82.371 11.372  8.233  1.00 24.32  ? 135 SER B CB  1 
ATOM   2275 O OG  . SER B 1 134 ? -81.563 11.455  9.395  1.00 29.60  ? 135 SER B OG  1 
ATOM   2276 N N   . GLN B 1 135 ? -84.336 9.931   6.327  1.00 33.71  ? 136 GLN B N   1 
ATOM   2277 C CA  . GLN B 1 135 ? -85.127 9.951   5.106  1.00 34.44  ? 136 GLN B CA  1 
ATOM   2278 C C   . GLN B 1 135 ? -86.542 9.446   5.377  1.00 36.51  ? 136 GLN B C   1 
ATOM   2279 O O   . GLN B 1 135 ? -87.479 9.783   4.651  1.00 39.61  ? 136 GLN B O   1 
ATOM   2280 C CB  . GLN B 1 135 ? -84.456 9.123   4.006  1.00 38.99  ? 136 GLN B CB  1 
ATOM   2281 C CG  . GLN B 1 135 ? -84.768 7.636   4.029  1.00 45.62  ? 136 GLN B CG  1 
ATOM   2282 C CD  . GLN B 1 135 ? -84.593 7.001   2.663  1.00 54.81  ? 136 GLN B CD  1 
ATOM   2283 O OE1 . GLN B 1 135 ? -83.753 7.428   1.869  1.00 59.73  ? 136 GLN B OE1 1 
ATOM   2284 N NE2 . GLN B 1 135 ? -85.398 5.985   2.376  1.00 47.63  ? 136 GLN B NE2 1 
ATOM   2285 N N   . GLU B 1 136 ? -86.700 8.661   6.437  1.00 34.34  ? 137 GLU B N   1 
ATOM   2286 C CA  . GLU B 1 136 ? -88.017 8.158   6.798  1.00 33.19  ? 137 GLU B CA  1 
ATOM   2287 C C   . GLU B 1 136 ? -88.834 9.246   7.480  1.00 34.85  ? 137 GLU B C   1 
ATOM   2288 O O   . GLU B 1 136 ? -90.055 9.300   7.341  1.00 35.89  ? 137 GLU B O   1 
ATOM   2289 C CB  . GLU B 1 136 ? -87.902 6.934   7.702  1.00 38.61  ? 137 GLU B CB  1 
ATOM   2290 C CG  . GLU B 1 136 ? -89.148 6.079   7.700  1.00 41.11  ? 137 GLU B CG  1 
ATOM   2291 C CD  . GLU B 1 136 ? -89.494 5.584   6.311  1.00 51.84  ? 137 GLU B CD  1 
ATOM   2292 O OE1 . GLU B 1 136 ? -90.698 5.481   5.995  1.00 47.79  ? 137 GLU B OE1 1 
ATOM   2293 O OE2 . GLU B 1 136 ? -88.559 5.297   5.535  1.00 45.92  ? 137 GLU B OE2 1 
ATOM   2294 N N   . LEU B 1 137 ? -88.150 10.105  8.228  1.00 37.27  ? 138 LEU B N   1 
ATOM   2295 C CA  . LEU B 1 137 ? -88.792 11.263  8.833  1.00 38.59  ? 138 LEU B CA  1 
ATOM   2296 C C   . LEU B 1 137 ? -89.261 12.234  7.757  1.00 33.41  ? 138 LEU B C   1 
ATOM   2297 O O   . LEU B 1 137 ? -90.375 12.748  7.816  1.00 35.60  ? 138 LEU B O   1 
ATOM   2298 C CB  . LEU B 1 137 ? -87.837 11.958  9.808  1.00 31.13  ? 138 LEU B CB  1 
ATOM   2299 C CG  . LEU B 1 137 ? -87.790 11.348  11.211 1.00 35.99  ? 138 LEU B CG  1 
ATOM   2300 C CD1 . LEU B 1 137 ? -86.662 11.954  12.031 1.00 31.61  ? 138 LEU B CD1 1 
ATOM   2301 C CD2 . LEU B 1 137 ? -89.127 11.545  11.907 1.00 36.05  ? 138 LEU B CD2 1 
ATOM   2302 N N   . GLU B 1 138 ? -88.401 12.472  6.772  1.00 34.29  ? 139 GLU B N   1 
ATOM   2303 C CA  . GLU B 1 138 ? -88.719 13.340  5.639  1.00 32.89  ? 139 GLU B CA  1 
ATOM   2304 C C   . GLU B 1 138 ? -90.016 12.920  4.952  1.00 34.16  ? 139 GLU B C   1 
ATOM   2305 O O   . GLU B 1 138 ? -90.880 13.742  4.657  1.00 34.37  ? 139 GLU B O   1 
ATOM   2306 C CB  . GLU B 1 138 ? -87.561 13.328  4.635  1.00 29.92  ? 139 GLU B CB  1 
ATOM   2307 C CG  . GLU B 1 138 ? -87.832 14.078  3.347  1.00 41.25  ? 139 GLU B CG  1 
ATOM   2308 C CD  . GLU B 1 138 ? -87.780 15.580  3.526  1.00 43.52  ? 139 GLU B CD  1 
ATOM   2309 O OE1 . GLU B 1 138 ? -87.263 16.036  4.568  1.00 52.61  ? 139 GLU B OE1 1 
ATOM   2310 O OE2 . GLU B 1 138 ? -88.253 16.305  2.626  1.00 48.39  ? 139 GLU B OE2 1 
ATOM   2311 N N   . TYR B 1 139 ? -90.134 11.618  4.723  1.00 27.87  ? 140 TYR B N   1 
ATOM   2312 C CA  . TYR B 1 139 ? -91.303 11.008  4.099  1.00 31.82  ? 140 TYR B CA  1 
ATOM   2313 C C   . TYR B 1 139 ? -92.582 11.231  4.899  1.00 29.14  ? 140 TYR B C   1 
ATOM   2314 O O   . TYR B 1 139 ? -93.655 11.446  4.329  1.00 27.71  ? 140 TYR B O   1 
ATOM   2315 C CB  . TYR B 1 139 ? -91.053 9.509   3.923  1.00 27.62  ? 140 TYR B CB  1 
ATOM   2316 C CG  . TYR B 1 139 ? -92.197 8.729   3.339  1.00 31.02  ? 140 TYR B CG  1 
ATOM   2317 C CD1 . TYR B 1 139 ? -92.429 8.714   1.971  1.00 27.79  ? 140 TYR B CD1 1 
ATOM   2318 C CD2 . TYR B 1 139 ? -93.032 7.983   4.156  1.00 30.84  ? 140 TYR B CD2 1 
ATOM   2319 C CE1 . TYR B 1 139 ? -93.478 7.990   1.433  1.00 24.16  ? 140 TYR B CE1 1 
ATOM   2320 C CE2 . TYR B 1 139 ? -94.079 7.253   3.632  1.00 27.69  ? 140 TYR B CE2 1 
ATOM   2321 C CZ  . TYR B 1 139 ? -94.297 7.261   2.270  1.00 32.53  ? 140 TYR B CZ  1 
ATOM   2322 O OH  . TYR B 1 139 ? -95.336 6.534   1.748  1.00 31.42  ? 140 TYR B OH  1 
ATOM   2323 N N   . LEU B 1 140 ? -92.459 11.175  6.221  1.00 36.18  ? 141 LEU B N   1 
ATOM   2324 C CA  . LEU B 1 140 ? -93.614 11.281  7.104  1.00 30.56  ? 141 LEU B CA  1 
ATOM   2325 C C   . LEU B 1 140 ? -93.948 12.722  7.491  1.00 39.09  ? 141 LEU B C   1 
ATOM   2326 O O   . LEU B 1 140 ? -95.009 12.982  8.058  1.00 45.99  ? 141 LEU B O   1 
ATOM   2327 C CB  . LEU B 1 140 ? -93.384 10.451  8.367  1.00 32.61  ? 141 LEU B CB  1 
ATOM   2328 C CG  . LEU B 1 140 ? -93.237 8.940   8.177  1.00 35.16  ? 141 LEU B CG  1 
ATOM   2329 C CD1 . LEU B 1 140 ? -93.099 8.258   9.519  1.00 43.10  ? 141 LEU B CD1 1 
ATOM   2330 C CD2 . LEU B 1 140 ? -94.417 8.369   7.413  1.00 36.92  ? 141 LEU B CD2 1 
ATOM   2331 N N   . THR B 1 141 ? -93.048 13.654  7.190  1.00 37.24  ? 142 THR B N   1 
ATOM   2332 C CA  . THR B 1 141 ? -93.304 15.065  7.469  1.00 42.27  ? 142 THR B CA  1 
ATOM   2333 C C   . THR B 1 141 ? -92.410 15.965  6.625  1.00 47.42  ? 142 THR B C   1 
ATOM   2334 O O   . THR B 1 141 ? -92.581 16.058  5.410  1.00 54.81  ? 142 THR B O   1 
ATOM   2335 C CB  . THR B 1 141 ? -93.098 15.401  8.967  1.00 52.65  ? 142 THR B CB  1 
ATOM   2336 O OG1 . THR B 1 141 ? -93.417 16.778  9.202  1.00 60.11  ? 142 THR B OG1 1 
ATOM   2337 C CG2 . THR B 1 141 ? -91.662 15.138  9.393  1.00 46.10  ? 142 THR B CG2 1 
HETATM 2338 O O   . HOH C 2 .   ? -93.234 8.643   21.163 1.00 52.37  ? 201 HOH A O   1 
HETATM 2339 O O   . HOH C 2 .   ? 72.892  -16.656 81.388 1.00 36.17  ? 202 HOH A O   1 
HETATM 2340 O O   . HOH C 2 .   ? -70.163 12.407  22.482 1.00 39.00  ? 203 HOH A O   1 
HETATM 2341 O O   . HOH C 2 .   ? -79.579 4.210   23.123 1.00 46.51  ? 204 HOH A O   1 
HETATM 2342 O O   . HOH C 2 .   ? -81.266 10.941  22.051 1.00 34.27  ? 205 HOH A O   1 
HETATM 2343 O O   . HOH C 2 .   ? 53.287  -23.010 77.422 1.00 55.62  ? 206 HOH A O   1 
HETATM 2344 O O   . HOH C 2 .   ? -7.416  -3.278  31.085 1.00 27.10  ? 207 HOH A O   1 
HETATM 2345 O O   . HOH C 2 .   ? -68.362 13.943  21.145 1.00 41.08  ? 208 HOH A O   1 
HETATM 2346 O O   . HOH C 2 .   ? -11.331 -6.274  23.638 1.00 33.89  ? 209 HOH A O   1 
HETATM 2347 O O   . HOH C 2 .   ? -21.716 2.455   26.545 1.00 34.17  ? 210 HOH A O   1 
HETATM 2348 O O   . HOH C 2 .   ? -37.707 3.107   28.109 1.00 41.09  ? 211 HOH A O   1 
HETATM 2349 O O   . HOH C 2 .   ? 71.368  -19.064 86.682 1.00 44.71  ? 212 HOH A O   1 
HETATM 2350 O O   . HOH C 2 .   ? 34.162  -19.255 68.817 1.00 52.38  ? 213 HOH A O   1 
HETATM 2351 O O   . HOH C 2 .   ? -20.168 -11.935 29.503 1.00 53.00  ? 214 HOH A O   1 
HETATM 2352 O O   . HOH C 2 .   ? -87.116 13.110  19.645 1.00 33.58  ? 215 HOH A O   1 
HETATM 2353 O O   . HOH C 2 .   ? 24.694  -16.534 51.201 1.00 59.96  ? 216 HOH A O   1 
HETATM 2354 O O   . HOH C 2 .   ? -6.458  -3.218  22.209 1.00 32.03  ? 217 HOH A O   1 
HETATM 2355 O O   . HOH C 2 .   ? -55.790 0.815   26.174 1.00 40.30  ? 218 HOH A O   1 
HETATM 2356 O O   . HOH C 2 .   ? 51.724  -8.759  85.973 1.00 35.69  ? 219 HOH A O   1 
HETATM 2357 O O   . HOH C 2 .   ? -29.091 1.162   31.998 1.00 53.71  ? 220 HOH A O   1 
HETATM 2358 O O   . HOH C 2 .   ? 52.487  -18.529 81.513 1.00 40.27  ? 221 HOH A O   1 
HETATM 2359 O O   . HOH C 2 .   ? 6.030   -8.132  32.711 1.00 35.35  ? 222 HOH A O   1 
HETATM 2360 O O   . HOH C 2 .   ? -65.033 -0.005  22.841 1.00 49.48  ? 223 HOH A O   1 
HETATM 2361 O O   . HOH C 2 .   ? 37.769  -10.389 67.778 1.00 56.69  ? 224 HOH A O   1 
HETATM 2362 O O   . HOH C 2 .   ? 32.536  -21.418 60.917 1.00 44.65  ? 225 HOH A O   1 
HETATM 2363 O O   . HOH C 2 .   ? -34.483 1.092   18.302 1.00 37.66  ? 226 HOH A O   1 
HETATM 2364 O O   . HOH C 2 .   ? 38.618  -19.111 72.519 1.00 48.18  ? 227 HOH A O   1 
HETATM 2365 O O   . HOH C 2 .   ? 23.124  -9.090  64.500 1.00 48.32  ? 228 HOH A O   1 
HETATM 2366 O O   . HOH C 2 .   ? 53.642  -13.094 93.536 1.00 40.97  ? 229 HOH A O   1 
HETATM 2367 O O   . HOH C 2 .   ? -75.432 13.941  19.346 1.00 42.07  ? 230 HOH A O   1 
HETATM 2368 O O   . HOH C 2 .   ? 63.645  -19.595 89.237 1.00 19.76  ? 231 HOH A O   1 
HETATM 2369 O O   . HOH C 2 .   ? 48.032  -18.334 78.685 1.00 39.17  ? 232 HOH A O   1 
HETATM 2370 O O   . HOH C 2 .   ? -69.100 13.498  16.846 1.00 35.51  ? 233 HOH A O   1 
HETATM 2371 O O   . HOH C 2 .   ? -91.200 7.457   25.167 1.00 46.52  ? 234 HOH A O   1 
HETATM 2372 O O   . HOH C 2 .   ? 18.577  -13.615 46.656 1.00 37.88  ? 235 HOH A O   1 
HETATM 2373 O O   . HOH C 2 .   ? -15.514 0.388   33.668 1.00 42.83  ? 236 HOH A O   1 
HETATM 2374 O O   . HOH C 2 .   ? -40.920 -0.267  18.573 1.00 49.12  ? 237 HOH A O   1 
HETATM 2375 O O   . HOH C 2 .   ? -17.953 -7.003  22.806 1.00 32.65  ? 238 HOH A O   1 
HETATM 2376 O O   . HOH C 2 .   ? 14.590  -17.130 56.004 1.00 53.42  ? 239 HOH A O   1 
HETATM 2377 O O   . HOH C 2 .   ? 67.266  -9.592  88.199 1.00 39.77  ? 240 HOH A O   1 
HETATM 2378 O O   . HOH C 2 .   ? -25.950 3.487   16.835 1.00 61.72  ? 241 HOH A O   1 
HETATM 2379 O O   . HOH C 2 .   ? -0.956  -4.229  31.161 1.00 33.80  ? 242 HOH A O   1 
HETATM 2380 O O   . HOH C 2 .   ? -42.652 7.872   24.675 1.00 38.64  ? 243 HOH A O   1 
HETATM 2381 O O   . HOH C 2 .   ? -51.719 3.094   26.432 1.00 35.21  ? 244 HOH A O   1 
HETATM 2382 O O   . HOH C 2 .   ? -36.863 1.946   18.197 1.00 40.26  ? 245 HOH A O   1 
HETATM 2383 O O   . HOH C 2 .   ? 51.736  -12.749 90.112 1.00 41.84  ? 246 HOH A O   1 
HETATM 2384 O O   . HOH C 2 .   ? -63.940 14.580  17.130 1.00 52.89  ? 247 HOH A O   1 
HETATM 2385 O O   . HOH C 2 .   ? 68.221  -10.455 86.343 1.00 34.81  ? 248 HOH A O   1 
HETATM 2386 O O   . HOH C 2 .   ? 15.072  -19.406 58.277 1.00 64.88  ? 249 HOH A O   1 
HETATM 2387 O O   . HOH C 2 .   ? 10.387  -22.499 44.114 1.00 61.29  ? 250 HOH A O   1 
HETATM 2388 O O   . HOH C 2 .   ? 50.480  -15.000 88.319 1.00 42.44  ? 251 HOH A O   1 
HETATM 2389 O O   . HOH C 2 .   ? 49.082  -8.615  84.500 1.00 24.18  ? 252 HOH A O   1 
HETATM 2390 O O   . HOH C 2 .   ? 7.742   -22.216 44.813 1.00 51.81  ? 253 HOH A O   1 
HETATM 2391 O O   . HOH C 2 .   ? -3.277  -4.953  29.576 1.00 54.39  ? 254 HOH A O   1 
HETATM 2392 O O   . HOH C 2 .   ? 39.931  -18.782 75.106 1.00 60.25  ? 255 HOH A O   1 
HETATM 2393 O O   . HOH C 2 .   ? -74.846 15.937  15.744 1.00 52.54  ? 256 HOH A O   1 
HETATM 2394 O O   . HOH C 2 .   ? -72.283 15.932  17.628 1.00 38.68  ? 257 HOH A O   1 
HETATM 2395 O O   . HOH C 2 .   ? -42.356 0.649   15.896 1.00 39.41  ? 258 HOH A O   1 
HETATM 2396 O O   . HOH C 2 .   ? 29.078  -12.992 49.583 1.00 44.00  ? 259 HOH A O   1 
HETATM 2397 O O   . HOH C 2 .   ? 8.268   -9.667  35.762 1.00 35.14  ? 260 HOH A O   1 
HETATM 2398 O O   . HOH C 2 .   ? -74.476 5.322   24.328 1.00 37.53  ? 261 HOH A O   1 
HETATM 2399 O O   . HOH C 2 .   ? 13.458  -12.582 39.359 1.00 32.79  ? 262 HOH A O   1 
HETATM 2400 O O   . HOH C 2 .   ? -75.812 2.296   24.313 1.00 49.35  ? 263 HOH A O   1 
HETATM 2401 O O   . HOH D 2 .   ? 62.900  1.297   84.754 1.00 50.67  ? 201 HOH B O   1 
HETATM 2402 O O   . HOH D 2 .   ? -65.673 -0.894  9.409  1.00 42.07  ? 202 HOH B O   1 
HETATM 2403 O O   . HOH D 2 .   ? 9.544   0.068   41.358 1.00 44.83  ? 203 HOH B O   1 
HETATM 2404 O O   . HOH D 2 .   ? -18.332 -10.772 45.239 1.00 55.43  ? 204 HOH B O   1 
HETATM 2405 O O   . HOH D 2 .   ? 42.148  -16.262 63.829 1.00 51.32  ? 205 HOH B O   1 
HETATM 2406 O O   . HOH D 2 .   ? 15.038  -4.886  45.163 1.00 28.44  ? 206 HOH B O   1 
HETATM 2407 O O   . HOH D 2 .   ? 32.351  -7.136  66.898 1.00 40.26  ? 207 HOH B O   1 
HETATM 2408 O O   . HOH D 2 .   ? 35.817  -3.053  56.548 1.00 30.46  ? 208 HOH B O   1 
HETATM 2409 O O   . HOH D 2 .   ? 69.244  -0.946  88.229 1.00 52.87  ? 209 HOH B O   1 
HETATM 2410 O O   . HOH D 2 .   ? -95.625 13.335  4.676  1.00 31.68  ? 210 HOH B O   1 
HETATM 2411 O O   . HOH D 2 .   ? -63.084 -1.675  10.036 1.00 36.87  ? 211 HOH B O   1 
HETATM 2412 O O   . HOH D 2 .   ? -35.999 -9.978  34.700 1.00 43.63  ? 212 HOH B O   1 
HETATM 2413 O O   . HOH D 2 .   ? 64.717  -7.496  89.239 1.00 38.58  ? 213 HOH B O   1 
HETATM 2414 O O   . HOH D 2 .   ? 24.004  -4.046  58.925 1.00 36.73  ? 214 HOH B O   1 
HETATM 2415 O O   . HOH D 2 .   ? -72.588 -0.293  6.513  1.00 50.52  ? 215 HOH B O   1 
HETATM 2416 O O   . HOH D 2 .   ? 49.564  -5.150  64.193 1.00 46.28  ? 216 HOH B O   1 
HETATM 2417 O O   . HOH D 2 .   ? 39.894  -11.210 64.885 1.00 38.49  ? 217 HOH B O   1 
HETATM 2418 O O   . HOH D 2 .   ? 26.405  -9.939  56.533 1.00 29.38  ? 218 HOH B O   1 
HETATM 2419 O O   . HOH D 2 .   ? -30.816 -6.797  37.382 1.00 44.83  ? 219 HOH B O   1 
HETATM 2420 O O   . HOH D 2 .   ? 26.056  -0.381  60.933 1.00 48.35  ? 220 HOH B O   1 
HETATM 2421 O O   . HOH D 2 .   ? -46.673 -11.847 22.246 1.00 36.95  ? 221 HOH B O   1 
HETATM 2422 O O   . HOH D 2 .   ? 32.204  -9.612  52.308 1.00 34.25  ? 222 HOH B O   1 
HETATM 2423 O O   . HOH D 2 .   ? 5.863   -2.837  41.515 1.00 31.33  ? 223 HOH B O   1 
HETATM 2424 O O   . HOH D 2 .   ? -38.604 -9.277  21.195 1.00 43.03  ? 224 HOH B O   1 
HETATM 2425 O O   . HOH D 2 .   ? 68.070  -0.712  82.936 1.00 59.16  ? 225 HOH B O   1 
HETATM 2426 O O   . HOH D 2 .   ? 21.657  -2.708  58.264 1.00 32.30  ? 226 HOH B O   1 
HETATM 2427 O O   . HOH D 2 .   ? 63.129  -13.203 72.856 1.00 36.02  ? 227 HOH B O   1 
HETATM 2428 O O   . HOH D 2 .   ? -72.540 -2.673  14.180 1.00 48.64  ? 228 HOH B O   1 
HETATM 2429 O O   . HOH D 2 .   ? 44.887  -7.000  60.488 1.00 35.59  ? 229 HOH B O   1 
HETATM 2430 O O   . HOH D 2 .   ? 70.296  -7.081  72.000 1.00 35.07  ? 230 HOH B O   1 
HETATM 2431 O O   . HOH D 2 .   ? 53.704  -3.900  69.262 1.00 23.67  ? 231 HOH B O   1 
HETATM 2432 O O   . HOH D 2 .   ? 47.825  -10.435 63.864 1.00 35.79  ? 232 HOH B O   1 
HETATM 2433 O O   . HOH D 2 .   ? 8.741   4.891   45.017 1.00 42.81  ? 233 HOH B O   1 
HETATM 2434 O O   . HOH D 2 .   ? 48.008  -1.864  73.689 1.00 39.97  ? 234 HOH B O   1 
HETATM 2435 O O   . HOH D 2 .   ? -64.495 -2.585  19.869 1.00 44.02  ? 235 HOH B O   1 
HETATM 2436 O O   . HOH D 2 .   ? -67.269 -5.888  21.985 1.00 35.95  ? 236 HOH B O   1 
HETATM 2437 O O   . HOH D 2 .   ? 18.590  -11.952 59.239 1.00 34.38  ? 237 HOH B O   1 
HETATM 2438 O O   . HOH D 2 .   ? 9.345   -1.125  52.242 1.00 29.95  ? 238 HOH B O   1 
HETATM 2439 O O   . HOH D 2 .   ? -48.398 -5.151  15.863 1.00 40.97  ? 239 HOH B O   1 
HETATM 2440 O O   . HOH D 2 .   ? -36.251 -13.196 31.536 1.00 49.27  ? 240 HOH B O   1 
HETATM 2441 O O   . HOH D 2 .   ? 14.118  1.513   54.127 1.00 50.74  ? 241 HOH B O   1 
HETATM 2442 O O   . HOH D 2 .   ? 27.203  -1.933  45.569 1.00 40.50  ? 242 HOH B O   1 
HETATM 2443 O O   . HOH D 2 .   ? -38.974 -13.070 33.966 1.00 40.41  ? 243 HOH B O   1 
HETATM 2444 O O   . HOH D 2 .   ? -76.215 10.207  9.155  1.00 44.12  ? 244 HOH B O   1 
HETATM 2445 O O   . HOH D 2 .   ? -54.456 -6.380  13.493 1.00 43.79  ? 245 HOH B O   1 
HETATM 2446 O O   . HOH D 2 .   ? 67.511  0.239   80.197 1.00 61.38  ? 246 HOH B O   1 
HETATM 2447 O O   . HOH D 2 .   ? -4.063  -10.448 47.443 1.00 39.17  ? 247 HOH B O   1 
HETATM 2448 O O   . HOH D 2 .   ? -75.368 -0.133  2.806  1.00 38.89  ? 248 HOH B O   1 
HETATM 2449 O O   . HOH D 2 .   ? -30.046 -10.414 26.827 1.00 52.84  ? 249 HOH B O   1 
HETATM 2450 O O   . HOH D 2 .   ? -46.139 -3.447  15.281 1.00 44.56  ? 250 HOH B O   1 
HETATM 2451 O O   . HOH D 2 .   ? -28.648 -8.886  25.079 1.00 32.78  ? 251 HOH B O   1 
HETATM 2452 O O   . HOH D 2 .   ? 49.446  -1.058  66.583 1.00 43.94  ? 252 HOH B O   1 
HETATM 2453 O O   . HOH D 2 .   ? -61.491 0.099   9.130  1.00 38.28  ? 253 HOH B O   1 
HETATM 2454 O O   . HOH D 2 .   ? -0.650  -2.424  52.126 1.00 34.10  ? 254 HOH B O   1 
HETATM 2455 O O   . HOH D 2 .   ? -52.128 -5.471  11.858 1.00 38.91  ? 255 HOH B O   1 
HETATM 2456 O O   . HOH D 2 .   ? 72.228  -3.367  89.249 1.00 50.89  ? 256 HOH B O   1 
HETATM 2457 O O   . HOH D 2 .   ? 47.163  0.990   67.946 1.00 43.23  ? 257 HOH B O   1 
HETATM 2458 O O   . HOH D 2 .   ? -16.012 2.971   35.791 1.00 42.34  ? 258 HOH B O   1 
HETATM 2459 O O   . HOH D 2 .   ? -61.206 -0.596  6.139  1.00 37.32  ? 259 HOH B O   1 
HETATM 2460 O O   . HOH D 2 .   ? 73.827  -5.014  88.979 1.00 45.94  ? 260 HOH B O   1 
HETATM 2461 O O   . HOH D 2 .   ? -77.397 -6.297  4.073  1.00 47.25  ? 261 HOH B O   1 
HETATM 2462 O O   . HOH D 2 .   ? 34.288  -11.422 54.562 1.00 39.34  ? 262 HOH B O   1 
HETATM 2463 O O   . HOH D 2 .   ? -74.177 1.261   0.000  0.50 45.84  ? 263 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   2   2   ALA ALA A . n 
A 1 2   ALA 2   3   3   ALA ALA A . n 
A 1 3   VAL 3   4   4   VAL VAL A . n 
A 1 4   LEU 4   5   5   LEU LEU A . n 
A 1 5   GLN 5   6   6   GLN GLN A . n 
A 1 6   GLN 6   7   7   GLN GLN A . n 
A 1 7   VAL 7   8   8   VAL VAL A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   GLU 9   10  10  GLU GLU A . n 
A 1 10  ARG 10  11  11  ARG ARG A . n 
A 1 11  THR 11  12  12  THR THR A . n 
A 1 12  GLU 12  13  13  GLU GLU A . n 
A 1 13  LEU 13  14  14  LEU LEU A . n 
A 1 14  ASN 14  15  15  ASN ASN A . n 
A 1 15  LYS 15  16  16  LYS LYS A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  PRO 17  18  18  PRO PRO A . n 
A 1 18  LYS 18  19  19  LYS LYS A . n 
A 1 19  SER 19  20  20  SER SER A . n 
A 1 20  VAL 20  21  21  VAL VAL A . n 
A 1 21  GLN 21  22  22  GLN GLN A . n 
A 1 22  ASN 22  23  23  ASN ASN A . n 
A 1 23  LYS 23  24  24  LYS LYS A . n 
A 1 24  LEU 24  25  25  LEU LEU A . n 
A 1 25  GLU 25  26  26  GLU GLU A . n 
A 1 26  LYS 26  27  27  LYS LYS A . n 
A 1 27  PHE 27  28  28  PHE PHE A . n 
A 1 28  LEU 28  29  29  LEU LEU A . n 
A 1 29  ALA 29  30  30  ALA ALA A . n 
A 1 30  ASP 30  31  31  ASP ASP A . n 
A 1 31  GLN 31  32  32  GLN GLN A . n 
A 1 32  GLN 32  33  33  GLN GLN A . n 
A 1 33  SER 33  34  34  SER SER A . n 
A 1 34  GLU 34  35  35  GLU GLU A . n 
A 1 35  ILE 35  36  36  ILE ILE A . n 
A 1 36  ASP 36  37  37  ASP ASP A . n 
A 1 37  GLY 37  38  38  GLY GLY A . n 
A 1 38  LEU 38  39  39  LEU LEU A . n 
A 1 39  LYS 39  40  40  LYS LYS A . n 
A 1 40  GLY 40  41  41  GLY GLY A . n 
A 1 41  ARG 41  42  42  ARG ARG A . n 
A 1 42  HIS 42  43  43  HIS HIS A . n 
A 1 43  GLU 43  44  44  GLU GLU A . n 
A 1 44  LYS 44  45  45  LYS LYS A . n 
A 1 45  PHE 45  46  46  PHE PHE A . n 
A 1 46  LYS 46  47  47  LYS LYS A . n 
A 1 47  VAL 47  48  48  VAL VAL A . n 
A 1 48  GLU 48  49  49  GLU GLU A . n 
A 1 49  SER 49  50  50  SER SER A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  GLN 51  52  52  GLN GLN A . n 
A 1 52  GLN 52  53  53  GLN GLN A . n 
A 1 53  TYR 53  54  54  TYR TYR A . n 
A 1 54  MET 54  55  55  MET MSE A . n 
A 1 55  GLU 55  56  56  GLU GLU A . n 
A 1 56  ILE 56  57  57  ILE ILE A . n 
A 1 57  GLU 57  58  58  GLU GLU A . n 
A 1 58  LYS 58  59  59  LYS LYS A . n 
A 1 59  ARG 59  60  60  ARG ARG A . n 
A 1 60  LEU 60  61  61  LEU LEU A . n 
A 1 61  SER 61  62  62  SER SER A . n 
A 1 62  HIS 62  63  63  HIS HIS A . n 
A 1 63  SER 63  64  64  SER SER A . n 
A 1 64  GLN 64  65  65  GLN GLN A . n 
A 1 65  GLU 65  66  66  GLU GLU A . n 
A 1 66  ARG 66  67  67  ARG ARG A . n 
A 1 67  LEU 67  68  68  LEU LEU A . n 
A 1 68  VAL 68  69  69  VAL VAL A . n 
A 1 69  ASN 69  70  70  ASN ASN A . n 
A 1 70  GLU 70  71  71  GLU GLU A . n 
A 1 71  THR 71  72  72  THR THR A . n 
A 1 72  ARG 72  73  73  ARG ARG A . n 
A 1 73  GLU 73  74  74  GLU GLU A . n 
A 1 74  CYS 74  75  75  CYS CYS A . n 
A 1 75  GLN 75  76  76  GLN GLN A . n 
A 1 76  SER 76  77  77  SER SER A . n 
A 1 77  LEU 77  78  78  LEU LEU A . n 
A 1 78  ARG 78  79  79  ARG ARG A . n 
A 1 79  LEU 79  80  80  LEU LEU A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  LEU 81  82  82  LEU LEU A . n 
A 1 82  GLU 82  83  83  GLU GLU A . n 
A 1 83  LYS 83  84  84  LYS LYS A . n 
A 1 84  LEU 84  85  85  LEU LEU A . n 
A 1 85  ASN 85  86  86  ASN ASN A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  GLN 87  88  88  GLN GLN A . n 
A 1 88  LEU 88  89  89  LEU LEU A . n 
A 1 89  LYS 89  90  90  LYS LYS A . n 
A 1 90  ALA 90  91  91  ALA ALA A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  THR 92  93  93  THR THR A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  LYS 94  95  95  LYS LYS A . n 
A 1 95  ASN 95  96  96  ASN ASN A . n 
A 1 96  LYS 96  97  97  LYS LYS A . n 
A 1 97  GLU 97  98  98  GLU GLU A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  GLU 99  100 100 GLU GLU A . n 
A 1 100 ILE 100 101 101 ILE ILE A . n 
A 1 101 ALA 101 102 102 ALA ALA A . n 
A 1 102 GLN 102 103 103 GLN GLN A . n 
A 1 103 ASP 103 104 104 ASP ASP A . n 
A 1 104 ARG 104 105 105 ARG ARG A . n 
A 1 105 ASN 105 106 106 ASN ASN A . n 
A 1 106 ILE 106 107 107 ILE ILE A . n 
A 1 107 ALA 107 108 108 ALA ALA A . n 
A 1 108 ILE 108 109 109 ILE ILE A . n 
A 1 109 GLN 109 110 110 GLN GLN A . n 
A 1 110 SER 110 111 111 SER SER A . n 
A 1 111 GLN 111 112 112 GLN GLN A . n 
A 1 112 MET 112 113 113 MET MSE A . n 
A 1 113 THR 113 114 114 THR THR A . n 
A 1 114 ARG 114 115 115 ARG ARG A . n 
A 1 115 THR 115 116 116 THR THR A . n 
A 1 116 LYS 116 117 117 LYS LYS A . n 
A 1 117 GLU 117 118 118 GLU GLU A . n 
A 1 118 GLU 118 119 119 GLU GLU A . n 
A 1 119 LEU 119 120 120 LEU LEU A . n 
A 1 120 GLU 120 121 121 GLU GLU A . n 
A 1 121 ALA 121 122 122 ALA ALA A . n 
A 1 122 GLU 122 123 123 GLU GLU A . n 
A 1 123 LYS 123 124 124 LYS LYS A . n 
A 1 124 ARG 124 125 125 ARG ARG A . n 
A 1 125 ASP 125 126 126 ASP ASP A . n 
A 1 126 LEU 126 127 127 LEU LEU A . n 
A 1 127 ILE 127 128 128 ILE ILE A . n 
A 1 128 ARG 128 129 129 ARG ARG A . n 
A 1 129 THR 129 130 130 THR THR A . n 
A 1 130 ASN 130 131 131 ASN ASN A . n 
A 1 131 GLU 131 132 132 GLU GLU A . n 
A 1 132 ARG 132 133 133 ARG ARG A . n 
A 1 133 LEU 133 134 134 LEU LEU A . n 
A 1 134 SER 134 135 135 SER SER A . n 
A 1 135 GLN 135 136 136 GLN GLN A . n 
A 1 136 GLU 136 137 137 GLU GLU A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 GLU 138 139 139 GLU GLU A . n 
A 1 139 TYR 139 140 140 TYR TYR A . n 
A 1 140 LEU 140 141 141 LEU LEU A . n 
A 1 141 THR 141 142 142 THR THR A . n 
B 1 1   ALA 1   2   ?   ?   ?   B . n 
B 1 2   ALA 2   3   3   ALA ALA B . n 
B 1 3   VAL 3   4   4   VAL VAL B . n 
B 1 4   LEU 4   5   5   LEU LEU B . n 
B 1 5   GLN 5   6   6   GLN GLN B . n 
B 1 6   GLN 6   7   7   GLN GLN B . n 
B 1 7   VAL 7   8   8   VAL VAL B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   GLU 9   10  10  GLU GLU B . n 
B 1 10  ARG 10  11  11  ARG ARG B . n 
B 1 11  THR 11  12  12  THR THR B . n 
B 1 12  GLU 12  13  13  GLU GLU B . n 
B 1 13  LEU 13  14  14  LEU LEU B . n 
B 1 14  ASN 14  15  15  ASN ASN B . n 
B 1 15  LYS 15  16  16  LYS LYS B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  PRO 17  18  18  PRO PRO B . n 
B 1 18  LYS 18  19  19  LYS LYS B . n 
B 1 19  SER 19  20  20  SER SER B . n 
B 1 20  VAL 20  21  21  VAL VAL B . n 
B 1 21  GLN 21  22  22  GLN GLN B . n 
B 1 22  ASN 22  23  23  ASN ASN B . n 
B 1 23  LYS 23  24  24  LYS LYS B . n 
B 1 24  LEU 24  25  25  LEU LEU B . n 
B 1 25  GLU 25  26  26  GLU GLU B . n 
B 1 26  LYS 26  27  27  LYS LYS B . n 
B 1 27  PHE 27  28  28  PHE PHE B . n 
B 1 28  LEU 28  29  29  LEU LEU B . n 
B 1 29  ALA 29  30  30  ALA ALA B . n 
B 1 30  ASP 30  31  31  ASP ASP B . n 
B 1 31  GLN 31  32  32  GLN GLN B . n 
B 1 32  GLN 32  33  33  GLN GLN B . n 
B 1 33  SER 33  34  34  SER SER B . n 
B 1 34  GLU 34  35  35  GLU GLU B . n 
B 1 35  ILE 35  36  36  ILE ILE B . n 
B 1 36  ASP 36  37  37  ASP ASP B . n 
B 1 37  GLY 37  38  38  GLY GLY B . n 
B 1 38  LEU 38  39  39  LEU LEU B . n 
B 1 39  LYS 39  40  40  LYS LYS B . n 
B 1 40  GLY 40  41  41  GLY GLY B . n 
B 1 41  ARG 41  42  42  ARG ARG B . n 
B 1 42  HIS 42  43  43  HIS HIS B . n 
B 1 43  GLU 43  44  44  GLU GLU B . n 
B 1 44  LYS 44  45  45  LYS LYS B . n 
B 1 45  PHE 45  46  46  PHE PHE B . n 
B 1 46  LYS 46  47  47  LYS LYS B . n 
B 1 47  VAL 47  48  48  VAL VAL B . n 
B 1 48  GLU 48  49  49  GLU GLU B . n 
B 1 49  SER 49  50  50  SER SER B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  GLN 51  52  52  GLN GLN B . n 
B 1 52  GLN 52  53  53  GLN GLN B . n 
B 1 53  TYR 53  54  54  TYR TYR B . n 
B 1 54  MET 54  55  55  MET MSE B . n 
B 1 55  GLU 55  56  56  GLU GLU B . n 
B 1 56  ILE 56  57  57  ILE ILE B . n 
B 1 57  GLU 57  58  58  GLU GLU B . n 
B 1 58  LYS 58  59  59  LYS LYS B . n 
B 1 59  ARG 59  60  60  ARG ARG B . n 
B 1 60  LEU 60  61  61  LEU LEU B . n 
B 1 61  SER 61  62  62  SER SER B . n 
B 1 62  HIS 62  63  63  HIS HIS B . n 
B 1 63  SER 63  64  64  SER SER B . n 
B 1 64  GLN 64  65  65  GLN GLN B . n 
B 1 65  GLU 65  66  66  GLU GLU B . n 
B 1 66  ARG 66  67  67  ARG ARG B . n 
B 1 67  LEU 67  68  68  LEU LEU B . n 
B 1 68  VAL 68  69  69  VAL VAL B . n 
B 1 69  ASN 69  70  70  ASN ASN B . n 
B 1 70  GLU 70  71  71  GLU GLU B . n 
B 1 71  THR 71  72  72  THR THR B . n 
B 1 72  ARG 72  73  73  ARG ARG B . n 
B 1 73  GLU 73  74  74  GLU GLU B . n 
B 1 74  CYS 74  75  75  CYS CYS B . n 
B 1 75  GLN 75  76  76  GLN GLN B . n 
B 1 76  SER 76  77  77  SER SER B . n 
B 1 77  LEU 77  78  78  LEU LEU B . n 
B 1 78  ARG 78  79  79  ARG ARG B . n 
B 1 79  LEU 79  80  80  LEU LEU B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  LEU 81  82  82  LEU LEU B . n 
B 1 82  GLU 82  83  83  GLU GLU B . n 
B 1 83  LYS 83  84  84  LYS LYS B . n 
B 1 84  LEU 84  85  85  LEU LEU B . n 
B 1 85  ASN 85  86  86  ASN ASN B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  GLN 87  88  88  GLN GLN B . n 
B 1 88  LEU 88  89  89  LEU LEU B . n 
B 1 89  LYS 89  90  90  LYS LYS B . n 
B 1 90  ALA 90  91  91  ALA ALA B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  THR 92  93  93  THR THR B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  LYS 94  95  95  LYS LYS B . n 
B 1 95  ASN 95  96  96  ASN ASN B . n 
B 1 96  LYS 96  97  97  LYS LYS B . n 
B 1 97  GLU 97  98  98  GLU GLU B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  GLU 99  100 100 GLU GLU B . n 
B 1 100 ILE 100 101 101 ILE ILE B . n 
B 1 101 ALA 101 102 102 ALA ALA B . n 
B 1 102 GLN 102 103 103 GLN GLN B . n 
B 1 103 ASP 103 104 104 ASP ASP B . n 
B 1 104 ARG 104 105 105 ARG ARG B . n 
B 1 105 ASN 105 106 106 ASN ASN B . n 
B 1 106 ILE 106 107 107 ILE ILE B . n 
B 1 107 ALA 107 108 108 ALA ALA B . n 
B 1 108 ILE 108 109 109 ILE ILE B . n 
B 1 109 GLN 109 110 110 GLN GLN B . n 
B 1 110 SER 110 111 111 SER SER B . n 
B 1 111 GLN 111 112 112 GLN GLN B . n 
B 1 112 MET 112 113 113 MET MSE B . n 
B 1 113 THR 113 114 114 THR THR B . n 
B 1 114 ARG 114 115 115 ARG ARG B . n 
B 1 115 THR 115 116 116 THR THR B . n 
B 1 116 LYS 116 117 117 LYS LYS B . n 
B 1 117 GLU 117 118 118 GLU GLU B . n 
B 1 118 GLU 118 119 119 GLU GLU B . n 
B 1 119 LEU 119 120 120 LEU LEU B . n 
B 1 120 GLU 120 121 121 GLU GLU B . n 
B 1 121 ALA 121 122 122 ALA ALA B . n 
B 1 122 GLU 122 123 123 GLU GLU B . n 
B 1 123 LYS 123 124 124 LYS LYS B . n 
B 1 124 ARG 124 125 125 ARG ARG B . n 
B 1 125 ASP 125 126 126 ASP ASP B . n 
B 1 126 LEU 126 127 127 LEU LEU B . n 
B 1 127 ILE 127 128 128 ILE ILE B . n 
B 1 128 ARG 128 129 129 ARG ARG B . n 
B 1 129 THR 129 130 130 THR THR B . n 
B 1 130 ASN 130 131 131 ASN ASN B . n 
B 1 131 GLU 131 132 132 GLU GLU B . n 
B 1 132 ARG 132 133 133 ARG ARG B . n 
B 1 133 LEU 133 134 134 LEU LEU B . n 
B 1 134 SER 134 135 135 SER SER B . n 
B 1 135 GLN 135 136 136 GLN GLN B . n 
B 1 136 GLU 136 137 137 GLU GLU B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 GLU 138 139 139 GLU GLU B . n 
B 1 139 TYR 139 140 140 TYR TYR B . n 
B 1 140 LEU 140 141 141 LEU LEU B . n 
B 1 141 THR 141 142 142 THR THR B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 HOH 1  201 24  HOH HOH A . 
C 2 HOH 2  202 106 HOH HOH A . 
C 2 HOH 3  203 104 HOH HOH A . 
C 2 HOH 4  204 121 HOH HOH A . 
C 2 HOH 5  205 32  HOH HOH A . 
C 2 HOH 6  206 111 HOH HOH A . 
C 2 HOH 7  207 3   HOH HOH A . 
C 2 HOH 8  208 25  HOH HOH A . 
C 2 HOH 9  209 11  HOH HOH A . 
C 2 HOH 10 210 115 HOH HOH A . 
C 2 HOH 11 211 20  HOH HOH A . 
C 2 HOH 12 212 19  HOH HOH A . 
C 2 HOH 13 213 123 HOH HOH A . 
C 2 HOH 14 214 39  HOH HOH A . 
C 2 HOH 15 215 30  HOH HOH A . 
C 2 HOH 16 216 113 HOH HOH A . 
C 2 HOH 17 217 2   HOH HOH A . 
C 2 HOH 18 218 85  HOH HOH A . 
C 2 HOH 19 219 108 HOH HOH A . 
C 2 HOH 20 220 82  HOH HOH A . 
C 2 HOH 21 221 36  HOH HOH A . 
C 2 HOH 22 222 91  HOH HOH A . 
C 2 HOH 23 223 76  HOH HOH A . 
C 2 HOH 24 224 72  HOH HOH A . 
C 2 HOH 25 225 114 HOH HOH A . 
C 2 HOH 26 226 61  HOH HOH A . 
C 2 HOH 27 227 18  HOH HOH A . 
C 2 HOH 28 228 122 HOH HOH A . 
C 2 HOH 29 229 4   HOH HOH A . 
C 2 HOH 30 230 40  HOH HOH A . 
C 2 HOH 31 231 8   HOH HOH A . 
C 2 HOH 32 232 107 HOH HOH A . 
C 2 HOH 33 233 105 HOH HOH A . 
C 2 HOH 34 234 27  HOH HOH A . 
C 2 HOH 35 235 65  HOH HOH A . 
C 2 HOH 36 236 22  HOH HOH A . 
C 2 HOH 37 237 69  HOH HOH A . 
C 2 HOH 38 238 12  HOH HOH A . 
C 2 HOH 39 239 125 HOH HOH A . 
C 2 HOH 40 240 64  HOH HOH A . 
C 2 HOH 41 241 96  HOH HOH A . 
C 2 HOH 42 242 1   HOH HOH A . 
C 2 HOH 43 243 37  HOH HOH A . 
C 2 HOH 44 244 110 HOH HOH A . 
C 2 HOH 45 245 124 HOH HOH A . 
C 2 HOH 46 246 44  HOH HOH A . 
C 2 HOH 47 247 88  HOH HOH A . 
C 2 HOH 48 248 120 HOH HOH A . 
C 2 HOH 49 249 99  HOH HOH A . 
C 2 HOH 50 250 70  HOH HOH A . 
C 2 HOH 51 251 77  HOH HOH A . 
C 2 HOH 52 252 13  HOH HOH A . 
C 2 HOH 53 253 81  HOH HOH A . 
C 2 HOH 54 254 117 HOH HOH A . 
C 2 HOH 55 255 97  HOH HOH A . 
C 2 HOH 56 256 80  HOH HOH A . 
C 2 HOH 57 257 67  HOH HOH A . 
C 2 HOH 58 258 102 HOH HOH A . 
C 2 HOH 59 259 112 HOH HOH A . 
C 2 HOH 60 260 52  HOH HOH A . 
C 2 HOH 61 261 7   HOH HOH A . 
C 2 HOH 62 262 51  HOH HOH A . 
C 2 HOH 63 263 54  HOH HOH A . 
D 2 HOH 1  201 103 HOH HOH B . 
D 2 HOH 2  202 100 HOH HOH B . 
D 2 HOH 3  203 14  HOH HOH B . 
D 2 HOH 4  204 17  HOH HOH B . 
D 2 HOH 5  205 90  HOH HOH B . 
D 2 HOH 6  206 10  HOH HOH B . 
D 2 HOH 7  207 56  HOH HOH B . 
D 2 HOH 8  208 50  HOH HOH B . 
D 2 HOH 9  209 116 HOH HOH B . 
D 2 HOH 10 210 49  HOH HOH B . 
D 2 HOH 11 211 53  HOH HOH B . 
D 2 HOH 12 212 79  HOH HOH B . 
D 2 HOH 13 213 15  HOH HOH B . 
D 2 HOH 14 214 92  HOH HOH B . 
D 2 HOH 15 215 16  HOH HOH B . 
D 2 HOH 16 216 101 HOH HOH B . 
D 2 HOH 17 217 5   HOH HOH B . 
D 2 HOH 18 218 66  HOH HOH B . 
D 2 HOH 19 219 94  HOH HOH B . 
D 2 HOH 20 220 126 HOH HOH B . 
D 2 HOH 21 221 63  HOH HOH B . 
D 2 HOH 22 222 23  HOH HOH B . 
D 2 HOH 23 223 6   HOH HOH B . 
D 2 HOH 24 224 109 HOH HOH B . 
D 2 HOH 25 225 57  HOH HOH B . 
D 2 HOH 26 226 31  HOH HOH B . 
D 2 HOH 27 227 84  HOH HOH B . 
D 2 HOH 28 228 73  HOH HOH B . 
D 2 HOH 29 229 86  HOH HOH B . 
D 2 HOH 30 230 68  HOH HOH B . 
D 2 HOH 31 231 29  HOH HOH B . 
D 2 HOH 32 232 59  HOH HOH B . 
D 2 HOH 33 233 45  HOH HOH B . 
D 2 HOH 34 234 42  HOH HOH B . 
D 2 HOH 35 235 38  HOH HOH B . 
D 2 HOH 36 236 74  HOH HOH B . 
D 2 HOH 37 237 93  HOH HOH B . 
D 2 HOH 38 238 9   HOH HOH B . 
D 2 HOH 39 239 118 HOH HOH B . 
D 2 HOH 40 240 41  HOH HOH B . 
D 2 HOH 41 241 60  HOH HOH B . 
D 2 HOH 42 242 28  HOH HOH B . 
D 2 HOH 43 243 33  HOH HOH B . 
D 2 HOH 44 244 34  HOH HOH B . 
D 2 HOH 45 245 89  HOH HOH B . 
D 2 HOH 46 246 87  HOH HOH B . 
D 2 HOH 47 247 95  HOH HOH B . 
D 2 HOH 48 248 21  HOH HOH B . 
D 2 HOH 49 249 55  HOH HOH B . 
D 2 HOH 50 250 98  HOH HOH B . 
D 2 HOH 51 251 26  HOH HOH B . 
D 2 HOH 52 252 47  HOH HOH B . 
D 2 HOH 53 253 35  HOH HOH B . 
D 2 HOH 54 254 71  HOH HOH B . 
D 2 HOH 55 255 83  HOH HOH B . 
D 2 HOH 56 256 48  HOH HOH B . 
D 2 HOH 57 257 62  HOH HOH B . 
D 2 HOH 58 258 119 HOH HOH B . 
D 2 HOH 59 259 78  HOH HOH B . 
D 2 HOH 60 260 43  HOH HOH B . 
D 2 HOH 61 261 46  HOH HOH B . 
D 2 HOH 62 262 58  HOH HOH B . 
D 2 HOH 63 263 75  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7110  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  20160 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     263 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-10-18 
2 'Structure model' 1 1 2019-05-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'     
2 2 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.journal_volume'          
7  2 'Structure model' '_citation.page_first'              
8  2 'Structure model' '_citation.page_last'               
9  2 'Structure model' '_citation.pdbx_database_id_DOI'    
10 2 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 2 'Structure model' '_citation.title'                   
12 2 'Structure model' '_citation.year'                    
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.9_1692 1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20     2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_1             B 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              80 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_2             B 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              80 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CD1 
_pdbx_validate_rmsd_angle.auth_asym_id_3             B 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              80 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                93.31 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -17.69 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? A HOH 263 ? 6.12 . 
2 1 O ? B HOH 263 ? 6.07 . 
# 
_pdbx_unobs_or_zero_occ_residues.id               1 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num    1 
_pdbx_unobs_or_zero_occ_residues.polymer_flag     Y 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag   1 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id     B 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id     ALA 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id      2 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code     ? 
_pdbx_unobs_or_zero_occ_residues.label_asym_id    B 
_pdbx_unobs_or_zero_occ_residues.label_comp_id    ALA 
_pdbx_unobs_or_zero_occ_residues.label_seq_id     1 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
#