data_5TWV
# 
_entry.id   5TWV 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5TWV         
WWPDB D_1000224900 
EMDB  EMD-8470     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        
'Cryo-EM structure of the pancreatic ATP-sensitive K+ channel SUR1/Kir6.2 in the presence of ATP and glibenclamide' 
_pdbx_database_related.db_id          EMD-8470 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5TWV 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Martin, G.M.' 1 
'Yoshioka, C.' 2 
'Chen, J.Z.'   3 
'Shyng, S.L.'  4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            6 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Cryo-EM structure of the ATP-sensitive potassium channel illuminates mechanisms of assembly and gating.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.24149 
_citation.pdbx_database_id_PubMed   28092267 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Martin, G.M.'  1 ? 
primary 'Yoshioka, C.'  2 ? 
primary 'Rex, E.A.'     3 ? 
primary 'Fay, J.F.'     4 ? 
primary 'Xie, Q.'       5 ? 
primary 'Whorton, M.R.' 6 ? 
primary 'Chen, J.Z.'    7 ? 
primary 'Shyng, S.L.'   8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5TWV 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5TWV 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-sensitive inward rectifier potassium channel 11' 43645.719  4 ? ? ? ? 
2 polymer     man 'ATP-binding cassette sub-family C member 8'          178330.516 4 ? ? ? ? 
3 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE"                           507.181    4 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'BIR, Inward rectifier K(+) channel Kir6.2, Potassium channel, inwardly rectifying subfamily J member 11' 
2 'Sulfonylurea receptor 1, SUR1'                                                                           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITPRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
;MLSRKGIIPEEYVLTRLAEDPTEPRYRTRERRARFVSKKGNCNVAHKNIREQGRFLQDVFTTLVDLKWPHTLLIFTMSFL
CSWLLFAMVWWLIAFAHGDLAPGEGTNVPCVTSIHSFSSAFLFSIEVQVTIGFGGRMVTEECPLAILILIVQNIVGLMIN
AIMLGCIFMKTAQAHRRAETLIFSKHAVITPRHGRLCFMLRVGDLRKSMIISATIHMQVVRKTTSPEGEVVPLHQVDIPM
ENGVGGNSIFLVAPLIIYHVIDSNSPLYDLAPSDLHHHQDLEIIVILEGVVETTGITTQARTSYLADEILWGQRFVPIVA
EEDGRYSVDYSKFGNTVKVPTPLCTARQLDEDRSLLDALTLASSRGPLRKRSVAVAKAKPKFSISPDSLS
;
A,C,E,G ? 
2 'polypeptide(L)' no no 
;DYKDDDDKMPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHN
LRWILTFILLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTI
KFVKFYDHAIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWW
MNAFIKTAHKKPIDLRAIAKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLL
GFAGPLCIFGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQ
TKIYNKIMHMSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWTMPVQIIVGVILLYYILGVSALIGAAVIILLAP
VQYFVATKLSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPI
AAVLITFVGHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQ
GQAGKYQAVPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIV
GQVGCGKSSLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFES
PFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAG
ILELLRDDKRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEP
SQGLPRAMSSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDY
WLAKWTDSALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRF
FETTPLGSILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQL
DDTTQLPLVSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVCMEYIGACVVLIAAATSISNSL
HRELSAGLVGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSV
RYDSSLKPVLKHVNTLISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLF
SGTIRFNLDPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASI
DMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
;DYKDDDDKMPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHN
LRWILTFILLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTI
KFVKFYDHAIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWW
MNAFIKTAHKKPIDLRAIAKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLL
GFAGPLCIFGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQ
TKIYNKIMHMSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWTMPVQIIVGVILLYYILGVSALIGAAVIILLAP
VQYFVATKLSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPI
AAVLITFVGHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQ
GQAGKYQAVPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIV
GQVGCGKSSLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFES
PFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAG
ILELLRDDKRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEP
SQGLPRAMSSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDY
WLAKWTDSALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRF
FETTPLGSILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQL
DDTTQLPLVSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVCMEYIGACVVLIAAATSISNSL
HRELSAGLVGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSV
RYDSSLKPVLKHVNTLISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLF
SGTIRFNLDPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASI
DMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
B,D,F,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    SER n 
1 4    ARG n 
1 5    LYS n 
1 6    GLY n 
1 7    ILE n 
1 8    ILE n 
1 9    PRO n 
1 10   GLU n 
1 11   GLU n 
1 12   TYR n 
1 13   VAL n 
1 14   LEU n 
1 15   THR n 
1 16   ARG n 
1 17   LEU n 
1 18   ALA n 
1 19   GLU n 
1 20   ASP n 
1 21   PRO n 
1 22   THR n 
1 23   GLU n 
1 24   PRO n 
1 25   ARG n 
1 26   TYR n 
1 27   ARG n 
1 28   THR n 
1 29   ARG n 
1 30   GLU n 
1 31   ARG n 
1 32   ARG n 
1 33   ALA n 
1 34   ARG n 
1 35   PHE n 
1 36   VAL n 
1 37   SER n 
1 38   LYS n 
1 39   LYS n 
1 40   GLY n 
1 41   ASN n 
1 42   CYS n 
1 43   ASN n 
1 44   VAL n 
1 45   ALA n 
1 46   HIS n 
1 47   LYS n 
1 48   ASN n 
1 49   ILE n 
1 50   ARG n 
1 51   GLU n 
1 52   GLN n 
1 53   GLY n 
1 54   ARG n 
1 55   PHE n 
1 56   LEU n 
1 57   GLN n 
1 58   ASP n 
1 59   VAL n 
1 60   PHE n 
1 61   THR n 
1 62   THR n 
1 63   LEU n 
1 64   VAL n 
1 65   ASP n 
1 66   LEU n 
1 67   LYS n 
1 68   TRP n 
1 69   PRO n 
1 70   HIS n 
1 71   THR n 
1 72   LEU n 
1 73   LEU n 
1 74   ILE n 
1 75   PHE n 
1 76   THR n 
1 77   MET n 
1 78   SER n 
1 79   PHE n 
1 80   LEU n 
1 81   CYS n 
1 82   SER n 
1 83   TRP n 
1 84   LEU n 
1 85   LEU n 
1 86   PHE n 
1 87   ALA n 
1 88   MET n 
1 89   VAL n 
1 90   TRP n 
1 91   TRP n 
1 92   LEU n 
1 93   ILE n 
1 94   ALA n 
1 95   PHE n 
1 96   ALA n 
1 97   HIS n 
1 98   GLY n 
1 99   ASP n 
1 100  LEU n 
1 101  ALA n 
1 102  PRO n 
1 103  GLY n 
1 104  GLU n 
1 105  GLY n 
1 106  THR n 
1 107  ASN n 
1 108  VAL n 
1 109  PRO n 
1 110  CYS n 
1 111  VAL n 
1 112  THR n 
1 113  SER n 
1 114  ILE n 
1 115  HIS n 
1 116  SER n 
1 117  PHE n 
1 118  SER n 
1 119  SER n 
1 120  ALA n 
1 121  PHE n 
1 122  LEU n 
1 123  PHE n 
1 124  SER n 
1 125  ILE n 
1 126  GLU n 
1 127  VAL n 
1 128  GLN n 
1 129  VAL n 
1 130  THR n 
1 131  ILE n 
1 132  GLY n 
1 133  PHE n 
1 134  GLY n 
1 135  GLY n 
1 136  ARG n 
1 137  MET n 
1 138  VAL n 
1 139  THR n 
1 140  GLU n 
1 141  GLU n 
1 142  CYS n 
1 143  PRO n 
1 144  LEU n 
1 145  ALA n 
1 146  ILE n 
1 147  LEU n 
1 148  ILE n 
1 149  LEU n 
1 150  ILE n 
1 151  VAL n 
1 152  GLN n 
1 153  ASN n 
1 154  ILE n 
1 155  VAL n 
1 156  GLY n 
1 157  LEU n 
1 158  MET n 
1 159  ILE n 
1 160  ASN n 
1 161  ALA n 
1 162  ILE n 
1 163  MET n 
1 164  LEU n 
1 165  GLY n 
1 166  CYS n 
1 167  ILE n 
1 168  PHE n 
1 169  MET n 
1 170  LYS n 
1 171  THR n 
1 172  ALA n 
1 173  GLN n 
1 174  ALA n 
1 175  HIS n 
1 176  ARG n 
1 177  ARG n 
1 178  ALA n 
1 179  GLU n 
1 180  THR n 
1 181  LEU n 
1 182  ILE n 
1 183  PHE n 
1 184  SER n 
1 185  LYS n 
1 186  HIS n 
1 187  ALA n 
1 188  VAL n 
1 189  ILE n 
1 190  THR n 
1 191  PRO n 
1 192  ARG n 
1 193  HIS n 
1 194  GLY n 
1 195  ARG n 
1 196  LEU n 
1 197  CYS n 
1 198  PHE n 
1 199  MET n 
1 200  LEU n 
1 201  ARG n 
1 202  VAL n 
1 203  GLY n 
1 204  ASP n 
1 205  LEU n 
1 206  ARG n 
1 207  LYS n 
1 208  SER n 
1 209  MET n 
1 210  ILE n 
1 211  ILE n 
1 212  SER n 
1 213  ALA n 
1 214  THR n 
1 215  ILE n 
1 216  HIS n 
1 217  MET n 
1 218  GLN n 
1 219  VAL n 
1 220  VAL n 
1 221  ARG n 
1 222  LYS n 
1 223  THR n 
1 224  THR n 
1 225  SER n 
1 226  PRO n 
1 227  GLU n 
1 228  GLY n 
1 229  GLU n 
1 230  VAL n 
1 231  VAL n 
1 232  PRO n 
1 233  LEU n 
1 234  HIS n 
1 235  GLN n 
1 236  VAL n 
1 237  ASP n 
1 238  ILE n 
1 239  PRO n 
1 240  MET n 
1 241  GLU n 
1 242  ASN n 
1 243  GLY n 
1 244  VAL n 
1 245  GLY n 
1 246  GLY n 
1 247  ASN n 
1 248  SER n 
1 249  ILE n 
1 250  PHE n 
1 251  LEU n 
1 252  VAL n 
1 253  ALA n 
1 254  PRO n 
1 255  LEU n 
1 256  ILE n 
1 257  ILE n 
1 258  TYR n 
1 259  HIS n 
1 260  VAL n 
1 261  ILE n 
1 262  ASP n 
1 263  SER n 
1 264  ASN n 
1 265  SER n 
1 266  PRO n 
1 267  LEU n 
1 268  TYR n 
1 269  ASP n 
1 270  LEU n 
1 271  ALA n 
1 272  PRO n 
1 273  SER n 
1 274  ASP n 
1 275  LEU n 
1 276  HIS n 
1 277  HIS n 
1 278  HIS n 
1 279  GLN n 
1 280  ASP n 
1 281  LEU n 
1 282  GLU n 
1 283  ILE n 
1 284  ILE n 
1 285  VAL n 
1 286  ILE n 
1 287  LEU n 
1 288  GLU n 
1 289  GLY n 
1 290  VAL n 
1 291  VAL n 
1 292  GLU n 
1 293  THR n 
1 294  THR n 
1 295  GLY n 
1 296  ILE n 
1 297  THR n 
1 298  THR n 
1 299  GLN n 
1 300  ALA n 
1 301  ARG n 
1 302  THR n 
1 303  SER n 
1 304  TYR n 
1 305  LEU n 
1 306  ALA n 
1 307  ASP n 
1 308  GLU n 
1 309  ILE n 
1 310  LEU n 
1 311  TRP n 
1 312  GLY n 
1 313  GLN n 
1 314  ARG n 
1 315  PHE n 
1 316  VAL n 
1 317  PRO n 
1 318  ILE n 
1 319  VAL n 
1 320  ALA n 
1 321  GLU n 
1 322  GLU n 
1 323  ASP n 
1 324  GLY n 
1 325  ARG n 
1 326  TYR n 
1 327  SER n 
1 328  VAL n 
1 329  ASP n 
1 330  TYR n 
1 331  SER n 
1 332  LYS n 
1 333  PHE n 
1 334  GLY n 
1 335  ASN n 
1 336  THR n 
1 337  VAL n 
1 338  LYS n 
1 339  VAL n 
1 340  PRO n 
1 341  THR n 
1 342  PRO n 
1 343  LEU n 
1 344  CYS n 
1 345  THR n 
1 346  ALA n 
1 347  ARG n 
1 348  GLN n 
1 349  LEU n 
1 350  ASP n 
1 351  GLU n 
1 352  ASP n 
1 353  ARG n 
1 354  SER n 
1 355  LEU n 
1 356  LEU n 
1 357  ASP n 
1 358  ALA n 
1 359  LEU n 
1 360  THR n 
1 361  LEU n 
1 362  ALA n 
1 363  SER n 
1 364  SER n 
1 365  ARG n 
1 366  GLY n 
1 367  PRO n 
1 368  LEU n 
1 369  ARG n 
1 370  LYS n 
1 371  ARG n 
1 372  SER n 
1 373  VAL n 
1 374  ALA n 
1 375  VAL n 
1 376  ALA n 
1 377  LYS n 
1 378  ALA n 
1 379  LYS n 
1 380  PRO n 
1 381  LYS n 
1 382  PHE n 
1 383  SER n 
1 384  ILE n 
1 385  SER n 
1 386  PRO n 
1 387  ASP n 
1 388  SER n 
1 389  LEU n 
1 390  SER n 
2 1    ASP n 
2 2    TYR n 
2 3    LYS n 
2 4    ASP n 
2 5    ASP n 
2 6    ASP n 
2 7    ASP n 
2 8    LYS n 
2 9    MET n 
2 10   PRO n 
2 11   LEU n 
2 12   ALA n 
2 13   PHE n 
2 14   CYS n 
2 15   GLY n 
2 16   THR n 
2 17   GLU n 
2 18   ASN n 
2 19   HIS n 
2 20   SER n 
2 21   ALA n 
2 22   ALA n 
2 23   TYR n 
2 24   ARG n 
2 25   VAL n 
2 26   ASP n 
2 27   GLN n 
2 28   GLY n 
2 29   VAL n 
2 30   LEU n 
2 31   ASN n 
2 32   ASN n 
2 33   GLY n 
2 34   CYS n 
2 35   PHE n 
2 36   VAL n 
2 37   ASP n 
2 38   ALA n 
2 39   LEU n 
2 40   ASN n 
2 41   VAL n 
2 42   VAL n 
2 43   PRO n 
2 44   HIS n 
2 45   VAL n 
2 46   PHE n 
2 47   LEU n 
2 48   LEU n 
2 49   PHE n 
2 50   ILE n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   LEU n 
2 56   PHE n 
2 57   ILE n 
2 58   GLY n 
2 59   TRP n 
2 60   GLY n 
2 61   SER n 
2 62   GLN n 
2 63   SER n 
2 64   SER n 
2 65   LYS n 
2 66   VAL n 
2 67   HIS n 
2 68   ILE n 
2 69   HIS n 
2 70   HIS n 
2 71   SER n 
2 72   THR n 
2 73   TRP n 
2 74   LEU n 
2 75   HIS n 
2 76   PHE n 
2 77   PRO n 
2 78   GLY n 
2 79   HIS n 
2 80   ASN n 
2 81   LEU n 
2 82   ARG n 
2 83   TRP n 
2 84   ILE n 
2 85   LEU n 
2 86   THR n 
2 87   PHE n 
2 88   ILE n 
2 89   LEU n 
2 90   LEU n 
2 91   PHE n 
2 92   VAL n 
2 93   LEU n 
2 94   VAL n 
2 95   CYS n 
2 96   GLU n 
2 97   ILE n 
2 98   ALA n 
2 99   GLU n 
2 100  GLY n 
2 101  ILE n 
2 102  LEU n 
2 103  SER n 
2 104  ASP n 
2 105  GLY n 
2 106  VAL n 
2 107  THR n 
2 108  GLU n 
2 109  SER n 
2 110  ARG n 
2 111  HIS n 
2 112  LEU n 
2 113  HIS n 
2 114  LEU n 
2 115  TYR n 
2 116  MET n 
2 117  PRO n 
2 118  ALA n 
2 119  GLY n 
2 120  MET n 
2 121  ALA n 
2 122  PHE n 
2 123  MET n 
2 124  ALA n 
2 125  ALA n 
2 126  ILE n 
2 127  THR n 
2 128  SER n 
2 129  VAL n 
2 130  VAL n 
2 131  TYR n 
2 132  TYR n 
2 133  HIS n 
2 134  ASN n 
2 135  ILE n 
2 136  GLU n 
2 137  THR n 
2 138  SER n 
2 139  ASN n 
2 140  PHE n 
2 141  PRO n 
2 142  LYS n 
2 143  LEU n 
2 144  LEU n 
2 145  ILE n 
2 146  ALA n 
2 147  LEU n 
2 148  LEU n 
2 149  ILE n 
2 150  TYR n 
2 151  TRP n 
2 152  THR n 
2 153  LEU n 
2 154  ALA n 
2 155  PHE n 
2 156  ILE n 
2 157  THR n 
2 158  LYS n 
2 159  THR n 
2 160  ILE n 
2 161  LYS n 
2 162  PHE n 
2 163  VAL n 
2 164  LYS n 
2 165  PHE n 
2 166  TYR n 
2 167  ASP n 
2 168  HIS n 
2 169  ALA n 
2 170  ILE n 
2 171  GLY n 
2 172  PHE n 
2 173  SER n 
2 174  GLN n 
2 175  LEU n 
2 176  ARG n 
2 177  PHE n 
2 178  CYS n 
2 179  LEU n 
2 180  THR n 
2 181  GLY n 
2 182  LEU n 
2 183  LEU n 
2 184  VAL n 
2 185  ILE n 
2 186  LEU n 
2 187  TYR n 
2 188  GLY n 
2 189  MET n 
2 190  LEU n 
2 191  LEU n 
2 192  LEU n 
2 193  VAL n 
2 194  GLU n 
2 195  VAL n 
2 196  ASN n 
2 197  VAL n 
2 198  ILE n 
2 199  ARG n 
2 200  VAL n 
2 201  ARG n 
2 202  ARG n 
2 203  TYR n 
2 204  ILE n 
2 205  PHE n 
2 206  PHE n 
2 207  LYS n 
2 208  THR n 
2 209  PRO n 
2 210  ARG n 
2 211  GLU n 
2 212  VAL n 
2 213  LYS n 
2 214  PRO n 
2 215  PRO n 
2 216  GLU n 
2 217  ASP n 
2 218  LEU n 
2 219  GLN n 
2 220  ASP n 
2 221  LEU n 
2 222  GLY n 
2 223  VAL n 
2 224  ARG n 
2 225  PHE n 
2 226  LEU n 
2 227  GLN n 
2 228  PRO n 
2 229  PHE n 
2 230  VAL n 
2 231  ASN n 
2 232  LEU n 
2 233  LEU n 
2 234  SER n 
2 235  LYS n 
2 236  GLY n 
2 237  THR n 
2 238  TYR n 
2 239  TRP n 
2 240  TRP n 
2 241  MET n 
2 242  ASN n 
2 243  ALA n 
2 244  PHE n 
2 245  ILE n 
2 246  LYS n 
2 247  THR n 
2 248  ALA n 
2 249  HIS n 
2 250  LYS n 
2 251  LYS n 
2 252  PRO n 
2 253  ILE n 
2 254  ASP n 
2 255  LEU n 
2 256  ARG n 
2 257  ALA n 
2 258  ILE n 
2 259  ALA n 
2 260  LYS n 
2 261  LEU n 
2 262  PRO n 
2 263  ILE n 
2 264  ALA n 
2 265  MET n 
2 266  ARG n 
2 267  ALA n 
2 268  LEU n 
2 269  THR n 
2 270  ASN n 
2 271  TYR n 
2 272  GLN n 
2 273  ARG n 
2 274  LEU n 
2 275  CYS n 
2 276  VAL n 
2 277  ALA n 
2 278  PHE n 
2 279  ASP n 
2 280  ALA n 
2 281  GLN n 
2 282  ALA n 
2 283  ARG n 
2 284  LYS n 
2 285  ASP n 
2 286  THR n 
2 287  GLN n 
2 288  SER n 
2 289  PRO n 
2 290  GLN n 
2 291  GLY n 
2 292  ALA n 
2 293  ARG n 
2 294  ALA n 
2 295  ILE n 
2 296  TRP n 
2 297  ARG n 
2 298  ALA n 
2 299  LEU n 
2 300  CYS n 
2 301  HIS n 
2 302  ALA n 
2 303  PHE n 
2 304  GLY n 
2 305  ARG n 
2 306  ARG n 
2 307  LEU n 
2 308  ILE n 
2 309  LEU n 
2 310  SER n 
2 311  SER n 
2 312  THR n 
2 313  PHE n 
2 314  ARG n 
2 315  ILE n 
2 316  LEU n 
2 317  ALA n 
2 318  ASP n 
2 319  LEU n 
2 320  LEU n 
2 321  GLY n 
2 322  PHE n 
2 323  ALA n 
2 324  GLY n 
2 325  PRO n 
2 326  LEU n 
2 327  CYS n 
2 328  ILE n 
2 329  PHE n 
2 330  GLY n 
2 331  ILE n 
2 332  VAL n 
2 333  ASP n 
2 334  HIS n 
2 335  LEU n 
2 336  GLY n 
2 337  LYS n 
2 338  GLU n 
2 339  ASN n 
2 340  HIS n 
2 341  VAL n 
2 342  PHE n 
2 343  GLN n 
2 344  PRO n 
2 345  LYS n 
2 346  THR n 
2 347  GLN n 
2 348  PHE n 
2 349  LEU n 
2 350  GLY n 
2 351  VAL n 
2 352  TYR n 
2 353  PHE n 
2 354  VAL n 
2 355  SER n 
2 356  SER n 
2 357  GLN n 
2 358  GLU n 
2 359  PHE n 
2 360  LEU n 
2 361  GLY n 
2 362  ASN n 
2 363  ALA n 
2 364  TYR n 
2 365  VAL n 
2 366  LEU n 
2 367  ALA n 
2 368  VAL n 
2 369  LEU n 
2 370  LEU n 
2 371  PHE n 
2 372  LEU n 
2 373  ALA n 
2 374  LEU n 
2 375  LEU n 
2 376  LEU n 
2 377  GLN n 
2 378  ARG n 
2 379  THR n 
2 380  PHE n 
2 381  LEU n 
2 382  GLN n 
2 383  ALA n 
2 384  SER n 
2 385  TYR n 
2 386  TYR n 
2 387  VAL n 
2 388  ALA n 
2 389  ILE n 
2 390  GLU n 
2 391  THR n 
2 392  GLY n 
2 393  ILE n 
2 394  ASN n 
2 395  LEU n 
2 396  ARG n 
2 397  GLY n 
2 398  ALA n 
2 399  ILE n 
2 400  GLN n 
2 401  THR n 
2 402  LYS n 
2 403  ILE n 
2 404  TYR n 
2 405  ASN n 
2 406  LYS n 
2 407  ILE n 
2 408  MET n 
2 409  HIS n 
2 410  MET n 
2 411  SER n 
2 412  THR n 
2 413  SER n 
2 414  ASN n 
2 415  LEU n 
2 416  SER n 
2 417  MET n 
2 418  GLY n 
2 419  GLU n 
2 420  MET n 
2 421  THR n 
2 422  ALA n 
2 423  GLY n 
2 424  GLN n 
2 425  ILE n 
2 426  CYS n 
2 427  ASN n 
2 428  LEU n 
2 429  VAL n 
2 430  ALA n 
2 431  ILE n 
2 432  ASP n 
2 433  THR n 
2 434  ASN n 
2 435  GLN n 
2 436  LEU n 
2 437  MET n 
2 438  TRP n 
2 439  PHE n 
2 440  PHE n 
2 441  PHE n 
2 442  LEU n 
2 443  CYS n 
2 444  PRO n 
2 445  ASN n 
2 446  LEU n 
2 447  TRP n 
2 448  THR n 
2 449  MET n 
2 450  PRO n 
2 451  VAL n 
2 452  GLN n 
2 453  ILE n 
2 454  ILE n 
2 455  VAL n 
2 456  GLY n 
2 457  VAL n 
2 458  ILE n 
2 459  LEU n 
2 460  LEU n 
2 461  TYR n 
2 462  TYR n 
2 463  ILE n 
2 464  LEU n 
2 465  GLY n 
2 466  VAL n 
2 467  SER n 
2 468  ALA n 
2 469  LEU n 
2 470  ILE n 
2 471  GLY n 
2 472  ALA n 
2 473  ALA n 
2 474  VAL n 
2 475  ILE n 
2 476  ILE n 
2 477  LEU n 
2 478  LEU n 
2 479  ALA n 
2 480  PRO n 
2 481  VAL n 
2 482  GLN n 
2 483  TYR n 
2 484  PHE n 
2 485  VAL n 
2 486  ALA n 
2 487  THR n 
2 488  LYS n 
2 489  LEU n 
2 490  SER n 
2 491  GLN n 
2 492  ALA n 
2 493  GLN n 
2 494  ARG n 
2 495  THR n 
2 496  THR n 
2 497  LEU n 
2 498  GLU n 
2 499  HIS n 
2 500  SER n 
2 501  ASN n 
2 502  GLU n 
2 503  ARG n 
2 504  LEU n 
2 505  LYS n 
2 506  GLN n 
2 507  THR n 
2 508  ASN n 
2 509  GLU n 
2 510  MET n 
2 511  LEU n 
2 512  ARG n 
2 513  GLY n 
2 514  MET n 
2 515  LYS n 
2 516  LEU n 
2 517  LEU n 
2 518  LYS n 
2 519  LEU n 
2 520  TYR n 
2 521  ALA n 
2 522  TRP n 
2 523  GLU n 
2 524  SER n 
2 525  ILE n 
2 526  PHE n 
2 527  CYS n 
2 528  SER n 
2 529  ARG n 
2 530  VAL n 
2 531  GLU n 
2 532  VAL n 
2 533  THR n 
2 534  ARG n 
2 535  ARG n 
2 536  LYS n 
2 537  GLU n 
2 538  MET n 
2 539  THR n 
2 540  SER n 
2 541  LEU n 
2 542  ARG n 
2 543  ALA n 
2 544  PHE n 
2 545  ALA n 
2 546  VAL n 
2 547  TYR n 
2 548  THR n 
2 549  SER n 
2 550  ILE n 
2 551  SER n 
2 552  ILE n 
2 553  PHE n 
2 554  MET n 
2 555  ASN n 
2 556  THR n 
2 557  ALA n 
2 558  ILE n 
2 559  PRO n 
2 560  ILE n 
2 561  ALA n 
2 562  ALA n 
2 563  VAL n 
2 564  LEU n 
2 565  ILE n 
2 566  THR n 
2 567  PHE n 
2 568  VAL n 
2 569  GLY n 
2 570  HIS n 
2 571  VAL n 
2 572  SER n 
2 573  PHE n 
2 574  PHE n 
2 575  LYS n 
2 576  GLU n 
2 577  SER n 
2 578  ASP n 
2 579  LEU n 
2 580  SER n 
2 581  PRO n 
2 582  SER n 
2 583  VAL n 
2 584  ALA n 
2 585  PHE n 
2 586  ALA n 
2 587  SER n 
2 588  LEU n 
2 589  SER n 
2 590  LEU n 
2 591  PHE n 
2 592  HIS n 
2 593  ILE n 
2 594  LEU n 
2 595  VAL n 
2 596  THR n 
2 597  PRO n 
2 598  LEU n 
2 599  PHE n 
2 600  LEU n 
2 601  LEU n 
2 602  SER n 
2 603  SER n 
2 604  VAL n 
2 605  VAL n 
2 606  ARG n 
2 607  SER n 
2 608  THR n 
2 609  VAL n 
2 610  LYS n 
2 611  ALA n 
2 612  LEU n 
2 613  VAL n 
2 614  SER n 
2 615  VAL n 
2 616  GLN n 
2 617  LYS n 
2 618  LEU n 
2 619  SER n 
2 620  GLU n 
2 621  PHE n 
2 622  LEU n 
2 623  SER n 
2 624  SER n 
2 625  ALA n 
2 626  GLU n 
2 627  ILE n 
2 628  ARG n 
2 629  GLU n 
2 630  GLU n 
2 631  GLN n 
2 632  CYS n 
2 633  ALA n 
2 634  PRO n 
2 635  ARG n 
2 636  GLU n 
2 637  PRO n 
2 638  ALA n 
2 639  PRO n 
2 640  GLN n 
2 641  GLY n 
2 642  GLN n 
2 643  ALA n 
2 644  GLY n 
2 645  LYS n 
2 646  TYR n 
2 647  GLN n 
2 648  ALA n 
2 649  VAL n 
2 650  PRO n 
2 651  LEU n 
2 652  LYS n 
2 653  VAL n 
2 654  VAL n 
2 655  ASN n 
2 656  ARG n 
2 657  LYS n 
2 658  ARG n 
2 659  PRO n 
2 660  ALA n 
2 661  ARG n 
2 662  GLU n 
2 663  GLU n 
2 664  VAL n 
2 665  ARG n 
2 666  ASP n 
2 667  LEU n 
2 668  LEU n 
2 669  GLY n 
2 670  PRO n 
2 671  LEU n 
2 672  GLN n 
2 673  ARG n 
2 674  LEU n 
2 675  ALA n 
2 676  PRO n 
2 677  SER n 
2 678  MET n 
2 679  ASP n 
2 680  GLY n 
2 681  ASP n 
2 682  ALA n 
2 683  ASP n 
2 684  ASN n 
2 685  PHE n 
2 686  CYS n 
2 687  VAL n 
2 688  GLN n 
2 689  ILE n 
2 690  ILE n 
2 691  GLY n 
2 692  GLY n 
2 693  PHE n 
2 694  PHE n 
2 695  THR n 
2 696  TRP n 
2 697  THR n 
2 698  PRO n 
2 699  ASP n 
2 700  GLY n 
2 701  ILE n 
2 702  PRO n 
2 703  THR n 
2 704  LEU n 
2 705  SER n 
2 706  ASN n 
2 707  ILE n 
2 708  THR n 
2 709  ILE n 
2 710  ARG n 
2 711  ILE n 
2 712  PRO n 
2 713  ARG n 
2 714  GLY n 
2 715  GLN n 
2 716  LEU n 
2 717  THR n 
2 718  MET n 
2 719  ILE n 
2 720  VAL n 
2 721  GLY n 
2 722  GLN n 
2 723  VAL n 
2 724  GLY n 
2 725  CYS n 
2 726  GLY n 
2 727  LYS n 
2 728  SER n 
2 729  SER n 
2 730  LEU n 
2 731  LEU n 
2 732  LEU n 
2 733  ALA n 
2 734  THR n 
2 735  LEU n 
2 736  GLY n 
2 737  GLU n 
2 738  MET n 
2 739  GLN n 
2 740  LYS n 
2 741  VAL n 
2 742  SER n 
2 743  GLY n 
2 744  ALA n 
2 745  VAL n 
2 746  PHE n 
2 747  TRP n 
2 748  ASN n 
2 749  SER n 
2 750  ASN n 
2 751  LEU n 
2 752  PRO n 
2 753  ASP n 
2 754  SER n 
2 755  GLU n 
2 756  GLY n 
2 757  GLU n 
2 758  ASP n 
2 759  PRO n 
2 760  SER n 
2 761  SER n 
2 762  PRO n 
2 763  GLU n 
2 764  ARG n 
2 765  GLU n 
2 766  THR n 
2 767  ALA n 
2 768  ALA n 
2 769  GLY n 
2 770  SER n 
2 771  ASP n 
2 772  ILE n 
2 773  ARG n 
2 774  SER n 
2 775  ARG n 
2 776  GLY n 
2 777  PRO n 
2 778  VAL n 
2 779  ALA n 
2 780  TYR n 
2 781  ALA n 
2 782  SER n 
2 783  GLN n 
2 784  LYS n 
2 785  PRO n 
2 786  TRP n 
2 787  LEU n 
2 788  LEU n 
2 789  ASN n 
2 790  ALA n 
2 791  THR n 
2 792  VAL n 
2 793  GLU n 
2 794  GLU n 
2 795  ASN n 
2 796  ILE n 
2 797  THR n 
2 798  PHE n 
2 799  GLU n 
2 800  SER n 
2 801  PRO n 
2 802  PHE n 
2 803  ASN n 
2 804  LYS n 
2 805  GLN n 
2 806  ARG n 
2 807  TYR n 
2 808  LYS n 
2 809  MET n 
2 810  VAL n 
2 811  ILE n 
2 812  GLU n 
2 813  ALA n 
2 814  CYS n 
2 815  SER n 
2 816  LEU n 
2 817  GLN n 
2 818  PRO n 
2 819  ASP n 
2 820  ILE n 
2 821  ASP n 
2 822  ILE n 
2 823  LEU n 
2 824  PRO n 
2 825  HIS n 
2 826  GLY n 
2 827  ASP n 
2 828  GLN n 
2 829  THR n 
2 830  GLN n 
2 831  ILE n 
2 832  GLY n 
2 833  GLU n 
2 834  ARG n 
2 835  GLY n 
2 836  ILE n 
2 837  ASN n 
2 838  LEU n 
2 839  SER n 
2 840  GLY n 
2 841  GLY n 
2 842  GLN n 
2 843  ARG n 
2 844  GLN n 
2 845  ARG n 
2 846  ILE n 
2 847  SER n 
2 848  VAL n 
2 849  ALA n 
2 850  ARG n 
2 851  ALA n 
2 852  LEU n 
2 853  TYR n 
2 854  GLN n 
2 855  GLN n 
2 856  THR n 
2 857  ASN n 
2 858  VAL n 
2 859  VAL n 
2 860  PHE n 
2 861  LEU n 
2 862  ASP n 
2 863  ASP n 
2 864  PRO n 
2 865  PHE n 
2 866  SER n 
2 867  ALA n 
2 868  LEU n 
2 869  ASP n 
2 870  VAL n 
2 871  HIS n 
2 872  LEU n 
2 873  SER n 
2 874  ASP n 
2 875  HIS n 
2 876  LEU n 
2 877  MET n 
2 878  GLN n 
2 879  ALA n 
2 880  GLY n 
2 881  ILE n 
2 882  LEU n 
2 883  GLU n 
2 884  LEU n 
2 885  LEU n 
2 886  ARG n 
2 887  ASP n 
2 888  ASP n 
2 889  LYS n 
2 890  ARG n 
2 891  THR n 
2 892  VAL n 
2 893  VAL n 
2 894  LEU n 
2 895  VAL n 
2 896  THR n 
2 897  HIS n 
2 898  LYS n 
2 899  LEU n 
2 900  GLN n 
2 901  TYR n 
2 902  LEU n 
2 903  PRO n 
2 904  HIS n 
2 905  ALA n 
2 906  ASP n 
2 907  TRP n 
2 908  ILE n 
2 909  ILE n 
2 910  ALA n 
2 911  MET n 
2 912  LYS n 
2 913  ASP n 
2 914  GLY n 
2 915  THR n 
2 916  ILE n 
2 917  GLN n 
2 918  ARG n 
2 919  GLU n 
2 920  GLY n 
2 921  THR n 
2 922  LEU n 
2 923  LYS n 
2 924  ASP n 
2 925  PHE n 
2 926  GLN n 
2 927  ARG n 
2 928  SER n 
2 929  GLU n 
2 930  CYS n 
2 931  GLN n 
2 932  LEU n 
2 933  PHE n 
2 934  GLU n 
2 935  HIS n 
2 936  TRP n 
2 937  LYS n 
2 938  THR n 
2 939  LEU n 
2 940  MET n 
2 941  ASN n 
2 942  ARG n 
2 943  GLN n 
2 944  ASP n 
2 945  GLN n 
2 946  GLU n 
2 947  LEU n 
2 948  GLU n 
2 949  LYS n 
2 950  GLU n 
2 951  THR n 
2 952  VAL n 
2 953  MET n 
2 954  GLU n 
2 955  ARG n 
2 956  LYS n 
2 957  ALA n 
2 958  SER n 
2 959  GLU n 
2 960  PRO n 
2 961  SER n 
2 962  GLN n 
2 963  GLY n 
2 964  LEU n 
2 965  PRO n 
2 966  ARG n 
2 967  ALA n 
2 968  MET n 
2 969  SER n 
2 970  SER n 
2 971  ARG n 
2 972  ASP n 
2 973  GLY n 
2 974  LEU n 
2 975  LEU n 
2 976  LEU n 
2 977  ASP n 
2 978  GLU n 
2 979  GLU n 
2 980  GLU n 
2 981  GLU n 
2 982  GLU n 
2 983  GLU n 
2 984  GLU n 
2 985  ALA n 
2 986  ALA n 
2 987  GLU n 
2 988  SER n 
2 989  GLU n 
2 990  GLU n 
2 991  ASP n 
2 992  ASP n 
2 993  ASN n 
2 994  LEU n 
2 995  SER n 
2 996  SER n 
2 997  VAL n 
2 998  LEU n 
2 999  HIS n 
2 1000 GLN n 
2 1001 ARG n 
2 1002 ALA n 
2 1003 LYS n 
2 1004 ILE n 
2 1005 PRO n 
2 1006 TRP n 
2 1007 ARG n 
2 1008 ALA n 
2 1009 CYS n 
2 1010 THR n 
2 1011 LYS n 
2 1012 TYR n 
2 1013 LEU n 
2 1014 SER n 
2 1015 SER n 
2 1016 ALA n 
2 1017 GLY n 
2 1018 ILE n 
2 1019 LEU n 
2 1020 LEU n 
2 1021 LEU n 
2 1022 SER n 
2 1023 LEU n 
2 1024 LEU n 
2 1025 VAL n 
2 1026 PHE n 
2 1027 SER n 
2 1028 GLN n 
2 1029 LEU n 
2 1030 LEU n 
2 1031 LYS n 
2 1032 HIS n 
2 1033 MET n 
2 1034 VAL n 
2 1035 LEU n 
2 1036 VAL n 
2 1037 ALA n 
2 1038 ILE n 
2 1039 ASP n 
2 1040 TYR n 
2 1041 TRP n 
2 1042 LEU n 
2 1043 ALA n 
2 1044 LYS n 
2 1045 TRP n 
2 1046 THR n 
2 1047 ASP n 
2 1048 SER n 
2 1049 ALA n 
2 1050 LEU n 
2 1051 VAL n 
2 1052 LEU n 
2 1053 SER n 
2 1054 PRO n 
2 1055 ALA n 
2 1056 ALA n 
2 1057 ARG n 
2 1058 ASN n 
2 1059 CYS n 
2 1060 SER n 
2 1061 LEU n 
2 1062 SER n 
2 1063 GLN n 
2 1064 GLU n 
2 1065 CYS n 
2 1066 ASP n 
2 1067 LEU n 
2 1068 ASP n 
2 1069 GLN n 
2 1070 SER n 
2 1071 VAL n 
2 1072 TYR n 
2 1073 ALA n 
2 1074 MET n 
2 1075 VAL n 
2 1076 PHE n 
2 1077 THR n 
2 1078 LEU n 
2 1079 LEU n 
2 1080 CYS n 
2 1081 SER n 
2 1082 LEU n 
2 1083 GLY n 
2 1084 ILE n 
2 1085 VAL n 
2 1086 LEU n 
2 1087 CYS n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 THR n 
2 1091 SER n 
2 1092 VAL n 
2 1093 THR n 
2 1094 VAL n 
2 1095 GLU n 
2 1096 TRP n 
2 1097 THR n 
2 1098 GLY n 
2 1099 LEU n 
2 1100 LYS n 
2 1101 VAL n 
2 1102 ALA n 
2 1103 LYS n 
2 1104 ARG n 
2 1105 LEU n 
2 1106 HIS n 
2 1107 ARG n 
2 1108 SER n 
2 1109 LEU n 
2 1110 LEU n 
2 1111 ASN n 
2 1112 ARG n 
2 1113 ILE n 
2 1114 ILE n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 PRO n 
2 1118 MET n 
2 1119 ARG n 
2 1120 PHE n 
2 1121 PHE n 
2 1122 GLU n 
2 1123 THR n 
2 1124 THR n 
2 1125 PRO n 
2 1126 LEU n 
2 1127 GLY n 
2 1128 SER n 
2 1129 ILE n 
2 1130 LEU n 
2 1131 ASN n 
2 1132 ARG n 
2 1133 PHE n 
2 1134 SER n 
2 1135 SER n 
2 1136 ASP n 
2 1137 CYS n 
2 1138 ASN n 
2 1139 THR n 
2 1140 ILE n 
2 1141 ASP n 
2 1142 GLN n 
2 1143 HIS n 
2 1144 ILE n 
2 1145 PRO n 
2 1146 SER n 
2 1147 THR n 
2 1148 LEU n 
2 1149 GLU n 
2 1150 CYS n 
2 1151 LEU n 
2 1152 SER n 
2 1153 ARG n 
2 1154 SER n 
2 1155 THR n 
2 1156 LEU n 
2 1157 LEU n 
2 1158 CYS n 
2 1159 VAL n 
2 1160 SER n 
2 1161 ALA n 
2 1162 LEU n 
2 1163 THR n 
2 1164 VAL n 
2 1165 ILE n 
2 1166 SER n 
2 1167 TYR n 
2 1168 VAL n 
2 1169 THR n 
2 1170 PRO n 
2 1171 VAL n 
2 1172 PHE n 
2 1173 LEU n 
2 1174 VAL n 
2 1175 ALA n 
2 1176 LEU n 
2 1177 LEU n 
2 1178 PRO n 
2 1179 LEU n 
2 1180 ALA n 
2 1181 VAL n 
2 1182 VAL n 
2 1183 CYS n 
2 1184 TYR n 
2 1185 PHE n 
2 1186 ILE n 
2 1187 GLN n 
2 1188 LYS n 
2 1189 TYR n 
2 1190 PHE n 
2 1191 ARG n 
2 1192 VAL n 
2 1193 ALA n 
2 1194 SER n 
2 1195 ARG n 
2 1196 ASP n 
2 1197 LEU n 
2 1198 GLN n 
2 1199 GLN n 
2 1200 LEU n 
2 1201 ASP n 
2 1202 ASP n 
2 1203 THR n 
2 1204 THR n 
2 1205 GLN n 
2 1206 LEU n 
2 1207 PRO n 
2 1208 LEU n 
2 1209 VAL n 
2 1210 SER n 
2 1211 HIS n 
2 1212 PHE n 
2 1213 ALA n 
2 1214 GLU n 
2 1215 THR n 
2 1216 VAL n 
2 1217 GLU n 
2 1218 GLY n 
2 1219 LEU n 
2 1220 THR n 
2 1221 THR n 
2 1222 ILE n 
2 1223 ARG n 
2 1224 ALA n 
2 1225 PHE n 
2 1226 ARG n 
2 1227 TYR n 
2 1228 GLU n 
2 1229 ALA n 
2 1230 ARG n 
2 1231 PHE n 
2 1232 GLN n 
2 1233 GLN n 
2 1234 LYS n 
2 1235 LEU n 
2 1236 LEU n 
2 1237 GLU n 
2 1238 TYR n 
2 1239 THR n 
2 1240 ASP n 
2 1241 SER n 
2 1242 ASN n 
2 1243 ASN n 
2 1244 ILE n 
2 1245 ALA n 
2 1246 SER n 
2 1247 LEU n 
2 1248 PHE n 
2 1249 LEU n 
2 1250 THR n 
2 1251 ALA n 
2 1252 ALA n 
2 1253 ASN n 
2 1254 ARG n 
2 1255 TRP n 
2 1256 LEU n 
2 1257 GLU n 
2 1258 VAL n 
2 1259 CYS n 
2 1260 MET n 
2 1261 GLU n 
2 1262 TYR n 
2 1263 ILE n 
2 1264 GLY n 
2 1265 ALA n 
2 1266 CYS n 
2 1267 VAL n 
2 1268 VAL n 
2 1269 LEU n 
2 1270 ILE n 
2 1271 ALA n 
2 1272 ALA n 
2 1273 ALA n 
2 1274 THR n 
2 1275 SER n 
2 1276 ILE n 
2 1277 SER n 
2 1278 ASN n 
2 1279 SER n 
2 1280 LEU n 
2 1281 HIS n 
2 1282 ARG n 
2 1283 GLU n 
2 1284 LEU n 
2 1285 SER n 
2 1286 ALA n 
2 1287 GLY n 
2 1288 LEU n 
2 1289 VAL n 
2 1290 GLY n 
2 1291 LEU n 
2 1292 GLY n 
2 1293 LEU n 
2 1294 THR n 
2 1295 TYR n 
2 1296 ALA n 
2 1297 LEU n 
2 1298 MET n 
2 1299 VAL n 
2 1300 SER n 
2 1301 ASN n 
2 1302 TYR n 
2 1303 LEU n 
2 1304 ASN n 
2 1305 TRP n 
2 1306 MET n 
2 1307 VAL n 
2 1308 ARG n 
2 1309 ASN n 
2 1310 LEU n 
2 1311 ALA n 
2 1312 ASP n 
2 1313 MET n 
2 1314 GLU n 
2 1315 ILE n 
2 1316 GLN n 
2 1317 LEU n 
2 1318 GLY n 
2 1319 ALA n 
2 1320 VAL n 
2 1321 LYS n 
2 1322 ARG n 
2 1323 ILE n 
2 1324 HIS n 
2 1325 ALA n 
2 1326 LEU n 
2 1327 LEU n 
2 1328 LYS n 
2 1329 THR n 
2 1330 GLU n 
2 1331 ALA n 
2 1332 GLU n 
2 1333 SER n 
2 1334 TYR n 
2 1335 GLU n 
2 1336 GLY n 
2 1337 LEU n 
2 1338 LEU n 
2 1339 ALA n 
2 1340 PRO n 
2 1341 SER n 
2 1342 LEU n 
2 1343 ILE n 
2 1344 PRO n 
2 1345 LYS n 
2 1346 ASN n 
2 1347 TRP n 
2 1348 PRO n 
2 1349 ASP n 
2 1350 GLN n 
2 1351 GLY n 
2 1352 LYS n 
2 1353 ILE n 
2 1354 GLN n 
2 1355 ILE n 
2 1356 GLN n 
2 1357 ASN n 
2 1358 LEU n 
2 1359 SER n 
2 1360 VAL n 
2 1361 ARG n 
2 1362 TYR n 
2 1363 ASP n 
2 1364 SER n 
2 1365 SER n 
2 1366 LEU n 
2 1367 LYS n 
2 1368 PRO n 
2 1369 VAL n 
2 1370 LEU n 
2 1371 LYS n 
2 1372 HIS n 
2 1373 VAL n 
2 1374 ASN n 
2 1375 THR n 
2 1376 LEU n 
2 1377 ILE n 
2 1378 SER n 
2 1379 PRO n 
2 1380 GLY n 
2 1381 GLN n 
2 1382 LYS n 
2 1383 ILE n 
2 1384 GLY n 
2 1385 ILE n 
2 1386 CYS n 
2 1387 GLY n 
2 1388 ARG n 
2 1389 THR n 
2 1390 GLY n 
2 1391 SER n 
2 1392 GLY n 
2 1393 LYS n 
2 1394 SER n 
2 1395 SER n 
2 1396 PHE n 
2 1397 SER n 
2 1398 LEU n 
2 1399 ALA n 
2 1400 PHE n 
2 1401 PHE n 
2 1402 ARG n 
2 1403 MET n 
2 1404 VAL n 
2 1405 ASP n 
2 1406 MET n 
2 1407 PHE n 
2 1408 GLU n 
2 1409 GLY n 
2 1410 ARG n 
2 1411 ILE n 
2 1412 ILE n 
2 1413 ILE n 
2 1414 ASP n 
2 1415 GLY n 
2 1416 ILE n 
2 1417 ASP n 
2 1418 ILE n 
2 1419 ALA n 
2 1420 LYS n 
2 1421 LEU n 
2 1422 PRO n 
2 1423 LEU n 
2 1424 HIS n 
2 1425 THR n 
2 1426 LEU n 
2 1427 ARG n 
2 1428 SER n 
2 1429 ARG n 
2 1430 LEU n 
2 1431 SER n 
2 1432 ILE n 
2 1433 ILE n 
2 1434 LEU n 
2 1435 GLN n 
2 1436 ASP n 
2 1437 PRO n 
2 1438 VAL n 
2 1439 LEU n 
2 1440 PHE n 
2 1441 SER n 
2 1442 GLY n 
2 1443 THR n 
2 1444 ILE n 
2 1445 ARG n 
2 1446 PHE n 
2 1447 ASN n 
2 1448 LEU n 
2 1449 ASP n 
2 1450 PRO n 
2 1451 GLU n 
2 1452 LYS n 
2 1453 LYS n 
2 1454 CYS n 
2 1455 SER n 
2 1456 ASP n 
2 1457 SER n 
2 1458 THR n 
2 1459 LEU n 
2 1460 TRP n 
2 1461 GLU n 
2 1462 ALA n 
2 1463 LEU n 
2 1464 GLU n 
2 1465 ILE n 
2 1466 ALA n 
2 1467 GLN n 
2 1468 LEU n 
2 1469 LYS n 
2 1470 LEU n 
2 1471 VAL n 
2 1472 VAL n 
2 1473 LYS n 
2 1474 ALA n 
2 1475 LEU n 
2 1476 PRO n 
2 1477 GLY n 
2 1478 GLY n 
2 1479 LEU n 
2 1480 ASP n 
2 1481 ALA n 
2 1482 ILE n 
2 1483 ILE n 
2 1484 THR n 
2 1485 GLU n 
2 1486 GLY n 
2 1487 GLY n 
2 1488 GLU n 
2 1489 ASN n 
2 1490 PHE n 
2 1491 SER n 
2 1492 GLN n 
2 1493 GLY n 
2 1494 GLN n 
2 1495 ARG n 
2 1496 GLN n 
2 1497 LEU n 
2 1498 PHE n 
2 1499 CYS n 
2 1500 LEU n 
2 1501 ALA n 
2 1502 ARG n 
2 1503 ALA n 
2 1504 PHE n 
2 1505 VAL n 
2 1506 ARG n 
2 1507 LYS n 
2 1508 THR n 
2 1509 SER n 
2 1510 ILE n 
2 1511 PHE n 
2 1512 ILE n 
2 1513 MET n 
2 1514 ASP n 
2 1515 GLU n 
2 1516 ALA n 
2 1517 THR n 
2 1518 ALA n 
2 1519 SER n 
2 1520 ILE n 
2 1521 ASP n 
2 1522 MET n 
2 1523 ALA n 
2 1524 THR n 
2 1525 GLU n 
2 1526 ASN n 
2 1527 ILE n 
2 1528 LEU n 
2 1529 GLN n 
2 1530 LYS n 
2 1531 VAL n 
2 1532 VAL n 
2 1533 MET n 
2 1534 THR n 
2 1535 ALA n 
2 1536 PHE n 
2 1537 ALA n 
2 1538 ASP n 
2 1539 ARG n 
2 1540 THR n 
2 1541 VAL n 
2 1542 VAL n 
2 1543 THR n 
2 1544 ILE n 
2 1545 ALA n 
2 1546 HIS n 
2 1547 ARG n 
2 1548 VAL n 
2 1549 HIS n 
2 1550 THR n 
2 1551 ILE n 
2 1552 LEU n 
2 1553 SER n 
2 1554 ALA n 
2 1555 ASP n 
2 1556 LEU n 
2 1557 VAL n 
2 1558 MET n 
2 1559 VAL n 
2 1560 LEU n 
2 1561 LYS n 
2 1562 ARG n 
2 1563 GLY n 
2 1564 ALA n 
2 1565 ILE n 
2 1566 LEU n 
2 1567 GLU n 
2 1568 PHE n 
2 1569 ASP n 
2 1570 LYS n 
2 1571 PRO n 
2 1572 GLU n 
2 1573 THR n 
2 1574 LEU n 
2 1575 LEU n 
2 1576 SER n 
2 1577 GLN n 
2 1578 LYS n 
2 1579 ASP n 
2 1580 SER n 
2 1581 VAL n 
2 1582 PHE n 
2 1583 ALA n 
2 1584 SER n 
2 1585 PHE n 
2 1586 VAL n 
2 1587 ARG n 
2 1588 ALA n 
2 1589 ASP n 
2 1590 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 390  Rat                     ? Kcnj11       ? ? ? ? ? ? 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? 
Rat 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? INS-1 ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 1590 'Black-bellied hamster' ? 'ABCC8, SUR' ? ? ? ? ? ? 'Cricetus cricetus' 10034 ? ? ? ? ? ? ? 
Rat 'Rattus norvegicus' 10116 ? ? ? ? ? ? ? ? INS-1 ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 5TWV        5TWV   ? 1 ? 1 
2 UNP ABCC8_CRICR Q09427 ? 2 
;MPLAFCGTENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGSQSSKVHIHHSTWLHFPGHNLRWILTFI
LLFVLVCEIAEGILSDGVTESRHLHLYMPAGMAFMAAITSVVYYHNIETSNFPKLLIALLIYWTLAFITKTIKFVKFYDH
AIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVRRYIFFKTPREVKPPEDLQDLGVRFLQPFVNLLSKGTYWWMNAFIKTA
HKKPIDLRAIAKLPIAMRALTNYQRLCVAFDAQARKDTQSPQGARAIWRALCHAFGRRLILSSTFRILADLLGFAGPLCI
FGIVDHLGKENHVFQPKTQFLGVYFVSSQEFLGNAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIYNKIM
HMSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWTMPVQIIVGVILLYYILGVSALIGAAVIILLAPVQYFVATK
LSQAQRTTLEHSNERLKQTNEMLRGMKLLKLYAWESIFCSRVEVTRRKEMTSLRAFAVYTSISIFMNTAIPIAAVLITFV
GHVSFFKESDLSPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLSSAEIREEQCAPREPAPQGQAGKYQA
VPLKVVNRKRPAREEVRDLLGPLQRLAPSMDGDADNFCVQIIGGFFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKS
SLLLATLGEMQKVSGAVFWNSNLPDSEGEDPSSPERETAAGSDIRSRGPVAYASQKPWLLNATVEENITFESPFNKQRYK
MVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQRISVARALYQQTNVVFLDDPFSALDVHLSDHLMQAGILELLRDD
KRTVVLVTHKLQYLPHADWIIAMKDGTIQREGTLKDFQRSECQLFEHWKTLMNRQDQELEKETVMERKASEPSQGLPRAM
SSRDGLLLDEEEEEEEAAESEEDDNLSSVLHQRAKIPWRACTKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDS
ALVLSPAARNCSLSQECDLDQSVYAMVFTLLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGS
ILNRFSSDCNTIDQHIPSTLECLSRSTLLCVSALTVISYVTPVFLVALLPLAVVCYFIQKYFRVASRDLQQLDDTTQLPL
VSHFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVCMEYIGACVVLIAAATSISNSLHRELSAGL
VGLGLTYALMVSNYLNWMVRNLADMEIQLGAVKRIHALLKTEAESYEGLLAPSLIPKNWPDQGKIQIQNLSVRYDSSLKP
VLKHVNTLISPGQKIGICGRTGSGKSSFSLAFFRMVDMFEGRIIIDGIDIAKLPLHTLRSRLSIILQDPVLFSGTIRFNL
DPEKKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENFSQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENIL
QKVVMTAFADRTVVTIAHRVHTILSADLVMVLKRGAILEFDKPETLLSQKDSVFASFVRADK
;
1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5TWV A 1 ? 390  ? 5TWV   1 ? 390  ? 1 390  
2 2 5TWV B 9 ? 1590 ? Q09427 1 ? 1582 ? 1 1582 
3 1 5TWV C 1 ? 390  ? 5TWV   1 ? 390  ? 1 390  
4 2 5TWV D 9 ? 1590 ? Q09427 1 ? 1582 ? 1 1582 
5 1 5TWV E 1 ? 390  ? 5TWV   1 ? 390  ? 1 390  
6 2 5TWV F 9 ? 1590 ? Q09427 1 ? 1582 ? 1 1582 
7 1 5TWV G 1 ? 390  ? 5TWV   1 ? 390  ? 1 390  
8 2 5TWV H 9 ? 1590 ? Q09427 1 ? 1582 ? 1 1582 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 5TWV ASP B 1 ? UNP Q09427 ? ? 'expression tag' -7 1  
2 5TWV TYR B 2 ? UNP Q09427 ? ? 'expression tag' -6 2  
2 5TWV LYS B 3 ? UNP Q09427 ? ? 'expression tag' -5 3  
2 5TWV ASP B 4 ? UNP Q09427 ? ? 'expression tag' -4 4  
2 5TWV ASP B 5 ? UNP Q09427 ? ? 'expression tag' -3 5  
2 5TWV ASP B 6 ? UNP Q09427 ? ? 'expression tag' -2 6  
2 5TWV ASP B 7 ? UNP Q09427 ? ? 'expression tag' -1 7  
2 5TWV LYS B 8 ? UNP Q09427 ? ? 'expression tag' 0  8  
4 5TWV ASP D 1 ? UNP Q09427 ? ? 'expression tag' -7 9  
4 5TWV TYR D 2 ? UNP Q09427 ? ? 'expression tag' -6 10 
4 5TWV LYS D 3 ? UNP Q09427 ? ? 'expression tag' -5 11 
4 5TWV ASP D 4 ? UNP Q09427 ? ? 'expression tag' -4 12 
4 5TWV ASP D 5 ? UNP Q09427 ? ? 'expression tag' -3 13 
4 5TWV ASP D 6 ? UNP Q09427 ? ? 'expression tag' -2 14 
4 5TWV ASP D 7 ? UNP Q09427 ? ? 'expression tag' -1 15 
4 5TWV LYS D 8 ? UNP Q09427 ? ? 'expression tag' 0  16 
6 5TWV ASP F 1 ? UNP Q09427 ? ? 'expression tag' -7 17 
6 5TWV TYR F 2 ? UNP Q09427 ? ? 'expression tag' -6 18 
6 5TWV LYS F 3 ? UNP Q09427 ? ? 'expression tag' -5 19 
6 5TWV ASP F 4 ? UNP Q09427 ? ? 'expression tag' -4 20 
6 5TWV ASP F 5 ? UNP Q09427 ? ? 'expression tag' -3 21 
6 5TWV ASP F 6 ? UNP Q09427 ? ? 'expression tag' -2 22 
6 5TWV ASP F 7 ? UNP Q09427 ? ? 'expression tag' -1 23 
6 5TWV LYS F 8 ? UNP Q09427 ? ? 'expression tag' 0  24 
8 5TWV ASP H 1 ? UNP Q09427 ? ? 'expression tag' -7 25 
8 5TWV TYR H 2 ? UNP Q09427 ? ? 'expression tag' -6 26 
8 5TWV LYS H 3 ? UNP Q09427 ? ? 'expression tag' -5 27 
8 5TWV ASP H 4 ? UNP Q09427 ? ? 'expression tag' -4 28 
8 5TWV ASP H 5 ? UNP Q09427 ? ? 'expression tag' -3 29 
8 5TWV ASP H 6 ? UNP Q09427 ? ? 'expression tag' -2 30 
8 5TWV ASP H 7 ? UNP Q09427 ? ? 'expression tag' -1 31 
8 5TWV LYS H 8 ? UNP Q09427 ? ? 'expression tag' 0  32 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                     ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                    ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                  ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'             ? 'C4 H7 N O4'        133.103 
ATP non-polymer         . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 
CYS 'L-peptide linking' y CYSTEINE                    ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                   ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'             ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                     ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                   ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                  ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                     ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                      ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                  ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE               ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                     ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                      ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                   ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                  ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                    ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                      ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5TWV 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5TWV 
_struct.title                        
'Cryo-EM structure of the pancreatic ATP-sensitive K+ channel SUR1/Kir6.2 in the presence of ATP and glibenclamide' 
_struct.pdbx_descriptor              
'ATP-sensitive inward rectifier potassium channel 11, ATP-binding cassette sub-family C member 8' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5TWV 
_struct_keywords.text            'katp, kir6.2, sur1, potassium channel, TRANSPORT PROTEIN' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 3 ? 
J N N 3 ? 
K N N 3 ? 
L N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLN A 52   ? ASP A 58   ? GLN A 52   ASP A 58   1 ? 7  
HELX_P HELX_P2   AA2 ASP A 58   ? LEU A 66   ? ASP A 58   LEU A 66   1 ? 9  
HELX_P HELX_P3   AA3 LYS A 67   ? ILE A 93   ? LYS A 67   ILE A 93   1 ? 27 
HELX_P HELX_P4   AA4 SER A 116  ? THR A 130  ? SER A 116  THR A 130  1 ? 15 
HELX_P HELX_P5   AA5 LEU A 144  ? ALA A 172  ? LEU A 144  ALA A 172  1 ? 29 
HELX_P HELX_P6   AA6 ALA A 174  ? THR A 180  ? ALA A 174  THR A 180  1 ? 7  
HELX_P HELX_P7   AA7 SER A 265  ? LEU A 270  ? SER A 265  LEU A 270  5 ? 6  
HELX_P HELX_P8   AA8 ALA A 271  ? GLN A 279  ? ALA A 271  GLN A 279  1 ? 9  
HELX_P HELX_P9   AA9 THR A 345  ? SER A 354  ? THR A 345  SER A 354  1 ? 10 
HELX_P HELX_P10  AB1 ASN B 18   ? ASP B 26   ? ASN B 10   ASP B 18   1 ? 9  
HELX_P HELX_P11  AB2 ASP B 26   ? GLY B 33   ? ASP B 18   GLY B 25   1 ? 8  
HELX_P HELX_P12  AB3 CYS B 34   ? ILE B 50   ? CYS B 26   ILE B 42   1 ? 17 
HELX_P HELX_P13  AB4 ILE B 50   ? SER B 61   ? ILE B 42   SER B 53   1 ? 12 
HELX_P HELX_P14  AB5 GLY B 78   ? VAL B 106  ? GLY B 70   VAL B 98   1 ? 29 
HELX_P HELX_P15  AB6 TYR B 115  ? GLU B 136  ? TYR B 107  GLU B 128  1 ? 22 
HELX_P HELX_P16  AB7 PRO B 141  ? HIS B 168  ? PRO B 133  HIS B 160  1 ? 28 
HELX_P HELX_P17  AB8 GLN B 174  ? VAL B 195  ? GLN B 166  VAL B 187  1 ? 22 
HELX_P HELX_P18  AB9 GLU B 216  ? ARG B 224  ? GLU B 208  ARG B 216  1 ? 9  
HELX_P HELX_P19  AC1 TYR B 238  ? LYS B 250  ? TYR B 230  LYS B 242  1 ? 13 
HELX_P HELX_P20  AC2 LYS B 250  ? ILE B 258  ? LYS B 242  ILE B 250  1 ? 9  
HELX_P HELX_P21  AC3 LYS B 260  ? MET B 265  ? LYS B 252  MET B 257  1 ? 6  
HELX_P HELX_P22  AC4 THR B 269  ? ASP B 285  ? THR B 261  ASP B 277  1 ? 17 
HELX_P HELX_P23  AC5 GLY B 291  ? GLY B 304  ? GLY B 283  GLY B 296  1 ? 14 
HELX_P HELX_P24  AC6 GLY B 304  ? GLY B 324  ? GLY B 296  GLY B 316  1 ? 21 
HELX_P HELX_P25  AC7 GLY B 324  ? LEU B 335  ? GLY B 316  LEU B 327  1 ? 12 
HELX_P HELX_P26  AC8 PHE B 359  ? SER B 411  ? PHE B 351  SER B 403  1 ? 53 
HELX_P HELX_P27  AC9 SER B 413  ? GLU B 419  ? SER B 405  GLU B 411  1 ? 7  
HELX_P HELX_P28  AD1 MET B 420  ? TRP B 438  ? MET B 412  TRP B 430  1 ? 19 
HELX_P HELX_P29  AD2 LEU B 442  ? LEU B 464  ? LEU B 434  LEU B 456  1 ? 23 
HELX_P HELX_P30  AD3 GLY B 465  ? LEU B 516  ? GLY B 457  LEU B 508  1 ? 52 
HELX_P HELX_P31  AD4 LYS B 518  ? GLU B 576  ? LYS B 510  GLU B 568  1 ? 59 
HELX_P HELX_P32  AD5 PRO B 581  ? LEU B 622  ? PRO B 573  LEU B 614  1 ? 42 
HELX_P HELX_P33  AD6 GLY B 726  ? LEU B 735  ? GLY B 718  LEU B 727  1 ? 10 
HELX_P HELX_P34  AD7 THR B 791  ? PHE B 798  ? THR B 783  PHE B 790  1 ? 8  
HELX_P HELX_P35  AD8 ASN B 803  ? CYS B 814  ? ASN B 795  CYS B 806  1 ? 12 
HELX_P HELX_P36  AD9 LEU B 816  ? ILE B 822  ? LEU B 808  ILE B 814  1 ? 7  
HELX_P HELX_P37  AE1 HIS B 825  ? THR B 829  ? HIS B 817  THR B 821  5 ? 5  
HELX_P HELX_P38  AE2 SER B 839  ? GLN B 855  ? SER B 831  GLN B 847  1 ? 17 
HELX_P HELX_P39  AE3 ASP B 869  ? LEU B 885  ? ASP B 861  LEU B 877  1 ? 17 
HELX_P HELX_P40  AE4 TYR B 901  ? ALA B 905  ? TYR B 893  ALA B 897  5 ? 5  
HELX_P HELX_P41  AE5 THR B 921  ? SER B 928  ? THR B 913  SER B 920  1 ? 8  
HELX_P HELX_P42  AE6 CYS B 930  ? TRP B 936  ? CYS B 922  TRP B 928  1 ? 7  
HELX_P HELX_P43  AE7 LYS B 1011 ? SER B 1015 ? LYS B 1003 SER B 1007 5 ? 5  
HELX_P HELX_P44  AE8 ILE B 1018 ? VAL B 1051 ? ILE B 1010 VAL B 1043 1 ? 34 
HELX_P HELX_P45  AE9 VAL B 1071 ? LEU B 1079 ? VAL B 1063 LEU B 1071 1 ? 9  
HELX_P HELX_P46  AF1 SER B 1081 ? THR B 1090 ? SER B 1073 THR B 1082 1 ? 10 
HELX_P HELX_P47  AF2 TRP B 1096 ? ILE B 1113 ? TRP B 1088 ILE B 1105 1 ? 18 
HELX_P HELX_P48  AF3 PRO B 1117 ? THR B 1123 ? PRO B 1109 THR B 1115 1 ? 7  
HELX_P HELX_P49  AF4 PRO B 1125 ? THR B 1169 ? PRO B 1117 THR B 1161 1 ? 45 
HELX_P HELX_P50  AF5 ALA B 1175 ? THR B 1204 ? ALA B 1167 THR B 1196 1 ? 30 
HELX_P HELX_P51  AF6 GLN B 1205 ? GLY B 1218 ? GLN B 1197 GLY B 1210 1 ? 14 
HELX_P HELX_P52  AF7 GLY B 1218 ? PHE B 1225 ? GLY B 1210 PHE B 1217 1 ? 8  
HELX_P HELX_P53  AF8 GLU B 1228 ? HIS B 1281 ? GLU B 1220 HIS B 1273 1 ? 54 
HELX_P HELX_P54  AF9 GLY B 1290 ? LEU B 1327 ? GLY B 1282 LEU B 1319 1 ? 38 
HELX_P HELX_P55  AG1 THR B 1389 ? ARG B 1402 ? THR B 1381 ARG B 1394 1 ? 14 
HELX_P HELX_P56  AG2 ALA B 1419 ? LEU B 1421 ? ALA B 1411 LEU B 1413 5 ? 3  
HELX_P HELX_P57  AG3 PRO B 1422 ? ARG B 1429 ? PRO B 1414 ARG B 1421 1 ? 8  
HELX_P HELX_P58  AG4 THR B 1443 ? LEU B 1448 ? THR B 1435 LEU B 1440 1 ? 6  
HELX_P HELX_P59  AG5 SER B 1455 ? ALA B 1466 ? SER B 1447 ALA B 1458 1 ? 12 
HELX_P HELX_P60  AG6 LEU B 1468 ? ALA B 1474 ? LEU B 1460 ALA B 1466 1 ? 7  
HELX_P HELX_P61  AG7 GLY B 1477 ? ALA B 1481 ? GLY B 1469 ALA B 1473 5 ? 5  
HELX_P HELX_P62  AG8 ILE B 1483 ? GLY B 1487 ? ILE B 1475 GLY B 1479 5 ? 5  
HELX_P HELX_P63  AG9 SER B 1491 ? LYS B 1507 ? SER B 1483 LYS B 1499 1 ? 17 
HELX_P HELX_P64  AH1 MET B 1522 ? ALA B 1537 ? MET B 1514 ALA B 1529 1 ? 16 
HELX_P HELX_P65  AH2 HIS B 1549 ? ALA B 1554 ? HIS B 1541 ALA B 1546 5 ? 6  
HELX_P HELX_P66  AH3 LYS B 1570 ? LYS B 1578 ? LYS B 1562 LYS B 1570 1 ? 9  
HELX_P HELX_P67  AH4 ASP B 1579 ? PHE B 1585 ? ASP B 1571 PHE B 1577 1 ? 7  
HELX_P HELX_P68  AH5 GLN C 52   ? ASP C 58   ? GLN C 52   ASP C 58   1 ? 7  
HELX_P HELX_P69  AH6 ASP C 58   ? LEU C 66   ? ASP C 58   LEU C 66   1 ? 9  
HELX_P HELX_P70  AH7 LYS C 67   ? GLY C 98   ? LYS C 67   GLY C 98   1 ? 32 
HELX_P HELX_P71  AH8 SER C 116  ? THR C 130  ? SER C 116  THR C 130  1 ? 15 
HELX_P HELX_P72  AH9 LEU C 144  ? ALA C 172  ? LEU C 144  ALA C 172  1 ? 29 
HELX_P HELX_P73  AI1 ALA C 174  ? THR C 180  ? ALA C 174  THR C 180  1 ? 7  
HELX_P HELX_P74  AI2 SER C 265  ? LEU C 270  ? SER C 265  LEU C 270  5 ? 6  
HELX_P HELX_P75  AI3 ALA C 271  ? GLN C 279  ? ALA C 271  GLN C 279  1 ? 9  
HELX_P HELX_P76  AI4 THR C 345  ? SER C 354  ? THR C 345  SER C 354  1 ? 10 
HELX_P HELX_P77  AI5 ASN D 18   ? ASP D 26   ? ASN D 10   ASP D 18   1 ? 9  
HELX_P HELX_P78  AI6 ASP D 26   ? GLY D 33   ? ASP D 18   GLY D 25   1 ? 8  
HELX_P HELX_P79  AI7 CYS D 34   ? ILE D 50   ? CYS D 26   ILE D 42   1 ? 17 
HELX_P HELX_P80  AI8 ILE D 50   ? SER D 61   ? ILE D 42   SER D 53   1 ? 12 
HELX_P HELX_P81  AI9 GLY D 78   ? VAL D 106  ? GLY D 70   VAL D 98   1 ? 29 
HELX_P HELX_P82  AJ1 TYR D 115  ? GLU D 136  ? TYR D 107  GLU D 128  1 ? 22 
HELX_P HELX_P83  AJ2 PRO D 141  ? HIS D 168  ? PRO D 133  HIS D 160  1 ? 28 
HELX_P HELX_P84  AJ3 GLN D 174  ? VAL D 195  ? GLN D 166  VAL D 187  1 ? 22 
HELX_P HELX_P85  AJ4 GLU D 216  ? ARG D 224  ? GLU D 208  ARG D 216  1 ? 9  
HELX_P HELX_P86  AJ5 TYR D 238  ? LYS D 250  ? TYR D 230  LYS D 242  1 ? 13 
HELX_P HELX_P87  AJ6 LYS D 250  ? ILE D 258  ? LYS D 242  ILE D 250  1 ? 9  
HELX_P HELX_P88  AJ7 LYS D 260  ? MET D 265  ? LYS D 252  MET D 257  1 ? 6  
HELX_P HELX_P89  AJ8 THR D 269  ? ASP D 285  ? THR D 261  ASP D 277  1 ? 17 
HELX_P HELX_P90  AJ9 GLY D 291  ? GLY D 304  ? GLY D 283  GLY D 296  1 ? 14 
HELX_P HELX_P91  AK1 GLY D 304  ? GLY D 324  ? GLY D 296  GLY D 316  1 ? 21 
HELX_P HELX_P92  AK2 GLY D 324  ? LEU D 335  ? GLY D 316  LEU D 327  1 ? 12 
HELX_P HELX_P93  AK3 PHE D 359  ? SER D 411  ? PHE D 351  SER D 403  1 ? 53 
HELX_P HELX_P94  AK4 SER D 413  ? GLU D 419  ? SER D 405  GLU D 411  1 ? 7  
HELX_P HELX_P95  AK5 MET D 420  ? TRP D 438  ? MET D 412  TRP D 430  1 ? 19 
HELX_P HELX_P96  AK6 LEU D 442  ? LEU D 464  ? LEU D 434  LEU D 456  1 ? 23 
HELX_P HELX_P97  AK7 GLY D 465  ? LEU D 516  ? GLY D 457  LEU D 508  1 ? 52 
HELX_P HELX_P98  AK8 LYS D 518  ? GLU D 576  ? LYS D 510  GLU D 568  1 ? 59 
HELX_P HELX_P99  AK9 PRO D 581  ? LEU D 622  ? PRO D 573  LEU D 614  1 ? 42 
HELX_P HELX_P100 AL1 GLY D 726  ? LEU D 735  ? GLY D 718  LEU D 727  1 ? 10 
HELX_P HELX_P101 AL2 THR D 791  ? PHE D 798  ? THR D 783  PHE D 790  1 ? 8  
HELX_P HELX_P102 AL3 ASN D 803  ? CYS D 814  ? ASN D 795  CYS D 806  1 ? 12 
HELX_P HELX_P103 AL4 LEU D 816  ? ILE D 822  ? LEU D 808  ILE D 814  1 ? 7  
HELX_P HELX_P104 AL5 HIS D 825  ? THR D 829  ? HIS D 817  THR D 821  5 ? 5  
HELX_P HELX_P105 AL6 SER D 839  ? GLN D 855  ? SER D 831  GLN D 847  1 ? 17 
HELX_P HELX_P106 AL7 ASP D 869  ? LEU D 885  ? ASP D 861  LEU D 877  1 ? 17 
HELX_P HELX_P107 AL8 TYR D 901  ? ALA D 905  ? TYR D 893  ALA D 897  5 ? 5  
HELX_P HELX_P108 AL9 THR D 921  ? SER D 928  ? THR D 913  SER D 920  1 ? 8  
HELX_P HELX_P109 AM1 CYS D 930  ? TRP D 936  ? CYS D 922  TRP D 928  1 ? 7  
HELX_P HELX_P110 AM2 LYS D 1011 ? SER D 1015 ? LYS D 1003 SER D 1007 5 ? 5  
HELX_P HELX_P111 AM3 ILE D 1018 ? VAL D 1051 ? ILE D 1010 VAL D 1043 1 ? 34 
HELX_P HELX_P112 AM4 VAL D 1071 ? LEU D 1079 ? VAL D 1063 LEU D 1071 1 ? 9  
HELX_P HELX_P113 AM5 SER D 1081 ? THR D 1090 ? SER D 1073 THR D 1082 1 ? 10 
HELX_P HELX_P114 AM6 TRP D 1096 ? ILE D 1113 ? TRP D 1088 ILE D 1105 1 ? 18 
HELX_P HELX_P115 AM7 PRO D 1117 ? THR D 1123 ? PRO D 1109 THR D 1115 1 ? 7  
HELX_P HELX_P116 AM8 PRO D 1125 ? THR D 1169 ? PRO D 1117 THR D 1161 1 ? 45 
HELX_P HELX_P117 AM9 ALA D 1175 ? THR D 1204 ? ALA D 1167 THR D 1196 1 ? 30 
HELX_P HELX_P118 AN1 GLN D 1205 ? GLY D 1218 ? GLN D 1197 GLY D 1210 1 ? 14 
HELX_P HELX_P119 AN2 GLY D 1218 ? PHE D 1225 ? GLY D 1210 PHE D 1217 1 ? 8  
HELX_P HELX_P120 AN3 GLU D 1228 ? HIS D 1281 ? GLU D 1220 HIS D 1273 1 ? 54 
HELX_P HELX_P121 AN4 GLY D 1290 ? LEU D 1327 ? GLY D 1282 LEU D 1319 1 ? 38 
HELX_P HELX_P122 AN5 THR D 1389 ? ARG D 1402 ? THR D 1381 ARG D 1394 1 ? 14 
HELX_P HELX_P123 AN6 ALA D 1419 ? LEU D 1421 ? ALA D 1411 LEU D 1413 5 ? 3  
HELX_P HELX_P124 AN7 PRO D 1422 ? ARG D 1429 ? PRO D 1414 ARG D 1421 1 ? 8  
HELX_P HELX_P125 AN8 THR D 1443 ? LEU D 1448 ? THR D 1435 LEU D 1440 1 ? 6  
HELX_P HELX_P126 AN9 SER D 1455 ? ALA D 1466 ? SER D 1447 ALA D 1458 1 ? 12 
HELX_P HELX_P127 AO1 LEU D 1468 ? ALA D 1474 ? LEU D 1460 ALA D 1466 1 ? 7  
HELX_P HELX_P128 AO2 GLY D 1477 ? ALA D 1481 ? GLY D 1469 ALA D 1473 5 ? 5  
HELX_P HELX_P129 AO3 ILE D 1483 ? GLY D 1487 ? ILE D 1475 GLY D 1479 5 ? 5  
HELX_P HELX_P130 AO4 SER D 1491 ? LYS D 1507 ? SER D 1483 LYS D 1499 1 ? 17 
HELX_P HELX_P131 AO5 MET D 1522 ? ALA D 1537 ? MET D 1514 ALA D 1529 1 ? 16 
HELX_P HELX_P132 AO6 HIS D 1549 ? ALA D 1554 ? HIS D 1541 ALA D 1546 5 ? 6  
HELX_P HELX_P133 AO7 LYS D 1570 ? LYS D 1578 ? LYS D 1562 LYS D 1570 1 ? 9  
HELX_P HELX_P134 AO8 ASP D 1579 ? PHE D 1585 ? ASP D 1571 PHE D 1577 1 ? 7  
HELX_P HELX_P135 AO9 GLN E 52   ? ASP E 58   ? GLN E 52   ASP E 58   1 ? 7  
HELX_P HELX_P136 AP1 ASP E 58   ? LEU E 66   ? ASP E 58   LEU E 66   1 ? 9  
HELX_P HELX_P137 AP2 LYS E 67   ? GLY E 98   ? LYS E 67   GLY E 98   1 ? 32 
HELX_P HELX_P138 AP3 SER E 116  ? THR E 130  ? SER E 116  THR E 130  1 ? 15 
HELX_P HELX_P139 AP4 LEU E 144  ? ALA E 172  ? LEU E 144  ALA E 172  1 ? 29 
HELX_P HELX_P140 AP5 ALA E 174  ? THR E 180  ? ALA E 174  THR E 180  1 ? 7  
HELX_P HELX_P141 AP6 SER E 265  ? LEU E 270  ? SER E 265  LEU E 270  5 ? 6  
HELX_P HELX_P142 AP7 ALA E 271  ? GLN E 279  ? ALA E 271  GLN E 279  1 ? 9  
HELX_P HELX_P143 AP8 THR E 345  ? SER E 354  ? THR E 345  SER E 354  1 ? 10 
HELX_P HELX_P144 AP9 ASN F 18   ? ASP F 26   ? ASN F 10   ASP F 18   1 ? 9  
HELX_P HELX_P145 AQ1 ASP F 26   ? GLY F 33   ? ASP F 18   GLY F 25   1 ? 8  
HELX_P HELX_P146 AQ2 CYS F 34   ? ILE F 50   ? CYS F 26   ILE F 42   1 ? 17 
HELX_P HELX_P147 AQ3 ILE F 50   ? SER F 61   ? ILE F 42   SER F 53   1 ? 12 
HELX_P HELX_P148 AQ4 GLY F 78   ? VAL F 106  ? GLY F 70   VAL F 98   1 ? 29 
HELX_P HELX_P149 AQ5 TYR F 115  ? GLU F 136  ? TYR F 107  GLU F 128  1 ? 22 
HELX_P HELX_P150 AQ6 PRO F 141  ? HIS F 168  ? PRO F 133  HIS F 160  1 ? 28 
HELX_P HELX_P151 AQ7 GLN F 174  ? VAL F 195  ? GLN F 166  VAL F 187  1 ? 22 
HELX_P HELX_P152 AQ8 GLU F 216  ? ARG F 224  ? GLU F 208  ARG F 216  1 ? 9  
HELX_P HELX_P153 AQ9 TYR F 238  ? LYS F 250  ? TYR F 230  LYS F 242  1 ? 13 
HELX_P HELX_P154 AR1 LYS F 250  ? ILE F 258  ? LYS F 242  ILE F 250  1 ? 9  
HELX_P HELX_P155 AR2 LYS F 260  ? MET F 265  ? LYS F 252  MET F 257  1 ? 6  
HELX_P HELX_P156 AR3 THR F 269  ? ASP F 285  ? THR F 261  ASP F 277  1 ? 17 
HELX_P HELX_P157 AR4 GLY F 291  ? GLY F 304  ? GLY F 283  GLY F 296  1 ? 14 
HELX_P HELX_P158 AR5 GLY F 304  ? GLY F 324  ? GLY F 296  GLY F 316  1 ? 21 
HELX_P HELX_P159 AR6 GLY F 324  ? LEU F 335  ? GLY F 316  LEU F 327  1 ? 12 
HELX_P HELX_P160 AR7 PHE F 359  ? SER F 411  ? PHE F 351  SER F 403  1 ? 53 
HELX_P HELX_P161 AR8 SER F 413  ? GLU F 419  ? SER F 405  GLU F 411  1 ? 7  
HELX_P HELX_P162 AR9 MET F 420  ? TRP F 438  ? MET F 412  TRP F 430  1 ? 19 
HELX_P HELX_P163 AS1 LEU F 442  ? LEU F 464  ? LEU F 434  LEU F 456  1 ? 23 
HELX_P HELX_P164 AS2 GLY F 465  ? LEU F 516  ? GLY F 457  LEU F 508  1 ? 52 
HELX_P HELX_P165 AS3 LYS F 518  ? GLU F 576  ? LYS F 510  GLU F 568  1 ? 59 
HELX_P HELX_P166 AS4 PRO F 581  ? LEU F 622  ? PRO F 573  LEU F 614  1 ? 42 
HELX_P HELX_P167 AS5 GLY F 726  ? LEU F 735  ? GLY F 718  LEU F 727  1 ? 10 
HELX_P HELX_P168 AS6 THR F 791  ? PHE F 798  ? THR F 783  PHE F 790  1 ? 8  
HELX_P HELX_P169 AS7 ASN F 803  ? CYS F 814  ? ASN F 795  CYS F 806  1 ? 12 
HELX_P HELX_P170 AS8 LEU F 816  ? ILE F 822  ? LEU F 808  ILE F 814  1 ? 7  
HELX_P HELX_P171 AS9 HIS F 825  ? THR F 829  ? HIS F 817  THR F 821  5 ? 5  
HELX_P HELX_P172 AT1 SER F 839  ? GLN F 855  ? SER F 831  GLN F 847  1 ? 17 
HELX_P HELX_P173 AT2 ASP F 869  ? LEU F 885  ? ASP F 861  LEU F 877  1 ? 17 
HELX_P HELX_P174 AT3 TYR F 901  ? ALA F 905  ? TYR F 893  ALA F 897  5 ? 5  
HELX_P HELX_P175 AT4 THR F 921  ? SER F 928  ? THR F 913  SER F 920  1 ? 8  
HELX_P HELX_P176 AT5 CYS F 930  ? TRP F 936  ? CYS F 922  TRP F 928  1 ? 7  
HELX_P HELX_P177 AT6 LYS F 1011 ? SER F 1015 ? LYS F 1003 SER F 1007 5 ? 5  
HELX_P HELX_P178 AT7 ILE F 1018 ? VAL F 1051 ? ILE F 1010 VAL F 1043 1 ? 34 
HELX_P HELX_P179 AT8 VAL F 1071 ? LEU F 1079 ? VAL F 1063 LEU F 1071 1 ? 9  
HELX_P HELX_P180 AT9 SER F 1081 ? THR F 1090 ? SER F 1073 THR F 1082 1 ? 10 
HELX_P HELX_P181 AU1 TRP F 1096 ? ILE F 1113 ? TRP F 1088 ILE F 1105 1 ? 18 
HELX_P HELX_P182 AU2 PRO F 1117 ? THR F 1123 ? PRO F 1109 THR F 1115 1 ? 7  
HELX_P HELX_P183 AU3 PRO F 1125 ? THR F 1169 ? PRO F 1117 THR F 1161 1 ? 45 
HELX_P HELX_P184 AU4 ALA F 1175 ? THR F 1204 ? ALA F 1167 THR F 1196 1 ? 30 
HELX_P HELX_P185 AU5 GLN F 1205 ? GLY F 1218 ? GLN F 1197 GLY F 1210 1 ? 14 
HELX_P HELX_P186 AU6 GLY F 1218 ? PHE F 1225 ? GLY F 1210 PHE F 1217 1 ? 8  
HELX_P HELX_P187 AU7 GLU F 1228 ? HIS F 1281 ? GLU F 1220 HIS F 1273 1 ? 54 
HELX_P HELX_P188 AU8 GLY F 1290 ? LEU F 1327 ? GLY F 1282 LEU F 1319 1 ? 38 
HELX_P HELX_P189 AU9 THR F 1389 ? ARG F 1402 ? THR F 1381 ARG F 1394 1 ? 14 
HELX_P HELX_P190 AV1 ALA F 1419 ? LEU F 1421 ? ALA F 1411 LEU F 1413 5 ? 3  
HELX_P HELX_P191 AV2 PRO F 1422 ? ARG F 1429 ? PRO F 1414 ARG F 1421 1 ? 8  
HELX_P HELX_P192 AV3 THR F 1443 ? LEU F 1448 ? THR F 1435 LEU F 1440 1 ? 6  
HELX_P HELX_P193 AV4 SER F 1455 ? ALA F 1466 ? SER F 1447 ALA F 1458 1 ? 12 
HELX_P HELX_P194 AV5 LEU F 1468 ? ALA F 1474 ? LEU F 1460 ALA F 1466 1 ? 7  
HELX_P HELX_P195 AV6 GLY F 1477 ? ALA F 1481 ? GLY F 1469 ALA F 1473 5 ? 5  
HELX_P HELX_P196 AV7 ILE F 1483 ? GLY F 1487 ? ILE F 1475 GLY F 1479 5 ? 5  
HELX_P HELX_P197 AV8 SER F 1491 ? LYS F 1507 ? SER F 1483 LYS F 1499 1 ? 17 
HELX_P HELX_P198 AV9 MET F 1522 ? ALA F 1537 ? MET F 1514 ALA F 1529 1 ? 16 
HELX_P HELX_P199 AW1 HIS F 1549 ? ALA F 1554 ? HIS F 1541 ALA F 1546 5 ? 6  
HELX_P HELX_P200 AW2 LYS F 1570 ? LYS F 1578 ? LYS F 1562 LYS F 1570 1 ? 9  
HELX_P HELX_P201 AW3 ASP F 1579 ? PHE F 1585 ? ASP F 1571 PHE F 1577 1 ? 7  
HELX_P HELX_P202 AW4 GLN G 52   ? ASP G 58   ? GLN G 52   ASP G 58   1 ? 7  
HELX_P HELX_P203 AW5 ASP G 58   ? LEU G 66   ? ASP G 58   LEU G 66   1 ? 9  
HELX_P HELX_P204 AW6 LYS G 67   ? ILE G 93   ? LYS G 67   ILE G 93   1 ? 27 
HELX_P HELX_P205 AW7 SER G 116  ? THR G 130  ? SER G 116  THR G 130  1 ? 15 
HELX_P HELX_P206 AW8 LEU G 144  ? ALA G 172  ? LEU G 144  ALA G 172  1 ? 29 
HELX_P HELX_P207 AW9 ALA G 174  ? THR G 180  ? ALA G 174  THR G 180  1 ? 7  
HELX_P HELX_P208 AX1 SER G 265  ? LEU G 270  ? SER G 265  LEU G 270  5 ? 6  
HELX_P HELX_P209 AX2 ALA G 271  ? GLN G 279  ? ALA G 271  GLN G 279  1 ? 9  
HELX_P HELX_P210 AX3 THR G 345  ? SER G 354  ? THR G 345  SER G 354  1 ? 10 
HELX_P HELX_P211 AX4 ASN H 18   ? ASP H 26   ? ASN H 10   ASP H 18   1 ? 9  
HELX_P HELX_P212 AX5 ASP H 26   ? GLY H 33   ? ASP H 18   GLY H 25   1 ? 8  
HELX_P HELX_P213 AX6 CYS H 34   ? ILE H 50   ? CYS H 26   ILE H 42   1 ? 17 
HELX_P HELX_P214 AX7 ILE H 50   ? SER H 61   ? ILE H 42   SER H 53   1 ? 12 
HELX_P HELX_P215 AX8 GLY H 78   ? VAL H 106  ? GLY H 70   VAL H 98   1 ? 29 
HELX_P HELX_P216 AX9 TYR H 115  ? GLU H 136  ? TYR H 107  GLU H 128  1 ? 22 
HELX_P HELX_P217 AY1 PRO H 141  ? HIS H 168  ? PRO H 133  HIS H 160  1 ? 28 
HELX_P HELX_P218 AY2 GLN H 174  ? VAL H 195  ? GLN H 166  VAL H 187  1 ? 22 
HELX_P HELX_P219 AY3 GLU H 216  ? ARG H 224  ? GLU H 208  ARG H 216  1 ? 9  
HELX_P HELX_P220 AY4 TYR H 238  ? LYS H 250  ? TYR H 230  LYS H 242  1 ? 13 
HELX_P HELX_P221 AY5 LYS H 250  ? ILE H 258  ? LYS H 242  ILE H 250  1 ? 9  
HELX_P HELX_P222 AY6 LYS H 260  ? MET H 265  ? LYS H 252  MET H 257  1 ? 6  
HELX_P HELX_P223 AY7 THR H 269  ? ASP H 285  ? THR H 261  ASP H 277  1 ? 17 
HELX_P HELX_P224 AY8 GLY H 291  ? GLY H 304  ? GLY H 283  GLY H 296  1 ? 14 
HELX_P HELX_P225 AY9 GLY H 304  ? GLY H 324  ? GLY H 296  GLY H 316  1 ? 21 
HELX_P HELX_P226 AZ1 GLY H 324  ? LEU H 335  ? GLY H 316  LEU H 327  1 ? 12 
HELX_P HELX_P227 AZ2 PHE H 359  ? SER H 411  ? PHE H 351  SER H 403  1 ? 53 
HELX_P HELX_P228 AZ3 SER H 413  ? GLU H 419  ? SER H 405  GLU H 411  1 ? 7  
HELX_P HELX_P229 AZ4 MET H 420  ? TRP H 438  ? MET H 412  TRP H 430  1 ? 19 
HELX_P HELX_P230 AZ5 LEU H 442  ? LEU H 464  ? LEU H 434  LEU H 456  1 ? 23 
HELX_P HELX_P231 AZ6 GLY H 465  ? LEU H 516  ? GLY H 457  LEU H 508  1 ? 52 
HELX_P HELX_P232 AZ7 LYS H 518  ? GLU H 576  ? LYS H 510  GLU H 568  1 ? 59 
HELX_P HELX_P233 AZ8 PRO H 581  ? LEU H 622  ? PRO H 573  LEU H 614  1 ? 42 
HELX_P HELX_P234 AZ9 GLY H 726  ? LEU H 735  ? GLY H 718  LEU H 727  1 ? 10 
HELX_P HELX_P235 BA1 THR H 791  ? PHE H 798  ? THR H 783  PHE H 790  1 ? 8  
HELX_P HELX_P236 BA2 ASN H 803  ? CYS H 814  ? ASN H 795  CYS H 806  1 ? 12 
HELX_P HELX_P237 BA3 LEU H 816  ? ILE H 822  ? LEU H 808  ILE H 814  1 ? 7  
HELX_P HELX_P238 BA4 HIS H 825  ? THR H 829  ? HIS H 817  THR H 821  5 ? 5  
HELX_P HELX_P239 BA5 SER H 839  ? GLN H 855  ? SER H 831  GLN H 847  1 ? 17 
HELX_P HELX_P240 BA6 ASP H 869  ? LEU H 885  ? ASP H 861  LEU H 877  1 ? 17 
HELX_P HELX_P241 BA7 TYR H 901  ? ALA H 905  ? TYR H 893  ALA H 897  5 ? 5  
HELX_P HELX_P242 BA8 THR H 921  ? SER H 928  ? THR H 913  SER H 920  1 ? 8  
HELX_P HELX_P243 BA9 CYS H 930  ? TRP H 936  ? CYS H 922  TRP H 928  1 ? 7  
HELX_P HELX_P244 BB1 LYS H 1011 ? SER H 1015 ? LYS H 1003 SER H 1007 5 ? 5  
HELX_P HELX_P245 BB2 ILE H 1018 ? VAL H 1051 ? ILE H 1010 VAL H 1043 1 ? 34 
HELX_P HELX_P246 BB3 VAL H 1071 ? LEU H 1079 ? VAL H 1063 LEU H 1071 1 ? 9  
HELX_P HELX_P247 BB4 SER H 1081 ? THR H 1090 ? SER H 1073 THR H 1082 1 ? 10 
HELX_P HELX_P248 BB5 TRP H 1096 ? ILE H 1113 ? TRP H 1088 ILE H 1105 1 ? 18 
HELX_P HELX_P249 BB6 PRO H 1117 ? THR H 1123 ? PRO H 1109 THR H 1115 1 ? 7  
HELX_P HELX_P250 BB7 PRO H 1125 ? THR H 1169 ? PRO H 1117 THR H 1161 1 ? 45 
HELX_P HELX_P251 BB8 ALA H 1175 ? THR H 1204 ? ALA H 1167 THR H 1196 1 ? 30 
HELX_P HELX_P252 BB9 GLN H 1205 ? GLY H 1218 ? GLN H 1197 GLY H 1210 1 ? 14 
HELX_P HELX_P253 BC1 GLY H 1218 ? PHE H 1225 ? GLY H 1210 PHE H 1217 1 ? 8  
HELX_P HELX_P254 BC2 GLU H 1228 ? HIS H 1281 ? GLU H 1220 HIS H 1273 1 ? 54 
HELX_P HELX_P255 BC3 GLY H 1290 ? LEU H 1327 ? GLY H 1282 LEU H 1319 1 ? 38 
HELX_P HELX_P256 BC4 THR H 1389 ? ARG H 1402 ? THR H 1381 ARG H 1394 1 ? 14 
HELX_P HELX_P257 BC5 ALA H 1419 ? LEU H 1421 ? ALA H 1411 LEU H 1413 5 ? 3  
HELX_P HELX_P258 BC6 PRO H 1422 ? ARG H 1429 ? PRO H 1414 ARG H 1421 1 ? 8  
HELX_P HELX_P259 BC7 THR H 1443 ? LEU H 1448 ? THR H 1435 LEU H 1440 1 ? 6  
HELX_P HELX_P260 BC8 SER H 1455 ? ALA H 1466 ? SER H 1447 ALA H 1458 1 ? 12 
HELX_P HELX_P261 BC9 LEU H 1468 ? ALA H 1474 ? LEU H 1460 ALA H 1466 1 ? 7  
HELX_P HELX_P262 BD1 GLY H 1477 ? ALA H 1481 ? GLY H 1469 ALA H 1473 5 ? 5  
HELX_P HELX_P263 BD2 ILE H 1483 ? GLY H 1487 ? ILE H 1475 GLY H 1479 5 ? 5  
HELX_P HELX_P264 BD3 SER H 1491 ? LYS H 1507 ? SER H 1483 LYS H 1499 1 ? 17 
HELX_P HELX_P265 BD4 MET H 1522 ? ALA H 1537 ? MET H 1514 ALA H 1529 1 ? 16 
HELX_P HELX_P266 BD5 HIS H 1549 ? ALA H 1554 ? HIS H 1541 ALA H 1546 5 ? 6  
HELX_P HELX_P267 BD6 LYS H 1570 ? LYS H 1578 ? LYS H 1562 LYS H 1570 1 ? 9  
HELX_P HELX_P268 BD7 ASP H 1579 ? PHE H 1585 ? ASP H 1571 PHE H 1577 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 110 SG ? ? ? 1_555 A CYS 142 SG ? ? A CYS 110 A CYS 142 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? B CYS 14  SG ? ? ? 1_555 B CYS 34  SG ? ? B CYS 6   B CYS 26  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf3 disulf ? ? C CYS 110 SG ? ? ? 1_555 C CYS 142 SG ? ? C CYS 110 C CYS 142 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf4 disulf ? ? D CYS 14  SG ? ? ? 1_555 D CYS 34  SG ? ? D CYS 6   D CYS 26  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf5 disulf ? ? E CYS 110 SG ? ? ? 1_555 E CYS 142 SG ? ? E CYS 110 E CYS 142 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf6 disulf ? ? F CYS 14  SG ? ? ? 1_555 F CYS 34  SG ? ? F CYS 6   F CYS 26  1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf7 disulf ? ? G CYS 110 SG ? ? ? 1_555 G CYS 142 SG ? ? G CYS 110 G CYS 142 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf8 disulf ? ? H CYS 14  SG ? ? ? 1_555 H CYS 34  SG ? ? H CYS 6   H CYS 26  1_555 ? ? ? ? ? ? ? 2.036 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 3 ? 
AA6 ? 2 ? 
AA7 ? 3 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 6 ? 
AB2 ? 4 ? 
AB3 ? 6 ? 
AB4 ? 3 ? 
AB5 ? 3 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
AB8 ? 3 ? 
AB9 ? 2 ? 
AC1 ? 2 ? 
AC2 ? 2 ? 
AC3 ? 6 ? 
AC4 ? 4 ? 
AC5 ? 6 ? 
AC6 ? 3 ? 
AC7 ? 3 ? 
AC8 ? 4 ? 
AC9 ? 4 ? 
AD1 ? 3 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
AD4 ? 2 ? 
AD5 ? 6 ? 
AD6 ? 4 ? 
AD7 ? 6 ? 
AD8 ? 3 ? 
AD9 ? 4 ? 
AE1 ? 4 ? 
AE2 ? 3 ? 
AE3 ? 2 ? 
AE4 ? 2 ? 
AE5 ? 2 ? 
AE6 ? 6 ? 
AE7 ? 4 ? 
AE8 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? parallel      
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? parallel      
AB1 3 4 ? parallel      
AB1 4 5 ? parallel      
AB1 5 6 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
AB3 5 6 ? anti-parallel 
AB4 1 2 ? parallel      
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? parallel      
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? parallel      
AC3 2 3 ? parallel      
AC3 3 4 ? parallel      
AC3 4 5 ? parallel      
AC3 5 6 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC5 1 2 ? parallel      
AC5 2 3 ? parallel      
AC5 3 4 ? parallel      
AC5 4 5 ? parallel      
AC5 5 6 ? anti-parallel 
AC6 1 2 ? parallel      
AC6 2 3 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? parallel      
AD5 2 3 ? parallel      
AD5 3 4 ? parallel      
AD5 4 5 ? parallel      
AD5 5 6 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? parallel      
AD7 2 3 ? parallel      
AD7 3 4 ? parallel      
AD7 4 5 ? parallel      
AD7 5 6 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? parallel      
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE6 1 2 ? parallel      
AE6 2 3 ? parallel      
AE6 3 4 ? parallel      
AE6 4 5 ? parallel      
AE6 5 6 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE8 1 2 ? parallel      
AE8 2 3 ? parallel      
AE8 3 4 ? parallel      
AE8 4 5 ? parallel      
AE8 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ALA A 45   ? LYS A 47   ? ALA A 45   LYS A 47   
AA1 2 TYR C 326  ? ASP C 329  ? TYR C 326  ASP C 329  
AA1 3 VAL C 319  ? GLU C 321  ? VAL C 319  GLU C 321  
AA2 1 LEU A 181  ? PHE A 183  ? LEU A 181  PHE A 183  
AA2 2 ARG A 195  ? ASP A 204  ? ARG A 195  ASP A 204  
AA2 3 LEU A 255  ? VAL A 260  ? LEU A 255  VAL A 260  
AA3 1 LEU A 181  ? PHE A 183  ? LEU A 181  PHE A 183  
AA3 2 ARG A 195  ? ASP A 204  ? ARG A 195  ASP A 204  
AA3 3 ALA A 187  ? ARG A 192  ? ALA A 187  ARG A 192  
AA3 4 ILE A 309  ? TRP A 311  ? ILE A 309  TRP A 311  
AA4 1 ILE A 210  ? ILE A 211  ? ILE A 210  ILE A 211  
AA4 2 GLU A 282  ? VAL A 291  ? GLU A 282  VAL A 291  
AA4 3 ILE A 215  ? ARG A 221  ? ILE A 215  ARG A 221  
AA4 4 HIS A 234  ? ASP A 237  ? HIS A 234  ASP A 237  
AA5 1 ILE A 210  ? ILE A 211  ? ILE A 210  ILE A 211  
AA5 2 GLU A 282  ? VAL A 291  ? GLU A 282  VAL A 291  
AA5 3 THR A 297  ? LEU A 305  ? THR A 297  LEU A 305  
AA6 1 GLN A 313  ? PHE A 315  ? GLN A 313  PHE A 315  
AA6 2 THR A 336  ? LYS A 338  ? THR A 336  LYS A 338  
AA7 1 VAL A 319  ? GLU A 321  ? VAL A 319  GLU A 321  
AA7 2 TYR A 326  ? ASP A 329  ? TYR A 326  ASP A 329  
AA7 3 ALA G 45   ? LYS G 47   ? ALA G 45   LYS G 47   
AA8 1 GLN B 688  ? ILE B 689  ? GLN B 680  ILE B 681  
AA8 2 VAL B 745  ? PHE B 746  ? VAL B 737  PHE B 738  
AA9 1 GLY B 692  ? PHE B 694  ? GLY B 684  PHE B 686  
AA9 2 LEU B 704  ? ILE B 707  ? LEU B 696  ILE B 699  
AB1 1 ALA B 779  ? ALA B 781  ? ALA B 771  ALA B 773  
AB1 2 VAL B 858  ? ASP B 862  ? VAL B 850  ASP B 854  
AB1 3 THR B 891  ? VAL B 895  ? THR B 883  VAL B 887  
AB1 4 LEU B 716  ? VAL B 720  ? LEU B 708  VAL B 712  
AB1 5 TRP B 907  ? LYS B 912  ? TRP B 899  LYS B 904  
AB1 6 THR B 915  ? GLY B 920  ? THR B 907  GLY B 912  
AB2 1 LEU B 1370 ? ILE B 1377 ? LEU B 1362 ILE B 1369 
AB2 2 ILE B 1353 ? VAL B 1360 ? ILE B 1345 VAL B 1352 
AB2 3 GLU B 1408 ? ILE B 1413 ? GLU B 1400 ILE B 1405 
AB2 4 ILE B 1416 ? ASP B 1417 ? ILE B 1408 ASP B 1409 
AB3 1 SER B 1431 ? ILE B 1433 ? SER B 1423 ILE B 1425 
AB3 2 ILE B 1510 ? ASP B 1514 ? ILE B 1502 ASP B 1506 
AB3 3 THR B 1540 ? ILE B 1544 ? THR B 1532 ILE B 1536 
AB3 4 LYS B 1382 ? CYS B 1386 ? LYS B 1374 CYS B 1378 
AB3 5 LEU B 1556 ? LYS B 1561 ? LEU B 1548 LYS B 1553 
AB3 6 ALA B 1564 ? ASP B 1569 ? ALA B 1556 ASP B 1561 
AB4 1 ALA C 45   ? LYS C 47   ? ALA C 45   LYS C 47   
AB4 2 TYR E 326  ? ASP E 329  ? TYR E 326  ASP E 329  
AB4 3 VAL E 319  ? GLU E 321  ? VAL E 319  GLU E 321  
AB5 1 LEU C 181  ? PHE C 183  ? LEU C 181  PHE C 183  
AB5 2 ARG C 195  ? ASP C 204  ? ARG C 195  ASP C 204  
AB5 3 LEU C 255  ? VAL C 260  ? LEU C 255  VAL C 260  
AB6 1 LEU C 181  ? PHE C 183  ? LEU C 181  PHE C 183  
AB6 2 ARG C 195  ? ASP C 204  ? ARG C 195  ASP C 204  
AB6 3 ALA C 187  ? ARG C 192  ? ALA C 187  ARG C 192  
AB6 4 ILE C 309  ? TRP C 311  ? ILE C 309  TRP C 311  
AB7 1 ILE C 210  ? ILE C 211  ? ILE C 210  ILE C 211  
AB7 2 GLU C 282  ? VAL C 291  ? GLU C 282  VAL C 291  
AB7 3 ILE C 215  ? ARG C 221  ? ILE C 215  ARG C 221  
AB7 4 HIS C 234  ? ASP C 237  ? HIS C 234  ASP C 237  
AB8 1 ILE C 210  ? ILE C 211  ? ILE C 210  ILE C 211  
AB8 2 GLU C 282  ? VAL C 291  ? GLU C 282  VAL C 291  
AB8 3 THR C 297  ? LEU C 305  ? THR C 297  LEU C 305  
AB9 1 GLN C 313  ? PHE C 315  ? GLN C 313  PHE C 315  
AB9 2 THR C 336  ? LYS C 338  ? THR C 336  LYS C 338  
AC1 1 GLN D 688  ? ILE D 689  ? GLN D 680  ILE D 681  
AC1 2 VAL D 745  ? PHE D 746  ? VAL D 737  PHE D 738  
AC2 1 GLY D 692  ? PHE D 694  ? GLY D 684  PHE D 686  
AC2 2 LEU D 704  ? ILE D 707  ? LEU D 696  ILE D 699  
AC3 1 ALA D 779  ? ALA D 781  ? ALA D 771  ALA D 773  
AC3 2 VAL D 858  ? ASP D 862  ? VAL D 850  ASP D 854  
AC3 3 THR D 891  ? VAL D 895  ? THR D 883  VAL D 887  
AC3 4 LEU D 716  ? VAL D 720  ? LEU D 708  VAL D 712  
AC3 5 TRP D 907  ? LYS D 912  ? TRP D 899  LYS D 904  
AC3 6 THR D 915  ? GLY D 920  ? THR D 907  GLY D 912  
AC4 1 LEU D 1370 ? ILE D 1377 ? LEU D 1362 ILE D 1369 
AC4 2 ILE D 1353 ? VAL D 1360 ? ILE D 1345 VAL D 1352 
AC4 3 GLU D 1408 ? ILE D 1413 ? GLU D 1400 ILE D 1405 
AC4 4 ILE D 1416 ? ASP D 1417 ? ILE D 1408 ASP D 1409 
AC5 1 SER D 1431 ? ILE D 1433 ? SER D 1423 ILE D 1425 
AC5 2 ILE D 1510 ? ASP D 1514 ? ILE D 1502 ASP D 1506 
AC5 3 THR D 1540 ? ILE D 1544 ? THR D 1532 ILE D 1536 
AC5 4 LYS D 1382 ? CYS D 1386 ? LYS D 1374 CYS D 1378 
AC5 5 LEU D 1556 ? LYS D 1561 ? LEU D 1548 LYS D 1553 
AC5 6 ALA D 1564 ? ASP D 1569 ? ALA D 1556 ASP D 1561 
AC6 1 ALA E 45   ? LYS E 47   ? ALA E 45   LYS E 47   
AC6 2 TYR G 326  ? ASP G 329  ? TYR G 326  ASP G 329  
AC6 3 VAL G 319  ? GLU G 321  ? VAL G 319  GLU G 321  
AC7 1 LEU E 181  ? PHE E 183  ? LEU E 181  PHE E 183  
AC7 2 ARG E 195  ? ASP E 204  ? ARG E 195  ASP E 204  
AC7 3 LEU E 255  ? VAL E 260  ? LEU E 255  VAL E 260  
AC8 1 LEU E 181  ? PHE E 183  ? LEU E 181  PHE E 183  
AC8 2 ARG E 195  ? ASP E 204  ? ARG E 195  ASP E 204  
AC8 3 ALA E 187  ? ARG E 192  ? ALA E 187  ARG E 192  
AC8 4 ILE E 309  ? TRP E 311  ? ILE E 309  TRP E 311  
AC9 1 ILE E 210  ? ILE E 211  ? ILE E 210  ILE E 211  
AC9 2 GLU E 282  ? VAL E 291  ? GLU E 282  VAL E 291  
AC9 3 ILE E 215  ? ARG E 221  ? ILE E 215  ARG E 221  
AC9 4 HIS E 234  ? ASP E 237  ? HIS E 234  ASP E 237  
AD1 1 ILE E 210  ? ILE E 211  ? ILE E 210  ILE E 211  
AD1 2 GLU E 282  ? VAL E 291  ? GLU E 282  VAL E 291  
AD1 3 THR E 297  ? LEU E 305  ? THR E 297  LEU E 305  
AD2 1 GLN E 313  ? PHE E 315  ? GLN E 313  PHE E 315  
AD2 2 THR E 336  ? LYS E 338  ? THR E 336  LYS E 338  
AD3 1 GLN F 688  ? ILE F 689  ? GLN F 680  ILE F 681  
AD3 2 VAL F 745  ? PHE F 746  ? VAL F 737  PHE F 738  
AD4 1 GLY F 692  ? PHE F 694  ? GLY F 684  PHE F 686  
AD4 2 LEU F 704  ? ILE F 707  ? LEU F 696  ILE F 699  
AD5 1 ALA F 779  ? ALA F 781  ? ALA F 771  ALA F 773  
AD5 2 VAL F 858  ? ASP F 862  ? VAL F 850  ASP F 854  
AD5 3 THR F 891  ? VAL F 895  ? THR F 883  VAL F 887  
AD5 4 LEU F 716  ? VAL F 720  ? LEU F 708  VAL F 712  
AD5 5 TRP F 907  ? LYS F 912  ? TRP F 899  LYS F 904  
AD5 6 THR F 915  ? GLY F 920  ? THR F 907  GLY F 912  
AD6 1 LEU F 1370 ? ILE F 1377 ? LEU F 1362 ILE F 1369 
AD6 2 ILE F 1353 ? VAL F 1360 ? ILE F 1345 VAL F 1352 
AD6 3 GLU F 1408 ? ILE F 1413 ? GLU F 1400 ILE F 1405 
AD6 4 ILE F 1416 ? ASP F 1417 ? ILE F 1408 ASP F 1409 
AD7 1 SER F 1431 ? ILE F 1433 ? SER F 1423 ILE F 1425 
AD7 2 ILE F 1510 ? ASP F 1514 ? ILE F 1502 ASP F 1506 
AD7 3 THR F 1540 ? ILE F 1544 ? THR F 1532 ILE F 1536 
AD7 4 LYS F 1382 ? CYS F 1386 ? LYS F 1374 CYS F 1378 
AD7 5 LEU F 1556 ? LYS F 1561 ? LEU F 1548 LYS F 1553 
AD7 6 ALA F 1564 ? ASP F 1569 ? ALA F 1556 ASP F 1561 
AD8 1 LEU G 181  ? PHE G 183  ? LEU G 181  PHE G 183  
AD8 2 ARG G 195  ? ASP G 204  ? ARG G 195  ASP G 204  
AD8 3 LEU G 255  ? VAL G 260  ? LEU G 255  VAL G 260  
AD9 1 LEU G 181  ? PHE G 183  ? LEU G 181  PHE G 183  
AD9 2 ARG G 195  ? ASP G 204  ? ARG G 195  ASP G 204  
AD9 3 ALA G 187  ? ARG G 192  ? ALA G 187  ARG G 192  
AD9 4 ILE G 309  ? TRP G 311  ? ILE G 309  TRP G 311  
AE1 1 ILE G 210  ? ILE G 211  ? ILE G 210  ILE G 211  
AE1 2 GLU G 282  ? VAL G 291  ? GLU G 282  VAL G 291  
AE1 3 ILE G 215  ? ARG G 221  ? ILE G 215  ARG G 221  
AE1 4 HIS G 234  ? ASP G 237  ? HIS G 234  ASP G 237  
AE2 1 ILE G 210  ? ILE G 211  ? ILE G 210  ILE G 211  
AE2 2 GLU G 282  ? VAL G 291  ? GLU G 282  VAL G 291  
AE2 3 THR G 297  ? LEU G 305  ? THR G 297  LEU G 305  
AE3 1 GLN G 313  ? PHE G 315  ? GLN G 313  PHE G 315  
AE3 2 THR G 336  ? LYS G 338  ? THR G 336  LYS G 338  
AE4 1 GLN H 688  ? ILE H 689  ? GLN H 680  ILE H 681  
AE4 2 VAL H 745  ? PHE H 746  ? VAL H 737  PHE H 738  
AE5 1 GLY H 692  ? PHE H 694  ? GLY H 684  PHE H 686  
AE5 2 LEU H 704  ? ILE H 707  ? LEU H 696  ILE H 699  
AE6 1 ALA H 779  ? ALA H 781  ? ALA H 771  ALA H 773  
AE6 2 VAL H 858  ? ASP H 862  ? VAL H 850  ASP H 854  
AE6 3 THR H 891  ? VAL H 895  ? THR H 883  VAL H 887  
AE6 4 LEU H 716  ? VAL H 720  ? LEU H 708  VAL H 712  
AE6 5 TRP H 907  ? LYS H 912  ? TRP H 899  LYS H 904  
AE6 6 THR H 915  ? GLY H 920  ? THR H 907  GLY H 912  
AE7 1 LEU H 1370 ? ILE H 1377 ? LEU H 1362 ILE H 1369 
AE7 2 ILE H 1353 ? VAL H 1360 ? ILE H 1345 VAL H 1352 
AE7 3 GLU H 1408 ? ILE H 1413 ? GLU H 1400 ILE H 1405 
AE7 4 ILE H 1416 ? ASP H 1417 ? ILE H 1408 ASP H 1409 
AE8 1 SER H 1431 ? ILE H 1433 ? SER H 1423 ILE H 1425 
AE8 2 ILE H 1510 ? ASP H 1514 ? ILE H 1502 ASP H 1506 
AE8 3 THR H 1540 ? ILE H 1544 ? THR H 1532 ILE H 1536 
AE8 4 LYS H 1382 ? CYS H 1386 ? LYS H 1374 CYS H 1378 
AE8 5 LEU H 1556 ? LYS H 1561 ? LEU H 1548 LYS H 1553 
AE8 6 ALA H 1564 ? ASP H 1569 ? ALA H 1556 ASP H 1561 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 45   ? N ALA A 45   O VAL C 328  ? O VAL C 328  
AA1 2 3 O SER C 327  ? O SER C 327  N ALA C 320  ? N ALA C 320  
AA2 1 2 N ILE A 182  ? N ILE A 182  O GLY A 203  ? O GLY A 203  
AA2 2 3 N LEU A 200  ? N LEU A 200  O ILE A 257  ? O ILE A 257  
AA3 1 2 N ILE A 182  ? N ILE A 182  O GLY A 203  ? O GLY A 203  
AA3 2 3 O MET A 199  ? O MET A 199  N VAL A 188  ? N VAL A 188  
AA3 3 4 N ALA A 187  ? N ALA A 187  O LEU A 310  ? O LEU A 310  
AA4 1 2 N ILE A 211  ? N ILE A 211  O VAL A 290  ? O VAL A 290  
AA4 2 3 O ILE A 286  ? O ILE A 286  N HIS A 216  ? N HIS A 216  
AA4 3 4 N VAL A 219  ? N VAL A 219  O VAL A 236  ? O VAL A 236  
AA5 1 2 N ILE A 211  ? N ILE A 211  O VAL A 290  ? O VAL A 290  
AA5 2 3 N VAL A 285  ? N VAL A 285  O THR A 302  ? O THR A 302  
AA6 1 2 N ARG A 314  ? N ARG A 314  O VAL A 337  ? O VAL A 337  
AA7 1 2 N ALA A 320  ? N ALA A 320  O SER A 327  ? O SER A 327  
AA7 2 3 N VAL A 328  ? N VAL A 328  O ALA G 45   ? O ALA G 45   
AA8 1 2 N GLN B 688  ? N GLN B 680  O PHE B 746  ? O PHE B 738  
AA9 1 2 N PHE B 694  ? N PHE B 686  O LEU B 704  ? O LEU B 696  
AB1 1 2 N ALA B 781  ? N ALA B 773  O PHE B 860  ? O PHE B 852  
AB1 2 3 N VAL B 859  ? N VAL B 851  O VAL B 893  ? O VAL B 885  
AB1 3 4 O LEU B 894  ? O LEU B 886  N THR B 717  ? N THR B 709  
AB1 4 5 N LEU B 716  ? N LEU B 708  O TRP B 907  ? O TRP B 899  
AB1 5 6 N ALA B 910  ? N ALA B 902  O ARG B 918  ? O ARG B 910  
AB2 1 2 O ILE B 1377 ? O ILE B 1369 N ILE B 1353 ? N ILE B 1345 
AB2 2 3 N SER B 1359 ? N SER B 1351 O GLU B 1408 ? O GLU B 1400 
AB2 3 4 N ILE B 1413 ? N ILE B 1405 O ILE B 1416 ? O ILE B 1408 
AB3 1 2 N ILE B 1433 ? N ILE B 1425 O ILE B 1512 ? O ILE B 1504 
AB3 2 3 N PHE B 1511 ? N PHE B 1503 O THR B 1540 ? O THR B 1532 
AB3 3 4 O THR B 1543 ? O THR B 1535 N ILE B 1385 ? N ILE B 1377 
AB3 4 5 N CYS B 1386 ? N CYS B 1378 O MET B 1558 ? O MET B 1550 
AB3 5 6 N VAL B 1557 ? N VAL B 1549 O ASP B 1569 ? O ASP B 1561 
AB4 1 2 N ALA C 45   ? N ALA C 45   O VAL E 328  ? O VAL E 328  
AB4 2 3 O SER E 327  ? O SER E 327  N ALA E 320  ? N ALA E 320  
AB5 1 2 N ILE C 182  ? N ILE C 182  O GLY C 203  ? O GLY C 203  
AB5 2 3 N LEU C 200  ? N LEU C 200  O ILE C 257  ? O ILE C 257  
AB6 1 2 N ILE C 182  ? N ILE C 182  O GLY C 203  ? O GLY C 203  
AB6 2 3 O MET C 199  ? O MET C 199  N VAL C 188  ? N VAL C 188  
AB6 3 4 N ALA C 187  ? N ALA C 187  O LEU C 310  ? O LEU C 310  
AB7 1 2 N ILE C 211  ? N ILE C 211  O VAL C 290  ? O VAL C 290  
AB7 2 3 O ILE C 286  ? O ILE C 286  N HIS C 216  ? N HIS C 216  
AB7 3 4 N VAL C 219  ? N VAL C 219  O VAL C 236  ? O VAL C 236  
AB8 1 2 N ILE C 211  ? N ILE C 211  O VAL C 290  ? O VAL C 290  
AB8 2 3 N VAL C 285  ? N VAL C 285  O THR C 302  ? O THR C 302  
AB9 1 2 N ARG C 314  ? N ARG C 314  O VAL C 337  ? O VAL C 337  
AC1 1 2 N GLN D 688  ? N GLN D 680  O PHE D 746  ? O PHE D 738  
AC2 1 2 N PHE D 694  ? N PHE D 686  O LEU D 704  ? O LEU D 696  
AC3 1 2 N ALA D 781  ? N ALA D 773  O PHE D 860  ? O PHE D 852  
AC3 2 3 N VAL D 859  ? N VAL D 851  O VAL D 893  ? O VAL D 885  
AC3 3 4 O LEU D 894  ? O LEU D 886  N THR D 717  ? N THR D 709  
AC3 4 5 N LEU D 716  ? N LEU D 708  O TRP D 907  ? O TRP D 899  
AC3 5 6 N ALA D 910  ? N ALA D 902  O ARG D 918  ? O ARG D 910  
AC4 1 2 O ILE D 1377 ? O ILE D 1369 N ILE D 1353 ? N ILE D 1345 
AC4 2 3 N SER D 1359 ? N SER D 1351 O GLU D 1408 ? O GLU D 1400 
AC4 3 4 N ILE D 1413 ? N ILE D 1405 O ILE D 1416 ? O ILE D 1408 
AC5 1 2 N ILE D 1433 ? N ILE D 1425 O ILE D 1512 ? O ILE D 1504 
AC5 2 3 N PHE D 1511 ? N PHE D 1503 O THR D 1540 ? O THR D 1532 
AC5 3 4 O THR D 1543 ? O THR D 1535 N ILE D 1385 ? N ILE D 1377 
AC5 4 5 N CYS D 1386 ? N CYS D 1378 O MET D 1558 ? O MET D 1550 
AC5 5 6 N VAL D 1557 ? N VAL D 1549 O ASP D 1569 ? O ASP D 1561 
AC6 1 2 N ALA E 45   ? N ALA E 45   O VAL G 328  ? O VAL G 328  
AC6 2 3 O SER G 327  ? O SER G 327  N ALA G 320  ? N ALA G 320  
AC7 1 2 N ILE E 182  ? N ILE E 182  O GLY E 203  ? O GLY E 203  
AC7 2 3 N LEU E 200  ? N LEU E 200  O ILE E 257  ? O ILE E 257  
AC8 1 2 N ILE E 182  ? N ILE E 182  O GLY E 203  ? O GLY E 203  
AC8 2 3 O MET E 199  ? O MET E 199  N VAL E 188  ? N VAL E 188  
AC8 3 4 N ALA E 187  ? N ALA E 187  O LEU E 310  ? O LEU E 310  
AC9 1 2 N ILE E 211  ? N ILE E 211  O VAL E 290  ? O VAL E 290  
AC9 2 3 O ILE E 286  ? O ILE E 286  N HIS E 216  ? N HIS E 216  
AC9 3 4 N VAL E 219  ? N VAL E 219  O VAL E 236  ? O VAL E 236  
AD1 1 2 N ILE E 211  ? N ILE E 211  O VAL E 290  ? O VAL E 290  
AD1 2 3 N VAL E 285  ? N VAL E 285  O THR E 302  ? O THR E 302  
AD2 1 2 N ARG E 314  ? N ARG E 314  O VAL E 337  ? O VAL E 337  
AD3 1 2 N GLN F 688  ? N GLN F 680  O PHE F 746  ? O PHE F 738  
AD4 1 2 N PHE F 694  ? N PHE F 686  O LEU F 704  ? O LEU F 696  
AD5 1 2 N ALA F 781  ? N ALA F 773  O PHE F 860  ? O PHE F 852  
AD5 2 3 N VAL F 859  ? N VAL F 851  O VAL F 893  ? O VAL F 885  
AD5 3 4 O LEU F 894  ? O LEU F 886  N THR F 717  ? N THR F 709  
AD5 4 5 N LEU F 716  ? N LEU F 708  O TRP F 907  ? O TRP F 899  
AD5 5 6 N ALA F 910  ? N ALA F 902  O ARG F 918  ? O ARG F 910  
AD6 1 2 O ILE F 1377 ? O ILE F 1369 N ILE F 1353 ? N ILE F 1345 
AD6 2 3 N SER F 1359 ? N SER F 1351 O GLU F 1408 ? O GLU F 1400 
AD6 3 4 N ILE F 1413 ? N ILE F 1405 O ILE F 1416 ? O ILE F 1408 
AD7 1 2 N ILE F 1433 ? N ILE F 1425 O ILE F 1512 ? O ILE F 1504 
AD7 2 3 N PHE F 1511 ? N PHE F 1503 O THR F 1540 ? O THR F 1532 
AD7 3 4 O THR F 1543 ? O THR F 1535 N ILE F 1385 ? N ILE F 1377 
AD7 4 5 N CYS F 1386 ? N CYS F 1378 O MET F 1558 ? O MET F 1550 
AD7 5 6 N VAL F 1557 ? N VAL F 1549 O ASP F 1569 ? O ASP F 1561 
AD8 1 2 N ILE G 182  ? N ILE G 182  O GLY G 203  ? O GLY G 203  
AD8 2 3 N LEU G 200  ? N LEU G 200  O ILE G 257  ? O ILE G 257  
AD9 1 2 N ILE G 182  ? N ILE G 182  O GLY G 203  ? O GLY G 203  
AD9 2 3 O MET G 199  ? O MET G 199  N VAL G 188  ? N VAL G 188  
AD9 3 4 N ALA G 187  ? N ALA G 187  O LEU G 310  ? O LEU G 310  
AE1 1 2 N ILE G 211  ? N ILE G 211  O VAL G 290  ? O VAL G 290  
AE1 2 3 O ILE G 286  ? O ILE G 286  N HIS G 216  ? N HIS G 216  
AE1 3 4 N VAL G 219  ? N VAL G 219  O VAL G 236  ? O VAL G 236  
AE2 1 2 N ILE G 211  ? N ILE G 211  O VAL G 290  ? O VAL G 290  
AE2 2 3 N VAL G 285  ? N VAL G 285  O THR G 302  ? O THR G 302  
AE3 1 2 N ARG G 314  ? N ARG G 314  O VAL G 337  ? O VAL G 337  
AE4 1 2 N GLN H 688  ? N GLN H 680  O PHE H 746  ? O PHE H 738  
AE5 1 2 N PHE H 694  ? N PHE H 686  O LEU H 704  ? O LEU H 696  
AE6 1 2 N ALA H 781  ? N ALA H 773  O PHE H 860  ? O PHE H 852  
AE6 2 3 N VAL H 859  ? N VAL H 851  O VAL H 893  ? O VAL H 885  
AE6 3 4 O LEU H 894  ? O LEU H 886  N THR H 717  ? N THR H 709  
AE6 4 5 N LEU H 716  ? N LEU H 708  O TRP H 907  ? O TRP H 899  
AE6 5 6 N ALA H 910  ? N ALA H 902  O ARG H 918  ? O ARG H 910  
AE7 1 2 O ILE H 1377 ? O ILE H 1369 N ILE H 1353 ? N ILE H 1345 
AE7 2 3 N SER H 1359 ? N SER H 1351 O GLU H 1408 ? O GLU H 1400 
AE7 3 4 N ILE H 1413 ? N ILE H 1405 O ILE H 1416 ? O ILE H 1408 
AE8 1 2 N ILE H 1433 ? N ILE H 1425 O ILE H 1512 ? O ILE H 1504 
AE8 2 3 N PHE H 1511 ? N PHE H 1503 O THR H 1540 ? O THR H 1532 
AE8 3 4 O THR H 1543 ? O THR H 1535 N ILE H 1385 ? N ILE H 1377 
AE8 4 5 N CYS H 1386 ? N CYS H 1378 O MET H 1558 ? O MET H 1550 
AE8 5 6 N VAL H 1557 ? N VAL H 1549 O ASP H 1569 ? O ASP H 1561 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ATP 401 ? 9 'binding site for residue ATP A 401' 
AC2 Software C ATP 401 ? 9 'binding site for residue ATP C 401' 
AC3 Software E ATP 401 ? 9 'binding site for residue ATP E 401' 
AC4 Software G ATP 401 ? 9 'binding site for residue ATP G 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 ASN A 48  ? ASN A 48  . ? 1_555 ? 
2  AC1 9 ILE A 49  ? ILE A 49  . ? 1_555 ? 
3  AC1 9 ARG A 50  ? ARG A 50  . ? 1_555 ? 
4  AC1 9 ILE C 182 ? ILE C 182 . ? 1_555 ? 
5  AC1 9 PHE C 183 ? PHE C 183 . ? 1_555 ? 
6  AC1 9 LYS C 185 ? LYS C 185 . ? 1_555 ? 
7  AC1 9 LEU C 205 ? LEU C 205 . ? 1_555 ? 
8  AC1 9 PHE C 333 ? PHE C 333 . ? 1_555 ? 
9  AC1 9 GLY C 334 ? GLY C 334 . ? 1_555 ? 
10 AC2 9 ASN C 48  ? ASN C 48  . ? 1_555 ? 
11 AC2 9 ILE C 49  ? ILE C 49  . ? 1_555 ? 
12 AC2 9 ARG C 50  ? ARG C 50  . ? 1_555 ? 
13 AC2 9 ILE E 182 ? ILE E 182 . ? 1_555 ? 
14 AC2 9 PHE E 183 ? PHE E 183 . ? 1_555 ? 
15 AC2 9 LYS E 185 ? LYS E 185 . ? 1_555 ? 
16 AC2 9 LEU E 205 ? LEU E 205 . ? 1_555 ? 
17 AC2 9 PHE E 333 ? PHE E 333 . ? 1_555 ? 
18 AC2 9 GLY E 334 ? GLY E 334 . ? 1_555 ? 
19 AC3 9 ASN E 48  ? ASN E 48  . ? 1_555 ? 
20 AC3 9 ILE E 49  ? ILE E 49  . ? 1_555 ? 
21 AC3 9 ARG E 50  ? ARG E 50  . ? 1_555 ? 
22 AC3 9 ILE G 182 ? ILE G 182 . ? 1_555 ? 
23 AC3 9 PHE G 183 ? PHE G 183 . ? 1_555 ? 
24 AC3 9 LYS G 185 ? LYS G 185 . ? 1_555 ? 
25 AC3 9 LEU G 205 ? LEU G 205 . ? 1_555 ? 
26 AC3 9 PHE G 333 ? PHE G 333 . ? 1_555 ? 
27 AC3 9 GLY G 334 ? GLY G 334 . ? 1_555 ? 
28 AC4 9 ILE A 182 ? ILE A 182 . ? 1_555 ? 
29 AC4 9 PHE A 183 ? PHE A 183 . ? 1_555 ? 
30 AC4 9 LYS A 185 ? LYS A 185 . ? 1_555 ? 
31 AC4 9 LEU A 205 ? LEU A 205 . ? 1_555 ? 
32 AC4 9 PHE A 333 ? PHE A 333 . ? 1_555 ? 
33 AC4 9 GLY A 334 ? GLY A 334 . ? 1_555 ? 
34 AC4 9 ASN G 48  ? ASN G 48  . ? 1_555 ? 
35 AC4 9 ILE G 49  ? ILE G 49  . ? 1_555 ? 
36 AC4 9 ARG G 50  ? ARG G 50  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5TWV 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . ARG A 1 32   ? 152.964 109.043 86.094  1.00 65.98  ? 32   ARG A N     1 
ATOM   2     C CA    . ARG A 1 32   ? 153.236 108.914 87.555  1.00 66.01  ? 32   ARG A CA    1 
ATOM   3     C C     . ARG A 1 32   ? 152.380 109.899 88.344  1.00 65.18  ? 32   ARG A C     1 
ATOM   4     O O     . ARG A 1 32   ? 151.997 109.626 89.482  1.00 65.13  ? 32   ARG A O     1 
ATOM   5     C CB    . ARG A 1 32   ? 154.721 109.171 87.825  1.00 66.76  ? 32   ARG A CB    1 
ATOM   6     C CG    . ARG A 1 32   ? 155.187 108.831 89.235  1.00 67.32  ? 32   ARG A CG    1 
ATOM   7     C CD    . ARG A 1 32   ? 156.678 109.077 89.371  1.00 67.67  ? 32   ARG A CD    1 
ATOM   8     N NE    . ARG A 1 32   ? 156.995 110.498 89.304  1.00 67.84  ? 32   ARG A NE    1 
ATOM   9     C CZ    . ARG A 1 32   ? 157.419 111.208 90.342  1.00 67.85  ? 32   ARG A CZ    1 
ATOM   10    N NH1   . ARG A 1 32   ? 157.576 110.615 91.517  1.00 67.82  ? 32   ARG A NH1   1 
ATOM   11    N NH2   . ARG A 1 32   ? 157.669 112.504 90.218  1.00 67.83  ? 32   ARG A NH2   1 
ATOM   12    N N     . ALA A 1 33   ? 152.076 111.034 87.721  1.00 64.34  ? 33   ALA A N     1 
ATOM   13    C CA    . ALA A 1 33   ? 151.271 112.090 88.332  1.00 63.52  ? 33   ALA A CA    1 
ATOM   14    C C     . ALA A 1 33   ? 149.804 111.698 88.412  1.00 62.65  ? 33   ALA A C     1 
ATOM   15    O O     . ALA A 1 33   ? 149.185 111.350 87.405  1.00 62.84  ? 33   ALA A O     1 
ATOM   16    C CB    . ALA A 1 33   ? 151.419 113.371 87.537  1.00 63.52  ? 33   ALA A CB    1 
ATOM   17    N N     . ARG A 1 34   ? 149.244 111.795 89.614  1.00 61.43  ? 34   ARG A N     1 
ATOM   18    C CA    . ARG A 1 34   ? 147.856 111.421 89.844  1.00 60.18  ? 34   ARG A CA    1 
ATOM   19    C C     . ARG A 1 34   ? 146.967 112.593 90.272  1.00 58.84  ? 34   ARG A C     1 
ATOM   20    O O     . ARG A 1 34   ? 147.444 113.588 90.821  1.00 58.89  ? 34   ARG A O     1 
ATOM   21    C CB    . ARG A 1 34   ? 147.806 110.310 90.894  1.00 60.21  ? 34   ARG A CB    1 
ATOM   22    C CG    . ARG A 1 34   ? 146.478 109.589 90.995  1.00 60.21  ? 34   ARG A CG    1 
ATOM   23    C CD    . ARG A 1 34   ? 146.534 108.519 92.079  1.00 60.21  ? 34   ARG A CD    1 
ATOM   24    N NE    . ARG A 1 34   ? 147.234 107.311 91.652  1.00 60.15  ? 34   ARG A NE    1 
ATOM   25    C CZ    . ARG A 1 34   ? 146.622 106.224 91.199  1.00 60.07  ? 34   ARG A CZ    1 
ATOM   26    N NH1   . ARG A 1 34   ? 145.299 106.201 91.119  1.00 60.06  ? 34   ARG A NH1   1 
ATOM   27    N NH2   . ARG A 1 34   ? 147.324 105.162 90.822  1.00 60.05  ? 34   ARG A NH2   1 
ATOM   28    N N     . PHE A 1 35   ? 145.670 112.449 90.012  1.00 57.44  ? 35   PHE A N     1 
ATOM   29    C CA    . PHE A 1 35   ? 144.652 113.453 90.325  1.00 56.02  ? 35   PHE A CA    1 
ATOM   30    C C     . PHE A 1 35   ? 143.804 113.003 91.516  1.00 54.71  ? 35   PHE A C     1 
ATOM   31    O O     . PHE A 1 35   ? 143.562 113.776 92.448  1.00 54.80  ? 35   PHE A O     1 
ATOM   32    C CB    . PHE A 1 35   ? 143.765 113.655 89.086  1.00 55.86  ? 35   PHE A CB    1 
ATOM   33    C CG    . PHE A 1 35   ? 142.533 114.489 89.322  1.00 55.67  ? 35   PHE A CG    1 
ATOM   34    C CD1   . PHE A 1 35   ? 142.625 115.861 89.521  1.00 55.57  ? 35   PHE A CD1   1 
ATOM   35    C CD2   . PHE A 1 35   ? 141.270 113.899 89.298  1.00 55.62  ? 35   PHE A CD2   1 
ATOM   36    C CE1   . PHE A 1 35   ? 141.480 116.635 89.689  1.00 55.53  ? 35   PHE A CE1   1 
ATOM   37    C CE2   . PHE A 1 35   ? 140.120 114.666 89.466  1.00 55.56  ? 35   PHE A CE2   1 
ATOM   38    C CZ    . PHE A 1 35   ? 140.225 116.037 89.661  1.00 55.52  ? 35   PHE A CZ    1 
ATOM   39    N N     . VAL A 1 36   ? 143.359 111.751 91.469  1.00 53.23  ? 36   VAL A N     1 
ATOM   40    C CA    . VAL A 1 36   ? 142.542 111.174 92.530  1.00 51.76  ? 36   VAL A CA    1 
ATOM   41    C C     . VAL A 1 36   ? 142.863 109.686 92.696  1.00 50.69  ? 36   VAL A C     1 
ATOM   42    O O     . VAL A 1 36   ? 143.160 108.979 91.727  1.00 50.54  ? 36   VAL A O     1 
ATOM   43    C CB    . VAL A 1 36   ? 141.040 111.336 92.234  1.00 51.46  ? 36   VAL A CB    1 
ATOM   44    C CG1   . VAL A 1 36   ? 140.687 110.636 90.935  1.00 51.35  ? 36   VAL A CG1   1 
ATOM   45    C CG2   . VAL A 1 36   ? 140.216 110.766 93.380  1.00 51.34  ? 36   VAL A CG2   1 
ATOM   46    N N     . SER A 1 37   ? 142.783 109.220 93.936  1.00 49.87  ? 37   SER A N     1 
ATOM   47    C CA    . SER A 1 37   ? 143.091 107.835 94.272  1.00 49.17  ? 37   SER A CA    1 
ATOM   48    C C     . SER A 1 37   ? 142.075 106.804 93.798  1.00 48.93  ? 37   SER A C     1 
ATOM   49    O O     . SER A 1 37   ? 140.933 107.129 93.468  1.00 48.78  ? 37   SER A O     1 
ATOM   50    C CB    . SER A 1 37   ? 143.276 107.700 95.783  1.00 48.83  ? 37   SER A CB    1 
ATOM   51    O OG    . SER A 1 37   ? 143.772 106.414 96.114  1.00 48.63  ? 37   SER A OG    1 
ATOM   52    N N     . LYS A 1 38   ? 142.506 105.548 93.778  1.00 49.00  ? 38   LYS A N     1 
ATOM   53    C CA    . LYS A 1 38   ? 141.651 104.448 93.349  1.00 49.28  ? 38   LYS A CA    1 
ATOM   54    C C     . LYS A 1 38   ? 140.534 104.194 94.361  1.00 49.38  ? 38   LYS A C     1 
ATOM   55    O O     . LYS A 1 38   ? 139.650 103.373 94.125  1.00 49.34  ? 38   LYS A O     1 
ATOM   56    C CB    . LYS A 1 38   ? 142.480 103.171 93.149  1.00 49.52  ? 38   LYS A CB    1 
ATOM   57    C CG    . LYS A 1 38   ? 141.728 102.037 92.445  1.00 49.82  ? 38   LYS A CG    1 
ATOM   58    C CD    . LYS A 1 38   ? 142.594 100.790 92.244  1.00 50.08  ? 38   LYS A CD    1 
ATOM   59    C CE    . LYS A 1 38   ? 141.866 99.729  91.419  1.00 50.21  ? 38   LYS A CE    1 
ATOM   60    N NZ    . LYS A 1 38   ? 140.561 99.330  92.019  1.00 50.26  ? 38   LYS A NZ    1 
ATOM   61    N N     . LYS A 1 39   ? 140.582 104.894 95.491  1.00 49.65  ? 39   LYS A N     1 
ATOM   62    C CA    . LYS A 1 39   ? 139.558 104.750 96.522  1.00 49.97  ? 39   LYS A CA    1 
ATOM   63    C C     . LYS A 1 39   ? 138.699 106.018 96.549  1.00 50.64  ? 39   LYS A C     1 
ATOM   64    O O     . LYS A 1 39   ? 137.484 105.944 96.726  1.00 50.56  ? 39   LYS A O     1 
ATOM   65    C CB    . LYS A 1 39   ? 140.205 104.508 97.895  1.00 49.67  ? 39   LYS A CB    1 
ATOM   66    C CG    . LYS A 1 39   ? 140.263 103.043 98.352  1.00 49.37  ? 39   LYS A CG    1 
ATOM   67    C CD    . LYS A 1 39   ? 138.891 102.530 98.779  1.00 49.12  ? 39   LYS A CD    1 
ATOM   68    C CE    . LYS A 1 39   ? 138.990 101.618 99.997  1.00 48.99  ? 39   LYS A CE    1 
ATOM   69    N NZ    . LYS A 1 39   ? 139.376 102.383 101.220 1.00 48.95  ? 39   LYS A NZ    1 
ATOM   70    N N     . GLY A 1 40   ? 139.337 107.174 96.358  1.00 51.42  ? 40   GLY A N     1 
ATOM   71    C CA    . GLY A 1 40   ? 138.614 108.440 96.345  1.00 52.28  ? 40   GLY A CA    1 
ATOM   72    C C     . GLY A 1 40   ? 139.356 109.615 96.962  1.00 53.19  ? 40   GLY A C     1 
ATOM   73    O O     . GLY A 1 40   ? 140.584 109.652 96.945  1.00 53.16  ? 40   GLY A O     1 
ATOM   74    N N     . ASN A 1 41   ? 138.598 110.588 97.468  1.00 54.15  ? 41   ASN A N     1 
ATOM   75    C CA    . ASN A 1 41   ? 139.146 111.772 98.142  1.00 55.19  ? 41   ASN A CA    1 
ATOM   76    C C     . ASN A 1 41   ? 140.425 112.423 97.612  1.00 56.40  ? 41   ASN A C     1 
ATOM   77    O O     . ASN A 1 41   ? 141.430 112.533 98.316  1.00 56.37  ? 41   ASN A O     1 
ATOM   78    C CB    . ASN A 1 41   ? 139.270 111.502 99.646  1.00 55.04  ? 41   ASN A CB    1 
ATOM   79    C CG    . ASN A 1 41   ? 140.338 110.492 99.986  1.00 54.91  ? 41   ASN A CG    1 
ATOM   80    O OD1   . ASN A 1 41   ? 140.826 109.758 99.130  1.00 54.87  ? 41   ASN A OD1   1 
ATOM   81    N ND2   . ASN A 1 41   ? 140.696 110.437 101.256 1.00 54.84  ? 41   ASN A ND2   1 
ATOM   82    N N     . CYS A 1 42   ? 140.367 112.840 96.355  1.00 57.80  ? 42   CYS A N     1 
ATOM   83    C CA    . CYS A 1 42   ? 141.468 113.497 95.660  1.00 59.38  ? 42   CYS A CA    1 
ATOM   84    C C     . CYS A 1 42   ? 141.961 114.744 96.398  1.00 61.39  ? 42   CYS A C     1 
ATOM   85    O O     . CYS A 1 42   ? 141.215 115.701 96.594  1.00 61.42  ? 42   CYS A O     1 
ATOM   86    C CB    . CYS A 1 42   ? 140.981 113.917 94.290  1.00 59.18  ? 42   CYS A CB    1 
ATOM   87    S SG    . CYS A 1 42   ? 139.398 114.769 94.427  1.00 59.08  ? 42   CYS A SG    1 
ATOM   88    N N     . ASN A 1 43   ? 143.237 114.711 96.777  1.00 63.45  ? 43   ASN A N     1 
ATOM   89    C CA    . ASN A 1 43   ? 143.897 115.800 97.491  1.00 65.51  ? 43   ASN A CA    1 
ATOM   90    C C     . ASN A 1 43   ? 144.502 116.838 96.533  1.00 66.81  ? 43   ASN A C     1 
ATOM   91    O O     . ASN A 1 43   ? 145.198 116.485 95.579  1.00 66.84  ? 43   ASN A O     1 
ATOM   92    C CB    . ASN A 1 43   ? 144.983 115.205 98.387  1.00 66.23  ? 43   ASN A CB    1 
ATOM   93    C CG    . ASN A 1 43   ? 145.771 114.103 97.698  1.00 66.84  ? 43   ASN A CG    1 
ATOM   94    O OD1   . ASN A 1 43   ? 145.208 113.291 96.961  1.00 67.02  ? 43   ASN A OD1   1 
ATOM   95    N ND2   . ASN A 1 43   ? 147.073 114.058 97.946  1.00 67.03  ? 43   ASN A ND2   1 
ATOM   96    N N     . VAL A 1 44   ? 144.232 118.111 96.812  1.00 67.90  ? 44   VAL A N     1 
ATOM   97    C CA    . VAL A 1 44   ? 144.711 119.229 95.997  1.00 68.86  ? 44   VAL A CA    1 
ATOM   98    C C     . VAL A 1 44   ? 145.429 120.281 96.857  1.00 69.22  ? 44   VAL A C     1 
ATOM   99    O O     . VAL A 1 44   ? 145.026 120.542 97.993  1.00 69.25  ? 44   VAL A O     1 
ATOM   100   C CB    . VAL A 1 44   ? 143.529 119.929 95.306  1.00 69.35  ? 44   VAL A CB    1 
ATOM   101   C CG1   . VAL A 1 44   ? 142.531 120.419 96.354  1.00 69.47  ? 44   VAL A CG1   1 
ATOM   102   C CG2   . VAL A 1 44   ? 144.025 121.104 94.488  1.00 69.56  ? 44   VAL A CG2   1 
ATOM   103   N N     . ALA A 1 45   ? 146.473 120.900 96.316  1.00 69.54  ? 45   ALA A N     1 
ATOM   104   C CA    . ALA A 1 45   ? 147.221 121.909 97.066  1.00 70.00  ? 45   ALA A CA    1 
ATOM   105   C C     . ALA A 1 45   ? 146.788 123.337 96.730  1.00 70.59  ? 45   ALA A C     1 
ATOM   106   O O     . ALA A 1 45   ? 146.809 123.741 95.568  1.00 70.48  ? 45   ALA A O     1 
ATOM   107   C CB    . ALA A 1 45   ? 148.711 121.739 96.805  1.00 69.92  ? 45   ALA A CB    1 
ATOM   108   N N     . HIS A 1 46   ? 146.406 124.095 97.757  1.00 71.41  ? 46   HIS A N     1 
ATOM   109   C CA    . HIS A 1 46   ? 145.954 125.479 97.599  1.00 72.28  ? 46   HIS A CA    1 
ATOM   110   C C     . HIS A 1 46   ? 146.986 126.522 97.993  1.00 73.24  ? 46   HIS A C     1 
ATOM   111   O O     . HIS A 1 46   ? 147.582 126.459 99.071  1.00 73.39  ? 46   HIS A O     1 
ATOM   112   C CB    . HIS A 1 46   ? 144.689 125.723 98.426  1.00 72.26  ? 46   HIS A CB    1 
ATOM   113   C CG    . HIS A 1 46   ? 143.538 124.856 98.039  1.00 72.31  ? 46   HIS A CG    1 
ATOM   114   N ND1   . HIS A 1 46   ? 143.083 123.825 98.833  1.00 72.35  ? 46   HIS A ND1   1 
ATOM   115   C CD2   . HIS A 1 46   ? 142.766 124.849 96.929  1.00 72.32  ? 46   HIS A CD2   1 
ATOM   116   C CE1   . HIS A 1 46   ? 142.076 123.222 98.227  1.00 72.32  ? 46   HIS A CE1   1 
ATOM   117   N NE2   . HIS A 1 46   ? 141.862 123.823 97.071  1.00 72.32  ? 46   HIS A NE2   1 
ATOM   118   N N     . LYS A 1 47   ? 147.176 127.503 97.122  1.00 74.02  ? 47   LYS A N     1 
ATOM   119   C CA    . LYS A 1 47   ? 148.129 128.566 97.384  1.00 74.89  ? 47   LYS A CA    1 
ATOM   120   C C     . LYS A 1 47   ? 147.413 129.905 97.359  1.00 75.88  ? 47   LYS A C     1 
ATOM   121   O O     . LYS A 1 47   ? 146.392 130.064 96.684  1.00 75.91  ? 47   LYS A O     1 
ATOM   122   C CB    . LYS A 1 47   ? 149.238 128.554 96.332  1.00 74.94  ? 47   LYS A CB    1 
ATOM   123   N N     . ASN A 1 48   ? 147.978 130.860 98.087  1.00 76.90  ? 48   ASN A N     1 
ATOM   124   C CA    . ASN A 1 48   ? 147.437 132.208 98.160  1.00 78.05  ? 48   ASN A CA    1 
ATOM   125   C C     . ASN A 1 48   ? 146.068 132.415 98.805  1.00 78.33  ? 48   ASN A C     1 
ATOM   126   O O     . ASN A 1 48   ? 145.140 132.876 98.153  1.00 78.32  ? 48   ASN A O     1 
ATOM   127   C CB    . ASN A 1 48   ? 147.426 132.828 96.774  1.00 78.81  ? 48   ASN A CB    1 
ATOM   128   N N     . ILE A 1 49   ? 145.925 132.024 100.068 1.00 78.63  ? 49   ILE A N     1 
ATOM   129   C CA    . ILE A 1 49   ? 144.665 132.188 100.792 1.00 79.07  ? 49   ILE A CA    1 
ATOM   130   C C     . ILE A 1 49   ? 144.416 133.646 101.203 1.00 79.35  ? 49   ILE A C     1 
ATOM   131   O O     . ILE A 1 49   ? 145.334 134.328 101.656 1.00 79.47  ? 49   ILE A O     1 
ATOM   132   C CB    . ILE A 1 49   ? 144.687 131.304 102.030 1.00 79.40  ? 49   ILE A CB    1 
ATOM   133   C CG1   . ILE A 1 49   ? 144.736 129.845 101.578 1.00 79.58  ? 49   ILE A CG1   1 
ATOM   134   C CG2   . ILE A 1 49   ? 143.484 131.587 102.907 1.00 79.50  ? 49   ILE A CG2   1 
ATOM   135   C CD1   . ILE A 1 49   ? 145.539 128.942 102.469 1.00 79.69  ? 49   ILE A CD1   1 
ATOM   136   N N     . ARG A 1 50   ? 143.177 134.118 101.067 1.00 79.55  ? 50   ARG A N     1 
ATOM   137   C CA    . ARG A 1 50   ? 142.862 135.511 101.406 1.00 79.77  ? 50   ARG A CA    1 
ATOM   138   C C     . ARG A 1 50   ? 142.607 135.762 102.892 1.00 80.42  ? 50   ARG A C     1 
ATOM   139   O O     . ARG A 1 50   ? 143.220 136.646 103.491 1.00 80.55  ? 50   ARG A O     1 
ATOM   140   C CB    . ARG A 1 50   ? 141.642 135.981 100.612 1.00 79.28  ? 50   ARG A CB    1 
ATOM   141   N N     . GLU A 1 51   ? 141.699 134.993 103.483 1.00 80.81  ? 51   GLU A N     1 
ATOM   142   C CA    . GLU A 1 51   ? 141.375 135.123 104.902 1.00 81.15  ? 51   GLU A CA    1 
ATOM   143   C C     . GLU A 1 51   ? 141.090 133.745 105.464 1.00 81.56  ? 51   GLU A C     1 
ATOM   144   O O     . GLU A 1 51   ? 140.505 132.898 104.790 1.00 81.53  ? 51   GLU A O     1 
ATOM   145   C CB    . GLU A 1 51   ? 140.131 135.990 105.120 1.00 81.12  ? 51   GLU A CB    1 
ATOM   146   C CG    . GLU A 1 51   ? 140.291 137.468 104.857 1.00 81.24  ? 51   GLU A CG    1 
ATOM   147   C CD    . GLU A 1 51   ? 139.005 138.232 105.125 1.00 81.40  ? 51   GLU A CD    1 
ATOM   148   O OE1   . GLU A 1 51   ? 138.584 138.305 106.301 1.00 81.47  ? 51   GLU A OE1   1 
ATOM   149   O OE2   . GLU A 1 51   ? 138.411 138.751 104.156 1.00 81.45  ? 51   GLU A OE2   1 
ATOM   150   N N     . GLN A 1 52   ? 141.550 133.522 106.690 1.00 82.00  ? 52   GLN A N     1 
ATOM   151   C CA    . GLN A 1 52   ? 141.230 132.310 107.451 1.00 82.41  ? 52   GLN A CA    1 
ATOM   152   C C     . GLN A 1 52   ? 140.084 132.593 108.465 1.00 82.45  ? 52   GLN A C     1 
ATOM   153   O O     . GLN A 1 52   ? 139.497 131.666 109.048 1.00 82.57  ? 52   GLN A O     1 
ATOM   154   C CB    . GLN A 1 52   ? 142.468 131.785 108.179 1.00 82.52  ? 52   GLN A CB    1 
ATOM   155   N N     . GLY A 1 53   ? 139.755 133.877 108.637 1.00 82.22  ? 53   GLY A N     1 
ATOM   156   C CA    . GLY A 1 53   ? 138.732 134.341 109.547 1.00 81.88  ? 53   GLY A CA    1 
ATOM   157   C C     . GLY A 1 53   ? 137.362 133.822 109.189 1.00 81.42  ? 53   GLY A C     1 
ATOM   158   O O     . GLY A 1 53   ? 136.587 133.486 110.071 1.00 81.63  ? 53   GLY A O     1 
ATOM   159   N N     . ARG A 1 54   ? 137.050 133.762 107.898 1.00 80.61  ? 54   ARG A N     1 
ATOM   160   C CA    . ARG A 1 54   ? 135.754 133.252 107.468 1.00 79.75  ? 54   ARG A CA    1 
ATOM   161   C C     . ARG A 1 54   ? 135.613 131.788 107.883 1.00 78.13  ? 54   ARG A C     1 
ATOM   162   O O     . ARG A 1 54   ? 134.567 131.370 108.387 1.00 77.96  ? 54   ARG A O     1 
ATOM   163   C CB    . ARG A 1 54   ? 135.595 133.388 105.954 1.00 80.49  ? 54   ARG A CB    1 
ATOM   164   C CG    . ARG A 1 54   ? 135.603 134.825 105.456 1.00 81.19  ? 54   ARG A CG    1 
ATOM   165   C CD    . ARG A 1 54   ? 134.445 135.618 106.041 1.00 81.92  ? 54   ARG A CD    1 
ATOM   166   N NE    . ARG A 1 54   ? 134.423 136.994 105.555 1.00 82.60  ? 54   ARG A NE    1 
ATOM   167   C CZ    . ARG A 1 54   ? 133.508 137.893 105.901 1.00 83.12  ? 54   ARG A CZ    1 
ATOM   168   N NH1   . ARG A 1 54   ? 132.534 137.564 106.738 1.00 83.31  ? 54   ARG A NH1   1 
ATOM   169   N NH2   . ARG A 1 54   ? 133.566 139.124 105.411 1.00 83.26  ? 54   ARG A NH2   1 
ATOM   170   N N     . PHE A 1 55   ? 136.687 131.021 107.700 1.00 76.74  ? 55   PHE A N     1 
ATOM   171   C CA    . PHE A 1 55   ? 136.691 129.616 108.078 1.00 75.49  ? 55   PHE A CA    1 
ATOM   172   C C     . PHE A 1 55   ? 136.502 129.497 109.584 1.00 73.29  ? 55   PHE A C     1 
ATOM   173   O O     . PHE A 1 55   ? 135.725 128.663 110.053 1.00 73.30  ? 55   PHE A O     1 
ATOM   174   C CB    . PHE A 1 55   ? 138.000 128.950 107.656 1.00 76.50  ? 55   PHE A CB    1 
ATOM   175   C CG    . PHE A 1 55   ? 138.236 128.961 106.172 1.00 77.49  ? 55   PHE A CG    1 
ATOM   176   C CD1   . PHE A 1 55   ? 137.789 127.917 105.380 1.00 77.88  ? 55   PHE A CD1   1 
ATOM   177   C CD2   . PHE A 1 55   ? 138.905 130.014 105.571 1.00 77.88  ? 55   PHE A CD2   1 
ATOM   178   C CE1   . PHE A 1 55   ? 138.004 127.923 104.014 1.00 78.08  ? 55   PHE A CE1   1 
ATOM   179   C CE2   . PHE A 1 55   ? 139.123 130.026 104.207 1.00 78.05  ? 55   PHE A CE2   1 
ATOM   180   C CZ    . PHE A 1 55   ? 138.672 128.979 103.426 1.00 78.11  ? 55   PHE A CZ    1 
ATOM   181   N N     . LEU A 1 56   ? 137.176 130.361 110.345 1.00 71.13  ? 56   LEU A N     1 
ATOM   182   C CA    . LEU A 1 56   ? 137.038 130.332 111.802 1.00 68.99  ? 56   LEU A CA    1 
ATOM   183   C C     . LEU A 1 56   ? 135.599 130.645 112.223 1.00 66.98  ? 56   LEU A C     1 
ATOM   184   O O     . LEU A 1 56   ? 135.055 130.031 113.141 1.00 67.09  ? 56   LEU A O     1 
ATOM   185   C CB    . LEU A 1 56   ? 138.014 131.308 112.462 1.00 68.82  ? 56   LEU A CB    1 
ATOM   186   C CG    . LEU A 1 56   ? 137.926 131.431 113.985 1.00 68.68  ? 56   LEU A CG    1 
ATOM   187   C CD1   . LEU A 1 56   ? 138.265 130.117 114.672 1.00 68.63  ? 56   LEU A CD1   1 
ATOM   188   C CD2   . LEU A 1 56   ? 138.811 132.559 114.493 1.00 68.64  ? 56   LEU A CD2   1 
ATOM   189   N N     . GLN A 1 57   ? 134.999 131.610 111.535 1.00 64.82  ? 57   GLN A N     1 
ATOM   190   C CA    . GLN A 1 57   ? 133.632 132.051 111.772 1.00 62.63  ? 57   GLN A CA    1 
ATOM   191   C C     . GLN A 1 57   ? 132.639 130.931 111.492 1.00 59.41  ? 57   GLN A C     1 
ATOM   192   O O     . GLN A 1 57   ? 131.639 130.789 112.196 1.00 59.37  ? 57   GLN A O     1 
ATOM   193   C CB    . GLN A 1 57   ? 133.304 133.269 110.905 1.00 63.64  ? 57   GLN A CB    1 
ATOM   194   C CG    . GLN A 1 57   ? 131.882 133.782 111.067 1.00 64.59  ? 57   GLN A CG    1 
ATOM   195   C CD    . GLN A 1 57   ? 131.572 134.200 112.490 1.00 65.39  ? 57   GLN A CD    1 
ATOM   196   O OE1   . GLN A 1 57   ? 132.423 134.115 113.375 1.00 65.66  ? 57   GLN A OE1   1 
ATOM   197   N NE2   . GLN A 1 57   ? 130.346 134.658 112.718 1.00 65.65  ? 57   GLN A NE2   1 
ATOM   198   N N     . ASP A 1 58   ? 132.916 130.135 110.463 1.00 56.27  ? 58   ASP A N     1 
ATOM   199   C CA    . ASP A 1 58   ? 132.012 129.051 110.109 1.00 53.15  ? 58   ASP A CA    1 
ATOM   200   C C     . ASP A 1 58   ? 132.269 127.842 110.996 1.00 50.15  ? 58   ASP A C     1 
ATOM   201   O O     . ASP A 1 58   ? 132.902 126.869 110.586 1.00 49.84  ? 58   ASP A O     1 
ATOM   202   C CB    . ASP A 1 58   ? 132.178 128.671 108.637 1.00 53.19  ? 58   ASP A CB    1 
ATOM   203   N N     . VAL A 1 59   ? 131.887 127.901 112.268 1.00 47.74  ? 59   VAL A N     1 
ATOM   204   C CA    . VAL A 1 59   ? 132.179 126.794 113.212 1.00 45.51  ? 59   VAL A CA    1 
ATOM   205   C C     . VAL A 1 59   ? 131.562 125.380 113.065 1.00 43.18  ? 59   VAL A C     1 
ATOM   206   O O     . VAL A 1 59   ? 132.256 124.344 113.212 1.00 43.03  ? 59   VAL A O     1 
ATOM   207   C CB    . VAL A 1 59   ? 131.951 127.256 114.669 1.00 45.64  ? 59   VAL A CB    1 
ATOM   208   C CG1   . VAL A 1 59   ? 132.975 128.313 115.054 1.00 45.70  ? 59   VAL A CG1   1 
ATOM   209   C CG2   . VAL A 1 59   ? 130.537 127.789 114.845 1.00 45.69  ? 59   VAL A CG2   1 
ATOM   210   N N     . PHE A 1 60   ? 130.276 125.330 112.739 1.00 41.17  ? 60   PHE A N     1 
ATOM   211   C CA    . PHE A 1 60   ? 129.563 124.056 112.685 1.00 39.37  ? 60   PHE A CA    1 
ATOM   212   C C     . PHE A 1 60   ? 130.070 123.026 111.684 1.00 37.15  ? 60   PHE A C     1 
ATOM   213   O O     . PHE A 1 60   ? 130.192 121.848 112.024 1.00 36.85  ? 60   PHE A O     1 
ATOM   214   C CB    . PHE A 1 60   ? 128.067 124.300 112.463 1.00 40.08  ? 60   PHE A CB    1 
ATOM   215   C CG    . PHE A 1 60   ? 127.401 125.035 113.590 1.00 40.96  ? 60   PHE A CG    1 
ATOM   216   C CD1   . PHE A 1 60   ? 126.823 124.342 114.640 1.00 41.35  ? 60   PHE A CD1   1 
ATOM   217   C CD2   . PHE A 1 60   ? 127.351 126.419 113.600 1.00 41.35  ? 60   PHE A CD2   1 
ATOM   218   C CE1   . PHE A 1 60   ? 126.208 125.015 115.680 1.00 41.62  ? 60   PHE A CE1   1 
ATOM   219   C CE2   . PHE A 1 60   ? 126.737 127.098 114.635 1.00 41.66  ? 60   PHE A CE2   1 
ATOM   220   C CZ    . PHE A 1 60   ? 126.166 126.395 115.678 1.00 41.78  ? 60   PHE A CZ    1 
ATOM   221   N N     . THR A 1 61   ? 130.402 123.451 110.472 1.00 35.48  ? 61   THR A N     1 
ATOM   222   C CA    . THR A 1 61   ? 130.864 122.484 109.488 1.00 34.03  ? 61   THR A CA    1 
ATOM   223   C C     . THR A 1 61   ? 132.146 121.806 109.958 1.00 33.39  ? 61   THR A C     1 
ATOM   224   O O     . THR A 1 61   ? 132.262 120.581 109.908 1.00 33.18  ? 61   THR A O     1 
ATOM   225   C CB    . THR A 1 61   ? 131.079 123.137 108.108 1.00 33.40  ? 61   THR A CB    1 
ATOM   226   O OG1   . THR A 1 61   ? 131.328 122.120 107.128 1.00 33.20  ? 61   THR A OG1   1 
ATOM   227   C CG2   . THR A 1 61   ? 132.259 124.097 108.146 1.00 33.18  ? 61   THR A CG2   1 
ATOM   228   N N     . THR A 1 62   ? 133.076 122.594 110.482 1.00 33.22  ? 62   THR A N     1 
ATOM   229   C CA    . THR A 1 62   ? 134.340 122.048 110.955 1.00 33.23  ? 62   THR A CA    1 
ATOM   230   C C     . THR A 1 62   ? 134.098 121.089 112.108 1.00 33.11  ? 62   THR A C     1 
ATOM   231   O O     . THR A 1 62   ? 134.678 119.978 112.155 1.00 32.73  ? 62   THR A O     1 
ATOM   232   C CB    . THR A 1 62   ? 135.287 123.162 111.431 1.00 33.50  ? 62   THR A CB    1 
ATOM   233   O OG1   . THR A 1 62   ? 134.659 123.903 112.485 1.00 33.56  ? 62   THR A OG1   1 
ATOM   234   C CG2   . THR A 1 62   ? 135.621 124.104 110.286 1.00 33.57  ? 62   THR A CG2   1 
ATOM   235   N N     . LEU A 1 63   ? 133.204 121.485 113.014 1.00 33.57  ? 63   LEU A N     1 
ATOM   236   C CA    . LEU A 1 63   ? 132.942 120.615 114.151 1.00 34.38  ? 63   LEU A CA    1 
ATOM   237   C C     . LEU A 1 63   ? 132.391 119.274 113.678 1.00 35.11  ? 63   LEU A C     1 
ATOM   238   O O     . LEU A 1 63   ? 132.894 118.213 114.066 1.00 34.77  ? 63   LEU A O     1 
ATOM   239   C CB    . LEU A 1 63   ? 131.967 121.277 115.124 1.00 34.67  ? 63   LEU A CB    1 
ATOM   240   C CG    . LEU A 1 63   ? 132.592 122.162 116.202 1.00 34.98  ? 63   LEU A CG    1 
ATOM   241   C CD1   . LEU A 1 63   ? 133.789 122.931 115.664 1.00 35.07  ? 63   LEU A CD1   1 
ATOM   242   C CD2   . LEU A 1 63   ? 131.558 123.103 116.801 1.00 35.07  ? 63   LEU A CD2   1 
ATOM   243   N N     . VAL A 1 64   ? 131.448 119.320 112.742 1.00 36.62  ? 64   VAL A N     1 
ATOM   244   C CA    . VAL A 1 64   ? 130.838 118.098 112.233 1.00 38.55  ? 64   VAL A CA    1 
ATOM   245   C C     . VAL A 1 64   ? 131.873 117.217 111.548 1.00 39.74  ? 64   VAL A C     1 
ATOM   246   O O     . VAL A 1 64   ? 131.874 115.997 111.707 1.00 39.72  ? 64   VAL A O     1 
ATOM   247   C CB    . VAL A 1 64   ? 129.701 118.407 111.244 1.00 39.54  ? 64   VAL A CB    1 
ATOM   248   C CG1   . VAL A 1 64   ? 129.240 117.133 110.553 1.00 39.94  ? 64   VAL A CG1   1 
ATOM   249   C CG2   . VAL A 1 64   ? 128.543 119.083 111.962 1.00 39.91  ? 64   VAL A CG2   1 
ATOM   250   N N     . ASP A 1 65   ? 132.755 117.851 110.789 1.00 41.08  ? 65   ASP A N     1 
ATOM   251   C CA    . ASP A 1 65   ? 133.809 117.157 110.071 1.00 42.61  ? 65   ASP A CA    1 
ATOM   252   C C     . ASP A 1 65   ? 134.814 116.432 110.966 1.00 43.32  ? 65   ASP A C     1 
ATOM   253   O O     . ASP A 1 65   ? 135.261 115.339 110.620 1.00 43.15  ? 65   ASP A O     1 
ATOM   254   C CB    . ASP A 1 65   ? 134.539 118.117 109.129 1.00 43.51  ? 65   ASP A CB    1 
ATOM   255   C CG    . ASP A 1 65   ? 135.587 117.417 108.284 1.00 44.19  ? 65   ASP A CG    1 
ATOM   256   O OD1   . ASP A 1 65   ? 135.732 116.184 108.417 1.00 44.37  ? 65   ASP A OD1   1 
ATOM   257   O OD2   . ASP A 1 65   ? 136.264 118.100 107.487 1.00 44.34  ? 65   ASP A OD2   1 
ATOM   258   N N     . LEU A 1 66   ? 135.176 117.015 112.108 1.00 44.33  ? 66   LEU A N     1 
ATOM   259   C CA    . LEU A 1 66   ? 136.205 116.353 112.937 1.00 45.54  ? 66   LEU A CA    1 
ATOM   260   C C     . LEU A 1 66   ? 135.914 114.947 113.520 1.00 46.84  ? 66   LEU A C     1 
ATOM   261   O O     . LEU A 1 66   ? 134.810 114.681 113.995 1.00 46.77  ? 66   LEU A O     1 
ATOM   262   C CB    . LEU A 1 66   ? 136.637 117.288 114.072 1.00 45.54  ? 66   LEU A CB    1 
ATOM   263   C CG    . LEU A 1 66   ? 137.272 118.615 113.654 1.00 45.53  ? 66   LEU A CG    1 
ATOM   264   C CD1   . LEU A 1 66   ? 137.658 119.429 114.879 1.00 45.53  ? 66   LEU A CD1   1 
ATOM   265   C CD2   . LEU A 1 66   ? 138.484 118.374 112.766 1.00 45.50  ? 66   LEU A CD2   1 
ATOM   266   N N     . LYS A 1 67   ? 136.920 114.062 113.475 1.00 48.25  ? 67   LYS A N     1 
ATOM   267   C CA    . LYS A 1 67   ? 136.835 112.729 114.053 1.00 49.70  ? 67   LYS A CA    1 
ATOM   268   C C     . LYS A 1 67   ? 136.289 112.664 115.475 1.00 50.61  ? 67   LYS A C     1 
ATOM   269   O O     . LYS A 1 67   ? 136.233 113.669 116.182 1.00 50.44  ? 67   LYS A O     1 
ATOM   270   C CB    . LYS A 1 67   ? 138.208 112.053 113.980 1.00 50.24  ? 67   LYS A CB    1 
ATOM   271   C CG    . LYS A 1 67   ? 138.665 111.798 112.549 1.00 50.77  ? 67   LYS A CG    1 
ATOM   272   C CD    . LYS A 1 67   ? 139.782 110.764 112.481 1.00 51.17  ? 67   LYS A CD    1 
ATOM   273   C CE    . LYS A 1 67   ? 141.135 111.328 112.891 1.00 51.41  ? 67   LYS A CE    1 
ATOM   274   N NZ    . LYS A 1 67   ? 141.752 112.150 111.813 1.00 51.50  ? 67   LYS A NZ    1 
ATOM   275   N N     . TRP A 1 68   ? 135.898 111.458 115.876 1.00 51.78  ? 68   TRP A N     1 
ATOM   276   C CA    . TRP A 1 68   ? 135.314 111.191 117.188 1.00 52.87  ? 68   TRP A CA    1 
ATOM   277   C C     . TRP A 1 68   ? 136.178 111.437 118.424 1.00 52.99  ? 68   TRP A C     1 
ATOM   278   O O     . TRP A 1 68   ? 135.675 111.862 119.462 1.00 52.64  ? 68   TRP A O     1 
ATOM   279   C CB    . TRP A 1 68   ? 134.822 109.745 117.248 1.00 53.80  ? 68   TRP A CB    1 
ATOM   280   C CG    . TRP A 1 68   ? 133.500 109.482 116.591 1.00 54.62  ? 68   TRP A CG    1 
ATOM   281   C CD1   . TRP A 1 68   ? 133.229 108.510 115.675 1.00 54.85  ? 68   TRP A CD1   1 
ATOM   282   C CD2   . TRP A 1 68   ? 132.252 110.133 116.869 1.00 55.07  ? 68   TRP A CD2   1 
ATOM   283   N NE1   . TRP A 1 68   ? 131.892 108.507 115.366 1.00 55.02  ? 68   TRP A NE1   1 
ATOM   284   C CE2   . TRP A 1 68   ? 131.269 109.494 116.084 1.00 55.12  ? 68   TRP A CE2   1 
ATOM   285   C CE3   . TRP A 1 68   ? 131.870 111.192 117.705 1.00 55.24  ? 68   TRP A CE3   1 
ATOM   286   C CZ2   . TRP A 1 68   ? 129.923 109.875 116.110 1.00 55.13  ? 68   TRP A CZ2   1 
ATOM   287   C CZ3   . TRP A 1 68   ? 130.528 111.574 117.732 1.00 55.25  ? 68   TRP A CZ3   1 
ATOM   288   C CH2   . TRP A 1 68   ? 129.572 110.913 116.938 1.00 55.16  ? 68   TRP A CH2   1 
ATOM   289   N N     . PRO A 1 69   ? 137.477 111.135 118.349 1.00 53.62  ? 69   PRO A N     1 
ATOM   290   C CA    . PRO A 1 69   ? 138.296 111.366 119.541 1.00 53.92  ? 69   PRO A CA    1 
ATOM   291   C C     . PRO A 1 69   ? 138.399 112.826 119.964 1.00 53.87  ? 69   PRO A C     1 
ATOM   292   O O     . PRO A 1 69   ? 138.334 113.133 121.153 1.00 53.86  ? 69   PRO A O     1 
ATOM   293   C CB    . PRO A 1 69   ? 139.648 110.770 119.153 1.00 54.15  ? 69   PRO A CB    1 
ATOM   294   C CG    . PRO A 1 69   ? 139.266 109.665 118.224 1.00 54.18  ? 69   PRO A CG    1 
ATOM   295   C CD    . PRO A 1 69   ? 138.192 110.305 117.365 1.00 53.96  ? 69   PRO A CD    1 
ATOM   296   N N     . HIS A 1 70   ? 138.555 113.718 118.987 1.00 53.78  ? 70   HIS A N     1 
ATOM   297   C CA    . HIS A 1 70   ? 138.665 115.149 119.254 1.00 53.67  ? 70   HIS A CA    1 
ATOM   298   C C     . HIS A 1 70   ? 137.314 115.729 119.617 1.00 52.43  ? 70   HIS A C     1 
ATOM   299   O O     . HIS A 1 70   ? 137.216 116.615 120.462 1.00 52.62  ? 70   HIS A O     1 
ATOM   300   C CB    . HIS A 1 70   ? 139.194 115.881 118.022 1.00 54.68  ? 70   HIS A CB    1 
ATOM   301   C CG    . HIS A 1 70   ? 140.571 115.466 117.630 1.00 55.56  ? 70   HIS A CG    1 
ATOM   302   N ND1   . HIS A 1 70   ? 141.112 115.769 116.399 1.00 55.91  ? 70   HIS A ND1   1 
ATOM   303   C CD2   . HIS A 1 70   ? 141.544 114.833 118.326 1.00 55.89  ? 70   HIS A CD2   1 
ATOM   304   C CE1   . HIS A 1 70   ? 142.359 115.340 116.354 1.00 56.07  ? 70   HIS A CE1   1 
ATOM   305   N NE2   . HIS A 1 70   ? 142.646 114.769 117.511 1.00 56.08  ? 70   HIS A NE2   1 
ATOM   306   N N     . THR A 1 71   ? 136.277 115.218 118.967 1.00 50.92  ? 71   THR A N     1 
ATOM   307   C CA    . THR A 1 71   ? 134.918 115.689 119.197 1.00 49.48  ? 71   THR A CA    1 
ATOM   308   C C     . THR A 1 71   ? 134.471 115.514 120.644 1.00 47.58  ? 71   THR A C     1 
ATOM   309   O O     . THR A 1 71   ? 133.757 116.352 121.191 1.00 47.53  ? 71   THR A O     1 
ATOM   310   C CB    . THR A 1 71   ? 133.929 114.943 118.295 1.00 49.86  ? 71   THR A CB    1 
ATOM   311   O OG1   . THR A 1 71   ? 134.381 115.005 116.936 1.00 50.01  ? 71   THR A OG1   1 
ATOM   312   C CG2   . THR A 1 71   ? 132.556 115.571 118.393 1.00 49.97  ? 71   THR A CG2   1 
ATOM   313   N N     . LEU A 1 72   ? 134.896 114.414 121.252 1.00 45.78  ? 72   LEU A N     1 
ATOM   314   C CA    . LEU A 1 72   ? 134.536 114.101 122.628 1.00 44.03  ? 72   LEU A CA    1 
ATOM   315   C C     . LEU A 1 72   ? 135.320 115.014 123.558 1.00 41.75  ? 72   LEU A C     1 
ATOM   316   O O     . LEU A 1 72   ? 134.843 115.413 124.619 1.00 41.72  ? 72   LEU A O     1 
ATOM   317   C CB    . LEU A 1 72   ? 134.893 112.647 122.926 1.00 44.57  ? 72   LEU A CB    1 
ATOM   318   C CG    . LEU A 1 72   ? 134.122 111.939 124.033 1.00 45.03  ? 72   LEU A CG    1 
ATOM   319   C CD1   . LEU A 1 72   ? 132.780 111.471 123.488 1.00 45.19  ? 72   LEU A CD1   1 
ATOM   320   C CD2   . LEU A 1 72   ? 134.931 110.752 124.527 1.00 45.16  ? 72   LEU A CD2   1 
ATOM   321   N N     . LEU A 1 73   ? 136.531 115.331 123.119 1.00 39.50  ? 73   LEU A N     1 
ATOM   322   C CA    . LEU A 1 73   ? 137.459 116.185 123.848 1.00 37.23  ? 73   LEU A CA    1 
ATOM   323   C C     . LEU A 1 73   ? 136.979 117.631 123.896 1.00 34.62  ? 73   LEU A C     1 
ATOM   324   O O     . LEU A 1 73   ? 137.212 118.337 124.877 1.00 34.65  ? 73   LEU A O     1 
ATOM   325   C CB    . LEU A 1 73   ? 138.821 116.134 123.168 1.00 37.54  ? 73   LEU A CB    1 
ATOM   326   C CG    . LEU A 1 73   ? 140.003 116.806 123.858 1.00 37.79  ? 73   LEU A CG    1 
ATOM   327   C CD1   . LEU A 1 73   ? 140.490 115.914 124.984 1.00 37.87  ? 73   LEU A CD1   1 
ATOM   328   C CD2   . LEU A 1 73   ? 141.116 117.037 122.848 1.00 37.89  ? 73   LEU A CD2   1 
ATOM   329   N N     . ILE A 1 74   ? 136.317 118.065 122.830 1.00 32.11  ? 74   ILE A N     1 
ATOM   330   C CA    . ILE A 1 74   ? 135.813 119.432 122.747 1.00 29.73  ? 74   ILE A CA    1 
ATOM   331   C C     . ILE A 1 74   ? 134.645 119.623 123.703 1.00 27.48  ? 74   ILE A C     1 
ATOM   332   O O     . ILE A 1 74   ? 134.540 120.643 124.379 1.00 27.56  ? 74   ILE A O     1 
ATOM   333   C CB    . ILE A 1 74   ? 135.330 119.771 121.321 1.00 29.82  ? 74   ILE A CB    1 
ATOM   334   C CG1   . ILE A 1 74   ? 136.507 119.776 120.346 1.00 29.74  ? 74   ILE A CG1   1 
ATOM   335   C CG2   . ILE A 1 74   ? 134.649 121.128 121.313 1.00 29.90  ? 74   ILE A CG2   1 
ATOM   336   C CD1   . ILE A 1 74   ? 136.109 119.839 118.888 1.00 29.71  ? 74   ILE A CD1   1 
ATOM   337   N N     . PHE A 1 75   ? 133.763 118.633 123.750 1.00 25.16  ? 75   PHE A N     1 
ATOM   338   C CA    . PHE A 1 75   ? 132.596 118.707 124.611 1.00 23.03  ? 75   PHE A CA    1 
ATOM   339   C C     . PHE A 1 75   ? 132.874 118.399 126.066 1.00 19.16  ? 75   PHE A C     1 
ATOM   340   O O     . PHE A 1 75   ? 132.114 118.805 126.946 1.00 19.16  ? 75   PHE A O     1 
ATOM   341   C CB    . PHE A 1 75   ? 131.507 117.775 124.089 1.00 24.80  ? 75   PHE A CB    1 
ATOM   342   C CG    . PHE A 1 75   ? 131.056 118.109 122.706 1.00 26.48  ? 75   PHE A CG    1 
ATOM   343   C CD1   . PHE A 1 75   ? 130.863 119.437 122.342 1.00 27.13  ? 75   PHE A CD1   1 
ATOM   344   C CD2   . PHE A 1 75   ? 130.804 117.111 121.773 1.00 27.13  ? 75   PHE A CD2   1 
ATOM   345   C CE1   . PHE A 1 75   ? 130.429 119.772 121.073 1.00 27.46  ? 75   PHE A CE1   1 
ATOM   346   C CE2   . PHE A 1 75   ? 130.366 117.437 120.490 1.00 27.44  ? 75   PHE A CE2   1 
ATOM   347   C CZ    . PHE A 1 75   ? 130.181 118.773 120.141 1.00 27.56  ? 75   PHE A CZ    1 
ATOM   348   N N     . THR A 1 76   ? 133.960 117.688 126.331 1.00 15.40  ? 76   THR A N     1 
ATOM   349   C CA    . THR A 1 76   ? 134.300 117.344 127.705 1.00 11.91  ? 76   THR A CA    1 
ATOM   350   C C     . THR A 1 76   ? 135.043 118.485 128.383 1.00 8.44   ? 76   THR A C     1 
ATOM   351   O O     . THR A 1 76   ? 134.777 118.802 129.540 1.00 8.09   ? 76   THR A O     1 
ATOM   352   C CB    . THR A 1 76   ? 135.161 116.071 127.763 1.00 12.22  ? 76   THR A CB    1 
ATOM   353   O OG1   . THR A 1 76   ? 136.231 116.171 126.818 1.00 12.31  ? 76   THR A OG1   1 
ATOM   354   C CG2   . THR A 1 76   ? 134.311 114.839 127.454 1.00 12.35  ? 76   THR A CG2   1 
ATOM   355   N N     . MET A 1 77   ? 135.964 119.103 127.656 1.00 5.62   ? 77   MET A N     1 
ATOM   356   C CA    . MET A 1 77   ? 136.741 120.206 128.203 1.00 3.04   ? 77   MET A CA    1 
ATOM   357   C C     . MET A 1 77   ? 135.942 121.502 128.312 1.00 0.22   ? 77   MET A C     1 
ATOM   358   O O     . MET A 1 77   ? 136.077 122.233 129.295 1.00 -0.20  ? 77   MET A O     1 
ATOM   359   C CB    . MET A 1 77   ? 137.997 120.415 127.352 1.00 3.49   ? 77   MET A CB    1 
ATOM   360   C CG    . MET A 1 77   ? 138.971 119.250 127.436 1.00 3.99   ? 77   MET A CG    1 
ATOM   361   S SD    . MET A 1 77   ? 139.643 119.067 129.103 1.00 4.40   ? 77   MET A SD    1 
ATOM   362   C CE    . MET A 1 77   ? 141.367 119.147 128.758 1.00 4.47   ? 77   MET A CE    1 
ATOM   363   N N     . SER A 1 78   ? 135.106 121.777 127.318 1.00 -1.87  ? 78   SER A N     1 
ATOM   364   C CA    . SER A 1 78   ? 134.296 122.989 127.317 1.00 -3.74  ? 78   SER A CA    1 
ATOM   365   C C     . SER A 1 78   ? 133.292 122.953 128.460 1.00 -5.80  ? 78   SER A C     1 
ATOM   366   O O     . SER A 1 78   ? 132.874 123.996 128.964 1.00 -5.82  ? 78   SER A O     1 
ATOM   367   C CB    . SER A 1 78   ? 133.567 123.146 125.977 1.00 -3.61  ? 78   SER A CB    1 
ATOM   368   O OG    . SER A 1 78   ? 132.615 122.115 125.779 1.00 -3.59  ? 78   SER A OG    1 
ATOM   369   N N     . PHE A 1 79   ? 132.901 121.751 128.866 1.00 -7.86  ? 79   PHE A N     1 
ATOM   370   C CA    . PHE A 1 79   ? 131.960 121.606 129.973 1.00 -9.74  ? 79   PHE A CA    1 
ATOM   371   C C     . PHE A 1 79   ? 132.699 121.857 131.271 1.00 -11.68 ? 79   PHE A C     1 
ATOM   372   O O     . PHE A 1 79   ? 132.231 122.591 132.139 1.00 -11.96 ? 79   PHE A O     1 
ATOM   373   C CB    . PHE A 1 79   ? 131.349 120.203 129.993 1.00 -9.50  ? 79   PHE A CB    1 
ATOM   374   C CG    . PHE A 1 79   ? 129.974 120.141 129.410 1.00 -9.08  ? 79   PHE A CG    1 
ATOM   375   C CD1   . PHE A 1 79   ? 129.729 120.607 128.122 1.00 -8.88  ? 79   PHE A CD1   1 
ATOM   376   C CD2   . PHE A 1 79   ? 128.912 119.644 130.157 1.00 -8.84  ? 79   PHE A CD2   1 
ATOM   377   C CE1   . PHE A 1 79   ? 128.445 120.581 127.587 1.00 -8.67  ? 79   PHE A CE1   1 
ATOM   378   C CE2   . PHE A 1 79   ? 127.622 119.615 129.629 1.00 -8.63  ? 79   PHE A CE2   1 
ATOM   379   C CZ    . PHE A 1 79   ? 127.390 120.083 128.344 1.00 -8.57  ? 79   PHE A CZ    1 
ATOM   380   N N     . LEU A 1 80   ? 133.867 121.238 131.384 1.00 -13.16 ? 80   LEU A N     1 
ATOM   381   C CA    . LEU A 1 80   ? 134.705 121.375 132.560 1.00 -14.46 ? 80   LEU A CA    1 
ATOM   382   C C     . LEU A 1 80   ? 135.189 122.806 132.680 1.00 -16.12 ? 80   LEU A C     1 
ATOM   383   O O     . LEU A 1 80   ? 135.270 123.359 133.776 1.00 -16.50 ? 80   LEU A O     1 
ATOM   384   C CB    . LEU A 1 80   ? 135.904 120.435 132.455 1.00 -13.87 ? 80   LEU A CB    1 
ATOM   385   C CG    . LEU A 1 80   ? 135.817 119.080 133.157 1.00 -13.29 ? 80   LEU A CG    1 
ATOM   386   C CD1   . LEU A 1 80   ? 136.813 118.118 132.534 1.00 -13.10 ? 80   LEU A CD1   1 
ATOM   387   C CD2   . LEU A 1 80   ? 136.089 119.260 134.643 1.00 -13.06 ? 80   LEU A CD2   1 
ATOM   388   N N     . CYS A 1 81   ? 135.515 123.400 131.542 1.00 -17.13 ? 81   CYS A N     1 
ATOM   389   C CA    . CYS A 1 81   ? 135.992 124.773 131.525 1.00 -17.98 ? 81   CYS A CA    1 
ATOM   390   C C     . CYS A 1 81   ? 134.906 125.707 132.043 1.00 -18.96 ? 81   CYS A C     1 
ATOM   391   O O     . CYS A 1 81   ? 135.201 126.754 132.618 1.00 -18.91 ? 81   CYS A O     1 
ATOM   392   C CB    . CYS A 1 81   ? 136.417 125.172 130.109 1.00 -17.89 ? 81   CYS A CB    1 
ATOM   393   N N     . SER A 1 82   ? 133.653 125.318 131.846 1.00 -19.90 ? 82   SER A N     1 
ATOM   394   C CA    . SER A 1 82   ? 132.532 126.121 132.309 1.00 -20.45 ? 82   SER A CA    1 
ATOM   395   C C     . SER A 1 82   ? 132.300 125.846 133.790 1.00 -20.30 ? 82   SER A C     1 
ATOM   396   O O     . SER A 1 82   ? 132.104 126.766 134.582 1.00 -20.55 ? 82   SER A O     1 
ATOM   397   C CB    . SER A 1 82   ? 131.270 125.785 131.505 1.00 -20.76 ? 82   SER A CB    1 
ATOM   398   O OG    . SER A 1 82   ? 131.412 126.167 130.146 1.00 -20.88 ? 82   SER A OG    1 
ATOM   399   N N     . TRP A 1 83   ? 132.365 124.577 134.167 1.00 -19.48 ? 83   TRP A N     1 
ATOM   400   C CA    . TRP A 1 83   ? 132.138 124.192 135.551 1.00 -18.30 ? 83   TRP A CA    1 
ATOM   401   C C     . TRP A 1 83   ? 133.080 124.861 136.538 1.00 -17.73 ? 83   TRP A C     1 
ATOM   402   O O     . TRP A 1 83   ? 132.736 125.024 137.707 1.00 -17.94 ? 83   TRP A O     1 
ATOM   403   C CB    . TRP A 1 83   ? 132.263 122.680 135.699 1.00 -17.55 ? 83   TRP A CB    1 
ATOM   404   C CG    . TRP A 1 83   ? 131.286 121.912 134.885 1.00 -16.84 ? 83   TRP A CG    1 
ATOM   405   C CD1   . TRP A 1 83   ? 130.196 122.403 134.226 1.00 -16.42 ? 83   TRP A CD1   1 
ATOM   406   C CD2   . TRP A 1 83   ? 131.278 120.500 134.682 1.00 -16.79 ? 83   TRP A CD2   1 
ATOM   407   N NE1   . TRP A 1 83   ? 129.506 121.379 133.624 1.00 -16.41 ? 83   TRP A NE1   1 
ATOM   408   C CE2   . TRP A 1 83   ? 130.148 120.197 133.891 1.00 -16.67 ? 83   TRP A CE2   1 
ATOM   409   C CE3   . TRP A 1 83   ? 132.114 119.457 135.096 1.00 -16.90 ? 83   TRP A CE3   1 
ATOM   410   C CZ2   . TRP A 1 83   ? 129.834 118.889 133.503 1.00 -16.88 ? 83   TRP A CZ2   1 
ATOM   411   C CZ3   . TRP A 1 83   ? 131.803 118.156 134.714 1.00 -16.87 ? 83   TRP A CZ3   1 
ATOM   412   C CH2   . TRP A 1 83   ? 130.670 117.886 133.924 1.00 -16.89 ? 83   TRP A CH2   1 
ATOM   413   N N     . LEU A 1 84   ? 134.262 125.249 136.072 1.00 -16.74 ? 84   LEU A N     1 
ATOM   414   C CA    . LEU A 1 84   ? 135.246 125.881 136.944 1.00 -15.65 ? 84   LEU A CA    1 
ATOM   415   C C     . LEU A 1 84   ? 134.998 127.363 137.102 1.00 -14.47 ? 84   LEU A C     1 
ATOM   416   O O     . LEU A 1 84   ? 135.407 127.973 138.089 1.00 -14.68 ? 84   LEU A O     1 
ATOM   417   C CB    . LEU A 1 84   ? 136.656 125.698 136.388 1.00 -15.57 ? 84   LEU A CB    1 
ATOM   418   N N     . LEU A 1 85   ? 134.352 127.936 136.102 1.00 -12.89 ? 85   LEU A N     1 
ATOM   419   C CA    . LEU A 1 85   ? 134.049 129.350 136.094 1.00 -11.12 ? 85   LEU A CA    1 
ATOM   420   C C     . LEU A 1 85   ? 132.881 129.617 137.039 1.00 -9.79  ? 85   LEU A C     1 
ATOM   421   O O     . LEU A 1 85   ? 132.859 130.626 137.744 1.00 -9.99  ? 85   LEU A O     1 
ATOM   422   C CB    . LEU A 1 85   ? 133.735 129.772 134.653 1.00 -10.66 ? 85   LEU A CB    1 
ATOM   423   C CG    . LEU A 1 85   ? 133.305 131.197 134.297 1.00 -10.17 ? 85   LEU A CG    1 
ATOM   424   C CD1   . LEU A 1 85   ? 134.431 132.156 134.637 1.00 -10.02 ? 85   LEU A CD1   1 
ATOM   425   C CD2   . LEU A 1 85   ? 132.929 131.280 132.827 1.00 -10.03 ? 85   LEU A CD2   1 
ATOM   426   N N     . PHE A 1 86   ? 131.924 128.696 137.061 1.00 -8.15  ? 86   PHE A N     1 
ATOM   427   C CA    . PHE A 1 86   ? 130.747 128.812 137.921 1.00 -6.29  ? 86   PHE A CA    1 
ATOM   428   C C     . PHE A 1 86   ? 131.082 128.446 139.356 1.00 -5.12  ? 86   PHE A C     1 
ATOM   429   O O     . PHE A 1 86   ? 130.272 128.651 140.260 1.00 -5.16  ? 86   PHE A O     1 
ATOM   430   C CB    . PHE A 1 86   ? 129.637 127.876 137.437 1.00 -5.57  ? 86   PHE A CB    1 
ATOM   431   C CG    . PHE A 1 86   ? 129.180 128.150 136.043 1.00 -4.80  ? 86   PHE A CG    1 
ATOM   432   C CD1   . PHE A 1 86   ? 128.640 129.384 135.712 1.00 -4.45  ? 86   PHE A CD1   1 
ATOM   433   C CD2   . PHE A 1 86   ? 129.306 127.183 135.054 1.00 -4.44  ? 86   PHE A CD2   1 
ATOM   434   C CE1   . PHE A 1 86   ? 128.233 129.660 134.418 1.00 -4.18  ? 86   PHE A CE1   1 
ATOM   435   C CE2   . PHE A 1 86   ? 128.900 127.450 133.748 1.00 -4.10  ? 86   PHE A CE2   1 
ATOM   436   C CZ    . PHE A 1 86   ? 128.364 128.695 133.433 1.00 -4.01  ? 86   PHE A CZ    1 
ATOM   437   N N     . ALA A 1 87   ? 132.273 127.896 139.555 1.00 -3.86  ? 87   ALA A N     1 
ATOM   438   C CA    . ALA A 1 87   ? 132.704 127.473 140.879 1.00 -2.59  ? 87   ALA A CA    1 
ATOM   439   C C     . ALA A 1 87   ? 133.562 128.531 141.556 1.00 -1.27  ? 87   ALA A C     1 
ATOM   440   O O     . ALA A 1 87   ? 133.547 128.669 142.779 1.00 -1.45  ? 87   ALA A O     1 
ATOM   441   C CB    . ALA A 1 87   ? 133.474 126.159 140.774 1.00 -2.64  ? 87   ALA A CB    1 
ATOM   442   N N     . MET A 1 88   ? 134.309 129.280 140.758 1.00 0.32   ? 88   MET A N     1 
ATOM   443   C CA    . MET A 1 88   ? 135.175 130.315 141.295 1.00 2.07   ? 88   MET A CA    1 
ATOM   444   C C     . MET A 1 88   ? 134.360 131.496 141.829 1.00 2.46   ? 88   MET A C     1 
ATOM   445   O O     . MET A 1 88   ? 134.653 132.029 142.901 1.00 2.39   ? 88   MET A O     1 
ATOM   446   C CB    . MET A 1 88   ? 136.144 130.781 140.205 1.00 3.61   ? 88   MET A CB    1 
ATOM   447   C CG    . MET A 1 88   ? 137.159 131.818 140.654 1.00 5.18   ? 88   MET A CG    1 
ATOM   448   S SD    . MET A 1 88   ? 138.311 131.138 141.864 1.00 6.36   ? 88   MET A SD    1 
ATOM   449   C CE    . MET A 1 88   ? 139.351 130.137 140.817 1.00 6.64   ? 88   MET A CE    1 
ATOM   450   N N     . VAL A 1 89   ? 133.333 131.885 141.081 1.00 3.24   ? 89   VAL A N     1 
ATOM   451   C CA    . VAL A 1 89   ? 132.481 133.006 141.461 1.00 4.53   ? 89   VAL A CA    1 
ATOM   452   C C     . VAL A 1 89   ? 131.558 132.613 142.603 1.00 5.21   ? 89   VAL A C     1 
ATOM   453   O O     . VAL A 1 89   ? 130.898 133.465 143.201 1.00 5.06   ? 89   VAL A O     1 
ATOM   454   C CB    . VAL A 1 89   ? 131.589 133.479 140.291 1.00 5.30   ? 89   VAL A CB    1 
ATOM   455   C CG1   . VAL A 1 89   ? 130.518 132.441 140.007 1.00 5.60   ? 89   VAL A CG1   1 
ATOM   456   C CG2   . VAL A 1 89   ? 130.942 134.818 140.628 1.00 5.67   ? 89   VAL A CG2   1 
ATOM   457   N N     . TRP A 1 90   ? 131.501 131.323 142.901 1.00 6.37   ? 90   TRP A N     1 
ATOM   458   C CA    . TRP A 1 90   ? 130.640 130.864 143.974 1.00 7.92   ? 90   TRP A CA    1 
ATOM   459   C C     . TRP A 1 90   ? 131.466 130.751 145.246 1.00 9.11   ? 90   TRP A C     1 
ATOM   460   O O     . TRP A 1 90   ? 130.932 130.778 146.358 1.00 8.53   ? 90   TRP A O     1 
ATOM   461   C CB    . TRP A 1 90   ? 130.029 129.520 143.594 1.00 8.63   ? 90   TRP A CB    1 
ATOM   462   C CG    . TRP A 1 90   ? 128.610 129.390 144.023 1.00 9.34   ? 90   TRP A CG    1 
ATOM   463   C CD1   . TRP A 1 90   ? 128.144 128.751 145.134 1.00 9.60   ? 90   TRP A CD1   1 
ATOM   464   C CD2   . TRP A 1 90   ? 127.469 129.946 143.368 1.00 9.65   ? 90   TRP A CD2   1 
ATOM   465   N NE1   . TRP A 1 90   ? 126.778 128.874 145.214 1.00 9.67   ? 90   TRP A NE1   1 
ATOM   466   C CE2   . TRP A 1 90   ? 126.338 129.604 144.141 1.00 9.63   ? 90   TRP A CE2   1 
ATOM   467   C CE3   . TRP A 1 90   ? 127.292 130.701 142.203 1.00 9.77   ? 90   TRP A CE3   1 
ATOM   468   C CZ2   . TRP A 1 90   ? 125.045 129.993 143.786 1.00 9.62   ? 90   TRP A CZ2   1 
ATOM   469   C CZ3   . TRP A 1 90   ? 126.005 131.089 141.848 1.00 9.79   ? 90   TRP A CZ3   1 
ATOM   470   C CH2   . TRP A 1 90   ? 124.898 130.733 142.640 1.00 9.69   ? 90   TRP A CH2   1 
ATOM   471   N N     . TRP A 1 91   ? 132.775 130.629 145.066 1.00 11.24  ? 91   TRP A N     1 
ATOM   472   C CA    . TRP A 1 91   ? 133.715 130.530 146.170 1.00 13.43  ? 91   TRP A CA    1 
ATOM   473   C C     . TRP A 1 91   ? 134.020 131.964 146.559 1.00 14.60  ? 91   TRP A C     1 
ATOM   474   O O     . TRP A 1 91   ? 134.589 132.242 147.615 1.00 14.22  ? 91   TRP A O     1 
ATOM   475   C CB    . TRP A 1 91   ? 134.997 129.844 145.699 1.00 14.42  ? 91   TRP A CB    1 
ATOM   476   C CG    . TRP A 1 91   ? 136.070 129.721 146.739 1.00 15.42  ? 91   TRP A CG    1 
ATOM   477   C CD1   . TRP A 1 91   ? 136.003 129.022 147.908 1.00 15.73  ? 91   TRP A CD1   1 
ATOM   478   C CD2   . TRP A 1 91   ? 137.399 130.257 146.669 1.00 16.14  ? 91   TRP A CD2   1 
ATOM   479   N NE1   . TRP A 1 91   ? 137.207 129.080 148.569 1.00 16.16  ? 91   TRP A NE1   1 
ATOM   480   C CE2   . TRP A 1 91   ? 138.084 129.830 147.830 1.00 16.54  ? 91   TRP A CE2   1 
ATOM   481   C CE3   . TRP A 1 91   ? 138.081 131.052 145.736 1.00 16.48  ? 91   TRP A CE3   1 
ATOM   482   C CZ2   . TRP A 1 91   ? 139.418 130.170 148.083 1.00 17.05  ? 91   TRP A CZ2   1 
ATOM   483   C CZ3   . TRP A 1 91   ? 139.408 131.391 145.986 1.00 16.83  ? 91   TRP A CZ3   1 
ATOM   484   C CH2   . TRP A 1 91   ? 140.061 130.949 147.153 1.00 17.09  ? 91   TRP A CH2   1 
ATOM   485   N N     . LEU A 1 92   ? 133.612 132.864 145.677 1.00 16.44  ? 92   LEU A N     1 
ATOM   486   C CA    . LEU A 1 92   ? 133.836 134.288 145.850 1.00 18.43  ? 92   LEU A CA    1 
ATOM   487   C C     . LEU A 1 92   ? 132.704 134.983 146.587 1.00 19.80  ? 92   LEU A C     1 
ATOM   488   O O     . LEU A 1 92   ? 132.932 135.958 147.301 1.00 19.66  ? 92   LEU A O     1 
ATOM   489   C CB    . LEU A 1 92   ? 134.016 134.933 144.484 1.00 19.25  ? 92   LEU A CB    1 
ATOM   490   C CG    . LEU A 1 92   ? 134.356 136.420 144.458 1.00 19.99  ? 92   LEU A CG    1 
ATOM   491   C CD1   . LEU A 1 92   ? 135.668 136.651 145.191 1.00 20.20  ? 92   LEU A CD1   1 
ATOM   492   C CD2   . LEU A 1 92   ? 134.451 136.892 143.016 1.00 20.16  ? 92   LEU A CD2   1 
ATOM   493   N N     . ILE A 1 93   ? 131.486 134.484 146.404 1.00 21.63  ? 93   ILE A N     1 
ATOM   494   C CA    . ILE A 1 93   ? 130.318 135.066 147.059 1.00 23.93  ? 93   ILE A CA    1 
ATOM   495   C C     . ILE A 1 93   ? 130.294 134.670 148.529 1.00 26.29  ? 93   ILE A C     1 
ATOM   496   O O     . ILE A 1 93   ? 129.607 135.294 149.339 1.00 26.06  ? 93   ILE A O     1 
ATOM   497   C CB    . ILE A 1 93   ? 129.008 134.602 146.385 1.00 24.20  ? 93   ILE A CB    1 
ATOM   498   C CG1   . ILE A 1 93   ? 128.886 133.080 146.487 1.00 24.32  ? 93   ILE A CG1   1 
ATOM   499   C CG2   . ILE A 1 93   ? 128.965 135.060 144.930 1.00 24.35  ? 93   ILE A CG2   1 
ATOM   500   C CD1   . ILE A 1 93   ? 127.545 132.531 146.052 1.00 24.40  ? 93   ILE A CD1   1 
ATOM   501   N N     . ALA A 1 94   ? 131.035 133.619 148.860 1.00 29.22  ? 94   ALA A N     1 
ATOM   502   C CA    . ALA A 1 94   ? 131.114 133.128 150.232 1.00 32.55  ? 94   ALA A CA    1 
ATOM   503   C C     . ALA A 1 94   ? 132.305 133.808 150.891 1.00 36.21  ? 94   ALA A C     1 
ATOM   504   O O     . ALA A 1 94   ? 132.380 133.922 152.116 1.00 36.12  ? 94   ALA A O     1 
ATOM   505   C CB    . ALA A 1 94   ? 131.301 131.609 150.231 1.00 32.49  ? 94   ALA A CB    1 
ATOM   506   N N     . PHE A 1 95   ? 133.240 134.247 150.057 1.00 40.10  ? 95   PHE A N     1 
ATOM   507   C CA    . PHE A 1 95   ? 134.444 134.920 150.524 1.00 44.13  ? 95   PHE A CA    1 
ATOM   508   C C     . PHE A 1 95   ? 134.163 136.405 150.672 1.00 47.26  ? 95   PHE A C     1 
ATOM   509   O O     . PHE A 1 95   ? 134.828 137.107 151.436 1.00 47.33  ? 95   PHE A O     1 
ATOM   510   C CB    . PHE A 1 95   ? 135.585 134.724 149.523 1.00 45.05  ? 95   PHE A CB    1 
ATOM   511   C CG    . PHE A 1 95   ? 136.895 134.389 150.163 1.00 45.97  ? 95   PHE A CG    1 
ATOM   512   C CD1   . PHE A 1 95   ? 137.142 133.101 150.627 1.00 46.32  ? 95   PHE A CD1   1 
ATOM   513   C CD2   . PHE A 1 95   ? 137.878 135.360 150.319 1.00 46.29  ? 95   PHE A CD2   1 
ATOM   514   C CE1   . PHE A 1 95   ? 138.352 132.782 151.239 1.00 46.47  ? 95   PHE A CE1   1 
ATOM   515   C CE2   . PHE A 1 95   ? 139.094 135.050 150.933 1.00 46.43  ? 95   PHE A CE2   1 
ATOM   516   C CZ    . PHE A 1 95   ? 139.330 133.757 151.392 1.00 46.48  ? 95   PHE A CZ    1 
ATOM   517   N N     . ALA A 1 96   ? 133.169 136.868 149.924 1.00 50.38  ? 96   ALA A N     1 
ATOM   518   C CA    . ALA A 1 96   ? 132.761 138.266 149.936 1.00 53.48  ? 96   ALA A CA    1 
ATOM   519   C C     . ALA A 1 96   ? 131.824 138.521 151.109 1.00 56.46  ? 96   ALA A C     1 
ATOM   520   O O     . ALA A 1 96   ? 131.727 139.644 151.607 1.00 56.45  ? 96   ALA A O     1 
ATOM   521   C CB    . ALA A 1 96   ? 132.068 138.612 148.626 1.00 53.57  ? 96   ALA A CB    1 
ATOM   522   N N     . HIS A 1 97   ? 131.116 137.474 151.525 1.00 59.42  ? 97   HIS A N     1 
ATOM   523   C CA    . HIS A 1 97   ? 130.200 137.557 152.656 1.00 62.35  ? 97   HIS A CA    1 
ATOM   524   C C     . HIS A 1 97   ? 131.061 137.202 153.865 1.00 65.37  ? 97   HIS A C     1 
ATOM   525   O O     . HIS A 1 97   ? 130.940 137.801 154.935 1.00 65.28  ? 97   HIS A O     1 
ATOM   526   C CB    . HIS A 1 97   ? 129.060 136.547 152.508 1.00 62.19  ? 97   HIS A CB    1 
ATOM   527   C CG    . HIS A 1 97   ? 127.725 137.091 152.910 1.00 61.90  ? 97   HIS A CG    1 
ATOM   528   N ND1   . HIS A 1 97   ? 127.035 138.012 152.151 1.00 61.74  ? 97   HIS A ND1   1 
ATOM   529   C CD2   . HIS A 1 97   ? 126.961 136.858 154.003 1.00 61.78  ? 97   HIS A CD2   1 
ATOM   530   C CE1   . HIS A 1 97   ? 125.904 138.322 152.758 1.00 61.69  ? 97   HIS A CE1   1 
ATOM   531   N NE2   . HIS A 1 97   ? 125.834 137.636 153.884 1.00 61.68  ? 97   HIS A NE2   1 
ATOM   532   N N     . GLY A 1 98   ? 131.932 136.215 153.667 1.00 68.48  ? 98   GLY A N     1 
ATOM   533   C CA    . GLY A 1 98   ? 132.853 135.787 154.707 1.00 71.64  ? 98   GLY A CA    1 
ATOM   534   C C     . GLY A 1 98   ? 132.320 134.880 155.796 1.00 74.88  ? 98   GLY A C     1 
ATOM   535   O O     . GLY A 1 98   ? 133.044 134.533 156.724 1.00 74.84  ? 98   GLY A O     1 
ATOM   536   N N     . ASP A 1 99   ? 131.063 134.477 155.679 1.00 78.23  ? 99   ASP A N     1 
ATOM   537   C CA    . ASP A 1 99   ? 130.423 133.624 156.681 1.00 81.59  ? 99   ASP A CA    1 
ATOM   538   C C     . ASP A 1 99   ? 130.948 132.197 156.856 1.00 83.71  ? 99   ASP A C     1 
ATOM   539   O O     . ASP A 1 99   ? 130.602 131.528 157.835 1.00 83.79  ? 99   ASP A O     1 
ATOM   540   C CB    . ASP A 1 99   ? 128.922 133.564 156.392 1.00 82.81  ? 99   ASP A CB    1 
ATOM   541   C CG    . ASP A 1 99   ? 128.617 133.330 154.921 1.00 83.80  ? 99   ASP A CG    1 
ATOM   542   O OD1   . ASP A 1 99   ? 129.258 132.449 154.303 1.00 84.11  ? 99   ASP A OD1   1 
ATOM   543   O OD2   . ASP A 1 99   ? 127.727 134.023 154.384 1.00 84.08  ? 99   ASP A OD2   1 
ATOM   544   N N     . LEU A 1 100  ? 131.791 131.725 155.941 1.00 85.69  ? 100  LEU A N     1 
ATOM   545   C CA    . LEU A 1 100  ? 132.274 130.350 156.015 1.00 87.69  ? 100  LEU A CA    1 
ATOM   546   C C     . LEU A 1 100  ? 133.299 129.940 157.085 1.00 88.51  ? 100  LEU A C     1 
ATOM   547   O O     . LEU A 1 100  ? 133.228 128.816 157.582 1.00 88.64  ? 100  LEU A O     1 
ATOM   548   C CB    . LEU A 1 100  ? 132.753 129.891 154.618 1.00 88.84  ? 100  LEU A CB    1 
ATOM   549   C CG    . LEU A 1 100  ? 133.911 130.552 153.854 1.00 89.80  ? 100  LEU A CG    1 
ATOM   550   C CD1   . LEU A 1 100  ? 135.239 130.047 154.385 1.00 90.05  ? 100  LEU A CD1   1 
ATOM   551   C CD2   . LEU A 1 100  ? 133.799 130.242 152.364 1.00 90.15  ? 100  LEU A CD2   1 
ATOM   552   N N     . ALA A 1 101  ? 134.217 130.821 157.464 1.00 89.04  ? 101  ALA A N     1 
ATOM   553   C CA    . ALA A 1 101  ? 135.224 130.457 158.472 1.00 89.63  ? 101  ALA A CA    1 
ATOM   554   C C     . ALA A 1 101  ? 134.930 130.809 159.950 1.00 90.09  ? 101  ALA A C     1 
ATOM   555   O O     . ALA A 1 101  ? 135.293 130.052 160.846 1.00 90.14  ? 101  ALA A O     1 
ATOM   556   C CB    . ALA A 1 101  ? 136.600 131.025 158.060 1.00 89.66  ? 101  ALA A CB    1 
ATOM   557   N N     . PRO A 1 102  ? 134.282 131.955 160.223 1.00 90.41  ? 102  PRO A N     1 
ATOM   558   C CA    . PRO A 1 102  ? 133.988 132.322 161.618 1.00 90.67  ? 102  PRO A CA    1 
ATOM   559   C C     . PRO A 1 102  ? 132.949 131.470 162.347 1.00 90.92  ? 102  PRO A C     1 
ATOM   560   O O     . PRO A 1 102  ? 132.957 131.375 163.575 1.00 91.04  ? 102  PRO A O     1 
ATOM   561   C CB    . PRO A 1 102  ? 133.567 133.788 161.511 1.00 90.60  ? 102  PRO A CB    1 
ATOM   562   C CG    . PRO A 1 102  ? 132.950 133.863 160.154 1.00 90.55  ? 102  PRO A CG    1 
ATOM   563   C CD    . PRO A 1 102  ? 133.887 133.034 159.299 1.00 90.47  ? 102  PRO A CD    1 
ATOM   564   N N     . GLY A 1 103  ? 132.052 130.859 161.582 1.00 90.91  ? 103  GLY A N     1 
ATOM   565   C CA    . GLY A 1 103  ? 131.037 130.005 162.171 1.00 90.78  ? 103  GLY A CA    1 
ATOM   566   C C     . GLY A 1 103  ? 130.089 130.649 163.164 1.00 90.43  ? 103  GLY A C     1 
ATOM   567   O O     . GLY A 1 103  ? 129.747 130.046 164.186 1.00 90.72  ? 103  GLY A O     1 
ATOM   568   N N     . GLU A 1 104  ? 129.655 131.867 162.861 1.00 89.51  ? 104  GLU A N     1 
ATOM   569   C CA    . GLU A 1 104  ? 128.716 132.594 163.712 1.00 88.34  ? 104  GLU A CA    1 
ATOM   570   C C     . GLU A 1 104  ? 127.313 132.015 163.567 1.00 86.79  ? 104  GLU A C     1 
ATOM   571   O O     . GLU A 1 104  ? 126.810 131.850 162.456 1.00 87.02  ? 104  GLU A O     1 
ATOM   572   C CB    . GLU A 1 104  ? 128.675 134.066 163.324 1.00 88.59  ? 104  GLU A CB    1 
ATOM   573   C CG    . GLU A 1 104  ? 127.588 134.839 164.038 1.00 88.75  ? 104  GLU A CG    1 
ATOM   574   C CD    . GLU A 1 104  ? 127.850 134.977 165.527 1.00 88.80  ? 104  GLU A CD    1 
ATOM   575   O OE1   . GLU A 1 104  ? 128.921 135.505 165.896 1.00 88.84  ? 104  GLU A OE1   1 
ATOM   576   O OE2   . GLU A 1 104  ? 126.987 134.557 166.326 1.00 88.79  ? 104  GLU A OE2   1 
ATOM   577   N N     . GLY A 1 105  ? 126.670 131.748 164.697 1.00 84.68  ? 105  GLY A N     1 
ATOM   578   C CA    . GLY A 1 105  ? 125.335 131.184 164.666 1.00 82.50  ? 105  GLY A CA    1 
ATOM   579   C C     . GLY A 1 105  ? 124.186 132.098 164.275 1.00 80.19  ? 105  GLY A C     1 
ATOM   580   O O     . GLY A 1 105  ? 123.154 131.613 163.815 1.00 80.25  ? 105  GLY A O     1 
ATOM   581   N N     . THR A 1 106  ? 124.342 133.407 164.449 1.00 77.71  ? 106  THR A N     1 
ATOM   582   C CA    . THR A 1 106  ? 123.274 134.347 164.108 1.00 75.17  ? 106  THR A CA    1 
ATOM   583   C C     . THR A 1 106  ? 123.354 134.745 162.638 1.00 72.73  ? 106  THR A C     1 
ATOM   584   O O     . THR A 1 106  ? 122.338 135.011 161.996 1.00 72.79  ? 106  THR A O     1 
ATOM   585   C CB    . THR A 1 106  ? 123.350 135.621 164.974 1.00 75.02  ? 106  THR A CB    1 
ATOM   586   O OG1   . THR A 1 106  ? 123.605 135.261 166.338 1.00 74.94  ? 106  THR A OG1   1 
ATOM   587   C CG2   . THR A 1 106  ? 122.038 136.389 164.910 1.00 74.93  ? 106  THR A CG2   1 
ATOM   588   N N     . ASN A 1 107  ? 124.578 134.785 162.119 1.00 70.16  ? 107  ASN A N     1 
ATOM   589   C CA    . ASN A 1 107  ? 124.835 135.132 160.725 1.00 67.55  ? 107  ASN A CA    1 
ATOM   590   C C     . ASN A 1 107  ? 124.584 133.942 159.813 1.00 65.21  ? 107  ASN A C     1 
ATOM   591   O O     . ASN A 1 107  ? 125.382 133.009 159.763 1.00 65.28  ? 107  ASN A O     1 
ATOM   592   C CB    . ASN A 1 107  ? 126.282 135.608 160.557 1.00 67.32  ? 107  ASN A CB    1 
ATOM   593   C CG    . ASN A 1 107  ? 126.423 137.114 160.640 1.00 67.14  ? 107  ASN A CG    1 
ATOM   594   O OD1   . ASN A 1 107  ? 125.610 137.781 161.280 1.00 67.04  ? 107  ASN A OD1   1 
ATOM   595   N ND2   . ASN A 1 107  ? 127.451 137.658 159.995 1.00 67.10  ? 107  ASN A ND2   1 
ATOM   596   N N     . VAL A 1 108  ? 123.466 133.985 159.089 1.00 62.72  ? 108  VAL A N     1 
ATOM   597   C CA    . VAL A 1 108  ? 123.092 132.919 158.170 1.00 60.30  ? 108  VAL A CA    1 
ATOM   598   C C     . VAL A 1 108  ? 123.739 133.076 156.789 1.00 58.24  ? 108  VAL A C     1 
ATOM   599   O O     . VAL A 1 108  ? 123.655 134.132 156.160 1.00 57.89  ? 108  VAL A O     1 
ATOM   600   C CB    . VAL A 1 108  ? 121.551 132.841 158.005 1.00 59.89  ? 108  VAL A CB    1 
ATOM   601   C CG1   . VAL A 1 108  ? 121.192 131.804 156.949 1.00 59.78  ? 108  VAL A CG1   1 
ATOM   602   C CG2   . VAL A 1 108  ? 120.908 132.458 159.335 1.00 59.75  ? 108  VAL A CG2   1 
ATOM   603   N N     . PRO A 1 109  ? 124.391 132.010 156.308 1.00 56.84  ? 109  PRO A N     1 
ATOM   604   C CA    . PRO A 1 109  ? 125.081 131.936 155.018 1.00 55.83  ? 109  PRO A CA    1 
ATOM   605   C C     . PRO A 1 109  ? 124.146 131.932 153.813 1.00 54.78  ? 109  PRO A C     1 
ATOM   606   O O     . PRO A 1 109  ? 123.028 131.421 153.892 1.00 54.95  ? 109  PRO A O     1 
ATOM   607   C CB    . PRO A 1 109  ? 125.876 130.640 155.135 1.00 56.01  ? 109  PRO A CB    1 
ATOM   608   C CG    . PRO A 1 109  ? 124.981 129.781 155.984 1.00 56.25  ? 109  PRO A CG    1 
ATOM   609   C CD    . PRO A 1 109  ? 124.580 130.760 157.066 1.00 56.50  ? 109  PRO A CD    1 
ATOM   610   N N     . CYS A 1 110  ? 124.600 132.493 152.695 1.00 53.81  ? 110  CYS A N     1 
ATOM   611   C CA    . CYS A 1 110  ? 123.773 132.544 151.496 1.00 53.22  ? 110  CYS A CA    1 
ATOM   612   C C     . CYS A 1 110  ? 123.615 131.145 150.907 1.00 52.35  ? 110  CYS A C     1 
ATOM   613   O O     . CYS A 1 110  ? 122.687 130.885 150.138 1.00 52.77  ? 110  CYS A O     1 
ATOM   614   C CB    . CYS A 1 110  ? 124.373 133.502 150.460 1.00 53.79  ? 110  CYS A CB    1 
ATOM   615   S SG    . CYS A 1 110  ? 123.094 134.209 149.364 1.00 54.38  ? 110  CYS A SG    1 
ATOM   616   N N     . VAL A 1 111  ? 124.525 130.249 151.281 1.00 51.01  ? 111  VAL A N     1 
ATOM   617   C CA    . VAL A 1 111  ? 124.488 128.856 150.840 1.00 49.83  ? 111  VAL A CA    1 
ATOM   618   C C     . VAL A 1 111  ? 125.073 128.019 151.967 1.00 48.82  ? 111  VAL A C     1 
ATOM   619   O O     . VAL A 1 111  ? 126.186 128.276 152.429 1.00 48.93  ? 111  VAL A O     1 
ATOM   620   C CB    . VAL A 1 111  ? 125.313 128.620 149.556 1.00 49.90  ? 111  VAL A CB    1 
ATOM   621   C CG1   . VAL A 1 111  ? 125.131 127.182 149.095 1.00 49.90  ? 111  VAL A CG1   1 
ATOM   622   C CG2   . VAL A 1 111  ? 124.883 129.578 148.459 1.00 49.91  ? 111  VAL A CG2   1 
ATOM   623   N N     . THR A 1 112  ? 124.329 127.010 152.402 1.00 47.68  ? 112  THR A N     1 
ATOM   624   C CA    . THR A 1 112  ? 124.772 126.175 153.505 1.00 46.80  ? 112  THR A CA    1 
ATOM   625   C C     . THR A 1 112  ? 125.771 125.075 153.142 1.00 46.79  ? 112  THR A C     1 
ATOM   626   O O     . THR A 1 112  ? 125.888 124.665 151.988 1.00 46.66  ? 112  THR A O     1 
ATOM   627   C CB    . THR A 1 112  ? 123.577 125.521 154.221 1.00 46.11  ? 112  THR A CB    1 
ATOM   628   O OG1   . THR A 1 112  ? 122.841 124.726 153.285 1.00 45.90  ? 112  THR A OG1   1 
ATOM   629   C CG2   . THR A 1 112  ? 122.654 126.586 154.792 1.00 45.90  ? 112  THR A CG2   1 
ATOM   630   N N     . SER A 1 113  ? 126.464 124.606 154.173 1.00 47.01  ? 113  SER A N     1 
ATOM   631   C CA    . SER A 1 113  ? 127.470 123.555 154.064 1.00 47.17  ? 113  SER A CA    1 
ATOM   632   C C     . SER A 1 113  ? 128.678 123.878 153.193 1.00 46.64  ? 113  SER A C     1 
ATOM   633   O O     . SER A 1 113  ? 129.287 122.974 152.620 1.00 46.84  ? 113  SER A O     1 
ATOM   634   C CB    . SER A 1 113  ? 126.823 122.256 153.569 1.00 47.63  ? 113  SER A CB    1 
ATOM   635   O OG    . SER A 1 113  ? 126.031 121.659 154.579 1.00 47.77  ? 113  SER A OG    1 
ATOM   636   N N     . ILE A 1 114  ? 129.040 125.152 153.093 1.00 45.95  ? 114  ILE A N     1 
ATOM   637   C CA    . ILE A 1 114  ? 130.207 125.527 152.305 1.00 45.51  ? 114  ILE A CA    1 
ATOM   638   C C     . ILE A 1 114  ? 131.375 125.668 153.269 1.00 46.01  ? 114  ILE A C     1 
ATOM   639   O O     . ILE A 1 114  ? 131.585 126.716 153.880 1.00 45.96  ? 114  ILE A O     1 
ATOM   640   C CB    . ILE A 1 114  ? 129.980 126.848 151.546 1.00 44.86  ? 114  ILE A CB    1 
ATOM   641   C CG1   . ILE A 1 114  ? 128.719 126.740 150.680 1.00 44.50  ? 114  ILE A CG1   1 
ATOM   642   C CG2   . ILE A 1 114  ? 131.180 127.155 150.669 1.00 44.82  ? 114  ILE A CG2   1 
ATOM   643   C CD1   . ILE A 1 114  ? 128.785 125.671 149.596 1.00 44.30  ? 114  ILE A CD1   1 
ATOM   644   N N     . HIS A 1 115  ? 132.130 124.585 153.394 1.00 46.88  ? 115  HIS A N     1 
ATOM   645   C CA    . HIS A 1 115  ? 133.254 124.525 154.312 1.00 47.92  ? 115  HIS A CA    1 
ATOM   646   C C     . HIS A 1 115  ? 134.593 124.629 153.594 1.00 47.61  ? 115  HIS A C     1 
ATOM   647   O O     . HIS A 1 115  ? 135.530 125.266 154.084 1.00 47.61  ? 115  HIS A O     1 
ATOM   648   C CB    . HIS A 1 115  ? 133.176 123.206 155.072 1.00 49.36  ? 115  HIS A CB    1 
ATOM   649   C CG    . HIS A 1 115  ? 133.959 123.187 156.341 1.00 50.64  ? 115  HIS A CG    1 
ATOM   650   N ND1   . HIS A 1 115  ? 133.690 124.039 157.390 1.00 51.12  ? 115  HIS A ND1   1 
ATOM   651   C CD2   . HIS A 1 115  ? 134.983 122.399 156.745 1.00 51.24  ? 115  HIS A CD2   1 
ATOM   652   C CE1   . HIS A 1 115  ? 134.514 123.774 158.388 1.00 51.45  ? 115  HIS A CE1   1 
ATOM   653   N NE2   . HIS A 1 115  ? 135.308 122.783 158.023 1.00 51.49  ? 115  HIS A NE2   1 
ATOM   654   N N     . SER A 1 116  ? 134.676 124.006 152.426 1.00 47.14  ? 116  SER A N     1 
ATOM   655   C CA    . SER A 1 116  ? 135.911 124.027 151.667 1.00 46.45  ? 116  SER A CA    1 
ATOM   656   C C     . SER A 1 116  ? 135.787 124.727 150.325 1.00 44.88  ? 116  SER A C     1 
ATOM   657   O O     . SER A 1 116  ? 134.739 125.271 149.967 1.00 44.77  ? 116  SER A O     1 
ATOM   658   C CB    . SER A 1 116  ? 136.409 122.597 151.450 1.00 47.14  ? 116  SER A CB    1 
ATOM   659   O OG    . SER A 1 116  ? 136.534 121.911 152.683 1.00 47.52  ? 116  SER A OG    1 
ATOM   660   N N     . PHE A 1 117  ? 136.930 124.897 149.669 1.00 43.42  ? 117  PHE A N     1 
ATOM   661   C CA    . PHE A 1 117  ? 136.965 125.502 148.345 1.00 41.97  ? 117  PHE A CA    1 
ATOM   662   C C     . PHE A 1 117  ? 136.313 124.577 147.326 1.00 38.80  ? 117  PHE A C     1 
ATOM   663   O O     . PHE A 1 117  ? 135.558 125.005 146.454 1.00 38.73  ? 117  PHE A O     1 
ATOM   664   C CB    . PHE A 1 117  ? 138.404 125.798 147.931 1.00 43.65  ? 117  PHE A CB    1 
ATOM   665   C CG    . PHE A 1 117  ? 138.557 126.115 146.473 1.00 45.22  ? 117  PHE A CG    1 
ATOM   666   C CD1   . PHE A 1 117  ? 138.742 127.420 146.050 1.00 45.86  ? 117  PHE A CD1   1 
ATOM   667   C CD2   . PHE A 1 117  ? 138.507 125.108 145.525 1.00 45.86  ? 117  PHE A CD2   1 
ATOM   668   C CE1   . PHE A 1 117  ? 138.880 127.714 144.708 1.00 46.20  ? 117  PHE A CE1   1 
ATOM   669   C CE2   . PHE A 1 117  ? 138.645 125.395 144.181 1.00 46.22  ? 117  PHE A CE2   1 
ATOM   670   C CZ    . PHE A 1 117  ? 138.832 126.699 143.771 1.00 46.32  ? 117  PHE A CZ    1 
ATOM   671   N N     . SER A 1 118  ? 136.565 123.282 147.486 1.00 35.68  ? 118  SER A N     1 
ATOM   672   C CA    . SER A 1 118  ? 136.035 122.237 146.606 1.00 32.62  ? 118  SER A CA    1 
ATOM   673   C C     . SER A 1 118  ? 134.507 122.160 146.615 1.00 29.61  ? 118  SER A C     1 
ATOM   674   O O     . SER A 1 118  ? 133.870 121.891 145.584 1.00 29.52  ? 118  SER A O     1 
ATOM   675   C CB    . SER A 1 118  ? 136.629 120.877 146.977 1.00 32.70  ? 118  SER A CB    1 
ATOM   676   O OG    . SER A 1 118  ? 136.147 119.860 146.116 1.00 32.76  ? 118  SER A OG    1 
ATOM   677   N N     . SER A 1 119  ? 133.922 122.418 147.779 1.00 27.03  ? 119  SER A N     1 
ATOM   678   C CA    . SER A 1 119  ? 132.476 122.340 147.957 1.00 24.77  ? 119  SER A CA    1 
ATOM   679   C C     . SER A 1 119  ? 131.729 123.283 147.020 1.00 23.18  ? 119  SER A C     1 
ATOM   680   O O     . SER A 1 119  ? 130.681 122.923 146.487 1.00 23.19  ? 119  SER A O     1 
ATOM   681   C CB    . SER A 1 119  ? 132.104 122.647 149.408 1.00 24.35  ? 119  SER A CB    1 
ATOM   682   O OG    . SER A 1 119  ? 132.557 123.935 149.788 1.00 24.16  ? 119  SER A OG    1 
ATOM   683   N N     . ALA A 1 120  ? 132.257 124.486 146.810 1.00 21.71  ? 120  ALA A N     1 
ATOM   684   C CA    . ALA A 1 120  ? 131.616 125.429 145.903 1.00 20.33  ? 120  ALA A CA    1 
ATOM   685   C C     . ALA A 1 120  ? 131.580 124.851 144.487 1.00 18.96  ? 120  ALA A C     1 
ATOM   686   O O     . ALA A 1 120  ? 130.567 124.955 143.797 1.00 18.78  ? 120  ALA A O     1 
ATOM   687   C CB    . ALA A 1 120  ? 132.350 126.761 145.917 1.00 20.28  ? 120  ALA A CB    1 
ATOM   688   N N     . PHE A 1 121  ? 132.677 124.224 144.065 1.00 17.80  ? 121  PHE A N     1 
ATOM   689   C CA    . PHE A 1 121  ? 132.753 123.608 142.742 1.00 16.66  ? 121  PHE A CA    1 
ATOM   690   C C     . PHE A 1 121  ? 131.736 122.478 142.626 1.00 13.87  ? 121  PHE A C     1 
ATOM   691   O O     . PHE A 1 121  ? 131.070 122.316 141.591 1.00 13.67  ? 121  PHE A O     1 
ATOM   692   C CB    . PHE A 1 121  ? 134.158 123.068 142.480 1.00 18.27  ? 121  PHE A CB    1 
ATOM   693   C CG    . PHE A 1 121  ? 134.266 122.245 141.229 1.00 19.86  ? 121  PHE A CG    1 
ATOM   694   C CD1   . PHE A 1 121  ? 134.694 122.818 140.042 1.00 20.56  ? 121  PHE A CD1   1 
ATOM   695   C CD2   . PHE A 1 121  ? 133.935 120.901 141.239 1.00 20.58  ? 121  PHE A CD2   1 
ATOM   696   C CE1   . PHE A 1 121  ? 134.792 122.063 138.890 1.00 21.03  ? 121  PHE A CE1   1 
ATOM   697   C CE2   . PHE A 1 121  ? 134.031 120.141 140.090 1.00 21.08  ? 121  PHE A CE2   1 
ATOM   698   C CZ    . PHE A 1 121  ? 134.461 120.722 138.914 1.00 21.24  ? 121  PHE A CZ    1 
ATOM   699   N N     . LEU A 1 122  ? 131.605 121.701 143.701 1.00 11.46  ? 122  LEU A N     1 
ATOM   700   C CA    . LEU A 1 122  ? 130.646 120.602 143.718 1.00 9.13   ? 122  LEU A CA    1 
ATOM   701   C C     . LEU A 1 122  ? 129.227 121.150 143.562 1.00 7.28   ? 122  LEU A C     1 
ATOM   702   O O     . LEU A 1 122  ? 128.421 120.604 142.809 1.00 7.00   ? 122  LEU A O     1 
ATOM   703   C CB    . LEU A 1 122  ? 130.765 119.804 145.016 1.00 8.96   ? 122  LEU A CB    1 
ATOM   704   N N     . PHE A 1 123  ? 128.942 122.252 144.253 1.00 6.06   ? 123  PHE A N     1 
ATOM   705   C CA    . PHE A 1 123  ? 127.638 122.902 144.181 1.00 5.26   ? 123  PHE A CA    1 
ATOM   706   C C     . PHE A 1 123  ? 127.374 123.400 142.764 1.00 4.39   ? 123  PHE A C     1 
ATOM   707   O O     . PHE A 1 123  ? 126.261 123.290 142.251 1.00 4.30   ? 123  PHE A O     1 
ATOM   708   C CB    . PHE A 1 123  ? 127.572 124.068 145.167 1.00 5.65   ? 123  PHE A CB    1 
ATOM   709   C CG    . PHE A 1 123  ? 126.430 125.010 144.918 1.00 6.10   ? 123  PHE A CG    1 
ATOM   710   C CD1   . PHE A 1 123  ? 125.243 124.881 145.618 1.00 6.32   ? 123  PHE A CD1   1 
ATOM   711   C CD2   . PHE A 1 123  ? 126.544 126.025 143.984 1.00 6.26   ? 123  PHE A CD2   1 
ATOM   712   C CE1   . PHE A 1 123  ? 124.190 125.748 145.391 1.00 6.36   ? 123  PHE A CE1   1 
ATOM   713   C CE2   . PHE A 1 123  ? 125.497 126.895 143.751 1.00 6.32   ? 123  PHE A CE2   1 
ATOM   714   C CZ    . PHE A 1 123  ? 124.317 126.757 144.456 1.00 6.35   ? 123  PHE A CZ    1 
ATOM   715   N N     . SER A 1 124  ? 128.412 123.944 142.135 1.00 3.73   ? 124  SER A N     1 
ATOM   716   C CA    . SER A 1 124  ? 128.321 124.449 140.775 1.00 3.27   ? 124  SER A CA    1 
ATOM   717   C C     . SER A 1 124  ? 127.969 123.317 139.817 1.00 3.07   ? 124  SER A C     1 
ATOM   718   O O     . SER A 1 124  ? 127.160 123.500 138.909 1.00 2.94   ? 124  SER A O     1 
ATOM   719   C CB    . SER A 1 124  ? 129.638 125.101 140.356 1.00 3.00   ? 124  SER A CB    1 
ATOM   720   O OG    . SER A 1 124  ? 129.572 125.577 139.023 1.00 2.82   ? 124  SER A OG    1 
ATOM   721   N N     . ILE A 1 125  ? 128.567 122.144 140.016 1.00 3.26   ? 125  ILE A N     1 
ATOM   722   C CA    . ILE A 1 125  ? 128.247 121.016 139.145 1.00 3.92   ? 125  ILE A CA    1 
ATOM   723   C C     . ILE A 1 125  ? 126.765 120.702 139.323 1.00 5.43   ? 125  ILE A C     1 
ATOM   724   O O     . ILE A 1 125  ? 126.046 120.404 138.371 1.00 5.41   ? 125  ILE A O     1 
ATOM   725   C CB    . ILE A 1 125  ? 129.077 119.770 139.495 1.00 3.47   ? 125  ILE A CB    1 
ATOM   726   C CG1   . ILE A 1 125  ? 130.557 120.020 139.206 1.00 3.26   ? 125  ILE A CG1   1 
ATOM   727   C CG2   . ILE A 1 125  ? 128.579 118.566 138.713 1.00 3.49   ? 125  ILE A CG2   1 
ATOM   728   C CD1   . ILE A 1 125  ? 130.852 120.307 137.750 1.00 3.23   ? 125  ILE A CD1   1 
ATOM   729   N N     . GLU A 1 126  ? 126.325 120.694 140.577 1.00 7.25   ? 126  GLU A N     1 
ATOM   730   C CA    . GLU A 1 126  ? 124.939 120.363 140.893 1.00 9.36   ? 126  GLU A CA    1 
ATOM   731   C C     . GLU A 1 126  ? 123.931 121.182 140.100 1.00 10.90  ? 126  GLU A C     1 
ATOM   732   O O     . GLU A 1 126  ? 123.042 120.626 139.464 1.00 10.95  ? 126  GLU A O     1 
ATOM   733   C CB    . GLU A 1 126  ? 124.672 120.499 142.396 1.00 10.06  ? 126  GLU A CB    1 
ATOM   734   C CG    . GLU A 1 126  ? 125.431 119.503 143.256 1.00 10.77  ? 126  GLU A CG    1 
ATOM   735   C CD    . GLU A 1 126  ? 125.718 120.034 144.647 1.00 11.42  ? 126  GLU A CD    1 
ATOM   736   O OE1   . GLU A 1 126  ? 125.129 121.069 145.024 1.00 11.63  ? 126  GLU A OE1   1 
ATOM   737   O OE2   . GLU A 1 126  ? 126.537 119.419 145.363 1.00 11.62  ? 126  GLU A OE2   1 
ATOM   738   N N     . VAL A 1 127  ? 124.075 122.501 140.131 1.00 12.46  ? 127  VAL A N     1 
ATOM   739   C CA    . VAL A 1 127  ? 123.147 123.374 139.424 1.00 14.13  ? 127  VAL A CA    1 
ATOM   740   C C     . VAL A 1 127  ? 123.152 123.174 137.911 1.00 15.38  ? 127  VAL A C     1 
ATOM   741   O O     . VAL A 1 127  ? 122.096 123.162 137.279 1.00 15.39  ? 127  VAL A O     1 
ATOM   742   C CB    . VAL A 1 127  ? 123.435 124.856 139.727 1.00 14.55  ? 127  VAL A CB    1 
ATOM   743   C CG1   . VAL A 1 127  ? 122.510 125.751 138.916 1.00 14.69  ? 127  VAL A CG1   1 
ATOM   744   C CG2   . VAL A 1 127  ? 123.287 125.132 141.215 1.00 14.66  ? 127  VAL A CG2   1 
ATOM   745   N N     . GLN A 1 128  ? 124.337 123.015 137.331 1.00 16.57  ? 128  GLN A N     1 
ATOM   746   C CA    . GLN A 1 128  ? 124.450 122.835 135.886 1.00 17.84  ? 128  GLN A CA    1 
ATOM   747   C C     . GLN A 1 128  ? 123.789 121.560 135.364 1.00 18.85  ? 128  GLN A C     1 
ATOM   748   O O     . GLN A 1 128  ? 123.117 121.580 134.333 1.00 18.78  ? 128  GLN A O     1 
ATOM   749   C CB    . GLN A 1 128  ? 125.920 122.873 135.461 1.00 18.15  ? 128  GLN A CB    1 
ATOM   750   C CG    . GLN A 1 128  ? 126.588 124.218 135.687 1.00 18.43  ? 128  GLN A CG    1 
ATOM   751   C CD    . GLN A 1 128  ? 125.858 125.348 134.990 1.00 18.60  ? 128  GLN A CD    1 
ATOM   752   O OE1   . GLN A 1 128  ? 124.945 125.116 134.197 1.00 18.64  ? 128  GLN A OE1   1 
ATOM   753   N NE2   . GLN A 1 128  ? 126.257 126.580 135.283 1.00 18.61  ? 128  GLN A NE2   1 
ATOM   754   N N     . VAL A 1 129  ? 123.980 120.456 136.075 1.00 20.02  ? 129  VAL A N     1 
ATOM   755   C CA    . VAL A 1 129  ? 123.403 119.178 135.668 1.00 21.40  ? 129  VAL A CA    1 
ATOM   756   C C     . VAL A 1 129  ? 122.063 118.880 136.340 1.00 22.98  ? 129  VAL A C     1 
ATOM   757   O O     . VAL A 1 129  ? 121.464 117.831 136.095 1.00 23.01  ? 129  VAL A O     1 
ATOM   758   C CB    . VAL A 1 129  ? 124.376 118.014 135.934 1.00 21.37  ? 129  VAL A CB    1 
ATOM   759   C CG1   . VAL A 1 129  ? 123.819 116.716 135.371 1.00 21.43  ? 129  VAL A CG1   1 
ATOM   760   C CG2   . VAL A 1 129  ? 125.737 118.318 135.327 1.00 21.37  ? 129  VAL A CG2   1 
ATOM   761   N N     . THR A 1 130  ? 121.620 119.795 137.202 1.00 24.74  ? 130  THR A N     1 
ATOM   762   C CA    . THR A 1 130  ? 120.363 119.680 137.957 1.00 26.61  ? 130  THR A CA    1 
ATOM   763   C C     . THR A 1 130  ? 120.297 118.421 138.830 1.00 28.05  ? 130  THR A C     1 
ATOM   764   O O     . THR A 1 130  ? 119.239 117.809 138.973 1.00 28.12  ? 130  THR A O     1 
ATOM   765   C CB    . THR A 1 130  ? 119.109 119.789 137.060 1.00 27.02  ? 130  THR A CB    1 
ATOM   766   O OG1   . THR A 1 130  ? 118.864 118.534 136.411 1.00 27.13  ? 130  THR A OG1   1 
ATOM   767   C CG2   . THR A 1 130  ? 119.299 120.874 136.012 1.00 27.14  ? 130  THR A CG2   1 
ATOM   768   N N     . ILE A 1 131  ? 121.434 118.044 139.410 1.00 29.33  ? 131  ILE A N     1 
ATOM   769   C CA    . ILE A 1 131  ? 121.515 116.871 140.271 1.00 30.68  ? 131  ILE A CA    1 
ATOM   770   C C     . ILE A 1 131  ? 120.664 117.045 141.523 1.00 31.59  ? 131  ILE A C     1 
ATOM   771   O O     . ILE A 1 131  ? 119.982 116.119 141.959 1.00 31.42  ? 131  ILE A O     1 
ATOM   772   C CB    . ILE A 1 131  ? 122.967 116.589 140.694 1.00 31.24  ? 131  ILE A CB    1 
ATOM   773   C CG1   . ILE A 1 131  ? 123.880 116.550 139.468 1.00 31.60  ? 131  ILE A CG1   1 
ATOM   774   C CG2   . ILE A 1 131  ? 123.049 115.286 141.474 1.00 31.37  ? 131  ILE A CG2   1 
ATOM   775   C CD1   . ILE A 1 131  ? 125.339 116.332 139.801 1.00 31.86  ? 131  ILE A CD1   1 
ATOM   776   N N     . GLY A 1 132  ? 120.713 118.244 142.092 1.00 32.79  ? 132  GLY A N     1 
ATOM   777   C CA    . GLY A 1 132  ? 119.956 118.561 143.288 1.00 34.09  ? 132  GLY A CA    1 
ATOM   778   C C     . GLY A 1 132  ? 120.217 117.648 144.471 1.00 35.40  ? 132  GLY A C     1 
ATOM   779   O O     . GLY A 1 132  ? 119.294 117.020 144.988 1.00 35.47  ? 132  GLY A O     1 
ATOM   780   N N     . PHE A 1 133  ? 121.472 117.569 144.906 1.00 36.66  ? 133  PHE A N     1 
ATOM   781   C CA    . PHE A 1 133  ? 121.817 116.728 146.057 1.00 38.04  ? 133  PHE A CA    1 
ATOM   782   C C     . PHE A 1 133  ? 121.077 117.046 147.361 1.00 38.76  ? 133  PHE A C     1 
ATOM   783   O O     . PHE A 1 133  ? 120.667 116.135 148.082 1.00 38.82  ? 133  PHE A O     1 
ATOM   784   C CB    . PHE A 1 133  ? 123.323 116.783 146.318 1.00 38.73  ? 133  PHE A CB    1 
ATOM   785   C CG    . PHE A 1 133  ? 124.037 115.525 145.941 1.00 39.44  ? 133  PHE A CG    1 
ATOM   786   C CD1   . PHE A 1 133  ? 124.360 114.575 146.905 1.00 39.74  ? 133  PHE A CD1   1 
ATOM   787   C CD2   . PHE A 1 133  ? 124.353 115.269 144.614 1.00 39.75  ? 133  PHE A CD2   1 
ATOM   788   C CE1   . PHE A 1 133  ? 124.986 113.385 146.547 1.00 39.90  ? 133  PHE A CE1   1 
ATOM   789   C CE2   . PHE A 1 133  ? 124.978 114.085 144.247 1.00 39.88  ? 133  PHE A CE2   1 
ATOM   790   C CZ    . PHE A 1 133  ? 125.296 113.141 145.215 1.00 39.92  ? 133  PHE A CZ    1 
ATOM   791   N N     . GLY A 1 134  ? 120.940 118.330 147.676 1.00 39.41  ? 134  GLY A N     1 
ATOM   792   C CA    . GLY A 1 134  ? 120.235 118.723 148.885 1.00 40.12  ? 134  GLY A CA    1 
ATOM   793   C C     . GLY A 1 134  ? 121.085 119.153 150.069 1.00 40.80  ? 134  GLY A C     1 
ATOM   794   O O     . GLY A 1 134  ? 120.572 119.749 151.015 1.00 40.70  ? 134  GLY A O     1 
ATOM   795   N N     . GLY A 1 135  ? 122.380 118.866 150.026 1.00 41.69  ? 135  GLY A N     1 
ATOM   796   C CA    . GLY A 1 135  ? 123.244 119.238 151.132 1.00 42.69  ? 135  GLY A CA    1 
ATOM   797   C C     . GLY A 1 135  ? 123.542 120.719 151.216 1.00 43.76  ? 135  GLY A C     1 
ATOM   798   O O     . GLY A 1 135  ? 123.584 121.292 152.307 1.00 43.67  ? 135  GLY A O     1 
ATOM   799   N N     . ARG A 1 136  ? 123.750 121.336 150.060 1.00 44.95  ? 136  ARG A N     1 
ATOM   800   C CA    . ARG A 1 136  ? 124.069 122.754 149.971 1.00 46.16  ? 136  ARG A CA    1 
ATOM   801   C C     . ARG A 1 136  ? 122.800 123.526 149.630 1.00 47.02  ? 136  ARG A C     1 
ATOM   802   O O     . ARG A 1 136  ? 122.327 123.485 148.495 1.00 46.94  ? 136  ARG A O     1 
ATOM   803   C CB    . ARG A 1 136  ? 125.102 122.972 148.872 1.00 46.56  ? 136  ARG A CB    1 
ATOM   804   C CG    . ARG A 1 136  ? 126.159 121.863 148.752 1.00 46.94  ? 136  ARG A CG    1 
ATOM   805   C CD    . ARG A 1 136  ? 127.203 121.917 149.869 1.00 47.23  ? 136  ARG A CD    1 
ATOM   806   N NE    . ARG A 1 136  ? 128.290 120.961 149.660 1.00 47.44  ? 136  ARG A NE    1 
ATOM   807   C CZ    . ARG A 1 136  ? 128.173 119.649 149.829 1.00 47.58  ? 136  ARG A CZ    1 
ATOM   808   N NH1   . ARG A 1 136  ? 127.012 119.138 150.211 1.00 47.62  ? 136  ARG A NH1   1 
ATOM   809   N NH2   . ARG A 1 136  ? 129.214 118.845 149.627 1.00 47.62  ? 136  ARG A NH2   1 
ATOM   810   N N     . MET A 1 137  ? 122.260 124.240 150.611 1.00 48.02  ? 137  MET A N     1 
ATOM   811   C CA    . MET A 1 137  ? 121.037 125.004 150.412 1.00 49.09  ? 137  MET A CA    1 
ATOM   812   C C     . MET A 1 137  ? 121.249 126.509 150.251 1.00 49.52  ? 137  MET A C     1 
ATOM   813   O O     . MET A 1 137  ? 122.120 127.101 150.891 1.00 49.48  ? 137  MET A O     1 
ATOM   814   C CB    . MET A 1 137  ? 120.073 124.737 151.568 1.00 49.87  ? 137  MET A CB    1 
ATOM   815   C CG    . MET A 1 137  ? 119.432 123.354 151.519 1.00 50.64  ? 137  MET A CG    1 
ATOM   816   S SD    . MET A 1 137  ? 118.494 123.099 149.994 1.00 51.25  ? 137  MET A SD    1 
ATOM   817   C CE    . MET A 1 137  ? 117.308 124.435 150.101 1.00 51.38  ? 137  MET A CE    1 
ATOM   818   N N     . VAL A 1 138  ? 120.434 127.114 149.386 1.00 50.13  ? 138  VAL A N     1 
ATOM   819   C CA    . VAL A 1 138  ? 120.497 128.546 149.098 1.00 50.86  ? 138  VAL A CA    1 
ATOM   820   C C     . VAL A 1 138  ? 119.406 129.319 149.832 1.00 51.26  ? 138  VAL A C     1 
ATOM   821   O O     . VAL A 1 138  ? 118.244 128.904 149.863 1.00 51.40  ? 138  VAL A O     1 
ATOM   822   C CB    . VAL A 1 138  ? 120.336 128.827 147.591 1.00 51.21  ? 138  VAL A CB    1 
ATOM   823   C CG1   . VAL A 1 138  ? 118.964 128.363 147.113 1.00 51.32  ? 138  VAL A CG1   1 
ATOM   824   C CG2   . VAL A 1 138  ? 120.496 130.312 147.328 1.00 51.37  ? 138  VAL A CG2   1 
ATOM   825   N N     . THR A 1 139  ? 119.784 130.461 150.399 1.00 51.43  ? 139  THR A N     1 
ATOM   826   C CA    . THR A 1 139  ? 118.860 131.296 151.157 1.00 51.61  ? 139  THR A CA    1 
ATOM   827   C C     . THR A 1 139  ? 118.483 132.625 150.500 1.00 51.51  ? 139  THR A C     1 
ATOM   828   O O     . THR A 1 139  ? 118.748 132.849 149.317 1.00 51.51  ? 139  THR A O     1 
ATOM   829   C CB    . THR A 1 139  ? 119.439 131.597 152.554 1.00 51.92  ? 139  THR A CB    1 
ATOM   830   O OG1   . THR A 1 139  ? 120.735 132.190 152.417 1.00 52.06  ? 139  THR A OG1   1 
ATOM   831   C CG2   . THR A 1 139  ? 119.563 130.315 153.358 1.00 52.04  ? 139  THR A CG2   1 
ATOM   832   N N     . GLU A 1 140  ? 117.836 133.484 151.291 1.00 51.43  ? 140  GLU A N     1 
ATOM   833   C CA    . GLU A 1 140  ? 117.377 134.803 150.848 1.00 51.39  ? 140  GLU A CA    1 
ATOM   834   C C     . GLU A 1 140  ? 118.204 135.934 151.466 1.00 50.39  ? 140  GLU A C     1 
ATOM   835   O O     . GLU A 1 140  ? 117.696 137.040 151.630 1.00 50.48  ? 140  GLU A O     1 
ATOM   836   C CB    . GLU A 1 140  ? 115.922 135.047 151.260 1.00 52.23  ? 140  GLU A CB    1 
ATOM   837   C CG    . GLU A 1 140  ? 114.898 134.016 150.828 1.00 52.99  ? 140  GLU A CG    1 
ATOM   838   C CD    . GLU A 1 140  ? 114.880 132.789 151.717 1.00 53.61  ? 140  GLU A CD    1 
ATOM   839   O OE1   . GLU A 1 140  ? 115.059 132.938 152.945 1.00 53.80  ? 140  GLU A OE1   1 
ATOM   840   O OE2   . GLU A 1 140  ? 114.673 131.678 151.189 1.00 53.78  ? 140  GLU A OE2   1 
ATOM   841   N N     . GLU A 1 141  ? 119.461 135.669 151.807 1.00 49.29  ? 141  GLU A N     1 
ATOM   842   C CA    . GLU A 1 141  ? 120.302 136.685 152.431 1.00 48.17  ? 141  GLU A CA    1 
ATOM   843   C C     . GLU A 1 141  ? 121.060 137.594 151.467 1.00 45.84  ? 141  GLU A C     1 
ATOM   844   O O     . GLU A 1 141  ? 121.181 138.798 151.717 1.00 45.89  ? 141  GLU A O     1 
ATOM   845   C CB    . GLU A 1 141  ? 121.299 136.015 153.379 1.00 49.24  ? 141  GLU A CB    1 
ATOM   846   C CG    . GLU A 1 141  ? 120.647 135.145 154.434 1.00 50.02  ? 141  GLU A CG    1 
ATOM   847   C CD    . GLU A 1 141  ? 119.775 135.944 155.374 1.00 50.53  ? 141  GLU A CD    1 
ATOM   848   O OE1   . GLU A 1 141  ? 120.306 136.867 156.025 1.00 50.67  ? 141  GLU A OE1   1 
ATOM   849   O OE2   . GLU A 1 141  ? 118.565 135.652 155.457 1.00 50.68  ? 141  GLU A OE2   1 
ATOM   850   N N     . CYS A 1 142  ? 121.559 137.028 150.373 1.00 43.49  ? 142  CYS A N     1 
ATOM   851   C CA    . CYS A 1 142  ? 122.334 137.808 149.411 1.00 41.29  ? 142  CYS A CA    1 
ATOM   852   C C     . CYS A 1 142  ? 121.693 137.867 148.019 1.00 38.82  ? 142  CYS A C     1 
ATOM   853   O O     . CYS A 1 142  ? 121.748 136.903 147.260 1.00 38.49  ? 142  CYS A O     1 
ATOM   854   C CB    . CYS A 1 142  ? 123.757 137.234 149.340 1.00 41.70  ? 142  CYS A CB    1 
ATOM   855   S SG    . CYS A 1 142  ? 124.012 135.718 148.355 1.00 42.04  ? 142  CYS A SG    1 
ATOM   856   N N     . PRO A 1 143  ? 121.071 139.011 147.672 1.00 36.86  ? 143  PRO A N     1 
ATOM   857   C CA    . PRO A 1 143  ? 120.394 139.275 146.393 1.00 34.47  ? 143  PRO A CA    1 
ATOM   858   C C     . PRO A 1 143  ? 121.317 139.326 145.177 1.00 30.31  ? 143  PRO A C     1 
ATOM   859   O O     . PRO A 1 143  ? 120.884 139.670 144.078 1.00 30.20  ? 143  PRO A O     1 
ATOM   860   C CB    . PRO A 1 143  ? 119.727 140.635 146.622 1.00 36.00  ? 143  PRO A CB    1 
ATOM   861   C CG    . PRO A 1 143  ? 119.564 140.713 148.094 1.00 36.88  ? 143  PRO A CG    1 
ATOM   862   C CD    . PRO A 1 143  ? 120.862 140.132 148.602 1.00 37.10  ? 143  PRO A CD    1 
ATOM   863   N N     . LEU A 1 144  ? 122.582 138.986 145.383 1.00 26.25  ? 144  LEU A N     1 
ATOM   864   C CA    . LEU A 1 144  ? 123.570 139.016 144.313 1.00 22.26  ? 144  LEU A CA    1 
ATOM   865   C C     . LEU A 1 144  ? 123.785 137.633 143.714 1.00 16.66  ? 144  LEU A C     1 
ATOM   866   O O     . LEU A 1 144  ? 123.805 137.468 142.494 1.00 16.37  ? 144  LEU A O     1 
ATOM   867   C CB    . LEU A 1 144  ? 124.893 139.560 144.856 1.00 23.91  ? 144  LEU A CB    1 
ATOM   868   C CG    . LEU A 1 144  ? 125.998 139.942 143.868 1.00 25.30  ? 144  LEU A CG    1 
ATOM   869   C CD1   . LEU A 1 144  ? 125.632 141.237 143.157 1.00 25.74  ? 144  LEU A CD1   1 
ATOM   870   C CD2   . LEU A 1 144  ? 127.307 140.115 144.623 1.00 25.75  ? 144  LEU A CD2   1 
ATOM   871   N N     . ALA A 1 145  ? 123.937 136.647 144.592 1.00 11.67  ? 145  ALA A N     1 
ATOM   872   C CA    . ALA A 1 145  ? 124.158 135.251 144.212 1.00 7.13   ? 145  ALA A CA    1 
ATOM   873   C C     . ALA A 1 145  ? 122.955 134.593 143.553 1.00 3.61   ? 145  ALA A C     1 
ATOM   874   O O     . ALA A 1 145  ? 123.102 133.657 142.782 1.00 3.12   ? 145  ALA A O     1 
ATOM   875   C CB    . ALA A 1 145  ? 124.560 134.451 145.444 1.00 6.66   ? 145  ALA A CB    1 
ATOM   876   N N     . ILE A 1 146  ? 121.765 135.059 143.892 1.00 1.27   ? 146  ILE A N     1 
ATOM   877   C CA    . ILE A 1 146  ? 120.541 134.497 143.334 1.00 -0.51  ? 146  ILE A CA    1 
ATOM   878   C C     . ILE A 1 146  ? 120.355 134.902 141.882 1.00 -3.76  ? 146  ILE A C     1 
ATOM   879   O O     . ILE A 1 146  ? 119.763 134.155 141.084 1.00 -3.79  ? 146  ILE A O     1 
ATOM   880   C CB    . ILE A 1 146  ? 119.286 134.953 144.125 1.00 1.19   ? 146  ILE A CB    1 
ATOM   881   C CG1   . ILE A 1 146  ? 119.129 136.471 144.082 1.00 2.31   ? 146  ILE A CG1   1 
ATOM   882   C CG2   . ILE A 1 146  ? 119.303 134.389 145.503 1.00 1.58   ? 146  ILE A CG2   1 
ATOM   883   C CD1   . ILE A 1 146  ? 117.809 137.016 144.646 1.00 2.95   ? 146  ILE A CD1   1 
ATOM   884   N N     . LEU A 1 147  ? 120.822 136.099 141.530 1.00 -6.90  ? 147  LEU A N     1 
ATOM   885   C CA    . LEU A 1 147  ? 120.703 136.550 140.140 1.00 -10.08 ? 147  LEU A CA    1 
ATOM   886   C C     . LEU A 1 147  ? 121.837 135.886 139.367 1.00 -13.53 ? 147  LEU A C     1 
ATOM   887   O O     . LEU A 1 147  ? 121.731 135.698 138.165 1.00 -13.73 ? 147  LEU A O     1 
ATOM   888   C CB    . LEU A 1 147  ? 120.819 138.079 140.081 1.00 -9.78  ? 147  LEU A CB    1 
ATOM   889   C CG    . LEU A 1 147  ? 122.166 138.778 140.245 1.00 -9.54  ? 147  LEU A CG    1 
ATOM   890   C CD1   . LEU A 1 147  ? 122.762 139.084 138.876 1.00 -9.47  ? 147  LEU A CD1   1 
ATOM   891   C CD2   . LEU A 1 147  ? 121.962 140.075 141.016 1.00 -9.39  ? 147  LEU A CD2   1 
ATOM   892   N N     . ILE A 1 148  ? 122.907 135.531 140.079 1.00 -16.48 ? 148  ILE A N     1 
ATOM   893   C CA    . ILE A 1 148  ? 124.062 134.883 139.458 1.00 -19.19 ? 148  ILE A CA    1 
ATOM   894   C C     . ILE A 1 148  ? 123.734 133.435 139.168 1.00 -21.71 ? 148  ILE A C     1 
ATOM   895   O O     . ILE A 1 148  ? 124.210 132.855 138.197 1.00 -21.92 ? 148  ILE A O     1 
ATOM   896   C CB    . ILE A 1 148  ? 125.296 134.895 140.367 1.00 -19.13 ? 148  ILE A CB    1 
ATOM   897   C CG1   . ILE A 1 148  ? 125.834 136.315 140.522 1.00 -18.91 ? 148  ILE A CG1   1 
ATOM   898   C CG2   . ILE A 1 148  ? 126.368 133.993 139.802 1.00 -19.21 ? 148  ILE A CG2   1 
ATOM   899   C CD1   . ILE A 1 148  ? 126.350 136.914 139.228 1.00 -18.65 ? 148  ILE A CD1   1 
ATOM   900   N N     . LEU A 1 149  ? 122.923 132.865 140.043 1.00 -23.80 ? 149  LEU A N     1 
ATOM   901   C CA    . LEU A 1 149  ? 122.518 131.477 139.928 1.00 -25.73 ? 149  LEU A CA    1 
ATOM   902   C C     . LEU A 1 149  ? 121.669 131.292 138.683 1.00 -27.79 ? 149  LEU A C     1 
ATOM   903   O O     . LEU A 1 149  ? 121.661 130.224 138.072 1.00 -28.18 ? 149  LEU A O     1 
ATOM   904   C CB    . LEU A 1 149  ? 121.736 131.075 141.176 1.00 -25.38 ? 149  LEU A CB    1 
ATOM   905   C CG    . LEU A 1 149  ? 121.427 129.592 141.332 1.00 -25.00 ? 149  LEU A CG    1 
ATOM   906   C CD1   . LEU A 1 149  ? 121.512 129.222 142.802 1.00 -24.98 ? 149  LEU A CD1   1 
ATOM   907   C CD2   . LEU A 1 149  ? 120.059 129.286 140.748 1.00 -24.85 ? 149  LEU A CD2   1 
ATOM   908   N N     . ILE A 1 150  ? 120.964 132.349 138.303 1.00 -29.24 ? 150  ILE A N     1 
ATOM   909   C CA    . ILE A 1 150  ? 120.115 132.325 137.124 1.00 -30.37 ? 150  ILE A CA    1 
ATOM   910   C C     . ILE A 1 150  ? 120.959 132.377 135.862 1.00 -31.22 ? 150  ILE A C     1 
ATOM   911   O O     . ILE A 1 150  ? 120.611 131.779 134.844 1.00 -31.72 ? 150  ILE A O     1 
ATOM   912   C CB    . ILE A 1 150  ? 119.153 133.515 137.126 1.00 -30.52 ? 150  ILE A CB    1 
ATOM   913   C CG1   . ILE A 1 150  ? 118.016 133.245 138.107 1.00 -30.55 ? 150  ILE A CG1   1 
ATOM   914   C CG2   . ILE A 1 150  ? 118.626 133.769 135.723 1.00 -30.58 ? 150  ILE A CG2   1 
ATOM   915   C CD1   . ILE A 1 150  ? 117.620 134.451 138.910 1.00 -30.45 ? 150  ILE A CD1   1 
ATOM   916   N N     . VAL A 1 151  ? 122.062 133.108 135.935 1.00 -31.18 ? 151  VAL A N     1 
ATOM   917   C CA    . VAL A 1 151  ? 122.960 133.244 134.798 1.00 -30.71 ? 151  VAL A CA    1 
ATOM   918   C C     . VAL A 1 151  ? 123.758 131.964 134.622 1.00 -30.08 ? 151  VAL A C     1 
ATOM   919   O O     . VAL A 1 151  ? 124.193 131.635 133.521 1.00 -30.22 ? 151  VAL A O     1 
ATOM   920   C CB    . VAL A 1 151  ? 123.934 134.420 135.000 1.00 -30.62 ? 151  VAL A CB    1 
ATOM   921   C CG1   . VAL A 1 151  ? 124.753 134.628 133.736 1.00 -30.51 ? 151  VAL A CG1   1 
ATOM   922   C CG2   . VAL A 1 151  ? 123.163 135.685 135.357 1.00 -30.67 ? 151  VAL A CG2   1 
ATOM   923   N N     . GLN A 1 152  ? 123.949 131.244 135.717 1.00 -29.07 ? 152  GLN A N     1 
ATOM   924   C CA    . GLN A 1 152  ? 124.696 129.999 135.680 1.00 -27.91 ? 152  GLN A CA    1 
ATOM   925   C C     . GLN A 1 152  ? 123.852 128.917 135.042 1.00 -27.79 ? 152  GLN A C     1 
ATOM   926   O O     . GLN A 1 152  ? 124.344 128.095 134.265 1.00 -27.86 ? 152  GLN A O     1 
ATOM   927   C CB    . GLN A 1 152  ? 125.062 129.563 137.096 1.00 -27.06 ? 152  GLN A CB    1 
ATOM   928   N N     . ASN A 1 153  ? 122.566 128.933 135.362 1.00 -27.58 ? 153  ASN A N     1 
ATOM   929   C CA    . ASN A 1 153  ? 121.641 127.930 134.868 1.00 -27.25 ? 153  ASN A CA    1 
ATOM   930   C C     . ASN A 1 153  ? 121.212 128.065 133.419 1.00 -27.74 ? 153  ASN A C     1 
ATOM   931   O O     . ASN A 1 153  ? 121.016 127.063 132.738 1.00 -27.94 ? 153  ASN A O     1 
ATOM   932   C CB    . ASN A 1 153  ? 120.405 127.899 135.755 1.00 -26.45 ? 153  ASN A CB    1 
ATOM   933   C CG    . ASN A 1 153  ? 119.721 126.559 135.730 1.00 -25.74 ? 153  ASN A CG    1 
ATOM   934   O OD1   . ASN A 1 153  ? 119.059 126.204 134.758 1.00 -25.53 ? 153  ASN A OD1   1 
ATOM   935   N ND2   . ASN A 1 153  ? 119.900 125.791 136.797 1.00 -25.58 ? 153  ASN A ND2   1 
ATOM   936   N N     . ILE A 1 154  ? 121.068 129.298 132.951 1.00 -27.93 ? 154  ILE A N     1 
ATOM   937   C CA    . ILE A 1 154  ? 120.644 129.549 131.580 1.00 -27.85 ? 154  ILE A CA    1 
ATOM   938   C C     . ILE A 1 154  ? 121.742 129.303 130.548 1.00 -27.97 ? 154  ILE A C     1 
ATOM   939   O O     . ILE A 1 154  ? 121.461 128.908 129.417 1.00 -28.34 ? 154  ILE A O     1 
ATOM   940   C CB    . ILE A 1 154  ? 120.144 130.989 131.417 1.00 -27.66 ? 154  ILE A CB    1 
ATOM   941   C CG1   . ILE A 1 154  ? 119.593 131.193 130.006 1.00 -27.47 ? 154  ILE A CG1   1 
ATOM   942   C CG2   . ILE A 1 154  ? 121.270 131.963 131.718 1.00 -27.71 ? 154  ILE A CG2   1 
ATOM   943   C CD1   . ILE A 1 154  ? 118.321 130.402 129.735 1.00 -27.39 ? 154  ILE A CD1   1 
ATOM   944   N N     . VAL A 1 155  ? 122.987 129.564 130.932 1.00 -27.58 ? 155  VAL A N     1 
ATOM   945   C CA    . VAL A 1 155  ? 124.106 129.356 130.023 1.00 -27.14 ? 155  VAL A CA    1 
ATOM   946   C C     . VAL A 1 155  ? 124.510 127.888 130.028 1.00 -26.44 ? 155  VAL A C     1 
ATOM   947   O O     . VAL A 1 155  ? 124.996 127.363 129.023 1.00 -26.48 ? 155  VAL A O     1 
ATOM   948   C CB    . VAL A 1 155  ? 125.339 130.200 130.423 1.00 -27.28 ? 155  VAL A CB    1 
ATOM   949   C CG1   . VAL A 1 155  ? 126.504 129.863 129.507 1.00 -27.29 ? 155  VAL A CG1   1 
ATOM   950   C CG2   . VAL A 1 155  ? 125.015 131.684 130.334 1.00 -27.30 ? 155  VAL A CG2   1 
ATOM   951   N N     . GLY A 1 156  ? 124.313 127.235 131.167 1.00 -25.60 ? 156  GLY A N     1 
ATOM   952   C CA    . GLY A 1 156  ? 124.675 125.836 131.288 1.00 -24.71 ? 156  GLY A CA    1 
ATOM   953   C C     . GLY A 1 156  ? 123.601 124.930 130.733 1.00 -23.86 ? 156  GLY A C     1 
ATOM   954   O O     . GLY A 1 156  ? 123.804 123.727 130.564 1.00 -23.96 ? 156  GLY A O     1 
ATOM   955   N N     . LEU A 1 157  ? 122.444 125.520 130.460 1.00 -23.06 ? 157  LEU A N     1 
ATOM   956   C CA    . LEU A 1 157  ? 121.310 124.797 129.909 1.00 -22.27 ? 157  LEU A CA    1 
ATOM   957   C C     . LEU A 1 157  ? 121.404 124.990 128.400 1.00 -22.18 ? 157  LEU A C     1 
ATOM   958   O O     . LEU A 1 157  ? 120.922 124.167 127.622 1.00 -22.38 ? 157  LEU A O     1 
ATOM   959   C CB    . LEU A 1 157  ? 120.001 125.389 130.465 1.00 -21.67 ? 157  LEU A CB    1 
ATOM   960   C CG    . LEU A 1 157  ? 118.660 124.647 130.352 1.00 -20.95 ? 157  LEU A CG    1 
ATOM   961   C CD1   . LEU A 1 157  ? 117.966 124.991 129.045 1.00 -20.76 ? 157  LEU A CD1   1 
ATOM   962   C CD2   . LEU A 1 157  ? 118.900 123.152 130.475 1.00 -20.69 ? 157  LEU A CD2   1 
ATOM   963   N N     . MET A 1 158  ? 122.064 126.073 128.001 1.00 -21.64 ? 158  MET A N     1 
ATOM   964   C CA    . MET A 1 158  ? 122.236 126.416 126.595 1.00 -20.79 ? 158  MET A CA    1 
ATOM   965   C C     . MET A 1 158  ? 123.335 125.628 125.879 1.00 -20.44 ? 158  MET A C     1 
ATOM   966   O O     . MET A 1 158  ? 123.193 125.291 124.703 1.00 -20.56 ? 158  MET A O     1 
ATOM   967   C CB    . MET A 1 158  ? 122.520 127.912 126.460 1.00 -19.78 ? 158  MET A CB    1 
ATOM   968   C CG    . MET A 1 158  ? 122.394 128.420 125.043 1.00 -18.57 ? 158  MET A CG    1 
ATOM   969   S SD    . MET A 1 158  ? 120.771 127.999 124.375 1.00 -17.32 ? 158  MET A SD    1 
ATOM   970   C CE    . MET A 1 158  ? 119.868 129.510 124.692 1.00 -16.92 ? 158  MET A CE    1 
ATOM   971   N N     . ILE A 1 159  ? 124.431 125.348 126.581 1.00 -19.70 ? 159  ILE A N     1 
ATOM   972   C CA    . ILE A 1 159  ? 125.533 124.599 125.983 1.00 -18.79 ? 159  ILE A CA    1 
ATOM   973   C C     . ILE A 1 159  ? 125.213 123.122 125.987 1.00 -18.16 ? 159  ILE A C     1 
ATOM   974   O O     . ILE A 1 159  ? 125.826 122.343 125.255 1.00 -18.30 ? 159  ILE A O     1 
ATOM   975   C CB    . ILE A 1 159  ? 126.851 124.773 126.748 1.00 -18.37 ? 159  ILE A CB    1 
ATOM   976   C CG1   . ILE A 1 159  ? 126.613 124.522 128.240 1.00 -18.26 ? 159  ILE A CG1   1 
ATOM   977   C CG2   . ILE A 1 159  ? 127.445 126.144 126.474 1.00 -18.10 ? 159  ILE A CG2   1 
ATOM   978   C CD1   . ILE A 1 159  ? 127.875 124.307 129.040 1.00 -18.21 ? 159  ILE A CD1   1 
ATOM   979   N N     . ASN A 1 160  ? 124.278 122.734 126.844 1.00 -17.20 ? 160  ASN A N     1 
ATOM   980   C CA    . ASN A 1 160  ? 123.892 121.340 126.918 1.00 -16.08 ? 160  ASN A CA    1 
ATOM   981   C C     . ASN A 1 160  ? 122.959 121.050 125.759 1.00 -14.82 ? 160  ASN A C     1 
ATOM   982   O O     . ASN A 1 160  ? 122.883 119.924 125.273 1.00 -15.02 ? 160  ASN A O     1 
ATOM   983   C CB    . ASN A 1 160  ? 123.188 121.033 128.235 1.00 -16.11 ? 160  ASN A CB    1 
ATOM   984   C CG    . ASN A 1 160  ? 122.694 119.608 128.295 1.00 -16.08 ? 160  ASN A CG    1 
ATOM   985   O OD1   . ASN A 1 160  ? 123.413 118.681 127.927 1.00 -16.10 ? 160  ASN A OD1   1 
ATOM   986   N ND2   . ASN A 1 160  ? 121.463 119.422 128.758 1.00 -16.07 ? 160  ASN A ND2   1 
ATOM   987   N N     . ALA A 1 161  ? 122.255 122.089 125.323 1.00 -13.23 ? 161  ALA A N     1 
ATOM   988   C CA    . ALA A 1 161  ? 121.323 121.976 124.213 1.00 -11.39 ? 161  ALA A CA    1 
ATOM   989   C C     . ALA A 1 161  ? 122.071 122.080 122.885 1.00 -9.09  ? 161  ALA A C     1 
ATOM   990   O O     . ALA A 1 161  ? 121.752 121.381 121.926 1.00 -9.36  ? 161  ALA A O     1 
ATOM   991   C CB    . ALA A 1 161  ? 120.265 123.071 124.312 1.00 -11.65 ? 161  ALA A CB    1 
ATOM   992   N N     . ILE A 1 162  ? 123.066 122.960 122.840 1.00 -6.17  ? 162  ILE A N     1 
ATOM   993   C CA    . ILE A 1 162  ? 123.875 123.173 121.643 1.00 -3.04  ? 162  ILE A CA    1 
ATOM   994   C C     . ILE A 1 162  ? 124.693 121.937 121.304 1.00 -0.50  ? 162  ILE A C     1 
ATOM   995   O O     . ILE A 1 162  ? 125.038 121.697 120.147 1.00 -0.63  ? 162  ILE A O     1 
ATOM   996   C CB    . ILE A 1 162  ? 124.819 124.372 121.843 1.00 -2.21  ? 162  ILE A CB    1 
ATOM   997   C CG1   . ILE A 1 162  ? 124.031 125.662 121.623 1.00 -1.73  ? 162  ILE A CG1   1 
ATOM   998   C CG2   . ILE A 1 162  ? 126.010 124.282 120.903 1.00 -2.04  ? 162  ILE A CG2   1 
ATOM   999   C CD1   . ILE A 1 162  ? 124.593 126.855 122.346 1.00 -1.44  ? 162  ILE A CD1   1 
ATOM   1000  N N     . MET A 1 163  ? 124.999 121.156 122.326 1.00 2.19   ? 163  MET A N     1 
ATOM   1001  C CA    . MET A 1 163  ? 125.780 119.949 122.142 1.00 4.78   ? 163  MET A CA    1 
ATOM   1002  C C     . MET A 1 163  ? 124.930 118.843 121.518 1.00 6.19   ? 163  MET A C     1 
ATOM   1003  O O     . MET A 1 163  ? 125.433 118.002 120.772 1.00 6.22   ? 163  MET A O     1 
ATOM   1004  C CB    . MET A 1 163  ? 126.330 119.490 123.491 1.00 5.87   ? 163  MET A CB    1 
ATOM   1005  C CG    . MET A 1 163  ? 127.222 118.279 123.411 1.00 6.84   ? 163  MET A CG    1 
ATOM   1006  S SD    . MET A 1 163  ? 127.833 117.807 125.033 1.00 7.69   ? 163  MET A SD    1 
ATOM   1007  C CE    . MET A 1 163  ? 126.615 116.603 125.497 1.00 7.71   ? 163  MET A CE    1 
ATOM   1008  N N     . LEU A 1 164  ? 123.637 118.866 121.818 1.00 7.49   ? 164  LEU A N     1 
ATOM   1009  C CA    . LEU A 1 164  ? 122.698 117.872 121.311 1.00 8.81   ? 164  LEU A CA    1 
ATOM   1010  C C     . LEU A 1 164  ? 122.552 117.957 119.798 1.00 9.70   ? 164  LEU A C     1 
ATOM   1011  O O     . LEU A 1 164  ? 122.391 116.948 119.115 1.00 9.59   ? 164  LEU A O     1 
ATOM   1012  C CB    . LEU A 1 164  ? 121.321 118.079 121.952 1.00 9.11   ? 164  LEU A CB    1 
ATOM   1013  C CG    . LEU A 1 164  ? 121.187 117.861 123.461 1.00 9.46   ? 164  LEU A CG    1 
ATOM   1014  C CD1   . LEU A 1 164  ? 119.794 118.258 123.916 1.00 9.54   ? 164  LEU A CD1   1 
ATOM   1015  C CD2   . LEU A 1 164  ? 121.440 116.399 123.781 1.00 9.56   ? 164  LEU A CD2   1 
ATOM   1016  N N     . GLY A 1 165  ? 122.586 119.179 119.283 1.00 10.81  ? 165  GLY A N     1 
ATOM   1017  C CA    . GLY A 1 165  ? 122.448 119.379 117.855 1.00 12.01  ? 165  GLY A CA    1 
ATOM   1018  C C     . GLY A 1 165  ? 123.725 119.115 117.085 1.00 13.32  ? 165  GLY A C     1 
ATOM   1019  O O     . GLY A 1 165  ? 123.682 118.821 115.893 1.00 13.23  ? 165  GLY A O     1 
ATOM   1020  N N     . CYS A 1 166  ? 124.865 119.217 117.757 1.00 14.86  ? 166  CYS A N     1 
ATOM   1021  C CA    . CYS A 1 166  ? 126.141 119.002 117.088 1.00 16.60  ? 166  CYS A CA    1 
ATOM   1022  C C     . CYS A 1 166  ? 126.479 117.523 116.959 1.00 17.57  ? 166  CYS A C     1 
ATOM   1023  O O     . CYS A 1 166  ? 127.091 117.106 115.977 1.00 17.49  ? 166  CYS A O     1 
ATOM   1024  C CB    . CYS A 1 166  ? 127.266 119.700 117.840 1.00 17.37  ? 166  CYS A CB    1 
ATOM   1025  S SG    . CYS A 1 166  ? 128.718 120.010 116.810 1.00 17.93  ? 166  CYS A SG    1 
ATOM   1026  N N     . ILE A 1 167  ? 126.073 116.738 117.951 1.00 18.62  ? 167  ILE A N     1 
ATOM   1027  C CA    . ILE A 1 167  ? 126.342 115.305 117.957 1.00 19.67  ? 167  ILE A CA    1 
ATOM   1028  C C     . ILE A 1 167  ? 125.397 114.579 117.010 1.00 19.78  ? 167  ILE A C     1 
ATOM   1029  O O     . ILE A 1 167  ? 125.735 113.530 116.456 1.00 19.77  ? 167  ILE A O     1 
ATOM   1030  C CB    . ILE A 1 167  ? 126.197 114.730 119.379 1.00 20.48  ? 167  ILE A CB    1 
ATOM   1031  C CG1   . ILE A 1 167  ? 124.818 115.084 119.943 1.00 20.92  ? 167  ILE A CG1   1 
ATOM   1032  C CG2   . ILE A 1 167  ? 127.284 115.298 120.289 1.00 20.65  ? 167  ILE A CG2   1 
ATOM   1033  C CD1   . ILE A 1 167  ? 123.884 113.904 120.102 1.00 21.17  ? 167  ILE A CD1   1 
ATOM   1034  N N     . PHE A 1 168  ? 124.208 115.141 116.842 1.00 20.09  ? 168  PHE A N     1 
ATOM   1035  C CA    . PHE A 1 168  ? 123.202 114.570 115.963 1.00 20.89  ? 168  PHE A CA    1 
ATOM   1036  C C     . PHE A 1 168  ? 123.688 114.676 114.518 1.00 21.04  ? 168  PHE A C     1 
ATOM   1037  O O     . PHE A 1 168  ? 123.559 113.733 113.736 1.00 20.89  ? 168  PHE A O     1 
ATOM   1038  C CB    . PHE A 1 168  ? 121.882 115.333 116.128 1.00 22.00  ? 168  PHE A CB    1 
ATOM   1039  C CG    . PHE A 1 168  ? 120.781 114.842 115.231 1.00 23.28  ? 168  PHE A CG    1 
ATOM   1040  C CD1   . PHE A 1 168  ? 119.826 113.955 115.706 1.00 23.79  ? 168  PHE A CD1   1 
ATOM   1041  C CD2   . PHE A 1 168  ? 120.712 115.254 113.905 1.00 23.85  ? 168  PHE A CD2   1 
ATOM   1042  C CE1   . PHE A 1 168  ? 118.815 113.481 114.874 1.00 24.13  ? 168  PHE A CE1   1 
ATOM   1043  C CE2   . PHE A 1 168  ? 119.707 114.787 113.061 1.00 24.09  ? 168  PHE A CE2   1 
ATOM   1044  C CZ    . PHE A 1 168  ? 118.755 113.900 113.546 1.00 24.20  ? 168  PHE A CZ    1 
ATOM   1045  N N     . MET A 1 169  ? 124.255 115.829 114.179 1.00 21.52  ? 169  MET A N     1 
ATOM   1046  C CA    . MET A 1 169  ? 124.740 116.088 112.829 1.00 22.04  ? 169  MET A CA    1 
ATOM   1047  C C     . MET A 1 169  ? 125.813 115.098 112.388 1.00 21.42  ? 169  MET A C     1 
ATOM   1048  O O     . MET A 1 169  ? 125.999 114.866 111.192 1.00 21.16  ? 169  MET A O     1 
ATOM   1049  C CB    . MET A 1 169  ? 125.303 117.508 112.736 1.00 23.08  ? 169  MET A CB    1 
ATOM   1050  C CG    . MET A 1 169  ? 124.267 118.604 112.913 1.00 23.75  ? 169  MET A CG    1 
ATOM   1051  S SD    . MET A 1 169  ? 122.969 118.516 111.665 1.00 24.21  ? 169  MET A SD    1 
ATOM   1052  C CE    . MET A 1 169  ? 123.871 118.919 110.183 1.00 24.35  ? 169  MET A CE    1 
ATOM   1053  N N     . LYS A 1 170  ? 126.520 114.530 113.356 1.00 21.13  ? 170  LYS A N     1 
ATOM   1054  C CA    . LYS A 1 170  ? 127.569 113.561 113.066 1.00 20.88  ? 170  LYS A CA    1 
ATOM   1055  C C     . LYS A 1 170  ? 126.970 112.166 113.014 1.00 20.54  ? 170  LYS A C     1 
ATOM   1056  O O     . LYS A 1 170  ? 127.582 111.233 112.492 1.00 20.42  ? 170  LYS A O     1 
ATOM   1057  C CB    . LYS A 1 170  ? 128.660 113.612 114.138 1.00 21.00  ? 170  LYS A CB    1 
ATOM   1058  N N     . THR A 1 171  ? 125.769 112.030 113.564 1.00 20.47  ? 171  THR A N     1 
ATOM   1059  C CA    . THR A 1 171  ? 125.074 110.749 113.580 1.00 20.54  ? 171  THR A CA    1 
ATOM   1060  C C     . THR A 1 171  ? 124.404 110.545 112.227 1.00 20.07  ? 171  THR A C     1 
ATOM   1061  O O     . THR A 1 171  ? 123.912 109.463 111.922 1.00 20.17  ? 171  THR A O     1 
ATOM   1062  C CB    . THR A 1 171  ? 123.981 110.707 114.675 1.00 21.07  ? 171  THR A CB    1 
ATOM   1063  N N     . ALA A 1 172  ? 124.391 111.602 111.425 1.00 19.53  ? 172  ALA A N     1 
ATOM   1064  C CA    . ALA A 1 172  ? 123.762 111.555 110.109 1.00 19.18  ? 172  ALA A CA    1 
ATOM   1065  C C     . ALA A 1 172  ? 124.724 111.651 108.932 1.00 18.96  ? 172  ALA A C     1 
ATOM   1066  O O     . ALA A 1 172  ? 124.290 111.882 107.803 1.00 18.87  ? 172  ALA A O     1 
ATOM   1067  C CB    . ALA A 1 172  ? 122.723 112.661 110.002 1.00 19.15  ? 172  ALA A CB    1 
ATOM   1068  N N     . GLN A 1 173  ? 126.021 111.499 109.169 1.00 59.63  ? 173  GLN A N     1 
ATOM   1069  C CA    . GLN A 1 173  ? 126.952 111.594 108.053 1.00 59.54  ? 173  GLN A CA    1 
ATOM   1070  C C     . GLN A 1 173  ? 126.907 110.322 107.221 1.00 58.65  ? 173  GLN A C     1 
ATOM   1071  O O     . GLN A 1 173  ? 127.070 109.214 107.732 1.00 58.72  ? 173  GLN A O     1 
ATOM   1072  C CB    . GLN A 1 173  ? 128.374 111.869 108.538 1.00 60.18  ? 173  GLN A CB    1 
ATOM   1073  C CG    . GLN A 1 173  ? 129.094 110.704 109.163 1.00 60.81  ? 173  GLN A CG    1 
ATOM   1074  C CD    . GLN A 1 173  ? 130.477 111.106 109.625 1.00 61.28  ? 173  GLN A CD    1 
ATOM   1075  O OE1   . GLN A 1 173  ? 131.158 111.886 108.957 1.00 61.43  ? 173  GLN A OE1   1 
ATOM   1076  N NE2   . GLN A 1 173  ? 130.908 110.569 110.758 1.00 61.42  ? 173  GLN A NE2   1 
ATOM   1077  N N     . ALA A 1 174  ? 126.689 110.509 105.923 1.00 57.79  ? 174  ALA A N     1 
ATOM   1078  C CA    . ALA A 1 174  ? 126.576 109.401 104.983 1.00 56.79  ? 174  ALA A CA    1 
ATOM   1079  C C     . ALA A 1 174  ? 127.799 109.133 104.103 1.00 56.07  ? 174  ALA A C     1 
ATOM   1080  O O     . ALA A 1 174  ? 127.670 108.507 103.051 1.00 55.30  ? 174  ALA A O     1 
ATOM   1081  C CB    . ALA A 1 174  ? 125.359 109.626 104.098 1.00 56.88  ? 174  ALA A CB    1 
ATOM   1082  N N     . HIS A 1 175  ? 129.024 109.387 104.544 1.00 55.63  ? 175  HIS A N     1 
ATOM   1083  C CA    . HIS A 1 175  ? 130.182 108.912 103.745 1.00 55.73  ? 175  HIS A CA    1 
ATOM   1084  C C     . HIS A 1 175  ? 130.301 107.338 103.761 1.00 55.04  ? 175  HIS A C     1 
ATOM   1085  O O     . HIS A 1 175  ? 130.613 106.627 102.744 1.00 55.30  ? 175  HIS A O     1 
ATOM   1086  C CB    . HIS A 1 175  ? 131.476 109.550 104.250 1.00 55.95  ? 175  HIS A CB    1 
ATOM   1087  C CG    . HIS A 1 175  ? 131.482 111.045 104.172 1.00 56.52  ? 175  HIS A CG    1 
ATOM   1088  N ND1   . HIS A 1 175  ? 131.519 111.726 102.975 1.00 56.69  ? 175  HIS A ND1   1 
ATOM   1089  C CD2   . HIS A 1 175  ? 131.459 111.989 105.142 1.00 56.72  ? 175  HIS A CD2   1 
ATOM   1090  C CE1   . HIS A 1 175  ? 131.517 113.026 103.211 1.00 56.85  ? 175  HIS A CE1   1 
ATOM   1091  N NE2   . HIS A 1 175  ? 131.481 113.212 104.518 1.00 56.88  ? 175  HIS A NE2   1 
ATOM   1092  N N     . ARG A 1 176  ? 130.009 106.800 104.944 1.00 54.88  ? 176  ARG A N     1 
ATOM   1093  C CA    . ARG A 1 176  ? 130.108 105.367 105.222 1.00 53.36  ? 176  ARG A CA    1 
ATOM   1094  C C     . ARG A 1 176  ? 129.202 104.548 104.321 1.00 51.38  ? 176  ARG A C     1 
ATOM   1095  O O     . ARG A 1 176  ? 129.584 103.473 103.860 1.00 51.04  ? 176  ARG A O     1 
ATOM   1096  C CB    . ARG A 1 176  ? 129.806 105.084 106.694 1.00 54.52  ? 176  ARG A CB    1 
ATOM   1097  C CG    . ARG A 1 176  ? 130.671 105.886 107.652 1.00 55.25  ? 176  ARG A CG    1 
ATOM   1098  C CD    . ARG A 1 176  ? 132.129 105.849 107.225 1.00 55.77  ? 176  ARG A CD    1 
ATOM   1099  N NE    . ARG A 1 176  ? 132.944 106.809 107.962 1.00 56.16  ? 176  ARG A NE    1 
ATOM   1100  C CZ    . ARG A 1 176  ? 134.231 107.034 107.723 1.00 56.49  ? 176  ARG A CZ    1 
ATOM   1101  N NH1   . ARG A 1 176  ? 134.856 106.366 106.763 1.00 56.55  ? 176  ARG A NH1   1 
ATOM   1102  N NH2   . ARG A 1 176  ? 134.896 107.926 108.444 1.00 56.59  ? 176  ARG A NH2   1 
ATOM   1103  N N     . ARG A 1 177  ? 128.004 105.062 104.051 1.00 49.35  ? 177  ARG A N     1 
ATOM   1104  C CA    . ARG A 1 177  ? 127.069 104.392 103.148 1.00 47.52  ? 177  ARG A CA    1 
ATOM   1105  C C     . ARG A 1 177  ? 127.664 104.313 101.740 1.00 45.77  ? 177  ARG A C     1 
ATOM   1106  O O     . ARG A 1 177  ? 127.520 103.305 101.050 1.00 45.88  ? 177  ARG A O     1 
ATOM   1107  C CB    . ARG A 1 177  ? 125.718 105.104 103.124 1.00 47.28  ? 177  ARG A CB    1 
ATOM   1108  C CG    . ARG A 1 177  ? 124.787 104.689 104.249 1.00 47.14  ? 177  ARG A CG    1 
ATOM   1109  C CD    . ARG A 1 177  ? 124.774 103.177 104.408 1.00 47.11  ? 177  ARG A CD    1 
ATOM   1110  N NE    . ARG A 1 177  ? 124.648 102.493 103.124 1.00 47.09  ? 177  ARG A NE    1 
ATOM   1111  C CZ    . ARG A 1 177  ? 123.494 102.107 102.593 1.00 47.05  ? 177  ARG A CZ    1 
ATOM   1112  N NH1   . ARG A 1 177  ? 122.356 102.335 103.235 1.00 47.03  ? 177  ARG A NH1   1 
ATOM   1113  N NH2   . ARG A 1 177  ? 123.474 101.490 101.419 1.00 47.04  ? 177  ARG A NH2   1 
ATOM   1114  N N     . ALA A 1 178  ? 128.338 105.386 101.326 1.00 44.03  ? 178  ALA A N     1 
ATOM   1115  C CA    . ALA A 1 178  ? 128.996 105.449 100.032 1.00 42.26  ? 178  ALA A CA    1 
ATOM   1116  C C     . ALA A 1 178  ? 130.105 104.400 99.890  1.00 40.62  ? 178  ALA A C     1 
ATOM   1117  O O     . ALA A 1 178  ? 130.320 103.910 98.779  1.00 40.46  ? 178  ALA A O     1 
ATOM   1118  C CB    . ALA A 1 178  ? 129.516 106.849 99.734  1.00 42.30  ? 178  ALA A CB    1 
ATOM   1119  N N     . GLU A 1 179  ? 130.808 104.036 100.975 1.00 39.32  ? 179  GLU A N     1 
ATOM   1120  C CA    . GLU A 1 179  ? 131.888 103.015 100.777 1.00 38.15  ? 179  GLU A CA    1 
ATOM   1121  C C     . GLU A 1 179  ? 131.452 101.630 100.160 1.00 36.54  ? 179  GLU A C     1 
ATOM   1122  O O     . GLU A 1 179  ? 132.102 101.133 99.242  1.00 36.67  ? 179  GLU A O     1 
ATOM   1123  C CB    . GLU A 1 179  ? 132.652 102.793 102.085 1.00 38.53  ? 179  GLU A CB    1 
ATOM   1124  C CG    . GLU A 1 179  ? 133.819 101.825 101.974 1.00 38.74  ? 179  GLU A CG    1 
ATOM   1125  C CD    . GLU A 1 179  ? 134.922 102.341 101.069 1.00 38.74  ? 179  GLU A CD    1 
ATOM   1126  O OE1   . GLU A 1 179  ? 134.899 103.540 100.725 1.00 38.69  ? 179  GLU A OE1   1 
ATOM   1127  O OE2   . GLU A 1 179  ? 135.809 101.544 100.699 1.00 38.69  ? 179  GLU A OE2   1 
ATOM   1128  N N     . THR A 1 180  ? 130.369 101.042 100.667 1.00 34.64  ? 180  THR A N     1 
ATOM   1129  C CA    . THR A 1 180  ? 129.676 99.848  100.185 1.00 32.75  ? 180  THR A CA    1 
ATOM   1130  C C     . THR A 1 180  ? 129.495 99.870  98.664  1.00 31.03  ? 180  THR A C     1 
ATOM   1131  O O     . THR A 1 180  ? 129.101 98.872  98.060  1.00 30.73  ? 180  THR A O     1 
ATOM   1132  C CB    . THR A 1 180  ? 128.281 99.712  100.849 1.00 32.64  ? 180  THR A CB    1 
ATOM   1133  O OG1   . THR A 1 180  ? 127.474 100.846 100.518 1.00 32.62  ? 180  THR A OG1   1 
ATOM   1134  C CG2   . THR A 1 180  ? 128.421 99.630  102.369 1.00 32.64  ? 180  THR A CG2   1 
ATOM   1135  N N     . LEU A 1 181  ? 129.778 101.017 98.055  1.00 29.81  ? 181  LEU A N     1 
ATOM   1136  C CA    . LEU A 1 181  ? 129.663 101.178 96.609  1.00 28.79  ? 181  LEU A CA    1 
ATOM   1137  C C     . LEU A 1 181  ? 131.027 100.847 96.008  1.00 27.99  ? 181  LEU A C     1 
ATOM   1138  O O     . LEU A 1 181  ? 131.948 101.659 96.059  1.00 27.80  ? 181  LEU A O     1 
ATOM   1139  C CB    . LEU A 1 181  ? 129.274 102.614 96.283  1.00 28.72  ? 181  LEU A CB    1 
ATOM   1140  C CG    . LEU A 1 181  ? 127.889 103.030 96.789  1.00 28.70  ? 181  LEU A CG    1 
ATOM   1141  C CD1   . LEU A 1 181  ? 127.789 104.543 96.807  1.00 28.69  ? 181  LEU A CD1   1 
ATOM   1142  C CD2   . LEU A 1 181  ? 126.808 102.414 95.908  1.00 28.70  ? 181  LEU A CD2   1 
ATOM   1143  N N     . ILE A 1 182  ? 131.143 99.654  95.434  1.00 27.69  ? 182  ILE A N     1 
ATOM   1144  C CA    . ILE A 1 182  ? 132.402 99.189  94.864  1.00 27.79  ? 182  ILE A CA    1 
ATOM   1145  C C     . ILE A 1 182  ? 132.555 99.296  93.350  1.00 27.69  ? 182  ILE A C     1 
ATOM   1146  O O     . ILE A 1 182  ? 131.625 99.028  92.592  1.00 27.70  ? 182  ILE A O     1 
ATOM   1147  C CB    . ILE A 1 182  ? 132.668 97.718  95.261  1.00 28.13  ? 182  ILE A CB    1 
ATOM   1148  C CG1   . ILE A 1 182  ? 132.792 97.593  96.785  1.00 28.44  ? 182  ILE A CG1   1 
ATOM   1149  C CG2   . ILE A 1 182  ? 133.921 97.219  94.592  1.00 28.19  ? 182  ILE A CG2   1 
ATOM   1150  C CD1   . ILE A 1 182  ? 133.998 98.298  97.377  1.00 28.50  ? 182  ILE A CD1   1 
ATOM   1151  N N     . PHE A 1 183  ? 133.759 99.678  92.929  1.00 27.75  ? 183  PHE A N     1 
ATOM   1152  C CA    . PHE A 1 183  ? 134.106 99.810  91.520  1.00 27.80  ? 183  PHE A CA    1 
ATOM   1153  C C     . PHE A 1 183  ? 135.153 98.751  91.201  1.00 27.80  ? 183  PHE A C     1 
ATOM   1154  O O     . PHE A 1 183  ? 135.905 98.319  92.080  1.00 27.84  ? 183  PHE A O     1 
ATOM   1155  C CB    . PHE A 1 183  ? 134.689 101.195 91.233  1.00 27.99  ? 183  PHE A CB    1 
ATOM   1156  C CG    . PHE A 1 183  ? 133.707 102.320 91.392  1.00 28.23  ? 183  PHE A CG    1 
ATOM   1157  C CD1   . PHE A 1 183  ? 132.564 102.385 90.605  1.00 28.34  ? 183  PHE A CD1   1 
ATOM   1158  C CD2   . PHE A 1 183  ? 133.943 103.333 92.318  1.00 28.37  ? 183  PHE A CD2   1 
ATOM   1159  C CE1   . PHE A 1 183  ? 131.667 103.444 90.734  1.00 28.42  ? 183  PHE A CE1   1 
ATOM   1160  C CE2   . PHE A 1 183  ? 133.050 104.397 92.453  1.00 28.41  ? 183  PHE A CE2   1 
ATOM   1161  C CZ    . PHE A 1 183  ? 131.914 104.452 91.662  1.00 28.43  ? 183  PHE A CZ    1 
ATOM   1162  N N     . SER A 1 184  ? 135.207 98.352  89.936  1.00 27.62  ? 184  SER A N     1 
ATOM   1163  C CA    . SER A 1 184  ? 136.134 97.329  89.470  1.00 27.42  ? 184  SER A CA    1 
ATOM   1164  C C     . SER A 1 184  ? 137.608 97.732  89.504  1.00 27.26  ? 184  SER A C     1 
ATOM   1165  O O     . SER A 1 184  ? 137.951 98.893  89.728  1.00 27.10  ? 184  SER A O     1 
ATOM   1166  C CB    . SER A 1 184  ? 135.735 96.885  88.057  1.00 27.23  ? 184  SER A CB    1 
ATOM   1167  O OG    . SER A 1 184  ? 135.637 97.983  87.164  1.00 27.07  ? 184  SER A OG    1 
ATOM   1168  N N     . LYS A 1 185  ? 138.467 96.742  89.286  1.00 47.53  ? 185  LYS A N     1 
ATOM   1169  C CA    . LYS A 1 185  ? 139.917 96.915  89.288  1.00 47.51  ? 185  LYS A CA    1 
ATOM   1170  C C     . LYS A 1 185  ? 140.398 97.623  88.026  1.00 47.69  ? 185  LYS A C     1 
ATOM   1171  O O     . LYS A 1 185  ? 141.155 98.593  88.092  1.00 47.22  ? 185  LYS A O     1 
ATOM   1172  C CB    . LYS A 1 185  ? 140.590 95.544  89.391  1.00 47.38  ? 185  LYS A CB    1 
ATOM   1173  N N     . HIS A 1 186  ? 139.954 97.119  86.878  1.00 48.59  ? 186  HIS A N     1 
ATOM   1174  C CA    . HIS A 1 186  ? 140.318 97.684  85.584  1.00 49.60  ? 186  HIS A CA    1 
ATOM   1175  C C     . HIS A 1 186  ? 139.082 97.895  84.716  1.00 49.79  ? 186  HIS A C     1 
ATOM   1176  O O     . HIS A 1 186  ? 137.989 97.445  85.059  1.00 49.46  ? 186  HIS A O     1 
ATOM   1177  C CB    . HIS A 1 186  ? 141.301 96.756  84.865  1.00 50.57  ? 186  HIS A CB    1 
ATOM   1178  C CG    . HIS A 1 186  ? 142.724 96.924  85.301  1.00 51.44  ? 186  HIS A CG    1 
ATOM   1179  N ND1   . HIS A 1 186  ? 143.089 97.025  86.625  1.00 51.74  ? 186  HIS A ND1   1 
ATOM   1180  C CD2   . HIS A 1 186  ? 143.873 96.989  84.587  1.00 51.78  ? 186  HIS A CD2   1 
ATOM   1181  C CE1   . HIS A 1 186  ? 144.401 97.144  86.711  1.00 51.87  ? 186  HIS A CE1   1 
ATOM   1182  N NE2   . HIS A 1 186  ? 144.902 97.122  85.488  1.00 51.88  ? 186  HIS A NE2   1 
ATOM   1183  N N     . ALA A 1 187  ? 139.270 98.550  83.573  1.00 50.64  ? 187  ALA A N     1 
ATOM   1184  C CA    . ALA A 1 187  ? 138.179 98.813  82.635  1.00 51.79  ? 187  ALA A CA    1 
ATOM   1185  C C     . ALA A 1 187  ? 138.395 98.074  81.312  1.00 53.24  ? 187  ALA A C     1 
ATOM   1186  O O     . ALA A 1 187  ? 139.485 97.567  81.050  1.00 52.91  ? 187  ALA A O     1 
ATOM   1187  C CB    . ALA A 1 187  ? 138.035 100.307 82.394  1.00 51.63  ? 187  ALA A CB    1 
ATOM   1188  N N     . VAL A 1 188  ? 137.357 98.019  80.480  1.00 55.21  ? 188  VAL A N     1 
ATOM   1189  C CA    . VAL A 1 188  ? 137.441 97.327  79.193  1.00 57.04  ? 188  VAL A CA    1 
ATOM   1190  C C     . VAL A 1 188  ? 136.855 98.121  78.024  1.00 57.38  ? 188  VAL A C     1 
ATOM   1191  O O     . VAL A 1 188  ? 135.951 98.936  78.207  1.00 57.33  ? 188  VAL A O     1 
ATOM   1192  C CB    . VAL A 1 188  ? 136.749 95.952  79.248  1.00 58.41  ? 188  VAL A CB    1 
ATOM   1193  C CG1   . VAL A 1 188  ? 137.527 95.001  80.144  1.00 58.87  ? 188  VAL A CG1   1 
ATOM   1194  C CG2   . VAL A 1 188  ? 135.314 96.100  79.729  1.00 58.88  ? 188  VAL A CG2   1 
ATOM   1195  N N     . ILE A 1 189  ? 137.376 97.870  76.825  1.00 57.72  ? 189  ILE A N     1 
ATOM   1196  C CA    . ILE A 1 189  ? 136.912 98.543  75.611  1.00 58.29  ? 189  ILE A CA    1 
ATOM   1197  C C     . ILE A 1 189  ? 136.744 97.554  74.455  1.00 59.26  ? 189  ILE A C     1 
ATOM   1198  O O     . ILE A 1 189  ? 137.728 97.152  73.834  1.00 58.92  ? 189  ILE A O     1 
ATOM   1199  C CB    . ILE A 1 189  ? 137.870 99.668  75.178  1.00 58.00  ? 189  ILE A CB    1 
ATOM   1200  C CG1   . ILE A 1 189  ? 137.850 100.808 76.197  1.00 58.00  ? 189  ILE A CG1   1 
ATOM   1201  C CG2   . ILE A 1 189  ? 137.491 100.187 73.800  1.00 57.91  ? 189  ILE A CG2   1 
ATOM   1202  C CD1   . ILE A 1 189  ? 138.715 101.988 75.810  1.00 58.05  ? 189  ILE A CD1   1 
ATOM   1203  N N     . THR A 1 190  ? 135.497 97.158  74.165  1.00 60.85  ? 190  THR A N     1 
ATOM   1204  C CA    . THR A 1 190  ? 135.208 96.189  73.115  1.00 62.63  ? 190  THR A CA    1 
ATOM   1205  C C     . THR A 1 190  ? 133.981 96.646  72.314  1.00 63.39  ? 190  THR A C     1 
ATOM   1206  O O     . THR A 1 190  ? 133.089 97.304  72.844  1.00 63.50  ? 190  THR A O     1 
ATOM   1207  C CB    . THR A 1 190  ? 134.953 94.784  73.711  1.00 63.35  ? 190  THR A CB    1 
ATOM   1208  O OG1   . THR A 1 190  ? 134.946 93.809  72.659  1.00 63.67  ? 190  THR A OG1   1 
ATOM   1209  C CG2   . THR A 1 190  ? 133.616 94.744  74.441  1.00 63.66  ? 190  THR A CG2   1 
ATOM   1210  N N     . PRO A 1 191  ? 133.927 96.304  71.019  1.00 64.60  ? 191  PRO A N     1 
ATOM   1211  C CA    . PRO A 1 191  ? 132.795 96.703  70.176  1.00 64.60  ? 191  PRO A CA    1 
ATOM   1212  C C     . PRO A 1 191  ? 131.528 95.880  70.342  1.00 65.54  ? 191  PRO A C     1 
ATOM   1213  O O     . PRO A 1 191  ? 131.548 94.654  70.212  1.00 65.13  ? 191  PRO A O     1 
ATOM   1214  C CB    . PRO A 1 191  ? 133.358 96.578  68.770  1.00 65.11  ? 191  PRO A CB    1 
ATOM   1215  C CG    . PRO A 1 191  ? 134.296 95.418  68.904  1.00 64.77  ? 191  PRO A CG    1 
ATOM   1216  C CD    . PRO A 1 191  ? 135.012 95.740  70.201  1.00 64.57  ? 191  PRO A CD    1 
ATOM   1217  N N     . ARG A 1 192  ? 130.426 96.574  70.601  1.00 65.98  ? 192  ARG A N     1 
ATOM   1218  C CA    . ARG A 1 192  ? 129.123 95.947  70.780  1.00 66.90  ? 192  ARG A CA    1 
ATOM   1219  C C     . ARG A 1 192  ? 128.179 96.391  69.664  1.00 66.82  ? 192  ARG A C     1 
ATOM   1220  O O     . ARG A 1 192  ? 128.035 97.582  69.412  1.00 66.62  ? 192  ARG A O     1 
ATOM   1221  C CB    . ARG A 1 192  ? 128.538 96.352  72.124  1.00 67.80  ? 192  ARG A CB    1 
ATOM   1222  C CG    . ARG A 1 192  ? 127.364 95.511  72.548  1.00 68.73  ? 192  ARG A CG    1 
ATOM   1223  C CD    . ARG A 1 192  ? 127.464 95.162  74.024  1.00 69.47  ? 192  ARG A CD    1 
ATOM   1224  N NE    . ARG A 1 192  ? 127.176 96.295  74.895  1.00 70.04  ? 192  ARG A NE    1 
ATOM   1225  C CZ    . ARG A 1 192  ? 125.971 96.834  75.038  1.00 70.40  ? 192  ARG A CZ    1 
ATOM   1226  N NH1   . ARG A 1 192  ? 124.946 96.337  74.356  1.00 70.51  ? 192  ARG A NH1   1 
ATOM   1227  N NH2   . ARG A 1 192  ? 125.782 97.855  75.861  1.00 70.50  ? 192  ARG A NH2   1 
ATOM   1228  N N     . HIS A 1 193  ? 127.518 95.437  69.018  1.00 67.17  ? 193  HIS A N     1 
ATOM   1229  C CA    . HIS A 1 193  ? 126.591 95.744  67.922  1.00 67.49  ? 193  HIS A CA    1 
ATOM   1230  C C     . HIS A 1 193  ? 127.263 96.417  66.733  1.00 67.50  ? 193  HIS A C     1 
ATOM   1231  O O     . HIS A 1 193  ? 126.587 96.986  65.872  1.00 67.57  ? 193  HIS A O     1 
ATOM   1232  C CB    . HIS A 1 193  ? 125.476 96.667  68.409  1.00 67.73  ? 193  HIS A CB    1 
ATOM   1233  C CG    . HIS A 1 193  ? 124.663 96.106  69.529  1.00 67.91  ? 193  HIS A CG    1 
ATOM   1234  N ND1   . HIS A 1 193  ? 124.082 94.858  69.473  1.00 68.00  ? 193  HIS A ND1   1 
ATOM   1235  C CD2   . HIS A 1 193  ? 124.305 96.637  70.722  1.00 67.96  ? 193  HIS A CD2   1 
ATOM   1236  C CE1   . HIS A 1 193  ? 123.398 94.644  70.582  1.00 68.03  ? 193  HIS A CE1   1 
ATOM   1237  N NE2   . HIS A 1 193  ? 123.516 95.709  71.356  1.00 68.01  ? 193  HIS A NE2   1 
ATOM   1238  N N     . GLY A 1 194  ? 128.584 96.339  66.665  1.00 67.40  ? 194  GLY A N     1 
ATOM   1239  C CA    . GLY A 1 194  ? 129.281 96.958  65.555  1.00 67.28  ? 194  GLY A CA    1 
ATOM   1240  C C     . GLY A 1 194  ? 129.887 98.301  65.899  1.00 67.11  ? 194  GLY A C     1 
ATOM   1241  O O     . GLY A 1 194  ? 130.451 98.970  65.036  1.00 67.15  ? 194  GLY A O     1 
ATOM   1242  N N     . ARG A 1 195  ? 129.772 98.707  67.155  1.00 66.83  ? 195  ARG A N     1 
ATOM   1243  C CA    . ARG A 1 195  ? 130.343 99.976  67.574  1.00 66.57  ? 195  ARG A CA    1 
ATOM   1244  C C     . ARG A 1 195  ? 131.207 99.779  68.816  1.00 65.52  ? 195  ARG A C     1 
ATOM   1245  O O     . ARG A 1 195  ? 130.839 99.048  69.735  1.00 65.35  ? 195  ARG A O     1 
ATOM   1246  C CB    . ARG A 1 195  ? 129.234 100.995 67.848  1.00 67.19  ? 195  ARG A CB    1 
ATOM   1247  C CG    . ARG A 1 195  ? 128.358 101.310 66.634  1.00 67.82  ? 195  ARG A CG    1 
ATOM   1248  C CD    . ARG A 1 195  ? 127.231 102.265 66.995  1.00 68.43  ? 195  ARG A CD    1 
ATOM   1249  N NE    . ARG A 1 195  ? 126.439 102.672 65.837  1.00 68.97  ? 195  ARG A NE    1 
ATOM   1250  C CZ    . ARG A 1 195  ? 125.307 103.365 65.919  1.00 69.39  ? 195  ARG A CZ    1 
ATOM   1251  N NH1   . ARG A 1 195  ? 124.839 103.720 67.109  1.00 69.53  ? 195  ARG A NH1   1 
ATOM   1252  N NH2   . ARG A 1 195  ? 124.646 103.707 64.819  1.00 69.54  ? 195  ARG A NH2   1 
ATOM   1253  N N     . LEU A 1 196  ? 132.361 100.439 68.823  1.00 64.97  ? 196  LEU A N     1 
ATOM   1254  C CA    . LEU A 1 196  ? 133.325 100.365 69.920  1.00 64.44  ? 196  LEU A CA    1 
ATOM   1255  C C     . LEU A 1 196  ? 132.786 101.050 71.176  1.00 63.75  ? 196  LEU A C     1 
ATOM   1256  O O     . LEU A 1 196  ? 132.233 102.148 71.105  1.00 63.61  ? 196  LEU A O     1 
ATOM   1257  C CB    . LEU A 1 196  ? 134.626 101.033 69.485  1.00 64.73  ? 196  LEU A CB    1 
ATOM   1258  C CG    . LEU A 1 196  ? 135.902 100.794 70.290  1.00 65.04  ? 196  LEU A CG    1 
ATOM   1259  C CD1   . LEU A 1 196  ? 136.403 99.382  70.031  1.00 65.18  ? 196  LEU A CD1   1 
ATOM   1260  C CD2   . LEU A 1 196  ? 136.962 101.804 69.874  1.00 65.11  ? 196  LEU A CD2   1 
ATOM   1261  N N     . CYS A 1 197  ? 132.881 100.377 72.316  1.00 63.28  ? 197  CYS A N     1 
ATOM   1262  C CA    . CYS A 1 197  ? 132.361 100.940 73.557  1.00 62.89  ? 197  CYS A CA    1 
ATOM   1263  C C     . CYS A 1 197  ? 133.309 100.735 74.726  1.00 62.41  ? 197  CYS A C     1 
ATOM   1264  O O     . CYS A 1 197  ? 134.083 99.789  74.739  1.00 62.55  ? 197  CYS A O     1 
ATOM   1265  C CB    . CYS A 1 197  ? 130.998 100.327 73.893  1.00 62.86  ? 197  CYS A CB    1 
ATOM   1266  S SG    . CYS A 1 197  ? 129.670 100.704 72.725  1.00 62.89  ? 197  CYS A SG    1 
ATOM   1267  N N     . PHE A 1 198  ? 133.219 101.618 75.715  1.00 61.76  ? 198  PHE A N     1 
ATOM   1268  C CA    . PHE A 1 198  ? 134.055 101.547 76.907  1.00 61.03  ? 198  PHE A CA    1 
ATOM   1269  C C     . PHE A 1 198  ? 133.179 101.058 78.051  1.00 59.30  ? 198  PHE A C     1 
ATOM   1270  O O     . PHE A 1 198  ? 132.132 101.637 78.321  1.00 59.28  ? 198  PHE A O     1 
ATOM   1271  C CB    . PHE A 1 198  ? 134.633 102.925 77.220  1.00 62.09  ? 198  PHE A CB    1 
ATOM   1272  C CG    . PHE A 1 198  ? 135.191 103.051 78.607  1.00 63.02  ? 198  PHE A CG    1 
ATOM   1273  C CD1   . PHE A 1 198  ? 136.440 102.542 78.915  1.00 63.39  ? 198  PHE A CD1   1 
ATOM   1274  C CD2   . PHE A 1 198  ? 134.467 103.688 79.600  1.00 63.43  ? 198  PHE A CD2   1 
ATOM   1275  C CE1   . PHE A 1 198  ? 136.956 102.661 80.191  1.00 63.54  ? 198  PHE A CE1   1 
ATOM   1276  C CE2   . PHE A 1 198  ? 134.978 103.812 80.876  1.00 63.61  ? 198  PHE A CE2   1 
ATOM   1277  C CZ    . PHE A 1 198  ? 136.223 103.296 81.174  1.00 63.62  ? 198  PHE A CZ    1 
ATOM   1278  N N     . MET A 1 199  ? 133.616 100.007 78.738  1.00 57.53  ? 199  MET A N     1 
ATOM   1279  C CA    . MET A 1 199  ? 132.807 99.425  79.808  1.00 55.94  ? 199  MET A CA    1 
ATOM   1280  C C     . MET A 1 199  ? 133.353 99.515  81.233  1.00 54.64  ? 199  MET A C     1 
ATOM   1281  O O     . MET A 1 199  ? 134.515 99.209  81.496  1.00 54.55  ? 199  MET A O     1 
ATOM   1282  C CB    . MET A 1 199  ? 132.481 97.963  79.480  1.00 55.84  ? 199  MET A CB    1 
ATOM   1283  N N     . LEU A 1 200  ? 132.480 99.943  82.143  1.00 53.59  ? 200  LEU A N     1 
ATOM   1284  C CA    . LEU A 1 200  ? 132.793 100.058 83.562  1.00 52.62  ? 200  LEU A CA    1 
ATOM   1285  C C     . LEU A 1 200  ? 131.664 99.407  84.353  1.00 51.31  ? 200  LEU A C     1 
ATOM   1286  O O     . LEU A 1 200  ? 130.492 99.581  84.026  1.00 51.12  ? 200  LEU A O     1 
ATOM   1287  C CB    . LEU A 1 200  ? 132.960 101.518 83.976  1.00 53.04  ? 200  LEU A CB    1 
ATOM   1288  C CG    . LEU A 1 200  ? 134.351 102.114 83.753  1.00 53.47  ? 200  LEU A CG    1 
ATOM   1289  C CD1   . LEU A 1 200  ? 134.393 103.561 84.216  1.00 53.61  ? 200  LEU A CD1   1 
ATOM   1290  C CD2   . LEU A 1 200  ? 135.405 101.286 84.471  1.00 53.60  ? 200  LEU A CD2   1 
ATOM   1291  N N     . ARG A 1 201  ? 132.019 98.665  85.395  1.00 50.38  ? 201  ARG A N     1 
ATOM   1292  C CA    . ARG A 1 201  ? 131.034 97.962  86.207  1.00 49.63  ? 201  ARG A CA    1 
ATOM   1293  C C     . ARG A 1 201  ? 131.058 98.384  87.674  1.00 48.21  ? 201  ARG A C     1 
ATOM   1294  O O     . ARG A 1 201  ? 132.121 98.530  88.278  1.00 48.10  ? 201  ARG A O     1 
ATOM   1295  C CB    . ARG A 1 201  ? 131.268 96.458  86.087  1.00 50.36  ? 201  ARG A CB    1 
ATOM   1296  C CG    . ARG A 1 201  ? 130.139 95.611  86.627  1.00 51.07  ? 201  ARG A CG    1 
ATOM   1297  C CD    . ARG A 1 201  ? 130.143 94.239  85.991  1.00 51.75  ? 201  ARG A CD    1 
ATOM   1298  N NE    . ARG A 1 201  ? 131.359 93.497  86.296  1.00 52.39  ? 201  ARG A NE    1 
ATOM   1299  C CZ    . ARG A 1 201  ? 131.614 92.274  85.846  1.00 52.88  ? 201  ARG A CZ    1 
ATOM   1300  N NH1   . ARG A 1 201  ? 130.731 91.663  85.066  1.00 53.01  ? 201  ARG A NH1   1 
ATOM   1301  N NH2   . ARG A 1 201  ? 132.743 91.660  86.177  1.00 53.07  ? 201  ARG A NH2   1 
ATOM   1302  N N     . VAL A 1 202  ? 129.862 98.563  88.236  1.00 47.04  ? 202  VAL A N     1 
ATOM   1303  C CA    . VAL A 1 202  ? 129.701 98.980  89.627  1.00 45.99  ? 202  VAL A CA    1 
ATOM   1304  C C     . VAL A 1 202  ? 128.744 98.072  90.406  1.00 45.27  ? 202  VAL A C     1 
ATOM   1305  O O     . VAL A 1 202  ? 127.763 97.567  89.856  1.00 45.24  ? 202  VAL A O     1 
ATOM   1306  C CB    . VAL A 1 202  ? 129.161 100.421 89.705  1.00 45.76  ? 202  VAL A CB    1 
ATOM   1307  C CG1   . VAL A 1 202  ? 127.829 100.520 88.966  1.00 45.70  ? 202  VAL A CG1   1 
ATOM   1308  C CG2   . VAL A 1 202  ? 128.983 100.835 91.156  1.00 45.68  ? 202  VAL A CG2   1 
ATOM   1309  N N     . GLY A 1 203  ? 129.024 97.883  91.694  1.00 44.69  ? 203  GLY A N     1 
ATOM   1310  C CA    . GLY A 1 203  ? 128.178 97.030  92.513  1.00 44.18  ? 203  GLY A CA    1 
ATOM   1311  C C     . GLY A 1 203  ? 127.885 97.532  93.915  1.00 43.72  ? 203  GLY A C     1 
ATOM   1312  O O     . GLY A 1 203  ? 128.523 98.469  94.400  1.00 43.67  ? 203  GLY A O     1 
ATOM   1313  N N     . ASP A 1 204  ? 126.916 96.894  94.567  1.00 43.34  ? 204  ASP A N     1 
ATOM   1314  C CA    . ASP A 1 204  ? 126.513 97.267  95.919  1.00 43.07  ? 204  ASP A CA    1 
ATOM   1315  C C     . ASP A 1 204  ? 126.561 96.070  96.866  1.00 42.78  ? 204  ASP A C     1 
ATOM   1316  O O     . ASP A 1 204  ? 126.071 94.989  96.542  1.00 42.76  ? 204  ASP A O     1 
ATOM   1317  C CB    . ASP A 1 204  ? 125.104 97.850  95.909  1.00 43.11  ? 204  ASP A CB    1 
ATOM   1318  C CG    . ASP A 1 204  ? 124.724 98.467  97.233  1.00 43.15  ? 204  ASP A CG    1 
ATOM   1319  O OD1   . ASP A 1 204  ? 125.428 99.400  97.670  1.00 43.14  ? 204  ASP A OD1   1 
ATOM   1320  O OD2   . ASP A 1 204  ? 123.727 98.026  97.834  1.00 43.15  ? 204  ASP A OD2   1 
ATOM   1321  N N     . LEU A 1 205  ? 127.133 96.285  98.048  1.00 42.54  ? 205  LEU A N     1 
ATOM   1322  C CA    . LEU A 1 205  ? 127.270 95.230  99.047  1.00 42.29  ? 205  LEU A CA    1 
ATOM   1323  C C     . LEU A 1 205  ? 126.189 95.240  100.131 1.00 41.42  ? 205  LEU A C     1 
ATOM   1324  O O     . LEU A 1 205  ? 126.242 94.440  101.065 1.00 41.23  ? 205  LEU A O     1 
ATOM   1325  C CB    . LEU A 1 205  ? 128.631 95.345  99.734  1.00 43.04  ? 205  LEU A CB    1 
ATOM   1326  C CG    . LEU A 1 205  ? 129.912 95.352  98.898  1.00 43.63  ? 205  LEU A CG    1 
ATOM   1327  C CD1   . LEU A 1 205  ? 131.090 95.634  99.819  1.00 43.81  ? 205  LEU A CD1   1 
ATOM   1328  C CD2   . LEU A 1 205  ? 130.093 94.022  98.187  1.00 43.86  ? 205  LEU A CD2   1 
ATOM   1329  N N     . ARG A 1 206  ? 125.216 96.137  100.018 1.00 40.89  ? 206  ARG A N     1 
ATOM   1330  C CA    . ARG A 1 206  ? 124.164 96.229  101.027 1.00 40.61  ? 206  ARG A CA    1 
ATOM   1331  C C     . ARG A 1 206  ? 122.799 95.737  100.568 1.00 40.08  ? 206  ARG A C     1 
ATOM   1332  O O     . ARG A 1 206  ? 122.572 95.511  99.379  1.00 39.74  ? 206  ARG A O     1 
ATOM   1333  C CB    . ARG A 1 206  ? 124.037 97.675  101.508 1.00 41.00  ? 206  ARG A CB    1 
ATOM   1334  C CG    . ARG A 1 206  ? 125.219 98.150  102.332 1.00 41.52  ? 206  ARG A CG    1 
ATOM   1335  C CD    . ARG A 1 206  ? 125.257 97.458  103.684 1.00 42.11  ? 206  ARG A CD    1 
ATOM   1336  N NE    . ARG A 1 206  ? 124.194 97.943  104.558 1.00 42.73  ? 206  ARG A NE    1 
ATOM   1337  C CZ    . ARG A 1 206  ? 123.985 97.521  105.799 1.00 43.22  ? 206  ARG A CZ    1 
ATOM   1338  N NH1   . ARG A 1 206  ? 124.767 96.590  106.331 1.00 43.35  ? 206  ARG A NH1   1 
ATOM   1339  N NH2   . ARG A 1 206  ? 122.986 98.031  106.511 1.00 43.38  ? 206  ARG A NH2   1 
ATOM   1340  N N     . LYS A 1 207  ? 121.896 95.571  101.529 1.00 40.14  ? 207  LYS A N     1 
ATOM   1341  C CA    . LYS A 1 207  ? 120.533 95.138  101.237 1.00 40.38  ? 207  LYS A CA    1 
ATOM   1342  C C     . LYS A 1 207  ? 119.751 96.435  101.086 1.00 40.84  ? 207  LYS A C     1 
ATOM   1343  O O     . LYS A 1 207  ? 118.631 96.445  100.581 1.00 40.77  ? 207  LYS A O     1 
ATOM   1344  C CB    . LYS A 1 207  ? 119.957 94.320  102.401 1.00 40.21  ? 207  LYS A CB    1 
ATOM   1345  C CG    . LYS A 1 207  ? 118.550 93.737  102.168 1.00 40.14  ? 207  LYS A CG    1 
ATOM   1346  C CD    . LYS A 1 207  ? 118.584 92.435  101.357 1.00 40.13  ? 207  LYS A CD    1 
ATOM   1347  C CE    . LYS A 1 207  ? 117.186 91.910  101.020 1.00 40.15  ? 207  LYS A CE    1 
ATOM   1348  N NZ    . LYS A 1 207  ? 116.523 91.185  102.140 1.00 40.12  ? 207  LYS A NZ    1 
ATOM   1349  N N     . SER A 1 208  ? 120.360 97.529  101.535 1.00 41.36  ? 208  SER A N     1 
ATOM   1350  C CA    . SER A 1 208  ? 119.741 98.845  101.451 1.00 41.81  ? 208  SER A CA    1 
ATOM   1351  C C     . SER A 1 208  ? 120.140 99.491  100.133 1.00 42.25  ? 208  SER A C     1 
ATOM   1352  O O     . SER A 1 208  ? 121.245 99.266  99.636  1.00 42.41  ? 208  SER A O     1 
ATOM   1353  C CB    . SER A 1 208  ? 120.184 99.722  102.625 1.00 41.68  ? 208  SER A CB    1 
ATOM   1354  O OG    . SER A 1 208  ? 119.742 99.193  103.864 1.00 41.55  ? 208  SER A OG    1 
ATOM   1355  N N     . MET A 1 209  ? 119.248 100.301 99.574  1.00 42.42  ? 209  MET A N     1 
ATOM   1356  C CA    . MET A 1 209  ? 119.508 100.940 98.287  1.00 42.46  ? 209  MET A CA    1 
ATOM   1357  C C     . MET A 1 209  ? 119.739 102.447 98.256  1.00 42.03  ? 209  MET A C     1 
ATOM   1358  O O     . MET A 1 209  ? 119.711 103.133 99.277  1.00 42.09  ? 209  MET A O     1 
ATOM   1359  C CB    . MET A 1 209  ? 118.377 100.619 97.312  1.00 42.99  ? 209  MET A CB    1 
ATOM   1360  C CG    . MET A 1 209  ? 118.283 99.168  96.902  1.00 43.52  ? 209  MET A CG    1 
ATOM   1361  S SD    . MET A 1 209  ? 117.062 98.969  95.592  1.00 44.03  ? 209  MET A SD    1 
ATOM   1362  C CE    . MET A 1 209  ? 118.013 99.529  94.182  1.00 44.10  ? 209  MET A CE    1 
ATOM   1363  N N     . ILE A 1 210  ? 119.954 102.934 97.037  1.00 41.53  ? 210  ILE A N     1 
ATOM   1364  C CA    . ILE A 1 210  ? 120.192 104.346 96.755  1.00 41.16  ? 210  ILE A CA    1 
ATOM   1365  C C     . ILE A 1 210  ? 119.165 104.843 95.755  1.00 40.31  ? 210  ILE A C     1 
ATOM   1366  O O     . ILE A 1 210  ? 118.991 104.264 94.681  1.00 40.14  ? 210  ILE A O     1 
ATOM   1367  C CB    . ILE A 1 210  ? 121.574 104.578 96.142  1.00 41.74  ? 210  ILE A CB    1 
ATOM   1368  C CG1   . ILE A 1 210  ? 121.919 103.397 95.230  1.00 42.15  ? 210  ILE A CG1   1 
ATOM   1369  C CG2   . ILE A 1 210  ? 122.601 104.799 97.232  1.00 41.88  ? 210  ILE A CG2   1 
ATOM   1370  C CD1   . ILE A 1 210  ? 123.195 103.556 94.442  1.00 42.36  ? 210  ILE A CD1   1 
ATOM   1371  N N     . ILE A 1 211  ? 118.517 105.944 96.099  1.00 39.83  ? 211  ILE A N     1 
ATOM   1372  C CA    . ILE A 1 211  ? 117.497 106.503 95.243  1.00 39.61  ? 211  ILE A CA    1 
ATOM   1373  C C     . ILE A 1 211  ? 117.965 107.651 94.363  1.00 39.56  ? 211  ILE A C     1 
ATOM   1374  O O     . ILE A 1 211  ? 118.789 108.477 94.767  1.00 39.35  ? 211  ILE A O     1 
ATOM   1375  C CB    . ILE A 1 211  ? 116.305 106.978 96.083  1.00 39.64  ? 211  ILE A CB    1 
ATOM   1376  C CG1   . ILE A 1 211  ? 116.109 106.038 97.279  1.00 39.76  ? 211  ILE A CG1   1 
ATOM   1377  C CG2   . ILE A 1 211  ? 115.049 106.989 95.243  1.00 39.63  ? 211  ILE A CG2   1 
ATOM   1378  C CD1   . ILE A 1 211  ? 115.804 104.594 96.901  1.00 39.82  ? 211  ILE A CD1   1 
ATOM   1379  N N     . SER A 1 212  ? 117.435 107.671 93.145  1.00 39.99  ? 212  SER A N     1 
ATOM   1380  C CA    . SER A 1 212  ? 117.738 108.718 92.183  1.00 40.56  ? 212  SER A CA    1 
ATOM   1381  C C     . SER A 1 212  ? 119.228 109.038 92.165  1.00 40.82  ? 212  SER A C     1 
ATOM   1382  O O     . SER A 1 212  ? 119.616 110.192 92.303  1.00 40.95  ? 212  SER A O     1 
ATOM   1383  C CB    . SER A 1 212  ? 116.919 109.965 92.551  1.00 40.82  ? 212  SER A CB    1 
ATOM   1384  O OG    . SER A 1 212  ? 116.895 110.915 91.506  1.00 40.93  ? 212  SER A OG    1 
ATOM   1385  N N     . ALA A 1 213  ? 120.059 108.008 92.009  1.00 40.91  ? 213  ALA A N     1 
ATOM   1386  C CA    . ALA A 1 213  ? 121.508 108.197 91.985  1.00 41.12  ? 213  ALA A CA    1 
ATOM   1387  C C     . ALA A 1 213  ? 122.054 108.354 90.570  1.00 41.38  ? 213  ALA A C     1 
ATOM   1388  O O     . ALA A 1 213  ? 122.216 107.373 89.843  1.00 41.23  ? 213  ALA A O     1 
ATOM   1389  C CB    . ALA A 1 213  ? 122.191 107.028 92.679  1.00 41.15  ? 213  ALA A CB    1 
ATOM   1390  N N     . THR A 1 214  ? 122.350 109.597 90.196  1.00 41.97  ? 214  THR A N     1 
ATOM   1391  C CA    . THR A 1 214  ? 122.883 109.919 88.871  1.00 42.51  ? 214  THR A CA    1 
ATOM   1392  C C     . THR A 1 214  ? 124.399 109.777 88.796  1.00 42.69  ? 214  THR A C     1 
ATOM   1393  O O     . THR A 1 214  ? 125.121 110.163 89.714  1.00 42.64  ? 214  THR A O     1 
ATOM   1394  C CB    . THR A 1 214  ? 122.514 111.366 88.450  1.00 42.90  ? 214  THR A CB    1 
ATOM   1395  O OG1   . THR A 1 214  ? 122.974 112.294 89.440  1.00 43.00  ? 214  THR A OG1   1 
ATOM   1396  C CG2   . THR A 1 214  ? 121.010 111.510 88.287  1.00 43.01  ? 214  THR A CG2   1 
ATOM   1397  N N     . ILE A 1 215  ? 124.865 109.235 87.677  1.00 42.82  ? 215  ILE A N     1 
ATOM   1398  C CA    . ILE A 1 215  ? 126.290 109.026 87.460  1.00 43.06  ? 215  ILE A CA    1 
ATOM   1399  C C     . ILE A 1 215  ? 126.822 109.921 86.344  1.00 42.61  ? 215  ILE A C     1 
ATOM   1400  O O     . ILE A 1 215  ? 126.241 109.981 85.263  1.00 42.19  ? 215  ILE A O     1 
ATOM   1401  C CB    . ILE A 1 215  ? 126.583 107.573 87.068  1.00 43.54  ? 215  ILE A CB    1 
ATOM   1402  C CG1   . ILE A 1 215  ? 125.781 106.620 87.960  1.00 44.03  ? 215  ILE A CG1   1 
ATOM   1403  C CG2   . ILE A 1 215  ? 128.065 107.296 87.211  1.00 43.53  ? 215  ILE A CG2   1 
ATOM   1404  C CD1   . ILE A 1 215  ? 124.851 105.687 87.198  1.00 44.25  ? 215  ILE A CD1   1 
ATOM   1405  N N     . HIS A 1 216  ? 127.936 110.596 86.614  1.00 42.85  ? 216  HIS A N     1 
ATOM   1406  C CA    . HIS A 1 216  ? 128.569 111.488 85.648  1.00 43.10  ? 216  HIS A CA    1 
ATOM   1407  C C     . HIS A 1 216  ? 130.032 111.110 85.444  1.00 44.21  ? 216  HIS A C     1 
ATOM   1408  O O     . HIS A 1 216  ? 130.808 111.078 86.399  1.00 44.30  ? 216  HIS A O     1 
ATOM   1409  C CB    . HIS A 1 216  ? 128.495 112.930 86.143  1.00 42.45  ? 216  HIS A CB    1 
ATOM   1410  C CG    . HIS A 1 216  ? 127.115 113.506 86.148  1.00 41.87  ? 216  HIS A CG    1 
ATOM   1411  N ND1   . HIS A 1 216  ? 126.727 114.494 87.026  1.00 41.67  ? 216  HIS A ND1   1 
ATOM   1412  C CD2   . HIS A 1 216  ? 126.045 113.265 85.357  1.00 41.64  ? 216  HIS A CD2   1 
ATOM   1413  C CE1   . HIS A 1 216  ? 125.478 114.839 86.776  1.00 41.54  ? 216  HIS A CE1   1 
ATOM   1414  N NE2   . HIS A 1 216  ? 125.041 114.109 85.766  1.00 41.54  ? 216  HIS A NE2   1 
ATOM   1415  N N     . MET A 1 217  ? 130.415 110.835 84.202  1.00 45.19  ? 217  MET A N     1 
ATOM   1416  C CA    . MET A 1 217  ? 131.796 110.475 83.909  1.00 46.25  ? 217  MET A CA    1 
ATOM   1417  C C     . MET A 1 217  ? 132.479 111.572 83.112  1.00 46.77  ? 217  MET A C     1 
ATOM   1418  O O     . MET A 1 217  ? 131.950 112.047 82.106  1.00 46.79  ? 217  MET A O     1 
ATOM   1419  C CB    . MET A 1 217  ? 131.850 109.170 83.124  1.00 46.87  ? 217  MET A CB    1 
ATOM   1420  C CG    . MET A 1 217  ? 131.393 107.961 83.910  1.00 47.55  ? 217  MET A CG    1 
ATOM   1421  S SD    . MET A 1 217  ? 131.401 106.474 82.896  1.00 48.22  ? 217  MET A SD    1 
ATOM   1422  C CE    . MET A 1 217  ? 130.772 105.274 84.061  1.00 48.44  ? 217  MET A CE    1 
ATOM   1423  N N     . GLN A 1 218  ? 133.664 111.966 83.564  1.00 47.30  ? 218  GLN A N     1 
ATOM   1424  C CA    . GLN A 1 218  ? 134.415 113.013 82.889  1.00 47.80  ? 218  GLN A CA    1 
ATOM   1425  C C     . GLN A 1 218  ? 135.823 112.583 82.495  1.00 47.91  ? 218  GLN A C     1 
ATOM   1426  O O     . GLN A 1 218  ? 136.482 111.831 83.216  1.00 47.78  ? 218  GLN A O     1 
ATOM   1427  C CB    . GLN A 1 218  ? 134.521 114.245 83.781  1.00 48.16  ? 218  GLN A CB    1 
ATOM   1428  C CG    . GLN A 1 218  ? 134.516 115.541 83.009  1.00 48.27  ? 218  GLN A CG    1 
ATOM   1429  C CD    . GLN A 1 218  ? 133.126 116.116 82.893  1.00 48.27  ? 218  GLN A CD    1 
ATOM   1430  O OE1   . GLN A 1 218  ? 132.139 115.438 83.177  1.00 48.25  ? 218  GLN A OE1   1 
ATOM   1431  N NE2   . GLN A 1 218  ? 133.037 117.373 82.476  1.00 48.27  ? 218  GLN A NE2   1 
ATOM   1432  N N     . VAL A 1 219  ? 136.270 113.073 81.343  1.00 48.36  ? 219  VAL A N     1 
ATOM   1433  C CA    . VAL A 1 219  ? 137.605 112.780 80.840  1.00 49.04  ? 219  VAL A CA    1 
ATOM   1434  C C     . VAL A 1 219  ? 138.503 113.973 81.130  1.00 50.01  ? 219  VAL A C     1 
ATOM   1435  O O     . VAL A 1 219  ? 138.353 115.032 80.520  1.00 49.99  ? 219  VAL A O     1 
ATOM   1436  C CB    . VAL A 1 219  ? 137.618 112.554 79.314  1.00 48.98  ? 219  VAL A CB    1 
ATOM   1437  C CG1   . VAL A 1 219  ? 139.050 112.370 78.840  1.00 48.98  ? 219  VAL A CG1   1 
ATOM   1438  C CG2   . VAL A 1 219  ? 136.789 111.338 78.951  1.00 48.96  ? 219  VAL A CG2   1 
ATOM   1439  N N     . VAL A 1 220  ? 139.442 113.794 82.052  1.00 51.13  ? 220  VAL A N     1 
ATOM   1440  C CA    . VAL A 1 220  ? 140.351 114.866 82.416  1.00 52.32  ? 220  VAL A CA    1 
ATOM   1441  C C     . VAL A 1 220  ? 141.718 114.750 81.733  1.00 53.30  ? 220  VAL A C     1 
ATOM   1442  O O     . VAL A 1 220  ? 142.599 114.008 82.175  1.00 53.24  ? 220  VAL A O     1 
ATOM   1443  C CB    . VAL A 1 220  ? 140.567 114.917 83.955  1.00 52.73  ? 220  VAL A CB    1 
ATOM   1444  C CG1   . VAL A 1 220  ? 141.265 113.646 84.453  1.00 52.83  ? 220  VAL A CG1   1 
ATOM   1445  C CG2   . VAL A 1 220  ? 141.388 116.137 84.312  1.00 52.87  ? 220  VAL A CG2   1 
ATOM   1446  N N     . ARG A 1 221  ? 141.885 115.485 80.641  1.00 54.41  ? 221  ARG A N     1 
ATOM   1447  C CA    . ARG A 1 221  ? 143.135 115.483 79.896  1.00 55.72  ? 221  ARG A CA    1 
ATOM   1448  C C     . ARG A 1 221  ? 143.549 116.928 79.629  1.00 56.79  ? 221  ARG A C     1 
ATOM   1449  O O     . ARG A 1 221  ? 142.717 117.832 79.667  1.00 56.82  ? 221  ARG A O     1 
ATOM   1450  C CB    . ARG A 1 221  ? 142.961 114.722 78.578  1.00 56.08  ? 221  ARG A CB    1 
ATOM   1451  C CG    . ARG A 1 221  ? 144.169 114.735 77.656  1.00 56.54  ? 221  ARG A CG    1 
ATOM   1452  C CD    . ARG A 1 221  ? 143.802 114.170 76.302  1.00 57.18  ? 221  ARG A CD    1 
ATOM   1453  N NE    . ARG A 1 221  ? 144.953 114.059 75.415  1.00 57.99  ? 221  ARG A NE    1 
ATOM   1454  C CZ    . ARG A 1 221  ? 144.866 113.776 74.120  1.00 58.70  ? 221  ARG A CZ    1 
ATOM   1455  N NH1   . ARG A 1 221  ? 143.673 113.580 73.568  1.00 58.95  ? 221  ARG A NH1   1 
ATOM   1456  N NH2   . ARG A 1 221  ? 145.964 113.683 73.380  1.00 58.90  ? 221  ARG A NH2   1 
ATOM   1457  N N     . LYS A 1 222  ? 144.833 117.138 79.361  1.00 57.89  ? 222  LYS A N     1 
ATOM   1458  C CA    . LYS A 1 222  ? 145.348 118.477 79.102  1.00 59.30  ? 222  LYS A CA    1 
ATOM   1459  C C     . LYS A 1 222  ? 145.301 118.794 77.615  1.00 60.77  ? 222  LYS A C     1 
ATOM   1460  O O     . LYS A 1 222  ? 146.151 118.344 76.845  1.00 60.75  ? 222  LYS A O     1 
ATOM   1461  C CB    . LYS A 1 222  ? 146.785 118.591 79.609  1.00 59.43  ? 222  LYS A CB    1 
ATOM   1462  N N     . THR A 1 223  ? 144.309 119.586 77.221  1.00 62.42  ? 223  THR A N     1 
ATOM   1463  C CA    . THR A 1 223  ? 144.110 119.959 75.825  1.00 64.00  ? 223  THR A CA    1 
ATOM   1464  C C     . THR A 1 223  ? 144.648 121.327 75.420  1.00 65.24  ? 223  THR A C     1 
ATOM   1465  O O     . THR A 1 223  ? 144.696 122.268 76.217  1.00 65.18  ? 223  THR A O     1 
ATOM   1466  C CB    . THR A 1 223  ? 142.608 119.894 75.465  1.00 64.24  ? 223  THR A CB    1 
ATOM   1467  O OG1   . THR A 1 223  ? 141.868 120.779 76.315  1.00 64.29  ? 223  THR A OG1   1 
ATOM   1468  C CG2   . THR A 1 223  ? 142.086 118.477 75.651  1.00 64.30  ? 223  THR A CG2   1 
ATOM   1469  N N     . THR A 1 224  ? 145.043 121.418 74.154  1.00 66.41  ? 224  THR A N     1 
ATOM   1470  C CA    . THR A 1 224  ? 145.583 122.649 73.591  1.00 67.39  ? 224  THR A CA    1 
ATOM   1471  C C     . THR A 1 224  ? 144.698 123.131 72.448  1.00 68.18  ? 224  THR A C     1 
ATOM   1472  O O     . THR A 1 224  ? 144.390 122.374 71.530  1.00 68.04  ? 224  THR A O     1 
ATOM   1473  C CB    . THR A 1 224  ? 146.996 122.431 73.037  1.00 67.55  ? 224  THR A CB    1 
ATOM   1474  O OG1   . THR A 1 224  ? 147.798 121.758 74.016  1.00 67.56  ? 224  THR A OG1   1 
ATOM   1475  C CG2   . THR A 1 224  ? 147.635 123.761 72.702  1.00 67.56  ? 224  THR A CG2   1 
ATOM   1476  N N     . SER A 1 225  ? 144.298 124.397 72.511  1.00 69.02  ? 225  SER A N     1 
ATOM   1477  C CA    . SER A 1 225  ? 143.453 124.978 71.482  1.00 69.84  ? 225  SER A CA    1 
ATOM   1478  C C     . SER A 1 225  ? 144.261 125.496 70.296  1.00 70.52  ? 225  SER A C     1 
ATOM   1479  O O     . SER A 1 225  ? 145.456 125.773 70.407  1.00 70.38  ? 225  SER A O     1 
ATOM   1480  C CB    . SER A 1 225  ? 142.595 126.101 72.081  1.00 69.82  ? 225  SER A CB    1 
ATOM   1481  O OG    . SER A 1 225  ? 143.357 126.966 72.900  1.00 69.78  ? 225  SER A OG    1 
ATOM   1482  N N     . PRO A 1 226  ? 143.606 125.622 69.136  1.00 71.38  ? 226  PRO A N     1 
ATOM   1483  C CA    . PRO A 1 226  ? 144.211 126.099 67.892  1.00 71.93  ? 226  PRO A CA    1 
ATOM   1484  C C     . PRO A 1 226  ? 144.793 127.507 67.982  1.00 72.47  ? 226  PRO A C     1 
ATOM   1485  O O     . PRO A 1 226  ? 145.533 127.933 67.094  1.00 72.41  ? 226  PRO A O     1 
ATOM   1486  C CB    . PRO A 1 226  ? 143.056 126.013 66.892  1.00 71.87  ? 226  PRO A CB    1 
ATOM   1487  C CG    . PRO A 1 226  ? 142.248 124.865 67.411  1.00 71.78  ? 226  PRO A CG    1 
ATOM   1488  C CD    . PRO A 1 226  ? 142.237 125.128 68.899  1.00 71.63  ? 226  PRO A CD    1 
ATOM   1489  N N     . GLU A 1 227  ? 144.468 128.229 69.047  1.00 73.15  ? 227  GLU A N     1 
ATOM   1490  C CA    . GLU A 1 227  ? 144.994 129.578 69.193  1.00 73.78  ? 227  GLU A CA    1 
ATOM   1491  C C     . GLU A 1 227  ? 146.291 129.612 69.989  1.00 73.94  ? 227  GLU A C     1 
ATOM   1492  O O     . GLU A 1 227  ? 146.990 130.621 69.987  1.00 73.91  ? 227  GLU A O     1 
ATOM   1493  C CB    . GLU A 1 227  ? 143.966 130.504 69.843  1.00 74.29  ? 227  GLU A CB    1 
ATOM   1494  C CG    . GLU A 1 227  ? 142.682 130.673 69.051  1.00 74.66  ? 227  GLU A CG    1 
ATOM   1495  C CD    . GLU A 1 227  ? 141.695 129.551 69.303  1.00 74.91  ? 227  GLU A CD    1 
ATOM   1496  O OE1   . GLU A 1 227  ? 141.541 128.674 68.426  1.00 74.97  ? 227  GLU A OE1   1 
ATOM   1497  O OE2   . GLU A 1 227  ? 141.079 129.544 70.391  1.00 74.96  ? 227  GLU A OE2   1 
ATOM   1498  N N     . GLY A 1 228  ? 146.610 128.514 70.671  1.00 74.02  ? 228  GLY A N     1 
ATOM   1499  C CA    . GLY A 1 228  ? 147.842 128.466 71.440  1.00 74.14  ? 228  GLY A CA    1 
ATOM   1500  C C     . GLY A 1 228  ? 147.676 128.505 72.946  1.00 74.19  ? 228  GLY A C     1 
ATOM   1501  O O     . GLY A 1 228  ? 148.621 128.831 73.662  1.00 74.27  ? 228  GLY A O     1 
ATOM   1502  N N     . GLU A 1 229  ? 146.488 128.172 73.438  1.00 74.07  ? 229  GLU A N     1 
ATOM   1503  C CA    . GLU A 1 229  ? 146.252 128.177 74.876  1.00 73.77  ? 229  GLU A CA    1 
ATOM   1504  C C     . GLU A 1 229  ? 146.273 126.770 75.458  1.00 72.94  ? 229  GLU A C     1 
ATOM   1505  O O     . GLU A 1 229  ? 145.573 125.877 74.979  1.00 72.86  ? 229  GLU A O     1 
ATOM   1506  C CB    . GLU A 1 229  ? 144.907 128.830 75.207  1.00 74.13  ? 229  GLU A CB    1 
ATOM   1507  C CG    . GLU A 1 229  ? 144.805 130.299 74.855  1.00 74.31  ? 229  GLU A CG    1 
ATOM   1508  C CD    . GLU A 1 229  ? 144.599 130.520 73.375  1.00 74.31  ? 229  GLU A CD    1 
ATOM   1509  O OE1   . GLU A 1 229  ? 143.786 129.779 72.789  1.00 74.25  ? 229  GLU A OE1   1 
ATOM   1510  O OE2   . GLU A 1 229  ? 145.236 131.428 72.802  1.00 74.31  ? 229  GLU A OE2   1 
ATOM   1511  N N     . VAL A 1 230  ? 147.079 126.589 76.501  1.00 72.10  ? 230  VAL A N     1 
ATOM   1512  C CA    . VAL A 1 230  ? 147.190 125.297 77.161  1.00 71.22  ? 230  VAL A CA    1 
ATOM   1513  C C     . VAL A 1 230  ? 146.495 125.254 78.512  1.00 70.64  ? 230  VAL A C     1 
ATOM   1514  O O     . VAL A 1 230  ? 146.979 125.830 79.488  1.00 70.55  ? 230  VAL A O     1 
ATOM   1515  C CB    . VAL A 1 230  ? 148.650 124.889 77.407  1.00 70.98  ? 230  VAL A CB    1 
ATOM   1516  C CG1   . VAL A 1 230  ? 148.693 123.512 78.050  1.00 70.90  ? 230  VAL A CG1   1 
ATOM   1517  C CG2   . VAL A 1 230  ? 149.420 124.890 76.104  1.00 70.88  ? 230  VAL A CG2   1 
ATOM   1518  N N     . VAL A 1 231  ? 145.357 124.571 78.556  1.00 70.13  ? 231  VAL A N     1 
ATOM   1519  C CA    . VAL A 1 231  ? 144.615 124.405 79.791  1.00 69.52  ? 231  VAL A CA    1 
ATOM   1520  C C     . VAL A 1 231  ? 145.156 123.100 80.371  1.00 68.40  ? 231  VAL A C     1 
ATOM   1521  O O     . VAL A 1 231  ? 145.102 122.051 79.723  1.00 68.25  ? 231  VAL A O     1 
ATOM   1522  C CB    . VAL A 1 231  ? 143.096 124.296 79.530  1.00 69.78  ? 231  VAL A CB    1 
ATOM   1523  C CG1   . VAL A 1 231  ? 142.805 123.205 78.498  1.00 69.85  ? 231  VAL A CG1   1 
ATOM   1524  C CG2   . VAL A 1 231  ? 142.380 123.985 80.830  1.00 69.88  ? 231  VAL A CG2   1 
ATOM   1525  N N     . PRO A 1 232  ? 145.668 123.148 81.609  1.00 67.52  ? 232  PRO A N     1 
ATOM   1526  C CA    . PRO A 1 232  ? 146.253 122.026 82.347  1.00 66.90  ? 232  PRO A CA    1 
ATOM   1527  C C     . PRO A 1 232  ? 145.383 120.783 82.528  1.00 66.32  ? 232  PRO A C     1 
ATOM   1528  O O     . PRO A 1 232  ? 145.870 119.652 82.410  1.00 66.22  ? 232  PRO A O     1 
ATOM   1529  C CB    . PRO A 1 232  ? 146.621 122.653 83.690  1.00 66.98  ? 232  PRO A CB    1 
ATOM   1530  C CG    . PRO A 1 232  ? 146.933 124.059 83.331  1.00 67.07  ? 232  PRO A CG    1 
ATOM   1531  C CD    . PRO A 1 232  ? 145.821 124.402 82.366  1.00 67.25  ? 232  PRO A CD    1 
ATOM   1532  N N     . LEU A 1 233  ? 144.103 120.991 82.823  1.00 65.88  ? 233  LEU A N     1 
ATOM   1533  C CA    . LEU A 1 233  ? 143.171 119.881 83.014  1.00 65.57  ? 233  LEU A CA    1 
ATOM   1534  C C     . LEU A 1 233  ? 141.791 120.273 82.537  1.00 64.96  ? 233  LEU A C     1 
ATOM   1535  O O     . LEU A 1 233  ? 141.039 120.929 83.250  1.00 64.90  ? 233  LEU A O     1 
ATOM   1536  C CB    . LEU A 1 233  ? 143.090 119.489 84.483  1.00 65.82  ? 233  LEU A CB    1 
ATOM   1537  C CG    . LEU A 1 233  ? 144.306 118.788 85.082  1.00 66.09  ? 233  LEU A CG    1 
ATOM   1538  C CD1   . LEU A 1 233  ? 144.077 118.640 86.576  1.00 66.16  ? 233  LEU A CD1   1 
ATOM   1539  C CD2   . LEU A 1 233  ? 144.512 117.418 84.433  1.00 66.19  ? 233  LEU A CD2   1 
ATOM   1540  N N     . HIS A 1 234  ? 141.463 119.852 81.328  1.00 64.47  ? 234  HIS A N     1 
ATOM   1541  C CA    . HIS A 1 234  ? 140.177 120.167 80.741  1.00 63.98  ? 234  HIS A CA    1 
ATOM   1542  C C     . HIS A 1 234  ? 139.207 119.018 80.986  1.00 63.20  ? 234  HIS A C     1 
ATOM   1543  O O     . HIS A 1 234  ? 139.545 117.857 80.776  1.00 63.11  ? 234  HIS A O     1 
ATOM   1544  C CB    . HIS A 1 234  ? 140.370 120.427 79.252  1.00 64.35  ? 234  HIS A CB    1 
ATOM   1545  C CG    . HIS A 1 234  ? 139.142 120.917 78.559  1.00 64.64  ? 234  HIS A CG    1 
ATOM   1546  N ND1   . HIS A 1 234  ? 138.118 120.076 78.185  1.00 64.75  ? 234  HIS A ND1   1 
ATOM   1547  C CD2   . HIS A 1 234  ? 138.760 122.163 78.197  1.00 64.77  ? 234  HIS A CD2   1 
ATOM   1548  C CE1   . HIS A 1 234  ? 137.157 120.782 77.621  1.00 64.82  ? 234  HIS A CE1   1 
ATOM   1549  N NE2   . HIS A 1 234  ? 137.521 122.052 77.615  1.00 64.83  ? 234  HIS A NE2   1 
ATOM   1550  N N     . GLN A 1 235  ? 138.007 119.347 81.453  1.00 62.60  ? 235  GLN A N     1 
ATOM   1551  C CA    . GLN A 1 235  ? 137.012 118.329 81.738  1.00 62.06  ? 235  GLN A CA    1 
ATOM   1552  C C     . GLN A 1 235  ? 135.878 118.302 80.737  1.00 62.02  ? 235  GLN A C     1 
ATOM   1553  O O     . GLN A 1 235  ? 135.043 119.208 80.691  1.00 62.00  ? 235  GLN A O     1 
ATOM   1554  C CB    . GLN A 1 235  ? 136.453 118.516 83.144  1.00 61.67  ? 235  GLN A CB    1 
ATOM   1555  C CG    . GLN A 1 235  ? 137.401 118.051 84.224  1.00 61.31  ? 235  GLN A CG    1 
ATOM   1556  C CD    . GLN A 1 235  ? 136.904 118.394 85.606  1.00 60.99  ? 235  GLN A CD    1 
ATOM   1557  O OE1   . GLN A 1 235  ? 135.798 118.014 85.992  1.00 60.88  ? 235  GLN A OE1   1 
ATOM   1558  N NE2   . GLN A 1 235  ? 137.720 119.113 86.367  1.00 60.87  ? 235  GLN A NE2   1 
ATOM   1559  N N     . VAL A 1 236  ? 135.869 117.240 79.940  1.00 62.04  ? 236  VAL A N     1 
ATOM   1560  C CA    . VAL A 1 236  ? 134.859 117.033 78.920  1.00 62.20  ? 236  VAL A CA    1 
ATOM   1561  C C     . VAL A 1 236  ? 134.049 115.786 79.248  1.00 61.84  ? 236  VAL A C     1 
ATOM   1562  O O     . VAL A 1 236  ? 134.594 114.707 79.513  1.00 61.76  ? 236  VAL A O     1 
ATOM   1563  C CB    . VAL A 1 236  ? 135.496 116.879 77.526  1.00 62.68  ? 236  VAL A CB    1 
ATOM   1564  C CG1   . VAL A 1 236  ? 136.415 115.655 77.484  1.00 62.87  ? 236  VAL A CG1   1 
ATOM   1565  C CG2   . VAL A 1 236  ? 134.406 116.748 76.484  1.00 62.90  ? 236  VAL A CG2   1 
ATOM   1566  N N     . ASP A 1 237  ? 132.733 115.948 79.218  1.00 61.67  ? 237  ASP A N     1 
ATOM   1567  C CA    . ASP A 1 237  ? 131.789 114.896 79.553  1.00 61.62  ? 237  ASP A CA    1 
ATOM   1568  C C     . ASP A 1 237  ? 131.481 113.912 78.422  1.00 61.26  ? 237  ASP A C     1 
ATOM   1569  O O     . ASP A 1 237  ? 131.384 114.296 77.256  1.00 61.21  ? 237  ASP A O     1 
ATOM   1570  C CB    . ASP A 1 237  ? 130.492 115.545 80.016  1.00 61.98  ? 237  ASP A CB    1 
ATOM   1571  C CG    . ASP A 1 237  ? 129.476 114.543 80.478  1.00 62.32  ? 237  ASP A CG    1 
ATOM   1572  O OD1   . ASP A 1 237  ? 129.787 113.335 80.457  1.00 62.39  ? 237  ASP A OD1   1 
ATOM   1573  O OD2   . ASP A 1 237  ? 128.364 114.964 80.860  1.00 62.40  ? 237  ASP A OD2   1 
ATOM   1574  N N     . ILE A 1 238  ? 131.321 112.639 78.789  1.00 61.21  ? 238  ILE A N     1 
ATOM   1575  C CA    . ILE A 1 238  ? 130.999 111.575 77.836  1.00 61.39  ? 238  ILE A CA    1 
ATOM   1576  C C     . ILE A 1 238  ? 129.606 111.008 78.124  1.00 61.24  ? 238  ILE A C     1 
ATOM   1577  O O     . ILE A 1 238  ? 129.224 110.807 79.277  1.00 61.17  ? 238  ILE A O     1 
ATOM   1578  C CB    . ILE A 1 238  ? 131.982 110.379 77.896  1.00 61.93  ? 238  ILE A CB    1 
ATOM   1579  C CG1   . ILE A 1 238  ? 132.054 109.840 79.320  1.00 62.28  ? 238  ILE A CG1   1 
ATOM   1580  C CG2   . ILE A 1 238  ? 133.347 110.793 77.377  1.00 62.02  ? 238  ILE A CG2   1 
ATOM   1581  C CD1   . ILE A 1 238  ? 132.631 108.446 79.434  1.00 62.43  ? 238  ILE A CD1   1 
ATOM   1582  N N     . PRO A 1 239  ? 128.842 110.732 77.065  1.00 61.40  ? 239  PRO A N     1 
ATOM   1583  C CA    . PRO A 1 239  ? 127.483 110.188 77.101  1.00 61.63  ? 239  PRO A CA    1 
ATOM   1584  C C     . PRO A 1 239  ? 127.319 108.832 77.778  1.00 62.23  ? 239  PRO A C     1 
ATOM   1585  O O     . PRO A 1 239  ? 128.164 107.945 77.648  1.00 62.08  ? 239  PRO A O     1 
ATOM   1586  C CB    . PRO A 1 239  ? 127.094 110.132 75.629  1.00 61.59  ? 239  PRO A CB    1 
ATOM   1587  C CG    . PRO A 1 239  ? 128.407 109.970 74.929  1.00 61.50  ? 239  PRO A CG    1 
ATOM   1588  C CD    . PRO A 1 239  ? 129.274 110.945 75.674  1.00 61.40  ? 239  PRO A CD    1 
ATOM   1589  N N     . MET A 1 240  ? 126.195 108.684 78.475  1.00 62.94  ? 240  MET A N     1 
ATOM   1590  C CA    . MET A 1 240  ? 125.846 107.461 79.190  1.00 63.82  ? 240  MET A CA    1 
ATOM   1591  C C     . MET A 1 240  ? 125.208 106.449 78.246  1.00 63.36  ? 240  MET A C     1 
ATOM   1592  O O     . MET A 1 240  ? 124.924 105.318 78.635  1.00 63.36  ? 240  MET A O     1 
ATOM   1593  C CB    . MET A 1 240  ? 124.876 107.784 80.322  1.00 65.03  ? 240  MET A CB    1 
ATOM   1594  C CG    . MET A 1 240  ? 125.338 108.912 81.230  1.00 66.13  ? 240  MET A CG    1 
ATOM   1595  S SD    . MET A 1 240  ? 126.910 108.566 82.036  1.00 66.87  ? 240  MET A SD    1 
ATOM   1596  C CE    . MET A 1 240  ? 126.383 107.443 83.313  1.00 67.03  ? 240  MET A CE    1 
ATOM   1597  N N     . GLU A 1 241  ? 124.962 106.873 77.014  1.00 63.00  ? 241  GLU A N     1 
ATOM   1598  C CA    . GLU A 1 241  ? 124.376 106.006 75.997  1.00 62.54  ? 241  GLU A CA    1 
ATOM   1599  C C     . GLU A 1 241  ? 122.992 105.438 76.306  1.00 61.82  ? 241  GLU A C     1 
ATOM   1600  O O     . GLU A 1 241  ? 122.560 104.469 75.687  1.00 61.74  ? 241  GLU A O     1 
ATOM   1601  C CB    . GLU A 1 241  ? 125.336 104.853 75.705  1.00 62.64  ? 241  GLU A CB    1 
ATOM   1602  N N     . ASN A 1 242  ? 122.295 106.010 77.279  1.00 61.16  ? 242  ASN A N     1 
ATOM   1603  C CA    . ASN A 1 242  ? 120.942 105.546 77.531  1.00 60.50  ? 242  ASN A CA    1 
ATOM   1604  C C     . ASN A 1 242  ? 120.120 106.050 76.346  1.00 60.52  ? 242  ASN A C     1 
ATOM   1605  O O     . ASN A 1 242  ? 120.285 107.195 75.924  1.00 60.61  ? 242  ASN A O     1 
ATOM   1606  C CB    . ASN A 1 242  ? 120.406 106.081 78.855  1.00 59.92  ? 242  ASN A CB    1 
ATOM   1607  C CG    . ASN A 1 242  ? 121.076 105.443 80.055  1.00 59.42  ? 242  ASN A CG    1 
ATOM   1608  O OD1   . ASN A 1 242  ? 120.785 104.299 80.407  1.00 59.24  ? 242  ASN A OD1   1 
ATOM   1609  N ND2   . ASN A 1 242  ? 121.981 106.178 80.690  1.00 59.27  ? 242  ASN A ND2   1 
ATOM   1610  N N     . GLY A 1 243  ? 119.240 105.214 75.808  1.00 60.29  ? 243  GLY A N     1 
ATOM   1611  C CA    . GLY A 1 243  ? 118.453 105.620 74.656  1.00 60.08  ? 243  GLY A CA    1 
ATOM   1612  C C     . GLY A 1 243  ? 117.540 106.800 74.924  1.00 59.84  ? 243  GLY A C     1 
ATOM   1613  O O     . GLY A 1 243  ? 117.422 107.711 74.105  1.00 59.83  ? 243  GLY A O     1 
ATOM   1614  N N     . VAL A 1 244  ? 116.894 106.779 76.083  1.00 59.59  ? 244  VAL A N     1 
ATOM   1615  C CA    . VAL A 1 244  ? 115.981 107.839 76.491  1.00 59.28  ? 244  VAL A CA    1 
ATOM   1616  C C     . VAL A 1 244  ? 116.651 109.199 76.703  1.00 58.56  ? 244  VAL A C     1 
ATOM   1617  O O     . VAL A 1 244  ? 116.086 110.239 76.365  1.00 58.63  ? 244  VAL A O     1 
ATOM   1618  C CB    . VAL A 1 244  ? 115.220 107.457 77.776  1.00 59.46  ? 244  VAL A CB    1 
ATOM   1619  C CG1   . VAL A 1 244  ? 114.323 108.601 78.222  1.00 59.48  ? 244  VAL A CG1   1 
ATOM   1620  C CG2   . VAL A 1 244  ? 114.409 106.190 77.554  1.00 59.51  ? 244  VAL A CG2   1 
ATOM   1621  N N     . GLY A 1 245  ? 117.853 109.178 77.268  1.00 57.66  ? 245  GLY A N     1 
ATOM   1622  C CA    . GLY A 1 245  ? 118.571 110.400 77.606  1.00 56.67  ? 245  GLY A CA    1 
ATOM   1623  C C     . GLY A 1 245  ? 118.937 110.294 79.079  1.00 55.60  ? 245  GLY A C     1 
ATOM   1624  O O     . GLY A 1 245  ? 118.794 111.247 79.846  1.00 55.66  ? 245  GLY A O     1 
ATOM   1625  N N     . GLY A 1 246  ? 119.410 109.112 79.460  1.00 54.36  ? 246  GLY A N     1 
ATOM   1626  C CA    . GLY A 1 246  ? 119.713 108.759 80.832  1.00 53.07  ? 246  GLY A CA    1 
ATOM   1627  C C     . GLY A 1 246  ? 120.708 109.460 81.734  1.00 51.69  ? 246  GLY A C     1 
ATOM   1628  O O     . GLY A 1 246  ? 121.794 109.899 81.355  1.00 51.73  ? 246  GLY A O     1 
ATOM   1629  N N     . ASN A 1 247  ? 120.251 109.531 82.977  1.00 50.25  ? 247  ASN A N     1 
ATOM   1630  C CA    . ASN A 1 247  ? 120.896 110.102 84.156  1.00 48.73  ? 247  ASN A CA    1 
ATOM   1631  C C     . ASN A 1 247  ? 121.253 109.024 85.171  1.00 47.30  ? 247  ASN A C     1 
ATOM   1632  O O     . ASN A 1 247  ? 122.340 109.050 85.750  1.00 46.98  ? 247  ASN A O     1 
ATOM   1633  C CB    . ASN A 1 247  ? 119.993 111.136 84.820  1.00 48.90  ? 247  ASN A CB    1 
ATOM   1634  C CG    . ASN A 1 247  ? 119.590 112.249 83.880  1.00 49.05  ? 247  ASN A CG    1 
ATOM   1635  O OD1   . ASN A 1 247  ? 120.440 112.942 83.321  1.00 49.07  ? 247  ASN A OD1   1 
ATOM   1636  N ND2   . ASN A 1 247  ? 118.285 112.427 83.700  1.00 49.08  ? 247  ASN A ND2   1 
ATOM   1637  N N     . SER A 1 248  ? 120.344 108.084 85.400  1.00 46.12  ? 248  SER A N     1 
ATOM   1638  C CA    . SER A 1 248  ? 120.607 107.028 86.368  1.00 44.86  ? 248  SER A CA    1 
ATOM   1639  C C     . SER A 1 248  ? 119.896 105.713 86.096  1.00 44.06  ? 248  SER A C     1 
ATOM   1640  O O     . SER A 1 248  ? 118.959 105.639 85.294  1.00 43.78  ? 248  SER A O     1 
ATOM   1641  C CB    . SER A 1 248  ? 120.256 107.507 87.770  1.00 44.38  ? 248  SER A CB    1 
ATOM   1642  O OG    . SER A 1 248  ? 118.888 107.849 87.863  1.00 44.06  ? 248  SER A OG    1 
ATOM   1643  N N     . ILE A 1 249  ? 120.353 104.684 86.801  1.00 43.74  ? 249  ILE A N     1 
ATOM   1644  C CA    . ILE A 1 249  ? 119.806 103.344 86.676  1.00 43.59  ? 249  ILE A CA    1 
ATOM   1645  C C     . ILE A 1 249  ? 119.725 102.623 88.016  1.00 42.85  ? 249  ILE A C     1 
ATOM   1646  O O     . ILE A 1 249  ? 120.634 102.695 88.842  1.00 42.70  ? 249  ILE A O     1 
ATOM   1647  C CB    . ILE A 1 249  ? 120.645 102.496 85.704  1.00 44.11  ? 249  ILE A CB    1 
ATOM   1648  C CG1   . ILE A 1 249  ? 120.647 103.148 84.318  1.00 44.51  ? 249  ILE A CG1   1 
ATOM   1649  C CG2   . ILE A 1 249  ? 120.078 101.086 85.611  1.00 44.17  ? 249  ILE A CG2   1 
ATOM   1650  C CD1   . ILE A 1 249  ? 121.546 102.475 83.298  1.00 44.71  ? 249  ILE A CD1   1 
ATOM   1651  N N     . PHE A 1 250  ? 118.619 101.909 88.182  1.00 42.29  ? 250  PHE A N     1 
ATOM   1652  C CA    . PHE A 1 250  ? 118.272 101.120 89.362  1.00 41.65  ? 250  PHE A CA    1 
ATOM   1653  C C     . PHE A 1 250  ? 119.373 100.077 89.623  1.00 40.97  ? 250  PHE A C     1 
ATOM   1654  O O     . PHE A 1 250  ? 119.512 99.109  88.878  1.00 40.94  ? 250  PHE A O     1 
ATOM   1655  C CB    . PHE A 1 250  ? 116.930 100.449 89.052  1.00 41.59  ? 250  PHE A CB    1 
ATOM   1656  C CG    . PHE A 1 250  ? 116.376 99.621  90.160  1.00 41.62  ? 250  PHE A CG    1 
ATOM   1657  C CD1   . PHE A 1 250  ? 115.744 100.211 91.247  1.00 41.65  ? 250  PHE A CD1   1 
ATOM   1658  C CD2   . PHE A 1 250  ? 116.431 98.237  90.086  1.00 41.67  ? 250  PHE A CD2   1 
ATOM   1659  C CE1   . PHE A 1 250  ? 115.168 99.425  92.250  1.00 41.80  ? 250  PHE A CE1   1 
ATOM   1660  C CE2   . PHE A 1 250  ? 115.863 97.442  91.077  1.00 41.80  ? 250  PHE A CE2   1 
ATOM   1661  C CZ    . PHE A 1 250  ? 115.228 98.036  92.161  1.00 41.86  ? 250  PHE A CZ    1 
ATOM   1662  N N     . LEU A 1 251  ? 120.135 100.270 90.702  1.00 40.49  ? 251  LEU A N     1 
ATOM   1663  C CA    . LEU A 1 251  ? 121.263 99.393  91.024  1.00 40.04  ? 251  LEU A CA    1 
ATOM   1664  C C     . LEU A 1 251  ? 121.153 98.435  92.214  1.00 39.57  ? 251  LEU A C     1 
ATOM   1665  O O     . LEU A 1 251  ? 121.354 98.826  93.364  1.00 39.63  ? 251  LEU A O     1 
ATOM   1666  C CB    . LEU A 1 251  ? 122.509 100.264 91.207  1.00 40.16  ? 251  LEU A CB    1 
ATOM   1667  C CG    . LEU A 1 251  ? 123.914 99.670  91.047  1.00 40.15  ? 251  LEU A CG    1 
ATOM   1668  C CD1   . LEU A 1 251  ? 124.244 98.740  92.198  1.00 40.12  ? 251  LEU A CD1   1 
ATOM   1669  C CD2   . LEU A 1 251  ? 123.992 98.942  89.718  1.00 40.13  ? 251  LEU A CD2   1 
ATOM   1670  N N     . VAL A 1 252  ? 120.846 97.174  91.922  1.00 38.98  ? 252  VAL A N     1 
ATOM   1671  C CA    . VAL A 1 252  ? 120.760 96.133  92.944  1.00 38.50  ? 252  VAL A CA    1 
ATOM   1672  C C     . VAL A 1 252  ? 121.891 95.134  92.725  1.00 38.11  ? 252  VAL A C     1 
ATOM   1673  O O     . VAL A 1 252  ? 122.507 94.652  93.676  1.00 37.98  ? 252  VAL A O     1 
ATOM   1674  C CB    . VAL A 1 252  ? 119.413 95.388  92.900  1.00 38.61  ? 252  VAL A CB    1 
ATOM   1675  C CG1   . VAL A 1 252  ? 118.289 96.352  93.230  1.00 38.65  ? 252  VAL A CG1   1 
ATOM   1676  C CG2   . VAL A 1 252  ? 119.192 94.779  91.520  1.00 38.66  ? 252  VAL A CG2   1 
ATOM   1677  N N     . ALA A 1 253  ? 122.133 94.821  91.457  1.00 37.91  ? 253  ALA A N     1 
ATOM   1678  C CA    . ALA A 1 253  ? 123.187 93.899  91.063  1.00 37.95  ? 253  ALA A CA    1 
ATOM   1679  C C     . ALA A 1 253  ? 124.163 94.686  90.201  1.00 38.46  ? 253  ALA A C     1 
ATOM   1680  O O     . ALA A 1 253  ? 123.827 95.741  89.666  1.00 38.32  ? 253  ALA A O     1 
ATOM   1681  C CB    . ALA A 1 253  ? 122.603 92.739  90.270  1.00 37.67  ? 253  ALA A CB    1 
ATOM   1682  N N     . PRO A 1 254  ? 125.392 94.181  90.060  1.00 39.23  ? 254  PRO A N     1 
ATOM   1683  C CA    . PRO A 1 254  ? 126.455 94.809  89.269  1.00 39.59  ? 254  PRO A CA    1 
ATOM   1684  C C     . PRO A 1 254  ? 126.092 95.010  87.801  1.00 39.64  ? 254  PRO A C     1 
ATOM   1685  O O     . PRO A 1 254  ? 125.845 94.051  87.070  1.00 39.49  ? 254  PRO A O     1 
ATOM   1686  C CB    . PRO A 1 254  ? 127.625 93.847  89.451  1.00 39.80  ? 254  PRO A CB    1 
ATOM   1687  C CG    . PRO A 1 254  ? 127.398 93.321  90.837  1.00 39.79  ? 254  PRO A CG    1 
ATOM   1688  C CD    . PRO A 1 254  ? 125.914 93.031  90.815  1.00 39.58  ? 254  PRO A CD    1 
ATOM   1689  N N     . LEU A 1 255  ? 126.062 96.273  87.385  1.00 40.00  ? 255  LEU A N     1 
ATOM   1690  C CA    . LEU A 1 255  ? 125.726 96.634  86.017  1.00 40.47  ? 255  LEU A CA    1 
ATOM   1691  C C     . LEU A 1 255  ? 126.887 97.342  85.326  1.00 40.42  ? 255  LEU A C     1 
ATOM   1692  O O     . LEU A 1 255  ? 127.688 98.027  85.964  1.00 40.15  ? 255  LEU A O     1 
ATOM   1693  C CB    . LEU A 1 255  ? 124.486 97.529  86.007  1.00 41.19  ? 255  LEU A CB    1 
ATOM   1694  C CG    . LEU A 1 255  ? 123.169 96.833  86.361  1.00 41.80  ? 255  LEU A CG    1 
ATOM   1695  C CD1   . LEU A 1 255  ? 122.116 97.868  86.724  1.00 42.01  ? 255  LEU A CD1   1 
ATOM   1696  C CD2   . LEU A 1 255  ? 122.708 95.979  85.184  1.00 42.01  ? 255  LEU A CD2   1 
ATOM   1697  N N     . ILE A 1 256  ? 126.949 97.172  84.009  1.00 40.96  ? 256  ILE A N     1 
ATOM   1698  C CA    . ILE A 1 256  ? 127.997 97.740  83.167  1.00 41.90  ? 256  ILE A CA    1 
ATOM   1699  C C     . ILE A 1 256  ? 127.531 99.024  82.489  1.00 42.22  ? 256  ILE A C     1 
ATOM   1700  O O     . ILE A 1 256  ? 126.460 99.055  81.888  1.00 41.89  ? 256  ILE A O     1 
ATOM   1701  C CB    . ILE A 1 256  ? 128.381 96.748  82.062  1.00 42.77  ? 256  ILE A CB    1 
ATOM   1702  C CG1   . ILE A 1 256  ? 128.568 95.352  82.664  1.00 43.37  ? 256  ILE A CG1   1 
ATOM   1703  C CG2   . ILE A 1 256  ? 129.650 97.206  81.376  1.00 42.96  ? 256  ILE A CG2   1 
ATOM   1704  C CD1   . ILE A 1 256  ? 128.129 94.218  81.754  1.00 43.76  ? 256  ILE A CD1   1 
ATOM   1705  N N     . ILE A 1 257  ? 128.382 100.045 82.497  1.00 43.06  ? 257  ILE A N     1 
ATOM   1706  C CA    . ILE A 1 257  ? 128.086 101.303 81.813  1.00 43.93  ? 257  ILE A CA    1 
ATOM   1707  C C     . ILE A 1 257  ? 128.873 101.293 80.501  1.00 44.58  ? 257  ILE A C     1 
ATOM   1708  O O     . ILE A 1 257  ? 130.046 100.927 80.493  1.00 44.61  ? 257  ILE A O     1 
ATOM   1709  C CB    . ILE A 1 257  ? 128.498 102.522 82.654  1.00 44.10  ? 257  ILE A CB    1 
ATOM   1710  C CG1   . ILE A 1 257  ? 127.702 102.564 83.961  1.00 44.25  ? 257  ILE A CG1   1 
ATOM   1711  C CG2   . ILE A 1 257  ? 128.291 103.806 81.866  1.00 44.04  ? 257  ILE A CG2   1 
ATOM   1712  C CD1   . ILE A 1 257  ? 127.973 101.396 84.882  1.00 44.22  ? 257  ILE A CD1   1 
ATOM   1713  N N     . TYR A 1 258  ? 128.246 101.695 79.396  1.00 45.20  ? 258  TYR A N     1 
ATOM   1714  C CA    . TYR A 1 258  ? 128.924 101.674 78.094  1.00 45.81  ? 258  TYR A CA    1 
ATOM   1715  C C     . TYR A 1 258  ? 129.121 103.034 77.408  1.00 45.53  ? 258  TYR A C     1 
ATOM   1716  O O     . TYR A 1 258  ? 128.199 103.847 77.339  1.00 45.27  ? 258  TYR A O     1 
ATOM   1717  C CB    . TYR A 1 258  ? 128.245 100.682 77.143  1.00 46.72  ? 258  TYR A CB    1 
ATOM   1718  C CG    . TYR A 1 258  ? 126.755 100.885 76.985  1.00 47.56  ? 258  TYR A CG    1 
ATOM   1719  C CD1   . TYR A 1 258  ? 126.216 101.305 75.778  1.00 47.92  ? 258  TYR A CD1   1 
ATOM   1720  C CD2   . TYR A 1 258  ? 125.889 100.654 78.046  1.00 47.91  ? 258  TYR A CD2   1 
ATOM   1721  C CE1   . TYR A 1 258  ? 124.855 101.489 75.629  1.00 48.19  ? 258  TYR A CE1   1 
ATOM   1722  C CE2   . TYR A 1 258  ? 124.526 100.837 77.907  1.00 48.18  ? 258  TYR A CE2   1 
ATOM   1723  C CZ    . TYR A 1 258  ? 124.015 101.256 76.697  1.00 48.30  ? 258  TYR A CZ    1 
ATOM   1724  O OH    . TYR A 1 258  ? 122.659 101.440 76.554  1.00 48.31  ? 258  TYR A OH    1 
ATOM   1725  N N     . HIS A 1 259  ? 130.334 103.266 76.905  1.00 45.59  ? 259  HIS A N     1 
ATOM   1726  C CA    . HIS A 1 259  ? 130.676 104.521 76.230  1.00 45.58  ? 259  HIS A CA    1 
ATOM   1727  C C     . HIS A 1 259  ? 130.970 104.365 74.730  1.00 45.72  ? 259  HIS A C     1 
ATOM   1728  O O     . HIS A 1 259  ? 132.088 104.053 74.324  1.00 45.39  ? 259  HIS A O     1 
ATOM   1729  C CB    . HIS A 1 259  ? 131.856 105.200 76.930  1.00 45.48  ? 259  HIS A CB    1 
ATOM   1730  N N     . VAL A 1 260  ? 129.941 104.614 73.928  1.00 46.31  ? 260  VAL A N     1 
ATOM   1731  C CA    . VAL A 1 260  ? 129.954 104.534 72.467  1.00 47.01  ? 260  VAL A CA    1 
ATOM   1732  C C     . VAL A 1 260  ? 130.886 105.607 71.905  1.00 47.34  ? 260  VAL A C     1 
ATOM   1733  O O     . VAL A 1 260  ? 130.697 106.808 72.142  1.00 47.41  ? 260  VAL A O     1 
ATOM   1734  C CB    . VAL A 1 260  ? 128.546 104.728 71.876  1.00 47.30  ? 260  VAL A CB    1 
ATOM   1735  C CG1   . VAL A 1 260  ? 128.589 104.624 70.359  1.00 47.45  ? 260  VAL A CG1   1 
ATOM   1736  C CG2   . VAL A 1 260  ? 127.581 103.709 72.460  1.00 47.41  ? 260  VAL A CG2   1 
ATOM   1737  N N     . ILE A 1 261  ? 131.908 105.176 71.175  1.00 47.77  ? 261  ILE A N     1 
ATOM   1738  C CA    . ILE A 1 261  ? 132.875 106.108 70.608  1.00 48.34  ? 261  ILE A CA    1 
ATOM   1739  C C     . ILE A 1 261  ? 132.434 106.679 69.264  1.00 48.66  ? 261  ILE A C     1 
ATOM   1740  O O     . ILE A 1 261  ? 132.592 106.039 68.225  1.00 48.80  ? 261  ILE A O     1 
ATOM   1741  C CB    . ILE A 1 261  ? 134.258 105.449 70.444  1.00 48.68  ? 261  ILE A CB    1 
ATOM   1742  C CG1   . ILE A 1 261  ? 134.716 104.845 71.771  1.00 48.79  ? 261  ILE A CG1   1 
ATOM   1743  C CG2   . ILE A 1 261  ? 135.272 106.459 69.932  1.00 48.82  ? 261  ILE A CG2   1 
ATOM   1744  C CD1   . ILE A 1 261  ? 134.751 105.839 72.911  1.00 48.87  ? 261  ILE A CD1   1 
ATOM   1745  N N     . ASP A 1 262  ? 131.882 107.889 69.290  1.00 48.75  ? 262  ASP A N     1 
ATOM   1746  C CA    . ASP A 1 262  ? 131.440 108.542 68.070  1.00 48.77  ? 262  ASP A CA    1 
ATOM   1747  C C     . ASP A 1 262  ? 132.376 109.683 67.703  1.00 48.39  ? 262  ASP A C     1 
ATOM   1748  O O     . ASP A 1 262  ? 133.464 109.824 68.262  1.00 48.46  ? 262  ASP A O     1 
ATOM   1749  C CB    . ASP A 1 262  ? 130.021 109.081 68.244  1.00 49.07  ? 262  ASP A CB    1 
ATOM   1750  C CG    . ASP A 1 262  ? 129.940 110.182 69.269  1.00 49.33  ? 262  ASP A CG    1 
ATOM   1751  O OD1   . ASP A 1 262  ? 130.365 109.955 70.421  1.00 49.38  ? 262  ASP A OD1   1 
ATOM   1752  O OD2   . ASP A 1 262  ? 129.444 111.274 68.926  1.00 49.41  ? 262  ASP A OD2   1 
ATOM   1753  N N     . SER A 1 263  ? 131.935 110.490 66.749  1.00 47.92  ? 263  SER A N     1 
ATOM   1754  C CA    . SER A 1 263  ? 132.718 111.615 66.269  1.00 47.52  ? 263  SER A CA    1 
ATOM   1755  C C     . SER A 1 263  ? 132.952 112.693 67.330  1.00 47.32  ? 263  SER A C     1 
ATOM   1756  O O     . SER A 1 263  ? 133.816 113.551 67.164  1.00 47.51  ? 263  SER A O     1 
ATOM   1757  C CB    . SER A 1 263  ? 132.033 112.223 65.045  1.00 47.41  ? 263  SER A CB    1 
ATOM   1758  O OG    . SER A 1 263  ? 132.903 113.111 64.371  1.00 47.40  ? 263  SER A OG    1 
ATOM   1759  N N     . ASN A 1 264  ? 132.189 112.655 68.416  1.00 46.72  ? 264  ASN A N     1 
ATOM   1760  C CA    . ASN A 1 264  ? 132.366 113.652 69.468  1.00 46.03  ? 264  ASN A CA    1 
ATOM   1761  C C     . ASN A 1 264  ? 133.227 113.130 70.604  1.00 45.41  ? 264  ASN A C     1 
ATOM   1762  O O     . ASN A 1 264  ? 133.658 113.897 71.463  1.00 45.46  ? 264  ASN A O     1 
ATOM   1763  C CB    . ASN A 1 264  ? 131.016 114.112 70.024  1.00 45.85  ? 264  ASN A CB    1 
ATOM   1764  C CG    . ASN A 1 264  ? 130.199 114.889 69.013  1.00 45.73  ? 264  ASN A CG    1 
ATOM   1765  O OD1   . ASN A 1 264  ? 129.727 114.329 68.025  1.00 45.70  ? 264  ASN A OD1   1 
ATOM   1766  N ND2   . ASN A 1 264  ? 130.037 116.188 69.247  1.00 45.69  ? 264  ASN A ND2   1 
ATOM   1767  N N     . SER A 1 265  ? 133.483 111.827 70.606  1.00 44.63  ? 265  SER A N     1 
ATOM   1768  C CA    . SER A 1 265  ? 134.294 111.227 71.654  1.00 43.81  ? 265  SER A CA    1 
ATOM   1769  C C     . SER A 1 265  ? 135.777 111.439 71.404  1.00 43.35  ? 265  SER A C     1 
ATOM   1770  O O     . SER A 1 265  ? 136.269 111.218 70.299  1.00 43.31  ? 265  SER A O     1 
ATOM   1771  C CB    . SER A 1 265  ? 134.011 109.732 71.763  1.00 43.49  ? 265  SER A CB    1 
ATOM   1772  O OG    . SER A 1 265  ? 134.816 109.149 72.773  1.00 43.36  ? 265  SER A OG    1 
ATOM   1773  N N     . PRO A 1 266  ? 136.507 111.879 72.433  1.00 43.02  ? 266  PRO A N     1 
ATOM   1774  C CA    . PRO A 1 266  ? 137.950 112.132 72.355  1.00 42.82  ? 266  PRO A CA    1 
ATOM   1775  C C     . PRO A 1 266  ? 138.786 110.867 72.112  1.00 42.63  ? 266  PRO A C     1 
ATOM   1776  O O     . PRO A 1 266  ? 139.948 110.950 71.709  1.00 42.61  ? 266  PRO A O     1 
ATOM   1777  C CB    . PRO A 1 266  ? 138.260 112.775 73.711  1.00 42.86  ? 266  PRO A CB    1 
ATOM   1778  C CG    . PRO A 1 266  ? 136.950 113.422 74.096  1.00 42.89  ? 266  PRO A CG    1 
ATOM   1779  C CD    . PRO A 1 266  ? 135.952 112.363 73.708  1.00 42.90  ? 266  PRO A CD    1 
ATOM   1780  N N     . LEU A 1 267  ? 138.187 109.704 72.348  1.00 42.43  ? 267  LEU A N     1 
ATOM   1781  C CA    . LEU A 1 267  ? 138.872 108.417 72.178  1.00 42.19  ? 267  LEU A CA    1 
ATOM   1782  C C     . LEU A 1 267  ? 138.663 107.845 70.784  1.00 41.87  ? 267  LEU A C     1 
ATOM   1783  O O     . LEU A 1 267  ? 138.879 106.657 70.539  1.00 41.72  ? 267  LEU A O     1 
ATOM   1784  C CB    . LEU A 1 267  ? 138.344 107.418 73.200  1.00 42.33  ? 267  LEU A CB    1 
ATOM   1785  C CG    . LEU A 1 267  ? 138.095 107.990 74.594  1.00 42.53  ? 267  LEU A CG    1 
ATOM   1786  C CD1   . LEU A 1 267  ? 137.182 107.055 75.367  1.00 42.63  ? 267  LEU A CD1   1 
ATOM   1787  C CD2   . LEU A 1 267  ? 139.415 108.203 75.315  1.00 42.64  ? 267  LEU A CD2   1 
ATOM   1788  N N     . TYR A 1 268  ? 138.243 108.711 69.876  1.00 41.77  ? 268  TYR A N     1 
ATOM   1789  C CA    . TYR A 1 268  ? 137.964 108.352 68.498  1.00 41.81  ? 268  TYR A CA    1 
ATOM   1790  C C     . TYR A 1 268  ? 139.247 108.222 67.690  1.00 42.27  ? 268  TYR A C     1 
ATOM   1791  O O     . TYR A 1 268  ? 139.305 107.488 66.699  1.00 42.27  ? 268  TYR A O     1 
ATOM   1792  C CB    . TYR A 1 268  ? 137.081 109.442 67.913  1.00 41.43  ? 268  TYR A CB    1 
ATOM   1793  C CG    . TYR A 1 268  ? 136.372 109.111 66.633  1.00 41.14  ? 268  TYR A CG    1 
ATOM   1794  C CD1   . TYR A 1 268  ? 135.624 107.938 66.504  1.00 40.99  ? 268  TYR A CD1   1 
ATOM   1795  C CD2   . TYR A 1 268  ? 136.353 110.024 65.586  1.00 41.00  ? 268  TYR A CD2   1 
ATOM   1796  C CE1   . TYR A 1 268  ? 134.864 107.696 65.361  1.00 40.84  ? 268  TYR A CE1   1 
ATOM   1797  C CE2   . TYR A 1 268  ? 135.602 109.795 64.444  1.00 40.85  ? 268  TYR A CE2   1 
ATOM   1798  C CZ    . TYR A 1 268  ? 134.856 108.632 64.338  1.00 40.80  ? 268  TYR A CZ    1 
ATOM   1799  O OH    . TYR A 1 268  ? 134.076 108.434 63.224  1.00 40.77  ? 268  TYR A OH    1 
ATOM   1800  N N     . ASP A 1 269  ? 140.277 108.940 68.121  1.00 42.78  ? 269  ASP A N     1 
ATOM   1801  C CA    . ASP A 1 269  ? 141.560 108.939 67.435  1.00 43.37  ? 269  ASP A CA    1 
ATOM   1802  C C     . ASP A 1 269  ? 142.616 108.154 68.210  1.00 43.64  ? 269  ASP A C     1 
ATOM   1803  O O     . ASP A 1 269  ? 143.801 108.475 68.154  1.00 43.58  ? 269  ASP A O     1 
ATOM   1804  C CB    . ASP A 1 269  ? 142.030 110.382 67.227  1.00 43.67  ? 269  ASP A CB    1 
ATOM   1805  C CG    . ASP A 1 269  ? 143.136 110.502 66.196  1.00 43.91  ? 269  ASP A CG    1 
ATOM   1806  O OD1   . ASP A 1 269  ? 142.910 110.104 65.036  1.00 43.94  ? 269  ASP A OD1   1 
ATOM   1807  O OD2   . ASP A 1 269  ? 144.229 111.000 66.538  1.00 43.93  ? 269  ASP A OD2   1 
ATOM   1808  N N     . LEU A 1 270  ? 142.175 107.121 68.926  1.00 43.90  ? 270  LEU A N     1 
ATOM   1809  C CA    . LEU A 1 270  ? 143.072 106.298 69.733  1.00 44.24  ? 270  LEU A CA    1 
ATOM   1810  C C     . LEU A 1 270  ? 143.214 104.841 69.293  1.00 45.32  ? 270  LEU A C     1 
ATOM   1811  O O     . LEU A 1 270  ? 142.227 104.169 69.009  1.00 45.19  ? 270  LEU A O     1 
ATOM   1812  C CB    . LEU A 1 270  ? 142.604 106.306 71.186  1.00 43.58  ? 270  LEU A CB    1 
ATOM   1813  C CG    . LEU A 1 270  ? 142.924 107.501 72.081  1.00 43.06  ? 270  LEU A CG    1 
ATOM   1814  C CD1   . LEU A 1 270  ? 142.445 108.811 71.471  1.00 42.92  ? 270  LEU A CD1   1 
ATOM   1815  C CD2   . LEU A 1 270  ? 142.259 107.252 73.421  1.00 42.90  ? 270  LEU A CD2   1 
ATOM   1816  N N     . ALA A 1 271  ? 144.455 104.358 69.269  1.00 46.61  ? 271  ALA A N     1 
ATOM   1817  C CA    . ALA A 1 271  ? 144.744 102.976 68.898  1.00 48.05  ? 271  ALA A CA    1 
ATOM   1818  C C     . ALA A 1 271  ? 144.890 102.146 70.178  1.00 49.93  ? 271  ALA A C     1 
ATOM   1819  O O     . ALA A 1 271  ? 145.258 102.670 71.224  1.00 49.66  ? 271  ALA A O     1 
ATOM   1820  C CB    . ALA A 1 271  ? 146.031 102.906 68.079  1.00 47.81  ? 271  ALA A CB    1 
ATOM   1821  N N     . PRO A 1 272  ? 144.641 100.832 70.094  1.00 52.36  ? 272  PRO A N     1 
ATOM   1822  C CA    . PRO A 1 272  ? 144.719 99.891  71.220  1.00 54.46  ? 272  PRO A CA    1 
ATOM   1823  C C     . PRO A 1 272  ? 146.036 99.719  71.990  1.00 57.21  ? 272  PRO A C     1 
ATOM   1824  O O     . PRO A 1 272  ? 146.048 99.841  73.217  1.00 57.18  ? 272  PRO A O     1 
ATOM   1825  C CB    . PRO A 1 272  ? 144.245 98.572  70.597  1.00 53.90  ? 272  PRO A CB    1 
ATOM   1826  C CG    . PRO A 1 272  ? 144.610 98.716  69.142  1.00 53.37  ? 272  PRO A CG    1 
ATOM   1827  C CD    . PRO A 1 272  ? 144.225 100.142 68.858  1.00 52.84  ? 272  PRO A CD    1 
ATOM   1828  N N     . SER A 1 273  ? 147.137 99.451  71.296  1.00 60.07  ? 273  SER A N     1 
ATOM   1829  C CA    . SER A 1 273  ? 148.413 99.274  71.988  1.00 62.92  ? 273  SER A CA    1 
ATOM   1830  C C     . SER A 1 273  ? 149.197 100.578 72.118  1.00 65.54  ? 273  SER A C     1 
ATOM   1831  O O     . SER A 1 273  ? 150.113 100.674 72.930  1.00 65.53  ? 273  SER A O     1 
ATOM   1832  C CB    . SER A 1 273  ? 149.269 98.206  71.281  1.00 63.06  ? 273  SER A CB    1 
ATOM   1833  O OG    . SER A 1 273  ? 149.460 98.487  69.905  1.00 63.08  ? 273  SER A OG    1 
ATOM   1834  N N     . ASP A 1 274  ? 148.827 101.579 71.326  1.00 68.17  ? 274  ASP A N     1 
ATOM   1835  C CA    . ASP A 1 274  ? 149.510 102.870 71.361  1.00 70.82  ? 274  ASP A CA    1 
ATOM   1836  C C     . ASP A 1 274  ? 148.943 103.844 72.381  1.00 73.07  ? 274  ASP A C     1 
ATOM   1837  O O     . ASP A 1 274  ? 149.665 104.713 72.875  1.00 73.08  ? 274  ASP A O     1 
ATOM   1838  C CB    . ASP A 1 274  ? 149.466 103.523 69.985  1.00 71.22  ? 274  ASP A CB    1 
ATOM   1839  C CG    . ASP A 1 274  ? 150.166 102.707 68.928  1.00 71.61  ? 274  ASP A CG    1 
ATOM   1840  O OD1   . ASP A 1 274  ? 149.629 101.649 68.532  1.00 71.72  ? 274  ASP A OD1   1 
ATOM   1841  O OD2   . ASP A 1 274  ? 151.264 103.117 68.502  1.00 71.74  ? 274  ASP A OD2   1 
ATOM   1842  N N     . LEU A 1 275  ? 147.665 103.708 72.707  1.00 75.32  ? 275  LEU A N     1 
ATOM   1843  C CA    . LEU A 1 275  ? 147.044 104.629 73.643  1.00 77.64  ? 275  LEU A CA    1 
ATOM   1844  C C     . LEU A 1 275  ? 147.316 104.350 75.122  1.00 79.71  ? 275  LEU A C     1 
ATOM   1845  O O     . LEU A 1 275  ? 147.279 105.272 75.933  1.00 79.61  ? 275  LEU A O     1 
ATOM   1846  C CB    . LEU A 1 275  ? 145.530 104.690 73.384  1.00 77.88  ? 275  LEU A CB    1 
ATOM   1847  N N     . HIS A 1 276  ? 147.617 103.106 75.482  1.00 81.99  ? 276  HIS A N     1 
ATOM   1848  C CA    . HIS A 1 276  ? 147.853 102.783 76.889  1.00 84.34  ? 276  HIS A CA    1 
ATOM   1849  C C     . HIS A 1 276  ? 149.146 103.277 77.513  1.00 86.27  ? 276  HIS A C     1 
ATOM   1850  O O     . HIS A 1 276  ? 149.215 103.469 78.731  1.00 86.28  ? 276  HIS A O     1 
ATOM   1851  C CB    . HIS A 1 276  ? 147.730 101.274 77.111  1.00 84.86  ? 276  HIS A CB    1 
ATOM   1852  C CG    . HIS A 1 276  ? 146.353 100.752 76.864  1.00 85.44  ? 276  HIS A CG    1 
ATOM   1853  N ND1   . HIS A 1 276  ? 145.227 101.495 77.153  1.00 85.69  ? 276  HIS A ND1   1 
ATOM   1854  C CD2   . HIS A 1 276  ? 145.912 99.587  76.336  1.00 85.73  ? 276  HIS A CD2   1 
ATOM   1855  C CE1   . HIS A 1 276  ? 144.151 100.810 76.811  1.00 85.84  ? 276  HIS A CE1   1 
ATOM   1856  N NE2   . HIS A 1 276  ? 144.539 99.648  76.315  1.00 85.84  ? 276  HIS A NE2   1 
ATOM   1857  N N     . HIS A 1 277  ? 150.170 103.480 76.699  1.00 88.23  ? 277  HIS A N     1 
ATOM   1858  C CA    . HIS A 1 277  ? 151.443 103.939 77.229  1.00 90.33  ? 277  HIS A CA    1 
ATOM   1859  C C     . HIS A 1 277  ? 151.810 105.361 76.804  1.00 91.27  ? 277  HIS A C     1 
ATOM   1860  O O     . HIS A 1 277  ? 152.336 106.140 77.603  1.00 91.28  ? 277  HIS A O     1 
ATOM   1861  C CB    . HIS A 1 277  ? 152.540 102.954 76.826  1.00 91.57  ? 277  HIS A CB    1 
ATOM   1862  C CG    . HIS A 1 277  ? 153.847 103.201 77.506  1.00 92.80  ? 277  HIS A CG    1 
ATOM   1863  N ND1   . HIS A 1 277  ? 154.745 104.153 77.073  1.00 93.29  ? 277  HIS A ND1   1 
ATOM   1864  C CD2   . HIS A 1 277  ? 154.396 102.638 78.609  1.00 93.36  ? 277  HIS A CD2   1 
ATOM   1865  C CE1   . HIS A 1 277  ? 155.792 104.165 77.879  1.00 93.57  ? 277  HIS A CE1   1 
ATOM   1866  N NE2   . HIS A 1 277  ? 155.605 103.256 78.818  1.00 93.60  ? 277  HIS A NE2   1 
ATOM   1867  N N     . HIS A 1 278  ? 151.532 105.688 75.544  1.00 92.28  ? 278  HIS A N     1 
ATOM   1868  C CA    . HIS A 1 278  ? 151.827 107.009 75.000  1.00 93.44  ? 278  HIS A CA    1 
ATOM   1869  C C     . HIS A 1 278  ? 151.107 108.120 75.753  1.00 93.22  ? 278  HIS A C     1 
ATOM   1870  O O     . HIS A 1 278  ? 151.698 109.154 76.072  1.00 93.26  ? 278  HIS A O     1 
ATOM   1871  C CB    . HIS A 1 278  ? 151.433 107.070 73.520  1.00 94.89  ? 278  HIS A CB    1 
ATOM   1872  C CG    . HIS A 1 278  ? 152.446 106.467 72.600  1.00 96.34  ? 278  HIS A CG    1 
ATOM   1873  N ND1   . HIS A 1 278  ? 152.773 105.128 72.616  1.00 96.99  ? 278  HIS A ND1   1 
ATOM   1874  C CD2   . HIS A 1 278  ? 153.242 107.036 71.665  1.00 97.00  ? 278  HIS A CD2   1 
ATOM   1875  C CE1   . HIS A 1 278  ? 153.725 104.898 71.730  1.00 97.37  ? 278  HIS A CE1   1 
ATOM   1876  N NE2   . HIS A 1 278  ? 154.028 106.039 71.139  1.00 97.36  ? 278  HIS A NE2   1 
ATOM   1877  N N     . GLN A 1 279  ? 149.831 107.901 76.036  1.00 92.96  ? 279  GLN A N     1 
ATOM   1878  C CA    . GLN A 1 279  ? 149.031 108.896 76.735  1.00 92.81  ? 279  GLN A CA    1 
ATOM   1879  C C     . GLN A 1 279  ? 149.074 108.720 78.235  1.00 91.23  ? 279  GLN A C     1 
ATOM   1880  O O     . GLN A 1 279  ? 149.046 107.600 78.744  1.00 91.38  ? 279  GLN A O     1 
ATOM   1881  C CB    . GLN A 1 279  ? 147.578 108.821 76.291  1.00 94.27  ? 279  GLN A CB    1 
ATOM   1882  C CG    . GLN A 1 279  ? 147.347 109.087 74.828  1.00 95.74  ? 279  GLN A CG    1 
ATOM   1883  C CD    . GLN A 1 279  ? 145.899 108.904 74.462  1.00 97.05  ? 279  GLN A CD    1 
ATOM   1884  O OE1   . GLN A 1 279  ? 145.329 107.836 74.679  1.00 97.50  ? 279  GLN A OE1   1 
ATOM   1885  N NE2   . GLN A 1 279  ? 145.288 109.946 73.918  1.00 97.51  ? 279  GLN A NE2   1 
ATOM   1886  N N     . ASP A 1 280  ? 149.127 109.844 78.939  1.00 89.46  ? 280  ASP A N     1 
ATOM   1887  C CA    . ASP A 1 280  ? 149.150 109.838 80.391  1.00 87.75  ? 280  ASP A CA    1 
ATOM   1888  C C     . ASP A 1 280  ? 147.973 110.666 80.872  1.00 85.91  ? 280  ASP A C     1 
ATOM   1889  O O     . ASP A 1 280  ? 148.138 111.758 81.420  1.00 85.95  ? 280  ASP A O     1 
ATOM   1890  C CB    . ASP A 1 280  ? 150.461 110.430 80.893  1.00 87.89  ? 280  ASP A CB    1 
ATOM   1891  C CG    . ASP A 1 280  ? 151.643 109.508 80.672  1.00 88.01  ? 280  ASP A CG    1 
ATOM   1892  O OD1   . ASP A 1 280  ? 151.663 108.420 81.286  1.00 88.05  ? 280  ASP A OD1   1 
ATOM   1893  O OD2   . ASP A 1 280  ? 152.543 109.855 79.879  1.00 88.02  ? 280  ASP A OD2   1 
ATOM   1894  N N     . LEU A 1 281  ? 146.769 110.148 80.654  1.00 83.95  ? 281  LEU A N     1 
ATOM   1895  C CA    . LEU A 1 281  ? 145.559 110.841 81.052  1.00 81.96  ? 281  LEU A CA    1 
ATOM   1896  C C     . LEU A 1 281  ? 144.749 109.996 82.024  1.00 80.26  ? 281  LEU A C     1 
ATOM   1897  O O     . LEU A 1 281  ? 145.133 108.871 82.360  1.00 80.36  ? 281  LEU A O     1 
ATOM   1898  C CB    . LEU A 1 281  ? 144.727 111.186 79.817  1.00 81.65  ? 281  LEU A CB    1 
ATOM   1899  C CG    . LEU A 1 281  ? 144.383 110.033 78.870  1.00 81.41  ? 281  LEU A CG    1 
ATOM   1900  C CD1   . LEU A 1 281  ? 143.153 109.314 79.389  1.00 81.35  ? 281  LEU A CD1   1 
ATOM   1901  C CD2   . LEU A 1 281  ? 144.123 110.572 77.468  1.00 81.34  ? 281  LEU A CD2   1 
ATOM   1902  N N     . GLU A 1 282  ? 143.622 110.547 82.460  1.00 78.31  ? 282  GLU A N     1 
ATOM   1903  C CA    . GLU A 1 282  ? 142.752 109.887 83.421  1.00 76.29  ? 282  GLU A CA    1 
ATOM   1904  C C     . GLU A 1 282  ? 141.278 110.198 83.187  1.00 72.77  ? 282  GLU A C     1 
ATOM   1905  O O     . GLU A 1 282  ? 140.925 111.280 82.714  1.00 72.75  ? 282  GLU A O     1 
ATOM   1906  C CB    . GLU A 1 282  ? 143.141 110.326 84.826  1.00 77.57  ? 282  GLU A CB    1 
ATOM   1907  C CG    . GLU A 1 282  ? 143.740 109.244 85.688  1.00 78.53  ? 282  GLU A CG    1 
ATOM   1908  C CD    . GLU A 1 282  ? 144.388 109.811 86.928  1.00 79.12  ? 282  GLU A CD    1 
ATOM   1909  O OE1   . GLU A 1 282  ? 145.598 110.117 86.880  1.00 79.32  ? 282  GLU A OE1   1 
ATOM   1910  O OE2   . GLU A 1 282  ? 143.685 109.969 87.947  1.00 79.25  ? 282  GLU A OE2   1 
ATOM   1911  N N     . ILE A 1 283  ? 140.434 109.229 83.527  1.00 69.38  ? 283  ILE A N     1 
ATOM   1912  C CA    . ILE A 1 283  ? 138.991 109.359 83.394  1.00 66.00  ? 283  ILE A CA    1 
ATOM   1913  C C     . ILE A 1 283  ? 138.352 109.107 84.753  1.00 62.31  ? 283  ILE A C     1 
ATOM   1914  O O     . ILE A 1 283  ? 138.519 108.038 85.340  1.00 62.01  ? 283  ILE A O     1 
ATOM   1915  C CB    . ILE A 1 283  ? 138.419 108.361 82.372  1.00 66.47  ? 283  ILE A CB    1 
ATOM   1916  C CG1   . ILE A 1 283  ? 139.060 108.575 81.001  1.00 66.75  ? 283  ILE A CG1   1 
ATOM   1917  C CG2   . ILE A 1 283  ? 136.908 108.502 82.280  1.00 66.52  ? 283  ILE A CG2   1 
ATOM   1918  C CD1   . ILE A 1 283  ? 138.526 107.651 79.929  1.00 66.97  ? 283  ILE A CD1   1 
ATOM   1919  N N     . ILE A 1 284  ? 137.622 110.099 85.248  1.00 58.98  ? 284  ILE A N     1 
ATOM   1920  C CA    . ILE A 1 284  ? 136.968 110.005 86.548  1.00 55.79  ? 284  ILE A CA    1 
ATOM   1921  C C     . ILE A 1 284  ? 135.514 109.565 86.563  1.00 52.80  ? 284  ILE A C     1 
ATOM   1922  O O     . ILE A 1 284  ? 134.707 109.977 85.729  1.00 52.46  ? 284  ILE A O     1 
ATOM   1923  C CB    . ILE A 1 284  ? 137.049 111.338 87.292  1.00 55.84  ? 284  ILE A CB    1 
ATOM   1924  C CG1   . ILE A 1 284  ? 136.697 112.480 86.338  1.00 55.96  ? 284  ILE A CG1   1 
ATOM   1925  C CG2   . ILE A 1 284  ? 138.425 111.497 87.902  1.00 55.83  ? 284  ILE A CG2   1 
ATOM   1926  C CD1   . ILE A 1 284  ? 136.710 113.847 86.969  1.00 56.09  ? 284  ILE A CD1   1 
ATOM   1927  N N     . VAL A 1 285  ? 135.194 108.745 87.558  1.00 50.37  ? 285  VAL A N     1 
ATOM   1928  C CA    . VAL A 1 285  ? 133.851 108.222 87.747  1.00 48.16  ? 285  VAL A CA    1 
ATOM   1929  C C     . VAL A 1 285  ? 133.155 108.959 88.895  1.00 45.98  ? 285  VAL A C     1 
ATOM   1930  O O     . VAL A 1 285  ? 133.647 108.962 90.023  1.00 45.88  ? 285  VAL A O     1 
ATOM   1931  C CB    . VAL A 1 285  ? 133.896 106.722 88.095  1.00 48.18  ? 285  VAL A CB    1 
ATOM   1932  C CG1   . VAL A 1 285  ? 132.542 106.100 87.837  1.00 48.20  ? 285  VAL A CG1   1 
ATOM   1933  C CG2   . VAL A 1 285  ? 134.982 106.020 87.283  1.00 48.22  ? 285  VAL A CG2   1 
ATOM   1934  N N     . ILE A 1 286  ? 132.012 109.575 88.608  1.00 44.06  ? 286  ILE A N     1 
ATOM   1935  C CA    . ILE A 1 286  ? 131.265 110.307 89.625  1.00 42.39  ? 286  ILE A CA    1 
ATOM   1936  C C     . ILE A 1 286  ? 129.890 109.719 89.909  1.00 40.72  ? 286  ILE A C     1 
ATOM   1937  O O     . ILE A 1 286  ? 128.916 110.014 89.212  1.00 40.65  ? 286  ILE A O     1 
ATOM   1938  C CB    . ILE A 1 286  ? 131.080 111.778 89.230  1.00 42.57  ? 286  ILE A CB    1 
ATOM   1939  C CG1   . ILE A 1 286  ? 132.446 112.462 89.163  1.00 42.80  ? 286  ILE A CG1   1 
ATOM   1940  C CG2   . ILE A 1 286  ? 130.200 112.483 90.240  1.00 42.59  ? 286  ILE A CG2   1 
ATOM   1941  C CD1   . ILE A 1 286  ? 132.906 112.805 87.765  1.00 42.89  ? 286  ILE A CD1   1 
ATOM   1942  N N     . LEU A 1 287  ? 129.820 108.902 90.952  1.00 39.47  ? 287  LEU A N     1 
ATOM   1943  C CA    . LEU A 1 287  ? 128.588 108.240 91.355  1.00 38.45  ? 287  LEU A CA    1 
ATOM   1944  C C     . LEU A 1 287  ? 127.916 108.995 92.494  1.00 36.68  ? 287  LEU A C     1 
ATOM   1945  O O     . LEU A 1 287  ? 128.458 109.075 93.593  1.00 36.69  ? 287  LEU A O     1 
ATOM   1946  C CB    . LEU A 1 287  ? 128.917 106.820 91.805  1.00 39.13  ? 287  LEU A CB    1 
ATOM   1947  C CG    . LEU A 1 287  ? 127.812 105.974 92.430  1.00 39.65  ? 287  LEU A CG    1 
ATOM   1948  C CD1   . LEU A 1 287  ? 126.707 105.737 91.413  1.00 39.75  ? 287  LEU A CD1   1 
ATOM   1949  C CD2   . LEU A 1 287  ? 128.398 104.649 92.899  1.00 39.78  ? 287  LEU A CD2   1 
ATOM   1950  N N     . GLU A 1 288  ? 126.728 109.529 92.233  1.00 35.01  ? 288  GLU A N     1 
ATOM   1951  C CA    . GLU A 1 288  ? 125.989 110.289 93.237  1.00 33.46  ? 288  GLU A CA    1 
ATOM   1952  C C     . GLU A 1 288  ? 124.729 109.541 93.648  1.00 31.96  ? 288  GLU A C     1 
ATOM   1953  O O     . GLU A 1 288  ? 124.424 108.489 93.097  1.00 32.01  ? 288  GLU A O     1 
ATOM   1954  C CB    . GLU A 1 288  ? 125.610 111.651 92.663  1.00 33.80  ? 288  GLU A CB    1 
ATOM   1955  C CG    . GLU A 1 288  ? 126.798 112.413 92.103  1.00 34.24  ? 288  GLU A CG    1 
ATOM   1956  C CD    . GLU A 1 288  ? 126.385 113.588 91.243  1.00 34.80  ? 288  GLU A CD    1 
ATOM   1957  O OE1   . GLU A 1 288  ? 125.761 113.359 90.182  1.00 35.00  ? 288  GLU A OE1   1 
ATOM   1958  O OE2   . GLU A 1 288  ? 126.684 114.737 91.626  1.00 34.99  ? 288  GLU A OE2   1 
ATOM   1959  N N     . GLY A 1 289  ? 123.997 110.090 94.613  1.00 30.36  ? 289  GLY A N     1 
ATOM   1960  C CA    . GLY A 1 289  ? 122.776 109.441 95.062  1.00 28.89  ? 289  GLY A CA    1 
ATOM   1961  C C     . GLY A 1 289  ? 122.414 109.675 96.517  1.00 27.43  ? 289  GLY A C     1 
ATOM   1962  O O     . GLY A 1 289  ? 123.211 110.212 97.282  1.00 27.25  ? 289  GLY A O     1 
ATOM   1963  N N     . VAL A 1 290  ? 121.201 109.268 96.889  1.00 26.35  ? 290  VAL A N     1 
ATOM   1964  C CA    . VAL A 1 290  ? 120.705 109.432 98.250  1.00 25.45  ? 290  VAL A CA    1 
ATOM   1965  C C     . VAL A 1 290  ? 120.406 108.094 98.928  1.00 25.20  ? 290  VAL A C     1 
ATOM   1966  O O     . VAL A 1 290  ? 120.140 107.081 98.276  1.00 25.17  ? 290  VAL A O     1 
ATOM   1967  C CB    . VAL A 1 290  ? 119.408 110.262 98.296  1.00 25.04  ? 290  VAL A CB    1 
ATOM   1968  C CG1   . VAL A 1 290  ? 118.279 109.505 97.611  1.00 24.90  ? 290  VAL A CG1   1 
ATOM   1969  C CG2   . VAL A 1 290  ? 119.036 110.565 99.738  1.00 24.89  ? 290  VAL A CG2   1 
ATOM   1970  N N     . VAL A 1 291  ? 120.441 108.124 100.256 1.00 25.12  ? 291  VAL A N     1 
ATOM   1971  C CA    . VAL A 1 291  ? 120.189 106.958 101.086 1.00 25.27  ? 291  VAL A CA    1 
ATOM   1972  C C     . VAL A 1 291  ? 118.707 106.785 101.369 1.00 25.74  ? 291  VAL A C     1 
ATOM   1973  O O     . VAL A 1 291  ? 117.998 107.754 101.634 1.00 25.75  ? 291  VAL A O     1 
ATOM   1974  C CB    . VAL A 1 291  ? 120.913 107.078 102.432 1.00 25.10  ? 291  VAL A CB    1 
ATOM   1975  N N     . GLU A 1 292  ? 118.246 105.540 101.338 1.00 26.29  ? 292  GLU A N     1 
ATOM   1976  C CA    . GLU A 1 292  ? 116.846 105.269 101.605 1.00 26.86  ? 292  GLU A CA    1 
ATOM   1977  C C     . GLU A 1 292  ? 116.530 105.398 103.092 1.00 25.88  ? 292  GLU A C     1 
ATOM   1978  O O     . GLU A 1 292  ? 115.365 105.341 103.484 1.00 25.88  ? 292  GLU A O     1 
ATOM   1979  C CB    . GLU A 1 292  ? 116.452 103.881 101.100 1.00 28.25  ? 292  GLU A CB    1 
ATOM   1980  C CG    . GLU A 1 292  ? 117.221 102.708 101.699 1.00 29.27  ? 292  GLU A CG    1 
ATOM   1981  C CD    . GLU A 1 292  ? 116.578 101.382 101.339 1.00 29.94  ? 292  GLU A CD    1 
ATOM   1982  O OE1   . GLU A 1 292  ? 116.301 101.171 100.140 1.00 30.12  ? 292  GLU A OE1   1 
ATOM   1983  O OE2   . GLU A 1 292  ? 116.347 100.555 102.247 1.00 30.10  ? 292  GLU A OE2   1 
ATOM   1984  N N     . THR A 1 293  ? 117.556 105.571 103.920 1.00 24.85  ? 293  THR A N     1 
ATOM   1985  C CA    . THR A 1 293  ? 117.320 105.716 105.353 1.00 23.97  ? 293  THR A CA    1 
ATOM   1986  C C     . THR A 1 293  ? 117.431 107.179 105.750 1.00 23.37  ? 293  THR A C     1 
ATOM   1987  O O     . THR A 1 293  ? 116.626 107.678 106.536 1.00 23.39  ? 293  THR A O     1 
ATOM   1988  C CB    . THR A 1 293  ? 118.324 104.907 106.203 1.00 23.82  ? 293  THR A CB    1 
ATOM   1989  O OG1   . THR A 1 293  ? 119.662 105.337 105.916 1.00 23.77  ? 293  THR A OG1   1 
ATOM   1990  C CG2   . THR A 1 293  ? 118.204 103.423 105.871 1.00 23.79  ? 293  THR A CG2   1 
ATOM   1991  N N     . THR A 1 294  ? 118.426 107.864 105.197 1.00 22.82  ? 294  THR A N     1 
ATOM   1992  C CA    . THR A 1 294  ? 118.639 109.273 105.501 1.00 22.27  ? 294  THR A CA    1 
ATOM   1993  C C     . THR A 1 294  ? 118.591 110.160 104.258 1.00 22.25  ? 294  THR A C     1 
ATOM   1994  O O     . THR A 1 294  ? 119.023 109.766 103.176 1.00 22.07  ? 294  THR A O     1 
ATOM   1995  C CB    . THR A 1 294  ? 119.984 109.469 106.225 1.00 21.83  ? 294  THR A CB    1 
ATOM   1996  O OG1   . THR A 1 294  ? 121.051 108.989 105.404 1.00 21.64  ? 294  THR A OG1   1 
ATOM   1997  C CG2   . THR A 1 294  ? 119.980 108.712 107.547 1.00 21.65  ? 294  THR A CG2   1 
ATOM   1998  N N     . GLY A 1 295  ? 118.052 111.363 104.427 1.00 22.50  ? 295  GLY A N     1 
ATOM   1999  C CA    . GLY A 1 295  ? 117.925 112.300 103.323 1.00 22.87  ? 295  GLY A CA    1 
ATOM   2000  C C     . GLY A 1 295  ? 119.206 112.747 102.641 1.00 23.28  ? 295  GLY A C     1 
ATOM   2001  O O     . GLY A 1 295  ? 119.166 113.269 101.527 1.00 23.28  ? 295  GLY A O     1 
ATOM   2002  N N     . ILE A 1 296  ? 120.341 112.556 103.311 1.00 23.67  ? 296  ILE A N     1 
ATOM   2003  C CA    . ILE A 1 296  ? 121.639 112.973 102.785 1.00 24.14  ? 296  ILE A CA    1 
ATOM   2004  C C     . ILE A 1 296  ? 122.084 112.253 101.510 1.00 24.30  ? 296  ILE A C     1 
ATOM   2005  O O     . ILE A 1 296  ? 121.935 111.036 101.383 1.00 24.08  ? 296  ILE A O     1 
ATOM   2006  C CB    . ILE A 1 296  ? 122.752 112.814 103.855 1.00 24.47  ? 296  ILE A CB    1 
ATOM   2007  C CG1   . ILE A 1 296  ? 122.197 113.080 105.259 1.00 24.62  ? 296  ILE A CG1   1 
ATOM   2008  C CG2   . ILE A 1 296  ? 123.883 113.792 103.581 1.00 24.57  ? 296  ILE A CG2   1 
ATOM   2009  C CD1   . ILE A 1 296  ? 121.621 114.470 105.468 1.00 24.62  ? 296  ILE A CD1   1 
ATOM   2010  N N     . THR A 1 297  ? 122.632 113.027 100.572 1.00 24.82  ? 297  THR A N     1 
ATOM   2011  C CA    . THR A 1 297  ? 123.126 112.499 99.300  1.00 25.31  ? 297  THR A CA    1 
ATOM   2012  C C     . THR A 1 297  ? 124.649 112.429 99.319  1.00 25.76  ? 297  THR A C     1 
ATOM   2013  O O     . THR A 1 297  ? 125.324 113.422 99.594  1.00 25.80  ? 297  THR A O     1 
ATOM   2014  C CB    . THR A 1 297  ? 122.678 113.377 98.108  1.00 25.37  ? 297  THR A CB    1 
ATOM   2015  O OG1   . THR A 1 297  ? 122.961 114.755 98.387  1.00 25.38  ? 297  THR A OG1   1 
ATOM   2016  C CG2   . THR A 1 297  ? 121.194 113.204 97.855  1.00 25.38  ? 297  THR A CG2   1 
ATOM   2017  N N     . THR A 1 298  ? 125.179 111.247 99.013  1.00 26.14  ? 298  THR A N     1 
ATOM   2018  C CA    . THR A 1 298  ? 126.622 111.007 99.013  1.00 26.65  ? 298  THR A CA    1 
ATOM   2019  C C     . THR A 1 298  ? 127.229 110.812 97.626  1.00 26.45  ? 298  THR A C     1 
ATOM   2020  O O     . THR A 1 298  ? 126.515 110.587 96.646  1.00 26.17  ? 298  THR A O     1 
ATOM   2021  C CB    . THR A 1 298  ? 126.967 109.770 99.856  1.00 27.27  ? 298  THR A CB    1 
ATOM   2022  O OG1   . THR A 1 298  ? 128.387 109.606 99.903  1.00 27.50  ? 298  THR A OG1   1 
ATOM   2023  C CG2   . THR A 1 298  ? 126.343 108.516 99.255  1.00 27.48  ? 298  THR A CG2   1 
ATOM   2024  N N     . GLN A 1 299  ? 128.557 110.867 97.567  1.00 26.77  ? 299  GLN A N     1 
ATOM   2025  C CA    . GLN A 1 299  ? 129.285 110.720 96.315  1.00 27.26  ? 299  GLN A CA    1 
ATOM   2026  C C     . GLN A 1 299  ? 130.502 109.789 96.438  1.00 27.86  ? 299  GLN A C     1 
ATOM   2027  O O     . GLN A 1 299  ? 131.277 109.888 97.392  1.00 27.73  ? 299  GLN A O     1 
ATOM   2028  C CB    . GLN A 1 299  ? 129.729 112.107 95.840  1.00 27.30  ? 299  GLN A CB    1 
ATOM   2029  C CG    . GLN A 1 299  ? 129.928 112.245 94.344  1.00 27.38  ? 299  GLN A CG    1 
ATOM   2030  C CD    . GLN A 1 299  ? 131.294 111.790 93.879  1.00 27.41  ? 299  GLN A CD    1 
ATOM   2031  O OE1   . GLN A 1 299  ? 132.315 112.318 94.315  1.00 27.39  ? 299  GLN A OE1   1 
ATOM   2032  N NE2   . GLN A 1 299  ? 131.321 110.807 92.986  1.00 27.41  ? 299  GLN A NE2   1 
ATOM   2033  N N     . ALA A 1 300  ? 130.652 108.882 95.473  1.00 28.74  ? 300  ALA A N     1 
ATOM   2034  C CA    . ALA A 1 300  ? 131.765 107.928 95.447  1.00 29.75  ? 300  ALA A CA    1 
ATOM   2035  C C     . ALA A 1 300  ? 132.554 108.109 94.154  1.00 30.90  ? 300  ALA A C     1 
ATOM   2036  O O     . ALA A 1 300  ? 132.012 107.967 93.055  1.00 30.82  ? 300  ALA A O     1 
ATOM   2037  C CB    . ALA A 1 300  ? 131.239 106.508 95.538  1.00 29.74  ? 300  ALA A CB    1 
ATOM   2038  N N     . ARG A 1 301  ? 133.842 108.395 94.299  1.00 32.07  ? 301  ARG A N     1 
ATOM   2039  C CA    . ARG A 1 301  ? 134.701 108.656 93.153  1.00 33.32  ? 301  ARG A CA    1 
ATOM   2040  C C     . ARG A 1 301  ? 135.972 107.831 93.029  1.00 34.75  ? 301  ARG A C     1 
ATOM   2041  O O     . ARG A 1 301  ? 136.612 107.467 94.022  1.00 34.75  ? 301  ARG A O     1 
ATOM   2042  C CB    . ARG A 1 301  ? 135.070 110.131 93.166  1.00 33.21  ? 301  ARG A CB    1 
ATOM   2043  C CG    . ARG A 1 301  ? 135.344 110.650 94.568  1.00 33.28  ? 301  ARG A CG    1 
ATOM   2044  C CD    . ARG A 1 301  ? 135.500 112.156 94.569  1.00 33.43  ? 301  ARG A CD    1 
ATOM   2045  N NE    . ARG A 1 301  ? 135.857 112.667 95.889  1.00 33.72  ? 301  ARG A NE    1 
ATOM   2046  C CZ    . ARG A 1 301  ? 135.041 112.660 96.937  1.00 34.04  ? 301  ARG A CZ    1 
ATOM   2047  N NH1   . ARG A 1 301  ? 133.819 112.165 96.815  1.00 34.15  ? 301  ARG A NH1   1 
ATOM   2048  N NH2   . ARG A 1 301  ? 135.446 113.144 98.105  1.00 34.14  ? 301  ARG A NH2   1 
ATOM   2049  N N     . THR A 1 302  ? 136.335 107.564 91.780  1.00 36.19  ? 302  THR A N     1 
ATOM   2050  C CA    . THR A 1 302  ? 137.530 106.805 91.441  1.00 37.62  ? 302  THR A CA    1 
ATOM   2051  C C     . THR A 1 302  ? 138.044 107.276 90.083  1.00 38.26  ? 302  THR A C     1 
ATOM   2052  O O     . THR A 1 302  ? 137.365 108.028 89.380  1.00 38.21  ? 302  THR A O     1 
ATOM   2053  C CB    . THR A 1 302  ? 137.227 105.293 91.370  1.00 38.27  ? 302  THR A CB    1 
ATOM   2054  O OG1   . THR A 1 302  ? 136.077 105.071 90.544  1.00 38.49  ? 302  THR A OG1   1 
ATOM   2055  C CG2   . THR A 1 302  ? 136.965 104.741 92.762  1.00 38.48  ? 302  THR A CG2   1 
ATOM   2056  N N     . SER A 1 303  ? 139.245 106.840 89.720  1.00 38.96  ? 303  SER A N     1 
ATOM   2057  C CA    . SER A 1 303  ? 139.840 107.232 88.446  1.00 39.76  ? 303  SER A CA    1 
ATOM   2058  C C     . SER A 1 303  ? 140.621 106.073 87.841  1.00 40.96  ? 303  SER A C     1 
ATOM   2059  O O     . SER A 1 303  ? 141.273 105.311 88.554  1.00 40.80  ? 303  SER A O     1 
ATOM   2060  C CB    . SER A 1 303  ? 140.776 108.424 88.654  1.00 39.58  ? 303  SER A CB    1 
ATOM   2061  O OG    . SER A 1 303  ? 141.089 109.051 87.424  1.00 39.54  ? 303  SER A OG    1 
ATOM   2062  N N     . TYR A 1 304  ? 140.547 105.947 86.522  1.00 42.43  ? 304  TYR A N     1 
ATOM   2063  C CA    . TYR A 1 304  ? 141.242 104.880 85.812  1.00 44.03  ? 304  TYR A CA    1 
ATOM   2064  C C     . TYR A 1 304  ? 142.286 105.428 84.845  1.00 45.05  ? 304  TYR A C     1 
ATOM   2065  O O     . TYR A 1 304  ? 141.950 106.140 83.898  1.00 44.86  ? 304  TYR A O     1 
ATOM   2066  C CB    . TYR A 1 304  ? 140.239 104.017 85.048  1.00 44.64  ? 304  TYR A CB    1 
ATOM   2067  C CG    . TYR A 1 304  ? 139.341 103.193 85.940  1.00 45.30  ? 304  TYR A CG    1 
ATOM   2068  C CD1   . TYR A 1 304  ? 138.319 103.786 86.677  1.00 45.59  ? 304  TYR A CD1   1 
ATOM   2069  C CD2   . TYR A 1 304  ? 139.530 101.815 86.068  1.00 45.61  ? 304  TYR A CD2   1 
ATOM   2070  C CE1   . TYR A 1 304  ? 137.507 103.031 87.523  1.00 45.85  ? 304  TYR A CE1   1 
ATOM   2071  C CE2   . TYR A 1 304  ? 138.726 101.049 86.913  1.00 45.84  ? 304  TYR A CE2   1 
ATOM   2072  C CZ    . TYR A 1 304  ? 137.715 101.663 87.638  1.00 45.98  ? 304  TYR A CZ    1 
ATOM   2073  O OH    . TYR A 1 304  ? 136.913 100.919 88.478  1.00 46.08  ? 304  TYR A OH    1 
ATOM   2074  N N     . LEU A 1 305  ? 143.549 105.080 85.080  1.00 46.38  ? 305  LEU A N     1 
ATOM   2075  C CA    . LEU A 1 305  ? 144.642 105.542 84.230  1.00 47.76  ? 305  LEU A CA    1 
ATOM   2076  C C     . LEU A 1 305  ? 144.760 104.804 82.908  1.00 48.41  ? 305  LEU A C     1 
ATOM   2077  O O     . LEU A 1 305  ? 144.020 103.861 82.624  1.00 48.26  ? 305  LEU A O     1 
ATOM   2078  C CB    . LEU A 1 305  ? 145.988 105.429 84.949  1.00 48.53  ? 305  LEU A CB    1 
ATOM   2079  C CG    . LEU A 1 305  ? 146.321 106.403 86.076  1.00 49.26  ? 305  LEU A CG    1 
ATOM   2080  C CD1   . LEU A 1 305  ? 145.495 106.066 87.305  1.00 49.46  ? 305  LEU A CD1   1 
ATOM   2081  C CD2   . LEU A 1 305  ? 147.809 106.309 86.398  1.00 49.51  ? 305  LEU A CD2   1 
ATOM   2082  N N     . ALA A 1 306  ? 145.732 105.249 82.120  1.00 49.32  ? 306  ALA A N     1 
ATOM   2083  C CA    . ALA A 1 306  ? 146.023 104.691 80.808  1.00 50.33  ? 306  ALA A CA    1 
ATOM   2084  C C     . ALA A 1 306  ? 146.443 103.225 80.904  1.00 51.63  ? 306  ALA A C     1 
ATOM   2085  O O     . ALA A 1 306  ? 146.215 102.447 79.978  1.00 51.48  ? 306  ALA A O     1 
ATOM   2086  C CB    . ALA A 1 306  ? 147.123 105.509 80.139  1.00 50.19  ? 306  ALA A CB    1 
ATOM   2087  N N     . ASP A 1 307  ? 147.072 102.861 82.017  1.00 53.25  ? 307  ASP A N     1 
ATOM   2088  C CA    . ASP A 1 307  ? 147.503 101.480 82.219  1.00 54.92  ? 307  ASP A CA    1 
ATOM   2089  C C     . ASP A 1 307  ? 146.414 100.699 82.948  1.00 56.00  ? 307  ASP A C     1 
ATOM   2090  O O     . ASP A 1 307  ? 146.446 99.470  82.999  1.00 56.03  ? 307  ASP A O     1 
ATOM   2091  C CB    . ASP A 1 307  ? 148.803 101.425 83.034  1.00 55.58  ? 307  ASP A CB    1 
ATOM   2092  C CG    . ASP A 1 307  ? 148.686 102.122 84.376  1.00 56.14  ? 307  ASP A CG    1 
ATOM   2093  O OD1   . ASP A 1 307  ? 148.649 103.370 84.398  1.00 56.33  ? 307  ASP A OD1   1 
ATOM   2094  O OD2   . ASP A 1 307  ? 148.626 101.421 85.409  1.00 56.34  ? 307  ASP A OD2   1 
ATOM   2095  N N     . GLU A 1 308  ? 145.447 101.416 83.507  1.00 57.01  ? 308  GLU A N     1 
ATOM   2096  C CA    . GLU A 1 308  ? 144.366 100.765 84.229  1.00 58.02  ? 308  GLU A CA    1 
ATOM   2097  C C     . GLU A 1 308  ? 143.248 100.299 83.313  1.00 58.14  ? 308  GLU A C     1 
ATOM   2098  O O     . GLU A 1 308  ? 142.309 99.635  83.757  1.00 58.29  ? 308  GLU A O     1 
ATOM   2099  C CB    . GLU A 1 308  ? 143.788 101.702 85.287  1.00 58.76  ? 308  GLU A CB    1 
ATOM   2100  C CG    . GLU A 1 308  ? 144.030 101.212 86.696  1.00 59.32  ? 308  GLU A CG    1 
ATOM   2101  C CD    . GLU A 1 308  ? 143.131 101.876 87.711  1.00 59.65  ? 308  GLU A CD    1 
ATOM   2102  O OE1   . GLU A 1 308  ? 143.244 103.105 87.898  1.00 59.74  ? 308  GLU A OE1   1 
ATOM   2103  O OE2   . GLU A 1 308  ? 142.308 101.162 88.323  1.00 59.74  ? 308  GLU A OE2   1 
ATOM   2104  N N     . ILE A 1 309  ? 143.350 100.659 82.038  1.00 58.10  ? 309  ILE A N     1 
ATOM   2105  C CA    . ILE A 1 309  ? 142.347 100.284 81.050  1.00 58.28  ? 309  ILE A CA    1 
ATOM   2106  C C     . ILE A 1 309  ? 142.841 99.133  80.182  1.00 58.67  ? 309  ILE A C     1 
ATOM   2107  O O     . ILE A 1 309  ? 143.969 99.149  79.691  1.00 58.71  ? 309  ILE A O     1 
ATOM   2108  C CB    . ILE A 1 309  ? 141.969 101.475 80.151  1.00 58.32  ? 309  ILE A CB    1 
ATOM   2109  C CG1   . ILE A 1 309  ? 141.512 102.660 81.002  1.00 58.32  ? 309  ILE A CG1   1 
ATOM   2110  C CG2   . ILE A 1 309  ? 140.881 101.076 79.165  1.00 58.43  ? 309  ILE A CG2   1 
ATOM   2111  C CD1   . ILE A 1 309  ? 141.160 103.890 80.196  1.00 58.36  ? 309  ILE A CD1   1 
ATOM   2112  N N     . LEU A 1 310  ? 141.984 98.136  79.999  1.00 59.16  ? 310  LEU A N     1 
ATOM   2113  C CA    . LEU A 1 310  ? 142.312 96.962  79.197  1.00 59.75  ? 310  LEU A CA    1 
ATOM   2114  C C     . LEU A 1 310  ? 141.546 96.918  77.879  1.00 60.68  ? 310  LEU A C     1 
ATOM   2115  O O     . LEU A 1 310  ? 140.353 97.219  77.826  1.00 60.69  ? 310  LEU A O     1 
ATOM   2116  C CB    . LEU A 1 310  ? 142.017 95.691  79.989  1.00 59.45  ? 310  LEU A CB    1 
ATOM   2117  C CG    . LEU A 1 310  ? 142.778 95.485  81.300  1.00 59.19  ? 310  LEU A CG    1 
ATOM   2118  C CD1   . LEU A 1 310  ? 142.065 94.429  82.123  1.00 59.09  ? 310  LEU A CD1   1 
ATOM   2119  C CD2   . LEU A 1 310  ? 144.219 95.080  81.020  1.00 59.04  ? 310  LEU A CD2   1 
ATOM   2120  N N     . TRP A 1 311  ? 142.242 96.518  76.824  1.00 61.59  ? 311  TRP A N     1 
ATOM   2121  C CA    . TRP A 1 311  ? 141.644 96.427  75.501  1.00 62.39  ? 311  TRP A CA    1 
ATOM   2122  C C     . TRP A 1 311  ? 141.634 94.975  75.039  1.00 62.77  ? 311  TRP A C     1 
ATOM   2123  O O     . TRP A 1 311  ? 142.650 94.284  75.120  1.00 62.95  ? 311  TRP A O     1 
ATOM   2124  C CB    . TRP A 1 311  ? 142.451 97.279  74.520  1.00 62.74  ? 311  TRP A CB    1 
ATOM   2125  C CG    . TRP A 1 311  ? 141.854 97.398  73.152  1.00 63.11  ? 311  TRP A CG    1 
ATOM   2126  C CD1   . TRP A 1 311  ? 141.706 96.405  72.227  1.00 63.07  ? 311  TRP A CD1   1 
ATOM   2127  C CD2   . TRP A 1 311  ? 141.355 98.593  72.542  1.00 63.63  ? 311  TRP A CD2   1 
ATOM   2128  N NE1   . TRP A 1 311  ? 141.150 96.909  71.075  1.00 63.27  ? 311  TRP A NE1   1 
ATOM   2129  C CE2   . TRP A 1 311  ? 140.926 98.251  71.242  1.00 63.65  ? 311  TRP A CE2   1 
ATOM   2130  C CE3   . TRP A 1 311  ? 141.232 99.922  72.970  1.00 64.08  ? 311  TRP A CE3   1 
ATOM   2131  C CZ2   . TRP A 1 311  ? 140.381 99.190  70.361  1.00 64.05  ? 311  TRP A CZ2   1 
ATOM   2132  C CZ3   . TRP A 1 311  ? 140.690 100.859 72.094  1.00 64.36  ? 311  TRP A CZ3   1 
ATOM   2133  C CH2   . TRP A 1 311  ? 140.272 100.485 70.804  1.00 64.32  ? 311  TRP A CH2   1 
ATOM   2134  N N     . GLY A 1 312  ? 140.480 94.515  74.568  1.00 62.84  ? 312  GLY A N     1 
ATOM   2135  C CA    . GLY A 1 312  ? 140.379 93.149  74.083  1.00 62.89  ? 312  GLY A CA    1 
ATOM   2136  C C     . GLY A 1 312  ? 139.571 92.184  74.932  1.00 62.93  ? 312  GLY A C     1 
ATOM   2137  O O     . GLY A 1 312  ? 138.995 91.234  74.402  1.00 62.85  ? 312  GLY A O     1 
ATOM   2138  N N     . GLN A 1 313  ? 139.523 92.414  76.241  1.00 63.14  ? 313  GLN A N     1 
ATOM   2139  C CA    . GLN A 1 313  ? 138.770 91.546  77.142  1.00 63.45  ? 313  GLN A CA    1 
ATOM   2140  C C     . GLN A 1 313  ? 137.452 92.165  77.571  1.00 63.67  ? 313  GLN A C     1 
ATOM   2141  O O     . GLN A 1 313  ? 137.181 93.331  77.286  1.00 63.55  ? 313  GLN A O     1 
ATOM   2142  C CB    . GLN A 1 313  ? 139.590 91.202  78.383  1.00 63.64  ? 313  GLN A CB    1 
ATOM   2143  N N     . ARG A 1 314  ? 136.658 91.381  78.290  1.00 64.16  ? 314  ARG A N     1 
ATOM   2144  C CA    . ARG A 1 314  ? 135.348 91.819  78.759  1.00 64.72  ? 314  ARG A CA    1 
ATOM   2145  C C     . ARG A 1 314  ? 135.062 91.393  80.203  1.00 64.75  ? 314  ARG A C     1 
ATOM   2146  O O     . ARG A 1 314  ? 135.804 90.606  80.788  1.00 64.59  ? 314  ARG A O     1 
ATOM   2147  C CB    . ARG A 1 314  ? 134.279 91.246  77.829  1.00 65.34  ? 314  ARG A CB    1 
ATOM   2148  C CG    . ARG A 1 314  ? 134.358 89.734  77.687  1.00 66.03  ? 314  ARG A CG    1 
ATOM   2149  C CD    . ARG A 1 314  ? 133.565 89.220  76.496  1.00 66.75  ? 314  ARG A CD    1 
ATOM   2150  N NE    . ARG A 1 314  ? 134.134 89.621  75.211  1.00 67.42  ? 314  ARG A NE    1 
ATOM   2151  C CZ    . ARG A 1 314  ? 133.671 90.618  74.466  1.00 67.95  ? 314  ARG A CZ    1 
ATOM   2152  N NH1   . ARG A 1 314  ? 132.625 91.321  74.881  1.00 68.10  ? 314  ARG A NH1   1 
ATOM   2153  N NH2   . ARG A 1 314  ? 134.245 90.907  73.303  1.00 68.15  ? 314  ARG A NH2   1 
ATOM   2154  N N     . PHE A 1 315  ? 133.980 91.923  80.769  1.00 65.07  ? 315  PHE A N     1 
ATOM   2155  C CA    . PHE A 1 315  ? 133.587 91.596  82.135  1.00 65.56  ? 315  PHE A CA    1 
ATOM   2156  C C     . PHE A 1 315  ? 132.858 90.261  82.209  1.00 65.70  ? 315  PHE A C     1 
ATOM   2157  O O     . PHE A 1 315  ? 131.857 90.061  81.525  1.00 65.59  ? 315  PHE A O     1 
ATOM   2158  C CB    . PHE A 1 315  ? 132.664 92.671  82.709  1.00 66.04  ? 315  PHE A CB    1 
ATOM   2159  C CG    . PHE A 1 315  ? 133.332 93.982  82.962  1.00 66.58  ? 315  PHE A CG    1 
ATOM   2160  C CD1   . PHE A 1 315  ? 134.403 94.065  83.843  1.00 66.80  ? 315  PHE A CD1   1 
ATOM   2161  C CD2   . PHE A 1 315  ? 132.871 95.144  82.350  1.00 66.86  ? 315  PHE A CD2   1 
ATOM   2162  C CE1   . PHE A 1 315  ? 135.009 95.283  84.114  1.00 66.98  ? 315  PHE A CE1   1 
ATOM   2163  C CE2   . PHE A 1 315  ? 133.474 96.376  82.617  1.00 66.99  ? 315  PHE A CE2   1 
ATOM   2164  C CZ    . PHE A 1 315  ? 134.544 96.441  83.501  1.00 67.03  ? 315  PHE A CZ    1 
ATOM   2165  N N     . VAL A 1 316  ? 133.349 89.361  83.055  1.00 66.17  ? 316  VAL A N     1 
ATOM   2166  C CA    . VAL A 1 316  ? 132.739 88.048  83.234  1.00 66.75  ? 316  VAL A CA    1 
ATOM   2167  C C     . VAL A 1 316  ? 131.368 88.137  83.924  1.00 67.28  ? 316  VAL A C     1 
ATOM   2168  O O     . VAL A 1 316  ? 131.210 88.835  84.925  1.00 67.44  ? 316  VAL A O     1 
ATOM   2169  C CB    . VAL A 1 316  ? 133.662 87.134  84.068  1.00 66.84  ? 316  VAL A CB    1 
ATOM   2170  C CG1   . VAL A 1 316  ? 133.060 85.748  84.169  1.00 66.85  ? 316  VAL A CG1   1 
ATOM   2171  C CG2   . VAL A 1 316  ? 135.057 87.074  83.442  1.00 66.89  ? 316  VAL A CG2   1 
ATOM   2172  N N     . PRO A 1 317  ? 130.370 87.410  83.402  1.00 67.56  ? 317  PRO A N     1 
ATOM   2173  C CA    . PRO A 1 317  ? 129.002 87.379  83.933  1.00 67.90  ? 317  PRO A CA    1 
ATOM   2174  C C     . PRO A 1 317  ? 128.911 86.943  85.395  1.00 68.59  ? 317  PRO A C     1 
ATOM   2175  O O     . PRO A 1 317  ? 129.186 85.796  85.738  1.00 68.49  ? 317  PRO A O     1 
ATOM   2176  C CB    . PRO A 1 317  ? 128.273 86.419  82.981  1.00 67.60  ? 317  PRO A CB    1 
ATOM   2177  C CG    . PRO A 1 317  ? 129.384 85.599  82.365  1.00 67.45  ? 317  PRO A CG    1 
ATOM   2178  C CD    . PRO A 1 317  ? 130.471 86.610  82.173  1.00 67.47  ? 317  PRO A CD    1 
ATOM   2179  N N     . ILE A 1 318  ? 128.512 87.894  86.236  1.00 69.47  ? 318  ILE A N     1 
ATOM   2180  C CA    . ILE A 1 318  ? 128.375 87.718  87.684  1.00 70.34  ? 318  ILE A CA    1 
ATOM   2181  C C     . ILE A 1 318  ? 127.062 87.058  88.105  1.00 71.15  ? 318  ILE A C     1 
ATOM   2182  O O     . ILE A 1 318  ? 127.033 86.257  89.040  1.00 70.98  ? 318  ILE A O     1 
ATOM   2183  C CB    . ILE A 1 318  ? 128.455 89.086  88.393  1.00 70.39  ? 318  ILE A CB    1 
ATOM   2184  C CG1   . ILE A 1 318  ? 129.682 89.864  87.907  1.00 70.41  ? 318  ILE A CG1   1 
ATOM   2185  C CG2   . ILE A 1 318  ? 128.502 88.905  89.891  1.00 70.35  ? 318  ILE A CG2   1 
ATOM   2186  C CD1   . ILE A 1 318  ? 131.000 89.199  88.215  1.00 70.39  ? 318  ILE A CD1   1 
ATOM   2187  N N     . VAL A 1 319  ? 125.980 87.416  87.426  1.00 72.19  ? 319  VAL A N     1 
ATOM   2188  C CA    . VAL A 1 319  ? 124.652 86.893  87.744  1.00 73.27  ? 319  VAL A CA    1 
ATOM   2189  C C     . VAL A 1 319  ? 124.429 85.439  87.335  1.00 73.59  ? 319  VAL A C     1 
ATOM   2190  O O     . VAL A 1 319  ? 124.620 85.070  86.175  1.00 73.57  ? 319  VAL A O     1 
ATOM   2191  C CB    . VAL A 1 319  ? 123.550 87.756  87.077  1.00 74.06  ? 319  VAL A CB    1 
ATOM   2192  C CG1   . VAL A 1 319  ? 122.241 87.603  87.833  1.00 74.35  ? 319  VAL A CG1   1 
ATOM   2193  C CG2   . VAL A 1 319  ? 123.977 89.216  87.035  1.00 74.33  ? 319  VAL A CG2   1 
ATOM   2194  N N     . ALA A 1 320  ? 124.023 84.616  88.299  1.00 73.98  ? 320  ALA A N     1 
ATOM   2195  C CA    . ALA A 1 320  ? 123.755 83.199  88.051  1.00 74.47  ? 320  ALA A CA    1 
ATOM   2196  C C     . ALA A 1 320  ? 122.383 82.881  88.628  1.00 75.12  ? 320  ALA A C     1 
ATOM   2197  O O     . ALA A 1 320  ? 122.098 83.207  89.783  1.00 74.98  ? 320  ALA A O     1 
ATOM   2198  C CB    . ALA A 1 320  ? 124.812 82.340  88.718  1.00 74.40  ? 320  ALA A CB    1 
ATOM   2199  N N     . GLU A 1 321  ? 121.533 82.239  87.835  1.00 76.08  ? 321  GLU A N     1 
ATOM   2200  C CA    . GLU A 1 321  ? 120.185 81.931  88.294  1.00 77.03  ? 321  GLU A CA    1 
ATOM   2201  C C     . GLU A 1 321  ? 120.026 80.625  89.041  1.00 77.39  ? 321  GLU A C     1 
ATOM   2202  O O     . GLU A 1 321  ? 120.372 79.552  88.546  1.00 77.33  ? 321  GLU A O     1 
ATOM   2203  C CB    . GLU A 1 321  ? 119.200 81.959  87.125  1.00 77.59  ? 321  GLU A CB    1 
ATOM   2204  C CG    . GLU A 1 321  ? 119.446 80.936  86.032  1.00 78.04  ? 321  GLU A CG    1 
ATOM   2205  C CD    . GLU A 1 321  ? 118.229 80.764  85.145  1.00 78.35  ? 321  GLU A CD    1 
ATOM   2206  O OE1   . GLU A 1 321  ? 117.214 80.236  85.644  1.00 78.45  ? 321  GLU A OE1   1 
ATOM   2207  O OE2   . GLU A 1 321  ? 118.282 81.164  83.962  1.00 78.41  ? 321  GLU A OE2   1 
ATOM   2208  N N     . GLU A 1 322  ? 119.475 80.739  90.241  1.00 77.74  ? 322  GLU A N     1 
ATOM   2209  C CA    . GLU A 1 322  ? 119.238 79.591  91.097  1.00 78.10  ? 322  GLU A CA    1 
ATOM   2210  C C     . GLU A 1 322  ? 117.753 79.358  91.274  1.00 77.94  ? 322  GLU A C     1 
ATOM   2211  O O     . GLU A 1 322  ? 116.924 80.059  90.690  1.00 77.94  ? 322  GLU A O     1 
ATOM   2212  C CB    . GLU A 1 322  ? 119.869 79.812  92.463  1.00 78.66  ? 322  GLU A CB    1 
ATOM   2213  C CG    . GLU A 1 322  ? 121.372 79.877  92.427  1.00 79.22  ? 322  GLU A CG    1 
ATOM   2214  C CD    . GLU A 1 322  ? 121.955 79.997  93.810  1.00 79.71  ? 322  GLU A CD    1 
ATOM   2215  O OE1   . GLU A 1 322  ? 121.652 81.002  94.489  1.00 79.89  ? 322  GLU A OE1   1 
ATOM   2216  O OE2   . GLU A 1 322  ? 122.706 79.087  94.220  1.00 79.86  ? 322  GLU A OE2   1 
ATOM   2217  N N     . ASP A 1 323  ? 117.423 78.378  92.104  1.00 77.82  ? 323  ASP A N     1 
ATOM   2218  C CA    . ASP A 1 323  ? 116.036 78.036  92.355  1.00 77.79  ? 323  ASP A CA    1 
ATOM   2219  C C     . ASP A 1 323  ? 115.268 79.131  93.093  1.00 77.70  ? 323  ASP A C     1 
ATOM   2220  O O     . ASP A 1 323  ? 114.123 79.418  92.757  1.00 77.60  ? 323  ASP A O     1 
ATOM   2221  C CB    . ASP A 1 323  ? 115.959 76.731  93.144  1.00 77.95  ? 323  ASP A CB    1 
ATOM   2222  C CG    . ASP A 1 323  ? 114.575 76.136  93.137  1.00 78.14  ? 323  ASP A CG    1 
ATOM   2223  O OD1   . ASP A 1 323  ? 113.644 76.790  93.648  1.00 78.20  ? 323  ASP A OD1   1 
ATOM   2224  O OD2   . ASP A 1 323  ? 114.422 75.016  92.613  1.00 78.19  ? 323  ASP A OD2   1 
ATOM   2225  N N     . GLY A 1 324  ? 115.896 79.744  94.091  1.00 77.77  ? 324  GLY A N     1 
ATOM   2226  C CA    . GLY A 1 324  ? 115.208 80.778  94.845  1.00 77.93  ? 324  GLY A CA    1 
ATOM   2227  C C     . GLY A 1 324  ? 115.323 82.180  94.276  1.00 78.16  ? 324  GLY A C     1 
ATOM   2228  O O     . GLY A 1 324  ? 114.318 82.867  94.093  1.00 78.13  ? 324  GLY A O     1 
ATOM   2229  N N     . ARG A 1 325  ? 116.551 82.606  94.002  1.00 78.45  ? 325  ARG A N     1 
ATOM   2230  C CA    . ARG A 1 325  ? 116.804 83.934  93.455  1.00 78.63  ? 325  ARG A CA    1 
ATOM   2231  C C     . ARG A 1 325  ? 118.058 83.948  92.590  1.00 78.37  ? 325  ARG A C     1 
ATOM   2232  O O     . ARG A 1 325  ? 118.675 82.910  92.355  1.00 78.20  ? 325  ARG A O     1 
ATOM   2233  C CB    . ARG A 1 325  ? 116.954 84.943  94.595  1.00 79.09  ? 325  ARG A CB    1 
ATOM   2234  C CG    . ARG A 1 325  ? 115.669 85.185  95.353  1.00 79.46  ? 325  ARG A CG    1 
ATOM   2235  C CD    . ARG A 1 325  ? 114.691 86.004  94.534  1.00 79.62  ? 325  ARG A CD    1 
ATOM   2236  N NE    . ARG A 1 325  ? 113.304 85.611  94.765  1.00 79.69  ? 325  ARG A NE    1 
ATOM   2237  C CZ    . ARG A 1 325  ? 112.254 86.359  94.443  1.00 79.69  ? 325  ARG A CZ    1 
ATOM   2238  N NH1   . ARG A 1 325  ? 112.433 87.549  93.880  1.00 79.67  ? 325  ARG A NH1   1 
ATOM   2239  N NH2   . ARG A 1 325  ? 111.025 85.912  94.668  1.00 79.67  ? 325  ARG A NH2   1 
ATOM   2240  N N     . TYR A 1 326  ? 118.435 85.134  92.131  1.00 78.36  ? 326  TYR A N     1 
ATOM   2241  C CA    . TYR A 1 326  ? 119.611 85.303  91.288  1.00 78.49  ? 326  TYR A CA    1 
ATOM   2242  C C     . TYR A 1 326  ? 120.813 85.686  92.140  1.00 78.20  ? 326  TYR A C     1 
ATOM   2243  O O     . TYR A 1 326  ? 120.798 86.714  92.817  1.00 78.29  ? 326  TYR A O     1 
ATOM   2244  C CB    . TYR A 1 326  ? 119.343 86.389  90.250  1.00 78.98  ? 326  TYR A CB    1 
ATOM   2245  C CG    . TYR A 1 326  ? 118.304 86.013  89.216  1.00 79.40  ? 326  TYR A CG    1 
ATOM   2246  C CD1   . TYR A 1 326  ? 118.683 85.611  87.936  1.00 79.59  ? 326  TYR A CD1   1 
ATOM   2247  C CD2   . TYR A 1 326  ? 116.939 86.080  89.507  1.00 79.58  ? 326  TYR A CD2   1 
ATOM   2248  C CE1   . TYR A 1 326  ? 117.732 85.291  86.966  1.00 79.73  ? 326  TYR A CE1   1 
ATOM   2249  C CE2   . TYR A 1 326  ? 115.978 85.759  88.543  1.00 79.73  ? 326  TYR A CE2   1 
ATOM   2250  C CZ    . TYR A 1 326  ? 116.384 85.370  87.274  1.00 79.83  ? 326  TYR A CZ    1 
ATOM   2251  O OH    . TYR A 1 326  ? 115.446 85.090  86.305  1.00 79.91  ? 326  TYR A OH    1 
ATOM   2252  N N     . SER A 1 327  ? 121.856 84.867  92.094  1.00 77.80  ? 327  SER A N     1 
ATOM   2253  C CA    . SER A 1 327  ? 123.050 85.113  92.892  1.00 77.42  ? 327  SER A CA    1 
ATOM   2254  C C     . SER A 1 327  ? 124.176 85.790  92.122  1.00 76.80  ? 327  SER A C     1 
ATOM   2255  O O     . SER A 1 327  ? 124.380 85.532  90.935  1.00 76.66  ? 327  SER A O     1 
ATOM   2256  C CB    . SER A 1 327  ? 123.553 83.794  93.479  1.00 77.61  ? 327  SER A CB    1 
ATOM   2257  O OG    . SER A 1 327  ? 124.591 84.013  94.417  1.00 77.65  ? 327  SER A OG    1 
ATOM   2258  N N     . VAL A 1 328  ? 124.909 86.656  92.822  1.00 76.32  ? 328  VAL A N     1 
ATOM   2259  C CA    . VAL A 1 328  ? 126.036 87.398  92.248  1.00 75.90  ? 328  VAL A CA    1 
ATOM   2260  C C     . VAL A 1 328  ? 127.349 87.193  93.000  1.00 75.34  ? 328  VAL A C     1 
ATOM   2261  O O     . VAL A 1 328  ? 127.494 87.596  94.155  1.00 75.20  ? 328  VAL A O     1 
ATOM   2262  C CB    . VAL A 1 328  ? 125.740 88.907  92.207  1.00 76.03  ? 328  VAL A CB    1 
ATOM   2263  C CG1   . VAL A 1 328  ? 124.777 89.203  91.080  1.00 76.09  ? 328  VAL A CG1   1 
ATOM   2264  C CG2   . VAL A 1 328  ? 125.147 89.366  93.542  1.00 76.12  ? 328  VAL A CG2   1 
ATOM   2265  N N     . ASP A 1 329  ? 128.310 86.586  92.315  1.00 75.04  ? 329  ASP A N     1 
ATOM   2266  C CA    . ASP A 1 329  ? 129.618 86.305  92.892  1.00 74.89  ? 329  ASP A CA    1 
ATOM   2267  C C     . ASP A 1 329  ? 130.593 87.457  92.646  1.00 75.18  ? 329  ASP A C     1 
ATOM   2268  O O     . ASP A 1 329  ? 130.843 87.832  91.503  1.00 75.11  ? 329  ASP A O     1 
ATOM   2269  C CB    . ASP A 1 329  ? 130.156 85.014  92.282  1.00 74.53  ? 329  ASP A CB    1 
ATOM   2270  C CG    . ASP A 1 329  ? 131.408 84.532  92.956  1.00 74.29  ? 329  ASP A CG    1 
ATOM   2271  O OD1   . ASP A 1 329  ? 131.426 84.472  94.202  1.00 74.22  ? 329  ASP A OD1   1 
ATOM   2272  O OD2   . ASP A 1 329  ? 132.369 84.200  92.236  1.00 74.21  ? 329  ASP A OD2   1 
ATOM   2273  N N     . TYR A 1 330  ? 131.157 87.998  93.724  1.00 75.81  ? 330  TYR A N     1 
ATOM   2274  C CA    . TYR A 1 330  ? 132.086 89.125  93.641  1.00 76.52  ? 330  TYR A CA    1 
ATOM   2275  C C     . TYR A 1 330  ? 133.563 88.827  93.452  1.00 76.08  ? 330  TYR A C     1 
ATOM   2276  O O     . TYR A 1 330  ? 134.386 89.739  93.522  1.00 76.20  ? 330  TYR A O     1 
ATOM   2277  C CB    . TYR A 1 330  ? 131.932 90.001  94.872  1.00 77.67  ? 330  TYR A CB    1 
ATOM   2278  C CG    . TYR A 1 330  ? 130.674 90.809  94.830  1.00 78.59  ? 330  TYR A CG    1 
ATOM   2279  C CD1   . TYR A 1 330  ? 130.614 92.003  94.111  1.00 79.04  ? 330  TYR A CD1   1 
ATOM   2280  C CD2   . TYR A 1 330  ? 129.523 90.363  95.471  1.00 78.92  ? 330  TYR A CD2   1 
ATOM   2281  C CE1   . TYR A 1 330  ? 129.432 92.732  94.034  1.00 79.33  ? 330  TYR A CE1   1 
ATOM   2282  C CE2   . TYR A 1 330  ? 128.342 91.077  95.400  1.00 79.21  ? 330  TYR A CE2   1 
ATOM   2283  C CZ    . TYR A 1 330  ? 128.299 92.259  94.684  1.00 79.42  ? 330  TYR A CZ    1 
ATOM   2284  O OH    . TYR A 1 330  ? 127.117 92.957  94.632  1.00 79.56  ? 330  TYR A OH    1 
ATOM   2285  N N     . SER A 1 331  ? 133.904 87.568  93.230  1.00 75.38  ? 331  SER A N     1 
ATOM   2286  C CA    . SER A 1 331  ? 135.299 87.213  93.021  1.00 74.79  ? 331  SER A CA    1 
ATOM   2287  C C     . SER A 1 331  ? 135.543 87.293  91.522  1.00 74.15  ? 331  SER A C     1 
ATOM   2288  O O     . SER A 1 331  ? 136.683 87.383  91.066  1.00 74.14  ? 331  SER A O     1 
ATOM   2289  C CB    . SER A 1 331  ? 135.568 85.795  93.524  1.00 74.79  ? 331  SER A CB    1 
ATOM   2290  O OG    . SER A 1 331  ? 134.850 84.836  92.766  1.00 74.76  ? 331  SER A OG    1 
ATOM   2291  N N     . LYS A 1 332  ? 134.452 87.260  90.766  1.00 73.69  ? 332  LYS A N     1 
ATOM   2292  C CA    . LYS A 1 332  ? 134.507 87.332  89.311  1.00 73.46  ? 332  LYS A CA    1 
ATOM   2293  C C     . LYS A 1 332  ? 134.417 88.786  88.881  1.00 74.02  ? 332  LYS A C     1 
ATOM   2294  O O     . LYS A 1 332  ? 134.587 89.115  87.708  1.00 74.03  ? 332  LYS A O     1 
ATOM   2295  C CB    . LYS A 1 332  ? 133.340 86.553  88.705  1.00 72.91  ? 332  LYS A CB    1 
ATOM   2296  C CG    . LYS A 1 332  ? 133.302 85.091  89.099  1.00 72.55  ? 332  LYS A CG    1 
ATOM   2297  C CD    . LYS A 1 332  ? 132.023 84.437  88.622  1.00 72.31  ? 332  LYS A CD    1 
ATOM   2298  C CE    . LYS A 1 332  ? 131.988 82.965  88.974  1.00 72.08  ? 332  LYS A CE    1 
ATOM   2299  N NZ    . LYS A 1 332  ? 130.628 82.416  88.735  1.00 71.91  ? 332  LYS A NZ    1 
ATOM   2300  N N     . PHE A 1 333  ? 134.141 89.650  89.849  1.00 74.68  ? 333  PHE A N     1 
ATOM   2301  C CA    . PHE A 1 333  ? 134.002 91.080  89.617  1.00 75.47  ? 333  PHE A CA    1 
ATOM   2302  C C     . PHE A 1 333  ? 135.307 91.688  89.110  1.00 75.82  ? 333  PHE A C     1 
ATOM   2303  O O     . PHE A 1 333  ? 135.299 92.630  88.314  1.00 76.02  ? 333  PHE A O     1 
ATOM   2304  C CB    . PHE A 1 333  ? 133.573 91.764  90.917  1.00 76.01  ? 333  PHE A CB    1 
ATOM   2305  C CG    . PHE A 1 333  ? 132.993 93.134  90.719  1.00 76.43  ? 333  PHE A CG    1 
ATOM   2306  C CD1   . PHE A 1 333  ? 131.823 93.307  89.988  1.00 76.60  ? 333  PHE A CD1   1 
ATOM   2307  C CD2   . PHE A 1 333  ? 133.616 94.251  91.261  1.00 76.59  ? 333  PHE A CD2   1 
ATOM   2308  C CE1   . PHE A 1 333  ? 131.282 94.574  89.795  1.00 76.67  ? 333  PHE A CE1   1 
ATOM   2309  C CE2   . PHE A 1 333  ? 133.081 95.527  91.076  1.00 76.63  ? 333  PHE A CE2   1 
ATOM   2310  C CZ    . PHE A 1 333  ? 131.911 95.688  90.341  1.00 76.66  ? 333  PHE A CZ    1 
ATOM   2311  N N     . GLY A 1 334  ? 136.426 91.143  89.579  1.00 75.78  ? 334  GLY A N     1 
ATOM   2312  C CA    . GLY A 1 334  ? 137.724 91.641  89.165  1.00 75.69  ? 334  GLY A CA    1 
ATOM   2313  C C     . GLY A 1 334  ? 138.376 90.716  88.164  1.00 75.55  ? 334  GLY A C     1 
ATOM   2314  O O     . GLY A 1 334  ? 139.601 90.695  88.029  1.00 75.55  ? 334  GLY A O     1 
ATOM   2315  N N     . ASN A 1 335  ? 137.549 89.943  87.467  1.00 75.39  ? 335  ASN A N     1 
ATOM   2316  C CA    . ASN A 1 335  ? 138.021 89.002  86.458  1.00 75.25  ? 335  ASN A CA    1 
ATOM   2317  C C     . ASN A 1 335  ? 137.514 89.380  85.067  1.00 74.94  ? 335  ASN A C     1 
ATOM   2318  O O     . ASN A 1 335  ? 136.349 89.749  84.890  1.00 74.84  ? 335  ASN A O     1 
ATOM   2319  C CB    . ASN A 1 335  ? 137.570 87.582  86.813  1.00 75.47  ? 335  ASN A CB    1 
ATOM   2320  C CG    . ASN A 1 335  ? 138.320 87.008  88.003  1.00 75.75  ? 335  ASN A CG    1 
ATOM   2321  O OD1   . ASN A 1 335  ? 138.570 87.711  88.982  1.00 75.82  ? 335  ASN A OD1   1 
ATOM   2322  N ND2   . ASN A 1 335  ? 138.672 85.730  87.928  1.00 75.88  ? 335  ASN A ND2   1 
ATOM   2323  N N     . THR A 1 336  ? 138.398 89.282  84.080  1.00 74.88  ? 336  THR A N     1 
ATOM   2324  C CA    . THR A 1 336  ? 138.058 89.610  82.700  1.00 74.86  ? 336  THR A CA    1 
ATOM   2325  C C     . THR A 1 336  ? 138.647 88.628  81.696  1.00 74.58  ? 336  THR A C     1 
ATOM   2326  O O     . THR A 1 336  ? 139.782 88.169  81.841  1.00 74.59  ? 336  THR A O     1 
ATOM   2327  C CB    . THR A 1 336  ? 138.539 91.023  82.339  1.00 75.16  ? 336  THR A CB    1 
ATOM   2328  O OG1   . THR A 1 336  ? 139.921 91.161  82.691  1.00 75.26  ? 336  THR A OG1   1 
ATOM   2329  C CG2   . THR A 1 336  ? 137.721 92.060  83.080  1.00 75.27  ? 336  THR A CG2   1 
ATOM   2330  N N     . VAL A 1 337  ? 137.861 88.321  80.670  1.00 74.27  ? 337  VAL A N     1 
ATOM   2331  C CA    . VAL A 1 337  ? 138.272 87.377  79.635  1.00 74.02  ? 337  VAL A CA    1 
ATOM   2332  C C     . VAL A 1 337  ? 138.437 87.989  78.248  1.00 73.68  ? 337  VAL A C     1 
ATOM   2333  O O     . VAL A 1 337  ? 137.591 88.748  77.768  1.00 73.66  ? 337  VAL A O     1 
ATOM   2334  C CB    . VAL A 1 337  ? 137.290 86.199  79.565  1.00 74.20  ? 337  VAL A CB    1 
ATOM   2335  C CG1   . VAL A 1 337  ? 137.572 85.243  80.709  1.00 74.29  ? 337  VAL A CG1   1 
ATOM   2336  C CG2   . VAL A 1 337  ? 135.854 86.706  79.668  1.00 74.29  ? 337  VAL A CG2   1 
ATOM   2337  N N     . LYS A 1 338  ? 139.532 87.606  77.607  1.00 73.49  ? 338  LYS A N     1 
ATOM   2338  C CA    . LYS A 1 338  ? 139.904 88.104  76.291  1.00 73.38  ? 338  LYS A CA    1 
ATOM   2339  C C     . LYS A 1 338  ? 139.187 87.447  75.110  1.00 72.69  ? 338  LYS A C     1 
ATOM   2340  O O     . LYS A 1 338  ? 139.098 86.223  75.031  1.00 72.57  ? 338  LYS A O     1 
ATOM   2341  C CB    . LYS A 1 338  ? 141.411 87.942  76.101  1.00 73.92  ? 338  LYS A CB    1 
ATOM   2342  C CG    . LYS A 1 338  ? 141.998 88.859  75.053  1.00 74.43  ? 338  LYS A CG    1 
ATOM   2343  C CD    . LYS A 1 338  ? 143.386 88.416  74.647  1.00 74.90  ? 338  LYS A CD    1 
ATOM   2344  C CE    . LYS A 1 338  ? 143.343 87.455  73.468  1.00 75.24  ? 338  LYS A CE    1 
ATOM   2345  N NZ    . LYS A 1 338  ? 144.686 86.869  73.198  1.00 75.43  ? 338  LYS A NZ    1 
ATOM   2346  N N     . VAL A 1 339  ? 138.690 88.280  74.196  1.00 72.11  ? 339  VAL A N     1 
ATOM   2347  C CA    . VAL A 1 339  ? 138.002 87.827  72.988  1.00 71.51  ? 339  VAL A CA    1 
ATOM   2348  C C     . VAL A 1 339  ? 138.556 88.602  71.786  1.00 70.97  ? 339  VAL A C     1 
ATOM   2349  O O     . VAL A 1 339  ? 139.023 89.732  71.925  1.00 70.90  ? 339  VAL A O     1 
ATOM   2350  C CB    . VAL A 1 339  ? 136.454 88.030  73.098  1.00 71.42  ? 339  VAL A CB    1 
ATOM   2351  C CG1   . VAL A 1 339  ? 135.799 87.936  71.727  1.00 71.39  ? 339  VAL A CG1   1 
ATOM   2352  C CG2   . VAL A 1 339  ? 135.863 86.958  74.010  1.00 71.39  ? 339  VAL A CG2   1 
ATOM   2353  N N     . PRO A 1 340  ? 138.514 88.000  70.591  1.00 70.58  ? 340  PRO A N     1 
ATOM   2354  C CA    . PRO A 1 340  ? 139.008 88.601  69.348  1.00 70.18  ? 340  PRO A CA    1 
ATOM   2355  C C     . PRO A 1 340  ? 138.392 89.942  68.959  1.00 69.55  ? 340  PRO A C     1 
ATOM   2356  O O     . PRO A 1 340  ? 137.218 90.015  68.586  1.00 69.46  ? 340  PRO A O     1 
ATOM   2357  C CB    . PRO A 1 340  ? 138.719 87.520  68.316  1.00 70.34  ? 340  PRO A CB    1 
ATOM   2358  C CG    . PRO A 1 340  ? 138.949 86.273  69.098  1.00 70.42  ? 340  PRO A CG    1 
ATOM   2359  C CD    . PRO A 1 340  ? 138.218 86.572  70.388  1.00 70.50  ? 340  PRO A CD    1 
ATOM   2360  N N     . THR A 1 341  ? 139.204 90.993  69.043  1.00 68.83  ? 341  THR A N     1 
ATOM   2361  C CA    . THR A 1 341  ? 138.777 92.344  68.698  1.00 67.94  ? 341  THR A CA    1 
ATOM   2362  C C     . THR A 1 341  ? 139.782 93.002  67.746  1.00 66.59  ? 341  THR A C     1 
ATOM   2363  O O     . THR A 1 341  ? 140.960 92.644  67.711  1.00 66.48  ? 341  THR A O     1 
ATOM   2364  C CB    . THR A 1 341  ? 138.627 93.230  69.952  1.00 68.21  ? 341  THR A CB    1 
ATOM   2365  O OG1   . THR A 1 341  ? 139.865 93.268  70.670  1.00 68.28  ? 341  THR A OG1   1 
ATOM   2366  C CG2   . THR A 1 341  ? 137.536 92.683  70.864  1.00 68.28  ? 341  THR A CG2   1 
ATOM   2367  N N     . PRO A 1 342  ? 139.315 93.967  66.949  1.00 65.39  ? 342  PRO A N     1 
ATOM   2368  C CA    . PRO A 1 342  ? 140.119 94.708  65.973  1.00 64.55  ? 342  PRO A CA    1 
ATOM   2369  C C     . PRO A 1 342  ? 141.185 95.594  66.607  1.00 63.85  ? 342  PRO A C     1 
ATOM   2370  O O     . PRO A 1 342  ? 140.959 96.216  67.644  1.00 63.71  ? 342  PRO A O     1 
ATOM   2371  C CB    . PRO A 1 342  ? 139.074 95.513  65.210  1.00 64.60  ? 342  PRO A CB    1 
ATOM   2372  C CG    . PRO A 1 342  ? 137.860 94.640  65.297  1.00 64.81  ? 342  PRO A CG    1 
ATOM   2373  C CD    . PRO A 1 342  ? 137.884 94.227  66.741  1.00 65.06  ? 342  PRO A CD    1 
ATOM   2374  N N     . LEU A 1 343  ? 142.340 95.647  65.953  1.00 63.42  ? 343  LEU A N     1 
ATOM   2375  C CA    . LEU A 1 343  ? 143.479 96.428  66.416  1.00 63.15  ? 343  LEU A CA    1 
ATOM   2376  C C     . LEU A 1 343  ? 143.546 97.799  65.745  1.00 62.49  ? 343  LEU A C     1 
ATOM   2377  O O     . LEU A 1 343  ? 144.630 98.345  65.552  1.00 62.51  ? 343  LEU A O     1 
ATOM   2378  C CB    . LEU A 1 343  ? 144.770 95.671  66.114  1.00 63.52  ? 343  LEU A CB    1 
ATOM   2379  C CG    . LEU A 1 343  ? 145.987 95.949  66.995  1.00 63.87  ? 343  LEU A CG    1 
ATOM   2380  C CD1   . LEU A 1 343  ? 145.935 95.035  68.213  1.00 63.97  ? 343  LEU A CD1   1 
ATOM   2381  C CD2   . LEU A 1 343  ? 147.261 95.691  66.210  1.00 64.00  ? 343  LEU A CD2   1 
ATOM   2382  N N     . CYS A 1 344  ? 142.394 98.352  65.384  1.00 61.84  ? 344  CYS A N     1 
ATOM   2383  C CA    . CYS A 1 344  ? 142.368 99.657  64.735  1.00 61.21  ? 344  CYS A CA    1 
ATOM   2384  C C     . CYS A 1 344  ? 141.623 100.680 65.579  1.00 60.16  ? 344  CYS A C     1 
ATOM   2385  O O     . CYS A 1 344  ? 140.920 100.324 66.523  1.00 60.26  ? 344  CYS A O     1 
ATOM   2386  C CB    . CYS A 1 344  ? 141.711 99.548  63.360  1.00 61.62  ? 344  CYS A CB    1 
ATOM   2387  S SG    . CYS A 1 344  ? 142.548 98.403  62.239  1.00 61.94  ? 344  CYS A SG    1 
ATOM   2388  N N     . THR A 1 345  ? 141.783 101.952 65.228  1.00 58.93  ? 345  THR A N     1 
ATOM   2389  C CA    . THR A 1 345  ? 141.125 103.037 65.941  1.00 57.67  ? 345  THR A CA    1 
ATOM   2390  C C     . THR A 1 345  ? 139.725 103.274 65.397  1.00 56.91  ? 345  THR A C     1 
ATOM   2391  O O     . THR A 1 345  ? 139.420 102.948 64.249  1.00 56.82  ? 345  THR A O     1 
ATOM   2392  C CB    . THR A 1 345  ? 141.900 104.355 65.832  1.00 57.30  ? 345  THR A CB    1 
ATOM   2393  O OG1   . THR A 1 345  ? 141.163 105.395 66.484  1.00 57.17  ? 345  THR A OG1   1 
ATOM   2394  C CG2   . THR A 1 345  ? 142.104 104.740 64.376  1.00 57.17  ? 345  THR A CG2   1 
ATOM   2395  N N     . ALA A 1 346  ? 138.897 103.889 66.231  1.00 56.31  ? 346  ALA A N     1 
ATOM   2396  C CA    . ALA A 1 346  ? 137.515 104.171 65.885  1.00 55.80  ? 346  ALA A CA    1 
ATOM   2397  C C     . ALA A 1 346  ? 137.330 105.037 64.638  1.00 55.39  ? 346  ALA A C     1 
ATOM   2398  O O     . ALA A 1 346  ? 136.292 104.954 63.985  1.00 55.29  ? 346  ALA A O     1 
ATOM   2399  C CB    . ALA A 1 346  ? 136.818 104.806 67.077  1.00 55.75  ? 346  ALA A CB    1 
ATOM   2400  N N     . ARG A 1 347  ? 138.303 105.880 64.318  1.00 55.13  ? 347  ARG A N     1 
ATOM   2401  C CA    . ARG A 1 347  ? 138.180 106.703 63.115  1.00 54.90  ? 347  ARG A CA    1 
ATOM   2402  C C     . ARG A 1 347  ? 138.430 105.775 61.945  1.00 54.78  ? 347  ARG A C     1 
ATOM   2403  O O     . ARG A 1 347  ? 137.853 105.924 60.868  1.00 54.70  ? 347  ARG A O     1 
ATOM   2404  C CB    . ARG A 1 347  ? 139.222 107.823 63.079  1.00 54.83  ? 347  ARG A CB    1 
ATOM   2405  C CG    . ARG A 1 347  ? 138.909 109.010 63.959  1.00 54.75  ? 347  ARG A CG    1 
ATOM   2406  C CD    . ARG A 1 347  ? 139.925 110.121 63.743  1.00 54.56  ? 347  ARG A CD    1 
ATOM   2407  N NE    . ARG A 1 347  ? 139.634 110.948 62.574  1.00 54.30  ? 347  ARG A NE    1 
ATOM   2408  C CZ    . ARG A 1 347  ? 138.874 112.037 62.609  1.00 54.09  ? 347  ARG A CZ    1 
ATOM   2409  N NH1   . ARG A 1 347  ? 138.331 112.417 63.756  1.00 54.02  ? 347  ARG A NH1   1 
ATOM   2410  N NH2   . ARG A 1 347  ? 138.655 112.743 61.507  1.00 54.03  ? 347  ARG A NH2   1 
ATOM   2411  N N     . GLN A 1 348  ? 139.295 104.803 62.189  1.00 54.87  ? 348  GLN A N     1 
ATOM   2412  C CA    . GLN A 1 348  ? 139.672 103.834 61.180  1.00 55.07  ? 348  GLN A CA    1 
ATOM   2413  C C     . GLN A 1 348  ? 138.616 102.750 61.029  1.00 55.66  ? 348  GLN A C     1 
ATOM   2414  O O     . GLN A 1 348  ? 138.444 102.189 59.947  1.00 55.53  ? 348  GLN A O     1 
ATOM   2415  C CB    . GLN A 1 348  ? 141.007 103.204 61.560  1.00 54.76  ? 348  GLN A CB    1 
ATOM   2416  C CG    . GLN A 1 348  ? 141.920 102.932 60.392  1.00 54.50  ? 348  GLN A CG    1 
ATOM   2417  C CD    . GLN A 1 348  ? 143.210 102.279 60.825  1.00 54.29  ? 348  GLN A CD    1 
ATOM   2418  O OE1   . GLN A 1 348  ? 143.875 102.748 61.749  1.00 54.19  ? 348  GLN A OE1   1 
ATOM   2419  N NE2   . GLN A 1 348  ? 143.574 101.189 60.163  1.00 54.20  ? 348  GLN A NE2   1 
ATOM   2420  N N     . LEU A 1 349  ? 137.912 102.461 62.116  1.00 56.52  ? 349  LEU A N     1 
ATOM   2421  C CA    . LEU A 1 349  ? 136.872 101.440 62.129  1.00 57.53  ? 349  LEU A CA    1 
ATOM   2422  C C     . LEU A 1 349  ? 135.593 101.897 61.457  1.00 58.60  ? 349  LEU A C     1 
ATOM   2423  O O     . LEU A 1 349  ? 134.834 101.083 60.919  1.00 58.58  ? 349  LEU A O     1 
ATOM   2424  C CB    . LEU A 1 349  ? 136.567 101.043 63.567  1.00 57.51  ? 349  LEU A CB    1 
ATOM   2425  C CG    . LEU A 1 349  ? 137.614 100.151 64.219  1.00 57.48  ? 349  LEU A CG    1 
ATOM   2426  C CD1   . LEU A 1 349  ? 137.469 100.207 65.727  1.00 57.43  ? 349  LEU A CD1   1 
ATOM   2427  C CD2   . LEU A 1 349  ? 137.453 98.735  63.691  1.00 57.47  ? 349  LEU A CD2   1 
ATOM   2428  N N     . ASP A 1 350  ? 135.338 103.197 61.504  1.00 59.84  ? 350  ASP A N     1 
ATOM   2429  C CA    . ASP A 1 350  ? 134.141 103.751 60.894  1.00 61.15  ? 350  ASP A CA    1 
ATOM   2430  C C     . ASP A 1 350  ? 134.473 104.051 59.449  1.00 62.10  ? 350  ASP A C     1 
ATOM   2431  O O     . ASP A 1 350  ? 133.598 104.146 58.585  1.00 62.13  ? 350  ASP A O     1 
ATOM   2432  C CB    . ASP A 1 350  ? 133.733 105.037 61.598  1.00 61.55  ? 350  ASP A CB    1 
ATOM   2433  C CG    . ASP A 1 350  ? 132.328 105.455 61.259  1.00 61.84  ? 350  ASP A CG    1 
ATOM   2434  O OD1   . ASP A 1 350  ? 131.403 104.663 61.533  1.00 61.91  ? 350  ASP A OD1   1 
ATOM   2435  O OD2   . ASP A 1 350  ? 132.143 106.564 60.719  1.00 61.90  ? 350  ASP A OD2   1 
ATOM   2436  N N     . GLU A 1 351  ? 135.766 104.196 59.211  1.00 63.03  ? 351  GLU A N     1 
ATOM   2437  C CA    . GLU A 1 351  ? 136.294 104.489 57.898  1.00 63.93  ? 351  GLU A CA    1 
ATOM   2438  C C     . GLU A 1 351  ? 136.322 103.213 57.082  1.00 64.37  ? 351  GLU A C     1 
ATOM   2439  O O     . GLU A 1 351  ? 136.177 103.234 55.860  1.00 64.24  ? 351  GLU A O     1 
ATOM   2440  C CB    . GLU A 1 351  ? 137.704 105.030 58.047  1.00 64.39  ? 351  GLU A CB    1 
ATOM   2441  C CG    . GLU A 1 351  ? 138.427 105.248 56.753  1.00 64.69  ? 351  GLU A CG    1 
ATOM   2442  C CD    . GLU A 1 351  ? 139.890 105.514 56.986  1.00 64.90  ? 351  GLU A CD    1 
ATOM   2443  O OE1   . GLU A 1 351  ? 140.572 104.622 57.533  1.00 64.96  ? 351  GLU A OE1   1 
ATOM   2444  O OE2   . GLU A 1 351  ? 140.356 106.616 56.631  1.00 64.96  ? 351  GLU A OE2   1 
ATOM   2445  N N     . ASP A 1 352  ? 136.519 102.099 57.777  1.00 64.98  ? 352  ASP A N     1 
ATOM   2446  C CA    . ASP A 1 352  ? 136.594 100.800 57.142  1.00 65.70  ? 352  ASP A CA    1 
ATOM   2447  C C     . ASP A 1 352  ? 135.189 100.298 56.825  1.00 67.48  ? 352  ASP A C     1 
ATOM   2448  O O     . ASP A 1 352  ? 134.989 99.526  55.888  1.00 67.35  ? 352  ASP A O     1 
ATOM   2449  C CB    . ASP A 1 352  ? 137.314 99.808  58.058  1.00 64.86  ? 352  ASP A CB    1 
ATOM   2450  C CG    . ASP A 1 352  ? 137.874 98.625  57.301  1.00 64.22  ? 352  ASP A CG    1 
ATOM   2451  O OD1   . ASP A 1 352  ? 138.376 97.678  57.942  1.00 63.99  ? 352  ASP A OD1   1 
ATOM   2452  O OD2   . ASP A 1 352  ? 137.810 98.648  56.054  1.00 64.00  ? 352  ASP A OD2   1 
ATOM   2453  N N     . ARG A 1 353  ? 134.224 100.756 57.616  1.00 69.46  ? 353  ARG A N     1 
ATOM   2454  C CA    . ARG A 1 353  ? 132.831 100.370 57.440  1.00 71.47  ? 353  ARG A CA    1 
ATOM   2455  C C     . ARG A 1 353  ? 132.099 101.313 56.486  1.00 72.59  ? 353  ARG A C     1 
ATOM   2456  O O     . ARG A 1 353  ? 131.028 100.980 55.981  1.00 72.41  ? 353  ARG A O     1 
ATOM   2457  C CB    . ARG A 1 353  ? 132.121 100.352 58.798  1.00 72.37  ? 353  ARG A CB    1 
ATOM   2458  N N     . SER A 1 354  ? 132.674 102.487 56.241  1.00 73.93  ? 354  SER A N     1 
ATOM   2459  C CA    . SER A 1 354  ? 132.063 103.466 55.342  1.00 75.18  ? 354  SER A CA    1 
ATOM   2460  C C     . SER A 1 354  ? 132.575 103.264 53.922  1.00 76.41  ? 354  SER A C     1 
ATOM   2461  O O     . SER A 1 354  ? 132.048 103.829 52.962  1.00 76.36  ? 354  SER A O     1 
ATOM   2462  C CB    . SER A 1 354  ? 132.381 104.895 55.805  1.00 75.12  ? 354  SER A CB    1 
ATOM   2463  O OG    . SER A 1 354  ? 131.711 105.219 57.013  1.00 75.06  ? 354  SER A OG    1 
ATOM   2464  N N     . LEU A 1 355  ? 133.607 102.440 53.811  1.00 77.68  ? 355  LEU A N     1 
ATOM   2465  C CA    . LEU A 1 355  ? 134.244 102.128 52.541  1.00 78.99  ? 355  LEU A CA    1 
ATOM   2466  C C     . LEU A 1 355  ? 133.728 100.772 52.083  1.00 80.17  ? 355  LEU A C     1 
ATOM   2467  O O     . LEU A 1 355  ? 133.778 100.427 50.900  1.00 80.22  ? 355  LEU A O     1 
ATOM   2468  C CB    . LEU A 1 355  ? 135.759 102.085 52.747  1.00 79.12  ? 355  LEU A CB    1 
ATOM   2469  C CG    . LEU A 1 355  ? 136.653 102.351 51.538  1.00 79.28  ? 355  LEU A CG    1 
ATOM   2470  C CD1   . LEU A 1 355  ? 137.897 103.095 51.994  1.00 79.36  ? 355  LEU A CD1   1 
ATOM   2471  C CD2   . LEU A 1 355  ? 137.000 101.046 50.846  1.00 79.32  ? 355  LEU A CD2   1 
ATOM   2472  N N     . LEU A 1 356  ? 133.216 100.023 53.051  1.00 81.21  ? 356  LEU A N     1 
ATOM   2473  C CA    . LEU A 1 356  ? 132.677 98.687  52.837  1.00 82.18  ? 356  LEU A CA    1 
ATOM   2474  C C     . LEU A 1 356  ? 131.236 98.759  52.339  1.00 82.81  ? 356  LEU A C     1 
ATOM   2475  O O     . LEU A 1 356  ? 130.866 98.090  51.375  1.00 82.91  ? 356  LEU A O     1 
ATOM   2476  C CB    . LEU A 1 356  ? 132.743 97.905  54.154  1.00 82.44  ? 356  LEU A CB    1 
ATOM   2477  C CG    . LEU A 1 356  ? 132.828 96.379  54.084  1.00 82.64  ? 356  LEU A CG    1 
ATOM   2478  C CD1   . LEU A 1 356  ? 133.752 95.875  55.185  1.00 82.72  ? 356  LEU A CD1   1 
ATOM   2479  C CD2   . LEU A 1 356  ? 131.443 95.767  54.201  1.00 82.68  ? 356  LEU A CD2   1 
ATOM   2480  N N     . CYS B 2 14   ? 144.247 130.204 152.004 1.00 63.24  ? 6    CYS B N     1 
ATOM   2481  C CA    . CYS B 2 14   ? 144.658 131.479 152.582 1.00 63.24  ? 6    CYS B CA    1 
ATOM   2482  C C     . CYS B 2 14   ? 144.488 131.454 154.097 1.00 63.24  ? 6    CYS B C     1 
ATOM   2483  O O     . CYS B 2 14   ? 145.060 132.280 154.804 1.00 63.24  ? 6    CYS B O     1 
ATOM   2484  C CB    . CYS B 2 14   ? 143.826 132.630 151.990 1.00 63.24  ? 6    CYS B CB    1 
ATOM   2485  S SG    . CYS B 2 14   ? 144.796 134.107 151.509 1.00 63.24  ? 6    CYS B SG    1 
ATOM   2486  N N     . GLY B 2 15   ? 143.710 130.495 154.592 1.00 48.35  ? 7    GLY B N     1 
ATOM   2487  C CA    . GLY B 2 15   ? 143.472 130.410 156.022 1.00 48.35  ? 7    GLY B CA    1 
ATOM   2488  C C     . GLY B 2 15   ? 144.353 129.455 156.805 1.00 48.35  ? 7    GLY B C     1 
ATOM   2489  O O     . GLY B 2 15   ? 144.604 128.331 156.367 1.00 48.35  ? 7    GLY B O     1 
ATOM   2490  N N     . THR B 2 16   ? 144.841 129.910 157.959 1.00 49.78  ? 8    THR B N     1 
ATOM   2491  C CA    . THR B 2 16   ? 145.662 129.060 158.811 1.00 49.78  ? 8    THR B CA    1 
ATOM   2492  C C     . THR B 2 16   ? 144.867 128.747 160.079 1.00 49.78  ? 8    THR B C     1 
ATOM   2493  O O     . THR B 2 16   ? 144.579 127.581 160.355 1.00 49.78  ? 8    THR B O     1 
ATOM   2494  C CB    . THR B 2 16   ? 146.976 129.761 159.207 1.00 49.78  ? 8    THR B CB    1 
ATOM   2495  N N     . GLU B 2 17   ? 144.508 129.774 160.853 1.00 49.72  ? 9    GLU B N     1 
ATOM   2496  C CA    . GLU B 2 17   ? 143.691 129.528 162.037 1.00 49.72  ? 9    GLU B CA    1 
ATOM   2497  C C     . GLU B 2 17   ? 142.359 130.280 161.980 1.00 49.72  ? 9    GLU B C     1 
ATOM   2498  O O     . GLU B 2 17   ? 141.292 129.674 161.890 1.00 49.72  ? 9    GLU B O     1 
ATOM   2499  C CB    . GLU B 2 17   ? 144.456 129.940 163.300 1.00 49.72  ? 9    GLU B CB    1 
ATOM   2500  N N     . ASN B 2 18   ? 142.405 131.614 162.095 1.00 50.82  ? 10   ASN B N     1 
ATOM   2501  C CA    . ASN B 2 18   ? 141.198 132.480 162.060 1.00 50.82  ? 10   ASN B CA    1 
ATOM   2502  C C     . ASN B 2 18   ? 141.145 133.606 160.992 1.00 50.82  ? 10   ASN B C     1 
ATOM   2503  O O     . ASN B 2 18   ? 140.329 134.561 161.078 1.00 50.82  ? 10   ASN B O     1 
ATOM   2504  C CB    . ASN B 2 18   ? 140.934 133.073 163.447 1.00 50.82  ? 10   ASN B CB    1 
ATOM   2505  N N     . HIS B 2 19   ? 141.982 133.477 159.970 1.00 44.56  ? 11   HIS B N     1 
ATOM   2506  C CA    . HIS B 2 19   ? 142.094 134.506 158.938 1.00 44.56  ? 11   HIS B CA    1 
ATOM   2507  C C     . HIS B 2 19   ? 140.823 134.804 158.144 1.00 44.56  ? 11   HIS B C     1 
ATOM   2508  O O     . HIS B 2 19   ? 140.520 135.969 157.886 1.00 44.56  ? 11   HIS B O     1 
ATOM   2509  C CB    . HIS B 2 19   ? 143.230 134.159 157.972 1.00 44.56  ? 11   HIS B CB    1 
ATOM   2510  N N     . SER B 2 20   ? 140.067 133.778 157.770 1.00 47.95  ? 12   SER B N     1 
ATOM   2511  C CA    . SER B 2 20   ? 138.860 134.026 156.991 1.00 47.95  ? 12   SER B CA    1 
ATOM   2512  C C     . SER B 2 20   ? 137.867 134.878 157.777 1.00 47.95  ? 12   SER B C     1 
ATOM   2513  O O     . SER B 2 20   ? 137.315 135.846 157.251 1.00 47.95  ? 12   SER B O     1 
ATOM   2514  C CB    . SER B 2 20   ? 138.208 132.705 156.578 1.00 47.95  ? 12   SER B CB    1 
ATOM   2515  N N     . ALA B 2 21   ? 137.685 134.549 159.053 1.00 82.13  ? 13   ALA B N     1 
ATOM   2516  C CA    . ALA B 2 21   ? 136.768 135.296 159.909 1.00 82.13  ? 13   ALA B CA    1 
ATOM   2517  C C     . ALA B 2 21   ? 137.254 136.730 160.066 1.00 82.13  ? 13   ALA B C     1 
ATOM   2518  O O     . ALA B 2 21   ? 136.461 137.700 159.992 1.00 82.13  ? 13   ALA B O     1 
ATOM   2519  C CB    . ALA B 2 21   ? 136.641 134.623 161.266 1.00 82.13  ? 13   ALA B CB    1 
ATOM   2520  N N     . ALA B 2 22   ? 138.569 136.877 160.237 1.00 94.21  ? 14   ALA B N     1 
ATOM   2521  C CA    . ALA B 2 22   ? 139.101 138.223 160.392 1.00 94.21  ? 14   ALA B CA    1 
ATOM   2522  C C     . ALA B 2 22   ? 138.807 139.054 159.139 1.00 94.21  ? 14   ALA B C     1 
ATOM   2523  O O     . ALA B 2 22   ? 138.310 140.180 159.235 1.00 94.21  ? 14   ALA B O     1 
ATOM   2524  C CB    . ALA B 2 22   ? 140.596 138.175 160.663 1.00 94.21  ? 14   ALA B CB    1 
ATOM   2525  N N     . TYR B 2 23   ? 139.018 138.460 157.965 1.00 71.87  ? 15   TYR B N     1 
ATOM   2526  C CA    . TYR B 2 23   ? 138.780 139.151 156.698 1.00 71.87  ? 15   TYR B CA    1 
ATOM   2527  C C     . TYR B 2 23   ? 137.310 139.524 156.547 1.00 71.87  ? 15   TYR B C     1 
ATOM   2528  O O     . TYR B 2 23   ? 136.972 140.608 156.072 1.00 71.87  ? 15   TYR B O     1 
ATOM   2529  C CB    . TYR B 2 23   ? 139.225 138.280 155.522 1.00 71.87  ? 15   TYR B CB    1 
ATOM   2530  N N     . ARG B 2 24   ? 136.444 138.609 156.963 1.00 64.42  ? 16   ARG B N     1 
ATOM   2531  C CA    . ARG B 2 24   ? 135.005 138.797 156.902 1.00 64.42  ? 16   ARG B CA    1 
ATOM   2532  C C     . ARG B 2 24   ? 134.508 139.965 157.753 1.00 64.42  ? 16   ARG B C     1 
ATOM   2533  O O     . ARG B 2 24   ? 133.587 140.672 157.346 1.00 64.42  ? 16   ARG B O     1 
ATOM   2534  C CB    . ARG B 2 24   ? 134.284 137.510 157.313 1.00 64.42  ? 16   ARG B CB    1 
ATOM   2535  N N     . VAL B 2 25   ? 135.102 140.179 158.927 1.00 79.73  ? 17   VAL B N     1 
ATOM   2536  C CA    . VAL B 2 25   ? 134.605 141.265 159.802 1.00 79.73  ? 17   VAL B CA    1 
ATOM   2537  C C     . VAL B 2 25   ? 134.644 142.737 159.305 1.00 79.73  ? 17   VAL B C     1 
ATOM   2538  O O     . VAL B 2 25   ? 133.714 143.507 159.544 1.00 79.73  ? 17   VAL B O     1 
ATOM   2539  C CB    . VAL B 2 25   ? 135.290 141.212 161.183 1.00 79.73  ? 17   VAL B CB    1 
ATOM   2540  N N     . ASP B 2 26   ? 135.723 143.100 158.623 1.00 81.19  ? 18   ASP B N     1 
ATOM   2541  C CA    . ASP B 2 26   ? 136.040 144.432 158.115 1.00 81.19  ? 18   ASP B CA    1 
ATOM   2542  C C     . ASP B 2 26   ? 135.307 144.726 156.806 1.00 81.19  ? 18   ASP B C     1 
ATOM   2543  O O     . ASP B 2 26   ? 135.195 143.861 155.940 1.00 81.19  ? 18   ASP B O     1 
ATOM   2544  C CB    . ASP B 2 26   ? 137.553 144.577 157.917 1.00 81.19  ? 18   ASP B CB    1 
ATOM   2545  N N     . GLN B 2 27   ? 134.812 145.955 156.674 1.00 101.89 ? 19   GLN B N     1 
ATOM   2546  C CA    . GLN B 2 27   ? 134.077 146.374 155.483 1.00 101.89 ? 19   GLN B CA    1 
ATOM   2547  C C     . GLN B 2 27   ? 134.972 146.529 154.253 1.00 101.89 ? 19   GLN B C     1 
ATOM   2548  O O     . GLN B 2 27   ? 136.158 146.831 154.370 1.00 101.89 ? 19   GLN B O     1 
ATOM   2549  C CB    . GLN B 2 27   ? 133.352 147.698 155.752 1.00 101.89 ? 19   GLN B CB    1 
ATOM   2550  N N     . GLY B 2 28   ? 134.391 146.320 153.074 1.00 87.46  ? 20   GLY B N     1 
ATOM   2551  C CA    . GLY B 2 28   ? 135.141 146.451 151.836 1.00 87.46  ? 20   GLY B CA    1 
ATOM   2552  C C     . GLY B 2 28   ? 136.112 145.309 151.622 1.00 87.46  ? 20   GLY B C     1 
ATOM   2553  O O     . GLY B 2 28   ? 137.257 145.524 151.222 1.00 87.46  ? 20   GLY B O     1 
ATOM   2554  N N     . VAL B 2 29   ? 135.644 144.093 151.881 1.00 76.89  ? 21   VAL B N     1 
ATOM   2555  C CA    . VAL B 2 29   ? 136.460 142.896 151.727 1.00 76.89  ? 21   VAL B CA    1 
ATOM   2556  C C     . VAL B 2 29   ? 137.724 143.030 152.568 1.00 76.89  ? 21   VAL B C     1 
ATOM   2557  O O     . VAL B 2 29   ? 138.795 142.536 152.203 1.00 76.89  ? 21   VAL B O     1 
ATOM   2558  C CB    . VAL B 2 29   ? 136.847 142.669 150.256 1.00 76.89  ? 21   VAL B CB    1 
ATOM   2559  N N     . LEU B 2 30   ? 137.585 143.712 153.700 1.00 77.67  ? 22   LEU B N     1 
ATOM   2560  C CA    . LEU B 2 30   ? 138.692 143.929 154.622 1.00 77.67  ? 22   LEU B CA    1 
ATOM   2561  C C     . LEU B 2 30   ? 139.921 144.508 153.924 1.00 77.67  ? 22   LEU B C     1 
ATOM   2562  O O     . LEU B 2 30   ? 141.043 144.033 154.114 1.00 77.67  ? 22   LEU B O     1 
ATOM   2563  C CB    . LEU B 2 30   ? 139.053 142.616 155.320 1.00 77.67  ? 22   LEU B CB    1 
ATOM   2564  N N     . ASN B 2 31   ? 139.702 145.539 153.114 1.00 78.53  ? 23   ASN B N     1 
ATOM   2565  C CA    . ASN B 2 31   ? 140.793 146.185 152.394 1.00 78.53  ? 23   ASN B CA    1 
ATOM   2566  C C     . ASN B 2 31   ? 141.554 145.171 151.540 1.00 78.53  ? 23   ASN B C     1 
ATOM   2567  O O     . ASN B 2 31   ? 142.754 145.314 151.293 1.00 78.53  ? 23   ASN B O     1 
ATOM   2568  C CB    . ASN B 2 31   ? 141.739 146.873 153.385 1.00 78.53  ? 23   ASN B CB    1 
ATOM   2569  N N     . ASN B 2 32   ? 140.839 144.136 151.099 1.00 60.73  ? 24   ASN B N     1 
ATOM   2570  C CA    . ASN B 2 32   ? 141.402 143.092 150.244 1.00 60.73  ? 24   ASN B CA    1 
ATOM   2571  C C     . ASN B 2 32   ? 142.556 142.264 150.815 1.00 60.73  ? 24   ASN B C     1 
ATOM   2572  O O     . ASN B 2 32   ? 143.636 142.225 150.229 1.00 60.73  ? 24   ASN B O     1 
ATOM   2573  C CB    . ASN B 2 32   ? 141.823 143.701 148.904 1.00 60.73  ? 24   ASN B CB    1 
ATOM   2574  N N     . GLY B 2 33   ? 142.360 141.614 151.963 1.00 36.91  ? 25   GLY B N     1 
ATOM   2575  C CA    . GLY B 2 33   ? 143.456 140.815 152.499 1.00 36.91  ? 25   GLY B CA    1 
ATOM   2576  C C     . GLY B 2 33   ? 143.796 139.635 151.598 1.00 36.91  ? 25   GLY B C     1 
ATOM   2577  O O     . GLY B 2 33   ? 144.923 139.528 151.114 1.00 36.91  ? 25   GLY B O     1 
ATOM   2578  N N     . CYS B 2 34   ? 142.826 138.760 151.351 1.00 36.25  ? 26   CYS B N     1 
ATOM   2579  C CA    . CYS B 2 34   ? 143.045 137.609 150.476 1.00 36.25  ? 26   CYS B CA    1 
ATOM   2580  C C     . CYS B 2 34   ? 142.186 137.776 149.235 1.00 36.25  ? 26   CYS B C     1 
ATOM   2581  O O     . CYS B 2 34   ? 142.315 137.028 148.267 1.00 36.25  ? 26   CYS B O     1 
ATOM   2582  C CB    . CYS B 2 34   ? 142.676 136.293 151.180 1.00 36.25  ? 26   CYS B CB    1 
ATOM   2583  S SG    . CYS B 2 34   ? 143.886 135.688 152.414 1.00 36.25  ? 26   CYS B SG    1 
ATOM   2584  N N     . PHE B 2 35   ? 141.303 138.768 149.278 1.00 26.85  ? 27   PHE B N     1 
ATOM   2585  C CA    . PHE B 2 35   ? 140.388 139.050 148.180 1.00 26.85  ? 27   PHE B CA    1 
ATOM   2586  C C     . PHE B 2 35   ? 141.067 139.685 146.976 1.00 26.85  ? 27   PHE B C     1 
ATOM   2587  O O     . PHE B 2 35   ? 140.642 139.476 145.841 1.00 26.85  ? 27   PHE B O     1 
ATOM   2588  C CB    . PHE B 2 35   ? 139.263 139.962 148.669 1.00 26.85  ? 27   PHE B CB    1 
ATOM   2589  N N     . VAL B 2 36   ? 142.112 140.468 147.222 1.00 27.91  ? 28   VAL B N     1 
ATOM   2590  C CA    . VAL B 2 36   ? 142.832 141.129 146.138 1.00 27.91  ? 28   VAL B CA    1 
ATOM   2591  C C     . VAL B 2 36   ? 143.548 140.098 145.280 1.00 27.91  ? 28   VAL B C     1 
ATOM   2592  O O     . VAL B 2 36   ? 143.829 140.336 144.104 1.00 27.91  ? 28   VAL B O     1 
ATOM   2593  C CB    . VAL B 2 36   ? 143.874 142.120 146.681 1.00 27.91  ? 28   VAL B CB    1 
ATOM   2594  N N     . ASP B 2 37   ? 143.844 138.952 145.882 1.00 24.93  ? 29   ASP B N     1 
ATOM   2595  C CA    . ASP B 2 37   ? 144.531 137.878 145.182 1.00 24.93  ? 29   ASP B CA    1 
ATOM   2596  C C     . ASP B 2 37   ? 143.525 137.016 144.434 1.00 24.93  ? 29   ASP B C     1 
ATOM   2597  O O     . ASP B 2 37   ? 143.774 136.583 143.309 1.00 24.93  ? 29   ASP B O     1 
ATOM   2598  C CB    . ASP B 2 37   ? 145.311 137.017 146.179 1.00 24.93  ? 29   ASP B CB    1 
ATOM   2599  N N     . ALA B 2 38   ? 142.382 136.781 145.067 1.00 25.38  ? 30   ALA B N     1 
ATOM   2600  C CA    . ALA B 2 38   ? 141.332 135.966 144.474 1.00 25.38  ? 30   ALA B CA    1 
ATOM   2601  C C     . ALA B 2 38   ? 140.665 136.695 143.317 1.00 25.38  ? 30   ALA B C     1 
ATOM   2602  O O     . ALA B 2 38   ? 140.134 136.065 142.403 1.00 25.38  ? 30   ALA B O     1 
ATOM   2603  C CB    . ALA B 2 38   ? 140.302 135.604 145.530 1.00 25.38  ? 30   ALA B CB    1 
ATOM   2604  N N     . LEU B 2 39   ? 140.690 138.022 143.377 1.00 27.49  ? 31   LEU B N     1 
ATOM   2605  C CA    . LEU B 2 39   ? 140.087 138.855 142.346 1.00 27.49  ? 31   LEU B CA    1 
ATOM   2606  C C     . LEU B 2 39   ? 140.837 138.719 141.029 1.00 27.49  ? 31   LEU B C     1 
ATOM   2607  O O     . LEU B 2 39   ? 140.229 138.688 139.967 1.00 27.49  ? 31   LEU B O     1 
ATOM   2608  C CB    . LEU B 2 39   ? 140.060 140.319 142.789 1.00 27.49  ? 31   LEU B CB    1 
ATOM   2609  C CG    . LEU B 2 39   ? 139.347 141.296 141.854 1.00 27.49  ? 31   LEU B CG    1 
ATOM   2610  C CD1   . LEU B 2 39   ? 137.903 140.871 141.634 1.00 27.49  ? 31   LEU B CD1   1 
ATOM   2611  C CD2   . LEU B 2 39   ? 139.413 142.712 142.406 1.00 27.49  ? 31   LEU B CD2   1 
ATOM   2612  N N     . ASN B 2 40   ? 142.161 138.661 141.108 1.00 24.56  ? 32   ASN B N     1 
ATOM   2613  C CA    . ASN B 2 40   ? 143.014 138.519 139.931 1.00 24.56  ? 32   ASN B CA    1 
ATOM   2614  C C     . ASN B 2 40   ? 142.814 137.201 139.181 1.00 24.56  ? 32   ASN B C     1 
ATOM   2615  O O     . ASN B 2 40   ? 142.850 137.156 137.951 1.00 24.56  ? 32   ASN B O     1 
ATOM   2616  C CB    . ASN B 2 40   ? 144.486 138.683 140.316 1.00 24.56  ? 32   ASN B CB    1 
ATOM   2617  N N     . VAL B 2 41   ? 142.602 136.135 139.943 1.00 23.71  ? 33   VAL B N     1 
ATOM   2618  C CA    . VAL B 2 41   ? 142.444 134.783 139.407 1.00 23.71  ? 33   VAL B CA    1 
ATOM   2619  C C     . VAL B 2 41   ? 141.263 134.540 138.464 1.00 23.71  ? 33   VAL B C     1 
ATOM   2620  O O     . VAL B 2 41   ? 141.394 133.795 137.493 1.00 23.71  ? 33   VAL B O     1 
ATOM   2621  C CB    . VAL B 2 41   ? 142.371 133.746 140.546 1.00 23.71  ? 33   VAL B CB    1 
ATOM   2622  C CG1   . VAL B 2 41   ? 142.150 132.352 139.979 1.00 23.71  ? 33   VAL B CG1   1 
ATOM   2623  C CG2   . VAL B 2 41   ? 143.638 133.793 141.386 1.00 23.71  ? 33   VAL B CG2   1 
ATOM   2624  N N     . VAL B 2 42   ? 140.120 135.161 138.735 1.00 23.79  ? 34   VAL B N     1 
ATOM   2625  C CA    . VAL B 2 42   ? 138.933 134.927 137.912 1.00 23.79  ? 34   VAL B CA    1 
ATOM   2626  C C     . VAL B 2 42   ? 139.111 135.302 136.440 1.00 23.79  ? 34   VAL B C     1 
ATOM   2627  O O     . VAL B 2 42   ? 138.671 134.567 135.556 1.00 23.79  ? 34   VAL B O     1 
ATOM   2628  C CB    . VAL B 2 42   ? 137.710 135.682 138.470 1.00 23.79  ? 34   VAL B CB    1 
ATOM   2629  N N     . PRO B 2 43   ? 139.753 136.432 136.173 1.00 28.23  ? 35   PRO B N     1 
ATOM   2630  C CA    . PRO B 2 43   ? 139.985 136.860 134.796 1.00 28.23  ? 35   PRO B CA    1 
ATOM   2631  C C     . PRO B 2 43   ? 140.878 135.881 134.046 1.00 28.23  ? 35   PRO B C     1 
ATOM   2632  O O     . PRO B 2 43   ? 140.624 135.588 132.877 1.00 28.23  ? 35   PRO B O     1 
ATOM   2633  C CB    . PRO B 2 43   ? 140.691 138.203 134.982 1.00 28.23  ? 35   PRO B CB    1 
ATOM   2634  C CG    . PRO B 2 43   ? 140.175 138.721 136.295 1.00 28.23  ? 35   PRO B CG    1 
ATOM   2635  C CD    . PRO B 2 43   ? 139.500 137.592 137.037 1.00 28.23  ? 35   PRO B CD    1 
ATOM   2636  N N     . HIS B 2 44   ? 141.910 135.376 134.714 1.00 27.16  ? 36   HIS B N     1 
ATOM   2637  C CA    . HIS B 2 44   ? 142.819 134.428 134.088 1.00 27.16  ? 36   HIS B CA    1 
ATOM   2638  C C     . HIS B 2 44   ? 142.072 133.155 133.709 1.00 27.16  ? 36   HIS B C     1 
ATOM   2639  O O     . HIS B 2 44   ? 142.276 132.604 132.627 1.00 27.16  ? 36   HIS B O     1 
ATOM   2640  C CB    . HIS B 2 44   ? 143.981 134.099 135.026 1.00 27.16  ? 36   HIS B CB    1 
ATOM   2641  N N     . VAL B 2 45   ? 141.204 132.695 134.602 1.00 24.54  ? 37   VAL B N     1 
ATOM   2642  C CA    . VAL B 2 45   ? 140.418 131.495 134.348 1.00 24.54  ? 37   VAL B CA    1 
ATOM   2643  C C     . VAL B 2 45   ? 139.490 131.721 133.161 1.00 24.54  ? 37   VAL B C     1 
ATOM   2644  O O     . VAL B 2 45   ? 139.328 130.850 132.308 1.00 24.54  ? 37   VAL B O     1 
ATOM   2645  C CB    . VAL B 2 45   ? 139.580 131.097 135.576 1.00 24.54  ? 37   VAL B CB    1 
ATOM   2646  N N     . PHE B 2 46   ? 138.887 132.904 133.116 1.00 23.64  ? 38   PHE B N     1 
ATOM   2647  C CA    . PHE B 2 46   ? 137.978 133.265 132.038 1.00 23.64  ? 38   PHE B CA    1 
ATOM   2648  C C     . PHE B 2 46   ? 138.715 133.301 130.707 1.00 23.64  ? 38   PHE B C     1 
ATOM   2649  O O     . PHE B 2 46   ? 138.198 132.854 129.683 1.00 23.64  ? 38   PHE B O     1 
ATOM   2650  C CB    . PHE B 2 46   ? 137.335 134.624 132.317 1.00 23.64  ? 38   PHE B CB    1 
ATOM   2651  C CG    . PHE B 2 46   ? 136.458 135.120 131.203 1.00 23.64  ? 38   PHE B CG    1 
ATOM   2652  C CD1   . PHE B 2 46   ? 135.086 134.932 131.246 1.00 23.64  ? 38   PHE B CD1   1 
ATOM   2653  C CD2   . PHE B 2 46   ? 137.005 135.775 130.113 1.00 23.64  ? 38   PHE B CD2   1 
ATOM   2654  C CE1   . PHE B 2 46   ? 134.276 135.389 130.222 1.00 23.64  ? 38   PHE B CE1   1 
ATOM   2655  C CE2   . PHE B 2 46   ? 136.202 136.234 129.086 1.00 23.64  ? 38   PHE B CE2   1 
ATOM   2656  C CZ    . PHE B 2 46   ? 134.835 136.040 129.140 1.00 23.64  ? 38   PHE B CZ    1 
ATOM   2657  N N     . LEU B 2 47   ? 139.930 133.836 130.733 1.00 26.90  ? 39   LEU B N     1 
ATOM   2658  C CA    . LEU B 2 47   ? 140.748 133.943 129.533 1.00 26.90  ? 39   LEU B CA    1 
ATOM   2659  C C     . LEU B 2 47   ? 141.259 132.582 129.080 1.00 26.90  ? 39   LEU B C     1 
ATOM   2660  O O     . LEU B 2 47   ? 141.661 132.414 127.929 1.00 26.90  ? 39   LEU B O     1 
ATOM   2661  C CB    . LEU B 2 47   ? 141.925 134.892 129.773 1.00 26.90  ? 39   LEU B CB    1 
ATOM   2662  N N     . LEU B 2 48   ? 141.245 131.610 129.986 1.00 27.09  ? 40   LEU B N     1 
ATOM   2663  C CA    . LEU B 2 48   ? 141.718 130.271 129.655 1.00 27.09  ? 40   LEU B CA    1 
ATOM   2664  C C     . LEU B 2 48   ? 140.579 129.305 129.363 1.00 27.09  ? 40   LEU B C     1 
ATOM   2665  O O     . LEU B 2 48   ? 140.784 128.264 128.737 1.00 27.09  ? 40   LEU B O     1 
ATOM   2666  C CB    . LEU B 2 48   ? 142.584 129.725 130.795 1.00 27.09  ? 40   LEU B CB    1 
ATOM   2667  N N     . PHE B 2 49   ? 139.377 129.660 129.805 1.00 38.06  ? 41   PHE B N     1 
ATOM   2668  C CA    . PHE B 2 49   ? 138.213 128.808 129.594 1.00 38.06  ? 41   PHE B CA    1 
ATOM   2669  C C     . PHE B 2 49   ? 137.530 129.085 128.266 1.00 38.06  ? 41   PHE B C     1 
ATOM   2670  O O     . PHE B 2 49   ? 136.722 128.286 127.792 1.00 38.06  ? 41   PHE B O     1 
ATOM   2671  C CB    . PHE B 2 49   ? 137.220 128.978 130.747 1.00 38.06  ? 41   PHE B CB    1 
ATOM   2672  C CG    . PHE B 2 49   ? 137.799 128.642 132.090 1.00 38.06  ? 41   PHE B CG    1 
ATOM   2673  C CD1   . PHE B 2 49   ? 138.812 127.693 132.201 1.00 38.06  ? 41   PHE B CD1   1 
ATOM   2674  C CD2   . PHE B 2 49   ? 137.332 129.260 133.246 1.00 38.06  ? 41   PHE B CD2   1 
ATOM   2675  C CE1   . PHE B 2 49   ? 139.353 127.363 133.434 1.00 38.06  ? 41   PHE B CE1   1 
ATOM   2676  C CE2   . PHE B 2 49   ? 137.870 128.933 134.491 1.00 38.06  ? 41   PHE B CE2   1 
ATOM   2677  C CZ    . PHE B 2 49   ? 138.883 127.981 134.582 1.00 38.06  ? 41   PHE B CZ    1 
ATOM   2678  N N     . ILE B 2 50   ? 137.661 130.328 127.814 1.00 33.78  ? 42   ILE B N     1 
ATOM   2679  C CA    . ILE B 2 50   ? 137.171 130.755 126.508 1.00 33.78  ? 42   ILE B CA    1 
ATOM   2680  C C     . ILE B 2 50   ? 138.040 130.186 125.384 1.00 33.78  ? 42   ILE B C     1 
ATOM   2681  O O     . ILE B 2 50   ? 137.557 129.771 124.331 1.00 33.78  ? 42   ILE B O     1 
ATOM   2682  C CB    . ILE B 2 50   ? 137.134 132.290 126.392 1.00 33.78  ? 42   ILE B CB    1 
ATOM   2683  N N     . THR B 2 51   ? 139.344 130.193 125.653 1.00 37.14  ? 43   THR B N     1 
ATOM   2684  C CA    . THR B 2 51   ? 140.409 129.777 124.735 1.00 37.14  ? 43   THR B CA    1 
ATOM   2685  C C     . THR B 2 51   ? 140.484 128.326 124.252 1.00 37.14  ? 43   THR B C     1 
ATOM   2686  O O     . THR B 2 51   ? 140.828 128.076 123.097 1.00 37.14  ? 43   THR B O     1 
ATOM   2687  C CB    . THR B 2 51   ? 141.795 130.156 125.301 1.00 37.14  ? 43   THR B CB    1 
ATOM   2688  N N     . PHE B 2 52   ? 140.168 127.374 125.120 1.00 44.54  ? 44   PHE B N     1 
ATOM   2689  C CA    . PHE B 2 52   ? 140.296 125.965 124.760 1.00 44.54  ? 44   PHE B CA    1 
ATOM   2690  C C     . PHE B 2 52   ? 139.451 125.575 123.551 1.00 44.54  ? 44   PHE B C     1 
ATOM   2691  O O     . PHE B 2 52   ? 139.900 124.812 122.696 1.00 44.54  ? 44   PHE B O     1 
ATOM   2692  C CB    . PHE B 2 52   ? 139.935 125.082 125.955 1.00 44.54  ? 44   PHE B CB    1 
ATOM   2693  C CG    . PHE B 2 52   ? 140.863 125.238 127.125 1.00 44.54  ? 44   PHE B CG    1 
ATOM   2694  C CD1   . PHE B 2 52   ? 142.122 125.791 126.959 1.00 44.54  ? 44   PHE B CD1   1 
ATOM   2695  C CD2   . PHE B 2 52   ? 140.475 124.834 128.392 1.00 44.54  ? 44   PHE B CD2   1 
ATOM   2696  C CE1   . PHE B 2 52   ? 142.977 125.936 128.034 1.00 44.54  ? 44   PHE B CE1   1 
ATOM   2697  C CE2   . PHE B 2 52   ? 141.326 124.978 129.471 1.00 44.54  ? 44   PHE B CE2   1 
ATOM   2698  C CZ    . PHE B 2 52   ? 142.578 125.529 129.292 1.00 44.54  ? 44   PHE B CZ    1 
ATOM   2699  N N     . PRO B 2 53   ? 138.236 126.099 123.475 1.00 46.96  ? 45   PRO B N     1 
ATOM   2700  C CA    . PRO B 2 53   ? 137.346 125.794 122.351 1.00 46.96  ? 45   PRO B CA    1 
ATOM   2701  C C     . PRO B 2 53   ? 137.898 126.275 121.007 1.00 46.96  ? 45   PRO B C     1 
ATOM   2702  O O     . PRO B 2 53   ? 137.770 125.574 120.003 1.00 46.96  ? 45   PRO B O     1 
ATOM   2703  C CB    . PRO B 2 53   ? 136.078 126.566 122.703 1.00 46.96  ? 45   PRO B CB    1 
ATOM   2704  C CG    . PRO B 2 53   ? 136.059 126.576 124.195 1.00 46.96  ? 45   PRO B CG    1 
ATOM   2705  C CD    . PRO B 2 53   ? 137.492 126.569 124.658 1.00 46.96  ? 45   PRO B CD    1 
ATOM   2706  N N     . ILE B 2 54   ? 138.507 127.456 120.998 1.00 43.78  ? 46   ILE B N     1 
ATOM   2707  C CA    . ILE B 2 54   ? 139.043 128.050 119.777 1.00 43.78  ? 46   ILE B CA    1 
ATOM   2708  C C     . ILE B 2 54   ? 140.444 127.545 119.457 1.00 43.78  ? 46   ILE B C     1 
ATOM   2709  O O     . ILE B 2 54   ? 140.892 127.617 118.313 1.00 43.78  ? 46   ILE B O     1 
ATOM   2710  C CB    . ILE B 2 54   ? 139.088 129.586 119.887 1.00 43.78  ? 46   ILE B CB    1 
ATOM   2711  N N     . LEU B 2 55   ? 141.216 127.307 120.514 1.00 42.02  ? 47   LEU B N     1 
ATOM   2712  C CA    . LEU B 2 55   ? 142.562 126.763 120.379 1.00 42.02  ? 47   LEU B CA    1 
ATOM   2713  C C     . LEU B 2 55   ? 142.565 125.295 119.959 1.00 42.02  ? 47   LEU B C     1 
ATOM   2714  O O     . LEU B 2 55   ? 143.314 124.886 119.071 1.00 42.02  ? 47   LEU B O     1 
ATOM   2715  C CB    . LEU B 2 55   ? 143.338 126.932 121.688 1.00 42.02  ? 47   LEU B CB    1 
ATOM   2716  N N     . PHE B 2 56   ? 141.711 124.510 120.615 1.00 51.95  ? 48   PHE B N     1 
ATOM   2717  C CA    . PHE B 2 56   ? 141.597 123.077 120.354 1.00 51.95  ? 48   PHE B CA    1 
ATOM   2718  C C     . PHE B 2 56   ? 141.063 122.755 118.966 1.00 51.95  ? 48   PHE B C     1 
ATOM   2719  O O     . PHE B 2 56   ? 141.558 121.856 118.286 1.00 51.95  ? 48   PHE B O     1 
ATOM   2720  C CB    . PHE B 2 56   ? 140.717 122.412 121.416 1.00 51.95  ? 48   PHE B CB    1 
ATOM   2721  N N     . ILE B 2 57   ? 140.047 123.503 118.557 1.00 53.05  ? 49   ILE B N     1 
ATOM   2722  C CA    . ILE B 2 57   ? 139.422 123.310 117.260 1.00 53.05  ? 49   ILE B CA    1 
ATOM   2723  C C     . ILE B 2 57   ? 140.406 123.595 116.138 1.00 53.05  ? 49   ILE B C     1 
ATOM   2724  O O     . ILE B 2 57   ? 140.429 122.900 115.123 1.00 53.05  ? 49   ILE B O     1 
ATOM   2725  C CB    . ILE B 2 57   ? 138.190 124.218 117.088 1.00 53.05  ? 49   ILE B CB    1 
ATOM   2726  N N     . GLY B 2 58   ? 141.223 124.623 116.332 1.00 59.77  ? 50   GLY B N     1 
ATOM   2727  C CA    . GLY B 2 58   ? 142.177 125.028 115.317 1.00 59.77  ? 50   GLY B CA    1 
ATOM   2728  C C     . GLY B 2 58   ? 143.333 124.054 115.327 1.00 59.77  ? 50   GLY B C     1 
ATOM   2729  O O     . GLY B 2 58   ? 144.153 124.025 114.410 1.00 59.77  ? 50   GLY B O     1 
ATOM   2730  N N     . TRP B 2 59   ? 143.386 123.254 116.387 1.00 69.22  ? 51   TRP B N     1 
ATOM   2731  C CA    . TRP B 2 59   ? 144.421 122.247 116.561 1.00 69.22  ? 51   TRP B CA    1 
ATOM   2732  C C     . TRP B 2 59   ? 143.967 120.970 115.860 1.00 69.22  ? 51   TRP B C     1 
ATOM   2733  O O     . TRP B 2 59   ? 144.784 120.206 115.354 1.00 69.22  ? 51   TRP B O     1 
ATOM   2734  C CB    . TRP B 2 59   ? 144.639 121.984 118.059 1.00 69.22  ? 51   TRP B CB    1 
ATOM   2735  C CG    . TRP B 2 59   ? 145.666 120.938 118.356 1.00 69.22  ? 51   TRP B CG    1 
ATOM   2736  C CD1   . TRP B 2 59   ? 147.016 121.038 118.170 1.00 69.22  ? 51   TRP B CD1   1 
ATOM   2737  C CD2   . TRP B 2 59   ? 145.426 119.612 118.850 1.00 69.22  ? 51   TRP B CD2   1 
ATOM   2738  N NE1   . TRP B 2 59   ? 147.630 119.857 118.514 1.00 69.22  ? 51   TRP B NE1   1 
ATOM   2739  C CE2   . TRP B 2 59   ? 146.679 118.966 118.933 1.00 69.22  ? 51   TRP B CE2   1 
ATOM   2740  C CE3   . TRP B 2 59   ? 144.274 118.907 119.227 1.00 69.22  ? 51   TRP B CE3   1 
ATOM   2741  C CZ2   . TRP B 2 59   ? 146.813 117.646 119.379 1.00 69.22  ? 51   TRP B CZ2   1 
ATOM   2742  C CZ3   . TRP B 2 59   ? 144.407 117.595 119.670 1.00 69.22  ? 51   TRP B CZ3   1 
ATOM   2743  C CH2   . TRP B 2 59   ? 145.671 116.978 119.741 1.00 69.22  ? 51   TRP B CH2   1 
ATOM   2744  N N     . GLY B 2 60   ? 142.653 120.762 115.823 1.00 86.23  ? 52   GLY B N     1 
ATOM   2745  C CA    . GLY B 2 60   ? 142.099 119.576 115.197 1.00 86.23  ? 52   GLY B CA    1 
ATOM   2746  C C     . GLY B 2 60   ? 141.803 119.728 113.718 1.00 86.23  ? 52   GLY B C     1 
ATOM   2747  O O     . GLY B 2 60   ? 142.044 118.808 112.938 1.00 86.23  ? 52   GLY B O     1 
ATOM   2748  N N     . SER B 2 61   ? 141.275 120.881 113.322 1.00 102.39 ? 53   SER B N     1 
ATOM   2749  C CA    . SER B 2 61   ? 140.950 121.120 111.920 1.00 102.39 ? 53   SER B CA    1 
ATOM   2750  C C     . SER B 2 61   ? 142.189 121.226 111.036 1.00 102.39 ? 53   SER B C     1 
ATOM   2751  O O     . SER B 2 61   ? 142.095 121.116 109.811 1.00 102.39 ? 53   SER B O     1 
ATOM   2752  C CB    . SER B 2 61   ? 140.110 122.390 111.784 1.00 102.39 ? 53   SER B CB    1 
ATOM   2753  O OG    . SER B 2 61   ? 138.821 122.201 112.334 1.00 102.39 ? 53   SER B OG    1 
ATOM   2754  N N     . GLN B 2 62   ? 143.346 121.435 111.655 1.00 87.03  ? 54   GLN B N     1 
ATOM   2755  C CA    . GLN B 2 62   ? 144.596 121.556 110.913 1.00 87.03  ? 54   GLN B CA    1 
ATOM   2756  C C     . GLN B 2 62   ? 145.382 120.251 110.971 1.00 87.03  ? 54   GLN B C     1 
ATOM   2757  O O     . GLN B 2 62   ? 146.508 120.171 110.477 1.00 87.03  ? 54   GLN B O     1 
ATOM   2758  C CB    . GLN B 2 62   ? 145.439 122.696 111.491 1.00 87.03  ? 54   GLN B CB    1 
ATOM   2759  N N     . SER B 2 63   ? 144.776 119.234 111.579 1.00 90.77  ? 55   SER B N     1 
ATOM   2760  C CA    . SER B 2 63   ? 145.408 117.929 111.725 1.00 90.77  ? 55   SER B CA    1 
ATOM   2761  C C     . SER B 2 63   ? 144.750 116.834 110.885 1.00 90.77  ? 55   SER B C     1 
ATOM   2762  O O     . SER B 2 63   ? 145.389 115.833 110.552 1.00 90.77  ? 55   SER B O     1 
ATOM   2763  C CB    . SER B 2 63   ? 145.404 117.523 113.201 1.00 90.77  ? 55   SER B CB    1 
ATOM   2764  N N     . SER B 2 64   ? 143.479 117.029 110.536 1.00 106.48 ? 56   SER B N     1 
ATOM   2765  C CA    . SER B 2 64   ? 142.745 116.042 109.745 1.00 106.48 ? 56   SER B CA    1 
ATOM   2766  C C     . SER B 2 64   ? 142.466 116.500 108.313 1.00 106.48 ? 56   SER B C     1 
ATOM   2767  O O     . SER B 2 64   ? 142.767 115.778 107.362 1.00 106.48 ? 56   SER B O     1 
ATOM   2768  C CB    . SER B 2 64   ? 141.422 115.698 110.437 1.00 106.48 ? 56   SER B CB    1 
ATOM   2769  N N     . LYS B 2 65   ? 141.903 117.696 108.161 1.00 121.08 ? 57   LYS B N     1 
ATOM   2770  C CA    . LYS B 2 65   ? 141.587 118.235 106.840 1.00 121.08 ? 57   LYS B CA    1 
ATOM   2771  C C     . LYS B 2 65   ? 141.692 119.756 106.820 1.00 121.08 ? 57   LYS B C     1 
ATOM   2772  O O     . LYS B 2 65   ? 140.764 120.458 107.221 1.00 121.08 ? 57   LYS B O     1 
ATOM   2773  C CB    . LYS B 2 65   ? 140.182 117.802 106.413 1.00 121.08 ? 57   LYS B CB    1 
ATOM   2774  N N     . VAL B 2 66   ? 142.830 120.255 106.346 1.00 109.39 ? 58   VAL B N     1 
ATOM   2775  C CA    . VAL B 2 66   ? 143.070 121.694 106.268 1.00 109.39 ? 58   VAL B CA    1 
ATOM   2776  C C     . VAL B 2 66   ? 143.832 122.032 104.993 1.00 109.39 ? 58   VAL B C     1 
ATOM   2777  O O     . VAL B 2 66   ? 144.639 121.236 104.510 1.00 109.39 ? 58   VAL B O     1 
ATOM   2778  C CB    . VAL B 2 66   ? 143.881 122.192 107.478 1.00 109.39 ? 58   VAL B CB    1 
ATOM   2779  N N     . HIS B 2 67   ? 143.570 123.216 104.451 1.00 116.06 ? 59   HIS B N     1 
ATOM   2780  C CA    . HIS B 2 67   ? 144.226 123.663 103.228 1.00 116.06 ? 59   HIS B CA    1 
ATOM   2781  C C     . HIS B 2 67   ? 145.226 124.776 103.512 1.00 116.06 ? 59   HIS B C     1 
ATOM   2782  O O     . HIS B 2 67   ? 145.982 125.179 102.627 1.00 116.06 ? 59   HIS B O     1 
ATOM   2783  C CB    . HIS B 2 67   ? 143.187 124.166 102.223 1.00 116.06 ? 59   HIS B CB    1 
ATOM   2784  N N     . ILE B 2 68   ? 145.228 125.266 104.748 1.00 130.83 ? 60   ILE B N     1 
ATOM   2785  C CA    . ILE B 2 68   ? 146.129 126.343 105.146 1.00 130.83 ? 60   ILE B CA    1 
ATOM   2786  C C     . ILE B 2 68   ? 147.451 125.795 105.665 1.00 130.83 ? 60   ILE B C     1 
ATOM   2787  O O     . ILE B 2 68   ? 148.118 126.427 106.488 1.00 130.83 ? 60   ILE B O     1 
ATOM   2788  C CB    . ILE B 2 68   ? 145.489 127.219 106.238 1.00 130.83 ? 60   ILE B CB    1 
ATOM   2789  N N     . HIS B 2 69   ? 147.829 124.621 105.169 1.00 141.26 ? 61   HIS B N     1 
ATOM   2790  C CA    . HIS B 2 69   ? 149.067 123.980 105.583 1.00 141.26 ? 61   HIS B CA    1 
ATOM   2791  C C     . HIS B 2 69   ? 150.202 124.288 104.612 1.00 141.26 ? 61   HIS B C     1 
ATOM   2792  O O     . HIS B 2 69   ? 151.293 123.721 104.728 1.00 141.26 ? 61   HIS B O     1 
ATOM   2793  C CB    . HIS B 2 69   ? 148.861 122.468 105.677 1.00 141.26 ? 61   HIS B CB    1 
ATOM   2794  N N     . HIS B 2 70   ? 149.953 125.189 103.663 1.00 124.85 ? 62   HIS B N     1 
ATOM   2795  C CA    . HIS B 2 70   ? 150.973 125.535 102.682 1.00 124.85 ? 62   HIS B CA    1 
ATOM   2796  C C     . HIS B 2 70   ? 151.554 126.947 102.789 1.00 124.85 ? 62   HIS B C     1 
ATOM   2797  O O     . HIS B 2 70   ? 152.771 127.098 102.897 1.00 124.85 ? 62   HIS B O     1 
ATOM   2798  C CB    . HIS B 2 70   ? 150.419 125.314 101.268 1.00 124.85 ? 62   HIS B CB    1 
ATOM   2799  N N     . SER B 2 71   ? 150.704 127.976 102.768 1.00 99.38  ? 63   SER B N     1 
ATOM   2800  C CA    . SER B 2 71   ? 151.193 129.358 102.849 1.00 99.38  ? 63   SER B CA    1 
ATOM   2801  C C     . SER B 2 71   ? 150.197 130.369 103.423 1.00 99.38  ? 63   SER B C     1 
ATOM   2802  O O     . SER B 2 71   ? 149.214 130.712 102.769 1.00 99.38  ? 63   SER B O     1 
ATOM   2803  C CB    . SER B 2 71   ? 151.645 129.825 101.463 1.00 99.38  ? 63   SER B CB    1 
ATOM   2804  N N     . THR B 2 72   ? 150.446 130.843 104.642 1.00 70.39  ? 64   THR B N     1 
ATOM   2805  C CA    . THR B 2 72   ? 149.557 131.820 105.269 1.00 70.39  ? 64   THR B CA    1 
ATOM   2806  C C     . THR B 2 72   ? 150.253 132.714 106.297 1.00 70.39  ? 64   THR B C     1 
ATOM   2807  O O     . THR B 2 72   ? 150.852 132.219 107.249 1.00 70.39  ? 64   THR B O     1 
ATOM   2808  C CB    . THR B 2 72   ? 148.362 131.122 105.940 1.00 70.39  ? 64   THR B CB    1 
ATOM   2809  N N     . TRP B 2 73   ? 150.192 134.028 106.091 1.00 57.05  ? 65   TRP B N     1 
ATOM   2810  C CA    . TRP B 2 73   ? 150.796 134.968 107.034 1.00 57.05  ? 65   TRP B CA    1 
ATOM   2811  C C     . TRP B 2 73   ? 150.139 136.353 107.037 1.00 57.05  ? 65   TRP B C     1 
ATOM   2812  O O     . TRP B 2 73   ? 149.734 136.860 105.993 1.00 57.05  ? 65   TRP B O     1 
ATOM   2813  C CB    . TRP B 2 73   ? 152.299 135.095 106.774 1.00 57.05  ? 65   TRP B CB    1 
ATOM   2814  C CG    . TRP B 2 73   ? 153.046 133.861 107.123 1.00 57.05  ? 65   TRP B CG    1 
ATOM   2815  C CD1   . TRP B 2 73   ? 153.394 132.852 106.276 1.00 57.05  ? 65   TRP B CD1   1 
ATOM   2816  C CD2   . TRP B 2 73   ? 153.601 133.525 108.403 1.00 57.05  ? 65   TRP B CD2   1 
ATOM   2817  N NE1   . TRP B 2 73   ? 154.133 131.905 106.947 1.00 57.05  ? 65   TRP B NE1   1 
ATOM   2818  C CE2   . TRP B 2 73   ? 154.274 132.293 108.253 1.00 57.05  ? 65   TRP B CE2   1 
ATOM   2819  C CE3   . TRP B 2 73   ? 153.597 134.145 109.662 1.00 57.05  ? 65   TRP B CE3   1 
ATOM   2820  C CZ2   . TRP B 2 73   ? 154.935 131.664 109.312 1.00 57.05  ? 65   TRP B CZ2   1 
ATOM   2821  C CZ3   . TRP B 2 73   ? 154.257 133.521 110.717 1.00 57.05  ? 65   TRP B CZ3   1 
ATOM   2822  C CH2   . TRP B 2 73   ? 154.917 132.290 110.533 1.00 57.05  ? 65   TRP B CH2   1 
ATOM   2823  N N     . LEU B 2 74   ? 150.035 136.956 108.221 1.00 57.29  ? 66   LEU B N     1 
ATOM   2824  C CA    . LEU B 2 74   ? 149.439 138.285 108.373 1.00 57.29  ? 66   LEU B CA    1 
ATOM   2825  C C     . LEU B 2 74   ? 150.133 139.088 109.470 1.00 57.29  ? 66   LEU B C     1 
ATOM   2826  O O     . LEU B 2 74   ? 150.569 138.534 110.478 1.00 57.29  ? 66   LEU B O     1 
ATOM   2827  C CB    . LEU B 2 74   ? 147.944 138.170 108.688 1.00 57.29  ? 66   LEU B CB    1 
ATOM   2828  N N     . HIS B 2 75   ? 150.218 140.401 109.269 1.00 50.37  ? 67   HIS B N     1 
ATOM   2829  C CA    . HIS B 2 75   ? 150.871 141.285 110.233 1.00 50.37  ? 67   HIS B CA    1 
ATOM   2830  C C     . HIS B 2 75   ? 149.902 142.201 110.974 1.00 50.37  ? 67   HIS B C     1 
ATOM   2831  O O     . HIS B 2 75   ? 148.852 142.573 110.448 1.00 50.37  ? 67   HIS B O     1 
ATOM   2832  C CB    . HIS B 2 75   ? 151.928 142.140 109.525 1.00 50.37  ? 67   HIS B CB    1 
ATOM   2833  C CG    . HIS B 2 75   ? 152.899 142.798 110.456 1.00 50.37  ? 67   HIS B CG    1 
ATOM   2834  N ND1   . HIS B 2 75   ? 153.847 142.088 111.159 1.00 50.37  ? 67   HIS B ND1   1 
ATOM   2835  C CD2   . HIS B 2 75   ? 153.060 144.095 110.808 1.00 50.37  ? 67   HIS B CD2   1 
ATOM   2836  C CE1   . HIS B 2 75   ? 154.550 142.920 111.906 1.00 50.37  ? 67   HIS B CE1   1 
ATOM   2837  N NE2   . HIS B 2 75   ? 154.094 144.144 111.713 1.00 50.37  ? 67   HIS B NE2   1 
ATOM   2838  N N     . PHE B 2 76   ? 150.276 142.563 112.198 1.00 44.73  ? 68   PHE B N     1 
ATOM   2839  C CA    . PHE B 2 76   ? 149.477 143.447 113.043 1.00 44.73  ? 68   PHE B CA    1 
ATOM   2840  C C     . PHE B 2 76   ? 150.364 144.518 113.683 1.00 44.73  ? 68   PHE B C     1 
ATOM   2841  O O     . PHE B 2 76   ? 151.502 144.242 114.071 1.00 44.73  ? 68   PHE B O     1 
ATOM   2842  C CB    . PHE B 2 76   ? 148.771 142.647 114.139 1.00 44.73  ? 68   PHE B CB    1 
ATOM   2843  C CG    . PHE B 2 76   ? 147.633 141.809 113.641 1.00 44.73  ? 68   PHE B CG    1 
ATOM   2844  C CD1   . PHE B 2 76   ? 146.394 142.384 113.373 1.00 44.73  ? 68   PHE B CD1   1 
ATOM   2845  C CD2   . PHE B 2 76   ? 147.801 140.446 113.423 1.00 44.73  ? 68   PHE B CD2   1 
ATOM   2846  C CE1   . PHE B 2 76   ? 145.338 141.614 112.901 1.00 44.73  ? 68   PHE B CE1   1 
ATOM   2847  C CE2   . PHE B 2 76   ? 146.750 139.666 112.949 1.00 44.73  ? 68   PHE B CE2   1 
ATOM   2848  C CZ    . PHE B 2 76   ? 145.517 140.253 112.686 1.00 44.73  ? 68   PHE B CZ    1 
ATOM   2849  N N     . PRO B 2 77   ? 149.853 145.759 113.781 1.00 49.77  ? 69   PRO B N     1 
ATOM   2850  C CA    . PRO B 2 77   ? 150.538 146.922 114.359 1.00 49.77  ? 69   PRO B CA    1 
ATOM   2851  C C     . PRO B 2 77   ? 150.883 146.709 115.833 1.00 49.77  ? 69   PRO B C     1 
ATOM   2852  O O     . PRO B 2 77   ? 149.996 146.633 116.684 1.00 49.77  ? 69   PRO B O     1 
ATOM   2853  C CB    . PRO B 2 77   ? 149.528 148.047 114.154 1.00 49.77  ? 69   PRO B CB    1 
ATOM   2854  C CG    . PRO B 2 77   ? 148.845 147.646 112.888 1.00 49.77  ? 69   PRO B CG    1 
ATOM   2855  C CD    . PRO B 2 77   ? 148.596 146.175 113.134 1.00 49.77  ? 69   PRO B CD    1 
ATOM   2856  N N     . GLY B 2 78   ? 152.177 146.622 116.123 1.00 47.11  ? 70   GLY B N     1 
ATOM   2857  C CA    . GLY B 2 78   ? 152.628 146.409 117.486 1.00 47.11  ? 70   GLY B CA    1 
ATOM   2858  C C     . GLY B 2 78   ? 153.052 144.969 117.686 1.00 47.11  ? 70   GLY B C     1 
ATOM   2859  O O     . GLY B 2 78   ? 152.865 144.396 118.762 1.00 47.11  ? 70   GLY B O     1 
ATOM   2860  N N     . HIS B 2 79   ? 153.631 144.378 116.646 1.00 44.49  ? 71   HIS B N     1 
ATOM   2861  C CA    . HIS B 2 79   ? 154.071 142.994 116.719 1.00 44.49  ? 71   HIS B CA    1 
ATOM   2862  C C     . HIS B 2 79   ? 155.301 142.838 117.603 1.00 44.49  ? 71   HIS B C     1 
ATOM   2863  O O     . HIS B 2 79   ? 155.387 141.900 118.393 1.00 44.49  ? 71   HIS B O     1 
ATOM   2864  C CB    . HIS B 2 79   ? 154.376 142.465 115.319 1.00 44.49  ? 71   HIS B CB    1 
ATOM   2865  C CG    . HIS B 2 79   ? 154.035 141.020 115.136 1.00 44.49  ? 71   HIS B CG    1 
ATOM   2866  N ND1   . HIS B 2 79   ? 152.741 140.549 115.219 1.00 44.49  ? 71   HIS B ND1   1 
ATOM   2867  C CD2   . HIS B 2 79   ? 154.813 139.940 114.891 1.00 44.49  ? 71   HIS B CD2   1 
ATOM   2868  C CE1   . HIS B 2 79   ? 152.738 139.242 115.033 1.00 44.49  ? 71   HIS B CE1   1 
ATOM   2869  N NE2   . HIS B 2 79   ? 153.982 138.847 114.832 1.00 44.49  ? 71   HIS B NE2   1 
ATOM   2870  N N     . ASN B 2 80   ? 156.248 143.761 117.469 1.00 44.33  ? 72   ASN B N     1 
ATOM   2871  C CA    . ASN B 2 80   ? 157.481 143.719 118.253 1.00 44.33  ? 72   ASN B CA    1 
ATOM   2872  C C     . ASN B 2 80   ? 157.281 144.179 119.693 1.00 44.33  ? 72   ASN B C     1 
ATOM   2873  O O     . ASN B 2 80   ? 158.113 143.905 120.560 1.00 44.33  ? 72   ASN B O     1 
ATOM   2874  C CB    . ASN B 2 80   ? 158.555 144.589 117.595 1.00 44.33  ? 72   ASN B CB    1 
ATOM   2875  N N     . LEU B 2 81   ? 156.183 144.884 119.942 1.00 42.38  ? 73   LEU B N     1 
ATOM   2876  C CA    . LEU B 2 81   ? 155.886 145.374 121.282 1.00 42.38  ? 73   LEU B CA    1 
ATOM   2877  C C     . LEU B 2 81   ? 154.990 144.369 121.984 1.00 42.38  ? 73   LEU B C     1 
ATOM   2878  O O     . LEU B 2 81   ? 154.787 144.439 123.198 1.00 42.38  ? 73   LEU B O     1 
ATOM   2879  C CB    . LEU B 2 81   ? 155.187 146.733 121.206 1.00 42.38  ? 73   LEU B CB    1 
ATOM   2880  N N     . ARG B 2 82   ? 154.460 143.434 121.203 1.00 44.53  ? 74   ARG B N     1 
ATOM   2881  C CA    . ARG B 2 82   ? 153.585 142.392 121.723 1.00 44.53  ? 74   ARG B CA    1 
ATOM   2882  C C     . ARG B 2 82   ? 154.435 141.223 122.194 1.00 44.53  ? 74   ARG B C     1 
ATOM   2883  O O     . ARG B 2 82   ? 154.057 140.499 123.113 1.00 44.53  ? 74   ARG B O     1 
ATOM   2884  C CB    . ARG B 2 82   ? 152.616 141.931 120.636 1.00 44.53  ? 74   ARG B CB    1 
ATOM   2885  N N     . TRP B 2 83   ? 155.583 141.045 121.549 1.00 47.91  ? 75   TRP B N     1 
ATOM   2886  C CA    . TRP B 2 83   ? 156.509 139.980 121.905 1.00 47.91  ? 75   TRP B CA    1 
ATOM   2887  C C     . TRP B 2 83   ? 157.350 140.441 123.076 1.00 47.91  ? 75   TRP B C     1 
ATOM   2888  O O     . TRP B 2 83   ? 157.722 139.651 123.943 1.00 47.91  ? 75   TRP B O     1 
ATOM   2889  C CB    . TRP B 2 83   ? 157.435 139.642 120.733 1.00 47.91  ? 75   TRP B CB    1 
ATOM   2890  C CG    . TRP B 2 83   ? 156.914 138.573 119.830 1.00 47.91  ? 75   TRP B CG    1 
ATOM   2891  C CD1   . TRP B 2 83   ? 156.019 137.594 120.154 1.00 47.91  ? 75   TRP B CD1   1 
ATOM   2892  C CD2   . TRP B 2 83   ? 157.301 138.330 118.469 1.00 47.91  ? 75   TRP B CD2   1 
ATOM   2893  N NE1   . TRP B 2 83   ? 155.826 136.756 119.081 1.00 47.91  ? 75   TRP B NE1   1 
ATOM   2894  C CE2   . TRP B 2 83   ? 156.600 137.185 118.034 1.00 47.91  ? 75   TRP B CE2   1 
ATOM   2895  C CE3   . TRP B 2 83   ? 158.174 138.969 117.576 1.00 47.91  ? 75   TRP B CE3   1 
ATOM   2896  C CZ2   . TRP B 2 83   ? 156.742 136.662 116.743 1.00 47.91  ? 75   TRP B CZ2   1 
ATOM   2897  C CZ3   . TRP B 2 83   ? 158.316 138.448 116.291 1.00 47.91  ? 75   TRP B CZ3   1 
ATOM   2898  C CH2   . TRP B 2 83   ? 157.602 137.305 115.889 1.00 47.91  ? 75   TRP B CH2   1 
ATOM   2899  N N     . ILE B 2 84   ? 157.654 141.733 123.087 1.00 41.82  ? 76   ILE B N     1 
ATOM   2900  C CA    . ILE B 2 84   ? 158.463 142.319 124.144 1.00 41.82  ? 76   ILE B CA    1 
ATOM   2901  C C     . ILE B 2 84   ? 157.672 142.411 125.440 1.00 41.82  ? 76   ILE B C     1 
ATOM   2902  O O     . ILE B 2 84   ? 158.248 142.504 126.522 1.00 41.82  ? 76   ILE B O     1 
ATOM   2903  C CB    . ILE B 2 84   ? 158.941 143.727 123.757 1.00 41.82  ? 76   ILE B CB    1 
ATOM   2904  N N     . LEU B 2 85   ? 156.348 142.393 125.322 1.00 45.68  ? 77   LEU B N     1 
ATOM   2905  C CA    . LEU B 2 85   ? 155.483 142.470 126.490 1.00 45.68  ? 77   LEU B CA    1 
ATOM   2906  C C     . LEU B 2 85   ? 155.129 141.059 126.933 1.00 45.68  ? 77   LEU B C     1 
ATOM   2907  O O     . LEU B 2 85   ? 154.693 140.837 128.061 1.00 45.68  ? 77   LEU B O     1 
ATOM   2908  C CB    . LEU B 2 85   ? 154.207 143.248 126.159 1.00 45.68  ? 77   LEU B CB    1 
ATOM   2909  N N     . THR B 2 86   ? 155.327 140.107 126.028 1.00 47.43  ? 78   THR B N     1 
ATOM   2910  C CA    . THR B 2 86   ? 155.040 138.704 126.304 1.00 47.43  ? 78   THR B CA    1 
ATOM   2911  C C     . THR B 2 86   ? 156.265 138.069 126.945 1.00 47.43  ? 78   THR B C     1 
ATOM   2912  O O     . THR B 2 86   ? 156.168 137.045 127.622 1.00 47.43  ? 78   THR B O     1 
ATOM   2913  C CB    . THR B 2 86   ? 154.698 137.946 125.011 1.00 47.43  ? 78   THR B CB    1 
ATOM   2914  N N     . PHE B 2 87   ? 157.417 138.692 126.716 1.00 53.06  ? 79   PHE B N     1 
ATOM   2915  C CA    . PHE B 2 87   ? 158.680 138.225 127.265 1.00 53.06  ? 79   PHE B CA    1 
ATOM   2916  C C     . PHE B 2 87   ? 158.922 138.874 128.616 1.00 53.06  ? 79   PHE B C     1 
ATOM   2917  O O     . PHE B 2 87   ? 159.458 138.249 129.532 1.00 53.06  ? 79   PHE B O     1 
ATOM   2918  C CB    . PHE B 2 87   ? 159.825 138.566 126.310 1.00 53.06  ? 79   PHE B CB    1 
ATOM   2919  C CG    . PHE B 2 87   ? 160.180 137.450 125.376 1.00 53.06  ? 79   PHE B CG    1 
ATOM   2920  C CD1   . PHE B 2 87   ? 161.013 136.422 125.797 1.00 53.06  ? 79   PHE B CD1   1 
ATOM   2921  C CD2   . PHE B 2 87   ? 159.647 137.400 124.092 1.00 53.06  ? 79   PHE B CD2   1 
ATOM   2922  C CE1   . PHE B 2 87   ? 161.315 135.358 124.956 1.00 53.06  ? 79   PHE B CE1   1 
ATOM   2923  C CE2   . PHE B 2 87   ? 159.942 136.337 123.240 1.00 53.06  ? 79   PHE B CE2   1 
ATOM   2924  C CZ    . PHE B 2 87   ? 160.776 135.314 123.674 1.00 53.06  ? 79   PHE B CZ    1 
ATOM   2925  N N     . ILE B 2 88   ? 158.511 140.132 128.737 1.00 47.44  ? 80   ILE B N     1 
ATOM   2926  C CA    . ILE B 2 88   ? 158.682 140.886 129.975 1.00 47.44  ? 80   ILE B CA    1 
ATOM   2927  C C     . ILE B 2 88   ? 157.669 140.453 131.024 1.00 47.44  ? 80   ILE B C     1 
ATOM   2928  O O     . ILE B 2 88   ? 157.865 140.687 132.217 1.00 47.44  ? 80   ILE B O     1 
ATOM   2929  C CB    . ILE B 2 88   ? 158.521 142.395 129.730 1.00 47.44  ? 80   ILE B CB    1 
ATOM   2930  N N     . LEU B 2 89   ? 156.583 139.835 130.571 1.00 48.37  ? 81   LEU B N     1 
ATOM   2931  C CA    . LEU B 2 89   ? 155.542 139.358 131.470 1.00 48.37  ? 81   LEU B CA    1 
ATOM   2932  C C     . LEU B 2 89   ? 155.949 137.978 131.973 1.00 48.37  ? 81   LEU B C     1 
ATOM   2933  O O     . LEU B 2 89   ? 155.366 137.449 132.920 1.00 48.37  ? 81   LEU B O     1 
ATOM   2934  C CB    . LEU B 2 89   ? 154.201 139.280 130.737 1.00 48.37  ? 81   LEU B CB    1 
ATOM   2935  N N     . LEU B 2 90   ? 156.958 137.409 131.320 1.00 55.78  ? 82   LEU B N     1 
ATOM   2936  C CA    . LEU B 2 90   ? 157.487 136.098 131.677 1.00 55.78  ? 82   LEU B CA    1 
ATOM   2937  C C     . LEU B 2 90   ? 158.470 136.314 132.818 1.00 55.78  ? 82   LEU B C     1 
ATOM   2938  O O     . LEU B 2 90   ? 158.532 135.530 133.764 1.00 55.78  ? 82   LEU B O     1 
ATOM   2939  C CB    . LEU B 2 90   ? 158.211 135.479 130.479 1.00 55.78  ? 82   LEU B CB    1 
ATOM   2940  C CG    . LEU B 2 90   ? 158.654 134.019 130.609 1.00 55.78  ? 82   LEU B CG    1 
ATOM   2941  C CD1   . LEU B 2 90   ? 157.423 133.131 130.673 1.00 55.78  ? 82   LEU B CD1   1 
ATOM   2942  C CD2   . LEU B 2 90   ? 159.530 133.625 129.427 1.00 55.78  ? 82   LEU B CD2   1 
ATOM   2943  N N     . PHE B 2 91   ? 159.233 137.396 132.711 1.00 58.26  ? 83   PHE B N     1 
ATOM   2944  C CA    . PHE B 2 91   ? 160.218 137.763 133.719 1.00 58.26  ? 83   PHE B CA    1 
ATOM   2945  C C     . PHE B 2 91   ? 159.510 138.236 134.977 1.00 58.26  ? 83   PHE B C     1 
ATOM   2946  O O     . PHE B 2 91   ? 160.046 138.144 136.082 1.00 58.26  ? 83   PHE B O     1 
ATOM   2947  C CB    . PHE B 2 91   ? 161.124 138.872 133.182 1.00 58.26  ? 83   PHE B CB    1 
ATOM   2948  C CG    . PHE B 2 91   ? 162.209 138.373 132.276 1.00 58.26  ? 83   PHE B CG    1 
ATOM   2949  C CD1   . PHE B 2 91   ? 163.238 137.590 132.784 1.00 58.26  ? 83   PHE B CD1   1 
ATOM   2950  C CD2   . PHE B 2 91   ? 162.201 138.671 130.916 1.00 58.26  ? 83   PHE B CD2   1 
ATOM   2951  C CE1   . PHE B 2 91   ? 164.243 137.105 131.956 1.00 58.26  ? 83   PHE B CE1   1 
ATOM   2952  C CE2   . PHE B 2 91   ? 163.205 138.190 130.076 1.00 58.26  ? 83   PHE B CE2   1 
ATOM   2953  C CZ    . PHE B 2 91   ? 164.228 137.405 130.599 1.00 58.26  ? 83   PHE B CZ    1 
ATOM   2954  N N     . VAL B 2 92   ? 158.294 138.738 134.796 1.00 52.93  ? 84   VAL B N     1 
ATOM   2955  C CA    . VAL B 2 92   ? 157.488 139.236 135.905 1.00 52.93  ? 84   VAL B CA    1 
ATOM   2956  C C     . VAL B 2 92   ? 156.672 138.112 136.529 1.00 52.93  ? 84   VAL B C     1 
ATOM   2957  O O     . VAL B 2 92   ? 156.186 138.241 137.651 1.00 52.93  ? 84   VAL B O     1 
ATOM   2958  C CB    . VAL B 2 92   ? 156.522 140.340 135.435 1.00 52.93  ? 84   VAL B CB    1 
ATOM   2959  N N     . LEU B 2 93   ? 156.517 137.015 135.793 1.00 51.27  ? 85   LEU B N     1 
ATOM   2960  C CA    . LEU B 2 93   ? 155.761 135.871 136.288 1.00 51.27  ? 85   LEU B CA    1 
ATOM   2961  C C     . LEU B 2 93   ? 156.704 134.953 137.061 1.00 51.27  ? 85   LEU B C     1 
ATOM   2962  O O     . LEU B 2 93   ? 156.269 134.141 137.883 1.00 51.27  ? 85   LEU B O     1 
ATOM   2963  C CB    . LEU B 2 93   ? 155.117 135.116 135.123 1.00 51.27  ? 85   LEU B CB    1 
ATOM   2964  N N     . VAL B 2 94   ? 157.960 134.941 136.627 1.00 51.77  ? 86   VAL B N     1 
ATOM   2965  C CA    . VAL B 2 94   ? 158.997 134.190 137.313 1.00 51.77  ? 86   VAL B CA    1 
ATOM   2966  C C     . VAL B 2 94   ? 159.272 134.869 138.648 1.00 51.77  ? 86   VAL B C     1 
ATOM   2967  O O     . VAL B 2 94   ? 159.441 134.221 139.677 1.00 51.77  ? 86   VAL B O     1 
ATOM   2968  C CB    . VAL B 2 94   ? 160.296 134.139 136.491 1.00 51.77  ? 86   VAL B CB    1 
ATOM   2969  N N     . CYS B 2 95   ? 159.327 136.197 138.599 1.00 53.24  ? 87   CYS B N     1 
ATOM   2970  C CA    . CYS B 2 95   ? 159.593 137.019 139.774 1.00 53.24  ? 87   CYS B CA    1 
ATOM   2971  C C     . CYS B 2 95   ? 158.511 136.951 140.846 1.00 53.24  ? 87   CYS B C     1 
ATOM   2972  O O     . CYS B 2 95   ? 158.814 136.871 142.036 1.00 53.24  ? 87   CYS B O     1 
ATOM   2973  C CB    . CYS B 2 95   ? 159.818 138.476 139.360 1.00 53.24  ? 87   CYS B CB    1 
ATOM   2974  N N     . GLU B 2 96   ? 157.251 136.977 140.425 1.00 50.47  ? 88   GLU B N     1 
ATOM   2975  C CA    . GLU B 2 96   ? 156.151 136.936 141.378 1.00 50.47  ? 88   GLU B CA    1 
ATOM   2976  C C     . GLU B 2 96   ? 156.168 135.628 142.150 1.00 50.47  ? 88   GLU B C     1 
ATOM   2977  O O     . GLU B 2 96   ? 155.987 135.610 143.367 1.00 50.47  ? 88   GLU B O     1 
ATOM   2978  C CB    . GLU B 2 96   ? 154.812 137.105 140.658 1.00 50.47  ? 88   GLU B CB    1 
ATOM   2979  N N     . ILE B 2 97   ? 156.362 134.539 141.411 1.00 55.97  ? 89   ILE B N     1 
ATOM   2980  C CA    . ILE B 2 97   ? 156.435 133.193 141.967 1.00 55.97  ? 89   ILE B CA    1 
ATOM   2981  C C     . ILE B 2 97   ? 157.637 133.026 142.891 1.00 55.97  ? 89   ILE B C     1 
ATOM   2982  O O     . ILE B 2 97   ? 157.551 132.367 143.928 1.00 55.97  ? 89   ILE B O     1 
ATOM   2983  C CB    . ILE B 2 97   ? 156.479 132.122 140.859 1.00 55.97  ? 89   ILE B CB    1 
ATOM   2984  C CG1   . ILE B 2 97   ? 155.160 132.106 140.086 1.00 55.97  ? 89   ILE B CG1   1 
ATOM   2985  C CG2   . ILE B 2 97   ? 156.771 130.749 141.449 1.00 55.97  ? 89   ILE B CG2   1 
ATOM   2986  C CD1   . ILE B 2 97   ? 155.207 131.277 138.821 1.00 55.97  ? 89   ILE B CD1   1 
ATOM   2987  N N     . ALA B 2 98   ? 158.760 133.631 142.510 1.00 47.92  ? 90   ALA B N     1 
ATOM   2988  C CA    . ALA B 2 98   ? 159.990 133.545 143.292 1.00 47.92  ? 90   ALA B CA    1 
ATOM   2989  C C     . ALA B 2 98   ? 159.794 134.153 144.674 1.00 47.92  ? 90   ALA B C     1 
ATOM   2990  O O     . ALA B 2 98   ? 160.274 133.614 145.671 1.00 47.92  ? 90   ALA B O     1 
ATOM   2991  C CB    . ALA B 2 98   ? 161.131 134.236 142.562 1.00 47.92  ? 90   ALA B CB    1 
ATOM   2992  N N     . GLU B 2 99   ? 159.155 135.318 144.698 1.00 51.02  ? 91   GLU B N     1 
ATOM   2993  C CA    . GLU B 2 99   ? 158.813 136.000 145.938 1.00 51.02  ? 91   GLU B CA    1 
ATOM   2994  C C     . GLU B 2 99   ? 157.793 135.151 146.689 1.00 51.02  ? 91   GLU B C     1 
ATOM   2995  O O     . GLU B 2 99   ? 157.837 135.028 147.913 1.00 51.02  ? 91   GLU B O     1 
ATOM   2996  C CB    . GLU B 2 99   ? 158.240 137.387 145.651 1.00 51.02  ? 91   GLU B CB    1 
ATOM   2997  N N     . GLY B 2 100  ? 156.873 134.565 145.925 1.00 44.99  ? 92   GLY B N     1 
ATOM   2998  C CA    . GLY B 2 100  ? 155.812 133.730 146.455 1.00 44.99  ? 92   GLY B CA    1 
ATOM   2999  C C     . GLY B 2 100  ? 156.336 132.499 147.164 1.00 44.99  ? 92   GLY B C     1 
ATOM   3000  O O     . GLY B 2 100  ? 155.796 132.090 148.191 1.00 44.99  ? 92   GLY B O     1 
ATOM   3001  N N     . ILE B 2 101  ? 157.394 131.906 146.619 1.00 40.78  ? 93   ILE B N     1 
ATOM   3002  C CA    . ILE B 2 101  ? 157.989 130.716 147.217 1.00 40.78  ? 93   ILE B CA    1 
ATOM   3003  C C     . ILE B 2 101  ? 158.512 131.027 148.616 1.00 40.78  ? 93   ILE B C     1 
ATOM   3004  O O     . ILE B 2 101  ? 158.349 130.229 149.538 1.00 40.78  ? 93   ILE B O     1 
ATOM   3005  C CB    . ILE B 2 101  ? 159.145 130.171 146.360 1.00 40.78  ? 93   ILE B CB    1 
ATOM   3006  C CG1   . ILE B 2 101  ? 158.640 129.785 144.969 1.00 40.78  ? 93   ILE B CG1   1 
ATOM   3007  C CG2   . ILE B 2 101  ? 159.798 128.979 147.043 1.00 40.78  ? 93   ILE B CG2   1 
ATOM   3008  C CD1   . ILE B 2 101  ? 157.560 128.725 144.985 1.00 40.78  ? 93   ILE B CD1   1 
ATOM   3009  N N     . LEU B 2 102  ? 159.139 132.188 148.769 1.00 45.90  ? 94   LEU B N     1 
ATOM   3010  C CA    . LEU B 2 102  ? 159.692 132.582 150.059 1.00 45.90  ? 94   LEU B CA    1 
ATOM   3011  C C     . LEU B 2 102  ? 158.605 132.729 151.119 1.00 45.90  ? 94   LEU B C     1 
ATOM   3012  O O     . LEU B 2 102  ? 158.784 132.314 152.264 1.00 45.90  ? 94   LEU B O     1 
ATOM   3013  C CB    . LEU B 2 102  ? 160.471 133.891 149.925 1.00 45.90  ? 94   LEU B CB    1 
ATOM   3014  C CG    . LEU B 2 102  ? 161.135 134.419 151.198 1.00 45.90  ? 94   LEU B CG    1 
ATOM   3015  C CD1   . LEU B 2 102  ? 162.096 133.387 151.768 1.00 45.90  ? 94   LEU B CD1   1 
ATOM   3016  C CD2   . LEU B 2 102  ? 161.852 135.732 150.924 1.00 45.90  ? 94   LEU B CD2   1 
ATOM   3017  N N     . SER B 2 103  ? 157.480 133.319 150.732 1.00 59.24  ? 95   SER B N     1 
ATOM   3018  C CA    . SER B 2 103  ? 156.368 133.519 151.654 1.00 59.24  ? 95   SER B CA    1 
ATOM   3019  C C     . SER B 2 103  ? 155.789 132.196 152.146 1.00 59.24  ? 95   SER B C     1 
ATOM   3020  O O     . SER B 2 103  ? 155.467 132.047 153.325 1.00 59.24  ? 95   SER B O     1 
ATOM   3021  C CB    . SER B 2 103  ? 155.272 134.358 150.994 1.00 59.24  ? 95   SER B CB    1 
ATOM   3022  O OG    . SER B 2 103  ? 154.176 134.549 151.872 1.00 59.24  ? 95   SER B OG    1 
ATOM   3023  N N     . ASP B 2 104  ? 155.662 131.237 151.234 1.00 57.34  ? 96   ASP B N     1 
ATOM   3024  C CA    . ASP B 2 104  ? 155.114 129.926 151.562 1.00 57.34  ? 96   ASP B CA    1 
ATOM   3025  C C     . ASP B 2 104  ? 155.971 129.169 152.572 1.00 57.34  ? 96   ASP B C     1 
ATOM   3026  O O     . ASP B 2 104  ? 155.453 128.514 153.476 1.00 57.34  ? 96   ASP B O     1 
ATOM   3027  C CB    . ASP B 2 104  ? 154.941 129.088 150.293 1.00 57.34  ? 96   ASP B CB    1 
ATOM   3028  N N     . GLY B 2 105  ? 157.286 129.265 152.410 1.00 56.43  ? 97   GLY B N     1 
ATOM   3029  C CA    . GLY B 2 105  ? 158.219 128.579 153.285 1.00 56.43  ? 97   GLY B CA    1 
ATOM   3030  C C     . GLY B 2 105  ? 158.174 129.004 154.740 1.00 56.43  ? 97   GLY B C     1 
ATOM   3031  O O     . GLY B 2 105  ? 158.268 128.167 155.637 1.00 56.43  ? 97   GLY B O     1 
ATOM   3032  N N     . VAL B 2 106  ? 158.030 130.303 154.981 1.00 59.81  ? 98   VAL B N     1 
ATOM   3033  C CA    . VAL B 2 106  ? 157.997 130.815 156.350 1.00 59.81  ? 98   VAL B CA    1 
ATOM   3034  C C     . VAL B 2 106  ? 157.878 129.650 157.332 1.00 59.81  ? 98   VAL B C     1 
ATOM   3035  O O     . VAL B 2 106  ? 158.125 129.799 158.531 1.00 59.81  ? 98   VAL B O     1 
ATOM   3036  C CB    . VAL B 2 106  ? 156.812 131.775 156.551 1.00 59.81  ? 98   VAL B CB    1 
ATOM   3037  N N     . THR B 2 107  ? 157.472 128.498 156.806 1.00 66.56  ? 99   THR B N     1 
ATOM   3038  C CA    . THR B 2 107  ? 157.330 127.270 157.583 1.00 66.56  ? 99   THR B CA    1 
ATOM   3039  C C     . THR B 2 107  ? 156.364 127.284 158.770 1.00 66.56  ? 99   THR B C     1 
ATOM   3040  O O     . THR B 2 107  ? 156.587 126.581 159.757 1.00 66.56  ? 99   THR B O     1 
ATOM   3041  C CB    . THR B 2 107  ? 158.708 126.785 158.084 1.00 66.56  ? 99   THR B CB    1 
ATOM   3042  N N     . GLU B 2 108  ? 155.297 128.073 158.689 1.00 61.97  ? 100  GLU B N     1 
ATOM   3043  C CA    . GLU B 2 108  ? 154.329 128.104 159.783 1.00 61.97  ? 100  GLU B CA    1 
ATOM   3044  C C     . GLU B 2 108  ? 153.035 127.448 159.313 1.00 61.97  ? 100  GLU B C     1 
ATOM   3045  O O     . GLU B 2 108  ? 152.548 126.488 159.912 1.00 61.97  ? 100  GLU B O     1 
ATOM   3046  C CB    . GLU B 2 108  ? 154.046 129.550 160.204 1.00 61.97  ? 100  GLU B CB    1 
ATOM   3047  N N     . SER B 2 109  ? 152.506 127.970 158.214 1.00 64.24  ? 101  SER B N     1 
ATOM   3048  C CA    . SER B 2 109  ? 151.289 127.467 157.600 1.00 64.24  ? 101  SER B CA    1 
ATOM   3049  C C     . SER B 2 109  ? 151.409 127.792 156.121 1.00 64.24  ? 101  SER B C     1 
ATOM   3050  O O     . SER B 2 109  ? 151.955 128.831 155.754 1.00 64.24  ? 101  SER B O     1 
ATOM   3051  C CB    . SER B 2 109  ? 150.057 128.154 158.197 1.00 64.24  ? 101  SER B CB    1 
ATOM   3052  N N     . ARG B 2 110  ? 150.910 126.902 155.270 1.00 54.87  ? 102  ARG B N     1 
ATOM   3053  C CA    . ARG B 2 110  ? 150.986 127.123 153.833 1.00 54.87  ? 102  ARG B CA    1 
ATOM   3054  C C     . ARG B 2 110  ? 149.757 127.860 153.309 1.00 54.87  ? 102  ARG B C     1 
ATOM   3055  O O     . ARG B 2 110  ? 148.671 127.285 153.213 1.00 54.87  ? 102  ARG B O     1 
ATOM   3056  C CB    . ARG B 2 110  ? 151.150 125.788 153.101 1.00 54.87  ? 102  ARG B CB    1 
ATOM   3057  N N     . HIS B 2 111  ? 149.936 129.138 152.979 1.00 46.96  ? 103  HIS B N     1 
ATOM   3058  C CA    . HIS B 2 111  ? 148.846 129.960 152.457 1.00 46.96  ? 103  HIS B CA    1 
ATOM   3059  C C     . HIS B 2 111  ? 148.748 129.725 150.953 1.00 46.96  ? 103  HIS B C     1 
ATOM   3060  O O     . HIS B 2 111  ? 149.608 130.163 150.191 1.00 46.96  ? 103  HIS B O     1 
ATOM   3061  C CB    . HIS B 2 111  ? 149.106 131.442 152.747 1.00 46.96  ? 103  HIS B CB    1 
ATOM   3062  N N     . LEU B 2 112  ? 147.697 129.024 150.539 1.00 42.66  ? 104  LEU B N     1 
ATOM   3063  C CA    . LEU B 2 112  ? 147.484 128.699 149.132 1.00 42.66  ? 104  LEU B CA    1 
ATOM   3064  C C     . LEU B 2 112  ? 147.098 129.886 148.251 1.00 42.66  ? 104  LEU B C     1 
ATOM   3065  O O     . LEU B 2 112  ? 147.451 129.926 147.070 1.00 42.66  ? 104  LEU B O     1 
ATOM   3066  C CB    . LEU B 2 112  ? 146.413 127.611 149.001 1.00 42.66  ? 104  LEU B CB    1 
ATOM   3067  N N     . HIS B 2 113  ? 146.382 130.854 148.816 1.00 48.18  ? 105  HIS B N     1 
ATOM   3068  C CA    . HIS B 2 113  ? 145.941 132.013 148.041 1.00 48.18  ? 105  HIS B CA    1 
ATOM   3069  C C     . HIS B 2 113  ? 146.944 133.164 148.010 1.00 48.18  ? 105  HIS B C     1 
ATOM   3070  O O     . HIS B 2 113  ? 146.574 134.312 147.754 1.00 48.18  ? 105  HIS B O     1 
ATOM   3071  C CB    . HIS B 2 113  ? 144.595 132.511 148.574 1.00 48.18  ? 105  HIS B CB    1 
ATOM   3072  N N     . LEU B 2 114  ? 148.214 132.853 148.243 1.00 29.05  ? 106  LEU B N     1 
ATOM   3073  C CA    . LEU B 2 114  ? 149.251 133.877 148.246 1.00 29.05  ? 106  LEU B CA    1 
ATOM   3074  C C     . LEU B 2 114  ? 150.100 133.850 146.981 1.00 29.05  ? 106  LEU B C     1 
ATOM   3075  O O     . LEU B 2 114  ? 150.570 134.890 146.515 1.00 29.05  ? 106  LEU B O     1 
ATOM   3076  C CB    . LEU B 2 114  ? 150.150 133.702 149.471 1.00 29.05  ? 106  LEU B CB    1 
ATOM   3077  N N     . TYR B 2 115  ? 150.310 132.653 146.443 1.00 35.90  ? 107  TYR B N     1 
ATOM   3078  C CA    . TYR B 2 115  ? 151.108 132.473 145.235 1.00 35.90  ? 107  TYR B CA    1 
ATOM   3079  C C     . TYR B 2 115  ? 150.300 131.997 144.030 1.00 35.90  ? 107  TYR B C     1 
ATOM   3080  O O     . TYR B 2 115  ? 150.862 131.733 142.966 1.00 35.90  ? 107  TYR B O     1 
ATOM   3081  C CB    . TYR B 2 115  ? 152.235 131.475 145.501 1.00 35.90  ? 107  TYR B CB    1 
ATOM   3082  C CG    . TYR B 2 115  ? 151.771 130.176 146.119 1.00 35.90  ? 107  TYR B CG    1 
ATOM   3083  C CD1   . TYR B 2 115  ? 151.640 130.047 147.500 1.00 35.90  ? 107  TYR B CD1   1 
ATOM   3084  C CD2   . TYR B 2 115  ? 151.442 129.080 145.322 1.00 35.90  ? 107  TYR B CD2   1 
ATOM   3085  C CE1   . TYR B 2 115  ? 151.195 128.857 148.076 1.00 35.90  ? 107  TYR B CE1   1 
ATOM   3086  C CE2   . TYR B 2 115  ? 150.992 127.883 145.886 1.00 35.90  ? 107  TYR B CE2   1 
ATOM   3087  C CZ    . TYR B 2 115  ? 150.872 127.779 147.263 1.00 35.90  ? 107  TYR B CZ    1 
ATOM   3088  O OH    . TYR B 2 115  ? 150.426 126.604 147.826 1.00 35.90  ? 107  TYR B OH    1 
ATOM   3089  N N     . MET B 2 116  ? 148.986 131.883 144.193 1.00 52.44  ? 108  MET B N     1 
ATOM   3090  C CA    . MET B 2 116  ? 148.122 131.419 143.110 1.00 52.44  ? 108  MET B CA    1 
ATOM   3091  C C     . MET B 2 116  ? 147.961 132.401 141.947 1.00 52.44  ? 108  MET B C     1 
ATOM   3092  O O     . MET B 2 116  ? 147.916 131.987 140.790 1.00 52.44  ? 108  MET B O     1 
ATOM   3093  C CB    . MET B 2 116  ? 146.741 131.062 143.661 1.00 52.44  ? 108  MET B CB    1 
ATOM   3094  N N     . PRO B 2 117  ? 147.860 133.711 142.238 1.00 74.90  ? 109  PRO B N     1 
ATOM   3095  C CA    . PRO B 2 117  ? 147.700 134.704 141.171 1.00 74.90  ? 109  PRO B CA    1 
ATOM   3096  C C     . PRO B 2 117  ? 148.845 134.736 140.167 1.00 74.90  ? 109  PRO B C     1 
ATOM   3097  O O     . PRO B 2 117  ? 148.678 135.198 139.039 1.00 74.90  ? 109  PRO B O     1 
ATOM   3098  C CB    . PRO B 2 117  ? 147.582 136.016 141.940 1.00 74.90  ? 109  PRO B CB    1 
ATOM   3099  C CG    . PRO B 2 117  ? 146.917 135.596 143.206 1.00 74.90  ? 109  PRO B CG    1 
ATOM   3100  C CD    . PRO B 2 117  ? 147.697 134.350 143.555 1.00 74.90  ? 109  PRO B CD    1 
ATOM   3101  N N     . ALA B 2 118  ? 150.007 134.244 140.581 1.00 89.91  ? 110  ALA B N     1 
ATOM   3102  C CA    . ALA B 2 118  ? 151.183 134.238 139.720 1.00 89.91  ? 110  ALA B CA    1 
ATOM   3103  C C     . ALA B 2 118  ? 151.237 133.020 138.810 1.00 89.91  ? 110  ALA B C     1 
ATOM   3104  O O     . ALA B 2 118  ? 151.822 133.070 137.726 1.00 89.91  ? 110  ALA B O     1 
ATOM   3105  C CB    . ALA B 2 118  ? 152.440 134.301 140.568 1.00 89.91  ? 110  ALA B CB    1 
ATOM   3106  N N     . GLY B 2 119  ? 150.630 131.928 139.259 1.00 89.46  ? 111  GLY B N     1 
ATOM   3107  C CA    . GLY B 2 119  ? 150.631 130.709 138.475 1.00 89.46  ? 111  GLY B CA    1 
ATOM   3108  C C     . GLY B 2 119  ? 149.536 130.694 137.430 1.00 89.46  ? 111  GLY B C     1 
ATOM   3109  O O     . GLY B 2 119  ? 149.603 129.932 136.465 1.00 89.46  ? 111  GLY B O     1 
ATOM   3110  N N     . MET B 2 120  ? 148.456 131.421 137.692 1.00 94.68  ? 112  MET B N     1 
ATOM   3111  C CA    . MET B 2 120  ? 147.368 131.555 136.728 1.00 94.68  ? 112  MET B CA    1 
ATOM   3112  C C     . MET B 2 120  ? 147.828 132.376 135.521 1.00 94.68  ? 112  MET B C     1 
ATOM   3113  O O     . MET B 2 120  ? 147.520 132.068 134.361 1.00 94.68  ? 112  MET B O     1 
ATOM   3114  C CB    . MET B 2 120  ? 146.150 132.211 137.381 1.00 94.68  ? 112  MET B CB    1 
ATOM   3115  N N     . ALA B 2 121  ? 148.593 133.420 135.826 1.00 96.20  ? 113  ALA B N     1 
ATOM   3116  C CA    . ALA B 2 121  ? 149.098 134.362 134.832 1.00 96.20  ? 113  ALA B CA    1 
ATOM   3117  C C     . ALA B 2 121  ? 150.022 133.740 133.796 1.00 96.20  ? 113  ALA B C     1 
ATOM   3118  O O     . ALA B 2 121  ? 149.950 134.084 132.616 1.00 96.20  ? 113  ALA B O     1 
ATOM   3119  C CB    . ALA B 2 121  ? 149.787 135.532 135.520 1.00 96.20  ? 113  ALA B CB    1 
ATOM   3120  N N     . PHE B 2 122  ? 150.893 132.833 134.225 1.00 70.01  ? 114  PHE B N     1 
ATOM   3121  C CA    . PHE B 2 122  ? 151.811 132.209 133.284 1.00 70.01  ? 114  PHE B CA    1 
ATOM   3122  C C     . PHE B 2 122  ? 151.026 131.438 132.231 1.00 70.01  ? 114  PHE B C     1 
ATOM   3123  O O     . PHE B 2 122  ? 151.329 131.516 131.040 1.00 70.01  ? 114  PHE B O     1 
ATOM   3124  C CB    . PHE B 2 122  ? 152.773 131.272 134.015 1.00 70.01  ? 114  PHE B CB    1 
ATOM   3125  N N     . MET B 2 123  ? 150.014 130.696 132.670 1.00 61.52  ? 115  MET B N     1 
ATOM   3126  C CA    . MET B 2 123  ? 149.177 129.950 131.744 1.00 61.52  ? 115  MET B CA    1 
ATOM   3127  C C     . MET B 2 123  ? 148.408 130.912 130.842 1.00 61.52  ? 115  MET B C     1 
ATOM   3128  O O     . MET B 2 123  ? 148.297 130.695 129.635 1.00 61.52  ? 115  MET B O     1 
ATOM   3129  C CB    . MET B 2 123  ? 148.203 129.051 132.506 1.00 61.52  ? 115  MET B CB    1 
ATOM   3130  N N     . ALA B 2 124  ? 147.884 131.979 131.440 1.00 89.46  ? 116  ALA B N     1 
ATOM   3131  C CA    . ALA B 2 124  ? 147.116 132.980 130.698 1.00 89.46  ? 116  ALA B CA    1 
ATOM   3132  C C     . ALA B 2 124  ? 147.919 133.750 129.644 1.00 89.46  ? 116  ALA B C     1 
ATOM   3133  O O     . ALA B 2 124  ? 147.439 133.995 128.538 1.00 89.46  ? 116  ALA B O     1 
ATOM   3134  C CB    . ALA B 2 124  ? 146.449 133.950 131.664 1.00 89.46  ? 116  ALA B CB    1 
ATOM   3135  N N     . ALA B 2 125  ? 149.144 134.117 130.000 1.00 46.93  ? 117  ALA B N     1 
ATOM   3136  C CA    . ALA B 2 125  ? 150.023 134.885 129.132 1.00 46.93  ? 117  ALA B CA    1 
ATOM   3137  C C     . ALA B 2 125  ? 150.509 133.963 128.032 1.00 46.93  ? 117  ALA B C     1 
ATOM   3138  O O     . ALA B 2 125  ? 150.870 134.407 126.942 1.00 46.93  ? 117  ALA B O     1 
ATOM   3139  C CB    . ALA B 2 125  ? 151.200 135.418 129.923 1.00 46.93  ? 117  ALA B CB    1 
ATOM   3140  N N     . ILE B 2 126  ? 150.520 132.670 128.336 1.00 42.37  ? 118  ILE B N     1 
ATOM   3141  C CA    . ILE B 2 126  ? 150.949 131.664 127.381 1.00 42.37  ? 118  ILE B CA    1 
ATOM   3142  C C     . ILE B 2 126  ? 149.776 131.379 126.461 1.00 42.37  ? 118  ILE B C     1 
ATOM   3143  O O     . ILE B 2 126  ? 149.952 130.942 125.326 1.00 42.37  ? 118  ILE B O     1 
ATOM   3144  C CB    . ILE B 2 126  ? 151.353 130.361 128.088 1.00 42.37  ? 118  ILE B CB    1 
ATOM   3145  N N     . THR B 2 127  ? 148.576 131.633 126.969 1.00 40.62  ? 119  THR B N     1 
ATOM   3146  C CA    . THR B 2 127  ? 147.358 131.414 126.204 1.00 40.62  ? 119  THR B CA    1 
ATOM   3147  C C     . THR B 2 127  ? 147.112 132.633 125.332 1.00 40.62  ? 119  THR B C     1 
ATOM   3148  O O     . THR B 2 127  ? 146.404 132.560 124.328 1.00 40.62  ? 119  THR B O     1 
ATOM   3149  C CB    . THR B 2 127  ? 146.148 131.218 127.131 1.00 40.62  ? 119  THR B CB    1 
ATOM   3150  N N     . SER B 2 128  ? 147.699 133.756 125.731 1.00 36.96  ? 120  SER B N     1 
ATOM   3151  C CA    . SER B 2 128  ? 147.557 135.002 124.991 1.00 36.96  ? 120  SER B CA    1 
ATOM   3152  C C     . SER B 2 128  ? 148.473 134.969 123.778 1.00 36.96  ? 120  SER B C     1 
ATOM   3153  O O     . SER B 2 128  ? 148.228 135.648 122.781 1.00 36.96  ? 120  SER B O     1 
ATOM   3154  C CB    . SER B 2 128  ? 147.927 136.187 125.883 1.00 36.96  ? 120  SER B CB    1 
ATOM   3155  N N     . VAL B 2 129  ? 149.530 134.171 123.876 1.00 36.82  ? 121  VAL B N     1 
ATOM   3156  C CA    . VAL B 2 129  ? 150.494 134.039 122.795 1.00 36.82  ? 121  VAL B CA    1 
ATOM   3157  C C     . VAL B 2 129  ? 149.941 133.107 121.725 1.00 36.82  ? 121  VAL B C     1 
ATOM   3158  O O     . VAL B 2 129  ? 150.333 133.179 120.558 1.00 36.82  ? 121  VAL B O     1 
ATOM   3159  C CB    . VAL B 2 129  ? 151.828 133.482 123.317 1.00 36.82  ? 121  VAL B CB    1 
ATOM   3160  N N     . VAL B 2 130  ? 149.025 132.233 122.136 1.00 38.22  ? 122  VAL B N     1 
ATOM   3161  C CA    . VAL B 2 130  ? 148.391 131.279 121.231 1.00 38.22  ? 122  VAL B CA    1 
ATOM   3162  C C     . VAL B 2 130  ? 147.200 131.947 120.553 1.00 38.22  ? 122  VAL B C     1 
ATOM   3163  O O     . VAL B 2 130  ? 146.718 131.491 119.514 1.00 38.22  ? 122  VAL B O     1 
ATOM   3164  C CB    . VAL B 2 130  ? 147.884 130.039 121.994 1.00 38.22  ? 122  VAL B CB    1 
ATOM   3165  C CG1   . VAL B 2 130  ? 147.284 129.034 121.023 1.00 38.22  ? 122  VAL B CG1   1 
ATOM   3166  C CG2   . VAL B 2 130  ? 149.019 129.411 122.781 1.00 38.22  ? 122  VAL B CG2   1 
ATOM   3167  N N     . TYR B 2 131  ? 146.731 133.033 121.160 1.00 37.43  ? 123  TYR B N     1 
ATOM   3168  C CA    . TYR B 2 131  ? 145.603 133.797 120.644 1.00 37.43  ? 123  TYR B CA    1 
ATOM   3169  C C     . TYR B 2 131  ? 146.108 134.736 119.561 1.00 37.43  ? 123  TYR B C     1 
ATOM   3170  O O     . TYR B 2 131  ? 145.383 135.096 118.633 1.00 37.43  ? 123  TYR B O     1 
ATOM   3171  C CB    . TYR B 2 131  ? 144.972 134.609 121.773 1.00 37.43  ? 123  TYR B CB    1 
ATOM   3172  C CG    . TYR B 2 131  ? 143.551 134.216 122.089 1.00 37.43  ? 123  TYR B CG    1 
ATOM   3173  C CD1   . TYR B 2 131  ? 142.535 134.399 121.154 1.00 37.43  ? 123  TYR B CD1   1 
ATOM   3174  C CD2   . TYR B 2 131  ? 143.220 133.660 123.323 1.00 37.43  ? 123  TYR B CD2   1 
ATOM   3175  C CE1   . TYR B 2 131  ? 141.224 134.038 121.436 1.00 37.43  ? 123  TYR B CE1   1 
ATOM   3176  C CE2   . TYR B 2 131  ? 141.913 133.295 123.618 1.00 37.43  ? 123  TYR B CE2   1 
ATOM   3177  C CZ    . TYR B 2 131  ? 140.920 133.487 122.669 1.00 37.43  ? 123  TYR B CZ    1 
ATOM   3178  O OH    . TYR B 2 131  ? 139.622 133.130 122.949 1.00 37.43  ? 123  TYR B OH    1 
ATOM   3179  N N     . TYR B 2 132  ? 147.369 135.125 119.713 1.00 38.52  ? 124  TYR B N     1 
ATOM   3180  C CA    . TYR B 2 132  ? 148.054 136.018 118.789 1.00 38.52  ? 124  TYR B CA    1 
ATOM   3181  C C     . TYR B 2 132  ? 148.491 135.239 117.569 1.00 38.52  ? 124  TYR B C     1 
ATOM   3182  O O     . TYR B 2 132  ? 148.669 135.792 116.485 1.00 38.52  ? 124  TYR B O     1 
ATOM   3183  C CB    . TYR B 2 132  ? 149.277 136.617 119.474 1.00 38.52  ? 124  TYR B CB    1 
ATOM   3184  C CG    . TYR B 2 132  ? 149.076 138.036 119.930 1.00 38.52  ? 124  TYR B CG    1 
ATOM   3185  C CD1   . TYR B 2 132  ? 149.001 139.072 119.006 1.00 38.52  ? 124  TYR B CD1   1 
ATOM   3186  C CD2   . TYR B 2 132  ? 148.955 138.345 121.283 1.00 38.52  ? 124  TYR B CD2   1 
ATOM   3187  C CE1   . TYR B 2 132  ? 148.812 140.384 119.412 1.00 38.52  ? 124  TYR B CE1   1 
ATOM   3188  C CE2   . TYR B 2 132  ? 148.763 139.656 121.705 1.00 38.52  ? 124  TYR B CE2   1 
ATOM   3189  C CZ    . TYR B 2 132  ? 148.694 140.671 120.762 1.00 38.52  ? 124  TYR B CZ    1 
ATOM   3190  O OH    . TYR B 2 132  ? 148.510 141.972 121.166 1.00 38.52  ? 124  TYR B OH    1 
ATOM   3191  N N     . HIS B 2 133  ? 148.682 133.944 117.766 1.00 42.10  ? 125  HIS B N     1 
ATOM   3192  C CA    . HIS B 2 133  ? 149.094 133.076 116.684 1.00 42.10  ? 125  HIS B CA    1 
ATOM   3193  C C     . HIS B 2 133  ? 147.862 132.619 115.922 1.00 42.10  ? 125  HIS B C     1 
ATOM   3194  O O     . HIS B 2 133  ? 147.924 132.353 114.724 1.00 42.10  ? 125  HIS B O     1 
ATOM   3195  C CB    . HIS B 2 133  ? 149.858 131.879 117.238 1.00 42.10  ? 125  HIS B CB    1 
ATOM   3196  C CG    . HIS B 2 133  ? 150.170 130.840 116.211 1.00 42.10  ? 125  HIS B CG    1 
ATOM   3197  N ND1   . HIS B 2 133  ? 149.298 129.820 115.900 1.00 42.10  ? 125  HIS B ND1   1 
ATOM   3198  C CD2   . HIS B 2 133  ? 151.241 130.682 115.399 1.00 42.10  ? 125  HIS B CD2   1 
ATOM   3199  C CE1   . HIS B 2 133  ? 149.820 129.076 114.941 1.00 42.10  ? 125  HIS B CE1   1 
ATOM   3200  N NE2   . HIS B 2 133  ? 150.998 129.579 114.618 1.00 42.10  ? 125  HIS B NE2   1 
ATOM   3201  N N     . ASN B 2 134  ? 146.740 132.533 116.628 1.00 42.63  ? 126  ASN B N     1 
ATOM   3202  C CA    . ASN B 2 134  ? 145.486 132.125 116.013 1.00 42.63  ? 126  ASN B CA    1 
ATOM   3203  C C     . ASN B 2 134  ? 144.895 133.332 115.302 1.00 42.63  ? 126  ASN B C     1 
ATOM   3204  O O     . ASN B 2 134  ? 144.073 133.196 114.394 1.00 42.63  ? 126  ASN B O     1 
ATOM   3205  C CB    . ASN B 2 134  ? 144.508 131.621 117.074 1.00 42.63  ? 126  ASN B CB    1 
ATOM   3206  N N     . ILE B 2 135  ? 145.324 134.514 115.727 1.00 38.89  ? 127  ILE B N     1 
ATOM   3207  C CA    . ILE B 2 135  ? 144.852 135.757 115.139 1.00 38.89  ? 127  ILE B CA    1 
ATOM   3208  C C     . ILE B 2 135  ? 145.740 136.112 113.960 1.00 38.89  ? 127  ILE B C     1 
ATOM   3209  O O     . ILE B 2 135  ? 145.305 136.777 113.021 1.00 38.89  ? 127  ILE B O     1 
ATOM   3210  C CB    . ILE B 2 135  ? 144.900 136.908 116.158 1.00 38.89  ? 127  ILE B CB    1 
ATOM   3211  N N     . GLU B 2 136  ? 146.990 135.667 114.019 1.00 31.87  ? 128  GLU B N     1 
ATOM   3212  C CA    . GLU B 2 136  ? 147.947 135.935 112.955 1.00 31.87  ? 128  GLU B CA    1 
ATOM   3213  C C     . GLU B 2 136  ? 147.680 135.010 111.770 1.00 31.87  ? 128  GLU B C     1 
ATOM   3214  O O     . GLU B 2 136  ? 148.229 135.197 110.682 1.00 31.87  ? 128  GLU B O     1 
ATOM   3215  C CB    . GLU B 2 136  ? 149.376 135.730 113.469 1.00 31.87  ? 128  GLU B CB    1 
ATOM   3216  N N     . THR B 2 137  ? 146.826 134.016 111.995 1.00 32.93  ? 129  THR B N     1 
ATOM   3217  C CA    . THR B 2 137  ? 146.456 133.042 110.972 1.00 32.93  ? 129  THR B CA    1 
ATOM   3218  C C     . THR B 2 137  ? 145.143 133.467 110.336 1.00 32.93  ? 129  THR B C     1 
ATOM   3219  O O     . THR B 2 137  ? 144.982 133.437 109.115 1.00 32.93  ? 129  THR B O     1 
ATOM   3220  C CB    . THR B 2 137  ? 146.273 131.644 111.587 1.00 32.93  ? 129  THR B CB    1 
ATOM   3221  N N     . SER B 2 138  ? 144.208 133.856 111.194 1.00 44.08  ? 130  SER B N     1 
ATOM   3222  C CA    . SER B 2 138  ? 142.893 134.315 110.777 1.00 44.08  ? 130  SER B CA    1 
ATOM   3223  C C     . SER B 2 138  ? 142.703 135.686 111.406 1.00 44.08  ? 130  SER B C     1 
ATOM   3224  O O     . SER B 2 138  ? 142.754 135.834 112.626 1.00 44.08  ? 130  SER B O     1 
ATOM   3225  C CB    . SER B 2 138  ? 141.813 133.342 111.260 1.00 44.08  ? 130  SER B CB    1 
ATOM   3226  O OG    . SER B 2 138  ? 141.859 133.196 112.666 1.00 44.08  ? 130  SER B OG    1 
ATOM   3227  N N     . ASN B 2 139  ? 142.502 136.685 110.556 1.00 45.20  ? 131  ASN B N     1 
ATOM   3228  C CA    . ASN B 2 139  ? 142.334 138.066 110.989 1.00 45.20  ? 131  ASN B CA    1 
ATOM   3229  C C     . ASN B 2 139  ? 140.915 138.432 111.393 1.00 45.20  ? 131  ASN B C     1 
ATOM   3230  O O     . ASN B 2 139  ? 140.043 138.606 110.544 1.00 45.20  ? 131  ASN B O     1 
ATOM   3231  C CB    . ASN B 2 139  ? 142.797 138.997 109.876 1.00 45.20  ? 131  ASN B CB    1 
ATOM   3232  C CG    . ASN B 2 139  ? 142.148 138.670 108.549 1.00 45.20  ? 131  ASN B CG    1 
ATOM   3233  O OD1   . ASN B 2 139  ? 142.058 137.505 108.162 1.00 45.20  ? 131  ASN B OD1   1 
ATOM   3234  N ND2   . ASN B 2 139  ? 141.694 139.696 107.843 1.00 45.20  ? 131  ASN B ND2   1 
ATOM   3235  N N     . PHE B 2 140  ? 140.697 138.552 112.696 1.00 42.43  ? 132  PHE B N     1 
ATOM   3236  C CA    . PHE B 2 140  ? 139.393 138.914 113.236 1.00 42.43  ? 132  PHE B CA    1 
ATOM   3237  C C     . PHE B 2 140  ? 139.663 139.692 114.519 1.00 42.43  ? 132  PHE B C     1 
ATOM   3238  O O     . PHE B 2 140  ? 140.613 139.397 115.242 1.00 42.43  ? 132  PHE B O     1 
ATOM   3239  C CB    . PHE B 2 140  ? 138.564 137.667 113.535 1.00 42.43  ? 132  PHE B CB    1 
ATOM   3240  N N     . PRO B 2 141  ? 138.834 140.705 114.811 1.00 42.44  ? 133  PRO B N     1 
ATOM   3241  C CA    . PRO B 2 141  ? 138.951 141.562 115.996 1.00 42.44  ? 133  PRO B CA    1 
ATOM   3242  C C     . PRO B 2 141  ? 138.296 140.995 117.251 1.00 42.44  ? 133  PRO B C     1 
ATOM   3243  O O     . PRO B 2 141  ? 138.418 141.570 118.334 1.00 42.44  ? 133  PRO B O     1 
ATOM   3244  C CB    . PRO B 2 141  ? 138.266 142.861 115.555 1.00 42.44  ? 133  PRO B CB    1 
ATOM   3245  C CG    . PRO B 2 141  ? 138.181 142.747 114.045 1.00 42.44  ? 133  PRO B CG    1 
ATOM   3246  C CD    . PRO B 2 141  ? 137.889 141.299 113.858 1.00 42.44  ? 133  PRO B CD    1 
ATOM   3247  N N     . LYS B 2 142  ? 137.592 139.876 117.105 1.00 32.87  ? 134  LYS B N     1 
ATOM   3248  C CA    . LYS B 2 142  ? 136.901 139.254 118.231 1.00 32.87  ? 134  LYS B CA    1 
ATOM   3249  C C     . LYS B 2 142  ? 137.851 138.754 119.313 1.00 32.87  ? 134  LYS B C     1 
ATOM   3250  O O     . LYS B 2 142  ? 137.460 138.606 120.471 1.00 32.87  ? 134  LYS B O     1 
ATOM   3251  C CB    . LYS B 2 142  ? 136.034 138.094 117.734 1.00 32.87  ? 134  LYS B CB    1 
ATOM   3252  N N     . LEU B 2 143  ? 139.097 138.491 118.933 1.00 31.97  ? 135  LEU B N     1 
ATOM   3253  C CA    . LEU B 2 143  ? 140.086 138.003 119.882 1.00 31.97  ? 135  LEU B CA    1 
ATOM   3254  C C     . LEU B 2 143  ? 140.722 139.155 120.640 1.00 31.97  ? 135  LEU B C     1 
ATOM   3255  O O     . LEU B 2 143  ? 141.008 139.042 121.834 1.00 31.97  ? 135  LEU B O     1 
ATOM   3256  C CB    . LEU B 2 143  ? 141.175 137.216 119.157 1.00 31.97  ? 135  LEU B CB    1 
ATOM   3257  N N     . LEU B 2 144  ? 140.943 140.261 119.937 1.00 33.87  ? 136  LEU B N     1 
ATOM   3258  C CA    . LEU B 2 144  ? 141.551 141.441 120.536 1.00 33.87  ? 136  LEU B CA    1 
ATOM   3259  C C     . LEU B 2 144  ? 140.564 142.113 121.481 1.00 33.87  ? 136  LEU B C     1 
ATOM   3260  O O     . LEU B 2 144  ? 140.939 142.959 122.293 1.00 33.87  ? 136  LEU B O     1 
ATOM   3261  C CB    . LEU B 2 144  ? 141.978 142.423 119.443 1.00 33.87  ? 136  LEU B CB    1 
ATOM   3262  N N     . ILE B 2 145  ? 139.298 141.726 121.368 1.00 36.37  ? 137  ILE B N     1 
ATOM   3263  C CA    . ILE B 2 145  ? 138.253 142.286 122.213 1.00 36.37  ? 137  ILE B CA    1 
ATOM   3264  C C     . ILE B 2 145  ? 138.135 141.462 123.485 1.00 36.37  ? 137  ILE B C     1 
ATOM   3265  O O     . ILE B 2 145  ? 137.691 141.957 124.521 1.00 36.37  ? 137  ILE B O     1 
ATOM   3266  C CB    . ILE B 2 145  ? 136.895 142.281 121.493 1.00 36.37  ? 137  ILE B CB    1 
ATOM   3267  N N     . ALA B 2 146  ? 138.533 140.198 123.394 1.00 38.68  ? 138  ALA B N     1 
ATOM   3268  C CA    . ALA B 2 146  ? 138.480 139.284 124.527 1.00 38.68  ? 138  ALA B CA    1 
ATOM   3269  C C     . ALA B 2 146  ? 139.751 139.416 125.352 1.00 38.68  ? 138  ALA B C     1 
ATOM   3270  O O     . ALA B 2 146  ? 139.791 139.037 126.524 1.00 38.68  ? 138  ALA B O     1 
ATOM   3271  C CB    . ALA B 2 146  ? 138.325 137.859 124.030 1.00 38.68  ? 138  ALA B CB    1 
ATOM   3272  N N     . LEU B 2 147  ? 140.790 139.943 124.715 1.00 33.68  ? 139  LEU B N     1 
ATOM   3273  C CA    . LEU B 2 147  ? 142.077 140.161 125.357 1.00 33.68  ? 139  LEU B CA    1 
ATOM   3274  C C     . LEU B 2 147  ? 141.995 141.502 126.060 1.00 33.68  ? 139  LEU B C     1 
ATOM   3275  O O     . LEU B 2 147  ? 142.487 141.671 127.176 1.00 33.68  ? 139  LEU B O     1 
ATOM   3276  C CB    . LEU B 2 147  ? 143.183 140.182 124.302 1.00 33.68  ? 139  LEU B CB    1 
ATOM   3277  C CG    . LEU B 2 147  ? 143.585 138.811 123.761 1.00 33.68  ? 139  LEU B CG    1 
ATOM   3278  C CD1   . LEU B 2 147  ? 144.341 138.947 122.449 1.00 33.68  ? 139  LEU B CD1   1 
ATOM   3279  C CD2   . LEU B 2 147  ? 144.430 138.112 124.811 1.00 33.68  ? 139  LEU B CD2   1 
ATOM   3280  N N     . LEU B 2 148  ? 141.356 142.449 125.380 1.00 37.43  ? 140  LEU B N     1 
ATOM   3281  C CA    . LEU B 2 148  ? 141.157 143.793 125.898 1.00 37.43  ? 140  LEU B CA    1 
ATOM   3282  C C     . LEU B 2 148  ? 140.288 143.701 127.138 1.00 37.43  ? 140  LEU B C     1 
ATOM   3283  O O     . LEU B 2 148  ? 140.427 144.493 128.069 1.00 37.43  ? 140  LEU B O     1 
ATOM   3284  C CB    . LEU B 2 148  ? 140.466 144.661 124.844 1.00 37.43  ? 140  LEU B CB    1 
ATOM   3285  C CG    . LEU B 2 148  ? 139.990 146.042 125.291 1.00 37.43  ? 140  LEU B CG    1 
ATOM   3286  C CD1   . LEU B 2 148  ? 141.158 146.833 125.855 1.00 37.43  ? 140  LEU B CD1   1 
ATOM   3287  C CD2   . LEU B 2 148  ? 139.361 146.765 124.113 1.00 37.43  ? 140  LEU B CD2   1 
ATOM   3288  N N     . ILE B 2 149  ? 139.388 142.722 127.140 1.00 35.06  ? 141  ILE B N     1 
ATOM   3289  C CA    . ILE B 2 149  ? 138.493 142.502 128.266 1.00 35.06  ? 141  ILE B CA    1 
ATOM   3290  C C     . ILE B 2 149  ? 139.300 141.963 129.439 1.00 35.06  ? 141  ILE B C     1 
ATOM   3291  O O     . ILE B 2 149  ? 138.928 142.138 130.601 1.00 35.06  ? 141  ILE B O     1 
ATOM   3292  C CB    . ILE B 2 149  ? 137.399 141.482 127.907 1.00 35.06  ? 141  ILE B CB    1 
ATOM   3293  N N     . TYR B 2 150  ? 140.416 141.315 129.124 1.00 24.31  ? 142  TYR B N     1 
ATOM   3294  C CA    . TYR B 2 150  ? 141.295 140.750 130.139 1.00 24.31  ? 142  TYR B CA    1 
ATOM   3295  C C     . TYR B 2 150  ? 142.270 141.807 130.648 1.00 24.31  ? 142  TYR B C     1 
ATOM   3296  O O     . TYR B 2 150  ? 142.447 141.975 131.854 1.00 24.31  ? 142  TYR B O     1 
ATOM   3297  C CB    . TYR B 2 150  ? 142.061 139.556 129.565 1.00 24.31  ? 142  TYR B CB    1 
ATOM   3298  C CG    . TYR B 2 150  ? 143.005 138.895 130.540 1.00 24.31  ? 142  TYR B CG    1 
ATOM   3299  C CD1   . TYR B 2 150  ? 142.564 137.891 131.391 1.00 24.31  ? 142  TYR B CD1   1 
ATOM   3300  C CD2   . TYR B 2 150  ? 144.341 139.267 130.606 1.00 24.31  ? 142  TYR B CD2   1 
ATOM   3301  C CE1   . TYR B 2 150  ? 143.424 137.280 132.284 1.00 24.31  ? 142  TYR B CE1   1 
ATOM   3302  C CE2   . TYR B 2 150  ? 145.209 138.663 131.495 1.00 24.31  ? 142  TYR B CE2   1 
ATOM   3303  C CZ    . TYR B 2 150  ? 144.745 137.671 132.332 1.00 24.31  ? 142  TYR B CZ    1 
ATOM   3304  O OH    . TYR B 2 150  ? 145.604 137.064 133.220 1.00 24.31  ? 142  TYR B OH    1 
ATOM   3305  N N     . TRP B 2 151  ? 142.893 142.519 129.715 1.00 32.91  ? 143  TRP B N     1 
ATOM   3306  C CA    . TRP B 2 151  ? 143.852 143.565 130.046 1.00 32.91  ? 143  TRP B CA    1 
ATOM   3307  C C     . TRP B 2 151  ? 143.246 144.635 130.940 1.00 32.91  ? 143  TRP B C     1 
ATOM   3308  O O     . TRP B 2 151  ? 143.941 145.258 131.745 1.00 32.91  ? 143  TRP B O     1 
ATOM   3309  C CB    . TRP B 2 151  ? 144.382 144.213 128.762 1.00 32.91  ? 143  TRP B CB    1 
ATOM   3310  C CG    . TRP B 2 151  ? 145.307 143.336 127.977 1.00 32.91  ? 143  TRP B CG    1 
ATOM   3311  C CD1   . TRP B 2 151  ? 145.161 142.949 126.675 1.00 32.91  ? 143  TRP B CD1   1 
ATOM   3312  C CD2   . TRP B 2 151  ? 146.532 142.745 128.437 1.00 32.91  ? 143  TRP B CD2   1 
ATOM   3313  N NE1   . TRP B 2 151  ? 146.218 142.151 126.298 1.00 32.91  ? 143  TRP B NE1   1 
ATOM   3314  C CE2   . TRP B 2 151  ? 147.071 142.009 127.360 1.00 32.91  ? 143  TRP B CE2   1 
ATOM   3315  C CE3   . TRP B 2 151  ? 147.223 142.761 129.659 1.00 32.91  ? 143  TRP B CE3   1 
ATOM   3316  C CZ2   . TRP B 2 151  ? 148.271 141.300 127.463 1.00 32.91  ? 143  TRP B CZ2   1 
ATOM   3317  C CZ3   . TRP B 2 151  ? 148.417 142.055 129.762 1.00 32.91  ? 143  TRP B CZ3   1 
ATOM   3318  C CH2   . TRP B 2 151  ? 148.927 141.332 128.668 1.00 32.91  ? 143  TRP B CH2   1 
ATOM   3319  N N     . THR B 2 152  ? 141.944 144.840 130.790 1.00 33.35  ? 144  THR B N     1 
ATOM   3320  C CA    . THR B 2 152  ? 141.223 145.833 131.572 1.00 33.35  ? 144  THR B CA    1 
ATOM   3321  C C     . THR B 2 152  ? 140.859 145.314 132.962 1.00 33.35  ? 144  THR B C     1 
ATOM   3322  O O     . THR B 2 152  ? 140.864 146.073 133.931 1.00 33.35  ? 144  THR B O     1 
ATOM   3323  C CB    . THR B 2 152  ? 139.946 146.285 130.835 1.00 33.35  ? 144  THR B CB    1 
ATOM   3324  O OG1   . THR B 2 152  ? 139.261 145.138 130.318 1.00 33.35  ? 144  THR B OG1   1 
ATOM   3325  C CG2   . THR B 2 152  ? 140.298 147.217 129.689 1.00 33.35  ? 144  THR B CG2   1 
ATOM   3326  N N     . LEU B 2 153  ? 140.554 144.024 133.060 1.00 35.79  ? 145  LEU B N     1 
ATOM   3327  C CA    . LEU B 2 153  ? 140.214 143.430 134.347 1.00 35.79  ? 145  LEU B CA    1 
ATOM   3328  C C     . LEU B 2 153  ? 141.485 143.204 135.158 1.00 35.79  ? 145  LEU B C     1 
ATOM   3329  O O     . LEU B 2 153  ? 141.464 143.216 136.389 1.00 35.79  ? 145  LEU B O     1 
ATOM   3330  C CB    . LEU B 2 153  ? 139.459 142.115 134.158 1.00 35.79  ? 145  LEU B CB    1 
ATOM   3331  C CG    . LEU B 2 153  ? 138.010 142.238 133.684 1.00 35.79  ? 145  LEU B CG    1 
ATOM   3332  C CD1   . LEU B 2 153  ? 137.395 140.863 133.470 1.00 35.79  ? 145  LEU B CD1   1 
ATOM   3333  C CD2   . LEU B 2 153  ? 137.186 143.050 134.672 1.00 35.79  ? 145  LEU B CD2   1 
ATOM   3334  N N     . ALA B 2 154  ? 142.592 143.003 134.452 1.00 31.19  ? 146  ALA B N     1 
ATOM   3335  C CA    . ALA B 2 154  ? 143.889 142.780 135.083 1.00 31.19  ? 146  ALA B CA    1 
ATOM   3336  C C     . ALA B 2 154  ? 144.446 144.122 135.537 1.00 31.19  ? 146  ALA B C     1 
ATOM   3337  O O     . ALA B 2 154  ? 145.247 144.197 136.471 1.00 31.19  ? 146  ALA B O     1 
ATOM   3338  C CB    . ALA B 2 154  ? 144.841 142.122 134.095 1.00 31.19  ? 146  ALA B CB    1 
ATOM   3339  N N     . PHE B 2 155  ? 144.014 145.180 134.859 1.00 40.48  ? 147  PHE B N     1 
ATOM   3340  C CA    . PHE B 2 155  ? 144.438 146.535 135.180 1.00 40.48  ? 147  PHE B CA    1 
ATOM   3341  C C     . PHE B 2 155  ? 143.773 146.982 136.479 1.00 40.48  ? 147  PHE B C     1 
ATOM   3342  O O     . PHE B 2 155  ? 144.387 147.661 137.298 1.00 40.48  ? 147  PHE B O     1 
ATOM   3343  C CB    . PHE B 2 155  ? 144.051 147.492 134.046 1.00 40.48  ? 147  PHE B CB    1 
ATOM   3344  C CG    . PHE B 2 155  ? 144.324 148.940 134.348 1.00 40.48  ? 147  PHE B CG    1 
ATOM   3345  C CD1   . PHE B 2 155  ? 145.630 149.396 134.509 1.00 40.48  ? 147  PHE B CD1   1 
ATOM   3346  C CD2   . PHE B 2 155  ? 143.275 149.843 134.502 1.00 40.48  ? 147  PHE B CD2   1 
ATOM   3347  C CE1   . PHE B 2 155  ? 145.888 150.730 134.814 1.00 40.48  ? 147  PHE B CE1   1 
ATOM   3348  C CE2   . PHE B 2 155  ? 143.524 151.181 134.807 1.00 40.48  ? 147  PHE B CE2   1 
ATOM   3349  C CZ    . PHE B 2 155  ? 144.832 151.623 134.966 1.00 40.48  ? 147  PHE B CZ    1 
ATOM   3350  N N     . ILE B 2 156  ? 142.517 146.581 136.658 1.00 41.68  ? 148  ILE B N     1 
ATOM   3351  C CA    . ILE B 2 156  ? 141.743 146.938 137.841 1.00 41.68  ? 148  ILE B CA    1 
ATOM   3352  C C     . ILE B 2 156  ? 142.162 146.169 139.089 1.00 41.68  ? 148  ILE B C     1 
ATOM   3353  O O     . ILE B 2 156  ? 141.929 146.620 140.212 1.00 41.68  ? 148  ILE B O     1 
ATOM   3354  C CB    . ILE B 2 156  ? 140.238 146.706 137.605 1.00 41.68  ? 148  ILE B CB    1 
ATOM   3355  N N     . THR B 2 157  ? 142.780 145.008 138.894 1.00 42.49  ? 149  THR B N     1 
ATOM   3356  C CA    . THR B 2 157  ? 143.233 144.184 140.012 1.00 42.49  ? 149  THR B CA    1 
ATOM   3357  C C     . THR B 2 157  ? 144.572 144.675 140.551 1.00 42.49  ? 149  THR B C     1 
ATOM   3358  O O     . THR B 2 157  ? 144.966 144.333 141.665 1.00 42.49  ? 149  THR B O     1 
ATOM   3359  C CB    . THR B 2 157  ? 143.369 142.702 139.596 1.00 42.49  ? 149  THR B CB    1 
ATOM   3360  O OG1   . THR B 2 157  ? 144.199 142.605 138.432 1.00 42.49  ? 149  THR B OG1   1 
ATOM   3361  C CG2   . THR B 2 157  ? 142.006 142.108 139.299 1.00 42.49  ? 149  THR B CG2   1 
ATOM   3362  N N     . LYS B 2 158  ? 145.322 145.325 139.666 1.00 41.44  ? 150  LYS B N     1 
ATOM   3363  C CA    . LYS B 2 158  ? 146.609 145.916 139.995 1.00 41.44  ? 150  LYS B CA    1 
ATOM   3364  C C     . LYS B 2 158  ? 146.388 147.064 140.964 1.00 41.44  ? 150  LYS B C     1 
ATOM   3365  O O     . LYS B 2 158  ? 147.155 147.265 141.902 1.00 41.44  ? 150  LYS B O     1 
ATOM   3366  C CB    . LYS B 2 158  ? 147.309 146.416 138.732 1.00 41.44  ? 150  LYS B CB    1 
ATOM   3367  N N     . THR B 2 159  ? 145.320 147.815 140.713 1.00 50.97  ? 151  THR B N     1 
ATOM   3368  C CA    . THR B 2 159  ? 144.960 148.969 141.524 1.00 50.97  ? 151  THR B CA    1 
ATOM   3369  C C     . THR B 2 159  ? 144.647 148.572 142.958 1.00 50.97  ? 151  THR B C     1 
ATOM   3370  O O     . THR B 2 159  ? 145.010 149.279 143.898 1.00 50.97  ? 151  THR B O     1 
ATOM   3371  C CB    . THR B 2 159  ? 143.745 149.710 140.935 1.00 50.97  ? 151  THR B CB    1 
ATOM   3372  O OG1   . THR B 2 159  ? 144.058 150.173 139.616 1.00 50.97  ? 151  THR B OG1   1 
ATOM   3373  C CG2   . THR B 2 159  ? 143.371 150.897 141.810 1.00 50.97  ? 151  THR B CG2   1 
ATOM   3374  N N     . ILE B 2 160  ? 143.964 147.445 143.126 1.00 45.43  ? 152  ILE B N     1 
ATOM   3375  C CA    . ILE B 2 160  ? 143.618 146.984 144.461 1.00 45.43  ? 152  ILE B CA    1 
ATOM   3376  C C     . ILE B 2 160  ? 144.888 146.698 145.253 1.00 45.43  ? 152  ILE B C     1 
ATOM   3377  O O     . ILE B 2 160  ? 144.994 147.063 146.423 1.00 45.43  ? 152  ILE B O     1 
ATOM   3378  C CB    . ILE B 2 160  ? 142.756 145.712 144.409 1.00 45.43  ? 152  ILE B CB    1 
ATOM   3379  C CG1   . ILE B 2 160  ? 141.491 145.959 143.585 1.00 45.43  ? 152  ILE B CG1   1 
ATOM   3380  C CG2   . ILE B 2 160  ? 142.403 145.250 145.814 1.00 45.43  ? 152  ILE B CG2   1 
ATOM   3381  C CD1   . ILE B 2 160  ? 140.623 147.075 144.120 1.00 45.43  ? 152  ILE B CD1   1 
ATOM   3382  N N     . LYS B 2 161  ? 145.851 146.028 144.631 1.00 38.07  ? 153  LYS B N     1 
ATOM   3383  C CA    . LYS B 2 161  ? 147.081 145.712 145.342 1.00 38.07  ? 153  LYS B CA    1 
ATOM   3384  C C     . LYS B 2 161  ? 147.778 147.002 145.742 1.00 38.07  ? 153  LYS B C     1 
ATOM   3385  O O     . LYS B 2 161  ? 148.240 147.146 146.875 1.00 38.07  ? 153  LYS B O     1 
ATOM   3386  C CB    . LYS B 2 161  ? 148.004 144.866 144.466 1.00 38.07  ? 153  LYS B CB    1 
ATOM   3387  C CG    . LYS B 2 161  ? 147.386 143.560 143.991 1.00 38.07  ? 153  LYS B CG    1 
ATOM   3388  C CD    . LYS B 2 161  ? 148.332 142.807 143.071 1.00 38.07  ? 153  LYS B CD    1 
ATOM   3389  C CE    . LYS B 2 161  ? 147.724 141.491 142.610 1.00 38.07  ? 153  LYS B CE    1 
ATOM   3390  N NZ    . LYS B 2 161  ? 147.439 140.582 143.753 1.00 38.07  ? 153  LYS B NZ    1 
ATOM   3391  N N     . PHE B 2 162  ? 147.840 147.947 144.810 1.00 49.63  ? 154  PHE B N     1 
ATOM   3392  C CA    . PHE B 2 162  ? 148.458 149.232 145.089 1.00 49.63  ? 154  PHE B CA    1 
ATOM   3393  C C     . PHE B 2 162  ? 147.651 149.969 146.149 1.00 49.63  ? 154  PHE B C     1 
ATOM   3394  O O     . PHE B 2 162  ? 148.205 150.543 147.086 1.00 49.63  ? 154  PHE B O     1 
ATOM   3395  C CB    . PHE B 2 162  ? 148.548 150.070 143.813 1.00 49.63  ? 154  PHE B CB    1 
ATOM   3396  C CG    . PHE B 2 162  ? 149.380 151.312 143.961 1.00 49.63  ? 154  PHE B CG    1 
ATOM   3397  C CD1   . PHE B 2 162  ? 150.726 151.301 143.634 1.00 49.63  ? 154  PHE B CD1   1 
ATOM   3398  C CD2   . PHE B 2 162  ? 148.818 152.487 144.428 1.00 49.63  ? 154  PHE B CD2   1 
ATOM   3399  C CE1   . PHE B 2 162  ? 151.495 152.442 143.768 1.00 49.63  ? 154  PHE B CE1   1 
ATOM   3400  C CE2   . PHE B 2 162  ? 149.581 153.632 144.565 1.00 49.63  ? 154  PHE B CE2   1 
ATOM   3401  C CZ    . PHE B 2 162  ? 150.922 153.609 144.235 1.00 49.63  ? 154  PHE B CZ    1 
ATOM   3402  N N     . VAL B 2 163  ? 146.329 149.918 146.005 1.00 53.49  ? 155  VAL B N     1 
ATOM   3403  C CA    . VAL B 2 163  ? 145.430 150.582 146.940 1.00 53.49  ? 155  VAL B CA    1 
ATOM   3404  C C     . VAL B 2 163  ? 145.566 149.986 148.331 1.00 53.49  ? 155  VAL B C     1 
ATOM   3405  O O     . VAL B 2 163  ? 145.590 150.708 149.328 1.00 53.49  ? 155  VAL B O     1 
ATOM   3406  C CB    . VAL B 2 163  ? 143.964 150.476 146.483 1.00 53.49  ? 155  VAL B CB    1 
ATOM   3407  N N     . LYS B 2 164  ? 145.657 148.662 148.393 1.00 62.63  ? 156  LYS B N     1 
ATOM   3408  C CA    . LYS B 2 164  ? 145.809 147.975 149.667 1.00 62.63  ? 156  LYS B CA    1 
ATOM   3409  C C     . LYS B 2 164  ? 147.131 148.373 150.309 1.00 62.63  ? 156  LYS B C     1 
ATOM   3410  O O     . LYS B 2 164  ? 147.203 148.610 151.515 1.00 62.63  ? 156  LYS B O     1 
ATOM   3411  C CB    . LYS B 2 164  ? 145.752 146.459 149.471 1.00 62.63  ? 156  LYS B CB    1 
ATOM   3412  N N     . PHE B 2 165  ? 148.165 148.375 149.471 1.00 62.67  ? 157  PHE B N     1 
ATOM   3413  C CA    . PHE B 2 165  ? 149.550 148.669 149.838 1.00 62.67  ? 157  PHE B CA    1 
ATOM   3414  C C     . PHE B 2 165  ? 149.855 150.070 150.360 1.00 62.67  ? 157  PHE B C     1 
ATOM   3415  O O     . PHE B 2 165  ? 150.671 150.227 151.268 1.00 62.67  ? 157  PHE B O     1 
ATOM   3416  C CB    . PHE B 2 165  ? 150.487 148.345 148.669 1.00 62.67  ? 157  PHE B CB    1 
ATOM   3417  C CG    . PHE B 2 165  ? 151.943 148.461 149.012 1.00 62.67  ? 157  PHE B CG    1 
ATOM   3418  C CD1   . PHE B 2 165  ? 152.651 147.362 149.467 1.00 62.67  ? 157  PHE B CD1   1 
ATOM   3419  C CD2   . PHE B 2 165  ? 152.604 149.672 148.882 1.00 62.67  ? 157  PHE B CD2   1 
ATOM   3420  C CE1   . PHE B 2 165  ? 153.992 147.466 149.784 1.00 62.67  ? 157  PHE B CE1   1 
ATOM   3421  C CE2   . PHE B 2 165  ? 153.945 149.783 149.199 1.00 62.67  ? 157  PHE B CE2   1 
ATOM   3422  C CZ    . PHE B 2 165  ? 154.640 148.677 149.650 1.00 62.67  ? 157  PHE B CZ    1 
ATOM   3423  N N     . TYR B 2 166  ? 149.210 151.088 149.799 1.00 67.62  ? 158  TYR B N     1 
ATOM   3424  C CA    . TYR B 2 166  ? 149.495 152.456 150.221 1.00 67.62  ? 158  TYR B CA    1 
ATOM   3425  C C     . TYR B 2 166  ? 149.200 152.629 151.706 1.00 67.62  ? 158  TYR B C     1 
ATOM   3426  O O     . TYR B 2 166  ? 149.986 153.236 152.433 1.00 67.62  ? 158  TYR B O     1 
ATOM   3427  C CB    . TYR B 2 166  ? 148.668 153.446 149.398 1.00 67.62  ? 158  TYR B CB    1 
ATOM   3428  C CG    . TYR B 2 166  ? 149.102 154.886 149.549 1.00 67.62  ? 158  TYR B CG    1 
ATOM   3429  C CD1   . TYR B 2 166  ? 150.064 155.432 148.711 1.00 67.62  ? 158  TYR B CD1   1 
ATOM   3430  C CD2   . TYR B 2 166  ? 148.546 155.701 150.527 1.00 67.62  ? 158  TYR B CD2   1 
ATOM   3431  C CE1   . TYR B 2 166  ? 150.463 156.749 148.843 1.00 67.62  ? 158  TYR B CE1   1 
ATOM   3432  C CE2   . TYR B 2 166  ? 148.939 157.019 150.666 1.00 67.62  ? 158  TYR B CE2   1 
ATOM   3433  C CZ    . TYR B 2 166  ? 149.897 157.537 149.822 1.00 67.62  ? 158  TYR B CZ    1 
ATOM   3434  O OH    . TYR B 2 166  ? 150.291 158.849 149.957 1.00 67.62  ? 158  TYR B OH    1 
ATOM   3435  N N     . ASP B 2 167  ? 148.071 152.096 152.159 1.00 64.71  ? 159  ASP B N     1 
ATOM   3436  C CA    . ASP B 2 167  ? 147.729 152.148 153.570 1.00 64.71  ? 159  ASP B CA    1 
ATOM   3437  C C     . ASP B 2 167  ? 148.760 151.322 154.329 1.00 64.71  ? 159  ASP B C     1 
ATOM   3438  O O     . ASP B 2 167  ? 149.198 151.685 155.421 1.00 64.71  ? 159  ASP B O     1 
ATOM   3439  C CB    . ASP B 2 167  ? 146.328 151.584 153.805 1.00 64.71  ? 159  ASP B CB    1 
ATOM   3440  C CG    . ASP B 2 167  ? 145.237 152.496 153.280 1.00 64.71  ? 159  ASP B CG    1 
ATOM   3441  O OD1   . ASP B 2 167  ? 145.532 153.676 152.995 1.00 64.71  ? 159  ASP B OD1   1 
ATOM   3442  O OD2   . ASP B 2 167  ? 144.084 152.033 153.152 1.00 64.71  ? 159  ASP B OD2   1 
ATOM   3443  N N     . HIS B 2 168  ? 149.138 150.200 153.722 1.00 65.57  ? 160  HIS B N     1 
ATOM   3444  C CA    . HIS B 2 168  ? 150.087 149.255 154.297 1.00 65.57  ? 160  HIS B CA    1 
ATOM   3445  C C     . HIS B 2 168  ? 151.352 149.473 153.476 1.00 65.57  ? 160  HIS B C     1 
ATOM   3446  O O     . HIS B 2 168  ? 151.763 148.618 152.689 1.00 65.57  ? 160  HIS B O     1 
ATOM   3447  C CB    . HIS B 2 168  ? 149.571 147.825 154.129 1.00 65.57  ? 160  HIS B CB    1 
ATOM   3448  N N     . ALA B 2 169  ? 151.961 150.639 153.674 1.00 67.09  ? 161  ALA B N     1 
ATOM   3449  C CA    . ALA B 2 169  ? 153.145 151.030 152.925 1.00 67.09  ? 161  ALA B CA    1 
ATOM   3450  C C     . ALA B 2 169  ? 154.496 150.695 153.547 1.00 67.09  ? 161  ALA B C     1 
ATOM   3451  O O     . ALA B 2 169  ? 154.724 150.889 154.743 1.00 67.09  ? 161  ALA B O     1 
ATOM   3452  C CB    . ALA B 2 169  ? 153.079 152.517 152.607 1.00 67.09  ? 161  ALA B CB    1 
ATOM   3453  N N     . ILE B 2 170  ? 155.386 150.186 152.700 1.00 77.15  ? 162  ILE B N     1 
ATOM   3454  C CA    . ILE B 2 170  ? 156.743 149.826 153.093 1.00 77.15  ? 162  ILE B CA    1 
ATOM   3455  C C     . ILE B 2 170  ? 157.714 150.784 152.409 1.00 77.15  ? 162  ILE B C     1 
ATOM   3456  O O     . ILE B 2 170  ? 158.608 151.348 153.044 1.00 77.15  ? 162  ILE B O     1 
ATOM   3457  C CB    . ILE B 2 170  ? 157.094 148.390 152.663 1.00 77.15  ? 162  ILE B CB    1 
ATOM   3458  N N     . GLY B 2 171  ? 157.516 150.959 151.105 1.00 69.54  ? 163  GLY B N     1 
ATOM   3459  C CA    . GLY B 2 171  ? 158.365 151.832 150.321 1.00 69.54  ? 163  GLY B CA    1 
ATOM   3460  C C     . GLY B 2 171  ? 159.154 151.034 149.303 1.00 69.54  ? 163  GLY B C     1 
ATOM   3461  O O     . GLY B 2 171  ? 158.618 150.617 148.275 1.00 69.54  ? 163  GLY B O     1 
ATOM   3462  N N     . PHE B 2 172  ? 160.433 150.821 149.587 1.00 50.95  ? 164  PHE B N     1 
ATOM   3463  C CA    . PHE B 2 172  ? 161.299 150.066 148.690 1.00 50.95  ? 164  PHE B CA    1 
ATOM   3464  C C     . PHE B 2 172  ? 161.688 148.724 149.303 1.00 50.95  ? 164  PHE B C     1 
ATOM   3465  O O     . PHE B 2 172  ? 162.346 147.908 148.660 1.00 50.95  ? 164  PHE B O     1 
ATOM   3466  C CB    . PHE B 2 172  ? 162.561 150.876 148.382 1.00 50.95  ? 164  PHE B CB    1 
ATOM   3467  N N     . SER B 2 173  ? 161.268 148.502 150.545 1.00 53.45  ? 165  SER B N     1 
ATOM   3468  C CA    . SER B 2 173  ? 161.595 147.275 151.264 1.00 53.45  ? 165  SER B CA    1 
ATOM   3469  C C     . SER B 2 173  ? 160.592 146.145 151.049 1.00 53.45  ? 165  SER B C     1 
ATOM   3470  O O     . SER B 2 173  ? 160.557 145.185 151.818 1.00 53.45  ? 165  SER B O     1 
ATOM   3471  C CB    . SER B 2 173  ? 161.722 147.574 152.760 1.00 53.45  ? 165  SER B CB    1 
ATOM   3472  N N     . GLN B 2 174  ? 159.788 146.252 149.996 1.00 51.00  ? 166  GLN B N     1 
ATOM   3473  C CA    . GLN B 2 174  ? 158.789 145.231 149.696 1.00 51.00  ? 166  GLN B CA    1 
ATOM   3474  C C     . GLN B 2 174  ? 159.029 144.602 148.324 1.00 51.00  ? 166  GLN B C     1 
ATOM   3475  O O     . GLN B 2 174  ? 159.194 145.307 147.328 1.00 51.00  ? 166  GLN B O     1 
ATOM   3476  C CB    . GLN B 2 174  ? 157.387 145.843 149.753 1.00 51.00  ? 166  GLN B CB    1 
ATOM   3477  N N     . LEU B 2 175  ? 159.051 143.272 148.283 1.00 54.41  ? 167  LEU B N     1 
ATOM   3478  C CA    . LEU B 2 175  ? 159.272 142.538 147.039 1.00 54.41  ? 167  LEU B CA    1 
ATOM   3479  C C     . LEU B 2 175  ? 157.962 142.243 146.318 1.00 54.41  ? 167  LEU B C     1 
ATOM   3480  O O     . LEU B 2 175  ? 157.959 141.896 145.134 1.00 54.41  ? 167  LEU B O     1 
ATOM   3481  C CB    . LEU B 2 175  ? 160.002 141.221 147.322 1.00 54.41  ? 167  LEU B CB    1 
ATOM   3482  N N     . ARG B 2 176  ? 156.854 142.265 147.050 1.00 43.76  ? 168  ARG B N     1 
ATOM   3483  C CA    . ARG B 2 176  ? 155.554 142.075 146.422 1.00 43.76  ? 168  ARG B CA    1 
ATOM   3484  C C     . ARG B 2 176  ? 155.286 143.278 145.516 1.00 43.76  ? 168  ARG B C     1 
ATOM   3485  O O     . ARG B 2 176  ? 154.805 143.151 144.383 1.00 43.76  ? 168  ARG B O     1 
ATOM   3486  C CB    . ARG B 2 176  ? 154.456 141.950 147.478 1.00 43.76  ? 168  ARG B CB    1 
ATOM   3487  N N     . PHE B 2 177  ? 155.634 144.450 146.040 1.00 51.10  ? 169  PHE B N     1 
ATOM   3488  C CA    . PHE B 2 177  ? 155.452 145.721 145.352 1.00 51.10  ? 169  PHE B CA    1 
ATOM   3489  C C     . PHE B 2 177  ? 156.270 145.811 144.073 1.00 51.10  ? 169  PHE B C     1 
ATOM   3490  O O     . PHE B 2 177  ? 155.798 146.333 143.064 1.00 51.10  ? 169  PHE B O     1 
ATOM   3491  C CB    . PHE B 2 177  ? 155.808 146.883 146.283 1.00 51.10  ? 169  PHE B CB    1 
ATOM   3492  C CG    . PHE B 2 177  ? 155.722 148.231 145.629 1.00 51.10  ? 169  PHE B CG    1 
ATOM   3493  C CD1   . PHE B 2 177  ? 154.515 148.905 145.553 1.00 51.10  ? 169  PHE B CD1   1 
ATOM   3494  C CD2   . PHE B 2 177  ? 156.851 148.829 145.094 1.00 51.10  ? 169  PHE B CD2   1 
ATOM   3495  C CE1   . PHE B 2 177  ? 154.433 150.147 144.953 1.00 51.10  ? 169  PHE B CE1   1 
ATOM   3496  C CE2   . PHE B 2 177  ? 156.777 150.071 144.493 1.00 51.10  ? 169  PHE B CE2   1 
ATOM   3497  C CZ    . PHE B 2 177  ? 155.566 150.730 144.422 1.00 51.10  ? 169  PHE B CZ    1 
ATOM   3498  N N     . CYS B 2 178  ? 157.499 145.308 144.117 1.00 50.73  ? 170  CYS B N     1 
ATOM   3499  C CA    . CYS B 2 178  ? 158.357 145.347 142.944 1.00 50.73  ? 170  CYS B CA    1 
ATOM   3500  C C     . CYS B 2 178  ? 157.734 144.528 141.821 1.00 50.73  ? 170  CYS B C     1 
ATOM   3501  O O     . CYS B 2 178  ? 157.725 144.951 140.664 1.00 50.73  ? 170  CYS B O     1 
ATOM   3502  C CB    . CYS B 2 178  ? 159.749 144.810 143.278 1.00 50.73  ? 170  CYS B CB    1 
ATOM   3503  N N     . LEU B 2 179  ? 157.208 143.357 142.165 1.00 49.85  ? 171  LEU B N     1 
ATOM   3504  C CA    . LEU B 2 179  ? 156.560 142.506 141.181 1.00 49.85  ? 171  LEU B CA    1 
ATOM   3505  C C     . LEU B 2 179  ? 155.322 143.206 140.636 1.00 49.85  ? 171  LEU B C     1 
ATOM   3506  O O     . LEU B 2 179  ? 155.054 143.178 139.435 1.00 49.85  ? 171  LEU B O     1 
ATOM   3507  C CB    . LEU B 2 179  ? 156.176 141.162 141.803 1.00 49.85  ? 171  LEU B CB    1 
ATOM   3508  N N     . THR B 2 180  ? 154.556 143.810 141.538 1.00 44.35  ? 172  THR B N     1 
ATOM   3509  C CA    . THR B 2 180  ? 153.345 144.526 141.161 1.00 44.35  ? 172  THR B CA    1 
ATOM   3510  C C     . THR B 2 180  ? 153.660 145.719 140.267 1.00 44.35  ? 172  THR B C     1 
ATOM   3511  O O     . THR B 2 180  ? 152.952 145.980 139.293 1.00 44.35  ? 172  THR B O     1 
ATOM   3512  C CB    . THR B 2 180  ? 152.572 145.017 142.399 1.00 44.35  ? 172  THR B CB    1 
ATOM   3513  N N     . GLY B 2 181  ? 154.726 146.440 140.601 1.00 41.29  ? 173  GLY B N     1 
ATOM   3514  C CA    . GLY B 2 181  ? 155.118 147.602 139.826 1.00 41.29  ? 173  GLY B CA    1 
ATOM   3515  C C     . GLY B 2 181  ? 155.496 147.234 138.407 1.00 41.29  ? 173  GLY B C     1 
ATOM   3516  O O     . GLY B 2 181  ? 155.126 147.922 137.457 1.00 41.29  ? 173  GLY B O     1 
ATOM   3517  N N     . LEU B 2 182  ? 156.237 146.140 138.260 1.00 38.26  ? 174  LEU B N     1 
ATOM   3518  C CA    . LEU B 2 182  ? 156.650 145.675 136.943 1.00 38.26  ? 174  LEU B CA    1 
ATOM   3519  C C     . LEU B 2 182  ? 155.428 145.281 136.124 1.00 38.26  ? 174  LEU B C     1 
ATOM   3520  O O     . LEU B 2 182  ? 155.338 145.579 134.933 1.00 38.26  ? 174  LEU B O     1 
ATOM   3521  C CB    . LEU B 2 182  ? 157.606 144.489 137.067 1.00 38.26  ? 174  LEU B CB    1 
ATOM   3522  N N     . LEU B 2 183  ? 154.495 144.608 136.793 1.00 38.98  ? 175  LEU B N     1 
ATOM   3523  C CA    . LEU B 2 183  ? 153.246 144.146 136.197 1.00 38.98  ? 175  LEU B CA    1 
ATOM   3524  C C     . LEU B 2 183  ? 152.376 145.308 135.731 1.00 38.98  ? 175  LEU B C     1 
ATOM   3525  O O     . LEU B 2 183  ? 151.726 145.232 134.688 1.00 38.98  ? 175  LEU B O     1 
ATOM   3526  C CB    . LEU B 2 183  ? 152.469 143.277 137.189 1.00 38.98  ? 175  LEU B CB    1 
ATOM   3527  N N     . VAL B 2 184  ? 152.373 146.385 136.510 1.00 33.93  ? 176  VAL B N     1 
ATOM   3528  C CA    . VAL B 2 184  ? 151.576 147.567 136.197 1.00 33.93  ? 176  VAL B CA    1 
ATOM   3529  C C     . VAL B 2 184  ? 151.991 148.183 134.866 1.00 33.93  ? 176  VAL B C     1 
ATOM   3530  O O     . VAL B 2 184  ? 151.146 148.627 134.088 1.00 33.93  ? 176  VAL B O     1 
ATOM   3531  C CB    . VAL B 2 184  ? 151.689 148.632 137.302 1.00 33.93  ? 176  VAL B CB    1 
ATOM   3532  N N     . ILE B 2 185  ? 153.294 148.208 134.603 1.00 48.66  ? 177  ILE B N     1 
ATOM   3533  C CA    . ILE B 2 185  ? 153.816 148.753 133.356 1.00 48.66  ? 177  ILE B CA    1 
ATOM   3534  C C     . ILE B 2 185  ? 153.305 147.951 132.161 1.00 48.66  ? 177  ILE B C     1 
ATOM   3535  O O     . ILE B 2 185  ? 152.965 148.519 131.123 1.00 48.66  ? 177  ILE B O     1 
ATOM   3536  C CB    . ILE B 2 185  ? 155.355 148.758 133.341 1.00 48.66  ? 177  ILE B CB    1 
ATOM   3537  N N     . LEU B 2 186  ? 153.181 146.638 132.321 1.00 44.97  ? 178  LEU B N     1 
ATOM   3538  C CA    . LEU B 2 186  ? 152.699 145.802 131.226 1.00 44.97  ? 178  LEU B CA    1 
ATOM   3539  C C     . LEU B 2 186  ? 151.277 146.193 130.823 1.00 44.97  ? 178  LEU B C     1 
ATOM   3540  O O     . LEU B 2 186  ? 150.954 146.267 129.632 1.00 44.97  ? 178  LEU B O     1 
ATOM   3541  C CB    . LEU B 2 186  ? 152.746 144.325 131.620 1.00 44.97  ? 178  LEU B CB    1 
ATOM   3542  N N     . TYR B 2 187  ? 150.435 146.461 131.815 1.00 38.71  ? 179  TYR B N     1 
ATOM   3543  C CA    . TYR B 2 187  ? 149.055 146.851 131.551 1.00 38.71  ? 179  TYR B CA    1 
ATOM   3544  C C     . TYR B 2 187  ? 149.017 148.166 130.781 1.00 38.71  ? 179  TYR B C     1 
ATOM   3545  O O     . TYR B 2 187  ? 148.247 148.320 129.832 1.00 38.71  ? 179  TYR B O     1 
ATOM   3546  C CB    . TYR B 2 187  ? 148.266 146.965 132.856 1.00 38.71  ? 179  TYR B CB    1 
ATOM   3547  C CG    . TYR B 2 187  ? 148.129 145.654 133.597 1.00 38.71  ? 179  TYR B CG    1 
ATOM   3548  C CD1   . TYR B 2 187  ? 147.851 144.476 132.917 1.00 38.71  ? 179  TYR B CD1   1 
ATOM   3549  C CD2   . TYR B 2 187  ? 148.288 145.593 134.975 1.00 38.71  ? 179  TYR B CD2   1 
ATOM   3550  C CE1   . TYR B 2 187  ? 147.727 143.275 133.589 1.00 38.71  ? 179  TYR B CE1   1 
ATOM   3551  C CE2   . TYR B 2 187  ? 148.167 144.396 135.656 1.00 38.71  ? 179  TYR B CE2   1 
ATOM   3552  C CZ    . TYR B 2 187  ? 147.886 143.241 134.958 1.00 38.71  ? 179  TYR B CZ    1 
ATOM   3553  O OH    . TYR B 2 187  ? 147.766 142.048 135.633 1.00 38.71  ? 179  TYR B OH    1 
ATOM   3554  N N     . GLY B 2 188  ? 149.876 149.103 131.177 1.00 41.52  ? 180  GLY B N     1 
ATOM   3555  C CA    . GLY B 2 188  ? 149.968 150.396 130.518 1.00 41.52  ? 180  GLY B CA    1 
ATOM   3556  C C     . GLY B 2 188  ? 150.418 150.231 129.079 1.00 41.52  ? 180  GLY B C     1 
ATOM   3557  O O     . GLY B 2 188  ? 149.919 150.897 128.172 1.00 41.52  ? 180  GLY B O     1 
ATOM   3558  N N     . MET B 2 189  ? 151.420 149.377 128.898 1.00 32.68  ? 181  MET B N     1 
ATOM   3559  C CA    . MET B 2 189  ? 151.962 149.028 127.589 1.00 32.68  ? 181  MET B CA    1 
ATOM   3560  C C     . MET B 2 189  ? 150.918 148.269 126.770 1.00 32.68  ? 181  MET B C     1 
ATOM   3561  O O     . MET B 2 189  ? 150.808 148.434 125.556 1.00 32.68  ? 181  MET B O     1 
ATOM   3562  C CB    . MET B 2 189  ? 153.230 148.187 127.740 1.00 32.68  ? 181  MET B CB    1 
ATOM   3563  N N     . LEU B 2 190  ? 150.156 147.436 127.471 1.00 24.54  ? 182  LEU B N     1 
ATOM   3564  C CA    . LEU B 2 190  ? 149.127 146.581 126.884 1.00 24.54  ? 182  LEU B CA    1 
ATOM   3565  C C     . LEU B 2 190  ? 148.023 147.351 126.166 1.00 24.54  ? 182  LEU B C     1 
ATOM   3566  O O     . LEU B 2 190  ? 147.501 146.894 125.150 1.00 24.54  ? 182  LEU B O     1 
ATOM   3567  C CB    . LEU B 2 190  ? 148.516 145.676 127.956 1.00 24.54  ? 182  LEU B CB    1 
ATOM   3568  N N     . LEU B 2 191  ? 147.708 148.567 126.595 1.00 29.09  ? 183  LEU B N     1 
ATOM   3569  C CA    . LEU B 2 191  ? 146.622 149.322 125.948 1.00 29.09  ? 183  LEU B CA    1 
ATOM   3570  C C     . LEU B 2 191  ? 146.813 149.656 124.451 1.00 29.09  ? 183  LEU B C     1 
ATOM   3571  O O     . LEU B 2 191  ? 145.865 149.559 123.642 1.00 29.09  ? 183  LEU B O     1 
ATOM   3572  C CB    . LEU B 2 191  ? 146.336 150.608 126.730 1.00 29.09  ? 183  LEU B CB    1 
ATOM   3573  N N     . LEU B 2 192  ? 148.041 150.006 124.077 1.00 28.80  ? 184  LEU B N     1 
ATOM   3574  C CA    . LEU B 2 192  ? 148.332 150.396 122.699 1.00 28.80  ? 184  LEU B CA    1 
ATOM   3575  C C     . LEU B 2 192  ? 148.016 149.273 121.721 1.00 28.80  ? 184  LEU B C     1 
ATOM   3576  O O     . LEU B 2 192  ? 147.432 149.510 120.662 1.00 28.80  ? 184  LEU B O     1 
ATOM   3577  C CB    . LEU B 2 192  ? 149.796 150.816 122.561 1.00 28.80  ? 184  LEU B CB    1 
ATOM   3578  N N     . VAL B 2 193  ? 148.324 148.042 122.119 1.00 23.10  ? 185  VAL B N     1 
ATOM   3579  C CA    . VAL B 2 193  ? 148.065 146.873 121.286 1.00 23.10  ? 185  VAL B CA    1 
ATOM   3580  C C     . VAL B 2 193  ? 146.565 146.769 121.039 1.00 23.10  ? 185  VAL B C     1 
ATOM   3581  O O     . VAL B 2 193  ? 146.123 146.414 119.948 1.00 23.10  ? 185  VAL B O     1 
ATOM   3582  C CB    . VAL B 2 193  ? 148.563 145.579 121.953 1.00 23.10  ? 185  VAL B CB    1 
ATOM   3583  N N     . GLU B 2 194  ? 145.789 147.084 122.074 1.00 25.37  ? 186  GLU B N     1 
ATOM   3584  C CA    . GLU B 2 194  ? 144.323 147.073 122.028 1.00 25.37  ? 186  GLU B CA    1 
ATOM   3585  C C     . GLU B 2 194  ? 143.695 148.251 121.261 1.00 25.37  ? 186  GLU B C     1 
ATOM   3586  O O     . GLU B 2 194  ? 142.505 148.237 120.948 1.00 25.37  ? 186  GLU B O     1 
ATOM   3587  C CB    . GLU B 2 194  ? 143.748 147.013 123.446 1.00 25.37  ? 186  GLU B CB    1 
ATOM   3588  N N     . VAL B 2 195  ? 144.505 149.263 120.966 1.00 23.00  ? 187  VAL B N     1 
ATOM   3589  C CA    . VAL B 2 195  ? 144.079 150.476 120.280 1.00 23.00  ? 187  VAL B CA    1 
ATOM   3590  C C     . VAL B 2 195  ? 144.256 150.415 118.763 1.00 23.00  ? 187  VAL B C     1 
ATOM   3591  O O     . VAL B 2 195  ? 144.205 151.446 118.092 1.00 23.00  ? 187  VAL B O     1 
ATOM   3592  C CB    . VAL B 2 195  ? 144.823 151.714 120.816 1.00 23.00  ? 187  VAL B CB    1 
ATOM   3593  N N     . ASN B 2 196  ? 144.470 149.219 118.225 1.00 29.36  ? 188  ASN B N     1 
ATOM   3594  C CA    . ASN B 2 196  ? 144.675 149.077 116.786 1.00 29.36  ? 188  ASN B CA    1 
ATOM   3595  C C     . ASN B 2 196  ? 143.506 149.661 115.999 1.00 29.36  ? 188  ASN B C     1 
ATOM   3596  O O     . ASN B 2 196  ? 142.340 149.479 116.350 1.00 29.36  ? 188  ASN B O     1 
ATOM   3597  C CB    . ASN B 2 196  ? 144.885 147.610 116.409 1.00 29.36  ? 188  ASN B CB    1 
ATOM   3598  C CG    . ASN B 2 196  ? 146.255 147.098 116.805 1.00 29.36  ? 188  ASN B CG    1 
ATOM   3599  O OD1   . ASN B 2 196  ? 147.046 147.818 117.414 1.00 29.36  ? 188  ASN B OD1   1 
ATOM   3600  N ND2   . ASN B 2 196  ? 146.543 145.849 116.461 1.00 29.36  ? 188  ASN B ND2   1 
ATOM   3601  N N     . VAL B 2 197  ? 143.851 150.366 114.927 1.00 28.67  ? 189  VAL B N     1 
ATOM   3602  C CA    . VAL B 2 197  ? 142.893 151.076 114.081 1.00 28.67  ? 189  VAL B CA    1 
ATOM   3603  C C     . VAL B 2 197  ? 142.358 150.139 112.995 1.00 28.67  ? 189  VAL B C     1 
ATOM   3604  O O     . VAL B 2 197  ? 141.358 150.436 112.341 1.00 28.67  ? 189  VAL B O     1 
ATOM   3605  C CB    . VAL B 2 197  ? 143.562 152.296 113.399 1.00 28.67  ? 189  VAL B CB    1 
ATOM   3606  C CG1   . VAL B 2 197  ? 142.508 153.316 112.981 1.00 28.67  ? 189  VAL B CG1   1 
ATOM   3607  C CG2   . VAL B 2 197  ? 144.580 152.920 114.340 1.00 28.67  ? 189  VAL B CG2   1 
ATOM   3608  N N     . ILE B 2 198  ? 143.032 149.005 112.814 1.00 36.28  ? 190  ILE B N     1 
ATOM   3609  C CA    . ILE B 2 198  ? 142.634 148.024 111.806 1.00 36.28  ? 190  ILE B CA    1 
ATOM   3610  C C     . ILE B 2 198  ? 141.561 147.062 112.310 1.00 36.28  ? 190  ILE B C     1 
ATOM   3611  O O     . ILE B 2 198  ? 141.133 146.164 111.582 1.00 36.28  ? 190  ILE B O     1 
ATOM   3612  C CB    . ILE B 2 198  ? 143.842 147.202 111.320 1.00 36.28  ? 190  ILE B CB    1 
ATOM   3613  N N     . ARG B 2 199  ? 141.133 147.251 113.557 1.00 51.61  ? 191  ARG B N     1 
ATOM   3614  C CA    . ARG B 2 199  ? 140.099 146.409 114.158 1.00 51.61  ? 191  ARG B CA    1 
ATOM   3615  C C     . ARG B 2 199  ? 138.734 147.062 113.935 1.00 51.61  ? 191  ARG B C     1 
ATOM   3616  O O     . ARG B 2 199  ? 138.508 148.202 114.339 1.00 51.61  ? 191  ARG B O     1 
ATOM   3617  C CB    . ARG B 2 199  ? 140.373 146.237 115.657 1.00 51.61  ? 191  ARG B CB    1 
ATOM   3618  N N     . VAL B 2 200  ? 137.828 146.330 113.292 1.00 74.98  ? 192  VAL B N     1 
ATOM   3619  C CA    . VAL B 2 200  ? 136.494 146.839 112.986 1.00 74.98  ? 192  VAL B CA    1 
ATOM   3620  C C     . VAL B 2 200  ? 135.384 146.334 113.910 1.00 74.98  ? 192  VAL B C     1 
ATOM   3621  O O     . VAL B 2 200  ? 134.234 146.193 113.487 1.00 74.98  ? 192  VAL B O     1 
ATOM   3622  C CB    . VAL B 2 200  ? 136.100 146.501 111.532 1.00 74.98  ? 192  VAL B CB    1 
ATOM   3623  N N     . ARG B 2 201  ? 135.722 146.074 115.170 1.00 85.24  ? 193  ARG B N     1 
ATOM   3624  C CA    . ARG B 2 201  ? 134.746 145.567 116.134 1.00 85.24  ? 193  ARG B CA    1 
ATOM   3625  C C     . ARG B 2 201  ? 133.799 146.624 116.694 1.00 85.24  ? 193  ARG B C     1 
ATOM   3626  O O     . ARG B 2 201  ? 132.770 146.287 117.284 1.00 85.24  ? 193  ARG B O     1 
ATOM   3627  C CB    . ARG B 2 201  ? 135.473 144.878 117.292 1.00 85.24  ? 193  ARG B CB    1 
ATOM   3628  N N     . ARG B 2 202  ? 134.138 147.896 116.504 1.00 78.85  ? 194  ARG B N     1 
ATOM   3629  C CA    . ARG B 2 202  ? 133.317 148.992 117.016 1.00 78.85  ? 194  ARG B CA    1 
ATOM   3630  C C     . ARG B 2 202  ? 132.122 149.342 116.130 1.00 78.85  ? 194  ARG B C     1 
ATOM   3631  O O     . ARG B 2 202  ? 132.029 148.901 114.985 1.00 78.85  ? 194  ARG B O     1 
ATOM   3632  C CB    . ARG B 2 202  ? 134.186 150.236 117.227 1.00 78.85  ? 194  ARG B CB    1 
ATOM   3633  N N     . TYR B 2 203  ? 131.210 150.139 116.681 1.00 94.75  ? 195  TYR B N     1 
ATOM   3634  C CA    . TYR B 2 203  ? 130.012 150.567 115.970 1.00 94.75  ? 195  TYR B CA    1 
ATOM   3635  C C     . TYR B 2 203  ? 130.365 151.515 114.828 1.00 94.75  ? 195  TYR B C     1 
ATOM   3636  O O     . TYR B 2 203  ? 129.657 151.582 113.820 1.00 94.75  ? 195  TYR B O     1 
ATOM   3637  C CB    . TYR B 2 203  ? 129.043 151.260 116.932 1.00 94.75  ? 195  TYR B CB    1 
ATOM   3638  N N     . ILE B 2 204  ? 131.465 152.243 114.993 1.00 100.64 ? 196  ILE B N     1 
ATOM   3639  C CA    . ILE B 2 204  ? 131.936 153.194 113.991 1.00 100.64 ? 196  ILE B CA    1 
ATOM   3640  C C     . ILE B 2 204  ? 132.715 152.501 112.869 1.00 100.64 ? 196  ILE B C     1 
ATOM   3641  O O     . ILE B 2 204  ? 133.249 151.411 113.061 1.00 100.64 ? 196  ILE B O     1 
ATOM   3642  C CB    . ILE B 2 204  ? 132.833 154.266 114.639 1.00 100.64 ? 196  ILE B CB    1 
ATOM   3643  N N     . PHE B 2 205  ? 132.779 153.148 111.706 1.00 90.61  ? 197  PHE B N     1 
ATOM   3644  C CA    . PHE B 2 205  ? 133.461 152.602 110.531 1.00 90.61  ? 197  PHE B CA    1 
ATOM   3645  C C     . PHE B 2 205  ? 133.155 151.126 110.266 1.00 90.61  ? 197  PHE B C     1 
ATOM   3646  O O     . PHE B 2 205  ? 134.055 150.289 110.232 1.00 90.61  ? 197  PHE B O     1 
ATOM   3647  C CB    . PHE B 2 205  ? 134.989 152.858 110.559 1.00 90.61  ? 197  PHE B CB    1 
ATOM   3648  C CG    . PHE B 2 205  ? 135.697 152.397 111.805 1.00 90.61  ? 197  PHE B CG    1 
ATOM   3649  C CD1   . PHE B 2 205  ? 135.878 153.260 112.881 1.00 90.61  ? 197  PHE B CD1   1 
ATOM   3650  C CD2   . PHE B 2 205  ? 136.231 151.113 111.881 1.00 90.61  ? 197  PHE B CD2   1 
ATOM   3651  C CE1   . PHE B 2 205  ? 136.593 152.854 114.007 1.00 90.61  ? 197  PHE B CE1   1 
ATOM   3652  C CE2   . PHE B 2 205  ? 136.946 150.701 113.002 1.00 90.61  ? 197  PHE B CE2   1 
ATOM   3653  C CZ    . PHE B 2 205  ? 137.124 151.572 114.067 1.00 90.61  ? 197  PHE B CZ    1 
ATOM   3654  N N     . PHE B 2 206  ? 131.870 150.818 110.086 1.00 86.27  ? 198  PHE B N     1 
ATOM   3655  C CA    . PHE B 2 206  ? 131.395 149.447 109.857 1.00 86.27  ? 198  PHE B CA    1 
ATOM   3656  C C     . PHE B 2 206  ? 132.057 148.689 108.709 1.00 86.27  ? 198  PHE B C     1 
ATOM   3657  O O     . PHE B 2 206  ? 131.837 147.487 108.547 1.00 86.27  ? 198  PHE B O     1 
ATOM   3658  C CB    . PHE B 2 206  ? 129.876 149.462 109.629 1.00 86.27  ? 198  PHE B CB    1 
ATOM   3659  N N     . LYS B 2 207  ? 132.865 149.386 107.916 1.00 79.91  ? 199  LYS B N     1 
ATOM   3660  C CA    . LYS B 2 207  ? 133.572 148.757 106.803 1.00 79.91  ? 199  LYS B CA    1 
ATOM   3661  C C     . LYS B 2 207  ? 135.012 148.486 107.238 1.00 79.91  ? 199  LYS B C     1 
ATOM   3662  O O     . LYS B 2 207  ? 135.409 148.867 108.342 1.00 79.91  ? 199  LYS B O     1 
ATOM   3663  C CB    . LYS B 2 207  ? 133.562 149.680 105.579 1.00 79.91  ? 199  LYS B CB    1 
ATOM   3664  N N     . THR B 2 208  ? 135.782 147.821 106.383 1.00 81.26  ? 200  THR B N     1 
ATOM   3665  C CA    . THR B 2 208  ? 137.168 147.528 106.703 1.00 81.26  ? 200  THR B CA    1 
ATOM   3666  C C     . THR B 2 208  ? 138.009 148.794 106.573 1.00 81.26  ? 200  THR B C     1 
ATOM   3667  O O     . THR B 2 208  ? 138.135 149.362 105.486 1.00 81.26  ? 200  THR B O     1 
ATOM   3668  C CB    . THR B 2 208  ? 137.759 146.459 105.764 1.00 81.26  ? 200  THR B CB    1 
ATOM   3669  N N     . PRO B 2 209  ? 138.579 149.264 107.692 1.00 83.26  ? 201  PRO B N     1 
ATOM   3670  C CA    . PRO B 2 209  ? 139.416 150.467 107.736 1.00 83.26  ? 201  PRO B CA    1 
ATOM   3671  C C     . PRO B 2 209  ? 140.695 150.366 106.906 1.00 83.26  ? 201  PRO B C     1 
ATOM   3672  O O     . PRO B 2 209  ? 141.267 151.380 106.501 1.00 83.26  ? 201  PRO B O     1 
ATOM   3673  C CB    . PRO B 2 209  ? 139.699 150.626 109.228 1.00 83.26  ? 201  PRO B CB    1 
ATOM   3674  C CG    . PRO B 2 209  ? 139.728 149.209 109.704 1.00 83.26  ? 201  PRO B CG    1 
ATOM   3675  C CD    . PRO B 2 209  ? 138.518 148.624 109.018 1.00 83.26  ? 201  PRO B CD    1 
ATOM   3676  N N     . ARG B 2 210  ? 141.133 149.136 106.662 1.00 123.66 ? 202  ARG B N     1 
ATOM   3677  C CA    . ARG B 2 210  ? 142.351 148.881 105.894 1.00 123.66 ? 202  ARG B CA    1 
ATOM   3678  C C     . ARG B 2 210  ? 142.144 147.750 104.886 1.00 123.66 ? 202  ARG B C     1 
ATOM   3679  O O     . ARG B 2 210  ? 142.060 146.580 105.260 1.00 123.66 ? 202  ARG B O     1 
ATOM   3680  C CB    . ARG B 2 210  ? 143.501 148.522 106.841 1.00 123.66 ? 202  ARG B CB    1 
ATOM   3681  N N     . GLU B 2 211  ? 142.071 148.109 103.608 1.00 169.73 ? 203  GLU B N     1 
ATOM   3682  C CA    . GLU B 2 211  ? 141.857 147.136 102.543 1.00 169.73 ? 203  GLU B CA    1 
ATOM   3683  C C     . GLU B 2 211  ? 143.143 146.642 101.894 1.00 169.73 ? 203  GLU B C     1 
ATOM   3684  O O     . GLU B 2 211  ? 143.129 145.686 101.115 1.00 169.73 ? 203  GLU B O     1 
ATOM   3685  C CB    . GLU B 2 211  ? 140.949 147.732 101.463 1.00 169.73 ? 203  GLU B CB    1 
ATOM   3686  N N     . VAL B 2 212  ? 144.256 147.296 102.206 1.00 187.03 ? 204  VAL B N     1 
ATOM   3687  C CA    . VAL B 2 212  ? 145.540 146.913 101.630 1.00 187.03 ? 204  VAL B CA    1 
ATOM   3688  C C     . VAL B 2 212  ? 146.345 146.066 102.602 1.00 187.03 ? 204  VAL B C     1 
ATOM   3689  O O     . VAL B 2 212  ? 147.471 145.674 102.303 1.00 187.03 ? 204  VAL B O     1 
ATOM   3690  C CB    . VAL B 2 212  ? 146.379 148.147 101.264 1.00 187.03 ? 204  VAL B CB    1 
ATOM   3691  N N     . LYS B 2 213  ? 145.756 145.787 103.760 1.00 159.81 ? 205  LYS B N     1 
ATOM   3692  C CA    . LYS B 2 213  ? 146.416 144.997 104.784 1.00 159.81 ? 205  LYS B CA    1 
ATOM   3693  C C     . LYS B 2 213  ? 146.391 143.496 104.519 1.00 159.81 ? 205  LYS B C     1 
ATOM   3694  O O     . LYS B 2 213  ? 147.390 142.808 104.735 1.00 159.81 ? 205  LYS B O     1 
ATOM   3695  C CB    . LYS B 2 213  ? 145.781 145.272 106.150 1.00 159.81 ? 205  LYS B CB    1 
ATOM   3696  N N     . PRO B 2 214  ? 145.251 142.966 104.036 1.00 141.25 ? 206  PRO B N     1 
ATOM   3697  C CA    . PRO B 2 214  ? 145.128 141.532 103.757 1.00 141.25 ? 206  PRO B CA    1 
ATOM   3698  C C     . PRO B 2 214  ? 146.168 141.000 102.773 1.00 141.25 ? 206  PRO B C     1 
ATOM   3699  O O     . PRO B 2 214  ? 146.805 139.987 103.041 1.00 141.25 ? 206  PRO B O     1 
ATOM   3700  C CB    . PRO B 2 214  ? 143.700 141.406 103.218 1.00 141.25 ? 206  PRO B CB    1 
ATOM   3701  C CG    . PRO B 2 214  ? 142.982 142.471 103.959 1.00 141.25 ? 206  PRO B CG    1 
ATOM   3702  C CD    . PRO B 2 214  ? 143.946 143.631 103.873 1.00 141.25 ? 206  PRO B CD    1 
ATOM   3703  N N     . PRO B 2 215  ? 146.348 141.671 101.617 1.00 119.50 ? 207  PRO B N     1 
ATOM   3704  C CA    . PRO B 2 215  ? 147.339 141.210 100.634 1.00 119.50 ? 207  PRO B CA    1 
ATOM   3705  C C     . PRO B 2 215  ? 148.764 141.596 101.032 1.00 119.50 ? 207  PRO B C     1 
ATOM   3706  O O     . PRO B 2 215  ? 149.081 142.781 101.154 1.00 119.50 ? 207  PRO B O     1 
ATOM   3707  C CB    . PRO B 2 215  ? 146.908 141.915 99.340  1.00 119.50 ? 207  PRO B CB    1 
ATOM   3708  C CG    . PRO B 2 215  ? 145.445 142.188 99.557  1.00 119.50 ? 207  PRO B CG    1 
ATOM   3709  C CD    . PRO B 2 215  ? 145.436 142.641 100.989 1.00 119.50 ? 207  PRO B CD    1 
ATOM   3710  N N     . GLU B 2 216  ? 149.623 140.601 101.231 1.00 61.67  ? 208  GLU B N     1 
ATOM   3711  C CA    . GLU B 2 216  ? 151.013 140.855 101.618 1.00 61.67  ? 208  GLU B CA    1 
ATOM   3712  C C     . GLU B 2 216  ? 151.977 140.612 100.455 1.00 61.67  ? 208  GLU B C     1 
ATOM   3713  O O     . GLU B 2 216  ? 151.703 139.801 99.571  1.00 61.67  ? 208  GLU B O     1 
ATOM   3714  C CB    . GLU B 2 216  ? 151.390 139.967 102.810 1.00 61.67  ? 208  GLU B CB    1 
ATOM   3715  N N     . ASP B 2 217  ? 153.054 141.387 100.400 1.00 53.14  ? 209  ASP B N     1 
ATOM   3716  C CA    . ASP B 2 217  ? 154.070 141.200 99.371  1.00 53.14  ? 209  ASP B CA    1 
ATOM   3717  C C     . ASP B 2 217  ? 154.777 139.860 99.581  1.00 53.14  ? 209  ASP B C     1 
ATOM   3718  O O     . ASP B 2 217  ? 155.066 139.120 98.631  1.00 53.14  ? 209  ASP B O     1 
ATOM   3719  C CB    . ASP B 2 217  ? 155.084 142.343 99.400  1.00 53.14  ? 209  ASP B CB    1 
ATOM   3720  N N     . LEU B 2 218  ? 155.030 139.557 100.851 1.00 56.99  ? 210  LEU B N     1 
ATOM   3721  C CA    . LEU B 2 218  ? 155.733 138.344 101.249 1.00 56.99  ? 210  LEU B CA    1 
ATOM   3722  C C     . LEU B 2 218  ? 155.010 137.061 100.862 1.00 56.99  ? 210  LEU B C     1 
ATOM   3723  O O     . LEU B 2 218  ? 155.643 136.109 100.419 1.00 56.99  ? 210  LEU B O     1 
ATOM   3724  C CB    . LEU B 2 218  ? 156.000 138.355 102.756 1.00 56.99  ? 210  LEU B CB    1 
ATOM   3725  N N     . GLN B 2 219  ? 153.690 137.030 101.021 1.00 63.32  ? 211  GLN B N     1 
ATOM   3726  C CA    . GLN B 2 219  ? 152.933 135.834 100.665 1.00 63.32  ? 211  GLN B CA    1 
ATOM   3727  C C     . GLN B 2 219  ? 153.062 135.563 99.170  1.00 63.32  ? 211  GLN B C     1 
ATOM   3728  O O     . GLN B 2 219  ? 153.280 134.423 98.743  1.00 63.32  ? 211  GLN B O     1 
ATOM   3729  C CB    . GLN B 2 219  ? 151.461 135.996 101.047 1.00 63.32  ? 211  GLN B CB    1 
ATOM   3730  N N     . ASP B 2 220  ? 152.967 136.629 98.378  1.00 52.56  ? 212  ASP B N     1 
ATOM   3731  C CA    . ASP B 2 220  ? 153.090 136.521 96.932  1.00 52.56  ? 212  ASP B CA    1 
ATOM   3732  C C     . ASP B 2 220  ? 154.483 136.025 96.574  1.00 52.56  ? 212  ASP B C     1 
ATOM   3733  O O     . ASP B 2 220  ? 154.640 135.156 95.715  1.00 52.56  ? 212  ASP B O     1 
ATOM   3734  C CB    . ASP B 2 220  ? 152.823 137.872 96.267  1.00 52.56  ? 212  ASP B CB    1 
ATOM   3735  N N     . LEU B 2 221  ? 155.480 136.417 97.360  1.00 48.96  ? 213  LEU B N     1 
ATOM   3736  C CA    . LEU B 2 221  ? 156.824 135.890 97.152  1.00 48.96  ? 213  LEU B CA    1 
ATOM   3737  C C     . LEU B 2 221  ? 156.755 134.372 97.404  1.00 48.96  ? 213  LEU B C     1 
ATOM   3738  O O     . LEU B 2 221  ? 157.194 133.583 96.575  1.00 48.96  ? 213  LEU B O     1 
ATOM   3739  C CB    . LEU B 2 221  ? 157.827 136.552 98.097  1.00 48.96  ? 213  LEU B CB    1 
ATOM   3740  N N     . GLY B 2 222  ? 156.150 134.002 98.534  1.00 54.77  ? 214  GLY B N     1 
ATOM   3741  C CA    . GLY B 2 222  ? 155.926 132.628 98.985  1.00 54.77  ? 214  GLY B CA    1 
ATOM   3742  C C     . GLY B 2 222  ? 154.989 131.682 98.222  1.00 54.77  ? 214  GLY B C     1 
ATOM   3743  O O     . GLY B 2 222  ? 155.197 130.472 98.213  1.00 54.77  ? 214  GLY B O     1 
ATOM   3744  N N     . VAL B 2 223  ? 153.915 132.212 97.640  1.00 44.35  ? 215  VAL B N     1 
ATOM   3745  C CA    . VAL B 2 223  ? 152.914 131.410 96.930  1.00 44.35  ? 215  VAL B CA    1 
ATOM   3746  C C     . VAL B 2 223  ? 153.536 130.673 95.756  1.00 44.35  ? 215  VAL B C     1 
ATOM   3747  O O     . VAL B 2 223  ? 153.226 129.509 95.501  1.00 44.35  ? 215  VAL B O     1 
ATOM   3748  C CB    . VAL B 2 223  ? 151.751 132.281 96.420  1.00 44.35  ? 215  VAL B CB    1 
ATOM   3749  N N     . ARG B 2 224  ? 154.417 131.363 95.044  1.00 46.53  ? 216  ARG B N     1 
ATOM   3750  C CA    . ARG B 2 224  ? 155.164 130.768 93.937  1.00 46.53  ? 216  ARG B CA    1 
ATOM   3751  C C     . ARG B 2 224  ? 156.508 130.180 94.423  1.00 46.53  ? 216  ARG B C     1 
ATOM   3752  O O     . ARG B 2 224  ? 157.303 129.690 93.622  1.00 46.53  ? 216  ARG B O     1 
ATOM   3753  C CB    . ARG B 2 224  ? 155.406 131.802 92.836  1.00 46.53  ? 216  ARG B CB    1 
ATOM   3754  N N     . PHE B 2 225  ? 156.746 130.237 95.735  1.00 41.33  ? 217  PHE B N     1 
ATOM   3755  C CA    . PHE B 2 225  ? 157.965 129.772 96.362  1.00 41.33  ? 217  PHE B CA    1 
ATOM   3756  C C     . PHE B 2 225  ? 157.881 128.371 96.950  1.00 41.33  ? 217  PHE B C     1 
ATOM   3757  O O     . PHE B 2 225  ? 157.006 128.074 97.762  1.00 41.33  ? 217  PHE B O     1 
ATOM   3758  C CB    . PHE B 2 225  ? 158.319 130.726 97.506  1.00 41.33  ? 217  PHE B CB    1 
ATOM   3759  N N     . LEU B 2 226  ? 158.804 127.509 96.535  1.00 44.89  ? 218  LEU B N     1 
ATOM   3760  C CA    . LEU B 2 226  ? 158.894 126.158 97.074  1.00 44.89  ? 218  LEU B CA    1 
ATOM   3761  C C     . LEU B 2 226  ? 159.263 126.242 98.556  1.00 44.89  ? 218  LEU B C     1 
ATOM   3762  O O     . LEU B 2 226  ? 158.729 125.505 99.385  1.00 44.89  ? 218  LEU B O     1 
ATOM   3763  C CB    . LEU B 2 226  ? 159.939 125.342 96.313  1.00 44.89  ? 218  LEU B CB    1 
ATOM   3764  N N     . GLN B 2 227  ? 160.160 127.175 98.863  1.00 43.75  ? 219  GLN B N     1 
ATOM   3765  C CA    . GLN B 2 227  ? 160.611 127.444 100.222 1.00 43.75  ? 219  GLN B CA    1 
ATOM   3766  C C     . GLN B 2 227  ? 160.503 128.953 100.405 1.00 43.75  ? 219  GLN B C     1 
ATOM   3767  O O     . GLN B 2 227  ? 161.248 129.711 99.785  1.00 43.75  ? 219  GLN B O     1 
ATOM   3768  C CB    . GLN B 2 227  ? 162.055 126.984 100.416 1.00 43.75  ? 219  GLN B CB    1 
ATOM   3769  N N     . PRO B 2 228  ? 159.579 129.390 101.253 1.00 41.69  ? 220  PRO B N     1 
ATOM   3770  C CA    . PRO B 2 228  ? 159.358 130.828 101.453 1.00 41.69  ? 220  PRO B CA    1 
ATOM   3771  C C     . PRO B 2 228  ? 160.554 131.596 102.013 1.00 41.69  ? 220  PRO B C     1 
ATOM   3772  O O     . PRO B 2 228  ? 160.833 132.684 101.509 1.00 41.69  ? 220  PRO B O     1 
ATOM   3773  C CB    . PRO B 2 228  ? 158.203 130.862 102.457 1.00 41.69  ? 220  PRO B CB    1 
ATOM   3774  C CG    . PRO B 2 228  ? 157.462 129.591 102.214 1.00 41.69  ? 220  PRO B CG    1 
ATOM   3775  C CD    . PRO B 2 228  ? 158.506 128.574 101.849 1.00 41.69  ? 220  PRO B CD    1 
ATOM   3776  N N     . PHE B 2 229  ? 161.228 131.059 103.029 1.00 36.34  ? 221  PHE B N     1 
ATOM   3777  C CA    . PHE B 2 229  ? 162.401 131.719 103.611 1.00 36.34  ? 221  PHE B CA    1 
ATOM   3778  C C     . PHE B 2 229  ? 162.133 133.181 103.984 1.00 36.34  ? 221  PHE B C     1 
ATOM   3779  O O     . PHE B 2 229  ? 162.939 134.058 103.673 1.00 36.34  ? 221  PHE B O     1 
ATOM   3780  C CB    . PHE B 2 229  ? 163.622 131.603 102.689 1.00 36.34  ? 221  PHE B CB    1 
ATOM   3781  N N     . VAL B 2 230  ? 161.009 133.443 104.645 1.00 29.21  ? 222  VAL B N     1 
ATOM   3782  C CA    . VAL B 2 230  ? 160.642 134.812 105.010 1.00 29.21  ? 222  VAL B CA    1 
ATOM   3783  C C     . VAL B 2 230  ? 161.018 135.202 106.438 1.00 29.21  ? 222  VAL B C     1 
ATOM   3784  O O     . VAL B 2 230  ? 160.714 134.487 107.393 1.00 29.21  ? 222  VAL B O     1 
ATOM   3785  C CB    . VAL B 2 230  ? 159.134 135.058 104.813 1.00 29.21  ? 222  VAL B CB    1 
ATOM   3786  N N     . ASN B 2 231  ? 161.681 136.348 106.568 1.00 20.12  ? 223  ASN B N     1 
ATOM   3787  C CA    . ASN B 2 231  ? 162.110 136.860 107.865 1.00 20.12  ? 223  ASN B CA    1 
ATOM   3788  C C     . ASN B 2 231  ? 160.939 137.142 108.801 1.00 20.12  ? 223  ASN B C     1 
ATOM   3789  O O     . ASN B 2 231  ? 161.048 136.957 110.012 1.00 20.12  ? 223  ASN B O     1 
ATOM   3790  C CB    . ASN B 2 231  ? 162.955 138.123 107.688 1.00 20.12  ? 223  ASN B CB    1 
ATOM   3791  N N     . LEU B 2 232  ? 159.829 137.605 108.233 1.00 30.62  ? 224  LEU B N     1 
ATOM   3792  C CA    . LEU B 2 232  ? 158.617 137.899 109.000 1.00 30.62  ? 224  LEU B CA    1 
ATOM   3793  C C     . LEU B 2 232  ? 157.982 136.678 109.673 1.00 30.62  ? 224  LEU B C     1 
ATOM   3794  O O     . LEU B 2 232  ? 156.859 136.291 109.348 1.00 30.62  ? 224  LEU B O     1 
ATOM   3795  C CB    . LEU B 2 232  ? 157.584 138.594 108.109 1.00 30.62  ? 224  LEU B CB    1 
ATOM   3796  N N     . LEU B 2 233  ? 158.713 136.078 110.611 1.00 35.22  ? 225  LEU B N     1 
ATOM   3797  C CA    . LEU B 2 233  ? 158.266 134.914 111.370 1.00 35.22  ? 225  LEU B CA    1 
ATOM   3798  C C     . LEU B 2 233  ? 158.494 135.057 112.879 1.00 35.22  ? 225  LEU B C     1 
ATOM   3799  O O     . LEU B 2 233  ? 158.816 136.141 113.366 1.00 35.22  ? 225  LEU B O     1 
ATOM   3800  C CB    . LEU B 2 233  ? 158.974 133.662 110.856 1.00 35.22  ? 225  LEU B CB    1 
ATOM   3801  N N     . SER B 2 234  ? 158.329 133.957 113.610 1.00 23.14  ? 226  SER B N     1 
ATOM   3802  C CA    . SER B 2 234  ? 158.504 133.947 115.065 1.00 23.14  ? 226  SER B CA    1 
ATOM   3803  C C     . SER B 2 234  ? 159.899 134.404 115.500 1.00 23.14  ? 226  SER B C     1 
ATOM   3804  O O     . SER B 2 234  ? 160.129 134.703 116.674 1.00 23.14  ? 226  SER B O     1 
ATOM   3805  C CB    . SER B 2 234  ? 158.246 132.537 115.607 1.00 23.14  ? 226  SER B CB    1 
ATOM   3806  N N     . LYS B 2 235  ? 160.822 134.451 114.544 1.00 33.02  ? 227  LYS B N     1 
ATOM   3807  C CA    . LYS B 2 235  ? 162.195 134.877 114.795 1.00 33.02  ? 227  LYS B CA    1 
ATOM   3808  C C     . LYS B 2 235  ? 162.935 133.996 115.800 1.00 33.02  ? 227  LYS B C     1 
ATOM   3809  O O     . LYS B 2 235  ? 163.881 134.445 116.446 1.00 33.02  ? 227  LYS B O     1 
ATOM   3810  C CB    . LYS B 2 235  ? 162.215 136.331 115.281 1.00 33.02  ? 227  LYS B CB    1 
ATOM   3811  N N     . GLY B 2 236  ? 162.509 132.746 115.932 1.00 89.46  ? 228  GLY B N     1 
ATOM   3812  C CA    . GLY B 2 236  ? 163.164 131.851 116.866 1.00 89.46  ? 228  GLY B CA    1 
ATOM   3813  C C     . GLY B 2 236  ? 164.063 130.836 116.192 1.00 89.46  ? 228  GLY B C     1 
ATOM   3814  O O     . GLY B 2 236  ? 164.718 130.045 116.871 1.00 89.46  ? 228  GLY B O     1 
ATOM   3815  N N     . THR B 2 237  ? 164.128 130.871 114.864 1.00 51.13  ? 229  THR B N     1 
ATOM   3816  C CA    . THR B 2 237  ? 164.940 129.912 114.114 1.00 51.13  ? 229  THR B CA    1 
ATOM   3817  C C     . THR B 2 237  ? 164.381 128.518 114.391 1.00 51.13  ? 229  THR B C     1 
ATOM   3818  O O     . THR B 2 237  ? 165.124 127.560 114.606 1.00 51.13  ? 229  THR B O     1 
ATOM   3819  C CB    . THR B 2 237  ? 166.422 129.966 114.541 1.00 51.13  ? 229  THR B CB    1 
ATOM   3820  N N     . TYR B 2 238  ? 163.053 128.431 114.385 1.00 53.88  ? 230  TYR B N     1 
ATOM   3821  C CA    . TYR B 2 238  ? 162.320 127.194 114.644 1.00 53.88  ? 230  TYR B CA    1 
ATOM   3822  C C     . TYR B 2 238  ? 161.635 126.671 113.386 1.00 53.88  ? 230  TYR B C     1 
ATOM   3823  O O     . TYR B 2 238  ? 161.629 125.469 113.119 1.00 53.88  ? 230  TYR B O     1 
ATOM   3824  C CB    . TYR B 2 238  ? 161.278 127.458 115.731 1.00 53.88  ? 230  TYR B CB    1 
ATOM   3825  C CG    . TYR B 2 238  ? 160.215 126.392 115.887 1.00 53.88  ? 230  TYR B CG    1 
ATOM   3826  C CD1   . TYR B 2 238  ? 160.524 125.142 116.413 1.00 53.88  ? 230  TYR B CD1   1 
ATOM   3827  C CD2   . TYR B 2 238  ? 158.888 126.649 115.538 1.00 53.88  ? 230  TYR B CD2   1 
ATOM   3828  C CE1   . TYR B 2 238  ? 159.540 124.172 116.595 1.00 53.88  ? 230  TYR B CE1   1 
ATOM   3829  C CE2   . TYR B 2 238  ? 157.894 125.688 115.713 1.00 53.88  ? 230  TYR B CE2   1 
ATOM   3830  C CZ    . TYR B 2 238  ? 158.226 124.453 116.244 1.00 53.88  ? 230  TYR B CZ    1 
ATOM   3831  O OH    . TYR B 2 238  ? 157.245 123.505 116.427 1.00 53.88  ? 230  TYR B OH    1 
ATOM   3832  N N     . TRP B 2 239  ? 161.105 127.573 112.567 1.00 63.56  ? 231  TRP B N     1 
ATOM   3833  C CA    . TRP B 2 239  ? 160.458 127.146 111.328 1.00 63.56  ? 231  TRP B CA    1 
ATOM   3834  C C     . TRP B 2 239  ? 161.453 127.110 110.163 1.00 63.56  ? 231  TRP B C     1 
ATOM   3835  O O     . TRP B 2 239  ? 161.231 126.411 109.175 1.00 63.56  ? 231  TRP B O     1 
ATOM   3836  C CB    . TRP B 2 239  ? 159.258 128.036 110.982 1.00 63.56  ? 231  TRP B CB    1 
ATOM   3837  C CG    . TRP B 2 239  ? 159.583 129.130 110.014 1.00 63.56  ? 231  TRP B CG    1 
ATOM   3838  C CD1   . TRP B 2 239  ? 159.849 130.428 110.312 1.00 63.56  ? 231  TRP B CD1   1 
ATOM   3839  C CD2   . TRP B 2 239  ? 159.714 129.009 108.591 1.00 63.56  ? 231  TRP B CD2   1 
ATOM   3840  N NE1   . TRP B 2 239  ? 160.118 131.135 109.164 1.00 63.56  ? 231  TRP B NE1   1 
ATOM   3841  C CE2   . TRP B 2 239  ? 160.044 130.284 108.093 1.00 63.56  ? 231  TRP B CE2   1 
ATOM   3842  C CE3   . TRP B 2 239  ? 159.575 127.949 107.691 1.00 63.56  ? 231  TRP B CE3   1 
ATOM   3843  C CZ2   . TRP B 2 239  ? 160.238 130.530 106.736 1.00 63.56  ? 231  TRP B CZ2   1 
ATOM   3844  C CZ3   . TRP B 2 239  ? 159.768 128.194 106.343 1.00 63.56  ? 231  TRP B CZ3   1 
ATOM   3845  C CH2   . TRP B 2 239  ? 160.095 129.474 105.878 1.00 63.56  ? 231  TRP B CH2   1 
ATOM   3846  N N     . TRP B 2 240  ? 162.550 127.856 110.285 1.00 60.20  ? 232  TRP B N     1 
ATOM   3847  C CA    . TRP B 2 240  ? 163.561 127.901 109.237 1.00 60.20  ? 232  TRP B CA    1 
ATOM   3848  C C     . TRP B 2 240  ? 164.272 126.564 109.181 1.00 60.20  ? 232  TRP B C     1 
ATOM   3849  O O     . TRP B 2 240  ? 164.925 126.225 108.195 1.00 60.20  ? 232  TRP B O     1 
ATOM   3850  C CB    . TRP B 2 240  ? 164.581 129.002 109.522 1.00 60.20  ? 232  TRP B CB    1 
ATOM   3851  C CG    . TRP B 2 240  ? 164.073 130.385 109.282 1.00 60.20  ? 232  TRP B CG    1 
ATOM   3852  C CD1   . TRP B 2 240  ? 163.234 131.100 110.083 1.00 60.20  ? 232  TRP B CD1   1 
ATOM   3853  C CD2   . TRP B 2 240  ? 164.388 131.232 108.172 1.00 60.20  ? 232  TRP B CD2   1 
ATOM   3854  N NE1   . TRP B 2 240  ? 162.997 132.338 109.536 1.00 60.20  ? 232  TRP B NE1   1 
ATOM   3855  C CE2   . TRP B 2 240  ? 163.696 132.444 108.362 1.00 60.20  ? 232  TRP B CE2   1 
ATOM   3856  C CE3   . TRP B 2 240  ? 165.185 131.082 107.033 1.00 60.20  ? 232  TRP B CE3   1 
ATOM   3857  C CZ2   . TRP B 2 240  ? 163.777 133.499 107.458 1.00 60.20  ? 232  TRP B CZ2   1 
ATOM   3858  C CZ3   . TRP B 2 240  ? 165.263 132.131 106.136 1.00 60.20  ? 232  TRP B CZ3   1 
ATOM   3859  C CH2   . TRP B 2 240  ? 164.565 133.324 106.354 1.00 60.20  ? 232  TRP B CH2   1 
ATOM   3860  N N     . MET B 2 241  ? 164.131 125.809 110.262 1.00 64.12  ? 233  MET B N     1 
ATOM   3861  C CA    . MET B 2 241  ? 164.761 124.504 110.390 1.00 64.12  ? 233  MET B CA    1 
ATOM   3862  C C     . MET B 2 241  ? 163.796 123.328 110.296 1.00 64.12  ? 233  MET B C     1 
ATOM   3863  O O     . MET B 2 241  ? 164.223 122.200 110.062 1.00 64.12  ? 233  MET B O     1 
ATOM   3864  C CB    . MET B 2 241  ? 165.531 124.422 111.710 1.00 64.12  ? 233  MET B CB    1 
ATOM   3865  N N     . ASN B 2 242  ? 162.503 123.588 110.467 1.00 74.69  ? 234  ASN B N     1 
ATOM   3866  C CA    . ASN B 2 242  ? 161.514 122.518 110.407 1.00 74.69  ? 234  ASN B CA    1 
ATOM   3867  C C     . ASN B 2 242  ? 161.030 122.263 108.986 1.00 74.69  ? 234  ASN B C     1 
ATOM   3868  O O     . ASN B 2 242  ? 160.428 121.226 108.702 1.00 74.69  ? 234  ASN B O     1 
ATOM   3869  C CB    . ASN B 2 242  ? 160.323 122.849 111.311 1.00 74.69  ? 234  ASN B CB    1 
ATOM   3870  N N     . ALA B 2 243  ? 161.305 123.210 108.094 1.00 84.13  ? 235  ALA B N     1 
ATOM   3871  C CA    . ALA B 2 243  ? 160.898 123.093 106.700 1.00 84.13  ? 235  ALA B CA    1 
ATOM   3872  C C     . ALA B 2 243  ? 161.955 122.342 105.899 1.00 84.13  ? 235  ALA B C     1 
ATOM   3873  O O     . ALA B 2 243  ? 161.648 121.707 104.889 1.00 84.13  ? 235  ALA B O     1 
ATOM   3874  C CB    . ALA B 2 243  ? 160.675 124.478 106.111 1.00 84.13  ? 235  ALA B CB    1 
ATOM   3875  N N     . PHE B 2 244  ? 163.212 122.661 106.183 1.00 64.08  ? 236  PHE B N     1 
ATOM   3876  C CA    . PHE B 2 244  ? 164.342 121.936 105.618 1.00 64.08  ? 236  PHE B CA    1 
ATOM   3877  C C     . PHE B 2 244  ? 164.430 120.564 106.294 1.00 64.08  ? 236  PHE B C     1 
ATOM   3878  O O     . PHE B 2 244  ? 164.687 119.530 105.662 1.00 64.08  ? 236  PHE B O     1 
ATOM   3879  C CB    . PHE B 2 244  ? 165.643 122.712 105.819 1.00 64.08  ? 236  PHE B CB    1 
ATOM   3880  C CG    . PHE B 2 244  ? 165.679 124.029 105.098 1.00 64.08  ? 236  PHE B CG    1 
ATOM   3881  C CD1   . PHE B 2 244  ? 164.812 124.281 104.049 1.00 64.08  ? 236  PHE B CD1   1 
ATOM   3882  C CD2   . PHE B 2 244  ? 166.581 125.013 105.467 1.00 64.08  ? 236  PHE B CD2   1 
ATOM   3883  C CE1   . PHE B 2 244  ? 164.843 125.491 103.382 1.00 64.08  ? 236  PHE B CE1   1 
ATOM   3884  C CE2   . PHE B 2 244  ? 166.618 126.224 104.805 1.00 64.08  ? 236  PHE B CE2   1 
ATOM   3885  C CZ    . PHE B 2 244  ? 165.747 126.464 103.760 1.00 64.08  ? 236  PHE B CZ    1 
ATOM   3886  N N     . ILE B 2 245  ? 164.187 120.592 107.604 1.00 59.56  ? 237  ILE B N     1 
ATOM   3887  C CA    . ILE B 2 245  ? 164.271 119.430 108.478 1.00 59.56  ? 237  ILE B CA    1 
ATOM   3888  C C     . ILE B 2 245  ? 163.306 118.296 108.166 1.00 59.56  ? 237  ILE B C     1 
ATOM   3889  O O     . ILE B 2 245  ? 163.693 117.141 108.233 1.00 59.56  ? 237  ILE B O     1 
ATOM   3890  C CB    . ILE B 2 245  ? 164.087 119.834 109.955 1.00 59.56  ? 237  ILE B CB    1 
ATOM   3891  N N     . LYS B 2 246  ? 162.057 118.603 107.832 1.00 74.18  ? 238  LYS B N     1 
ATOM   3892  C CA    . LYS B 2 246  ? 161.112 117.534 107.525 1.00 74.18  ? 238  LYS B CA    1 
ATOM   3893  C C     . LYS B 2 246  ? 161.588 116.765 106.296 1.00 74.18  ? 238  LYS B C     1 
ATOM   3894  O O     . LYS B 2 246  ? 161.605 115.524 106.277 1.00 74.18  ? 238  LYS B O     1 
ATOM   3895  C CB    . LYS B 2 246  ? 159.714 118.103 107.283 1.00 74.18  ? 238  LYS B CB    1 
ATOM   3896  N N     . THR B 2 247  ? 162.032 117.513 105.288 1.00 85.70  ? 239  THR B N     1 
ATOM   3897  C CA    . THR B 2 247  ? 162.536 116.921 104.062 1.00 85.70  ? 239  THR B CA    1 
ATOM   3898  C C     . THR B 2 247  ? 163.773 116.094 104.371 1.00 85.70  ? 239  THR B C     1 
ATOM   3899  O O     . THR B 2 247  ? 163.915 114.978 103.880 1.00 85.70  ? 239  THR B O     1 
ATOM   3900  C CB    . THR B 2 247  ? 162.893 117.995 103.019 1.00 85.70  ? 239  THR B CB    1 
ATOM   3901  N N     . ALA B 2 248  ? 164.648 116.620 105.227 1.00 94.49  ? 240  ALA B N     1 
ATOM   3902  C CA    . ALA B 2 248  ? 165.862 115.896 105.582 1.00 94.49  ? 240  ALA B CA    1 
ATOM   3903  C C     . ALA B 2 248  ? 165.524 114.579 106.279 1.00 94.49  ? 240  ALA B C     1 
ATOM   3904  O O     . ALA B 2 248  ? 166.145 113.548 106.019 1.00 94.49  ? 240  ALA B O     1 
ATOM   3905  C CB    . ALA B 2 248  ? 166.751 116.755 106.467 1.00 94.49  ? 240  ALA B CB    1 
ATOM   3906  N N     . HIS B 2 249  ? 164.533 114.624 107.163 1.00 115.61 ? 241  HIS B N     1 
ATOM   3907  C CA    . HIS B 2 249  ? 164.089 113.456 107.906 1.00 115.61 ? 241  HIS B CA    1 
ATOM   3908  C C     . HIS B 2 249  ? 163.535 112.401 106.964 1.00 115.61 ? 241  HIS B C     1 
ATOM   3909  O O     . HIS B 2 249  ? 163.803 111.211 107.135 1.00 115.61 ? 241  HIS B O     1 
ATOM   3910  C CB    . HIS B 2 249  ? 163.031 113.848 108.939 1.00 115.61 ? 241  HIS B CB    1 
ATOM   3911  N N     . LYS B 2 250  ? 162.765 112.827 105.966 1.00 157.94 ? 242  LYS B N     1 
ATOM   3912  C CA    . LYS B 2 250  ? 162.219 111.859 105.020 1.00 157.94 ? 242  LYS B CA    1 
ATOM   3913  C C     . LYS B 2 250  ? 163.386 111.251 104.253 1.00 157.94 ? 242  LYS B C     1 
ATOM   3914  O O     . LYS B 2 250  ? 164.309 111.968 103.870 1.00 157.94 ? 242  LYS B O     1 
ATOM   3915  C CB    . LYS B 2 250  ? 161.243 112.534 104.057 1.00 157.94 ? 242  LYS B CB    1 
ATOM   3916  N N     . LYS B 2 251  ? 163.375 109.944 104.011 1.00 166.49 ? 243  LYS B N     1 
ATOM   3917  C CA    . LYS B 2 251  ? 164.507 109.399 103.271 1.00 166.49 ? 243  LYS B CA    1 
ATOM   3918  C C     . LYS B 2 251  ? 164.375 109.582 101.762 1.00 166.49 ? 243  LYS B C     1 
ATOM   3919  O O     . LYS B 2 251  ? 165.339 109.957 101.094 1.00 166.49 ? 243  LYS B O     1 
ATOM   3920  C CB    . LYS B 2 251  ? 164.697 107.916 103.603 1.00 166.49 ? 243  LYS B CB    1 
ATOM   3921  N N     . PRO B 2 252  ? 163.188 109.321 101.223 1.00 171.99 ? 244  PRO B N     1 
ATOM   3922  C CA    . PRO B 2 252  ? 162.967 109.492 99.784  1.00 171.99 ? 244  PRO B CA    1 
ATOM   3923  C C     . PRO B 2 252  ? 163.105 110.956 99.381  1.00 171.99 ? 244  PRO B C     1 
ATOM   3924  O O     . PRO B 2 252  ? 163.703 111.275 98.354  1.00 171.99 ? 244  PRO B O     1 
ATOM   3925  C CB    . PRO B 2 252  ? 161.522 109.027 99.602  1.00 171.99 ? 244  PRO B CB    1 
ATOM   3926  C CG    . PRO B 2 252  ? 161.320 108.025 100.688 1.00 171.99 ? 244  PRO B CG    1 
ATOM   3927  C CD    . PRO B 2 252  ? 162.134 108.511 101.856 1.00 171.99 ? 244  PRO B CD    1 
ATOM   3928  N N     . ILE B 2 253  ? 162.544 111.834 100.207 1.00 153.98 ? 245  ILE B N     1 
ATOM   3929  C CA    . ILE B 2 253  ? 162.579 113.275 99.978  1.00 153.98 ? 245  ILE B CA    1 
ATOM   3930  C C     . ILE B 2 253  ? 163.987 113.864 100.027 1.00 153.98 ? 245  ILE B C     1 
ATOM   3931  O O     . ILE B 2 253  ? 164.326 114.750 99.244  1.00 153.98 ? 245  ILE B O     1 
ATOM   3932  C CB    . ILE B 2 253  ? 161.690 114.026 100.987 1.00 153.98 ? 245  ILE B CB    1 
ATOM   3933  N N     . ASP B 2 254  ? 164.801 113.362 100.949 1.00 154.59 ? 246  ASP B N     1 
ATOM   3934  C CA    . ASP B 2 254  ? 166.154 113.875 101.133 1.00 154.59 ? 246  ASP B CA    1 
ATOM   3935  C C     . ASP B 2 254  ? 167.046 113.726 99.908  1.00 154.59 ? 246  ASP B C     1 
ATOM   3936  O O     . ASP B 2 254  ? 167.797 114.643 99.576  1.00 154.59 ? 246  ASP B O     1 
ATOM   3937  C CB    . ASP B 2 254  ? 166.814 113.204 102.340 1.00 154.59 ? 246  ASP B CB    1 
ATOM   3938  N N     . LEU B 2 255  ? 166.973 112.585 99.232  1.00 152.55 ? 247  LEU B N     1 
ATOM   3939  C CA    . LEU B 2 255  ? 167.809 112.398 98.056  1.00 152.55 ? 247  LEU B CA    1 
ATOM   3940  C C     . LEU B 2 255  ? 167.442 113.422 96.991  1.00 152.55 ? 247  LEU B C     1 
ATOM   3941  O O     . LEU B 2 255  ? 168.317 114.033 96.377  1.00 152.55 ? 247  LEU B O     1 
ATOM   3942  C CB    . LEU B 2 255  ? 167.648 110.981 97.504  1.00 152.55 ? 247  LEU B CB    1 
ATOM   3943  N N     . ARG B 2 256  ? 166.143 113.612 96.776  1.00 152.93 ? 248  ARG B N     1 
ATOM   3944  C CA    . ARG B 2 256  ? 165.671 114.585 95.799  1.00 152.93 ? 248  ARG B CA    1 
ATOM   3945  C C     . ARG B 2 256  ? 166.018 116.010 96.216  1.00 152.93 ? 248  ARG B C     1 
ATOM   3946  O O     . ARG B 2 256  ? 166.451 116.825 95.400  1.00 152.93 ? 248  ARG B O     1 
ATOM   3947  C CB    . ARG B 2 256  ? 164.160 114.450 95.599  1.00 152.93 ? 248  ARG B CB    1 
ATOM   3948  N N     . ALA B 2 257  ? 165.822 116.298 97.498  1.00 148.83 ? 249  ALA B N     1 
ATOM   3949  C CA    . ALA B 2 257  ? 166.095 117.620 98.056  1.00 148.83 ? 249  ALA B CA    1 
ATOM   3950  C C     . ALA B 2 257  ? 167.569 118.004 98.007  1.00 148.83 ? 249  ALA B C     1 
ATOM   3951  O O     . ALA B 2 257  ? 167.916 119.146 97.707  1.00 148.83 ? 249  ALA B O     1 
ATOM   3952  C CB    . ALA B 2 257  ? 165.573 117.708 99.482  1.00 148.83 ? 249  ALA B CB    1 
ATOM   3953  N N     . ILE B 2 258  ? 168.432 117.039 98.304  1.00 135.25 ? 250  ILE B N     1 
ATOM   3954  C CA    . ILE B 2 258  ? 169.869 117.281 98.328  1.00 135.25 ? 250  ILE B CA    1 
ATOM   3955  C C     . ILE B 2 258  ? 170.515 117.287 96.947  1.00 135.25 ? 250  ILE B C     1 
ATOM   3956  O O     . ILE B 2 258  ? 171.739 117.229 96.838  1.00 135.25 ? 250  ILE B O     1 
ATOM   3957  C CB    . ILE B 2 258  ? 170.595 116.245 99.209  1.00 135.25 ? 250  ILE B CB    1 
ATOM   3958  N N     . ALA B 2 259  ? 169.706 117.357 95.893  1.00 128.74 ? 251  ALA B N     1 
ATOM   3959  C CA    . ALA B 2 259  ? 170.265 117.369 94.545  1.00 128.74 ? 251  ALA B CA    1 
ATOM   3960  C C     . ALA B 2 259  ? 169.747 118.556 93.743  1.00 128.74 ? 251  ALA B C     1 
ATOM   3961  O O     . ALA B 2 259  ? 170.505 119.221 93.035  1.00 128.74 ? 251  ALA B O     1 
ATOM   3962  C CB    . ALA B 2 259  ? 169.950 116.065 93.829  1.00 128.74 ? 251  ALA B CB    1 
ATOM   3963  N N     . LYS B 2 260  ? 168.447 118.764 93.857  1.00 98.49  ? 252  LYS B N     1 
ATOM   3964  C CA    . LYS B 2 260  ? 167.744 119.823 93.167  1.00 98.49  ? 252  LYS B CA    1 
ATOM   3965  C C     . LYS B 2 260  ? 167.454 120.945 94.144  1.00 98.49  ? 252  LYS B C     1 
ATOM   3966  O O     . LYS B 2 260  ? 166.469 121.638 93.993  1.00 98.49  ? 252  LYS B O     1 
ATOM   3967  C CB    . LYS B 2 260  ? 166.441 119.299 92.565  1.00 98.49  ? 252  LYS B CB    1 
ATOM   3968  N N     . LEU B 2 261  ? 168.322 121.124 95.140  1.00 79.24  ? 253  LEU B N     1 
ATOM   3969  C CA    . LEU B 2 261  ? 168.135 122.136 96.173  1.00 79.24  ? 253  LEU B CA    1 
ATOM   3970  C C     . LEU B 2 261  ? 168.047 123.540 95.587  1.00 79.24  ? 253  LEU B C     1 
ATOM   3971  O O     . LEU B 2 261  ? 167.245 124.350 96.050  1.00 79.24  ? 253  LEU B O     1 
ATOM   3972  C CB    . LEU B 2 261  ? 169.265 122.066 97.200  1.00 79.24  ? 253  LEU B CB    1 
ATOM   3973  N N     . PRO B 2 262  ? 168.855 123.842 94.572  1.00 67.22  ? 254  PRO B N     1 
ATOM   3974  C CA    . PRO B 2 262  ? 168.775 125.166 93.948  1.00 67.22  ? 254  PRO B CA    1 
ATOM   3975  C C     . PRO B 2 262  ? 167.381 125.345 93.350  1.00 67.22  ? 254  PRO B C     1 
ATOM   3976  O O     . PRO B 2 262  ? 166.774 126.403 93.517  1.00 67.22  ? 254  PRO B O     1 
ATOM   3977  C CB    . PRO B 2 262  ? 169.818 125.085 92.837  1.00 67.22  ? 254  PRO B CB    1 
ATOM   3978  C CG    . PRO B 2 262  ? 170.828 124.118 93.349  1.00 67.22  ? 254  PRO B CG    1 
ATOM   3979  C CD    . PRO B 2 262  ? 170.072 123.114 94.174  1.00 67.22  ? 254  PRO B CD    1 
ATOM   3980  N N     . ILE B 2 263  ? 166.883 124.317 92.664  1.00 54.12  ? 255  ILE B N     1 
ATOM   3981  C CA    . ILE B 2 263  ? 165.533 124.333 92.116  1.00 54.12  ? 255  ILE B CA    1 
ATOM   3982  C C     . ILE B 2 263  ? 164.535 124.361 93.273  1.00 54.12  ? 255  ILE B C     1 
ATOM   3983  O O     . ILE B 2 263  ? 163.528 125.067 93.232  1.00 54.12  ? 255  ILE B O     1 
ATOM   3984  C CB    . ILE B 2 263  ? 165.261 123.099 91.239  1.00 54.12  ? 255  ILE B CB    1 
ATOM   3985  N N     . ALA B 2 264  ? 164.836 123.575 94.305  1.00 48.47  ? 256  ALA B N     1 
ATOM   3986  C CA    . ALA B 2 264  ? 164.015 123.482 95.496  1.00 48.47  ? 256  ALA B CA    1 
ATOM   3987  C C     . ALA B 2 264  ? 164.023 124.855 96.115  1.00 48.47  ? 256  ALA B C     1 
ATOM   3988  O O     . ALA B 2 264  ? 162.987 125.338 96.569  1.00 48.47  ? 256  ALA B O     1 
ATOM   3989  C CB    . ALA B 2 264  ? 164.578 122.457 96.465  1.00 48.47  ? 256  ALA B CB    1 
ATOM   3990  N N     . MET B 2 265  ? 165.187 125.501 96.141  1.00 54.46  ? 257  MET B N     1 
ATOM   3991  C CA    . MET B 2 265  ? 165.166 126.857 96.665  1.00 54.46  ? 257  MET B CA    1 
ATOM   3992  C C     . MET B 2 265  ? 164.235 127.692 95.799  1.00 54.46  ? 257  MET B C     1 
ATOM   3993  O O     . MET B 2 265  ? 164.258 127.594 94.573  1.00 54.46  ? 257  MET B O     1 
ATOM   3994  C CB    . MET B 2 265  ? 166.571 127.457 96.667  1.00 54.46  ? 257  MET B CB    1 
ATOM   3995  N N     . ARG B 2 266  ? 163.483 128.556 96.438  1.00 59.75  ? 258  ARG B N     1 
ATOM   3996  C CA    . ARG B 2 266  ? 162.537 129.356 95.715  1.00 59.75  ? 258  ARG B CA    1 
ATOM   3997  C C     . ARG B 2 266  ? 163.047 130.723 95.317  1.00 59.75  ? 258  ARG B C     1 
ATOM   3998  O O     . ARG B 2 266  ? 162.289 131.497 94.722  1.00 59.75  ? 258  ARG B O     1 
ATOM   3999  C CB    . ARG B 2 266  ? 161.342 129.533 96.602  1.00 59.75  ? 258  ARG B CB    1 
ATOM   4000  N N     . ALA B 2 267  ? 164.305 131.017 95.655  1.00 47.99  ? 259  ALA B N     1 
ATOM   4001  C CA    . ALA B 2 267  ? 164.918 132.317 95.366  1.00 47.99  ? 259  ALA B CA    1 
ATOM   4002  C C     . ALA B 2 267  ? 164.006 133.418 95.897  1.00 47.99  ? 259  ALA B C     1 
ATOM   4003  O O     . ALA B 2 267  ? 163.558 134.277 95.153  1.00 47.99  ? 259  ALA B O     1 
ATOM   4004  C CB    . ALA B 2 267  ? 165.220 132.495 93.879  1.00 47.99  ? 259  ALA B CB    1 
ATOM   4005  N N     . LEU B 2 268  ? 163.649 133.313 97.171  1.00 49.73  ? 260  LEU B N     1 
ATOM   4006  C CA    . LEU B 2 268  ? 162.750 134.274 97.793  1.00 49.73  ? 260  LEU B CA    1 
ATOM   4007  C C     . LEU B 2 268  ? 163.351 135.650 98.050  1.00 49.73  ? 260  LEU B C     1 
ATOM   4008  O O     . LEU B 2 268  ? 162.716 136.663 97.759  1.00 49.73  ? 260  LEU B O     1 
ATOM   4009  C CB    . LEU B 2 268  ? 162.198 133.706 99.097  1.00 49.73  ? 260  LEU B CB    1 
ATOM   4010  N N     . THR B 2 269  ? 164.564 135.705 98.592  1.00 54.64  ? 261  THR B N     1 
ATOM   4011  C CA    . THR B 2 269  ? 165.145 137.012 98.881  1.00 54.64  ? 261  THR B CA    1 
ATOM   4012  C C     . THR B 2 269  ? 165.668 137.674 97.614  1.00 54.64  ? 261  THR B C     1 
ATOM   4013  O O     . THR B 2 269  ? 166.514 138.567 97.675  1.00 54.64  ? 261  THR B O     1 
ATOM   4014  C CB    . THR B 2 269  ? 166.304 136.897 99.884  1.00 54.64  ? 261  THR B CB    1 
ATOM   4015  N N     . ASN B 2 270  ? 165.160 137.231 96.467  1.00 62.26  ? 262  ASN B N     1 
ATOM   4016  C CA    . ASN B 2 270  ? 165.571 137.777 95.181  1.00 62.26  ? 262  ASN B CA    1 
ATOM   4017  C C     . ASN B 2 270  ? 164.961 139.152 94.951  1.00 62.26  ? 262  ASN B C     1 
ATOM   4018  O O     . ASN B 2 270  ? 165.475 139.947 94.162  1.00 62.26  ? 262  ASN B O     1 
ATOM   4019  C CB    . ASN B 2 270  ? 165.149 136.836 94.055  1.00 62.26  ? 262  ASN B CB    1 
ATOM   4020  N N     . TYR B 2 271  ? 163.856 139.423 95.637  1.00 56.41  ? 263  TYR B N     1 
ATOM   4021  C CA    . TYR B 2 271  ? 163.171 140.700 95.508  1.00 56.41  ? 263  TYR B CA    1 
ATOM   4022  C C     . TYR B 2 271  ? 163.759 141.687 96.503  1.00 56.41  ? 263  TYR B C     1 
ATOM   4023  O O     . TYR B 2 271  ? 163.407 142.866 96.506  1.00 56.41  ? 263  TYR B O     1 
ATOM   4024  C CB    . TYR B 2 271  ? 161.675 140.520 95.774  1.00 56.41  ? 263  TYR B CB    1 
ATOM   4025  N N     . GLN B 2 272  ? 164.652 141.189 97.351  1.00 51.63  ? 264  GLN B N     1 
ATOM   4026  C CA    . GLN B 2 272  ? 165.302 142.010 98.360  1.00 51.63  ? 264  GLN B CA    1 
ATOM   4027  C C     . GLN B 2 272  ? 166.778 142.198 98.040  1.00 51.63  ? 264  GLN B C     1 
ATOM   4028  O O     . GLN B 2 272  ? 167.435 143.072 98.603  1.00 51.63  ? 264  GLN B O     1 
ATOM   4029  C CB    . GLN B 2 272  ? 165.148 141.361 99.738  1.00 51.63  ? 264  GLN B CB    1 
ATOM   4030  N N     . ARG B 2 273  ? 167.337 141.333 97.199  1.00 48.90  ? 265  ARG B N     1 
ATOM   4031  C CA    . ARG B 2 273  ? 168.721 141.508 96.760  1.00 48.90  ? 265  ARG B CA    1 
ATOM   4032  C C     . ARG B 2 273  ? 168.816 142.754 95.866  1.00 48.90  ? 265  ARG B C     1 
ATOM   4033  O O     . ARG B 2 273  ? 169.747 143.573 95.964  1.00 48.90  ? 265  ARG B O     1 
ATOM   4034  C CB    . ARG B 2 273  ? 169.206 140.272 96.001  1.00 48.90  ? 265  ARG B CB    1 
ATOM   4035  N N     . LEU B 2 274  ? 167.804 142.888 95.011  1.00 51.80  ? 266  LEU B N     1 
ATOM   4036  C CA    . LEU B 2 274  ? 167.705 143.977 94.045  1.00 51.80  ? 266  LEU B CA    1 
ATOM   4037  C C     . LEU B 2 274  ? 167.617 145.335 94.720  1.00 51.80  ? 266  LEU B C     1 
ATOM   4038  O O     . LEU B 2 274  ? 168.195 146.311 94.243  1.00 51.80  ? 266  LEU B O     1 
ATOM   4039  C CB    . LEU B 2 274  ? 166.496 143.770 93.129  1.00 51.80  ? 266  LEU B CB    1 
ATOM   4040  N N     . CYS B 2 275  ? 166.882 145.403 95.825  1.00 63.11  ? 267  CYS B N     1 
ATOM   4041  C CA    . CYS B 2 275  ? 166.745 146.654 96.558  1.00 63.11  ? 267  CYS B CA    1 
ATOM   4042  C C     . CYS B 2 275  ? 168.110 147.098 97.075  1.00 63.11  ? 267  CYS B C     1 
ATOM   4043  O O     . CYS B 2 275  ? 168.454 148.278 97.006  1.00 63.11  ? 267  CYS B O     1 
ATOM   4044  C CB    . CYS B 2 275  ? 165.767 146.491 97.722  1.00 63.11  ? 267  CYS B CB    1 
ATOM   4045  N N     . VAL B 2 276  ? 168.887 146.148 97.590  1.00 55.83  ? 268  VAL B N     1 
ATOM   4046  C CA    . VAL B 2 276  ? 170.220 146.449 98.082  1.00 55.83  ? 268  VAL B CA    1 
ATOM   4047  C C     . VAL B 2 276  ? 171.090 146.934 96.927  1.00 55.83  ? 268  VAL B C     1 
ATOM   4048  O O     . VAL B 2 276  ? 171.849 147.892 97.072  1.00 55.83  ? 268  VAL B O     1 
ATOM   4049  C CB    . VAL B 2 276  ? 170.876 145.212 98.721  1.00 55.83  ? 268  VAL B CB    1 
ATOM   4050  C CG1   . VAL B 2 276  ? 172.291 145.533 99.171  1.00 55.83  ? 268  VAL B CG1   1 
ATOM   4051  C CG2   . VAL B 2 276  ? 170.037 144.711 99.887  1.00 55.83  ? 268  VAL B CG2   1 
ATOM   4052  N N     . ALA B 2 277  ? 170.988 146.356 95.740  1.00 47.61  ? 269  ALA B N     1 
ATOM   4053  C CA    . ALA B 2 277  ? 171.830 146.905 94.679  1.00 47.61  ? 269  ALA B CA    1 
ATOM   4054  C C     . ALA B 2 277  ? 171.416 148.366 94.444  1.00 47.61  ? 269  ALA B C     1 
ATOM   4055  O O     . ALA B 2 277  ? 172.257 149.287 94.384  1.00 47.61  ? 269  ALA B O     1 
ATOM   4056  C CB    . ALA B 2 277  ? 171.681 146.094 93.403  1.00 47.61  ? 269  ALA B CB    1 
ATOM   4057  N N     . PHE B 2 278  ? 170.103 148.574 94.385  1.00 53.33  ? 270  PHE B N     1 
ATOM   4058  C CA    . PHE B 2 278  ? 169.530 149.898 94.181  1.00 53.33  ? 270  PHE B CA    1 
ATOM   4059  C C     . PHE B 2 278  ? 169.875 150.799 95.356  1.00 53.33  ? 270  PHE B C     1 
ATOM   4060  O O     . PHE B 2 278  ? 170.208 151.972 95.181  1.00 53.33  ? 270  PHE B O     1 
ATOM   4061  C CB    . PHE B 2 278  ? 168.013 149.806 94.011  1.00 53.33  ? 270  PHE B CB    1 
ATOM   4062  N N     . ASP B 2 279  ? 169.970 150.254 96.555  1.00 55.32  ? 271  ASP B N     1 
ATOM   4063  C CA    . ASP B 2 279  ? 170.295 151.046 97.734  1.00 55.32  ? 271  ASP B CA    1 
ATOM   4064  C C     . ASP B 2 279  ? 171.739 151.524 97.686  1.00 55.32  ? 271  ASP B C     1 
ATOM   4065  O O     . ASP B 2 279  ? 172.057 152.617 98.154  1.00 55.32  ? 271  ASP B O     1 
ATOM   4066  C CB    . ASP B 2 279  ? 170.051 150.235 99.008  1.00 55.32  ? 271  ASP B CB    1 
ATOM   4067  N N     . ALA B 2 280  ? 172.612 150.701 97.113  1.00 52.76  ? 272  ALA B N     1 
ATOM   4068  C CA    . ALA B 2 280  ? 174.023 151.047 97.006  1.00 52.76  ? 272  ALA B CA    1 
ATOM   4069  C C     . ALA B 2 280  ? 174.203 152.292 96.146  1.00 52.76  ? 272  ALA B C     1 
ATOM   4070  O O     . ALA B 2 280  ? 175.007 153.168 96.465  1.00 52.76  ? 272  ALA B O     1 
ATOM   4071  C CB    . ALA B 2 280  ? 174.812 149.882 96.430  1.00 52.76  ? 272  ALA B CB    1 
ATOM   4072  N N     . GLN B 2 281  ? 173.449 152.364 95.054  1.00 65.46  ? 273  GLN B N     1 
ATOM   4073  C CA    . GLN B 2 281  ? 173.521 153.509 94.157  1.00 65.46  ? 273  GLN B CA    1 
ATOM   4074  C C     . GLN B 2 281  ? 173.078 154.777 94.877  1.00 65.46  ? 273  GLN B C     1 
ATOM   4075  O O     . GLN B 2 281  ? 173.683 155.837 94.719  1.00 65.46  ? 273  GLN B O     1 
ATOM   4076  C CB    . GLN B 2 281  ? 172.654 153.276 92.919  1.00 65.46  ? 273  GLN B CB    1 
ATOM   4077  N N     . ALA B 2 282  ? 172.019 154.659 95.672  1.00 64.03  ? 274  ALA B N     1 
ATOM   4078  C CA    . ALA B 2 282  ? 171.497 155.797 96.417  1.00 64.03  ? 274  ALA B CA    1 
ATOM   4079  C C     . ALA B 2 282  ? 172.525 156.304 97.420  1.00 64.03  ? 274  ALA B C     1 
ATOM   4080  O O     . ALA B 2 282  ? 172.707 157.510 97.583  1.00 64.03  ? 274  ALA B O     1 
ATOM   4081  C CB    . ALA B 2 282  ? 170.205 155.419 97.124  1.00 64.03  ? 274  ALA B CB    1 
ATOM   4082  N N     . ARG B 2 283  ? 173.199 155.373 98.088  1.00 76.91  ? 275  ARG B N     1 
ATOM   4083  C CA    . ARG B 2 283  ? 174.217 155.720 99.071  1.00 76.91  ? 275  ARG B CA    1 
ATOM   4084  C C     . ARG B 2 283  ? 175.374 156.451 98.407  1.00 76.91  ? 275  ARG B C     1 
ATOM   4085  O O     . ARG B 2 283  ? 175.909 157.418 98.950  1.00 76.91  ? 275  ARG B O     1 
ATOM   4086  C CB    . ARG B 2 283  ? 174.729 154.466 99.779  1.00 76.91  ? 275  ARG B CB    1 
ATOM   4087  N N     . LYS B 2 284  ? 175.752 155.981 97.223  1.00 72.33  ? 276  LYS B N     1 
ATOM   4088  C CA    . LYS B 2 284  ? 176.842 156.580 96.464  1.00 72.33  ? 276  LYS B CA    1 
ATOM   4089  C C     . LYS B 2 284  ? 176.511 158.017 96.079  1.00 72.33  ? 276  LYS B C     1 
ATOM   4090  O O     . LYS B 2 284  ? 177.375 158.891 96.113  1.00 72.33  ? 276  LYS B O     1 
ATOM   4091  C CB    . LYS B 2 284  ? 177.138 155.754 95.211  1.00 72.33  ? 276  LYS B CB    1 
ATOM   4092  N N     . ASP B 2 285  ? 175.256 158.246 95.705  1.00 70.25  ? 277  ASP B N     1 
ATOM   4093  C CA    . ASP B 2 285  ? 174.787 159.568 95.304  1.00 70.25  ? 277  ASP B CA    1 
ATOM   4094  C C     . ASP B 2 285  ? 175.028 160.644 96.363  1.00 70.25  ? 277  ASP B C     1 
ATOM   4095  O O     . ASP B 2 285  ? 174.134 160.976 97.142  1.00 70.25  ? 277  ASP B O     1 
ATOM   4096  C CB    . ASP B 2 285  ? 173.301 159.518 94.941  1.00 70.25  ? 277  ASP B CB    1 
ATOM   4097  N N     . THR B 2 286  ? 176.243 161.179 96.382  1.00 91.87  ? 278  THR B N     1 
ATOM   4098  C CA    . THR B 2 286  ? 176.621 162.238 97.311  1.00 91.87  ? 278  THR B CA    1 
ATOM   4099  C C     . THR B 2 286  ? 177.001 163.510 96.555  1.00 91.87  ? 278  THR B C     1 
ATOM   4100  O O     . THR B 2 286  ? 176.969 163.546 95.324  1.00 91.87  ? 278  THR B O     1 
ATOM   4101  C CB    . THR B 2 286  ? 177.811 161.806 98.195  1.00 91.87  ? 278  THR B CB    1 
ATOM   4102  N N     . GLN B 2 287  ? 177.355 164.554 97.298  1.00 111.57 ? 279  GLN B N     1 
ATOM   4103  C CA    . GLN B 2 287  ? 177.734 165.829 96.702  1.00 111.57 ? 279  GLN B CA    1 
ATOM   4104  C C     . GLN B 2 287  ? 179.225 165.915 96.400  1.00 111.57 ? 279  GLN B C     1 
ATOM   4105  O O     . GLN B 2 287  ? 179.674 166.839 95.721  1.00 111.57 ? 279  GLN B O     1 
ATOM   4106  C CB    . GLN B 2 287  ? 177.331 166.979 97.631  1.00 111.57 ? 279  GLN B CB    1 
ATOM   4107  N N     . SER B 2 288  ? 179.988 164.950 96.906  1.00 134.39 ? 280  SER B N     1 
ATOM   4108  C CA    . SER B 2 288  ? 181.435 164.919 96.698  1.00 134.39 ? 280  SER B CA    1 
ATOM   4109  C C     . SER B 2 288  ? 181.846 163.760 95.786  1.00 134.39 ? 280  SER B C     1 
ATOM   4110  O O     . SER B 2 288  ? 181.152 162.744 95.711  1.00 134.39 ? 280  SER B O     1 
ATOM   4111  C CB    . SER B 2 288  ? 182.155 164.798 98.044  1.00 134.39 ? 280  SER B CB    1 
ATOM   4112  N N     . PRO B 2 289  ? 182.993 163.893 95.096  1.00 122.70 ? 281  PRO B N     1 
ATOM   4113  C CA    . PRO B 2 289  ? 183.520 162.877 94.178  1.00 122.70 ? 281  PRO B CA    1 
ATOM   4114  C C     . PRO B 2 289  ? 183.783 161.506 94.808  1.00 122.70 ? 281  PRO B C     1 
ATOM   4115  O O     . PRO B 2 289  ? 183.758 161.353 96.032  1.00 122.70 ? 281  PRO B O     1 
ATOM   4116  C CB    . PRO B 2 289  ? 184.791 163.528 93.638  1.00 122.70 ? 281  PRO B CB    1 
ATOM   4117  C CG    . PRO B 2 289  ? 185.212 164.440 94.753  1.00 122.70 ? 281  PRO B CG    1 
ATOM   4118  C CD    . PRO B 2 289  ? 183.899 165.051 95.163  1.00 122.70 ? 281  PRO B CD    1 
ATOM   4119  N N     . GLN B 2 290  ? 183.996 160.508 93.956  1.00 125.13 ? 282  GLN B N     1 
ATOM   4120  C CA    . GLN B 2 290  ? 184.252 159.151 94.418  1.00 125.13 ? 282  GLN B CA    1 
ATOM   4121  C C     . GLN B 2 290  ? 185.572 159.063 95.171  1.00 125.13 ? 282  GLN B C     1 
ATOM   4122  O O     . GLN B 2 290  ? 186.574 159.651 94.765  1.00 125.13 ? 282  GLN B O     1 
ATOM   4123  C CB    . GLN B 2 290  ? 184.256 158.176 93.239  1.00 125.13 ? 282  GLN B CB    1 
ATOM   4124  N N     . GLY B 2 291  ? 185.561 158.323 96.274  1.00 95.70  ? 283  GLY B N     1 
ATOM   4125  C CA    . GLY B 2 291  ? 186.746 158.141 97.087  1.00 95.70  ? 283  GLY B CA    1 
ATOM   4126  C C     . GLY B 2 291  ? 186.711 156.819 97.824  1.00 95.70  ? 283  GLY B C     1 
ATOM   4127  O O     . GLY B 2 291  ? 185.642 156.242 98.024  1.00 95.70  ? 283  GLY B O     1 
ATOM   4128  N N     . ALA B 2 292  ? 187.877 156.334 98.233  1.00 87.44  ? 284  ALA B N     1 
ATOM   4129  C CA    . ALA B 2 292  ? 187.947 155.083 98.971  1.00 87.44  ? 284  ALA B CA    1 
ATOM   4130  C C     . ALA B 2 292  ? 187.175 155.287 100.265 1.00 87.44  ? 284  ALA B C     1 
ATOM   4131  O O     . ALA B 2 292  ? 186.450 154.406 100.724 1.00 87.44  ? 284  ALA B O     1 
ATOM   4132  C CB    . ALA B 2 292  ? 189.391 154.712 99.260  1.00 87.44  ? 284  ALA B CB    1 
ATOM   4133  N N     . ARG B 2 293  ? 187.344 156.471 100.844 1.00 86.41  ? 285  ARG B N     1 
ATOM   4134  C CA    . ARG B 2 293  ? 186.667 156.844 102.080 1.00 86.41  ? 285  ARG B CA    1 
ATOM   4135  C C     . ARG B 2 293  ? 185.193 157.079 101.779 1.00 86.41  ? 285  ARG B C     1 
ATOM   4136  O O     . ARG B 2 293  ? 184.312 156.697 102.550 1.00 86.41  ? 285  ARG B O     1 
ATOM   4137  C CB    . ARG B 2 293  ? 187.293 158.104 102.679 1.00 86.41  ? 285  ARG B CB    1 
ATOM   4138  N N     . ALA B 2 294  ? 184.949 157.718 100.640 1.00 82.84  ? 286  ALA B N     1 
ATOM   4139  C CA    . ALA B 2 294  ? 183.606 158.041 100.178 1.00 82.84  ? 286  ALA B CA    1 
ATOM   4140  C C     . ALA B 2 294  ? 182.803 156.780 99.893  1.00 82.84  ? 286  ALA B C     1 
ATOM   4141  O O     . ALA B 2 294  ? 181.616 156.706 100.227 1.00 82.84  ? 286  ALA B O     1 
ATOM   4142  C CB    . ALA B 2 294  ? 183.680 158.925 98.935  1.00 82.84  ? 286  ALA B CB    1 
ATOM   4143  N N     . ILE B 2 295  ? 183.429 155.777 99.275  1.00 88.40  ? 287  ILE B N     1 
ATOM   4144  C CA    . ILE B 2 295  ? 182.734 154.517 99.045  1.00 88.40  ? 287  ILE B CA    1 
ATOM   4145  C C     . ILE B 2 295  ? 182.618 153.728 100.338 1.00 88.40  ? 287  ILE B C     1 
ATOM   4146  O O     . ILE B 2 295  ? 181.694 152.922 100.498 1.00 88.40  ? 287  ILE B O     1 
ATOM   4147  C CB    . ILE B 2 295  ? 183.445 153.697 97.956  1.00 88.40  ? 287  ILE B CB    1 
ATOM   4148  N N     . TRP B 2 296  ? 183.541 153.945 101.274 1.00 80.22  ? 288  TRP B N     1 
ATOM   4149  C CA    . TRP B 2 296  ? 183.499 153.244 102.551 1.00 80.22  ? 288  TRP B CA    1 
ATOM   4150  C C     . TRP B 2 296  ? 182.351 153.749 103.413 1.00 80.22  ? 288  TRP B C     1 
ATOM   4151  O O     . TRP B 2 296  ? 181.487 152.970 103.838 1.00 80.22  ? 288  TRP B O     1 
ATOM   4152  C CB    . TRP B 2 296  ? 184.827 153.426 103.279 1.00 80.22  ? 288  TRP B CB    1 
ATOM   4153  C CG    . TRP B 2 296  ? 184.923 152.630 104.525 1.00 80.22  ? 288  TRP B CG    1 
ATOM   4154  C CD1   . TRP B 2 296  ? 184.669 153.056 105.793 1.00 80.22  ? 288  TRP B CD1   1 
ATOM   4155  C CD2   . TRP B 2 296  ? 185.336 151.269 104.632 1.00 80.22  ? 288  TRP B CD2   1 
ATOM   4156  N NE1   . TRP B 2 296  ? 184.881 152.034 106.685 1.00 80.22  ? 288  TRP B NE1   1 
ATOM   4157  C CE2   . TRP B 2 296  ? 185.295 150.926 105.994 1.00 80.22  ? 288  TRP B CE2   1 
ATOM   4158  C CE3   . TRP B 2 296  ? 185.733 150.303 103.707 1.00 80.22  ? 288  TRP B CE3   1 
ATOM   4159  C CZ2   . TRP B 2 296  ? 185.634 149.658 106.455 1.00 80.22  ? 288  TRP B CZ2   1 
ATOM   4160  C CZ3   . TRP B 2 296  ? 186.069 149.046 104.164 1.00 80.22  ? 288  TRP B CZ3   1 
ATOM   4161  C CH2   . TRP B 2 296  ? 186.018 148.734 105.525 1.00 80.22  ? 288  TRP B CH2   1 
ATOM   4162  N N     . ARG B 2 297  ? 182.332 155.057 103.681 1.00 63.69  ? 289  ARG B N     1 
ATOM   4163  C CA    . ARG B 2 297  ? 181.251 155.644 104.462 1.00 63.69  ? 289  ARG B CA    1 
ATOM   4164  C C     . ARG B 2 297  ? 179.936 155.621 103.695 1.00 63.69  ? 289  ARG B C     1 
ATOM   4165  O O     . ARG B 2 297  ? 178.863 155.592 104.307 1.00 63.69  ? 289  ARG B O     1 
ATOM   4166  C CB    . ARG B 2 297  ? 181.611 157.074 104.858 1.00 63.69  ? 289  ARG B CB    1 
ATOM   4167  N N     . ALA B 2 298  ? 179.946 155.572 102.348 1.00 61.81  ? 290  ALA B N     1 
ATOM   4168  C CA    . ALA B 2 298  ? 178.638 155.420 101.660 1.00 61.81  ? 290  ALA B CA    1 
ATOM   4169  C C     . ALA B 2 298  ? 178.217 154.000 101.910 1.00 61.81  ? 290  ALA B C     1 
ATOM   4170  O O     . ALA B 2 298  ? 177.031 153.770 102.114 1.00 61.81  ? 290  ALA B O     1 
ATOM   4171  C CB    . ALA B 2 298  ? 178.606 155.706 100.168 1.00 61.81  ? 290  ALA B CB    1 
ATOM   4172  N N     . LEU B 2 299  ? 179.164 153.048 101.926 1.00 60.81  ? 291  LEU B N     1 
ATOM   4173  C CA    . LEU B 2 299  ? 178.714 151.675 102.134 1.00 60.81  ? 291  LEU B CA    1 
ATOM   4174  C C     . LEU B 2 299  ? 178.139 151.486 103.530 1.00 60.81  ? 291  LEU B C     1 
ATOM   4175  O O     . LEU B 2 299  ? 177.130 150.789 103.702 1.00 60.81  ? 291  LEU B O     1 
ATOM   4176  C CB    . LEU B 2 299  ? 179.869 150.703 101.896 1.00 60.81  ? 291  LEU B CB    1 
ATOM   4177  N N     . CYS B 2 300  ? 178.776 152.099 104.535 1.00 50.32  ? 292  CYS B N     1 
ATOM   4178  C CA    . CYS B 2 300  ? 178.250 152.048 105.894 1.00 50.32  ? 292  CYS B CA    1 
ATOM   4179  C C     . CYS B 2 300  ? 176.918 152.779 106.001 1.00 50.32  ? 292  CYS B C     1 
ATOM   4180  O O     . CYS B 2 300  ? 176.057 152.384 106.794 1.00 50.32  ? 292  CYS B O     1 
ATOM   4181  C CB    . CYS B 2 300  ? 179.261 152.646 106.869 1.00 50.32  ? 292  CYS B CB    1 
ATOM   4182  N N     . HIS B 2 301  ? 176.740 153.798 105.170 1.00 51.65  ? 293  HIS B N     1 
ATOM   4183  C CA    . HIS B 2 301  ? 175.476 154.520 105.119 1.00 51.65  ? 293  HIS B CA    1 
ATOM   4184  C C     . HIS B 2 301  ? 174.465 153.724 104.281 1.00 51.65  ? 293  HIS B C     1 
ATOM   4185  O O     . HIS B 2 301  ? 173.256 153.860 104.465 1.00 51.65  ? 293  HIS B O     1 
ATOM   4186  C CB    . HIS B 2 301  ? 175.668 155.914 104.523 1.00 51.65  ? 293  HIS B CB    1 
ATOM   4187  C CG    . HIS B 2 301  ? 174.388 156.662 104.321 1.00 51.65  ? 293  HIS B CG    1 
ATOM   4188  N ND1   . HIS B 2 301  ? 173.863 157.509 105.274 1.00 51.65  ? 293  HIS B ND1   1 
ATOM   4189  C CD2   . HIS B 2 301  ? 173.525 156.688 103.278 1.00 51.65  ? 293  HIS B CD2   1 
ATOM   4190  C CE1   . HIS B 2 301  ? 172.733 158.026 104.825 1.00 51.65  ? 293  HIS B CE1   1 
ATOM   4191  N NE2   . HIS B 2 301  ? 172.506 157.544 103.616 1.00 51.65  ? 293  HIS B NE2   1 
ATOM   4192  N N     . ALA B 2 302  ? 174.967 152.897 103.362 1.00 57.34  ? 294  ALA B N     1 
ATOM   4193  C CA    . ALA B 2 302  ? 174.123 152.077 102.505 1.00 57.34  ? 294  ALA B CA    1 
ATOM   4194  C C     . ALA B 2 302  ? 173.461 150.978 103.303 1.00 57.34  ? 294  ALA B C     1 
ATOM   4195  O O     . ALA B 2 302  ? 172.254 150.764 103.173 1.00 57.34  ? 294  ALA B O     1 
ATOM   4196  C CB    . ALA B 2 302  ? 174.924 151.467 101.363 1.00 57.34  ? 294  ALA B CB    1 
ATOM   4197  N N     . PHE B 2 303  ? 174.236 150.272 104.126 1.00 53.73  ? 295  PHE B N     1 
ATOM   4198  C CA    . PHE B 2 303  ? 173.615 149.195 104.892 1.00 53.73  ? 295  PHE B CA    1 
ATOM   4199  C C     . PHE B 2 303  ? 172.517 149.723 105.801 1.00 53.73  ? 295  PHE B C     1 
ATOM   4200  O O     . PHE B 2 303  ? 171.482 149.071 105.978 1.00 53.73  ? 295  PHE B O     1 
ATOM   4201  C CB    . PHE B 2 303  ? 174.675 148.458 105.699 1.00 53.73  ? 295  PHE B CB    1 
ATOM   4202  C CG    . PHE B 2 303  ? 175.572 147.612 104.866 1.00 53.73  ? 295  PHE B CG    1 
ATOM   4203  C CD1   . PHE B 2 303  ? 175.160 147.158 103.624 1.00 53.73  ? 295  PHE B CD1   1 
ATOM   4204  C CD2   . PHE B 2 303  ? 176.847 147.304 105.305 1.00 53.73  ? 295  PHE B CD2   1 
ATOM   4205  C CE1   . PHE B 2 303  ? 175.990 146.387 102.853 1.00 53.73  ? 295  PHE B CE1   1 
ATOM   4206  C CE2   . PHE B 2 303  ? 177.683 146.536 104.533 1.00 53.73  ? 295  PHE B CE2   1 
ATOM   4207  C CZ    . PHE B 2 303  ? 177.254 146.082 103.308 1.00 53.73  ? 295  PHE B CZ    1 
ATOM   4208  N N     . GLY B 2 304  ? 172.724 150.895 106.390 1.00 47.53  ? 296  GLY B N     1 
ATOM   4209  C CA    . GLY B 2 304  ? 171.696 151.520 107.191 1.00 47.53  ? 296  GLY B CA    1 
ATOM   4210  C C     . GLY B 2 304  ? 171.494 150.899 108.557 1.00 47.53  ? 296  GLY B C     1 
ATOM   4211  O O     . GLY B 2 304  ? 172.356 151.006 109.433 1.00 47.53  ? 296  GLY B O     1 
ATOM   4212  N N     . ARG B 2 305  ? 170.352 150.230 108.738 1.00 43.97  ? 297  ARG B N     1 
ATOM   4213  C CA    . ARG B 2 305  ? 169.915 149.840 110.074 1.00 43.97  ? 297  ARG B CA    1 
ATOM   4214  C C     . ARG B 2 305  ? 170.727 148.683 110.639 1.00 43.97  ? 297  ARG B C     1 
ATOM   4215  O O     . ARG B 2 305  ? 171.044 148.684 111.833 1.00 43.97  ? 297  ARG B O     1 
ATOM   4216  C CB    . ARG B 2 305  ? 168.437 149.458 110.048 1.00 43.97  ? 297  ARG B CB    1 
ATOM   4217  C CG    . ARG B 2 305  ? 167.496 150.566 109.622 1.00 43.97  ? 297  ARG B CG    1 
ATOM   4218  C CD    . ARG B 2 305  ? 167.380 151.649 110.676 1.00 43.97  ? 297  ARG B CD    1 
ATOM   4219  N NE    . ARG B 2 305  ? 166.389 152.650 110.295 1.00 43.97  ? 297  ARG B NE    1 
ATOM   4220  C CZ    . ARG B 2 305  ? 166.114 153.738 111.006 1.00 43.97  ? 297  ARG B CZ    1 
ATOM   4221  N NH1   . ARG B 2 305  ? 166.757 153.966 112.141 1.00 43.97  ? 297  ARG B NH1   1 
ATOM   4222  N NH2   . ARG B 2 305  ? 165.195 154.593 110.583 1.00 43.97  ? 297  ARG B NH2   1 
ATOM   4223  N N     . ARG B 2 306  ? 171.074 147.701 109.807 1.00 39.89  ? 298  ARG B N     1 
ATOM   4224  C CA    . ARG B 2 306  ? 171.550 146.417 110.306 1.00 39.89  ? 298  ARG B CA    1 
ATOM   4225  C C     . ARG B 2 306  ? 172.955 146.471 110.881 1.00 39.89  ? 298  ARG B C     1 
ATOM   4226  O O     . ARG B 2 306  ? 173.327 145.571 111.641 1.00 39.89  ? 298  ARG B O     1 
ATOM   4227  C CB    . ARG B 2 306  ? 171.507 145.371 109.191 1.00 39.89  ? 298  ARG B CB    1 
ATOM   4228  N N     . LEU B 2 307  ? 173.741 147.487 110.532 1.00 34.94  ? 299  LEU B N     1 
ATOM   4229  C CA    . LEU B 2 307  ? 175.095 147.585 111.061 1.00 34.94  ? 299  LEU B CA    1 
ATOM   4230  C C     . LEU B 2 307  ? 175.070 147.895 112.553 1.00 34.94  ? 299  LEU B C     1 
ATOM   4231  O O     . LEU B 2 307  ? 175.510 147.083 113.378 1.00 34.94  ? 299  LEU B O     1 
ATOM   4232  C CB    . LEU B 2 307  ? 175.876 148.650 110.291 1.00 34.94  ? 299  LEU B CB    1 
ATOM   4233  N N     . ILE B 2 308  ? 174.516 149.052 112.922 1.00 40.24  ? 300  ILE B N     1 
ATOM   4234  C CA    . ILE B 2 308  ? 174.459 149.424 114.332 1.00 40.24  ? 300  ILE B CA    1 
ATOM   4235  C C     . ILE B 2 308  ? 173.382 148.632 115.051 1.00 40.24  ? 300  ILE B C     1 
ATOM   4236  O O     . ILE B 2 308  ? 173.411 148.499 116.280 1.00 40.24  ? 300  ILE B O     1 
ATOM   4237  C CB    . ILE B 2 308  ? 174.229 150.938 114.481 1.00 40.24  ? 300  ILE B CB    1 
ATOM   4238  N N     . LEU B 2 309  ? 172.406 148.120 114.304 1.00 41.86  ? 301  LEU B N     1 
ATOM   4239  C CA    . LEU B 2 309  ? 171.374 147.277 114.890 1.00 41.86  ? 301  LEU B CA    1 
ATOM   4240  C C     . LEU B 2 309  ? 171.953 145.945 115.340 1.00 41.86  ? 301  LEU B C     1 
ATOM   4241  O O     . LEU B 2 309  ? 171.811 145.557 116.506 1.00 41.86  ? 301  LEU B O     1 
ATOM   4242  C CB    . LEU B 2 309  ? 170.247 147.088 113.878 1.00 41.86  ? 301  LEU B CB    1 
ATOM   4243  C CG    . LEU B 2 309  ? 168.996 146.285 114.222 1.00 41.86  ? 301  LEU B CG    1 
ATOM   4244  C CD1   . LEU B 2 309  ? 167.800 146.948 113.589 1.00 41.86  ? 301  LEU B CD1   1 
ATOM   4245  C CD2   . LEU B 2 309  ? 169.116 144.877 113.667 1.00 41.86  ? 301  LEU B CD2   1 
ATOM   4246  N N     . SER B 2 310  ? 172.620 145.238 114.426 1.00 40.51  ? 302  SER B N     1 
ATOM   4247  C CA    . SER B 2 310  ? 173.244 143.967 114.778 1.00 40.51  ? 302  SER B CA    1 
ATOM   4248  C C     . SER B 2 310  ? 174.409 144.161 115.738 1.00 40.51  ? 302  SER B C     1 
ATOM   4249  O O     . SER B 2 310  ? 174.713 143.261 116.532 1.00 40.51  ? 302  SER B O     1 
ATOM   4250  C CB    . SER B 2 310  ? 173.711 143.248 113.513 1.00 40.51  ? 302  SER B CB    1 
ATOM   4251  N N     . SER B 2 311  ? 175.067 145.322 115.680 1.00 42.22  ? 303  SER B N     1 
ATOM   4252  C CA    . SER B 2 311  ? 176.057 145.656 116.695 1.00 42.22  ? 303  SER B CA    1 
ATOM   4253  C C     . SER B 2 311  ? 175.403 145.824 118.059 1.00 42.22  ? 303  SER B C     1 
ATOM   4254  O O     . SER B 2 311  ? 175.984 145.445 119.083 1.00 42.22  ? 303  SER B O     1 
ATOM   4255  C CB    . SER B 2 311  ? 176.807 146.927 116.300 1.00 42.22  ? 303  SER B CB    1 
ATOM   4256  N N     . THR B 2 312  ? 174.187 146.373 118.090 1.00 44.25  ? 304  THR B N     1 
ATOM   4257  C CA    . THR B 2 312  ? 173.498 146.564 119.360 1.00 44.25  ? 304  THR B CA    1 
ATOM   4258  C C     . THR B 2 312  ? 173.005 145.240 119.924 1.00 44.25  ? 304  THR B C     1 
ATOM   4259  O O     . THR B 2 312  ? 173.025 145.036 121.144 1.00 44.25  ? 304  THR B O     1 
ATOM   4260  C CB    . THR B 2 312  ? 172.335 147.539 119.188 1.00 44.25  ? 304  THR B CB    1 
ATOM   4261  N N     . PHE B 2 313  ? 172.552 144.334 119.052 1.00 53.31  ? 305  PHE B N     1 
ATOM   4262  C CA    . PHE B 2 313  ? 172.248 142.983 119.504 1.00 53.31  ? 305  PHE B CA    1 
ATOM   4263  C C     . PHE B 2 313  ? 173.495 142.258 119.979 1.00 53.31  ? 305  PHE B C     1 
ATOM   4264  O O     . PHE B 2 313  ? 173.417 141.453 120.915 1.00 53.31  ? 305  PHE B O     1 
ATOM   4265  C CB    . PHE B 2 313  ? 171.569 142.179 118.396 1.00 53.31  ? 305  PHE B CB    1 
ATOM   4266  C CG    . PHE B 2 313  ? 170.113 142.486 118.226 1.00 53.31  ? 305  PHE B CG    1 
ATOM   4267  C CD1   . PHE B 2 313  ? 169.173 141.929 119.086 1.00 53.31  ? 305  PHE B CD1   1 
ATOM   4268  C CD2   . PHE B 2 313  ? 169.675 143.309 117.201 1.00 53.31  ? 305  PHE B CD2   1 
ATOM   4269  C CE1   . PHE B 2 313  ? 167.828 142.199 118.932 1.00 53.31  ? 305  PHE B CE1   1 
ATOM   4270  C CE2   . PHE B 2 313  ? 168.330 143.587 117.042 1.00 53.31  ? 305  PHE B CE2   1 
ATOM   4271  C CZ    . PHE B 2 313  ? 167.400 143.030 117.910 1.00 53.31  ? 305  PHE B CZ    1 
ATOM   4272  N N     . ARG B 2 314  ? 174.645 142.532 119.360 1.00 53.86  ? 306  ARG B N     1 
ATOM   4273  C CA    . ARG B 2 314  ? 175.890 141.951 119.844 1.00 53.86  ? 306  ARG B CA    1 
ATOM   4274  C C     . ARG B 2 314  ? 176.273 142.512 121.205 1.00 53.86  ? 306  ARG B C     1 
ATOM   4275  O O     . ARG B 2 314  ? 176.843 141.792 122.033 1.00 53.86  ? 306  ARG B O     1 
ATOM   4276  C CB    . ARG B 2 314  ? 177.010 142.191 118.834 1.00 53.86  ? 306  ARG B CB    1 
ATOM   4277  N N     . ILE B 2 315  ? 175.954 143.783 121.457 1.00 54.36  ? 307  ILE B N     1 
ATOM   4278  C CA    . ILE B 2 315  ? 176.239 144.374 122.759 1.00 54.36  ? 307  ILE B CA    1 
ATOM   4279  C C     . ILE B 2 315  ? 175.291 143.825 123.811 1.00 54.36  ? 307  ILE B C     1 
ATOM   4280  O O     . ILE B 2 315  ? 175.668 143.683 124.981 1.00 54.36  ? 307  ILE B O     1 
ATOM   4281  C CB    . ILE B 2 315  ? 176.161 145.908 122.682 1.00 54.36  ? 307  ILE B CB    1 
ATOM   4282  N N     . LEU B 2 316  ? 174.050 143.523 123.424 1.00 57.03  ? 308  LEU B N     1 
ATOM   4283  C CA    . LEU B 2 316  ? 173.136 142.850 124.340 1.00 57.03  ? 308  LEU B CA    1 
ATOM   4284  C C     . LEU B 2 316  ? 173.607 141.433 124.634 1.00 57.03  ? 308  LEU B C     1 
ATOM   4285  O O     . LEU B 2 316  ? 173.441 140.933 125.754 1.00 57.03  ? 308  LEU B O     1 
ATOM   4286  C CB    . LEU B 2 316  ? 171.724 142.837 123.758 1.00 57.03  ? 308  LEU B CB    1 
ATOM   4287  N N     . ALA B 2 317  ? 174.201 140.774 123.634 1.00 55.24  ? 309  ALA B N     1 
ATOM   4288  C CA    . ALA B 2 317  ? 174.808 139.466 123.855 1.00 55.24  ? 309  ALA B CA    1 
ATOM   4289  C C     . ALA B 2 317  ? 176.010 139.567 124.778 1.00 55.24  ? 309  ALA B C     1 
ATOM   4290  O O     . ALA B 2 317  ? 176.271 138.642 125.556 1.00 55.24  ? 309  ALA B O     1 
ATOM   4291  C CB    . ALA B 2 317  ? 175.214 138.842 122.522 1.00 55.24  ? 309  ALA B CB    1 
ATOM   4292  N N     . ASP B 2 318  ? 176.743 140.677 124.711 1.00 61.58  ? 310  ASP B N     1 
ATOM   4293  C CA    . ASP B 2 318  ? 177.805 140.917 125.676 1.00 61.58  ? 310  ASP B CA    1 
ATOM   4294  C C     . ASP B 2 318  ? 177.240 141.184 127.062 1.00 61.58  ? 310  ASP B C     1 
ATOM   4295  O O     . ASP B 2 318  ? 177.884 140.855 128.066 1.00 61.58  ? 310  ASP B O     1 
ATOM   4296  C CB    . ASP B 2 318  ? 178.670 142.090 125.223 1.00 61.58  ? 310  ASP B CB    1 
ATOM   4297  N N     . LEU B 2 319  ? 176.046 141.771 127.134 1.00 65.33  ? 311  LEU B N     1 
ATOM   4298  C CA    . LEU B 2 319  ? 175.432 142.052 128.426 1.00 65.33  ? 311  LEU B CA    1 
ATOM   4299  C C     . LEU B 2 319  ? 174.973 140.769 129.105 1.00 65.33  ? 311  LEU B C     1 
ATOM   4300  O O     . LEU B 2 319  ? 175.268 140.540 130.284 1.00 65.33  ? 311  LEU B O     1 
ATOM   4301  C CB    . LEU B 2 319  ? 174.260 143.017 128.247 1.00 65.33  ? 311  LEU B CB    1 
ATOM   4302  N N     . LEU B 2 320  ? 174.252 139.918 128.373 1.00 62.73  ? 312  LEU B N     1 
ATOM   4303  C CA    . LEU B 2 320  ? 173.767 138.677 128.964 1.00 62.73  ? 312  LEU B CA    1 
ATOM   4304  C C     . LEU B 2 320  ? 174.891 137.672 129.166 1.00 62.73  ? 312  LEU B C     1 
ATOM   4305  O O     . LEU B 2 320  ? 174.914 136.966 130.179 1.00 62.73  ? 312  LEU B O     1 
ATOM   4306  C CB    . LEU B 2 320  ? 172.671 138.072 128.089 1.00 62.73  ? 312  LEU B CB    1 
ATOM   4307  N N     . GLY B 2 321  ? 175.778 137.568 128.183 1.00 62.31  ? 313  GLY B N     1 
ATOM   4308  C CA    . GLY B 2 321  ? 176.901 136.651 128.247 1.00 62.31  ? 313  GLY B CA    1 
ATOM   4309  C C     . GLY B 2 321  ? 177.958 136.892 129.313 1.00 62.31  ? 313  GLY B C     1 
ATOM   4310  O O     . GLY B 2 321  ? 178.441 135.951 129.938 1.00 62.31  ? 313  GLY B O     1 
ATOM   4311  N N     . PHE B 2 322  ? 178.311 138.155 129.525 1.00 64.64  ? 314  PHE B N     1 
ATOM   4312  C CA    . PHE B 2 322  ? 179.361 138.514 130.481 1.00 64.64  ? 314  PHE B CA    1 
ATOM   4313  C C     . PHE B 2 322  ? 179.097 138.155 131.943 1.00 64.64  ? 314  PHE B C     1 
ATOM   4314  O O     . PHE B 2 322  ? 179.994 137.679 132.638 1.00 64.64  ? 314  PHE B O     1 
ATOM   4315  C CB    . PHE B 2 322  ? 179.682 140.009 130.371 1.00 64.64  ? 314  PHE B CB    1 
ATOM   4316  N N     . ALA B 2 323  ? 177.873 138.379 132.407 1.00 69.88  ? 315  ALA B N     1 
ATOM   4317  C CA    . ALA B 2 323  ? 177.520 138.086 133.794 1.00 69.88  ? 315  ALA B CA    1 
ATOM   4318  C C     . ALA B 2 323  ? 177.626 136.598 134.121 1.00 69.88  ? 315  ALA B C     1 
ATOM   4319  O O     . ALA B 2 323  ? 178.070 136.212 135.201 1.00 69.88  ? 315  ALA B O     1 
ATOM   4320  C CB    . ALA B 2 323  ? 176.122 138.601 134.100 1.00 69.88  ? 315  ALA B CB    1 
ATOM   4321  N N     . GLY B 2 324  ? 177.205 135.778 133.169 1.00 61.29  ? 316  GLY B N     1 
ATOM   4322  C CA    . GLY B 2 324  ? 177.190 134.339 133.310 1.00 61.29  ? 316  GLY B CA    1 
ATOM   4323  C C     . GLY B 2 324  ? 177.657 133.796 134.649 1.00 61.29  ? 316  GLY B C     1 
ATOM   4324  O O     . GLY B 2 324  ? 176.857 133.275 135.434 1.00 61.29  ? 316  GLY B O     1 
ATOM   4325  N N     . PRO B 2 325  ? 178.919 134.001 135.036 1.00 65.21  ? 317  PRO B N     1 
ATOM   4326  C CA    . PRO B 2 325  ? 179.488 133.517 136.329 1.00 65.21  ? 317  PRO B CA    1 
ATOM   4327  C C     . PRO B 2 325  ? 178.988 134.076 137.717 1.00 65.21  ? 317  PRO B C     1 
ATOM   4328  O O     . PRO B 2 325  ? 179.014 133.392 138.798 1.00 65.21  ? 317  PRO B O     1 
ATOM   4329  C CB    . PRO B 2 325  ? 180.985 133.808 136.172 1.00 65.21  ? 317  PRO B CB    1 
ATOM   4330  C CG    . PRO B 2 325  ? 181.216 133.795 134.698 1.00 65.21  ? 317  PRO B CG    1 
ATOM   4331  C CD    . PRO B 2 325  ? 179.974 134.365 134.074 1.00 65.21  ? 317  PRO B CD    1 
ATOM   4332  N N     . LEU B 2 326  ? 178.519 135.321 137.693 1.00 60.72  ? 318  LEU B N     1 
ATOM   4333  C CA    . LEU B 2 326  ? 178.104 136.010 138.918 1.00 60.72  ? 318  LEU B CA    1 
ATOM   4334  C C     . LEU B 2 326  ? 177.012 135.256 139.664 1.00 60.72  ? 318  LEU B C     1 
ATOM   4335  O O     . LEU B 2 326  ? 177.073 135.120 140.889 1.00 60.72  ? 318  LEU B O     1 
ATOM   4336  C CB    . LEU B 2 326  ? 177.632 137.430 138.597 1.00 60.72  ? 318  LEU B CB    1 
ATOM   4337  N N     . CYS B 2 327  ? 176.049 134.699 138.932 1.00 57.37  ? 319  CYS B N     1 
ATOM   4338  C CA    . CYS B 2 327  ? 174.979 133.904 139.531 1.00 57.37  ? 319  CYS B CA    1 
ATOM   4339  C C     . CYS B 2 327  ? 175.565 132.667 140.225 1.00 57.37  ? 319  CYS B C     1 
ATOM   4340  O O     . CYS B 2 327  ? 175.115 132.278 141.303 1.00 57.37  ? 319  CYS B O     1 
ATOM   4341  C CB    . CYS B 2 327  ? 173.963 133.483 138.469 1.00 57.37  ? 319  CYS B CB    1 
ATOM   4342  N N     . ILE B 2 328  ? 176.570 132.060 139.599 1.00 48.13  ? 320  ILE B N     1 
ATOM   4343  C CA    . ILE B 2 328  ? 177.248 130.895 140.139 1.00 48.13  ? 320  ILE B CA    1 
ATOM   4344  C C     . ILE B 2 328  ? 177.929 131.168 141.484 1.00 48.13  ? 320  ILE B C     1 
ATOM   4345  O O     . ILE B 2 328  ? 177.933 130.274 142.334 1.00 48.13  ? 320  ILE B O     1 
ATOM   4346  C CB    . ILE B 2 328  ? 178.260 130.287 139.146 1.00 48.13  ? 320  ILE B CB    1 
ATOM   4347  N N     . PHE B 2 329  ? 178.497 132.363 141.706 1.00 58.44  ? 321  PHE B N     1 
ATOM   4348  C CA    . PHE B 2 329  ? 179.169 132.561 143.035 1.00 58.44  ? 321  PHE B CA    1 
ATOM   4349  C C     . PHE B 2 329  ? 178.257 132.380 144.298 1.00 58.44  ? 321  PHE B C     1 
ATOM   4350  O O     . PHE B 2 329  ? 178.633 131.733 145.275 1.00 58.44  ? 321  PHE B O     1 
ATOM   4351  C CB    . PHE B 2 329  ? 179.863 133.922 143.087 1.00 58.44  ? 321  PHE B CB    1 
ATOM   4352  C CG    . PHE B 2 329  ? 180.498 134.225 144.413 1.00 58.44  ? 321  PHE B CG    1 
ATOM   4353  C CD1   . PHE B 2 329  ? 181.733 133.689 144.742 1.00 58.44  ? 321  PHE B CD1   1 
ATOM   4354  C CD2   . PHE B 2 329  ? 179.862 135.040 145.332 1.00 58.44  ? 321  PHE B CD2   1 
ATOM   4355  C CE1   . PHE B 2 329  ? 182.320 133.963 145.962 1.00 58.44  ? 321  PHE B CE1   1 
ATOM   4356  C CE2   . PHE B 2 329  ? 180.444 135.319 146.554 1.00 58.44  ? 321  PHE B CE2   1 
ATOM   4357  C CZ    . PHE B 2 329  ? 181.676 134.779 146.869 1.00 58.44  ? 321  PHE B CZ    1 
ATOM   4358  N N     . GLY B 2 330  ? 177.072 132.971 144.222 1.00 65.38  ? 322  GLY B N     1 
ATOM   4359  C CA    . GLY B 2 330  ? 175.917 132.960 145.099 1.00 65.38  ? 322  GLY B CA    1 
ATOM   4360  C C     . GLY B 2 330  ? 175.566 131.563 145.571 1.00 65.38  ? 322  GLY B C     1 
ATOM   4361  O O     . GLY B 2 330  ? 175.107 131.378 146.702 1.00 65.38  ? 322  GLY B O     1 
ATOM   4362  N N     . ILE B 2 331  ? 175.783 130.562 144.718 1.00 55.08  ? 323  ILE B N     1 
ATOM   4363  C CA    . ILE B 2 331  ? 175.522 129.185 145.120 1.00 55.08  ? 323  ILE B CA    1 
ATOM   4364  C C     . ILE B 2 331  ? 176.580 128.711 146.100 1.00 55.08  ? 323  ILE B C     1 
ATOM   4365  O O     . ILE B 2 331  ? 176.277 128.021 147.081 1.00 55.08  ? 323  ILE B O     1 
ATOM   4366  C CB    . ILE B 2 331  ? 175.449 128.275 143.882 1.00 55.08  ? 323  ILE B CB    1 
ATOM   4367  N N     . VAL B 2 332  ? 177.840 129.086 145.864 1.00 50.53  ? 324  VAL B N     1 
ATOM   4368  C CA    . VAL B 2 332  ? 178.909 128.709 146.776 1.00 50.53  ? 324  VAL B CA    1 
ATOM   4369  C C     . VAL B 2 332  ? 178.808 129.456 148.096 1.00 50.53  ? 324  VAL B C     1 
ATOM   4370  O O     . VAL B 2 332  ? 179.284 128.964 149.124 1.00 50.53  ? 324  VAL B O     1 
ATOM   4371  C CB    . VAL B 2 332  ? 180.278 128.957 146.124 1.00 50.53  ? 324  VAL B CB    1 
ATOM   4372  N N     . ASP B 2 333  ? 178.186 130.632 148.097 1.00 60.10  ? 325  ASP B N     1 
ATOM   4373  C CA    . ASP B 2 333  ? 178.044 131.438 149.300 1.00 60.10  ? 325  ASP B CA    1 
ATOM   4374  C C     . ASP B 2 333  ? 176.830 131.038 150.125 1.00 60.10  ? 325  ASP B C     1 
ATOM   4375  O O     . ASP B 2 333  ? 176.973 130.631 151.281 1.00 60.10  ? 325  ASP B O     1 
ATOM   4376  C CB    . ASP B 2 333  ? 177.961 132.922 148.926 1.00 60.10  ? 325  ASP B CB    1 
ATOM   4377  N N     . HIS B 2 334  ? 175.630 131.136 149.545 1.00 61.03  ? 326  HIS B N     1 
ATOM   4378  C CA    . HIS B 2 334  ? 174.416 130.772 150.267 1.00 61.03  ? 326  HIS B CA    1 
ATOM   4379  C C     . HIS B 2 334  ? 174.293 129.269 150.470 1.00 61.03  ? 326  HIS B C     1 
ATOM   4380  O O     . HIS B 2 334  ? 173.567 128.835 151.371 1.00 61.03  ? 326  HIS B O     1 
ATOM   4381  C CB    . HIS B 2 334  ? 173.184 131.298 149.530 1.00 61.03  ? 326  HIS B CB    1 
ATOM   4382  N N     . LEU B 2 335  ? 174.968 128.467 149.651 1.00 54.09  ? 327  LEU B N     1 
ATOM   4383  C CA    . LEU B 2 335  ? 175.037 127.033 149.881 1.00 54.09  ? 327  LEU B CA    1 
ATOM   4384  C C     . LEU B 2 335  ? 176.288 126.641 150.652 1.00 54.09  ? 327  LEU B C     1 
ATOM   4385  O O     . LEU B 2 335  ? 176.194 126.095 151.754 1.00 54.09  ? 327  LEU B O     1 
ATOM   4386  C CB    . LEU B 2 335  ? 174.990 126.280 148.548 1.00 54.09  ? 327  LEU B CB    1 
ATOM   4387  N N     . GLY B 2 336  ? 177.461 126.934 150.099 1.00 52.57  ? 328  GLY B N     1 
ATOM   4388  C CA    . GLY B 2 336  ? 178.705 126.503 150.698 1.00 52.57  ? 328  GLY B CA    1 
ATOM   4389  C C     . GLY B 2 336  ? 179.106 127.302 151.919 1.00 52.57  ? 328  GLY B C     1 
ATOM   4390  O O     . GLY B 2 336  ? 179.279 126.736 153.002 1.00 52.57  ? 328  GLY B O     1 
ATOM   4391  N N     . LYS B 2 337  ? 179.258 128.618 151.748 1.00 55.75  ? 329  LYS B N     1 
ATOM   4392  C CA    . LYS B 2 337  ? 179.728 129.457 152.845 1.00 55.75  ? 329  LYS B CA    1 
ATOM   4393  C C     . LYS B 2 337  ? 178.671 129.588 153.930 1.00 55.75  ? 329  LYS B C     1 
ATOM   4394  O O     . LYS B 2 337  ? 178.991 129.547 155.125 1.00 55.75  ? 329  LYS B O     1 
ATOM   4395  C CB    . LYS B 2 337  ? 180.133 130.832 152.319 1.00 55.75  ? 329  LYS B CB    1 
ATOM   4396  N N     . GLU B 2 338  ? 177.410 129.735 153.542 1.00 75.17  ? 330  GLU B N     1 
ATOM   4397  C CA    . GLU B 2 338  ? 176.339 129.682 154.522 1.00 75.17  ? 330  GLU B CA    1 
ATOM   4398  C C     . GLU B 2 338  ? 176.134 128.234 154.937 1.00 75.17  ? 330  GLU B C     1 
ATOM   4399  O O     . GLU B 2 338  ? 175.348 127.509 154.318 1.00 75.17  ? 330  GLU B O     1 
ATOM   4400  C CB    . GLU B 2 338  ? 175.050 130.283 153.962 1.00 75.17  ? 330  GLU B CB    1 
ATOM   4401  N N     . ASN B 2 339  ? 176.857 127.799 155.965 1.00 74.40  ? 331  ASN B N     1 
ATOM   4402  C CA    . ASN B 2 339  ? 176.793 126.413 156.408 1.00 74.40  ? 331  ASN B CA    1 
ATOM   4403  C C     . ASN B 2 339  ? 175.714 126.188 157.459 1.00 74.40  ? 331  ASN B C     1 
ATOM   4404  O O     . ASN B 2 339  ? 175.022 125.166 157.429 1.00 74.40  ? 331  ASN B O     1 
ATOM   4405  C CB    . ASN B 2 339  ? 178.152 125.974 156.958 1.00 74.40  ? 331  ASN B CB    1 
ATOM   4406  N N     . HIS B 2 340  ? 175.559 127.121 158.392 1.00 99.87  ? 332  HIS B N     1 
ATOM   4407  C CA    . HIS B 2 340  ? 174.580 126.990 159.466 1.00 99.87  ? 332  HIS B CA    1 
ATOM   4408  C C     . HIS B 2 340  ? 173.821 128.301 159.645 1.00 99.87  ? 332  HIS B C     1 
ATOM   4409  O O     . HIS B 2 340  ? 173.661 128.806 160.757 1.00 99.87  ? 332  HIS B O     1 
ATOM   4410  C CB    . HIS B 2 340  ? 175.256 126.557 160.765 1.00 99.87  ? 332  HIS B CB    1 
ATOM   4411  N N     . VAL B 2 341  ? 173.358 128.879 158.536 1.00 109.23 ? 333  VAL B N     1 
ATOM   4412  C CA    . VAL B 2 341  ? 172.564 130.102 158.618 1.00 109.23 ? 333  VAL B CA    1 
ATOM   4413  C C     . VAL B 2 341  ? 171.171 129.792 159.154 1.00 109.23 ? 333  VAL B C     1 
ATOM   4414  O O     . VAL B 2 341  ? 170.804 130.232 160.249 1.00 109.23 ? 333  VAL B O     1 
ATOM   4415  C CB    . VAL B 2 341  ? 172.497 130.795 157.245 1.00 109.23 ? 333  VAL B CB    1 
ATOM   4416  N N     . PHE B 2 342  ? 170.384 129.030 158.378 1.00 128.64 ? 334  PHE B N     1 
ATOM   4417  C CA    . PHE B 2 342  ? 169.112 128.412 158.795 1.00 128.64 ? 334  PHE B CA    1 
ATOM   4418  C C     . PHE B 2 342  ? 168.066 129.424 159.276 1.00 128.64 ? 334  PHE B C     1 
ATOM   4419  O O     . PHE B 2 342  ? 167.176 129.082 160.056 1.00 128.64 ? 334  PHE B O     1 
ATOM   4420  C CB    . PHE B 2 342  ? 169.342 127.343 159.867 1.00 128.64 ? 334  PHE B CB    1 
ATOM   4421  N N     . GLN B 2 343  ? 168.158 130.668 158.825 1.00 141.69 ? 335  GLN B N     1 
ATOM   4422  C CA    . GLN B 2 343  ? 167.201 131.707 159.203 1.00 141.69 ? 335  GLN B CA    1 
ATOM   4423  C C     . GLN B 2 343  ? 166.519 132.230 157.948 1.00 141.69 ? 335  GLN B C     1 
ATOM   4424  O O     . GLN B 2 343  ? 167.183 132.871 157.111 1.00 141.69 ? 335  GLN B O     1 
ATOM   4425  C CB    . GLN B 2 343  ? 167.894 132.843 159.954 1.00 141.69 ? 335  GLN B CB    1 
ATOM   4426  N N     . PRO B 2 344  ? 165.221 131.978 157.757 1.00 119.53 ? 336  PRO B N     1 
ATOM   4427  C CA    . PRO B 2 344  ? 164.590 132.377 156.488 1.00 119.53 ? 336  PRO B CA    1 
ATOM   4428  C C     . PRO B 2 344  ? 164.358 133.871 156.351 1.00 119.53 ? 336  PRO B C     1 
ATOM   4429  O O     . PRO B 2 344  ? 164.633 134.433 155.283 1.00 119.53 ? 336  PRO B O     1 
ATOM   4430  C CB    . PRO B 2 344  ? 163.274 131.588 156.497 1.00 119.53 ? 336  PRO B CB    1 
ATOM   4431  C CG    . PRO B 2 344  ? 162.979 131.359 157.943 1.00 119.53 ? 336  PRO B CG    1 
ATOM   4432  C CD    . PRO B 2 344  ? 164.310 131.203 158.619 1.00 119.53 ? 336  PRO B CD    1 
ATOM   4433  N N     . LYS B 2 345  ? 163.878 134.543 157.396 1.00 90.31  ? 337  LYS B N     1 
ATOM   4434  C CA    . LYS B 2 345  ? 163.490 135.939 157.265 1.00 90.31  ? 337  LYS B CA    1 
ATOM   4435  C C     . LYS B 2 345  ? 163.557 136.634 158.616 1.00 90.31  ? 337  LYS B C     1 
ATOM   4436  O O     . LYS B 2 345  ? 163.539 135.999 159.673 1.00 90.31  ? 337  LYS B O     1 
ATOM   4437  C CB    . LYS B 2 345  ? 162.080 136.074 156.678 1.00 90.31  ? 337  LYS B CB    1 
ATOM   4438  N N     . THR B 2 346  ? 163.636 137.965 158.558 1.00 75.45  ? 338  THR B N     1 
ATOM   4439  C CA    . THR B 2 346  ? 163.591 138.807 159.744 1.00 75.45  ? 338  THR B CA    1 
ATOM   4440  C C     . THR B 2 346  ? 162.673 140.011 159.595 1.00 75.45  ? 338  THR B C     1 
ATOM   4441  O O     . THR B 2 346  ? 162.504 140.756 160.565 1.00 75.45  ? 338  THR B O     1 
ATOM   4442  C CB    . THR B 2 346  ? 164.999 139.302 160.112 1.00 75.45  ? 338  THR B CB    1 
ATOM   4443  N N     . GLN B 2 347  ? 162.080 140.225 158.425 1.00 50.27  ? 339  GLN B N     1 
ATOM   4444  C CA    . GLN B 2 347  ? 161.168 141.332 158.197 1.00 50.27  ? 339  GLN B CA    1 
ATOM   4445  C C     . GLN B 2 347  ? 159.746 140.903 158.559 1.00 50.27  ? 339  GLN B C     1 
ATOM   4446  O O     . GLN B 2 347  ? 159.534 139.901 159.246 1.00 50.27  ? 339  GLN B O     1 
ATOM   4447  C CB    . GLN B 2 347  ? 161.268 141.811 156.752 1.00 50.27  ? 339  GLN B CB    1 
ATOM   4448  N N     . PHE B 2 348  ? 158.759 141.688 158.125 1.00 42.92  ? 340  PHE B N     1 
ATOM   4449  C CA    . PHE B 2 348  ? 157.358 141.352 158.345 1.00 42.92  ? 340  PHE B CA    1 
ATOM   4450  C C     . PHE B 2 348  ? 156.999 140.101 157.552 1.00 42.92  ? 340  PHE B C     1 
ATOM   4451  O O     . PHE B 2 348  ? 156.891 140.143 156.322 1.00 42.92  ? 340  PHE B O     1 
ATOM   4452  C CB    . PHE B 2 348  ? 156.470 142.527 157.939 1.00 42.92  ? 340  PHE B CB    1 
ATOM   4453  C CG    . PHE B 2 348  ? 155.014 142.319 158.231 1.00 42.92  ? 340  PHE B CG    1 
ATOM   4454  C CD1   . PHE B 2 348  ? 154.535 142.428 159.525 1.00 42.92  ? 340  PHE B CD1   1 
ATOM   4455  C CD2   . PHE B 2 348  ? 154.124 142.021 157.214 1.00 42.92  ? 340  PHE B CD2   1 
ATOM   4456  C CE1   . PHE B 2 348  ? 153.194 142.240 159.801 1.00 42.92  ? 340  PHE B CE1   1 
ATOM   4457  C CE2   . PHE B 2 348  ? 152.781 141.832 157.482 1.00 42.92  ? 340  PHE B CE2   1 
ATOM   4458  C CZ    . PHE B 2 348  ? 152.317 141.941 158.777 1.00 42.92  ? 340  PHE B CZ    1 
ATOM   4459  N N     . LEU B 2 349  ? 156.815 138.985 158.260 1.00 43.48  ? 341  LEU B N     1 
ATOM   4460  C CA    . LEU B 2 349  ? 156.660 137.686 157.619 1.00 43.48  ? 341  LEU B CA    1 
ATOM   4461  C C     . LEU B 2 349  ? 155.289 137.484 156.991 1.00 43.48  ? 341  LEU B C     1 
ATOM   4462  O O     . LEU B 2 349  ? 155.099 136.504 156.264 1.00 43.48  ? 341  LEU B O     1 
ATOM   4463  C CB    . LEU B 2 349  ? 156.926 136.567 158.627 1.00 43.48  ? 341  LEU B CB    1 
ATOM   4464  N N     . GLY B 2 350  ? 154.330 138.373 157.256 1.00 52.66  ? 342  GLY B N     1 
ATOM   4465  C CA    . GLY B 2 350  ? 153.030 138.260 156.622 1.00 52.66  ? 342  GLY B CA    1 
ATOM   4466  C C     . GLY B 2 350  ? 153.032 138.593 155.144 1.00 52.66  ? 342  GLY B C     1 
ATOM   4467  O O     . GLY B 2 350  ? 152.108 138.192 154.430 1.00 52.66  ? 342  GLY B O     1 
ATOM   4468  N N     . VAL B 2 351  ? 154.048 139.312 154.671 1.00 69.20  ? 343  VAL B N     1 
ATOM   4469  C CA    . VAL B 2 351  ? 154.170 139.704 153.276 1.00 69.20  ? 343  VAL B CA    1 
ATOM   4470  C C     . VAL B 2 351  ? 155.611 139.479 152.830 1.00 69.20  ? 343  VAL B C     1 
ATOM   4471  O O     . VAL B 2 351  ? 156.439 138.948 153.569 1.00 69.20  ? 343  VAL B O     1 
ATOM   4472  C CB    . VAL B 2 351  ? 153.741 141.167 153.035 1.00 69.20  ? 343  VAL B CB    1 
ATOM   4473  N N     . TYR B 2 352  ? 155.899 139.892 151.600 1.00 80.13  ? 344  TYR B N     1 
ATOM   4474  C CA    . TYR B 2 352  ? 157.200 139.692 150.970 1.00 80.13  ? 344  TYR B CA    1 
ATOM   4475  C C     . TYR B 2 352  ? 158.000 140.985 151.061 1.00 80.13  ? 344  TYR B C     1 
ATOM   4476  O O     . TYR B 2 352  ? 157.437 142.080 150.954 1.00 80.13  ? 344  TYR B O     1 
ATOM   4477  C CB    . TYR B 2 352  ? 157.036 139.251 149.518 1.00 80.13  ? 344  TYR B CB    1 
ATOM   4478  N N     . PHE B 2 353  ? 159.307 140.854 151.269 1.00 66.73  ? 345  PHE B N     1 
ATOM   4479  C CA    . PHE B 2 353  ? 160.202 141.996 151.379 1.00 66.73  ? 345  PHE B CA    1 
ATOM   4480  C C     . PHE B 2 353  ? 161.318 141.909 150.344 1.00 66.73  ? 345  PHE B C     1 
ATOM   4481  O O     . PHE B 2 353  ? 161.748 140.821 149.953 1.00 66.73  ? 345  PHE B O     1 
ATOM   4482  C CB    . PHE B 2 353  ? 160.781 142.096 152.795 1.00 66.73  ? 345  PHE B CB    1 
ATOM   4483  C CG    . PHE B 2 353  ? 161.606 140.907 153.213 1.00 66.73  ? 345  PHE B CG    1 
ATOM   4484  C CD1   . PHE B 2 353  ? 161.000 139.779 153.758 1.00 66.73  ? 345  PHE B CD1   1 
ATOM   4485  C CD2   . PHE B 2 353  ? 162.989 140.933 153.114 1.00 66.73  ? 345  PHE B CD2   1 
ATOM   4486  C CE1   . PHE B 2 353  ? 161.753 138.691 154.153 1.00 66.73  ? 345  PHE B CE1   1 
ATOM   4487  C CE2   . PHE B 2 353  ? 163.748 139.847 153.514 1.00 66.73  ? 345  PHE B CE2   1 
ATOM   4488  C CZ    . PHE B 2 353  ? 163.128 138.726 154.034 1.00 66.73  ? 345  PHE B CZ    1 
ATOM   4489  N N     . VAL B 2 354  ? 161.799 143.079 149.918 1.00 51.65  ? 346  VAL B N     1 
ATOM   4490  C CA    . VAL B 2 354  ? 162.738 143.145 148.802 1.00 51.65  ? 346  VAL B CA    1 
ATOM   4491  C C     . VAL B 2 354  ? 164.154 142.746 149.189 1.00 51.65  ? 346  VAL B C     1 
ATOM   4492  O O     . VAL B 2 354  ? 164.969 142.461 148.304 1.00 51.65  ? 346  VAL B O     1 
ATOM   4493  C CB    . VAL B 2 354  ? 162.749 144.555 148.188 1.00 51.65  ? 346  VAL B CB    1 
ATOM   4494  N N     . SER B 2 355  ? 164.476 142.723 150.478 1.00 38.37  ? 347  SER B N     1 
ATOM   4495  C CA    . SER B 2 355  ? 165.824 142.381 150.895 1.00 38.37  ? 347  SER B CA    1 
ATOM   4496  C C     . SER B 2 355  ? 166.065 140.882 150.754 1.00 38.37  ? 347  SER B C     1 
ATOM   4497  O O     . SER B 2 355  ? 165.125 140.085 150.665 1.00 38.37  ? 347  SER B O     1 
ATOM   4498  C CB    . SER B 2 355  ? 166.063 142.819 152.338 1.00 38.37  ? 347  SER B CB    1 
ATOM   4499  N N     . SER B 2 356  ? 167.355 140.521 150.715 1.00 27.19  ? 348  SER B N     1 
ATOM   4500  C CA    . SER B 2 356  ? 167.838 139.135 150.659 1.00 27.19  ? 348  SER B CA    1 
ATOM   4501  C C     . SER B 2 356  ? 167.263 138.378 149.465 1.00 27.19  ? 348  SER B C     1 
ATOM   4502  O O     . SER B 2 356  ? 166.920 137.197 149.560 1.00 27.19  ? 348  SER B O     1 
ATOM   4503  C CB    . SER B 2 356  ? 167.550 138.388 151.963 1.00 27.19  ? 348  SER B CB    1 
ATOM   4504  N N     . GLN B 2 357  ? 167.154 139.069 148.328 1.00 25.69  ? 349  GLN B N     1 
ATOM   4505  C CA    . GLN B 2 357  ? 166.606 138.457 147.125 1.00 25.69  ? 349  GLN B CA    1 
ATOM   4506  C C     . GLN B 2 357  ? 167.541 137.419 146.527 1.00 25.69  ? 349  GLN B C     1 
ATOM   4507  O O     . GLN B 2 357  ? 167.104 136.620 145.694 1.00 25.69  ? 349  GLN B O     1 
ATOM   4508  C CB    . GLN B 2 357  ? 166.294 139.529 146.081 1.00 25.69  ? 349  GLN B CB    1 
ATOM   4509  N N     . GLU B 2 358  ? 168.813 137.417 146.920 1.00 29.07  ? 350  GLU B N     1 
ATOM   4510  C CA    . GLU B 2 358  ? 169.741 136.349 146.555 1.00 29.07  ? 350  GLU B CA    1 
ATOM   4511  C C     . GLU B 2 358  ? 169.683 135.258 147.623 1.00 29.07  ? 350  GLU B C     1 
ATOM   4512  O O     . GLU B 2 358  ? 170.614 135.035 148.398 1.00 29.07  ? 350  GLU B O     1 
ATOM   4513  C CB    . GLU B 2 358  ? 171.150 136.900 146.382 1.00 29.07  ? 350  GLU B CB    1 
ATOM   4514  N N     . PHE B 2 359  ? 168.544 134.577 147.658 1.00 41.60  ? 351  PHE B N     1 
ATOM   4515  C CA    . PHE B 2 359  ? 168.358 133.466 148.571 1.00 41.60  ? 351  PHE B CA    1 
ATOM   4516  C C     . PHE B 2 359  ? 168.923 132.188 147.958 1.00 41.60  ? 351  PHE B C     1 
ATOM   4517  O O     . PHE B 2 359  ? 169.491 132.190 146.863 1.00 41.60  ? 351  PHE B O     1 
ATOM   4518  C CB    . PHE B 2 359  ? 166.881 133.303 148.919 1.00 41.60  ? 351  PHE B CB    1 
ATOM   4519  N N     . LEU B 2 360  ? 168.761 131.079 148.680 1.00 46.12  ? 352  LEU B N     1 
ATOM   4520  C CA    . LEU B 2 360  ? 169.240 129.793 148.187 1.00 46.12  ? 352  LEU B CA    1 
ATOM   4521  C C     . LEU B 2 360  ? 168.374 129.289 147.040 1.00 46.12  ? 352  LEU B C     1 
ATOM   4522  O O     . LEU B 2 360  ? 168.889 128.925 145.977 1.00 46.12  ? 352  LEU B O     1 
ATOM   4523  C CB    . LEU B 2 360  ? 169.271 128.776 149.328 1.00 46.12  ? 352  LEU B CB    1 
ATOM   4524  N N     . GLY B 2 361  ? 167.053 129.256 147.243 1.00 42.78  ? 353  GLY B N     1 
ATOM   4525  C CA    . GLY B 2 361  ? 166.145 128.870 146.176 1.00 42.78  ? 353  GLY B CA    1 
ATOM   4526  C C     . GLY B 2 361  ? 166.147 129.844 145.017 1.00 42.78  ? 353  GLY B C     1 
ATOM   4527  O O     . GLY B 2 361  ? 166.075 129.433 143.853 1.00 42.78  ? 353  GLY B O     1 
ATOM   4528  N N     . ASN B 2 362  ? 166.261 131.137 145.317 1.00 39.54  ? 354  ASN B N     1 
ATOM   4529  C CA    . ASN B 2 362  ? 166.398 132.145 144.277 1.00 39.54  ? 354  ASN B CA    1 
ATOM   4530  C C     . ASN B 2 362  ? 167.734 132.051 143.559 1.00 39.54  ? 354  ASN B C     1 
ATOM   4531  O O     . ASN B 2 362  ? 167.857 132.562 142.443 1.00 39.54  ? 354  ASN B O     1 
ATOM   4532  C CB    . ASN B 2 362  ? 166.222 133.539 144.875 1.00 39.54  ? 354  ASN B CB    1 
ATOM   4533  N N     . ALA B 2 363  ? 168.741 131.431 144.174 1.00 37.38  ? 355  ALA B N     1 
ATOM   4534  C CA    . ALA B 2 363  ? 169.948 131.121 143.424 1.00 37.38  ? 355  ALA B CA    1 
ATOM   4535  C C     . ALA B 2 363  ? 169.706 129.979 142.450 1.00 37.38  ? 355  ALA B C     1 
ATOM   4536  O O     . ALA B 2 363  ? 170.320 129.944 141.378 1.00 37.38  ? 355  ALA B O     1 
ATOM   4537  C CB    . ALA B 2 363  ? 171.099 130.779 144.369 1.00 37.38  ? 355  ALA B CB    1 
ATOM   4538  N N     . TYR B 2 364  ? 168.815 129.046 142.794 1.00 43.18  ? 356  TYR B N     1 
ATOM   4539  C CA    . TYR B 2 364  ? 168.496 127.967 141.866 1.00 43.18  ? 356  TYR B CA    1 
ATOM   4540  C C     . TYR B 2 364  ? 167.693 128.490 140.685 1.00 43.18  ? 356  TYR B C     1 
ATOM   4541  O O     . TYR B 2 364  ? 168.067 128.285 139.523 1.00 43.18  ? 356  TYR B O     1 
ATOM   4542  C CB    . TYR B 2 364  ? 167.718 126.847 142.563 1.00 43.18  ? 356  TYR B CB    1 
ATOM   4543  C CG    . TYR B 2 364  ? 168.444 126.137 143.679 1.00 43.18  ? 356  TYR B CG    1 
ATOM   4544  C CD1   . TYR B 2 364  ? 169.595 125.407 143.429 1.00 43.18  ? 356  TYR B CD1   1 
ATOM   4545  C CD2   . TYR B 2 364  ? 167.916 126.101 144.960 1.00 43.18  ? 356  TYR B CD2   1 
ATOM   4546  C CE1   . TYR B 2 364  ? 170.254 124.739 144.448 1.00 43.18  ? 356  TYR B CE1   1 
ATOM   4547  C CE2   . TYR B 2 364  ? 168.556 125.432 145.983 1.00 43.18  ? 356  TYR B CE2   1 
ATOM   4548  C CZ    . TYR B 2 364  ? 169.721 124.747 145.721 1.00 43.18  ? 356  TYR B CZ    1 
ATOM   4549  O OH    . TYR B 2 364  ? 170.360 124.070 146.733 1.00 43.18  ? 356  TYR B OH    1 
ATOM   4550  N N     . VAL B 2 365  ? 166.582 129.173 140.968 1.00 32.74  ? 357  VAL B N     1 
ATOM   4551  C CA    . VAL B 2 365  ? 165.717 129.637 139.890 1.00 32.74  ? 357  VAL B CA    1 
ATOM   4552  C C     . VAL B 2 365  ? 166.352 130.805 139.156 1.00 32.74  ? 357  VAL B C     1 
ATOM   4553  O O     . VAL B 2 365  ? 166.072 131.030 137.974 1.00 32.74  ? 357  VAL B O     1 
ATOM   4554  C CB    . VAL B 2 365  ? 164.328 130.007 140.439 1.00 32.74  ? 357  VAL B CB    1 
ATOM   4555  N N     . LEU B 2 366  ? 167.208 131.565 139.831 1.00 28.32  ? 358  LEU B N     1 
ATOM   4556  C CA    . LEU B 2 366  ? 167.996 132.571 139.144 1.00 28.32  ? 358  LEU B CA    1 
ATOM   4557  C C     . LEU B 2 366  ? 169.122 131.952 138.334 1.00 28.32  ? 358  LEU B C     1 
ATOM   4558  O O     . LEU B 2 366  ? 169.604 132.582 137.390 1.00 28.32  ? 358  LEU B O     1 
ATOM   4559  C CB    . LEU B 2 366  ? 168.566 133.577 140.144 1.00 28.32  ? 358  LEU B CB    1 
ATOM   4560  N N     . ALA B 2 367  ? 169.558 130.742 138.690 1.00 28.17  ? 359  ALA B N     1 
ATOM   4561  C CA    . ALA B 2 367  ? 170.521 130.035 137.857 1.00 28.17  ? 359  ALA B CA    1 
ATOM   4562  C C     . ALA B 2 367  ? 169.851 129.487 136.607 1.00 28.17  ? 359  ALA B C     1 
ATOM   4563  O O     . ALA B 2 367  ? 170.450 129.481 135.526 1.00 28.17  ? 359  ALA B O     1 
ATOM   4564  C CB    . ALA B 2 367  ? 171.184 128.910 138.649 1.00 28.17  ? 359  ALA B CB    1 
ATOM   4565  N N     . VAL B 2 368  ? 168.603 129.033 136.741 1.00 29.75  ? 360  VAL B N     1 
ATOM   4566  C CA    . VAL B 2 368  ? 167.828 128.683 135.558 1.00 29.75  ? 360  VAL B CA    1 
ATOM   4567  C C     . VAL B 2 368  ? 167.502 129.932 134.756 1.00 29.75  ? 360  VAL B C     1 
ATOM   4568  O O     . VAL B 2 368  ? 167.361 129.873 133.529 1.00 29.75  ? 360  VAL B O     1 
ATOM   4569  C CB    . VAL B 2 368  ? 166.552 127.922 135.959 1.00 29.75  ? 360  VAL B CB    1 
ATOM   4570  N N     . LEU B 2 369  ? 167.382 131.077 135.429 1.00 29.28  ? 361  LEU B N     1 
ATOM   4571  C CA    . LEU B 2 369  ? 167.240 132.344 134.727 1.00 29.28  ? 361  LEU B CA    1 
ATOM   4572  C C     . LEU B 2 369  ? 168.525 132.721 134.012 1.00 29.28  ? 361  LEU B C     1 
ATOM   4573  O O     . LEU B 2 369  ? 168.485 133.399 132.981 1.00 29.28  ? 361  LEU B O     1 
ATOM   4574  C CB    . LEU B 2 369  ? 166.837 133.444 135.706 1.00 29.28  ? 361  LEU B CB    1 
ATOM   4575  N N     . LEU B 2 370  ? 169.670 132.300 134.545 1.00 28.37  ? 362  LEU B N     1 
ATOM   4576  C CA    . LEU B 2 370  ? 170.924 132.480 133.832 1.00 28.37  ? 362  LEU B CA    1 
ATOM   4577  C C     . LEU B 2 370  ? 171.022 131.525 132.656 1.00 28.37  ? 362  LEU B C     1 
ATOM   4578  O O     . LEU B 2 370  ? 171.727 131.810 131.683 1.00 28.37  ? 362  LEU B O     1 
ATOM   4579  C CB    . LEU B 2 370  ? 172.103 132.283 134.782 1.00 28.37  ? 362  LEU B CB    1 
ATOM   4580  N N     . PHE B 2 371  ? 170.341 130.383 132.734 1.00 33.04  ? 363  PHE B N     1 
ATOM   4581  C CA    . PHE B 2 371  ? 170.268 129.505 131.573 1.00 33.04  ? 363  PHE B CA    1 
ATOM   4582  C C     . PHE B 2 371  ? 169.374 130.102 130.499 1.00 33.04  ? 363  PHE B C     1 
ATOM   4583  O O     . PHE B 2 371  ? 169.682 130.012 129.305 1.00 33.04  ? 363  PHE B O     1 
ATOM   4584  C CB    . PHE B 2 371  ? 169.760 128.127 131.989 1.00 33.04  ? 363  PHE B CB    1 
ATOM   4585  N N     . LEU B 2 372  ? 168.261 130.712 130.907 1.00 32.21  ? 364  LEU B N     1 
ATOM   4586  C CA    . LEU B 2 372  ? 167.353 131.327 129.948 1.00 32.21  ? 364  LEU B CA    1 
ATOM   4587  C C     . LEU B 2 372  ? 167.978 132.564 129.322 1.00 32.21  ? 364  LEU B C     1 
ATOM   4588  O O     . LEU B 2 372  ? 167.833 132.803 128.118 1.00 32.21  ? 364  LEU B O     1 
ATOM   4589  C CB    . LEU B 2 372  ? 166.036 131.681 130.634 1.00 32.21  ? 364  LEU B CB    1 
ATOM   4590  N N     . ALA B 2 373  ? 168.688 133.353 130.124 1.00 38.17  ? 365  ALA B N     1 
ATOM   4591  C CA    . ALA B 2 373  ? 169.436 134.474 129.585 1.00 38.17  ? 365  ALA B CA    1 
ATOM   4592  C C     . ALA B 2 373  ? 170.647 134.012 128.795 1.00 38.17  ? 365  ALA B C     1 
ATOM   4593  O O     . ALA B 2 373  ? 171.141 134.761 127.951 1.00 38.17  ? 365  ALA B O     1 
ATOM   4594  C CB    . ALA B 2 373  ? 169.871 135.408 130.714 1.00 38.17  ? 365  ALA B CB    1 
ATOM   4595  N N     . LEU B 2 374  ? 171.144 132.803 129.066 1.00 39.42  ? 366  LEU B N     1 
ATOM   4596  C CA    . LEU B 2 374  ? 172.173 132.224 128.214 1.00 39.42  ? 366  LEU B CA    1 
ATOM   4597  C C     . LEU B 2 374  ? 171.596 131.834 126.865 1.00 39.42  ? 366  LEU B C     1 
ATOM   4598  O O     . LEU B 2 374  ? 172.290 131.916 125.844 1.00 39.42  ? 366  LEU B O     1 
ATOM   4599  C CB    . LEU B 2 374  ? 172.806 131.013 128.898 1.00 39.42  ? 366  LEU B CB    1 
ATOM   4600  N N     . LEU B 2 375  ? 170.328 131.415 126.844 1.00 45.74  ? 367  LEU B N     1 
ATOM   4601  C CA    . LEU B 2 375  ? 169.634 131.231 125.578 1.00 45.74  ? 367  LEU B CA    1 
ATOM   4602  C C     . LEU B 2 375  ? 169.370 132.566 124.900 1.00 45.74  ? 367  LEU B C     1 
ATOM   4603  O O     . LEU B 2 375  ? 169.333 132.638 123.669 1.00 45.74  ? 367  LEU B O     1 
ATOM   4604  C CB    . LEU B 2 375  ? 168.323 130.475 125.797 1.00 45.74  ? 367  LEU B CB    1 
ATOM   4605  N N     . LEU B 2 376  ? 169.184 133.627 125.686 1.00 40.63  ? 368  LEU B N     1 
ATOM   4606  C CA    . LEU B 2 376  ? 169.075 134.957 125.106 1.00 40.63  ? 368  LEU B CA    1 
ATOM   4607  C C     . LEU B 2 376  ? 170.407 135.423 124.538 1.00 40.63  ? 368  LEU B C     1 
ATOM   4608  O O     . LEU B 2 376  ? 170.436 136.157 123.544 1.00 40.63  ? 368  LEU B O     1 
ATOM   4609  C CB    . LEU B 2 376  ? 168.571 135.941 126.157 1.00 40.63  ? 368  LEU B CB    1 
ATOM   4610  N N     . GLN B 2 377  ? 171.514 134.989 125.139 1.00 38.81  ? 369  GLN B N     1 
ATOM   4611  C CA    . GLN B 2 377  ? 172.835 135.444 124.726 1.00 38.81  ? 369  GLN B CA    1 
ATOM   4612  C C     . GLN B 2 377  ? 173.324 134.688 123.502 1.00 38.81  ? 369  GLN B C     1 
ATOM   4613  O O     . GLN B 2 377  ? 173.867 135.291 122.571 1.00 38.81  ? 369  GLN B O     1 
ATOM   4614  C CB    . GLN B 2 377  ? 173.827 135.286 125.878 1.00 38.81  ? 369  GLN B CB    1 
ATOM   4615  N N     . ARG B 2 378  ? 173.158 133.366 123.495 1.00 36.09  ? 370  ARG B N     1 
ATOM   4616  C CA    . ARG B 2 378  ? 173.493 132.597 122.305 1.00 36.09  ? 370  ARG B CA    1 
ATOM   4617  C C     . ARG B 2 378  ? 172.495 132.851 121.187 1.00 36.09  ? 370  ARG B C     1 
ATOM   4618  O O     . ARG B 2 378  ? 172.869 132.841 120.008 1.00 36.09  ? 370  ARG B O     1 
ATOM   4619  C CB    . ARG B 2 378  ? 173.548 131.110 122.647 1.00 36.09  ? 370  ARG B CB    1 
ATOM   4620  N N     . THR B 2 379  ? 171.232 133.091 121.543 1.00 33.76  ? 371  THR B N     1 
ATOM   4621  C CA    . THR B 2 379  ? 170.206 133.351 120.541 1.00 33.76  ? 371  THR B CA    1 
ATOM   4622  C C     . THR B 2 379  ? 170.420 134.703 119.878 1.00 33.76  ? 371  THR B C     1 
ATOM   4623  O O     . THR B 2 379  ? 170.372 134.817 118.649 1.00 33.76  ? 371  THR B O     1 
ATOM   4624  C CB    . THR B 2 379  ? 168.820 133.286 121.179 1.00 33.76  ? 371  THR B CB    1 
ATOM   4625  N N     . PHE B 2 380  ? 170.658 135.742 120.680 1.00 36.32  ? 372  PHE B N     1 
ATOM   4626  C CA    . PHE B 2 380  ? 170.944 137.053 120.113 1.00 36.32  ? 372  PHE B CA    1 
ATOM   4627  C C     . PHE B 2 380  ? 172.310 137.081 119.449 1.00 36.32  ? 372  PHE B C     1 
ATOM   4628  O O     . PHE B 2 380  ? 172.520 137.844 118.499 1.00 36.32  ? 372  PHE B O     1 
ATOM   4629  C CB    . PHE B 2 380  ? 170.857 138.125 121.199 1.00 36.32  ? 372  PHE B CB    1 
ATOM   4630  N N     . LEU B 2 381  ? 173.237 136.256 119.936 1.00 26.56  ? 373  LEU B N     1 
ATOM   4631  C CA    . LEU B 2 381  ? 174.559 136.155 119.332 1.00 26.56  ? 373  LEU B CA    1 
ATOM   4632  C C     . LEU B 2 381  ? 174.468 135.594 117.922 1.00 26.56  ? 373  LEU B C     1 
ATOM   4633  O O     . LEU B 2 381  ? 174.937 136.218 116.965 1.00 26.56  ? 373  LEU B O     1 
ATOM   4634  C CB    . LEU B 2 381  ? 175.466 135.284 120.200 1.00 26.56  ? 373  LEU B CB    1 
ATOM   4635  N N     . GLN B 2 382  ? 173.817 134.440 117.772 1.00 29.70  ? 374  GLN B N     1 
ATOM   4636  C CA    . GLN B 2 382  ? 173.603 133.871 116.449 1.00 29.70  ? 374  GLN B CA    1 
ATOM   4637  C C     . GLN B 2 382  ? 172.617 134.684 115.622 1.00 29.70  ? 374  GLN B C     1 
ATOM   4638  O O     . GLN B 2 382  ? 172.590 134.542 114.395 1.00 29.70  ? 374  GLN B O     1 
ATOM   4639  C CB    . GLN B 2 382  ? 173.114 132.428 116.575 1.00 29.70  ? 374  GLN B CB    1 
ATOM   4640  N N     . ALA B 2 383  ? 171.807 135.523 116.261 1.00 26.57  ? 375  ALA B N     1 
ATOM   4641  C CA    . ALA B 2 383  ? 170.915 136.399 115.517 1.00 26.57  ? 375  ALA B CA    1 
ATOM   4642  C C     . ALA B 2 383  ? 171.693 137.518 114.844 1.00 26.57  ? 375  ALA B C     1 
ATOM   4643  O O     . ALA B 2 383  ? 171.507 137.791 113.653 1.00 26.57  ? 375  ALA B O     1 
ATOM   4644  C CB    . ALA B 2 383  ? 169.849 136.968 116.451 1.00 26.57  ? 375  ALA B CB    1 
ATOM   4645  N N     . SER B 2 384  ? 172.571 138.183 115.599 1.00 25.67  ? 376  SER B N     1 
ATOM   4646  C CA    . SER B 2 384  ? 173.407 139.219 115.011 1.00 25.67  ? 376  SER B CA    1 
ATOM   4647  C C     . SER B 2 384  ? 174.422 138.626 114.049 1.00 25.67  ? 376  SER B C     1 
ATOM   4648  O O     . SER B 2 384  ? 174.821 139.290 113.084 1.00 25.67  ? 376  SER B O     1 
ATOM   4649  C CB    . SER B 2 384  ? 174.112 140.009 116.109 1.00 25.67  ? 376  SER B CB    1 
ATOM   4650  O OG    . SER B 2 384  ? 174.957 141.002 115.559 1.00 25.67  ? 376  SER B OG    1 
ATOM   4651  N N     . TYR B 2 385  ? 174.849 137.386 114.306 1.00 30.06  ? 377  TYR B N     1 
ATOM   4652  C CA    . TYR B 2 385  ? 175.623 136.642 113.321 1.00 30.06  ? 377  TYR B CA    1 
ATOM   4653  C C     . TYR B 2 385  ? 174.821 136.445 112.042 1.00 30.06  ? 377  TYR B C     1 
ATOM   4654  O O     . TYR B 2 385  ? 175.354 136.600 110.938 1.00 30.06  ? 377  TYR B O     1 
ATOM   4655  C CB    . TYR B 2 385  ? 176.041 135.282 113.891 1.00 30.06  ? 377  TYR B CB    1 
ATOM   4656  C CG    . TYR B 2 385  ? 177.076 135.308 114.997 1.00 30.06  ? 377  TYR B CG    1 
ATOM   4657  C CD1   . TYR B 2 385  ? 177.856 136.431 115.234 1.00 30.06  ? 377  TYR B CD1   1 
ATOM   4658  C CD2   . TYR B 2 385  ? 177.259 134.201 115.817 1.00 30.06  ? 377  TYR B CD2   1 
ATOM   4659  C CE1   . TYR B 2 385  ? 178.798 136.447 116.252 1.00 30.06  ? 377  TYR B CE1   1 
ATOM   4660  C CE2   . TYR B 2 385  ? 178.196 134.207 116.834 1.00 30.06  ? 377  TYR B CE2   1 
ATOM   4661  C CZ    . TYR B 2 385  ? 178.961 135.331 117.046 1.00 30.06  ? 377  TYR B CZ    1 
ATOM   4662  O OH    . TYR B 2 385  ? 179.894 135.338 118.057 1.00 30.06  ? 377  TYR B OH    1 
ATOM   4663  N N     . TYR B 2 386  ? 173.531 136.126 112.180 1.00 24.21  ? 378  TYR B N     1 
ATOM   4664  C CA    . TYR B 2 386  ? 172.672 135.885 111.026 1.00 24.21  ? 378  TYR B CA    1 
ATOM   4665  C C     . TYR B 2 386  ? 172.475 137.145 110.201 1.00 24.21  ? 378  TYR B C     1 
ATOM   4666  O O     . TYR B 2 386  ? 172.574 137.110 108.967 1.00 24.21  ? 378  TYR B O     1 
ATOM   4667  C CB    . TYR B 2 386  ? 171.323 135.343 111.494 1.00 24.21  ? 378  TYR B CB    1 
ATOM   4668  C CG    . TYR B 2 386  ? 170.318 135.165 110.386 1.00 24.21  ? 378  TYR B CG    1 
ATOM   4669  C CD1   . TYR B 2 386  ? 170.411 134.099 109.507 1.00 24.21  ? 378  TYR B CD1   1 
ATOM   4670  C CD2   . TYR B 2 386  ? 169.270 136.066 110.222 1.00 24.21  ? 378  TYR B CD2   1 
ATOM   4671  C CE1   . TYR B 2 386  ? 169.492 133.932 108.492 1.00 24.21  ? 378  TYR B CE1   1 
ATOM   4672  C CE2   . TYR B 2 386  ? 168.348 135.909 109.209 1.00 24.21  ? 378  TYR B CE2   1 
ATOM   4673  C CZ    . TYR B 2 386  ? 168.463 134.840 108.349 1.00 24.21  ? 378  TYR B CZ    1 
ATOM   4674  O OH    . TYR B 2 386  ? 167.545 134.677 107.339 1.00 24.21  ? 378  TYR B OH    1 
ATOM   4675  N N     . VAL B 2 387  ? 172.208 138.270 110.868 1.00 26.49  ? 379  VAL B N     1 
ATOM   4676  C CA    . VAL B 2 387  ? 172.055 139.533 110.159 1.00 26.49  ? 379  VAL B CA    1 
ATOM   4677  C C     . VAL B 2 387  ? 173.386 139.988 109.582 1.00 26.49  ? 379  VAL B C     1 
ATOM   4678  O O     . VAL B 2 387  ? 173.422 140.710 108.579 1.00 26.49  ? 379  VAL B O     1 
ATOM   4679  C CB    . VAL B 2 387  ? 171.450 140.598 111.091 1.00 26.49  ? 379  VAL B CB    1 
ATOM   4680  N N     . ALA B 2 388  ? 174.495 139.575 110.196 1.00 26.15  ? 380  ALA B N     1 
ATOM   4681  C CA    . ALA B 2 388  ? 175.803 139.873 109.629 1.00 26.15  ? 380  ALA B CA    1 
ATOM   4682  C C     . ALA B 2 388  ? 176.037 139.093 108.343 1.00 26.15  ? 380  ALA B C     1 
ATOM   4683  O O     . ALA B 2 388  ? 176.564 139.643 107.368 1.00 26.15  ? 380  ALA B O     1 
ATOM   4684  C CB    . ALA B 2 388  ? 176.897 139.567 110.648 1.00 26.15  ? 380  ALA B CB    1 
ATOM   4685  N N     . ILE B 2 389  ? 175.648 137.817 108.322 1.00 30.73  ? 381  ILE B N     1 
ATOM   4686  C CA    . ILE B 2 389  ? 175.842 136.999 107.129 1.00 30.73  ? 381  ILE B CA    1 
ATOM   4687  C C     . ILE B 2 389  ? 174.923 137.470 106.009 1.00 30.73  ? 381  ILE B C     1 
ATOM   4688  O O     . ILE B 2 389  ? 175.329 137.536 104.841 1.00 30.73  ? 381  ILE B O     1 
ATOM   4689  C CB    . ILE B 2 389  ? 175.636 135.510 107.466 1.00 30.73  ? 381  ILE B CB    1 
ATOM   4690  C CG1   . ILE B 2 389  ? 176.704 135.030 108.445 1.00 30.73  ? 381  ILE B CG1   1 
ATOM   4691  C CG2   . ILE B 2 389  ? 175.707 134.640 106.226 1.00 30.73  ? 381  ILE B CG2   1 
ATOM   4692  C CD1   . ILE B 2 389  ? 176.444 133.648 108.998 1.00 30.73  ? 381  ILE B CD1   1 
ATOM   4693  N N     . GLU B 2 390  ? 173.685 137.840 106.352 1.00 27.71  ? 382  GLU B N     1 
ATOM   4694  C CA    . GLU B 2 390  ? 172.778 138.398 105.353 1.00 27.71  ? 382  GLU B CA    1 
ATOM   4695  C C     . GLU B 2 390  ? 173.269 139.745 104.850 1.00 27.71  ? 382  GLU B C     1 
ATOM   4696  O O     . GLU B 2 390  ? 173.113 140.066 103.662 1.00 27.71  ? 382  GLU B O     1 
ATOM   4697  C CB    . GLU B 2 390  ? 171.375 138.533 105.943 1.00 27.71  ? 382  GLU B CB    1 
ATOM   4698  N N     . THR B 2 391  ? 173.888 140.524 105.736 1.00 31.91  ? 383  THR B N     1 
ATOM   4699  C CA    . THR B 2 391  ? 174.460 141.806 105.355 1.00 31.91  ? 383  THR B CA    1 
ATOM   4700  C C     . THR B 2 391  ? 175.634 141.621 104.401 1.00 31.91  ? 383  THR B C     1 
ATOM   4701  O O     . THR B 2 391  ? 175.786 142.382 103.439 1.00 31.91  ? 383  THR B O     1 
ATOM   4702  C CB    . THR B 2 391  ? 174.883 142.561 106.613 1.00 31.91  ? 383  THR B CB    1 
ATOM   4703  O OG1   . THR B 2 391  ? 173.752 142.690 107.482 1.00 31.91  ? 383  THR B OG1   1 
ATOM   4704  C CG2   . THR B 2 391  ? 175.395 143.948 106.271 1.00 31.91  ? 383  THR B CG2   1 
ATOM   4705  N N     . GLY B 2 392  ? 176.458 140.596 104.634 1.00 31.85  ? 384  GLY B N     1 
ATOM   4706  C CA    . GLY B 2 392  ? 177.532 140.298 103.703 1.00 31.85  ? 384  GLY B CA    1 
ATOM   4707  C C     . GLY B 2 392  ? 177.035 139.726 102.393 1.00 31.85  ? 384  GLY B C     1 
ATOM   4708  O O     . GLY B 2 392  ? 177.674 139.906 101.350 1.00 31.85  ? 384  GLY B O     1 
ATOM   4709  N N     . ILE B 2 393  ? 175.897 139.031 102.428 1.00 33.93  ? 385  ILE B N     1 
ATOM   4710  C CA    . ILE B 2 393  ? 175.304 138.489 101.211 1.00 33.93  ? 385  ILE B CA    1 
ATOM   4711  C C     . ILE B 2 393  ? 174.810 139.619 100.321 1.00 33.93  ? 385  ILE B C     1 
ATOM   4712  O O     . ILE B 2 393  ? 175.137 139.681 99.127  1.00 33.93  ? 385  ILE B O     1 
ATOM   4713  C CB    . ILE B 2 393  ? 174.170 137.512 101.560 1.00 33.93  ? 385  ILE B CB    1 
ATOM   4714  N N     . ASN B 2 394  ? 174.040 140.546 100.899 1.00 34.04  ? 386  ASN B N     1 
ATOM   4715  C CA    . ASN B 2 394  ? 173.628 141.738 100.168 1.00 34.04  ? 386  ASN B CA    1 
ATOM   4716  C C     . ASN B 2 394  ? 174.812 142.631 99.814  1.00 34.04  ? 386  ASN B C     1 
ATOM   4717  O O     . ASN B 2 394  ? 174.739 143.383 98.835  1.00 34.04  ? 386  ASN B O     1 
ATOM   4718  C CB    . ASN B 2 394  ? 172.603 142.519 100.986 1.00 34.04  ? 386  ASN B CB    1 
ATOM   4719  N N     . LEU B 2 395  ? 175.901 142.539 100.579 1.00 43.66  ? 387  LEU B N     1 
ATOM   4720  C CA    . LEU B 2 395  ? 177.105 143.307 100.292 1.00 43.66  ? 387  LEU B CA    1 
ATOM   4721  C C     . LEU B 2 395  ? 177.771 142.826 99.012  1.00 43.66  ? 387  LEU B C     1 
ATOM   4722  O O     . LEU B 2 395  ? 177.985 143.607 98.078  1.00 43.66  ? 387  LEU B O     1 
ATOM   4723  C CB    . LEU B 2 395  ? 178.079 143.198 101.461 1.00 43.66  ? 387  LEU B CB    1 
ATOM   4724  N N     . ARG B 2 396  ? 178.119 141.537 98.957  1.00 41.54  ? 388  ARG B N     1 
ATOM   4725  C CA    . ARG B 2 396  ? 178.811 141.021 97.784  1.00 41.54  ? 388  ARG B CA    1 
ATOM   4726  C C     . ARG B 2 396  ? 177.889 140.953 96.576  1.00 41.54  ? 388  ARG B C     1 
ATOM   4727  O O     . ARG B 2 396  ? 178.358 141.037 95.435  1.00 41.54  ? 388  ARG B O     1 
ATOM   4728  C CB    . ARG B 2 396  ? 179.418 139.651 98.084  1.00 41.54  ? 388  ARG B CB    1 
ATOM   4729  C CG    . ARG B 2 396  ? 178.417 138.543 98.355  1.00 41.54  ? 388  ARG B CG    1 
ATOM   4730  C CD    . ARG B 2 396  ? 179.123 137.235 98.638  1.00 41.54  ? 388  ARG B CD    1 
ATOM   4731  N NE    . ARG B 2 396  ? 178.183 136.136 98.813  1.00 41.54  ? 388  ARG B NE    1 
ATOM   4732  C CZ    . ARG B 2 396  ? 178.545 134.879 99.032  1.00 41.54  ? 388  ARG B CZ    1 
ATOM   4733  N NH1   . ARG B 2 396  ? 179.830 134.564 99.104  1.00 41.54  ? 388  ARG B NH1   1 
ATOM   4734  N NH2   . ARG B 2 396  ? 177.624 133.936 99.177  1.00 41.54  ? 388  ARG B NH2   1 
ATOM   4735  N N     . GLY B 2 397  ? 176.580 140.826 96.804  1.00 43.09  ? 389  GLY B N     1 
ATOM   4736  C CA    . GLY B 2 397  ? 175.649 140.874 95.692  1.00 43.09  ? 389  GLY B CA    1 
ATOM   4737  C C     . GLY B 2 397  ? 175.523 142.270 95.112  1.00 43.09  ? 389  GLY B C     1 
ATOM   4738  O O     . GLY B 2 397  ? 175.522 142.450 93.891  1.00 43.09  ? 389  GLY B O     1 
ATOM   4739  N N     . ALA B 2 398  ? 175.424 143.277 95.983  1.00 51.00  ? 390  ALA B N     1 
ATOM   4740  C CA    . ALA B 2 398  ? 175.256 144.647 95.512  1.00 51.00  ? 390  ALA B CA    1 
ATOM   4741  C C     . ALA B 2 398  ? 176.540 145.175 94.881  1.00 51.00  ? 390  ALA B C     1 
ATOM   4742  O O     . ALA B 2 398  ? 176.518 145.735 93.776  1.00 51.00  ? 390  ALA B O     1 
ATOM   4743  C CB    . ALA B 2 398  ? 174.816 145.542 96.671  1.00 51.00  ? 390  ALA B CB    1 
ATOM   4744  N N     . ILE B 2 399  ? 177.670 144.986 95.565  1.00 47.96  ? 391  ILE B N     1 
ATOM   4745  C CA    . ILE B 2 399  ? 178.954 145.438 95.041  1.00 47.96  ? 391  ILE B CA    1 
ATOM   4746  C C     . ILE B 2 399  ? 179.362 144.611 93.835  1.00 47.96  ? 391  ILE B C     1 
ATOM   4747  O O     . ILE B 2 399  ? 180.093 145.093 92.962  1.00 47.96  ? 391  ILE B O     1 
ATOM   4748  C CB    . ILE B 2 399  ? 180.026 145.388 96.144  1.00 47.96  ? 391  ILE B CB    1 
ATOM   4749  N N     . GLN B 2 400  ? 178.908 143.359 93.767  1.00 45.24  ? 392  GLN B N     1 
ATOM   4750  C CA    . GLN B 2 400  ? 179.081 142.585 92.548  1.00 45.24  ? 392  GLN B CA    1 
ATOM   4751  C C     . GLN B 2 400  ? 178.251 143.169 91.413  1.00 45.24  ? 392  GLN B C     1 
ATOM   4752  O O     . GLN B 2 400  ? 178.713 143.226 90.266  1.00 45.24  ? 392  GLN B O     1 
ATOM   4753  C CB    . GLN B 2 400  ? 178.703 141.127 92.800  1.00 45.24  ? 392  GLN B CB    1 
ATOM   4754  N N     . THR B 2 401  ? 177.035 143.631 91.724  1.00 48.72  ? 393  THR B N     1 
ATOM   4755  C CA    . THR B 2 401  ? 176.134 144.151 90.701  1.00 48.72  ? 393  THR B CA    1 
ATOM   4756  C C     . THR B 2 401  ? 176.666 145.443 90.103  1.00 48.72  ? 393  THR B C     1 
ATOM   4757  O O     . THR B 2 401  ? 176.799 145.565 88.878  1.00 48.72  ? 393  THR B O     1 
ATOM   4758  C CB    . THR B 2 401  ? 174.742 144.371 91.292  1.00 48.72  ? 393  THR B CB    1 
ATOM   4759  N N     . LYS B 2 402  ? 177.011 146.412 90.954  1.00 47.50  ? 394  LYS B N     1 
ATOM   4760  C CA    . LYS B 2 402  ? 177.622 147.634 90.453  1.00 47.50  ? 394  LYS B CA    1 
ATOM   4761  C C     . LYS B 2 402  ? 179.040 147.401 89.954  1.00 47.50  ? 394  LYS B C     1 
ATOM   4762  O O     . LYS B 2 402  ? 179.552 148.214 89.177  1.00 47.50  ? 394  LYS B O     1 
ATOM   4763  C CB    . LYS B 2 402  ? 177.619 148.709 91.539  1.00 47.50  ? 394  LYS B CB    1 
ATOM   4764  N N     . ILE B 2 403  ? 179.677 146.308 90.375  1.00 45.17  ? 395  ILE B N     1 
ATOM   4765  C CA    . ILE B 2 403  ? 181.023 145.996 89.908  1.00 45.17  ? 395  ILE B CA    1 
ATOM   4766  C C     . ILE B 2 403  ? 180.992 145.584 88.443  1.00 45.17  ? 395  ILE B C     1 
ATOM   4767  O O     . ILE B 2 403  ? 181.589 146.237 87.580  1.00 45.17  ? 395  ILE B O     1 
ATOM   4768  C CB    . ILE B 2 403  ? 181.651 144.897 90.784  1.00 45.17  ? 395  ILE B CB    1 
ATOM   4769  N N     . TYR B 2 404  ? 180.277 144.498 88.142  1.00 47.02  ? 396  TYR B N     1 
ATOM   4770  C CA    . TYR B 2 404  ? 180.262 144.002 86.773  1.00 47.02  ? 396  TYR B CA    1 
ATOM   4771  C C     . TYR B 2 404  ? 179.403 144.870 85.869  1.00 47.02  ? 396  TYR B C     1 
ATOM   4772  O O     . TYR B 2 404  ? 179.630 144.910 84.654  1.00 47.02  ? 396  TYR B O     1 
ATOM   4773  C CB    . TYR B 2 404  ? 179.786 142.556 86.755  1.00 47.02  ? 396  TYR B CB    1 
ATOM   4774  C CG    . TYR B 2 404  ? 180.785 141.621 87.379  1.00 47.02  ? 396  TYR B CG    1 
ATOM   4775  C CD1   . TYR B 2 404  ? 181.841 141.114 86.638  1.00 47.02  ? 396  TYR B CD1   1 
ATOM   4776  C CD2   . TYR B 2 404  ? 180.696 141.278 88.719  1.00 47.02  ? 396  TYR B CD2   1 
ATOM   4777  C CE1   . TYR B 2 404  ? 182.767 140.268 87.209  1.00 47.02  ? 396  TYR B CE1   1 
ATOM   4778  C CE2   . TYR B 2 404  ? 181.618 140.435 89.302  1.00 47.02  ? 396  TYR B CE2   1 
ATOM   4779  C CZ    . TYR B 2 404  ? 182.652 139.936 88.541  1.00 47.02  ? 396  TYR B CZ    1 
ATOM   4780  O OH    . TYR B 2 404  ? 183.572 139.092 89.117  1.00 47.02  ? 396  TYR B OH    1 
ATOM   4781  N N     . ASN B 2 405  ? 178.421 145.574 86.438  1.00 48.39  ? 397  ASN B N     1 
ATOM   4782  C CA    . ASN B 2 405  ? 177.732 146.604 85.671  1.00 48.39  ? 397  ASN B CA    1 
ATOM   4783  C C     . ASN B 2 405  ? 178.661 147.769 85.366  1.00 48.39  ? 397  ASN B C     1 
ATOM   4784  O O     . ASN B 2 405  ? 178.560 148.379 84.294  1.00 48.39  ? 397  ASN B O     1 
ATOM   4785  C CB    . ASN B 2 405  ? 176.500 147.091 86.430  1.00 48.39  ? 397  ASN B CB    1 
ATOM   4786  N N     . LYS B 2 406  ? 179.580 148.069 86.285  1.00 57.45  ? 398  LYS B N     1 
ATOM   4787  C CA    . LYS B 2 406  ? 180.505 149.179 86.087  1.00 57.45  ? 398  LYS B CA    1 
ATOM   4788  C C     . LYS B 2 406  ? 181.535 148.857 85.013  1.00 57.45  ? 398  LYS B C     1 
ATOM   4789  O O     . LYS B 2 406  ? 181.780 149.670 84.114  1.00 57.45  ? 398  LYS B O     1 
ATOM   4790  C CB    . LYS B 2 406  ? 181.191 149.524 87.408  1.00 57.45  ? 398  LYS B CB    1 
ATOM   4791  N N     . ILE B 2 407  ? 182.148 147.672 85.085  1.00 55.31  ? 399  ILE B N     1 
ATOM   4792  C CA    . ILE B 2 407  ? 183.145 147.321 84.078  1.00 55.31  ? 399  ILE B CA    1 
ATOM   4793  C C     . ILE B 2 407  ? 182.466 146.969 82.760  1.00 55.31  ? 399  ILE B C     1 
ATOM   4794  O O     . ILE B 2 407  ? 183.044 147.163 81.682  1.00 55.31  ? 399  ILE B O     1 
ATOM   4795  C CB    . ILE B 2 407  ? 184.062 146.192 84.602  1.00 55.31  ? 399  ILE B CB    1 
ATOM   4796  C CG1   . ILE B 2 407  ? 185.276 146.008 83.688  1.00 55.31  ? 399  ILE B CG1   1 
ATOM   4797  C CG2   . ILE B 2 407  ? 183.309 144.878 84.783  1.00 55.31  ? 399  ILE B CG2   1 
ATOM   4798  C CD1   . ILE B 2 407  ? 186.166 147.224 83.612  1.00 55.31  ? 399  ILE B CD1   1 
ATOM   4799  N N     . MET B 2 408  ? 181.219 146.504 82.814  1.00 60.44  ? 400  MET B N     1 
ATOM   4800  C CA    . MET B 2 408  ? 180.483 146.239 81.589  1.00 60.44  ? 400  MET B CA    1 
ATOM   4801  C C     . MET B 2 408  ? 180.063 147.531 80.906  1.00 60.44  ? 400  MET B C     1 
ATOM   4802  O O     . MET B 2 408  ? 179.938 147.570 79.678  1.00 60.44  ? 400  MET B O     1 
ATOM   4803  C CB    . MET B 2 408  ? 179.264 145.369 81.890  1.00 60.44  ? 400  MET B CB    1 
ATOM   4804  N N     . HIS B 2 409  ? 179.860 148.596 81.676  1.00 72.63  ? 401  HIS B N     1 
ATOM   4805  C CA    . HIS B 2 409  ? 179.400 149.849 81.098  1.00 72.63  ? 401  HIS B CA    1 
ATOM   4806  C C     . HIS B 2 409  ? 180.538 150.796 80.741  1.00 72.63  ? 401  HIS B C     1 
ATOM   4807  O O     . HIS B 2 409  ? 180.375 151.638 79.851  1.00 72.63  ? 401  HIS B O     1 
ATOM   4808  C CB    . HIS B 2 409  ? 178.437 150.544 82.066  1.00 72.63  ? 401  HIS B CB    1 
ATOM   4809  C CG    . HIS B 2 409  ? 177.761 151.744 81.485  1.00 72.63  ? 401  HIS B CG    1 
ATOM   4810  N ND1   . HIS B 2 409  ? 178.316 153.006 81.532  1.00 72.63  ? 401  HIS B ND1   1 
ATOM   4811  C CD2   . HIS B 2 409  ? 176.580 151.877 80.838  1.00 72.63  ? 401  HIS B CD2   1 
ATOM   4812  C CE1   . HIS B 2 409  ? 177.504 153.863 80.942  1.00 72.63  ? 401  HIS B CE1   1 
ATOM   4813  N NE2   . HIS B 2 409  ? 176.442 153.204 80.513  1.00 72.63  ? 401  HIS B NE2   1 
ATOM   4814  N N     . MET B 2 410  ? 181.692 150.670 81.397  1.00 81.40  ? 402  MET B N     1 
ATOM   4815  C CA    . MET B 2 410  ? 182.730 151.687 81.270  1.00 81.40  ? 402  MET B CA    1 
ATOM   4816  C C     . MET B 2 410  ? 183.482 151.575 79.948  1.00 81.40  ? 402  MET B C     1 
ATOM   4817  O O     . MET B 2 410  ? 183.409 152.480 79.108  1.00 81.40  ? 402  MET B O     1 
ATOM   4818  C CB    . MET B 2 410  ? 183.703 151.585 82.446  1.00 81.40  ? 402  MET B CB    1 
ATOM   4819  N N     . SER B 2 411  ? 184.186 150.452 79.751  1.00 97.34  ? 403  SER B N     1 
ATOM   4820  C CA    . SER B 2 411  ? 185.070 150.196 78.604  1.00 97.34  ? 403  SER B CA    1 
ATOM   4821  C C     . SER B 2 411  ? 186.096 151.315 78.421  1.00 97.34  ? 403  SER B C     1 
ATOM   4822  O O     . SER B 2 411  ? 186.251 151.885 77.339  1.00 97.34  ? 403  SER B O     1 
ATOM   4823  C CB    . SER B 2 411  ? 184.268 149.966 77.320  1.00 97.34  ? 403  SER B CB    1 
ATOM   4824  N N     . THR B 2 412  ? 186.797 151.634 79.505  1.00 101.82 ? 404  THR B N     1 
ATOM   4825  C CA    . THR B 2 412  ? 187.820 152.668 79.507  1.00 101.82 ? 404  THR B CA    1 
ATOM   4826  C C     . THR B 2 412  ? 189.192 152.055 79.755  1.00 101.82 ? 404  THR B C     1 
ATOM   4827  O O     . THR B 2 412  ? 189.321 151.037 80.440  1.00 101.82 ? 404  THR B O     1 
ATOM   4828  C CB    . THR B 2 412  ? 187.527 153.730 80.572  1.00 101.82 ? 404  THR B CB    1 
ATOM   4829  N N     . SER B 2 413  ? 190.211 152.707 79.179  1.00 104.96 ? 405  SER B N     1 
ATOM   4830  C CA    . SER B 2 413  ? 191.631 152.350 79.293  1.00 104.96 ? 405  SER B CA    1 
ATOM   4831  C C     . SER B 2 413  ? 191.888 150.921 78.804  1.00 104.96 ? 405  SER B C     1 
ATOM   4832  O O     . SER B 2 413  ? 192.253 150.021 79.562  1.00 104.96 ? 405  SER B O     1 
ATOM   4833  C CB    . SER B 2 413  ? 192.151 152.546 80.722  1.00 104.96 ? 405  SER B CB    1 
ATOM   4834  O OG    . SER B 2 413  ? 193.513 152.163 80.814  1.00 104.96 ? 405  SER B OG    1 
ATOM   4835  N N     . ASN B 2 414  ? 191.692 150.743 77.497  1.00 106.00 ? 406  ASN B N     1 
ATOM   4836  C CA    . ASN B 2 414  ? 191.859 149.438 76.868  1.00 106.00 ? 406  ASN B CA    1 
ATOM   4837  C C     . ASN B 2 414  ? 193.313 148.984 76.778  1.00 106.00 ? 406  ASN B C     1 
ATOM   4838  O O     . ASN B 2 414  ? 193.553 147.842 76.373  1.00 106.00 ? 406  ASN B O     1 
ATOM   4839  C CB    . ASN B 2 414  ? 191.238 149.450 75.471  1.00 106.00 ? 406  ASN B CB    1 
ATOM   4840  N N     . LEU B 2 415  ? 194.281 149.838 77.130  1.00 100.41 ? 407  LEU B N     1 
ATOM   4841  C CA    . LEU B 2 415  ? 195.686 149.434 77.094  1.00 100.41 ? 407  LEU B CA    1 
ATOM   4842  C C     . LEU B 2 415  ? 195.992 148.422 78.190  1.00 100.41 ? 407  LEU B C     1 
ATOM   4843  O O     . LEU B 2 415  ? 196.617 147.385 77.933  1.00 100.41 ? 407  LEU B O     1 
ATOM   4844  C CB    . LEU B 2 415  ? 196.586 150.662 77.224  1.00 100.41 ? 407  LEU B CB    1 
ATOM   4845  N N     . SER B 2 416  ? 195.566 148.705 79.424  1.00 104.55 ? 408  SER B N     1 
ATOM   4846  C CA    . SER B 2 416  ? 195.667 147.704 80.480  1.00 104.55 ? 408  SER B CA    1 
ATOM   4847  C C     . SER B 2 416  ? 194.685 146.565 80.252  1.00 104.55 ? 408  SER B C     1 
ATOM   4848  O O     . SER B 2 416  ? 194.949 145.428 80.662  1.00 104.55 ? 408  SER B O     1 
ATOM   4849  C CB    . SER B 2 416  ? 195.433 148.342 81.847  1.00 104.55 ? 408  SER B CB    1 
ATOM   4850  O OG    . SER B 2 416  ? 196.459 149.266 82.159  1.00 104.55 ? 408  SER B OG    1 
ATOM   4851  N N     . MET B 2 417  ? 193.554 146.847 79.602  1.00 114.32 ? 409  MET B N     1 
ATOM   4852  C CA    . MET B 2 417  ? 192.658 145.781 79.177  1.00 114.32 ? 409  MET B CA    1 
ATOM   4853  C C     . MET B 2 417  ? 193.217 145.010 77.993  1.00 114.32 ? 409  MET B C     1 
ATOM   4854  O O     . MET B 2 417  ? 192.769 143.889 77.732  1.00 114.32 ? 409  MET B O     1 
ATOM   4855  C CB    . MET B 2 417  ? 191.280 146.346 78.829  1.00 114.32 ? 409  MET B CB    1 
ATOM   4856  N N     . GLY B 2 418  ? 194.180 145.586 77.268  1.00 128.04 ? 410  GLY B N     1 
ATOM   4857  C CA    . GLY B 2 418  ? 194.877 144.828 76.246  1.00 128.04 ? 410  GLY B CA    1 
ATOM   4858  C C     . GLY B 2 418  ? 195.750 143.735 76.823  1.00 128.04 ? 410  GLY B C     1 
ATOM   4859  O O     . GLY B 2 418  ? 195.961 142.702 76.183  1.00 128.04 ? 410  GLY B O     1 
ATOM   4860  N N     . GLU B 2 419  ? 196.262 143.939 78.033  1.00 127.23 ? 411  GLU B N     1 
ATOM   4861  C CA    . GLU B 2 419  ? 196.996 142.903 78.736  1.00 127.23 ? 411  GLU B CA    1 
ATOM   4862  C C     . GLU B 2 419  ? 196.022 142.028 79.517  1.00 127.23 ? 411  GLU B C     1 
ATOM   4863  O O     . GLU B 2 419  ? 194.817 142.285 79.567  1.00 127.23 ? 411  GLU B O     1 
ATOM   4864  C CB    . GLU B 2 419  ? 198.049 143.522 79.655  1.00 127.23 ? 411  GLU B CB    1 
ATOM   4865  N N     . MET B 2 420  ? 196.549 140.981 80.149  1.00 113.95 ? 412  MET B N     1 
ATOM   4866  C CA    . MET B 2 420  ? 195.749 140.073 80.959  1.00 113.95 ? 412  MET B CA    1 
ATOM   4867  C C     . MET B 2 420  ? 195.596 140.547 82.399  1.00 113.95 ? 412  MET B C     1 
ATOM   4868  O O     . MET B 2 420  ? 195.170 139.767 83.256  1.00 113.95 ? 412  MET B O     1 
ATOM   4869  C CB    . MET B 2 420  ? 196.358 138.668 80.936  1.00 113.95 ? 412  MET B CB    1 
ATOM   4870  N N     . THR B 2 421  ? 195.941 141.806 82.682  1.00 97.64  ? 413  THR B N     1 
ATOM   4871  C CA    . THR B 2 421  ? 195.775 142.349 84.022  1.00 97.64  ? 413  THR B CA    1 
ATOM   4872  C C     . THR B 2 421  ? 194.312 142.542 84.389  1.00 97.64  ? 413  THR B C     1 
ATOM   4873  O O     . THR B 2 421  ? 193.987 142.581 85.579  1.00 97.64  ? 413  THR B O     1 
ATOM   4874  C CB    . THR B 2 421  ? 196.520 143.680 84.147  1.00 97.64  ? 413  THR B CB    1 
ATOM   4875  N N     . ALA B 2 422  ? 193.428 142.673 83.398  1.00 76.86  ? 414  ALA B N     1 
ATOM   4876  C CA    . ALA B 2 422  ? 192.003 142.771 83.685  1.00 76.86  ? 414  ALA B CA    1 
ATOM   4877  C C     . ALA B 2 422  ? 191.457 141.450 84.214  1.00 76.86  ? 414  ALA B C     1 
ATOM   4878  O O     . ALA B 2 422  ? 190.555 141.438 85.059  1.00 76.86  ? 414  ALA B O     1 
ATOM   4879  C CB    . ALA B 2 422  ? 191.244 143.205 82.434  1.00 76.86  ? 414  ALA B CB    1 
ATOM   4880  N N     . GLY B 2 423  ? 191.990 140.328 83.722  1.00 65.03  ? 415  GLY B N     1 
ATOM   4881  C CA    . GLY B 2 423  ? 191.616 139.038 84.273  1.00 65.03  ? 415  GLY B CA    1 
ATOM   4882  C C     . GLY B 2 423  ? 192.140 138.834 85.677  1.00 65.03  ? 415  GLY B C     1 
ATOM   4883  O O     . GLY B 2 423  ? 191.486 138.187 86.501  1.00 65.03  ? 415  GLY B O     1 
ATOM   4884  N N     . GLN B 2 424  ? 193.317 139.390 85.971  1.00 60.86  ? 416  GLN B N     1 
ATOM   4885  C CA    . GLN B 2 424  ? 193.782 139.439 87.349  1.00 60.86  ? 416  GLN B CA    1 
ATOM   4886  C C     . GLN B 2 424  ? 192.901 140.349 88.194  1.00 60.86  ? 416  GLN B C     1 
ATOM   4887  O O     . GLN B 2 424  ? 192.730 140.105 89.392  1.00 60.86  ? 416  GLN B O     1 
ATOM   4888  C CB    . GLN B 2 424  ? 195.236 139.905 87.397  1.00 60.86  ? 416  GLN B CB    1 
ATOM   4889  N N     . ILE B 2 425  ? 192.317 141.384 87.590  1.00 58.26  ? 417  ILE B N     1 
ATOM   4890  C CA    . ILE B 2 425  ? 191.380 142.222 88.325  1.00 58.26  ? 417  ILE B CA    1 
ATOM   4891  C C     . ILE B 2 425  ? 190.068 141.484 88.541  1.00 58.26  ? 417  ILE B C     1 
ATOM   4892  O O     . ILE B 2 425  ? 189.324 141.788 89.479  1.00 58.26  ? 417  ILE B O     1 
ATOM   4893  C CB    . ILE B 2 425  ? 191.165 143.559 87.594  1.00 58.26  ? 417  ILE B CB    1 
ATOM   4894  N N     . CYS B 2 426  ? 189.758 140.512 87.686  1.00 55.69  ? 418  CYS B N     1 
ATOM   4895  C CA    . CYS B 2 426  ? 188.553 139.717 87.886  1.00 55.69  ? 418  CYS B CA    1 
ATOM   4896  C C     . CYS B 2 426  ? 188.756 138.681 88.981  1.00 55.69  ? 418  CYS B C     1 
ATOM   4897  O O     . CYS B 2 426  ? 187.904 138.525 89.863  1.00 55.69  ? 418  CYS B O     1 
ATOM   4898  C CB    . CYS B 2 426  ? 188.151 139.042 86.576  1.00 55.69  ? 418  CYS B CB    1 
ATOM   4899  N N     . ASN B 2 427  ? 189.879 137.958 88.928  1.00 50.83  ? 419  ASN B N     1 
ATOM   4900  C CA    . ASN B 2 427  ? 190.153 136.931 89.929  1.00 50.83  ? 419  ASN B CA    1 
ATOM   4901  C C     . ASN B 2 427  ? 190.409 137.552 91.293  1.00 50.83  ? 419  ASN B C     1 
ATOM   4902  O O     . ASN B 2 427  ? 189.861 137.095 92.304  1.00 50.83  ? 419  ASN B O     1 
ATOM   4903  C CB    . ASN B 2 427  ? 191.345 136.079 89.495  1.00 50.83  ? 419  ASN B CB    1 
ATOM   4904  N N     . LEU B 2 428  ? 191.218 138.611 91.336  1.00 51.62  ? 420  LEU B N     1 
ATOM   4905  C CA    . LEU B 2 428  ? 191.406 139.359 92.570  1.00 51.62  ? 420  LEU B CA    1 
ATOM   4906  C C     . LEU B 2 428  ? 190.166 140.150 92.954  1.00 51.62  ? 420  LEU B C     1 
ATOM   4907  O O     . LEU B 2 428  ? 190.027 140.528 94.120  1.00 51.62  ? 420  LEU B O     1 
ATOM   4908  C CB    . LEU B 2 428  ? 192.613 140.293 92.453  1.00 51.62  ? 420  LEU B CB    1 
ATOM   4909  C CG    . LEU B 2 428  ? 194.005 139.747 92.809  1.00 51.62  ? 420  LEU B CG    1 
ATOM   4910  C CD1   . LEU B 2 428  ? 194.556 138.757 91.794  1.00 51.62  ? 420  LEU B CD1   1 
ATOM   4911  C CD2   . LEU B 2 428  ? 194.980 140.893 93.005  1.00 51.62  ? 420  LEU B CD2   1 
ATOM   4912  N N     . VAL B 2 429  ? 189.264 140.412 92.006  1.00 46.78  ? 421  VAL B N     1 
ATOM   4913  C CA    . VAL B 2 429  ? 187.989 141.011 92.374  1.00 46.78  ? 421  VAL B CA    1 
ATOM   4914  C C     . VAL B 2 429  ? 187.115 139.989 93.080  1.00 46.78  ? 421  VAL B C     1 
ATOM   4915  O O     . VAL B 2 429  ? 186.358 140.334 93.994  1.00 46.78  ? 421  VAL B O     1 
ATOM   4916  C CB    . VAL B 2 429  ? 187.287 141.590 91.133  1.00 46.78  ? 421  VAL B CB    1 
ATOM   4917  N N     . ALA B 2 430  ? 187.211 138.721 92.683  1.00 42.01  ? 422  ALA B N     1 
ATOM   4918  C CA    . ALA B 2 430  ? 186.436 137.681 93.347  1.00 42.01  ? 422  ALA B CA    1 
ATOM   4919  C C     . ALA B 2 430  ? 187.019 137.359 94.716  1.00 42.01  ? 422  ALA B C     1 
ATOM   4920  O O     . ALA B 2 430  ? 186.303 137.369 95.725  1.00 42.01  ? 422  ALA B O     1 
ATOM   4921  C CB    . ALA B 2 430  ? 186.380 136.431 92.472  1.00 42.01  ? 422  ALA B CB    1 
ATOM   4922  N N     . ILE B 2 431  ? 188.328 137.086 94.771  1.00 46.23  ? 423  ILE B N     1 
ATOM   4923  C CA    . ILE B 2 431  ? 188.975 136.700 96.022  1.00 46.23  ? 423  ILE B CA    1 
ATOM   4924  C C     . ILE B 2 431  ? 189.037 137.872 96.990  1.00 46.23  ? 423  ILE B C     1 
ATOM   4925  O O     . ILE B 2 431  ? 188.963 137.687 98.211  1.00 46.23  ? 423  ILE B O     1 
ATOM   4926  C CB    . ILE B 2 431  ? 190.377 136.130 95.745  1.00 46.23  ? 423  ILE B CB    1 
ATOM   4927  N N     . ASP B 2 432  ? 189.155 139.092 96.472  1.00 47.02  ? 424  ASP B N     1 
ATOM   4928  C CA    . ASP B 2 432  ? 189.145 140.261 97.339  1.00 47.02  ? 424  ASP B CA    1 
ATOM   4929  C C     . ASP B 2 432  ? 187.729 140.681 97.706  1.00 47.02  ? 424  ASP B C     1 
ATOM   4930  O O     . ASP B 2 432  ? 187.531 141.319 98.742  1.00 47.02  ? 424  ASP B O     1 
ATOM   4931  C CB    . ASP B 2 432  ? 189.878 141.423 96.669  1.00 47.02  ? 424  ASP B CB    1 
ATOM   4932  N N     . THR B 2 433  ? 186.745 140.349 96.871  1.00 47.20  ? 425  THR B N     1 
ATOM   4933  C CA    . THR B 2 433  ? 185.364 140.686 97.197  1.00 47.20  ? 425  THR B CA    1 
ATOM   4934  C C     . THR B 2 433  ? 184.828 139.770 98.288  1.00 47.20  ? 425  THR B C     1 
ATOM   4935  O O     . THR B 2 433  ? 184.300 140.241 99.304  1.00 47.20  ? 425  THR B O     1 
ATOM   4936  C CB    . THR B 2 433  ? 184.492 140.602 95.945  1.00 47.20  ? 425  THR B CB    1 
ATOM   4937  N N     . ASN B 2 434  ? 184.965 138.454 98.098  1.00 46.74  ? 426  ASN B N     1 
ATOM   4938  C CA    . ASN B 2 434  ? 184.587 137.520 99.152  1.00 46.74  ? 426  ASN B CA    1 
ATOM   4939  C C     . ASN B 2 434  ? 185.533 137.616 100.339 1.00 46.74  ? 426  ASN B C     1 
ATOM   4940  O O     . ASN B 2 434  ? 185.141 137.319 101.471 1.00 46.74  ? 426  ASN B O     1 
ATOM   4941  C CB    . ASN B 2 434  ? 184.555 136.093 98.611  1.00 46.74  ? 426  ASN B CB    1 
ATOM   4942  N N     . GLN B 2 435  ? 186.776 138.041 100.100 1.00 42.69  ? 427  GLN B N     1 
ATOM   4943  C CA    . GLN B 2 435  ? 187.662 138.385 101.199 1.00 42.69  ? 427  GLN B CA    1 
ATOM   4944  C C     . GLN B 2 435  ? 187.219 139.651 101.917 1.00 42.69  ? 427  GLN B C     1 
ATOM   4945  O O     . GLN B 2 435  ? 187.596 139.858 103.074 1.00 42.69  ? 427  GLN B O     1 
ATOM   4946  C CB    . GLN B 2 435  ? 189.094 138.548 100.690 1.00 42.69  ? 427  GLN B CB    1 
ATOM   4947  N N     . LEU B 2 436  ? 186.433 140.503 101.262 1.00 37.91  ? 428  LEU B N     1 
ATOM   4948  C CA    . LEU B 2 436  ? 185.942 141.721 101.889 1.00 37.91  ? 428  LEU B CA    1 
ATOM   4949  C C     . LEU B 2 436  ? 184.659 141.478 102.667 1.00 37.91  ? 428  LEU B C     1 
ATOM   4950  O O     . LEU B 2 436  ? 184.447 142.096 103.714 1.00 37.91  ? 428  LEU B O     1 
ATOM   4951  C CB    . LEU B 2 436  ? 185.717 142.803 100.835 1.00 37.91  ? 428  LEU B CB    1 
ATOM   4952  N N     . MET B 2 437  ? 183.790 140.604 102.161 1.00 41.29  ? 429  MET B N     1 
ATOM   4953  C CA    . MET B 2 437  ? 182.637 140.183 102.949 1.00 41.29  ? 429  MET B CA    1 
ATOM   4954  C C     . MET B 2 437  ? 183.078 139.332 104.128 1.00 41.29  ? 429  MET B C     1 
ATOM   4955  O O     . MET B 2 437  ? 182.543 139.460 105.236 1.00 41.29  ? 429  MET B O     1 
ATOM   4956  C CB    . MET B 2 437  ? 181.652 139.412 102.071 1.00 41.29  ? 429  MET B CB    1 
ATOM   4957  N N     . TRP B 2 438  ? 184.067 138.467 103.905 1.00 42.81  ? 430  TRP B N     1 
ATOM   4958  C CA    . TRP B 2 438  ? 184.703 137.730 104.984 1.00 42.81  ? 430  TRP B CA    1 
ATOM   4959  C C     . TRP B 2 438  ? 185.498 138.650 105.900 1.00 42.81  ? 430  TRP B C     1 
ATOM   4960  O O     . TRP B 2 438  ? 185.741 138.297 107.059 1.00 42.81  ? 430  TRP B O     1 
ATOM   4961  C CB    . TRP B 2 438  ? 185.600 136.644 104.390 1.00 42.81  ? 430  TRP B CB    1 
ATOM   4962  C CG    . TRP B 2 438  ? 186.241 135.725 105.378 1.00 42.81  ? 430  TRP B CG    1 
ATOM   4963  C CD1   . TRP B 2 438  ? 187.546 135.726 105.766 1.00 42.81  ? 430  TRP B CD1   1 
ATOM   4964  C CD2   . TRP B 2 438  ? 185.610 134.662 106.095 1.00 42.81  ? 430  TRP B CD2   1 
ATOM   4965  N NE1   . TRP B 2 438  ? 187.769 134.729 106.682 1.00 42.81  ? 430  TRP B NE1   1 
ATOM   4966  C CE2   . TRP B 2 438  ? 186.593 134.062 106.902 1.00 42.81  ? 430  TRP B CE2   1 
ATOM   4967  C CE3   . TRP B 2 438  ? 184.307 134.161 106.133 1.00 42.81  ? 430  TRP B CE3   1 
ATOM   4968  C CZ2   . TRP B 2 438  ? 186.317 132.985 107.738 1.00 42.81  ? 430  TRP B CZ2   1 
ATOM   4969  C CZ3   . TRP B 2 438  ? 184.033 133.094 106.964 1.00 42.81  ? 430  TRP B CZ3   1 
ATOM   4970  C CH2   . TRP B 2 438  ? 185.034 132.517 107.756 1.00 42.81  ? 430  TRP B CH2   1 
ATOM   4971  N N     . PHE B 2 439  ? 185.906 139.819 105.405 1.00 47.37  ? 431  PHE B N     1 
ATOM   4972  C CA    . PHE B 2 439  ? 186.507 140.822 106.273 1.00 47.37  ? 431  PHE B CA    1 
ATOM   4973  C C     . PHE B 2 439  ? 185.445 141.516 107.117 1.00 47.37  ? 431  PHE B C     1 
ATOM   4974  O O     . PHE B 2 439  ? 185.694 141.882 108.271 1.00 47.37  ? 431  PHE B O     1 
ATOM   4975  C CB    . PHE B 2 439  ? 187.280 141.840 105.436 1.00 47.37  ? 431  PHE B CB    1 
ATOM   4976  N N     . PHE B 2 440  ? 184.252 141.690 106.561 1.00 35.07  ? 432  PHE B N     1 
ATOM   4977  C CA    . PHE B 2 440  ? 183.137 142.296 107.270 1.00 35.07  ? 432  PHE B CA    1 
ATOM   4978  C C     . PHE B 2 440  ? 182.376 141.274 108.111 1.00 35.07  ? 432  PHE B C     1 
ATOM   4979  O O     . PHE B 2 440  ? 181.455 141.651 108.845 1.00 35.07  ? 432  PHE B O     1 
ATOM   4980  C CB    . PHE B 2 440  ? 182.228 142.978 106.237 1.00 35.07  ? 432  PHE B CB    1 
ATOM   4981  C CG    . PHE B 2 440  ? 181.164 143.847 106.829 1.00 35.07  ? 432  PHE B CG    1 
ATOM   4982  C CD1   . PHE B 2 440  ? 181.491 145.066 107.397 1.00 35.07  ? 432  PHE B CD1   1 
ATOM   4983  C CD2   . PHE B 2 440  ? 179.840 143.447 106.814 1.00 35.07  ? 432  PHE B CD2   1 
ATOM   4984  C CE1   . PHE B 2 440  ? 180.516 145.868 107.948 1.00 35.07  ? 432  PHE B CE1   1 
ATOM   4985  C CE2   . PHE B 2 440  ? 178.860 144.241 107.365 1.00 35.07  ? 432  PHE B CE2   1 
ATOM   4986  C CZ    . PHE B 2 440  ? 179.197 145.455 107.930 1.00 35.07  ? 432  PHE B CZ    1 
ATOM   4987  N N     . PHE B 2 441  ? 182.811 140.010 108.072 1.00 38.74  ? 433  PHE B N     1 
ATOM   4988  C CA    . PHE B 2 441  ? 182.030 138.878 108.561 1.00 38.74  ? 433  PHE B CA    1 
ATOM   4989  C C     . PHE B 2 441  ? 181.757 138.941 110.061 1.00 38.74  ? 433  PHE B C     1 
ATOM   4990  O O     . PHE B 2 441  ? 180.700 138.488 110.514 1.00 38.74  ? 433  PHE B O     1 
ATOM   4991  C CB    . PHE B 2 441  ? 182.763 137.582 108.211 1.00 38.74  ? 433  PHE B CB    1 
ATOM   4992  C CG    . PHE B 2 441  ? 182.052 136.340 108.641 1.00 38.74  ? 433  PHE B CG    1 
ATOM   4993  C CD1   . PHE B 2 441  ? 180.955 135.877 107.936 1.00 38.74  ? 433  PHE B CD1   1 
ATOM   4994  C CD2   . PHE B 2 441  ? 182.492 135.621 109.745 1.00 38.74  ? 433  PHE B CD2   1 
ATOM   4995  C CE1   . PHE B 2 441  ? 180.300 134.724 108.329 1.00 38.74  ? 433  PHE B CE1   1 
ATOM   4996  C CE2   . PHE B 2 441  ? 181.840 134.469 110.146 1.00 38.74  ? 433  PHE B CE2   1 
ATOM   4997  C CZ    . PHE B 2 441  ? 180.743 134.019 109.436 1.00 38.74  ? 433  PHE B CZ    1 
ATOM   4998  N N     . LEU B 2 442  ? 182.672 139.501 110.843 1.00 42.71  ? 434  LEU B N     1 
ATOM   4999  C CA    . LEU B 2 442  ? 182.502 139.565 112.289 1.00 42.71  ? 434  LEU B CA    1 
ATOM   5000  C C     . LEU B 2 442  ? 182.876 140.938 112.818 1.00 42.71  ? 434  LEU B C     1 
ATOM   5001  O O     . LEU B 2 442  ? 183.520 141.066 113.862 1.00 42.71  ? 434  LEU B O     1 
ATOM   5002  C CB    . LEU B 2 442  ? 183.320 138.480 112.985 1.00 42.71  ? 434  LEU B CB    1 
ATOM   5003  N N     . CYS B 2 443  ? 182.479 141.984 112.106 1.00 50.37  ? 435  CYS B N     1 
ATOM   5004  C CA    . CYS B 2 443  ? 182.781 143.353 112.515 1.00 50.37  ? 435  CYS B CA    1 
ATOM   5005  C C     . CYS B 2 443  ? 182.069 143.798 113.801 1.00 50.37  ? 435  CYS B C     1 
ATOM   5006  O O     . CYS B 2 443  ? 182.707 144.486 114.612 1.00 50.37  ? 435  CYS B O     1 
ATOM   5007  C CB    . CYS B 2 443  ? 182.489 144.321 111.360 1.00 50.37  ? 435  CYS B CB    1 
ATOM   5008  N N     . PRO B 2 444  ? 180.792 143.460 114.064 1.00 48.78  ? 436  PRO B N     1 
ATOM   5009  C CA    . PRO B 2 444  ? 180.273 143.721 115.416 1.00 48.78  ? 436  PRO B CA    1 
ATOM   5010  C C     . PRO B 2 444  ? 180.895 142.845 116.485 1.00 48.78  ? 436  PRO B C     1 
ATOM   5011  O O     . PRO B 2 444  ? 180.861 143.229 117.659 1.00 48.78  ? 436  PRO B O     1 
ATOM   5012  C CB    . PRO B 2 444  ? 178.770 143.451 115.287 1.00 48.78  ? 436  PRO B CB    1 
ATOM   5013  C CG    . PRO B 2 444  ? 178.478 143.643 113.877 1.00 48.78  ? 436  PRO B CG    1 
ATOM   5014  C CD    . PRO B 2 444  ? 179.668 143.113 113.164 1.00 48.78  ? 436  PRO B CD    1 
ATOM   5015  N N     . ASN B 2 445  ? 181.446 141.682 116.125 1.00 61.24  ? 437  ASN B N     1 
ATOM   5016  C CA    . ASN B 2 445  ? 182.180 140.886 117.103 1.00 61.24  ? 437  ASN B CA    1 
ATOM   5017  C C     . ASN B 2 445  ? 183.462 141.590 117.519 1.00 61.24  ? 437  ASN B C     1 
ATOM   5018  O O     . ASN B 2 445  ? 183.852 141.552 118.693 1.00 61.24  ? 437  ASN B O     1 
ATOM   5019  C CB    . ASN B 2 445  ? 182.480 139.498 116.539 1.00 61.24  ? 437  ASN B CB    1 
ATOM   5020  N N     . LEU B 2 446  ? 184.126 142.249 116.568 1.00 65.41  ? 438  LEU B N     1 
ATOM   5021  C CA    . LEU B 2 446  ? 185.271 143.081 116.909 1.00 65.41  ? 438  LEU B CA    1 
ATOM   5022  C C     . LEU B 2 446  ? 184.844 144.327 117.663 1.00 65.41  ? 438  LEU B C     1 
ATOM   5023  O O     . LEU B 2 446  ? 185.588 144.815 118.519 1.00 65.41  ? 438  LEU B O     1 
ATOM   5024  C CB    . LEU B 2 446  ? 186.035 143.471 115.647 1.00 65.41  ? 438  LEU B CB    1 
ATOM   5025  N N     . TRP B 2 447  ? 183.659 144.859 117.357 1.00 62.48  ? 439  TRP B N     1 
ATOM   5026  C CA    . TRP B 2 447  ? 183.185 146.042 118.062 1.00 62.48  ? 439  TRP B CA    1 
ATOM   5027  C C     . TRP B 2 447  ? 182.800 145.725 119.500 1.00 62.48  ? 439  TRP B C     1 
ATOM   5028  O O     . TRP B 2 447  ? 182.916 146.586 120.377 1.00 62.48  ? 439  TRP B O     1 
ATOM   5029  C CB    . TRP B 2 447  ? 182.000 146.650 117.317 1.00 62.48  ? 439  TRP B CB    1 
ATOM   5030  C CG    . TRP B 2 447  ? 181.499 147.894 117.949 1.00 62.48  ? 439  TRP B CG    1 
ATOM   5031  C CD1   . TRP B 2 447  ? 180.358 148.041 118.680 1.00 62.48  ? 439  TRP B CD1   1 
ATOM   5032  C CD2   . TRP B 2 447  ? 182.137 149.174 117.935 1.00 62.48  ? 439  TRP B CD2   1 
ATOM   5033  N NE1   . TRP B 2 447  ? 180.236 149.339 119.109 1.00 62.48  ? 439  TRP B NE1   1 
ATOM   5034  C CE2   . TRP B 2 447  ? 181.315 150.055 118.667 1.00 62.48  ? 439  TRP B CE2   1 
ATOM   5035  C CE3   . TRP B 2 447  ? 183.317 149.662 117.369 1.00 62.48  ? 439  TRP B CE3   1 
ATOM   5036  C CZ2   . TRP B 2 447  ? 181.637 151.399 118.846 1.00 62.48  ? 439  TRP B CZ2   1 
ATOM   5037  C CZ3   . TRP B 2 447  ? 183.636 150.997 117.547 1.00 62.48  ? 439  TRP B CZ3   1 
ATOM   5038  C CH2   . TRP B 2 447  ? 182.799 151.849 118.281 1.00 62.48  ? 439  TRP B CH2   1 
ATOM   5039  N N     . THR B 2 448  ? 182.365 144.497 119.761 1.00 69.90  ? 440  THR B N     1 
ATOM   5040  C CA    . THR B 2 448  ? 181.930 144.078 121.085 1.00 69.90  ? 440  THR B CA    1 
ATOM   5041  C C     . THR B 2 448  ? 182.983 143.266 121.826 1.00 69.90  ? 440  THR B C     1 
ATOM   5042  O O     . THR B 2 448  ? 182.743 142.861 122.967 1.00 69.90  ? 440  THR B O     1 
ATOM   5043  C CB    . THR B 2 448  ? 180.638 143.265 120.983 1.00 69.90  ? 440  THR B CB    1 
ATOM   5044  N N     . MET B 2 449  ? 184.135 143.010 121.205 1.00 76.31  ? 441  MET B N     1 
ATOM   5045  C CA    . MET B 2 449  ? 185.192 142.285 121.908 1.00 76.31  ? 441  MET B CA    1 
ATOM   5046  C C     . MET B 2 449  ? 185.845 143.087 123.040 1.00 76.31  ? 441  MET B C     1 
ATOM   5047  O O     . MET B 2 449  ? 185.966 142.536 124.150 1.00 76.31  ? 441  MET B O     1 
ATOM   5048  C CB    . MET B 2 449  ? 186.217 141.751 120.898 1.00 76.31  ? 441  MET B CB    1 
ATOM   5049  N N     . PRO B 2 450  ? 186.289 144.355 122.865 1.00 81.02  ? 442  PRO B N     1 
ATOM   5050  C CA    . PRO B 2 450  ? 186.951 145.026 124.000 1.00 81.02  ? 442  PRO B CA    1 
ATOM   5051  C C     . PRO B 2 450  ? 186.013 145.407 125.129 1.00 81.02  ? 442  PRO B C     1 
ATOM   5052  O O     . PRO B 2 450  ? 186.487 145.622 126.249 1.00 81.02  ? 442  PRO B O     1 
ATOM   5053  C CB    . PRO B 2 450  ? 187.571 146.279 123.366 1.00 81.02  ? 442  PRO B CB    1 
ATOM   5054  C CG    . PRO B 2 450  ? 187.623 146.007 121.930 1.00 81.02  ? 442  PRO B CG    1 
ATOM   5055  C CD    . PRO B 2 450  ? 186.396 145.218 121.668 1.00 81.02  ? 442  PRO B CD    1 
ATOM   5056  N N     . VAL B 2 451  ? 184.709 145.518 124.873 1.00 67.70  ? 443  VAL B N     1 
ATOM   5057  C CA    . VAL B 2 451  ? 183.773 145.748 125.967 1.00 67.70  ? 443  VAL B CA    1 
ATOM   5058  C C     . VAL B 2 451  ? 183.679 144.510 126.843 1.00 67.70  ? 443  VAL B C     1 
ATOM   5059  O O     . VAL B 2 451  ? 183.570 144.606 128.071 1.00 67.70  ? 443  VAL B O     1 
ATOM   5060  C CB    . VAL B 2 451  ? 182.397 146.160 125.414 1.00 67.70  ? 443  VAL B CB    1 
ATOM   5061  N N     . GLN B 2 452  ? 183.736 143.329 126.227 1.00 71.83  ? 444  GLN B N     1 
ATOM   5062  C CA    . GLN B 2 452  ? 183.712 142.092 126.996 1.00 71.83  ? 444  GLN B CA    1 
ATOM   5063  C C     . GLN B 2 452  ? 185.038 141.860 127.706 1.00 71.83  ? 444  GLN B C     1 
ATOM   5064  O O     . GLN B 2 452  ? 185.063 141.326 128.822 1.00 71.83  ? 444  GLN B O     1 
ATOM   5065  C CB    . GLN B 2 452  ? 183.378 140.915 126.082 1.00 71.83  ? 444  GLN B CB    1 
ATOM   5066  N N     . ILE B 2 453  ? 186.147 142.254 127.075 1.00 69.17  ? 445  ILE B N     1 
ATOM   5067  C CA    . ILE B 2 453  ? 187.451 142.113 127.715 1.00 69.17  ? 445  ILE B CA    1 
ATOM   5068  C C     . ILE B 2 453  ? 187.580 143.081 128.883 1.00 69.17  ? 445  ILE B C     1 
ATOM   5069  O O     . ILE B 2 453  ? 188.161 142.748 129.923 1.00 69.17  ? 445  ILE B O     1 
ATOM   5070  C CB    . ILE B 2 453  ? 188.576 142.317 126.686 1.00 69.17  ? 445  ILE B CB    1 
ATOM   5071  N N     . ILE B 2 454  ? 187.024 144.283 128.738 1.00 76.26  ? 446  ILE B N     1 
ATOM   5072  C CA    . ILE B 2 454  ? 187.135 145.293 129.783 1.00 76.26  ? 446  ILE B CA    1 
ATOM   5073  C C     . ILE B 2 454  ? 186.181 144.994 130.931 1.00 76.26  ? 446  ILE B C     1 
ATOM   5074  O O     . ILE B 2 454  ? 186.526 145.182 132.101 1.00 76.26  ? 446  ILE B O     1 
ATOM   5075  C CB    . ILE B 2 454  ? 186.885 146.693 129.194 1.00 76.26  ? 446  ILE B CB    1 
ATOM   5076  N N     . VAL B 2 455  ? 184.969 144.532 130.618 1.00 82.83  ? 447  VAL B N     1 
ATOM   5077  C CA    . VAL B 2 455  ? 184.005 144.230 131.670 1.00 82.83  ? 447  VAL B CA    1 
ATOM   5078  C C     . VAL B 2 455  ? 184.406 142.960 132.407 1.00 82.83  ? 447  VAL B C     1 
ATOM   5079  O O     . VAL B 2 455  ? 184.326 142.892 133.640 1.00 82.83  ? 447  VAL B O     1 
ATOM   5080  C CB    . VAL B 2 455  ? 182.587 144.122 131.082 1.00 82.83  ? 447  VAL B CB    1 
ATOM   5081  N N     . GLY B 2 456  ? 184.850 141.941 131.668 1.00 89.97  ? 448  GLY B N     1 
ATOM   5082  C CA    . GLY B 2 456  ? 185.325 140.725 132.307 1.00 89.97  ? 448  GLY B CA    1 
ATOM   5083  C C     . GLY B 2 456  ? 186.613 140.929 133.076 1.00 89.97  ? 448  GLY B C     1 
ATOM   5084  O O     . GLY B 2 456  ? 186.832 140.291 134.111 1.00 89.97  ? 448  GLY B O     1 
ATOM   5085  N N     . VAL B 2 457  ? 187.472 141.828 132.595 1.00 90.39  ? 449  VAL B N     1 
ATOM   5086  C CA    . VAL B 2 457  ? 188.663 142.185 133.357 1.00 90.39  ? 449  VAL B CA    1 
ATOM   5087  C C     . VAL B 2 457  ? 188.284 142.999 134.584 1.00 90.39  ? 449  VAL B C     1 
ATOM   5088  O O     . VAL B 2 457  ? 188.987 142.964 135.602 1.00 90.39  ? 449  VAL B O     1 
ATOM   5089  C CB    . VAL B 2 457  ? 189.658 142.942 132.462 1.00 90.39  ? 449  VAL B CB    1 
ATOM   5090  N N     . ILE B 2 458  ? 187.176 143.736 134.516 1.00 95.01  ? 450  ILE B N     1 
ATOM   5091  C CA    . ILE B 2 458  ? 186.739 144.525 135.661 1.00 95.01  ? 450  ILE B CA    1 
ATOM   5092  C C     . ILE B 2 458  ? 186.174 143.622 136.747 1.00 95.01  ? 450  ILE B C     1 
ATOM   5093  O O     . ILE B 2 458  ? 186.460 143.808 137.935 1.00 95.01  ? 450  ILE B O     1 
ATOM   5094  C CB    . ILE B 2 458  ? 185.721 145.588 135.217 1.00 95.01  ? 450  ILE B CB    1 
ATOM   5095  N N     . LEU B 2 459  ? 185.362 142.632 136.360 1.00 104.70 ? 451  LEU B N     1 
ATOM   5096  C CA    . LEU B 2 459  ? 184.867 141.662 137.332 1.00 104.70 ? 451  LEU B CA    1 
ATOM   5097  C C     . LEU B 2 459  ? 185.991 140.787 137.863 1.00 104.70 ? 451  LEU B C     1 
ATOM   5098  O O     . LEU B 2 459  ? 185.967 140.385 139.037 1.00 104.70 ? 451  LEU B O     1 
ATOM   5099  C CB    . LEU B 2 459  ? 183.773 140.799 136.705 1.00 104.70 ? 451  LEU B CB    1 
ATOM   5100  N N     . LEU B 2 460  ? 186.984 140.498 137.017 1.00 109.42 ? 452  LEU B N     1 
ATOM   5101  C CA    . LEU B 2 460  ? 188.207 139.862 137.487 1.00 109.42 ? 452  LEU B CA    1 
ATOM   5102  C C     . LEU B 2 460  ? 188.924 140.731 138.507 1.00 109.42 ? 452  LEU B C     1 
ATOM   5103  O O     . LEU B 2 460  ? 189.528 140.208 139.447 1.00 109.42 ? 452  LEU B O     1 
ATOM   5104  C CB    . LEU B 2 460  ? 189.125 139.558 136.307 1.00 109.42 ? 452  LEU B CB    1 
ATOM   5105  N N     . TYR B 2 461  ? 188.846 142.058 138.355 1.00 116.22 ? 453  TYR B N     1 
ATOM   5106  C CA    . TYR B 2 461  ? 189.424 142.951 139.352 1.00 116.22 ? 453  TYR B CA    1 
ATOM   5107  C C     . TYR B 2 461  ? 188.596 142.977 140.628 1.00 116.22 ? 453  TYR B C     1 
ATOM   5108  O O     . TYR B 2 461  ? 189.144 143.196 141.716 1.00 116.22 ? 453  TYR B O     1 
ATOM   5109  C CB    . TYR B 2 461  ? 189.580 144.362 138.784 1.00 116.22 ? 453  TYR B CB    1 
ATOM   5110  C CG    . TYR B 2 461  ? 190.232 145.329 139.744 1.00 116.22 ? 453  TYR B CG    1 
ATOM   5111  C CD1   . TYR B 2 461  ? 191.596 145.261 140.007 1.00 116.22 ? 453  TYR B CD1   1 
ATOM   5112  C CD2   . TYR B 2 461  ? 189.488 146.308 140.390 1.00 116.22 ? 453  TYR B CD2   1 
ATOM   5113  C CE1   . TYR B 2 461  ? 192.200 146.139 140.885 1.00 116.22 ? 453  TYR B CE1   1 
ATOM   5114  C CE2   . TYR B 2 461  ? 190.082 147.191 141.270 1.00 116.22 ? 453  TYR B CE2   1 
ATOM   5115  C CZ    . TYR B 2 461  ? 191.439 147.103 141.512 1.00 116.22 ? 453  TYR B CZ    1 
ATOM   5116  O OH    . TYR B 2 461  ? 192.040 147.979 142.386 1.00 116.22 ? 453  TYR B OH    1 
ATOM   5117  N N     . TYR B 2 462  ? 187.283 142.756 140.528 1.00 105.22 ? 454  TYR B N     1 
ATOM   5118  C CA    . TYR B 2 462  ? 186.501 142.559 141.742 1.00 105.22 ? 454  TYR B CA    1 
ATOM   5119  C C     . TYR B 2 462  ? 186.820 141.232 142.416 1.00 105.22 ? 454  TYR B C     1 
ATOM   5120  O O     . TYR B 2 462  ? 186.598 141.100 143.625 1.00 105.22 ? 454  TYR B O     1 
ATOM   5121  C CB    . TYR B 2 462  ? 185.000 142.644 141.460 1.00 105.22 ? 454  TYR B CB    1 
ATOM   5122  C CG    . TYR B 2 462  ? 184.491 144.042 141.178 1.00 105.22 ? 454  TYR B CG    1 
ATOM   5123  C CD1   . TYR B 2 462  ? 184.402 144.984 142.199 1.00 105.22 ? 454  TYR B CD1   1 
ATOM   5124  C CD2   . TYR B 2 462  ? 184.044 144.404 139.914 1.00 105.22 ? 454  TYR B CD2   1 
ATOM   5125  C CE1   . TYR B 2 462  ? 183.926 146.264 141.957 1.00 105.22 ? 454  TYR B CE1   1 
ATOM   5126  C CE2   . TYR B 2 462  ? 183.561 145.680 139.661 1.00 105.22 ? 454  TYR B CE2   1 
ATOM   5127  C CZ    . TYR B 2 462  ? 183.504 146.604 140.688 1.00 105.22 ? 454  TYR B CZ    1 
ATOM   5128  O OH    . TYR B 2 462  ? 183.025 147.870 140.444 1.00 105.22 ? 454  TYR B OH    1 
ATOM   5129  N N     . ILE B 2 463  ? 187.334 140.250 141.674 1.00 99.28  ? 455  ILE B N     1 
ATOM   5130  C CA    . ILE B 2 463  ? 187.801 139.020 142.308 1.00 99.28  ? 455  ILE B CA    1 
ATOM   5131  C C     . ILE B 2 463  ? 189.115 139.268 143.045 1.00 99.28  ? 455  ILE B C     1 
ATOM   5132  O O     . ILE B 2 463  ? 189.189 139.137 144.273 1.00 99.28  ? 455  ILE B O     1 
ATOM   5133  C CB    . ILE B 2 463  ? 187.943 137.894 141.271 1.00 99.28  ? 455  ILE B CB    1 
ATOM   5134  N N     . LEU B 2 464  ? 190.161 139.645 142.309 1.00 113.59 ? 456  LEU B N     1 
ATOM   5135  C CA    . LEU B 2 464  ? 191.484 139.893 142.879 1.00 113.59 ? 456  LEU B CA    1 
ATOM   5136  C C     . LEU B 2 464  ? 192.288 140.740 141.897 1.00 113.59 ? 456  LEU B C     1 
ATOM   5137  O O     . LEU B 2 464  ? 191.780 141.177 140.864 1.00 113.59 ? 456  LEU B O     1 
ATOM   5138  C CB    . LEU B 2 464  ? 192.214 138.583 143.196 1.00 113.59 ? 456  LEU B CB    1 
ATOM   5139  N N     . GLY B 2 465  ? 193.549 140.987 142.235 1.00 127.32 ? 457  GLY B N     1 
ATOM   5140  C CA    . GLY B 2 465  ? 194.421 141.725 141.342 1.00 127.32 ? 457  GLY B CA    1 
ATOM   5141  C C     . GLY B 2 465  ? 195.403 140.867 140.567 1.00 127.32 ? 457  GLY B C     1 
ATOM   5142  O O     . GLY B 2 465  ? 195.563 141.024 139.349 1.00 127.32 ? 457  GLY B O     1 
ATOM   5143  N N     . VAL B 2 466  ? 196.064 139.946 141.278 1.00 135.59 ? 458  VAL B N     1 
ATOM   5144  C CA    . VAL B 2 466  ? 197.168 139.187 140.697 1.00 135.59 ? 458  VAL B CA    1 
ATOM   5145  C C     . VAL B 2 466  ? 196.666 138.177 139.676 1.00 135.59 ? 458  VAL B C     1 
ATOM   5146  O O     . VAL B 2 466  ? 197.385 137.828 138.729 1.00 135.59 ? 458  VAL B O     1 
ATOM   5147  C CB    . VAL B 2 466  ? 197.983 138.503 141.809 1.00 135.59 ? 458  VAL B CB    1 
ATOM   5148  N N     . SER B 2 467  ? 195.435 137.689 139.844 1.00 146.99 ? 459  SER B N     1 
ATOM   5149  C CA    . SER B 2 467  ? 194.843 136.817 138.838 1.00 146.99 ? 459  SER B CA    1 
ATOM   5150  C C     . SER B 2 467  ? 194.550 137.582 137.554 1.00 146.99 ? 459  SER B C     1 
ATOM   5151  O O     . SER B 2 467  ? 194.737 137.050 136.453 1.00 146.99 ? 459  SER B O     1 
ATOM   5152  C CB    . SER B 2 467  ? 193.568 136.176 139.385 1.00 146.99 ? 459  SER B CB    1 
ATOM   5153  N N     . ALA B 2 468  ? 194.100 138.833 137.680 1.00 152.69 ? 460  ALA B N     1 
ATOM   5154  C CA    . ALA B 2 468  ? 193.888 139.677 136.511 1.00 152.69 ? 460  ALA B CA    1 
ATOM   5155  C C     . ALA B 2 468  ? 195.201 140.020 135.828 1.00 152.69 ? 460  ALA B C     1 
ATOM   5156  O O     . ALA B 2 468  ? 195.243 140.134 134.597 1.00 152.69 ? 460  ALA B O     1 
ATOM   5157  C CB    . ALA B 2 468  ? 193.150 140.955 136.908 1.00 152.69 ? 460  ALA B CB    1 
ATOM   5158  N N     . LEU B 2 469  ? 196.275 140.184 136.606 1.00 146.51 ? 461  LEU B N     1 
ATOM   5159  C CA    . LEU B 2 469  ? 197.591 140.378 136.006 1.00 146.51 ? 461  LEU B CA    1 
ATOM   5160  C C     . LEU B 2 469  ? 198.060 139.119 135.287 1.00 146.51 ? 461  LEU B C     1 
ATOM   5161  O O     . LEU B 2 469  ? 198.700 139.202 134.232 1.00 146.51 ? 461  LEU B O     1 
ATOM   5162  C CB    . LEU B 2 469  ? 198.597 140.791 137.076 1.00 146.51 ? 461  LEU B CB    1 
ATOM   5163  N N     . ILE B 2 470  ? 197.724 137.946 135.832 1.00 151.40 ? 462  ILE B N     1 
ATOM   5164  C CA    . ILE B 2 470  ? 198.182 136.688 135.250 1.00 151.40 ? 462  ILE B CA    1 
ATOM   5165  C C     . ILE B 2 470  ? 197.454 136.402 133.941 1.00 151.40 ? 462  ILE B C     1 
ATOM   5166  O O     . ILE B 2 470  ? 198.083 136.182 132.898 1.00 151.40 ? 462  ILE B O     1 
ATOM   5167  C CB    . ILE B 2 470  ? 198.000 135.538 136.258 1.00 151.40 ? 462  ILE B CB    1 
ATOM   5168  N N     . GLY B 2 471  ? 196.121 136.400 133.976 1.00 164.74 ? 463  GLY B N     1 
ATOM   5169  C CA    . GLY B 2 471  ? 195.362 136.099 132.772 1.00 164.74 ? 463  GLY B CA    1 
ATOM   5170  C C     . GLY B 2 471  ? 195.417 137.213 131.746 1.00 164.74 ? 463  GLY B C     1 
ATOM   5171  O O     . GLY B 2 471  ? 195.490 136.955 130.541 1.00 164.74 ? 463  GLY B O     1 
ATOM   5172  N N     . ALA B 2 472  ? 195.390 138.467 132.208 1.00 186.17 ? 464  ALA B N     1 
ATOM   5173  C CA    . ALA B 2 472  ? 195.464 139.597 131.290 1.00 186.17 ? 464  ALA B CA    1 
ATOM   5174  C C     . ALA B 2 472  ? 196.846 139.716 130.661 1.00 186.17 ? 464  ALA B C     1 
ATOM   5175  O O     . ALA B 2 472  ? 196.967 140.120 129.500 1.00 186.17 ? 464  ALA B O     1 
ATOM   5176  C CB    . ALA B 2 472  ? 195.095 140.890 132.013 1.00 186.17 ? 464  ALA B CB    1 
ATOM   5177  N N     . ALA B 2 473  ? 197.896 139.368 131.409 1.00 202.22 ? 465  ALA B N     1 
ATOM   5178  C CA    . ALA B 2 473  ? 199.220 139.285 130.807 1.00 202.22 ? 465  ALA B CA    1 
ATOM   5179  C C     . ALA B 2 473  ? 199.331 138.086 129.877 1.00 202.22 ? 465  ALA B C     1 
ATOM   5180  O O     . ALA B 2 473  ? 200.105 138.119 128.912 1.00 202.22 ? 465  ALA B O     1 
ATOM   5181  C CB    . ALA B 2 473  ? 200.290 139.216 131.894 1.00 202.22 ? 465  ALA B CB    1 
ATOM   5182  N N     . VAL B 2 474  ? 198.563 137.025 130.145 1.00 195.45 ? 466  VAL B N     1 
ATOM   5183  C CA    . VAL B 2 474  ? 198.616 135.830 129.309 1.00 195.45 ? 466  VAL B CA    1 
ATOM   5184  C C     . VAL B 2 474  ? 197.960 136.088 127.959 1.00 195.45 ? 466  VAL B C     1 
ATOM   5185  O O     . VAL B 2 474  ? 198.454 135.634 126.920 1.00 195.45 ? 466  VAL B O     1 
ATOM   5186  C CB    . VAL B 2 474  ? 197.959 134.645 130.034 1.00 195.45 ? 466  VAL B CB    1 
ATOM   5187  N N     . ILE B 2 475  ? 196.832 136.798 127.952 1.00 212.87 ? 467  ILE B N     1 
ATOM   5188  C CA    . ILE B 2 475  ? 196.236 137.196 126.682 1.00 212.87 ? 467  ILE B CA    1 
ATOM   5189  C C     . ILE B 2 475  ? 197.063 138.295 126.036 1.00 212.87 ? 467  ILE B C     1 
ATOM   5190  O O     . ILE B 2 475  ? 197.178 138.356 124.801 1.00 212.87 ? 467  ILE B O     1 
ATOM   5191  C CB    . ILE B 2 475  ? 194.776 137.635 126.888 1.00 212.87 ? 467  ILE B CB    1 
ATOM   5192  N N     . ILE B 2 476  ? 197.677 139.155 126.858 1.00 237.98 ? 468  ILE B N     1 
ATOM   5193  C CA    . ILE B 2 476  ? 198.470 140.279 126.370 1.00 237.98 ? 468  ILE B CA    1 
ATOM   5194  C C     . ILE B 2 476  ? 199.744 139.802 125.688 1.00 237.98 ? 468  ILE B C     1 
ATOM   5195  O O     . ILE B 2 476  ? 200.305 140.507 124.841 1.00 237.98 ? 468  ILE B O     1 
ATOM   5196  C CB    . ILE B 2 476  ? 198.783 141.248 127.526 1.00 237.98 ? 468  ILE B CB    1 
ATOM   5197  N N     . LEU B 2 477  ? 200.231 138.615 126.046 1.00 225.85 ? 469  LEU B N     1 
ATOM   5198  C CA    . LEU B 2 477  ? 201.296 137.978 125.286 1.00 225.85 ? 469  LEU B CA    1 
ATOM   5199  C C     . LEU B 2 477  ? 200.765 137.010 124.239 1.00 225.85 ? 469  LEU B C     1 
ATOM   5200  O O     . LEU B 2 477  ? 201.478 136.708 123.276 1.00 225.85 ? 469  LEU B O     1 
ATOM   5201  C CB    . LEU B 2 477  ? 202.249 137.235 126.230 1.00 225.85 ? 469  LEU B CB    1 
ATOM   5202  N N     . LEU B 2 478  ? 199.530 136.537 124.400 1.00 200.68 ? 470  LEU B N     1 
ATOM   5203  C CA    . LEU B 2 478  ? 198.985 135.533 123.494 1.00 200.68 ? 470  LEU B CA    1 
ATOM   5204  C C     . LEU B 2 478  ? 198.521 136.136 122.178 1.00 200.68 ? 470  LEU B C     1 
ATOM   5205  O O     . LEU B 2 478  ? 198.473 135.429 121.166 1.00 200.68 ? 470  LEU B O     1 
ATOM   5206  C CB    . LEU B 2 478  ? 197.829 134.794 124.169 1.00 200.68 ? 470  LEU B CB    1 
ATOM   5207  N N     . ALA B 2 479  ? 198.174 137.428 122.164 1.00 182.21 ? 471  ALA B N     1 
ATOM   5208  C CA    . ALA B 2 479  ? 197.755 138.047 120.906 1.00 182.21 ? 471  ALA B CA    1 
ATOM   5209  C C     . ALA B 2 479  ? 198.891 138.236 119.893 1.00 182.21 ? 471  ALA B C     1 
ATOM   5210  O O     . ALA B 2 479  ? 198.691 137.860 118.722 1.00 182.21 ? 471  ALA B O     1 
ATOM   5211  C CB    . ALA B 2 479  ? 197.002 139.354 121.192 1.00 182.21 ? 471  ALA B CB    1 
ATOM   5212  N N     . PRO B 2 480  ? 200.079 138.793 120.233 1.00 187.18 ? 472  PRO B N     1 
ATOM   5213  C CA    . PRO B 2 480  ? 201.091 138.981 119.172 1.00 187.18 ? 472  PRO B CA    1 
ATOM   5214  C C     . PRO B 2 480  ? 201.689 137.688 118.645 1.00 187.18 ? 472  PRO B C     1 
ATOM   5215  O O     . PRO B 2 480  ? 202.138 137.657 117.492 1.00 187.18 ? 472  PRO B O     1 
ATOM   5216  C CB    . PRO B 2 480  ? 202.162 139.852 119.842 1.00 187.18 ? 472  PRO B CB    1 
ATOM   5217  C CG    . PRO B 2 480  ? 201.491 140.486 120.974 1.00 187.18 ? 472  PRO B CG    1 
ATOM   5218  C CD    . PRO B 2 480  ? 200.556 139.446 121.474 1.00 187.18 ? 472  PRO B CD    1 
ATOM   5219  N N     . VAL B 2 481  ? 201.707 136.623 119.448 1.00 178.82 ? 473  VAL B N     1 
ATOM   5220  C CA    . VAL B 2 481  ? 202.095 135.322 118.920 1.00 178.82 ? 473  VAL B CA    1 
ATOM   5221  C C     . VAL B 2 481  ? 201.015 134.789 117.994 1.00 178.82 ? 473  VAL B C     1 
ATOM   5222  O O     . VAL B 2 481  ? 201.308 134.048 117.046 1.00 178.82 ? 473  VAL B O     1 
ATOM   5223  C CB    . VAL B 2 481  ? 202.382 134.339 120.069 1.00 178.82 ? 473  VAL B CB    1 
ATOM   5224  N N     . GLN B 2 482  ? 199.760 135.166 118.242 1.00 162.76 ? 474  GLN B N     1 
ATOM   5225  C CA    . GLN B 2 482  ? 198.657 134.702 117.411 1.00 162.76 ? 474  GLN B CA    1 
ATOM   5226  C C     . GLN B 2 482  ? 198.696 135.348 116.033 1.00 162.76 ? 474  GLN B C     1 
ATOM   5227  O O     . GLN B 2 482  ? 198.756 134.651 115.015 1.00 162.76 ? 474  GLN B O     1 
ATOM   5228  C CB    . GLN B 2 482  ? 197.321 134.975 118.104 1.00 162.76 ? 474  GLN B CB    1 
ATOM   5229  N N     . TYR B 2 483  ? 198.673 136.685 115.968 1.00 142.72 ? 475  TYR B N     1 
ATOM   5230  C CA    . TYR B 2 483  ? 198.647 137.273 114.632 1.00 142.72 ? 475  TYR B CA    1 
ATOM   5231  C C     . TYR B 2 483  ? 200.026 137.331 113.992 1.00 142.72 ? 475  TYR B C     1 
ATOM   5232  O O     . TYR B 2 483  ? 200.119 137.355 112.760 1.00 142.72 ? 475  TYR B O     1 
ATOM   5233  C CB    . TYR B 2 483  ? 197.996 138.668 114.623 1.00 142.72 ? 475  TYR B CB    1 
ATOM   5234  C CG    . TYR B 2 483  ? 198.733 139.814 115.292 1.00 142.72 ? 475  TYR B CG    1 
ATOM   5235  C CD1   . TYR B 2 483  ? 198.466 140.159 116.608 1.00 142.72 ? 475  TYR B CD1   1 
ATOM   5236  C CD2   . TYR B 2 483  ? 199.645 140.596 114.584 1.00 142.72 ? 475  TYR B CD2   1 
ATOM   5237  C CE1   . TYR B 2 483  ? 199.112 141.221 117.214 1.00 142.72 ? 475  TYR B CE1   1 
ATOM   5238  C CE2   . TYR B 2 483  ? 200.303 141.650 115.182 1.00 142.72 ? 475  TYR B CE2   1 
ATOM   5239  C CZ    . TYR B 2 483  ? 200.032 141.958 116.498 1.00 142.72 ? 475  TYR B CZ    1 
ATOM   5240  O OH    . TYR B 2 483  ? 200.680 143.013 117.097 1.00 142.72 ? 475  TYR B OH    1 
ATOM   5241  N N     . PHE B 2 484  ? 201.097 137.349 114.786 1.00 132.53 ? 476  PHE B N     1 
ATOM   5242  C CA    . PHE B 2 484  ? 202.423 137.342 114.186 1.00 132.53 ? 476  PHE B CA    1 
ATOM   5243  C C     . PHE B 2 484  ? 202.821 135.946 113.726 1.00 132.53 ? 476  PHE B C     1 
ATOM   5244  O O     . PHE B 2 484  ? 203.349 135.783 112.619 1.00 132.53 ? 476  PHE B O     1 
ATOM   5245  C CB    . PHE B 2 484  ? 203.460 137.895 115.161 1.00 132.53 ? 476  PHE B CB    1 
ATOM   5246  C CG    . PHE B 2 484  ? 204.841 137.975 114.582 1.00 132.53 ? 476  PHE B CG    1 
ATOM   5247  C CD1   . PHE B 2 484  ? 205.158 138.955 113.654 1.00 132.53 ? 476  PHE B CD1   1 
ATOM   5248  C CD2   . PHE B 2 484  ? 205.819 137.069 114.959 1.00 132.53 ? 476  PHE B CD2   1 
ATOM   5249  C CE1   . PHE B 2 484  ? 206.427 139.032 113.111 1.00 132.53 ? 476  PHE B CE1   1 
ATOM   5250  C CE2   . PHE B 2 484  ? 207.090 137.139 114.421 1.00 132.53 ? 476  PHE B CE2   1 
ATOM   5251  C CZ    . PHE B 2 484  ? 207.394 138.123 113.495 1.00 132.53 ? 476  PHE B CZ    1 
ATOM   5252  N N     . VAL B 2 485  ? 202.582 134.932 114.563 1.00 137.02 ? 477  VAL B N     1 
ATOM   5253  C CA    . VAL B 2 485  ? 202.870 133.561 114.157 1.00 137.02 ? 477  VAL B CA    1 
ATOM   5254  C C     . VAL B 2 485  ? 201.909 133.117 113.064 1.00 137.02 ? 477  VAL B C     1 
ATOM   5255  O O     . VAL B 2 485  ? 202.282 132.344 112.171 1.00 137.02 ? 477  VAL B O     1 
ATOM   5256  C CB    . VAL B 2 485  ? 202.813 132.617 115.372 1.00 137.02 ? 477  VAL B CB    1 
ATOM   5257  N N     . ALA B 2 486  ? 200.667 133.605 113.107 1.00 141.12 ? 478  ALA B N     1 
ATOM   5258  C CA    . ALA B 2 486  ? 199.725 133.329 112.033 1.00 141.12 ? 478  ALA B CA    1 
ATOM   5259  C C     . ALA B 2 486  ? 200.100 134.074 110.761 1.00 141.12 ? 478  ALA B C     1 
ATOM   5260  O O     . ALA B 2 486  ? 199.791 133.610 109.659 1.00 141.12 ? 478  ALA B O     1 
ATOM   5261  C CB    . ALA B 2 486  ? 198.308 133.697 112.468 1.00 141.12 ? 478  ALA B CB    1 
ATOM   5262  N N     . THR B 2 487  ? 200.755 135.229 110.892 1.00 132.39 ? 479  THR B N     1 
ATOM   5263  C CA    . THR B 2 487  ? 201.286 135.900 109.715 1.00 132.39 ? 479  THR B CA    1 
ATOM   5264  C C     . THR B 2 487  ? 202.472 135.143 109.141 1.00 132.39 ? 479  THR B C     1 
ATOM   5265  O O     . THR B 2 487  ? 202.672 135.135 107.920 1.00 132.39 ? 479  THR B O     1 
ATOM   5266  C CB    . THR B 2 487  ? 201.687 137.334 110.060 1.00 132.39 ? 479  THR B CB    1 
ATOM   5267  N N     . LYS B 2 488  ? 203.263 134.502 110.006 1.00 134.87 ? 480  LYS B N     1 
ATOM   5268  C CA    . LYS B 2 488  ? 204.333 133.631 109.532 1.00 134.87 ? 480  LYS B CA    1 
ATOM   5269  C C     . LYS B 2 488  ? 203.766 132.412 108.824 1.00 134.87 ? 480  LYS B C     1 
ATOM   5270  O O     . LYS B 2 488  ? 204.324 131.949 107.821 1.00 134.87 ? 480  LYS B O     1 
ATOM   5271  C CB    . LYS B 2 488  ? 205.223 133.208 110.700 1.00 134.87 ? 480  LYS B CB    1 
ATOM   5272  N N     . LEU B 2 489  ? 202.647 131.885 109.325 1.00 140.35 ? 481  LEU B N     1 
ATOM   5273  C CA    . LEU B 2 489  ? 201.946 130.821 108.623 1.00 140.35 ? 481  LEU B CA    1 
ATOM   5274  C C     . LEU B 2 489  ? 201.307 131.313 107.334 1.00 140.35 ? 481  LEU B C     1 
ATOM   5275  O O     . LEU B 2 489  ? 201.100 130.515 106.414 1.00 140.35 ? 481  LEU B O     1 
ATOM   5276  C CB    . LEU B 2 489  ? 200.885 130.203 109.532 1.00 140.35 ? 481  LEU B CB    1 
ATOM   5277  N N     . SER B 2 490  ? 200.994 132.608 107.247 1.00 144.57 ? 482  SER B N     1 
ATOM   5278  C CA    . SER B 2 490  ? 200.440 133.167 106.020 1.00 144.57 ? 482  SER B CA    1 
ATOM   5279  C C     . SER B 2 490  ? 201.512 133.322 104.952 1.00 144.57 ? 482  SER B C     1 
ATOM   5280  O O     . SER B 2 490  ? 201.256 133.065 103.769 1.00 144.57 ? 482  SER B O     1 
ATOM   5281  C CB    . SER B 2 490  ? 199.775 134.512 106.310 1.00 144.57 ? 482  SER B CB    1 
ATOM   5282  N N     . GLN B 2 491  ? 202.715 133.747 105.350 1.00 140.44 ? 483  GLN B N     1 
ATOM   5283  C CA    . GLN B 2 491  ? 203.838 133.740 104.420 1.00 140.44 ? 483  GLN B CA    1 
ATOM   5284  C C     . GLN B 2 491  ? 204.233 132.318 104.050 1.00 140.44 ? 483  GLN B C     1 
ATOM   5285  O O     . GLN B 2 491  ? 204.669 132.069 102.918 1.00 140.44 ? 483  GLN B O     1 
ATOM   5286  C CB    . GLN B 2 491  ? 205.025 134.489 105.026 1.00 140.44 ? 483  GLN B CB    1 
ATOM   5287  N N     . ALA B 2 492  ? 204.067 131.376 104.985 1.00 155.14 ? 484  ALA B N     1 
ATOM   5288  C CA    . ALA B 2 492  ? 204.245 129.963 104.674 1.00 155.14 ? 484  ALA B CA    1 
ATOM   5289  C C     . ALA B 2 492  ? 203.202 129.472 103.683 1.00 155.14 ? 484  ALA B C     1 
ATOM   5290  O O     . ALA B 2 492  ? 203.479 128.567 102.889 1.00 155.14 ? 484  ALA B O     1 
ATOM   5291  C CB    . ALA B 2 492  ? 204.183 129.133 105.956 1.00 155.14 ? 484  ALA B CB    1 
ATOM   5292  N N     . GLN B 2 493  ? 202.003 130.052 103.714 1.00 153.35 ? 485  GLN B N     1 
ATOM   5293  C CA    . GLN B 2 493  ? 200.995 129.754 102.709 1.00 153.35 ? 485  GLN B CA    1 
ATOM   5294  C C     . GLN B 2 493  ? 201.277 130.448 101.387 1.00 153.35 ? 485  GLN B C     1 
ATOM   5295  O O     . GLN B 2 493  ? 200.801 129.985 100.345 1.00 153.35 ? 485  GLN B O     1 
ATOM   5296  C CB    . GLN B 2 493  ? 199.609 130.156 103.217 1.00 153.35 ? 485  GLN B CB    1 
ATOM   5297  N N     . ARG B 2 494  ? 202.030 131.546 101.405 1.00 148.63 ? 486  ARG B N     1 
ATOM   5298  C CA    . ARG B 2 494  ? 202.407 132.198 100.158 1.00 148.63 ? 486  ARG B CA    1 
ATOM   5299  C C     . ARG B 2 494  ? 203.499 131.413 99.439  1.00 148.63 ? 486  ARG B C     1 
ATOM   5300  O O     . ARG B 2 494  ? 203.363 131.092 98.252  1.00 148.63 ? 486  ARG B O     1 
ATOM   5301  C CB    . ARG B 2 494  ? 202.861 133.633 100.433 1.00 148.63 ? 486  ARG B CB    1 
ATOM   5302  N N     . THR B 2 495  ? 204.583 131.088 100.149 1.00 138.56 ? 487  THR B N     1 
ATOM   5303  C CA    . THR B 2 495  ? 205.668 130.326 99.535  1.00 138.56 ? 487  THR B CA    1 
ATOM   5304  C C     . THR B 2 495  ? 205.249 128.886 99.273  1.00 138.56 ? 487  THR B C     1 
ATOM   5305  O O     . THR B 2 495  ? 205.593 128.311 98.231  1.00 138.56 ? 487  THR B O     1 
ATOM   5306  C CB    . THR B 2 495  ? 206.911 130.366 100.423 1.00 138.56 ? 487  THR B CB    1 
ATOM   5307  N N     . THR B 2 496  ? 204.493 128.295 100.202 1.00 154.41 ? 488  THR B N     1 
ATOM   5308  C CA    . THR B 2 496  ? 203.950 126.959 99.985  1.00 154.41 ? 488  THR B CA    1 
ATOM   5309  C C     . THR B 2 496  ? 202.892 126.959 98.891  1.00 154.41 ? 488  THR B C     1 
ATOM   5310  O O     . THR B 2 496  ? 202.691 125.939 98.225  1.00 154.41 ? 488  THR B O     1 
ATOM   5311  C CB    . THR B 2 496  ? 203.365 126.408 101.285 1.00 154.41 ? 488  THR B CB    1 
ATOM   5312  N N     . LEU B 2 497  ? 202.214 128.092 98.688  1.00 143.72 ? 489  LEU B N     1 
ATOM   5313  C CA    . LEU B 2 497  ? 201.305 128.215 97.557  1.00 143.72 ? 489  LEU B CA    1 
ATOM   5314  C C     . LEU B 2 497  ? 202.066 128.340 96.244  1.00 143.72 ? 489  LEU B C     1 
ATOM   5315  O O     . LEU B 2 497  ? 201.569 127.909 95.198  1.00 143.72 ? 489  LEU B O     1 
ATOM   5316  C CB    . LEU B 2 497  ? 200.378 129.415 97.753  1.00 143.72 ? 489  LEU B CB    1 
ATOM   5317  N N     . GLU B 2 498  ? 203.266 128.925 96.278  1.00 144.22 ? 490  GLU B N     1 
ATOM   5318  C CA    . GLU B 2 498  ? 204.085 128.992 95.072  1.00 144.22 ? 490  GLU B CA    1 
ATOM   5319  C C     . GLU B 2 498  ? 204.640 127.621 94.709  1.00 144.22 ? 490  GLU B C     1 
ATOM   5320  O O     . GLU B 2 498  ? 204.623 127.228 93.535  1.00 144.22 ? 490  GLU B O     1 
ATOM   5321  C CB    . GLU B 2 498  ? 205.219 129.999 95.263  1.00 144.22 ? 490  GLU B CB    1 
ATOM   5322  N N     . HIS B 2 499  ? 205.138 126.881 95.703  1.00 145.22 ? 491  HIS B N     1 
ATOM   5323  C CA    . HIS B 2 499  ? 205.637 125.536 95.439  1.00 145.22 ? 491  HIS B CA    1 
ATOM   5324  C C     . HIS B 2 499  ? 204.507 124.580 95.077  1.00 145.22 ? 491  HIS B C     1 
ATOM   5325  O O     . HIS B 2 499  ? 204.706 123.662 94.273  1.00 145.22 ? 491  HIS B O     1 
ATOM   5326  C CB    . HIS B 2 499  ? 206.409 125.014 96.648  1.00 145.22 ? 491  HIS B CB    1 
ATOM   5327  N N     . SER B 2 500  ? 203.318 124.784 95.649  1.00 137.59 ? 492  SER B N     1 
ATOM   5328  C CA    . SER B 2 500  ? 202.165 123.991 95.247  1.00 137.59 ? 492  SER B CA    1 
ATOM   5329  C C     . SER B 2 500  ? 201.686 124.376 93.855  1.00 137.59 ? 492  SER B C     1 
ATOM   5330  O O     . SER B 2 500  ? 201.103 123.547 93.149  1.00 137.59 ? 492  SER B O     1 
ATOM   5331  C CB    . SER B 2 500  ? 201.032 124.151 96.259  1.00 137.59 ? 492  SER B CB    1 
ATOM   5332  N N     . ASN B 2 501  ? 201.918 125.628 93.449  1.00 140.83 ? 493  ASN B N     1 
ATOM   5333  C CA    . ASN B 2 501  ? 201.668 126.010 92.065  1.00 140.83 ? 493  ASN B CA    1 
ATOM   5334  C C     . ASN B 2 501  ? 202.665 125.349 91.125  1.00 140.83 ? 493  ASN B C     1 
ATOM   5335  O O     . ASN B 2 501  ? 202.315 125.021 89.984  1.00 140.83 ? 493  ASN B O     1 
ATOM   5336  C CB    . ASN B 2 501  ? 201.718 127.530 91.917  1.00 140.83 ? 493  ASN B CB    1 
ATOM   5337  N N     . GLU B 2 502  ? 203.903 125.140 91.584  1.00 137.48 ? 494  GLU B N     1 
ATOM   5338  C CA    . GLU B 2 502  ? 204.847 124.333 90.815  1.00 137.48 ? 494  GLU B CA    1 
ATOM   5339  C C     . GLU B 2 502  ? 204.421 122.871 90.772  1.00 137.48 ? 494  GLU B C     1 
ATOM   5340  O O     . GLU B 2 502  ? 204.685 122.178 89.782  1.00 137.48 ? 494  GLU B O     1 
ATOM   5341  C CB    . GLU B 2 502  ? 206.253 124.458 91.402  1.00 137.48 ? 494  GLU B CB    1 
ATOM   5342  N N     . ARG B 2 503  ? 203.760 122.390 91.830  1.00 142.54 ? 495  ARG B N     1 
ATOM   5343  C CA    . ARG B 2 503  ? 203.184 121.052 91.801  1.00 142.54 ? 495  ARG B CA    1 
ATOM   5344  C C     . ARG B 2 503  ? 202.007 120.972 90.838  1.00 142.54 ? 495  ARG B C     1 
ATOM   5345  O O     . ARG B 2 503  ? 201.756 119.913 90.254  1.00 142.54 ? 495  ARG B O     1 
ATOM   5346  C CB    . ARG B 2 503  ? 202.749 120.635 93.205  1.00 142.54 ? 495  ARG B CB    1 
ATOM   5347  N N     . LEU B 2 504  ? 201.278 122.075 90.660  1.00 141.51 ? 496  LEU B N     1 
ATOM   5348  C CA    . LEU B 2 504  ? 200.221 122.101 89.658  1.00 141.51 ? 496  LEU B CA    1 
ATOM   5349  C C     . LEU B 2 504  ? 200.795 122.170 88.251  1.00 141.51 ? 496  LEU B C     1 
ATOM   5350  O O     . LEU B 2 504  ? 200.213 121.605 87.317  1.00 141.51 ? 496  LEU B O     1 
ATOM   5351  C CB    . LEU B 2 504  ? 199.289 123.284 89.908  1.00 141.51 ? 496  LEU B CB    1 
ATOM   5352  N N     . LYS B 2 505  ? 201.929 122.856 88.080  1.00 150.69 ? 497  LYS B N     1 
ATOM   5353  C CA    . LYS B 2 505  ? 202.572 122.919 86.771  1.00 150.69 ? 497  LYS B CA    1 
ATOM   5354  C C     . LYS B 2 505  ? 203.167 121.571 86.384  1.00 150.69 ? 497  LYS B C     1 
ATOM   5355  O O     . LYS B 2 505  ? 203.086 121.160 85.219  1.00 150.69 ? 497  LYS B O     1 
ATOM   5356  C CB    . LYS B 2 505  ? 203.650 124.002 86.769  1.00 150.69 ? 497  LYS B CB    1 
ATOM   5357  N N     . GLN B 2 506  ? 203.757 120.863 87.347  1.00 160.74 ? 498  GLN B N     1 
ATOM   5358  C CA    . GLN B 2 506  ? 204.191 119.498 87.088  1.00 160.74 ? 498  GLN B CA    1 
ATOM   5359  C C     . GLN B 2 506  ? 203.018 118.533 87.010  1.00 160.74 ? 498  GLN B C     1 
ATOM   5360  O O     . GLN B 2 506  ? 203.175 117.430 86.479  1.00 160.74 ? 498  GLN B O     1 
ATOM   5361  C CB    . GLN B 2 506  ? 205.173 119.042 88.167  1.00 160.74 ? 498  GLN B CB    1 
ATOM   5362  N N     . THR B 2 507  ? 201.849 118.922 87.530  1.00 175.42 ? 499  THR B N     1 
ATOM   5363  C CA    . THR B 2 507  ? 200.662 118.079 87.442  1.00 175.42 ? 499  THR B CA    1 
ATOM   5364  C C     . THR B 2 507  ? 200.043 118.140 86.049  1.00 175.42 ? 499  THR B C     1 
ATOM   5365  O O     . THR B 2 507  ? 199.685 117.107 85.472  1.00 175.42 ? 499  THR B O     1 
ATOM   5366  C CB    . THR B 2 507  ? 199.641 118.500 88.500  1.00 175.42 ? 499  THR B CB    1 
ATOM   5367  N N     . ASN B 2 508  ? 199.902 119.347 85.494  1.00 176.70 ? 500  ASN B N     1 
ATOM   5368  C CA    . ASN B 2 508  ? 199.473 119.463 84.105  1.00 176.70 ? 500  ASN B CA    1 
ATOM   5369  C C     . ASN B 2 508  ? 200.569 119.011 83.150  1.00 176.70 ? 500  ASN B C     1 
ATOM   5370  O O     . ASN B 2 508  ? 200.277 118.588 82.025  1.00 176.70 ? 500  ASN B O     1 
ATOM   5371  C CB    . ASN B 2 508  ? 199.058 120.901 83.797  1.00 176.70 ? 500  ASN B CB    1 
ATOM   5372  N N     . GLU B 2 509  ? 201.832 119.102 83.579  1.00 176.25 ? 501  GLU B N     1 
ATOM   5373  C CA    . GLU B 2 509  ? 202.915 118.475 82.832  1.00 176.25 ? 501  GLU B CA    1 
ATOM   5374  C C     . GLU B 2 509  ? 202.814 116.955 82.879  1.00 176.25 ? 501  GLU B C     1 
ATOM   5375  O O     . GLU B 2 509  ? 203.269 116.277 81.951  1.00 176.25 ? 501  GLU B O     1 
ATOM   5376  C CB    . GLU B 2 509  ? 204.266 118.938 83.377  1.00 176.25 ? 501  GLU B CB    1 
ATOM   5377  N N     . MET B 2 510  ? 202.235 116.405 83.950  1.00 174.33 ? 502  MET B N     1 
ATOM   5378  C CA    . MET B 2 510  ? 201.946 114.978 83.990  1.00 174.33 ? 502  MET B CA    1 
ATOM   5379  C C     . MET B 2 510  ? 200.716 114.636 83.164  1.00 174.33 ? 502  MET B C     1 
ATOM   5380  O O     . MET B 2 510  ? 200.583 113.497 82.702  1.00 174.33 ? 502  MET B O     1 
ATOM   5381  C CB    . MET B 2 510  ? 201.759 114.515 85.436  1.00 174.33 ? 502  MET B CB    1 
ATOM   5382  N N     . LEU B 2 511  ? 199.803 115.595 82.982  1.00 175.15 ? 503  LEU B N     1 
ATOM   5383  C CA    . LEU B 2 511  ? 198.752 115.426 81.986  1.00 175.15 ? 503  LEU B CA    1 
ATOM   5384  C C     . LEU B 2 511  ? 199.344 115.416 80.583  1.00 175.15 ? 503  LEU B C     1 
ATOM   5385  O O     . LEU B 2 511  ? 198.872 114.682 79.704  1.00 175.15 ? 503  LEU B O     1 
ATOM   5386  C CB    . LEU B 2 511  ? 197.707 116.529 82.128  1.00 175.15 ? 503  LEU B CB    1 
ATOM   5387  N N     . ARG B 2 512  ? 200.392 116.213 80.363  1.00 210.20 ? 504  ARG B N     1 
ATOM   5388  C CA    . ARG B 2 512  ? 201.153 116.112 79.125  1.00 210.20 ? 504  ARG B CA    1 
ATOM   5389  C C     . ARG B 2 512  ? 201.900 114.786 79.039  1.00 210.20 ? 504  ARG B C     1 
ATOM   5390  O O     . ARG B 2 512  ? 202.120 114.273 77.937  1.00 210.20 ? 504  ARG B O     1 
ATOM   5391  C CB    . ARG B 2 512  ? 202.127 117.283 79.011  1.00 210.20 ? 504  ARG B CB    1 
ATOM   5392  N N     . GLY B 2 513  ? 202.293 114.222 80.185  1.00 215.91 ? 505  GLY B N     1 
ATOM   5393  C CA    . GLY B 2 513  ? 202.881 112.893 80.186  1.00 215.91 ? 505  GLY B CA    1 
ATOM   5394  C C     . GLY B 2 513  ? 201.883 111.812 79.831  1.00 215.91 ? 505  GLY B C     1 
ATOM   5395  O O     . GLY B 2 513  ? 202.242 110.809 79.207  1.00 215.91 ? 505  GLY B O     1 
ATOM   5396  N N     . MET B 2 514  ? 200.617 111.999 80.218  1.00 209.36 ? 506  MET B N     1 
ATOM   5397  C CA    . MET B 2 514  ? 199.557 111.123 79.733  1.00 209.36 ? 506  MET B CA    1 
ATOM   5398  C C     . MET B 2 514  ? 199.289 111.355 78.252  1.00 209.36 ? 506  MET B C     1 
ATOM   5399  O O     . MET B 2 514  ? 198.849 110.436 77.551  1.00 209.36 ? 506  MET B O     1 
ATOM   5400  C CB    . MET B 2 514  ? 198.281 111.335 80.549  1.00 209.36 ? 506  MET B CB    1 
ATOM   5401  N N     . LYS B 2 515  ? 199.545 112.569 77.760  1.00 208.67 ? 507  LYS B N     1 
ATOM   5402  C CA    . LYS B 2 515  ? 199.488 112.801 76.324  1.00 208.67 ? 507  LYS B CA    1 
ATOM   5403  C C     . LYS B 2 515  ? 200.695 112.218 75.598  1.00 208.67 ? 507  LYS B C     1 
ATOM   5404  O O     . LYS B 2 515  ? 200.633 112.028 74.379  1.00 208.67 ? 507  LYS B O     1 
ATOM   5405  C CB    . LYS B 2 515  ? 199.385 114.300 76.040  1.00 208.67 ? 507  LYS B CB    1 
ATOM   5406  N N     . LEU B 2 516  ? 201.778 111.926 76.314  1.00 195.50 ? 508  LEU B N     1 
ATOM   5407  C CA    . LEU B 2 516  ? 203.007 111.430 75.711  1.00 195.50 ? 508  LEU B CA    1 
ATOM   5408  C C     . LEU B 2 516  ? 202.972 109.904 75.625  1.00 195.50 ? 508  LEU B C     1 
ATOM   5409  O O     . LEU B 2 516  ? 201.929 109.270 75.793  1.00 195.50 ? 508  LEU B O     1 
ATOM   5410  C CB    . LEU B 2 516  ? 204.219 111.919 76.499  1.00 195.50 ? 508  LEU B CB    1 
ATOM   5411  N N     . LEU B 2 517  ? 204.130 109.300 75.362  1.00 185.50 ? 509  LEU B N     1 
ATOM   5412  C CA    . LEU B 2 517  ? 204.242 107.858 75.182  1.00 185.50 ? 509  LEU B CA    1 
ATOM   5413  C C     . LEU B 2 517  ? 204.207 107.148 76.537  1.00 185.50 ? 509  LEU B C     1 
ATOM   5414  O O     . LEU B 2 517  ? 203.914 107.740 77.580  1.00 185.50 ? 509  LEU B O     1 
ATOM   5415  C CB    . LEU B 2 517  ? 205.509 107.526 74.402  1.00 185.50 ? 509  LEU B CB    1 
ATOM   5416  N N     . LYS B 2 518  ? 204.509 105.851 76.534  1.00 209.86 ? 510  LYS B N     1 
ATOM   5417  C CA    . LYS B 2 518  ? 204.439 105.048 77.751  1.00 209.86 ? 510  LYS B CA    1 
ATOM   5418  C C     . LYS B 2 518  ? 205.783 104.985 78.475  1.00 209.86 ? 510  LYS B C     1 
ATOM   5419  O O     . LYS B 2 518  ? 205.886 105.387 79.639  1.00 209.86 ? 510  LYS B O     1 
ATOM   5420  C CB    . LYS B 2 518  ? 203.946 103.635 77.414  1.00 209.86 ? 510  LYS B CB    1 
ATOM   5421  N N     . LEU B 2 519  ? 206.821 104.494 77.791  1.00 240.73 ? 511  LEU B N     1 
ATOM   5422  C CA    . LEU B 2 519  ? 208.097 104.236 78.455  1.00 240.73 ? 511  LEU B CA    1 
ATOM   5423  C C     . LEU B 2 519  ? 208.863 105.525 78.732  1.00 240.73 ? 511  LEU B C     1 
ATOM   5424  O O     . LEU B 2 519  ? 209.428 105.695 79.822  1.00 240.73 ? 511  LEU B O     1 
ATOM   5425  C CB    . LEU B 2 519  ? 208.940 103.282 77.607  1.00 240.73 ? 511  LEU B CB    1 
ATOM   5426  N N     . TYR B 2 520  ? 208.889 106.441 77.760  1.00 241.21 ? 512  TYR B N     1 
ATOM   5427  C CA    . TYR B 2 520  ? 209.656 107.676 77.904  1.00 241.21 ? 512  TYR B CA    1 
ATOM   5428  C C     . TYR B 2 520  ? 209.042 108.593 78.955  1.00 241.21 ? 512  TYR B C     1 
ATOM   5429  O O     . TYR B 2 520  ? 209.747 109.118 79.826  1.00 241.21 ? 512  TYR B O     1 
ATOM   5430  C CB    . TYR B 2 520  ? 209.745 108.389 76.555  1.00 241.21 ? 512  TYR B CB    1 
ATOM   5431  N N     . ALA B 2 521  ? 207.722 108.790 78.896  1.00 241.11 ? 513  ALA B N     1 
ATOM   5432  C CA    . ALA B 2 521  ? 207.053 109.622 79.889  1.00 241.11 ? 513  ALA B CA    1 
ATOM   5433  C C     . ALA B 2 521  ? 206.956 108.922 81.238  1.00 241.11 ? 513  ALA B C     1 
ATOM   5434  O O     . ALA B 2 521  ? 206.873 109.591 82.273  1.00 241.11 ? 513  ALA B O     1 
ATOM   5435  C CB    . ALA B 2 521  ? 205.661 110.019 79.397  1.00 241.11 ? 513  ALA B CB    1 
ATOM   5436  N N     . TRP B 2 522  ? 206.963 107.587 81.252  1.00 235.38 ? 514  TRP B N     1 
ATOM   5437  C CA    . TRP B 2 522  ? 206.964 106.868 82.521  1.00 235.38 ? 514  TRP B CA    1 
ATOM   5438  C C     . TRP B 2 522  ? 208.293 107.044 83.246  1.00 235.38 ? 514  TRP B C     1 
ATOM   5439  O O     . TRP B 2 522  ? 208.321 107.356 84.443  1.00 235.38 ? 514  TRP B O     1 
ATOM   5440  C CB    . TRP B 2 522  ? 206.666 105.386 82.288  1.00 235.38 ? 514  TRP B CB    1 
ATOM   5441  N N     . GLU B 2 523  ? 209.408 106.879 82.528  1.00 245.32 ? 515  GLU B N     1 
ATOM   5442  C CA    . GLU B 2 523  ? 210.719 106.999 83.160  1.00 245.32 ? 515  GLU B CA    1 
ATOM   5443  C C     . GLU B 2 523  ? 211.062 108.455 83.458  1.00 245.32 ? 515  GLU B C     1 
ATOM   5444  O O     . GLU B 2 523  ? 211.352 108.813 84.607  1.00 245.32 ? 515  GLU B O     1 
ATOM   5445  C CB    . GLU B 2 523  ? 211.790 106.366 82.269  1.00 245.32 ? 515  GLU B CB    1 
ATOM   5446  N N     . SER B 2 524  ? 211.025 109.310 82.435  1.00 237.05 ? 516  SER B N     1 
ATOM   5447  C CA    . SER B 2 524  ? 211.428 110.700 82.608  1.00 237.05 ? 516  SER B CA    1 
ATOM   5448  C C     . SER B 2 524  ? 210.394 111.518 83.372  1.00 237.05 ? 516  SER B C     1 
ATOM   5449  O O     . SER B 2 524  ? 210.762 112.469 84.069  1.00 237.05 ? 516  SER B O     1 
ATOM   5450  C CB    . SER B 2 524  ? 211.698 111.342 81.246  1.00 237.05 ? 516  SER B CB    1 
ATOM   5451  N N     . ILE B 2 525  ? 209.113 111.174 83.260  1.00 245.18 ? 517  ILE B N     1 
ATOM   5452  C CA    . ILE B 2 525  ? 208.093 111.929 83.977  1.00 245.18 ? 517  ILE B CA    1 
ATOM   5453  C C     . ILE B 2 525  ? 207.829 111.358 85.368  1.00 245.18 ? 517  ILE B C     1 
ATOM   5454  O O     . ILE B 2 525  ? 207.434 112.101 86.271  1.00 245.18 ? 517  ILE B O     1 
ATOM   5455  C CB    . ILE B 2 525  ? 206.792 112.008 83.162  1.00 245.18 ? 517  ILE B CB    1 
ATOM   5456  N N     . PHE B 2 526  ? 208.025 110.050 85.568  1.00 230.66 ? 518  PHE B N     1 
ATOM   5457  C CA    . PHE B 2 526  ? 207.961 109.519 86.926  1.00 230.66 ? 518  PHE B CA    1 
ATOM   5458  C C     . PHE B 2 526  ? 209.168 109.974 87.736  1.00 230.66 ? 518  PHE B C     1 
ATOM   5459  O O     . PHE B 2 526  ? 209.023 110.388 88.894  1.00 230.66 ? 518  PHE B O     1 
ATOM   5460  C CB    . PHE B 2 526  ? 207.872 107.995 86.902  1.00 230.66 ? 518  PHE B CB    1 
ATOM   5461  N N     . CYS B 2 527  ? 210.359 109.932 87.133  1.00 231.38 ? 519  CYS B N     1 
ATOM   5462  C CA    . CYS B 2 527  ? 211.567 110.351 87.837  1.00 231.38 ? 519  CYS B CA    1 
ATOM   5463  C C     . CYS B 2 527  ? 211.622 111.867 87.989  1.00 231.38 ? 519  CYS B C     1 
ATOM   5464  O O     . CYS B 2 527  ? 211.916 112.381 89.075  1.00 231.38 ? 519  CYS B O     1 
ATOM   5465  C CB    . CYS B 2 527  ? 212.803 109.836 87.099  1.00 231.38 ? 519  CYS B CB    1 
ATOM   5466  N N     . SER B 2 528  ? 211.342 112.600 86.909  1.00 222.55 ? 520  SER B N     1 
ATOM   5467  C CA    . SER B 2 528  ? 211.426 114.056 86.958  1.00 222.55 ? 520  SER B CA    1 
ATOM   5468  C C     . SER B 2 528  ? 210.268 114.654 87.746  1.00 222.55 ? 520  SER B C     1 
ATOM   5469  O O     . SER B 2 528  ? 210.467 115.570 88.552  1.00 222.55 ? 520  SER B O     1 
ATOM   5470  C CB    . SER B 2 528  ? 211.460 114.627 85.541  1.00 222.55 ? 520  SER B CB    1 
ATOM   5471  N N     . ARG B 2 529  ? 209.054 114.146 87.529  1.00 213.31 ? 521  ARG B N     1 
ATOM   5472  C CA    . ARG B 2 529  ? 207.900 114.670 88.251  1.00 213.31 ? 521  ARG B CA    1 
ATOM   5473  C C     . ARG B 2 529  ? 207.904 114.230 89.706  1.00 213.31 ? 521  ARG B C     1 
ATOM   5474  O O     . ARG B 2 529  ? 207.439 114.973 90.577  1.00 213.31 ? 521  ARG B O     1 
ATOM   5475  C CB    . ARG B 2 529  ? 206.607 114.233 87.567  1.00 213.31 ? 521  ARG B CB    1 
ATOM   5476  N N     . VAL B 2 530  ? 208.422 113.034 89.993  1.00 207.86 ? 522  VAL B N     1 
ATOM   5477  C CA    . VAL B 2 530  ? 208.506 112.602 91.381  1.00 207.86 ? 522  VAL B CA    1 
ATOM   5478  C C     . VAL B 2 530  ? 209.634 113.323 92.108  1.00 207.86 ? 522  VAL B C     1 
ATOM   5479  O O     . VAL B 2 530  ? 209.526 113.601 93.309  1.00 207.86 ? 522  VAL B O     1 
ATOM   5480  C CB    . VAL B 2 530  ? 208.674 111.076 91.460  1.00 207.86 ? 522  VAL B CB    1 
ATOM   5481  N N     . GLU B 2 531  ? 210.722 113.647 91.407  1.00 204.20 ? 523  GLU B N     1 
ATOM   5482  C CA    . GLU B 2 531  ? 211.844 114.325 92.050  1.00 204.20 ? 523  GLU B CA    1 
ATOM   5483  C C     . GLU B 2 531  ? 211.555 115.805 92.270  1.00 204.20 ? 523  GLU B C     1 
ATOM   5484  O O     . GLU B 2 531  ? 211.829 116.338 93.351  1.00 204.20 ? 523  GLU B O     1 
ATOM   5485  C CB    . GLU B 2 531  ? 213.111 114.146 91.216  1.00 204.20 ? 523  GLU B CB    1 
ATOM   5486  N N     . VAL B 2 532  ? 211.006 116.481 91.257  1.00 201.22 ? 524  VAL B N     1 
ATOM   5487  C CA    . VAL B 2 532  ? 210.670 117.892 91.408  1.00 201.22 ? 524  VAL B CA    1 
ATOM   5488  C C     . VAL B 2 532  ? 209.437 118.059 92.287  1.00 201.22 ? 524  VAL B C     1 
ATOM   5489  O O     . VAL B 2 532  ? 209.320 119.048 93.022  1.00 201.22 ? 524  VAL B O     1 
ATOM   5490  C CB    . VAL B 2 532  ? 210.470 118.546 90.030  1.00 201.22 ? 524  VAL B CB    1 
ATOM   5491  N N     . THR B 2 533  ? 208.502 117.106 92.227  1.00 211.52 ? 525  THR B N     1 
ATOM   5492  C CA    . THR B 2 533  ? 207.340 117.150 93.108  1.00 211.52 ? 525  THR B CA    1 
ATOM   5493  C C     . THR B 2 533  ? 207.723 116.842 94.550  1.00 211.52 ? 525  THR B C     1 
ATOM   5494  O O     . THR B 2 533  ? 207.097 117.361 95.480  1.00 211.52 ? 525  THR B O     1 
ATOM   5495  C CB    . THR B 2 533  ? 206.267 116.172 92.624  1.00 211.52 ? 525  THR B CB    1 
ATOM   5496  N N     . ARG B 2 534  ? 208.739 116.003 94.755  1.00 199.48 ? 526  ARG B N     1 
ATOM   5497  C CA    . ARG B 2 534  ? 209.301 115.831 96.086  1.00 199.48 ? 526  ARG B CA    1 
ATOM   5498  C C     . ARG B 2 534  ? 210.148 117.022 96.504  1.00 199.48 ? 526  ARG B C     1 
ATOM   5499  O O     . ARG B 2 534  ? 210.370 117.221 97.703  1.00 199.48 ? 526  ARG B O     1 
ATOM   5500  C CB    . ARG B 2 534  ? 210.139 114.553 96.148  1.00 199.48 ? 526  ARG B CB    1 
ATOM   5501  N N     . ARG B 2 535  ? 210.624 117.814 95.543  1.00 190.62 ? 527  ARG B N     1 
ATOM   5502  C CA    . ARG B 2 535  ? 211.402 119.006 95.861  1.00 190.62 ? 527  ARG B CA    1 
ATOM   5503  C C     . ARG B 2 535  ? 210.500 120.139 96.338  1.00 190.62 ? 527  ARG B C     1 
ATOM   5504  O O     . ARG B 2 535  ? 210.680 120.675 97.438  1.00 190.62 ? 527  ARG B O     1 
ATOM   5505  C CB    . ARG B 2 535  ? 212.213 119.443 94.639  1.00 190.62 ? 527  ARG B CB    1 
ATOM   5506  N N     . LYS B 2 536  ? 209.523 120.519 95.511  1.00 188.38 ? 528  LYS B N     1 
ATOM   5507  C CA    . LYS B 2 536  ? 208.577 121.555 95.909  1.00 188.38 ? 528  LYS B CA    1 
ATOM   5508  C C     . LYS B 2 536  ? 207.663 121.074 97.027  1.00 188.38 ? 528  LYS B C     1 
ATOM   5509  O O     . LYS B 2 536  ? 207.269 121.869 97.887  1.00 188.38 ? 528  LYS B O     1 
ATOM   5510  C CB    . LYS B 2 536  ? 207.758 122.007 94.703  1.00 188.38 ? 528  LYS B CB    1 
ATOM   5511  N N     . GLU B 2 537  ? 207.330 119.782 97.041  1.00 214.43 ? 529  GLU B N     1 
ATOM   5512  C CA    . GLU B 2 537  ? 206.592 119.218 98.162  1.00 214.43 ? 529  GLU B CA    1 
ATOM   5513  C C     . GLU B 2 537  ? 207.466 119.053 99.397  1.00 214.43 ? 529  GLU B C     1 
ATOM   5514  O O     . GLU B 2 537  ? 206.934 118.859 100.495 1.00 214.43 ? 529  GLU B O     1 
ATOM   5515  C CB    . GLU B 2 537  ? 205.980 117.870 97.775  1.00 214.43 ? 529  GLU B CB    1 
ATOM   5516  N N     . MET B 2 538  ? 208.790 119.107 99.241  1.00 216.05 ? 530  MET B N     1 
ATOM   5517  C CA    . MET B 2 538  ? 209.679 119.104 100.397 1.00 216.05 ? 530  MET B CA    1 
ATOM   5518  C C     . MET B 2 538  ? 209.808 120.499 100.991 1.00 216.05 ? 530  MET B C     1 
ATOM   5519  O O     . MET B 2 538  ? 209.832 120.652 102.219 1.00 216.05 ? 530  MET B O     1 
ATOM   5520  C CB    . MET B 2 538  ? 211.053 118.559 100.005 1.00 216.05 ? 530  MET B CB    1 
ATOM   5521  N N     . THR B 2 539  ? 209.899 121.521 100.134 1.00 210.70 ? 531  THR B N     1 
ATOM   5522  C CA    . THR B 2 539  ? 209.909 122.899 100.617 1.00 210.70 ? 531  THR B CA    1 
ATOM   5523  C C     . THR B 2 539  ? 208.568 123.268 101.237 1.00 210.70 ? 531  THR B C     1 
ATOM   5524  O O     . THR B 2 539  ? 208.516 123.916 102.289 1.00 210.70 ? 531  THR B O     1 
ATOM   5525  C CB    . THR B 2 539  ? 210.253 123.854 99.476  1.00 210.70 ? 531  THR B CB    1 
ATOM   5526  N N     . SER B 2 540  ? 207.474 122.843 100.606 1.00 222.12 ? 532  SER B N     1 
ATOM   5527  C CA    . SER B 2 540  ? 206.151 123.007 101.194 1.00 222.12 ? 532  SER B CA    1 
ATOM   5528  C C     . SER B 2 540  ? 205.890 122.014 102.318 1.00 222.12 ? 532  SER B C     1 
ATOM   5529  O O     . SER B 2 540  ? 204.923 122.186 103.064 1.00 222.12 ? 532  SER B O     1 
ATOM   5530  C CB    . SER B 2 540  ? 205.075 122.863 100.116 1.00 222.12 ? 532  SER B CB    1 
ATOM   5531  N N     . LEU B 2 541  ? 206.713 120.969 102.441 1.00 221.50 ? 533  LEU B N     1 
ATOM   5532  C CA    . LEU B 2 541  ? 206.615 120.077 103.589 1.00 221.50 ? 533  LEU B CA    1 
ATOM   5533  C C     . LEU B 2 541  ? 207.248 120.706 104.820 1.00 221.50 ? 533  LEU B C     1 
ATOM   5534  O O     . LEU B 2 541  ? 206.714 120.581 105.928 1.00 221.50 ? 533  LEU B O     1 
ATOM   5535  C CB    . LEU B 2 541  ? 207.271 118.732 103.273 1.00 221.50 ? 533  LEU B CB    1 
ATOM   5536  N N     . ARG B 2 542  ? 208.383 121.387 104.642 1.00 224.42 ? 534  ARG B N     1 
ATOM   5537  C CA    . ARG B 2 542  ? 208.973 122.142 105.744 1.00 224.42 ? 534  ARG B CA    1 
ATOM   5538  C C     . ARG B 2 542  ? 208.137 123.372 106.070 1.00 224.42 ? 534  ARG B C     1 
ATOM   5539  O O     . ARG B 2 542  ? 208.027 123.763 107.240 1.00 224.42 ? 534  ARG B O     1 
ATOM   5540  C CB    . ARG B 2 542  ? 210.408 122.539 105.400 1.00 224.42 ? 534  ARG B CB    1 
ATOM   5541  N N     . ALA B 2 543  ? 207.540 123.993 105.047 1.00 215.04 ? 535  ALA B N     1 
ATOM   5542  C CA    . ALA B 2 543  ? 206.590 125.075 105.283 1.00 215.04 ? 535  ALA B CA    1 
ATOM   5543  C C     . ALA B 2 543  ? 205.348 124.564 106.000 1.00 215.04 ? 535  ALA B C     1 
ATOM   5544  O O     . ALA B 2 543  ? 204.771 125.267 106.841 1.00 215.04 ? 535  ALA B O     1 
ATOM   5545  C CB    . ALA B 2 543  ? 206.215 125.740 103.959 1.00 215.04 ? 535  ALA B CB    1 
ATOM   5546  N N     . PHE B 2 544  ? 204.937 123.332 105.692 1.00 219.22 ? 536  PHE B N     1 
ATOM   5547  C CA    . PHE B 2 544  ? 203.844 122.704 106.421 1.00 219.22 ? 536  PHE B CA    1 
ATOM   5548  C C     . PHE B 2 544  ? 204.246 122.379 107.851 1.00 219.22 ? 536  PHE B C     1 
ATOM   5549  O O     . PHE B 2 544  ? 203.395 122.371 108.747 1.00 219.22 ? 536  PHE B O     1 
ATOM   5550  C CB    . PHE B 2 544  ? 203.393 121.436 105.694 1.00 219.22 ? 536  PHE B CB    1 
ATOM   5551  N N     . ALA B 2 545  ? 205.533 122.114 108.084 1.00 207.66 ? 537  ALA B N     1 
ATOM   5552  C CA    . ALA B 2 545  ? 206.003 121.902 109.446 1.00 207.66 ? 537  ALA B CA    1 
ATOM   5553  C C     . ALA B 2 545  ? 206.039 123.205 110.230 1.00 207.66 ? 537  ALA B C     1 
ATOM   5554  O O     . ALA B 2 545  ? 205.827 123.200 111.449 1.00 207.66 ? 537  ALA B O     1 
ATOM   5555  C CB    . ALA B 2 545  ? 207.386 121.249 109.434 1.00 207.66 ? 537  ALA B CB    1 
ATOM   5556  N N     . VAL B 2 546  ? 206.301 124.326 109.557 1.00 195.45 ? 538  VAL B N     1 
ATOM   5557  C CA    . VAL B 2 546  ? 206.254 125.614 110.242 1.00 195.45 ? 538  VAL B CA    1 
ATOM   5558  C C     . VAL B 2 546  ? 204.812 126.009 110.532 1.00 195.45 ? 538  VAL B C     1 
ATOM   5559  O O     . VAL B 2 546  ? 204.510 126.576 111.590 1.00 195.45 ? 538  VAL B O     1 
ATOM   5560  C CB    . VAL B 2 546  ? 206.980 126.688 109.414 1.00 195.45 ? 538  VAL B CB    1 
ATOM   5561  N N     . TYR B 2 547  ? 203.902 125.710 109.600 1.00 212.35 ? 539  TYR B N     1 
ATOM   5562  C CA    . TYR B 2 547  ? 202.495 126.044 109.800 1.00 212.35 ? 539  TYR B CA    1 
ATOM   5563  C C     . TYR B 2 547  ? 201.870 125.182 110.890 1.00 212.35 ? 539  TYR B C     1 
ATOM   5564  O O     . TYR B 2 547  ? 201.132 125.686 111.745 1.00 212.35 ? 539  TYR B O     1 
ATOM   5565  C CB    . TYR B 2 547  ? 201.730 125.889 108.484 1.00 212.35 ? 539  TYR B CB    1 
ATOM   5566  N N     . THR B 2 548  ? 202.169 123.881 110.885 1.00 199.51 ? 540  THR B N     1 
ATOM   5567  C CA    . THR B 2 548  ? 201.732 123.014 111.971 1.00 199.51 ? 540  THR B CA    1 
ATOM   5568  C C     . THR B 2 548  ? 202.457 123.326 113.271 1.00 199.51 ? 540  THR B C     1 
ATOM   5569  O O     . THR B 2 548  ? 201.941 123.005 114.345 1.00 199.51 ? 540  THR B O     1 
ATOM   5570  C CB    . THR B 2 548  ? 201.947 121.548 111.597 1.00 199.51 ? 540  THR B CB    1 
ATOM   5571  N N     . SER B 2 549  ? 203.639 123.941 113.195 1.00 203.17 ? 541  SER B N     1 
ATOM   5572  C CA    . SER B 2 549  ? 204.311 124.407 114.401 1.00 203.17 ? 541  SER B CA    1 
ATOM   5573  C C     . SER B 2 549  ? 203.611 125.621 114.994 1.00 203.17 ? 541  SER B C     1 
ATOM   5574  O O     . SER B 2 549  ? 203.555 125.764 116.222 1.00 203.17 ? 541  SER B O     1 
ATOM   5575  C CB    . SER B 2 549  ? 205.773 124.730 114.095 1.00 203.17 ? 541  SER B CB    1 
ATOM   5576  N N     . ILE B 2 550  ? 203.075 126.503 114.148 1.00 205.96 ? 542  ILE B N     1 
ATOM   5577  C CA    . ILE B 2 550  ? 202.289 127.623 114.655 1.00 205.96 ? 542  ILE B CA    1 
ATOM   5578  C C     . ILE B 2 550  ? 200.939 127.142 115.171 1.00 205.96 ? 542  ILE B C     1 
ATOM   5579  O O     . ILE B 2 550  ? 200.384 127.716 116.121 1.00 205.96 ? 542  ILE B O     1 
ATOM   5580  C CB    . ILE B 2 550  ? 202.128 128.700 113.567 1.00 205.96 ? 542  ILE B CB    1 
ATOM   5581  N N     . SER B 2 551  ? 200.385 126.090 114.556 1.00 201.70 ? 543  SER B N     1 
ATOM   5582  C CA    . SER B 2 551  ? 199.184 125.462 115.098 1.00 201.70 ? 543  SER B CA    1 
ATOM   5583  C C     . SER B 2 551  ? 199.469 124.827 116.451 1.00 201.70 ? 543  SER B C     1 
ATOM   5584  O O     . SER B 2 551  ? 198.628 124.860 117.358 1.00 201.70 ? 543  SER B O     1 
ATOM   5585  C CB    . SER B 2 551  ? 198.647 124.422 114.116 1.00 201.70 ? 543  SER B CB    1 
ATOM   5586  N N     . ILE B 2 552  ? 200.672 124.271 116.613 1.00 200.27 ? 544  ILE B N     1 
ATOM   5587  C CA    . ILE B 2 552  ? 201.113 123.796 117.916 1.00 200.27 ? 544  ILE B CA    1 
ATOM   5588  C C     . ILE B 2 552  ? 201.419 124.953 118.855 1.00 200.27 ? 544  ILE B C     1 
ATOM   5589  O O     . ILE B 2 552  ? 201.513 124.750 120.069 1.00 200.27 ? 544  ILE B O     1 
ATOM   5590  C CB    . ILE B 2 552  ? 202.343 122.885 117.764 1.00 200.27 ? 544  ILE B CB    1 
ATOM   5591  N N     . PHE B 2 553  ? 201.721 126.100 118.252 1.00 180.39 ? 545  PHE B N     1 
ATOM   5592  C CA    . PHE B 2 553  ? 201.919 127.330 118.994 1.00 180.39 ? 545  PHE B CA    1 
ATOM   5593  C C     . PHE B 2 553  ? 200.559 127.686 119.591 1.00 180.39 ? 545  PHE B C     1 
ATOM   5594  O O     . PHE B 2 553  ? 200.471 128.125 120.730 1.00 180.39 ? 545  PHE B O     1 
ATOM   5595  C CB    . PHE B 2 553  ? 202.408 128.446 118.072 1.00 180.39 ? 545  PHE B CB    1 
ATOM   5596  N N     . MET B 2 554  ? 199.508 127.527 118.784 1.00 176.46 ? 546  MET B N     1 
ATOM   5597  C CA    . MET B 2 554  ? 198.133 127.771 119.204 1.00 176.46 ? 546  MET B CA    1 
ATOM   5598  C C     . MET B 2 554  ? 197.721 126.768 120.275 1.00 176.46 ? 546  MET B C     1 
ATOM   5599  O O     . MET B 2 554  ? 197.041 127.116 121.240 1.00 176.46 ? 546  MET B O     1 
ATOM   5600  C CB    . MET B 2 554  ? 197.186 127.686 118.009 1.00 176.46 ? 546  MET B CB    1 
ATOM   5601  N N     . ASN B 2 555  ? 198.125 125.511 120.084 1.00 183.16 ? 547  ASN B N     1 
ATOM   5602  C CA    . ASN B 2 555  ? 197.822 124.444 121.035 1.00 183.16 ? 547  ASN B CA    1 
ATOM   5603  C C     . ASN B 2 555  ? 198.494 124.737 122.369 1.00 183.16 ? 547  ASN B C     1 
ATOM   5604  O O     . ASN B 2 555  ? 197.910 124.549 123.436 1.00 183.16 ? 547  ASN B O     1 
ATOM   5605  C CB    . ASN B 2 555  ? 198.286 123.094 120.493 1.00 183.16 ? 547  ASN B CB    1 
ATOM   5606  N N     . THR B 2 556  ? 199.735 125.207 122.283 1.00 183.23 ? 548  THR B N     1 
ATOM   5607  C CA    . THR B 2 556  ? 200.533 125.602 123.439 1.00 183.23 ? 548  THR B CA    1 
ATOM   5608  C C     . THR B 2 556  ? 199.901 126.803 124.140 1.00 183.23 ? 548  THR B C     1 
ATOM   5609  O O     . THR B 2 556  ? 199.921 126.906 125.366 1.00 183.23 ? 548  THR B O     1 
ATOM   5610  C CB    . THR B 2 556  ? 201.977 125.955 123.036 1.00 183.23 ? 548  THR B CB    1 
ATOM   5611  N N     . ALA B 2 557  ? 199.343 127.706 123.340 1.00 178.22 ? 549  ALA B N     1 
ATOM   5612  C CA    . ALA B 2 557  ? 198.726 128.922 123.834 1.00 178.22 ? 549  ALA B CA    1 
ATOM   5613  C C     . ALA B 2 557  ? 197.578 128.611 124.777 1.00 178.22 ? 549  ALA B C     1 
ATOM   5614  O O     . ALA B 2 557  ? 197.448 129.279 125.803 1.00 178.22 ? 549  ALA B O     1 
ATOM   5615  C CB    . ALA B 2 557  ? 198.242 129.777 122.672 1.00 178.22 ? 549  ALA B CB    1 
ATOM   5616  N N     . ILE B 2 558  ? 196.738 127.623 124.476 1.00 160.91 ? 550  ILE B N     1 
ATOM   5617  C CA    . ILE B 2 558  ? 195.693 127.361 125.475 1.00 160.91 ? 550  ILE B CA    1 
ATOM   5618  C C     . ILE B 2 558  ? 196.268 126.938 126.837 1.00 160.91 ? 550  ILE B C     1 
ATOM   5619  O O     . ILE B 2 558  ? 195.711 127.352 127.874 1.00 160.91 ? 550  ILE B O     1 
ATOM   5620  C CB    . ILE B 2 558  ? 194.666 126.342 124.948 1.00 160.91 ? 550  ILE B CB    1 
ATOM   5621  N N     . PRO B 2 559  ? 197.358 126.150 126.939 1.00 166.00 ? 551  PRO B N     1 
ATOM   5622  C CA    . PRO B 2 559  ? 198.020 126.025 128.253 1.00 166.00 ? 551  PRO B CA    1 
ATOM   5623  C C     . PRO B 2 559  ? 198.686 127.297 128.760 1.00 166.00 ? 551  PRO B C     1 
ATOM   5624  O O     . PRO B 2 559  ? 199.137 127.304 129.911 1.00 166.00 ? 551  PRO B O     1 
ATOM   5625  C CB    . PRO B 2 559  ? 199.059 124.922 128.028 1.00 166.00 ? 551  PRO B CB    1 
ATOM   5626  C CG    . PRO B 2 559  ? 198.489 124.104 126.985 1.00 166.00 ? 551  PRO B CG    1 
ATOM   5627  C CD    . PRO B 2 559  ? 197.823 125.056 126.056 1.00 166.00 ? 551  PRO B CD    1 
ATOM   5628  N N     . ILE B 2 560  ? 198.816 128.320 127.924 1.00 164.75 ? 552  ILE B N     1 
ATOM   5629  C CA    . ILE B 2 560  ? 199.335 129.585 128.428 1.00 164.75 ? 552  ILE B CA    1 
ATOM   5630  C C     . ILE B 2 560  ? 198.294 130.083 129.439 1.00 164.75 ? 552  ILE B C     1 
ATOM   5631  O O     . ILE B 2 560  ? 198.627 130.520 130.546 1.00 164.75 ? 552  ILE B O     1 
ATOM   5632  C CB    . ILE B 2 560  ? 199.504 130.622 127.307 1.00 164.75 ? 552  ILE B CB    1 
ATOM   5633  N N     . ALA B 2 561  ? 197.023 129.981 129.043 1.00 145.17 ? 553  ALA B N     1 
ATOM   5634  C CA    . ALA B 2 561  ? 195.887 130.357 129.872 1.00 145.17 ? 553  ALA B CA    1 
ATOM   5635  C C     . ALA B 2 561  ? 195.826 129.438 131.081 1.00 145.17 ? 553  ALA B C     1 
ATOM   5636  O O     . ALA B 2 561  ? 195.531 129.873 132.190 1.00 145.17 ? 553  ALA B O     1 
ATOM   5637  C CB    . ALA B 2 561  ? 194.597 130.276 129.074 1.00 145.17 ? 553  ALA B CB    1 
ATOM   5638  N N     . ALA B 2 562  ? 196.096 128.155 130.851 1.00 130.77 ? 554  ALA B N     1 
ATOM   5639  C CA    . ALA B 2 562  ? 196.098 127.160 131.916 1.00 130.77 ? 554  ALA B CA    1 
ATOM   5640  C C     . ALA B 2 562  ? 197.186 127.496 132.927 1.00 130.77 ? 554  ALA B C     1 
ATOM   5641  O O     . ALA B 2 562  ? 196.976 127.399 134.136 1.00 130.77 ? 554  ALA B O     1 
ATOM   5642  C CB    . ALA B 2 562  ? 196.313 125.769 131.342 1.00 130.77 ? 554  ALA B CB    1 
ATOM   5643  N N     . VAL B 2 563  ? 198.349 127.908 132.424 1.00 149.54 ? 555  VAL B N     1 
ATOM   5644  C CA    . VAL B 2 563  ? 199.467 128.297 133.274 1.00 149.54 ? 555  VAL B CA    1 
ATOM   5645  C C     . VAL B 2 563  ? 199.079 129.517 134.102 1.00 149.54 ? 555  VAL B C     1 
ATOM   5646  O O     . VAL B 2 563  ? 199.403 129.606 135.285 1.00 149.54 ? 555  VAL B O     1 
ATOM   5647  C CB    . VAL B 2 563  ? 200.722 128.627 132.445 1.00 149.54 ? 555  VAL B CB    1 
ATOM   5648  N N     . LEU B 2 564  ? 198.380 130.459 133.469 1.00 143.06 ? 556  LEU B N     1 
ATOM   5649  C CA    . LEU B 2 564  ? 197.917 131.657 134.154 1.00 143.06 ? 556  LEU B CA    1 
ATOM   5650  C C     . LEU B 2 564  ? 196.937 131.293 135.270 1.00 143.06 ? 556  LEU B C     1 
ATOM   5651  O O     . LEU B 2 564  ? 196.975 131.880 136.352 1.00 143.06 ? 556  LEU B O     1 
ATOM   5652  C CB    . LEU B 2 564  ? 197.258 132.619 133.165 1.00 143.06 ? 556  LEU B CB    1 
ATOM   5653  N N     . ILE B 2 565  ? 196.065 130.324 135.003 1.00 124.61 ? 557  ILE B N     1 
ATOM   5654  C CA    . ILE B 2 565  ? 195.078 129.891 135.986 1.00 124.61 ? 557  ILE B CA    1 
ATOM   5655  C C     . ILE B 2 565  ? 195.780 129.327 137.214 1.00 124.61 ? 557  ILE B C     1 
ATOM   5656  O O     . ILE B 2 565  ? 195.385 129.603 138.347 1.00 124.61 ? 557  ILE B O     1 
ATOM   5657  C CB    . ILE B 2 565  ? 194.134 128.822 135.407 1.00 124.61 ? 557  ILE B CB    1 
ATOM   5658  N N     . THR B 2 566  ? 196.826 128.539 136.986 1.00 128.62 ? 558  THR B N     1 
ATOM   5659  C CA    . THR B 2 566  ? 197.610 127.983 138.088 1.00 128.62 ? 558  THR B CA    1 
ATOM   5660  C C     . THR B 2 566  ? 198.464 129.054 138.760 1.00 128.62 ? 558  THR B C     1 
ATOM   5661  O O     . THR B 2 566  ? 198.527 129.130 139.994 1.00 128.62 ? 558  THR B O     1 
ATOM   5662  C CB    . THR B 2 566  ? 198.486 126.836 137.584 1.00 128.62 ? 558  THR B CB    1 
ATOM   5663  N N     . PHE B 2 567  ? 199.126 129.894 137.959 1.00 138.43 ? 559  PHE B N     1 
ATOM   5664  C CA    . PHE B 2 567  ? 199.882 131.016 138.508 1.00 138.43 ? 559  PHE B CA    1 
ATOM   5665  C C     . PHE B 2 567  ? 198.961 132.073 139.098 1.00 138.43 ? 559  PHE B C     1 
ATOM   5666  O O     . PHE B 2 567  ? 199.358 132.799 140.018 1.00 138.43 ? 559  PHE B O     1 
ATOM   5667  C CB    . PHE B 2 567  ? 200.766 131.622 137.418 1.00 138.43 ? 559  PHE B CB    1 
ATOM   5668  C CG    . PHE B 2 567  ? 201.591 132.794 137.877 1.00 138.43 ? 559  PHE B CG    1 
ATOM   5669  C CD1   . PHE B 2 567  ? 202.696 132.604 138.693 1.00 138.43 ? 559  PHE B CD1   1 
ATOM   5670  C CD2   . PHE B 2 567  ? 201.269 134.084 137.476 1.00 138.43 ? 559  PHE B CD2   1 
ATOM   5671  C CE1   . PHE B 2 567  ? 203.462 133.681 139.109 1.00 138.43 ? 559  PHE B CE1   1 
ATOM   5672  C CE2   . PHE B 2 567  ? 202.032 135.164 137.888 1.00 138.43 ? 559  PHE B CE2   1 
ATOM   5673  C CZ    . PHE B 2 567  ? 203.130 134.963 138.707 1.00 138.43 ? 559  PHE B CZ    1 
ATOM   5674  N N     . VAL B 2 568  ? 197.733 132.164 138.587 1.00 134.40 ? 560  VAL B N     1 
ATOM   5675  C CA    . VAL B 2 568  ? 196.766 133.127 139.100 1.00 134.40 ? 560  VAL B CA    1 
ATOM   5676  C C     . VAL B 2 568  ? 196.328 132.743 140.508 1.00 134.40 ? 560  VAL B C     1 
ATOM   5677  O O     . VAL B 2 568  ? 196.366 133.563 141.433 1.00 134.40 ? 560  VAL B O     1 
ATOM   5678  C CB    . VAL B 2 568  ? 195.566 133.229 138.144 1.00 134.40 ? 560  VAL B CB    1 
ATOM   5679  N N     . GLY B 2 569  ? 195.912 131.488 140.692 1.00 118.12 ? 561  GLY B N     1 
ATOM   5680  C CA    . GLY B 2 569  ? 195.493 131.051 142.013 1.00 118.12 ? 561  GLY B CA    1 
ATOM   5681  C C     . GLY B 2 569  ? 196.655 130.900 142.976 1.00 118.12 ? 561  GLY B C     1 
ATOM   5682  O O     . GLY B 2 569  ? 196.509 131.134 144.180 1.00 118.12 ? 561  GLY B O     1 
ATOM   5683  N N     . HIS B 2 570  ? 197.825 130.522 142.461 1.00 122.24 ? 562  HIS B N     1 
ATOM   5684  C CA    . HIS B 2 570  ? 198.989 130.330 143.318 1.00 122.24 ? 562  HIS B CA    1 
ATOM   5685  C C     . HIS B 2 570  ? 199.544 131.662 143.805 1.00 122.24 ? 562  HIS B C     1 
ATOM   5686  O O     . HIS B 2 570  ? 199.696 131.879 145.013 1.00 122.24 ? 562  HIS B O     1 
ATOM   5687  C CB    . HIS B 2 570  ? 200.065 129.546 142.566 1.00 122.24 ? 562  HIS B CB    1 
ATOM   5688  N N     . VAL B 2 571  ? 199.848 132.569 142.874 1.00 149.08 ? 563  VAL B N     1 
ATOM   5689  C CA    . VAL B 2 571  ? 200.462 133.842 143.242 1.00 149.08 ? 563  VAL B CA    1 
ATOM   5690  C C     . VAL B 2 571  ? 199.435 134.767 143.880 1.00 149.08 ? 563  VAL B C     1 
ATOM   5691  O O     . VAL B 2 571  ? 199.739 135.477 144.849 1.00 149.08 ? 563  VAL B O     1 
ATOM   5692  C CB    . VAL B 2 571  ? 201.125 134.490 142.014 1.00 149.08 ? 563  VAL B CB    1 
ATOM   5693  N N     . SER B 2 572  ? 198.204 134.770 143.357 1.00 151.08 ? 564  SER B N     1 
ATOM   5694  C CA    . SER B 2 572  ? 197.130 135.531 143.984 1.00 151.08 ? 564  SER B CA    1 
ATOM   5695  C C     . SER B 2 572  ? 196.728 134.944 145.328 1.00 151.08 ? 564  SER B C     1 
ATOM   5696  O O     . SER B 2 572  ? 196.165 135.660 146.163 1.00 151.08 ? 564  SER B O     1 
ATOM   5697  C CB    . SER B 2 572  ? 195.914 135.599 143.058 1.00 151.08 ? 564  SER B CB    1 
ATOM   5698  N N     . PHE B 2 573  ? 197.003 133.660 145.556 1.00 139.60 ? 565  PHE B N     1 
ATOM   5699  C CA    . PHE B 2 573  ? 196.836 133.104 146.889 1.00 139.60 ? 565  PHE B CA    1 
ATOM   5700  C C     . PHE B 2 573  ? 197.973 133.522 147.810 1.00 139.60 ? 565  PHE B C     1 
ATOM   5701  O O     . PHE B 2 573  ? 197.753 133.757 149.003 1.00 139.60 ? 565  PHE B O     1 
ATOM   5702  C CB    . PHE B 2 573  ? 196.746 131.583 146.821 1.00 139.60 ? 565  PHE B CB    1 
ATOM   5703  C CG    . PHE B 2 573  ? 196.546 130.936 148.156 1.00 139.60 ? 565  PHE B CG    1 
ATOM   5704  C CD1   . PHE B 2 573  ? 195.317 131.002 148.791 1.00 139.60 ? 565  PHE B CD1   1 
ATOM   5705  C CD2   . PHE B 2 573  ? 197.587 130.264 148.782 1.00 139.60 ? 565  PHE B CD2   1 
ATOM   5706  C CE1   . PHE B 2 573  ? 195.126 130.410 150.023 1.00 139.60 ? 565  PHE B CE1   1 
ATOM   5707  C CE2   . PHE B 2 573  ? 197.404 129.671 150.016 1.00 139.60 ? 565  PHE B CE2   1 
ATOM   5708  C CZ    . PHE B 2 573  ? 196.170 129.744 150.637 1.00 139.60 ? 565  PHE B CZ    1 
ATOM   5709  N N     . PHE B 2 574  ? 199.194 133.620 147.282 1.00 112.46 ? 566  PHE B N     1 
ATOM   5710  C CA    . PHE B 2 574  ? 200.338 133.862 148.151 1.00 112.46 ? 566  PHE B CA    1 
ATOM   5711  C C     . PHE B 2 574  ? 200.497 135.332 148.517 1.00 112.46 ? 566  PHE B C     1 
ATOM   5712  O O     . PHE B 2 574  ? 200.980 135.638 149.614 1.00 112.46 ? 566  PHE B O     1 
ATOM   5713  C CB    . PHE B 2 574  ? 201.621 133.346 147.501 1.00 112.46 ? 566  PHE B CB    1 
ATOM   5714  C CG    . PHE B 2 574  ? 202.832 133.514 148.365 1.00 112.46 ? 566  PHE B CG    1 
ATOM   5715  C CD1   . PHE B 2 574  ? 203.004 132.731 149.495 1.00 112.46 ? 566  PHE B CD1   1 
ATOM   5716  C CD2   . PHE B 2 574  ? 203.794 134.463 148.057 1.00 112.46 ? 566  PHE B CD2   1 
ATOM   5717  C CE1   . PHE B 2 574  ? 204.113 132.884 150.302 1.00 112.46 ? 566  PHE B CE1   1 
ATOM   5718  C CE2   . PHE B 2 574  ? 204.908 134.623 148.859 1.00 112.46 ? 566  PHE B CE2   1 
ATOM   5719  C CZ    . PHE B 2 574  ? 205.066 133.831 149.984 1.00 112.46 ? 566  PHE B CZ    1 
ATOM   5720  N N     . LYS B 2 575  ? 200.110 136.250 147.628 1.00 117.57 ? 567  LYS B N     1 
ATOM   5721  C CA    . LYS B 2 575  ? 200.230 137.669 147.949 1.00 117.57 ? 567  LYS B CA    1 
ATOM   5722  C C     . LYS B 2 575  ? 199.241 138.087 149.030 1.00 117.57 ? 567  LYS B C     1 
ATOM   5723  O O     . LYS B 2 575  ? 199.580 138.900 149.898 1.00 117.57 ? 567  LYS B O     1 
ATOM   5724  C CB    . LYS B 2 575  ? 200.028 138.512 146.691 1.00 117.57 ? 567  LYS B CB    1 
ATOM   5725  N N     . GLU B 2 576  ? 198.032 137.542 149.001 1.00 130.75 ? 568  GLU B N     1 
ATOM   5726  C CA    . GLU B 2 576  ? 197.019 137.834 149.999 1.00 130.75 ? 568  GLU B CA    1 
ATOM   5727  C C     . GLU B 2 576  ? 197.104 136.814 151.132 1.00 130.75 ? 568  GLU B C     1 
ATOM   5728  O O     . GLU B 2 576  ? 198.051 136.028 151.223 1.00 130.75 ? 568  GLU B O     1 
ATOM   5729  C CB    . GLU B 2 576  ? 195.634 137.854 149.353 1.00 130.75 ? 568  GLU B CB    1 
ATOM   5730  N N     . SER B 2 577  ? 196.111 136.827 152.016 1.00 143.76 ? 569  SER B N     1 
ATOM   5731  C CA    . SER B 2 577  ? 196.076 135.934 153.170 1.00 143.76 ? 569  SER B CA    1 
ATOM   5732  C C     . SER B 2 577  ? 194.672 135.368 153.366 1.00 143.76 ? 569  SER B C     1 
ATOM   5733  O O     . SER B 2 577  ? 194.139 135.337 154.476 1.00 143.76 ? 569  SER B O     1 
ATOM   5734  C CB    . SER B 2 577  ? 196.559 136.656 154.424 1.00 143.76 ? 569  SER B CB    1 
ATOM   5735  N N     . ASP B 2 578  ? 194.047 134.916 152.279 1.00 142.32 ? 570  ASP B N     1 
ATOM   5736  C CA    . ASP B 2 578  ? 192.714 134.331 152.367 1.00 142.32 ? 570  ASP B CA    1 
ATOM   5737  C C     . ASP B 2 578  ? 192.538 133.253 151.304 1.00 142.32 ? 570  ASP B C     1 
ATOM   5738  O O     . ASP B 2 578  ? 193.217 133.247 150.274 1.00 142.32 ? 570  ASP B O     1 
ATOM   5739  C CB    . ASP B 2 578  ? 191.623 135.404 152.246 1.00 142.32 ? 570  ASP B CB    1 
ATOM   5740  C CG    . ASP B 2 578  ? 191.757 136.254 150.990 1.00 142.32 ? 570  ASP B CG    1 
ATOM   5741  O OD1   . ASP B 2 578  ? 192.773 136.135 150.273 1.00 142.32 ? 570  ASP B OD1   1 
ATOM   5742  O OD2   . ASP B 2 578  ? 190.830 137.044 150.712 1.00 142.32 ? 570  ASP B OD2   1 
ATOM   5743  N N     . LEU B 2 579  ? 191.609 132.335 151.574 1.00 102.75 ? 571  LEU B N     1 
ATOM   5744  C CA    . LEU B 2 579  ? 191.278 131.237 150.674 1.00 102.75 ? 571  LEU B CA    1 
ATOM   5745  C C     . LEU B 2 579  ? 189.770 131.189 150.476 1.00 102.75 ? 571  LEU B C     1 
ATOM   5746  O O     . LEU B 2 579  ? 189.007 131.440 151.412 1.00 102.75 ? 571  LEU B O     1 
ATOM   5747  C CB    . LEU B 2 579  ? 191.774 129.895 151.222 1.00 102.75 ? 571  LEU B CB    1 
ATOM   5748  N N     . SER B 2 580  ? 189.344 130.866 149.253 1.00 77.01  ? 572  SER B N     1 
ATOM   5749  C CA    . SER B 2 580  ? 187.928 130.824 148.914 1.00 77.01  ? 572  SER B CA    1 
ATOM   5750  C C     . SER B 2 580  ? 187.737 129.911 147.715 1.00 77.01  ? 572  SER B C     1 
ATOM   5751  O O     . SER B 2 580  ? 188.648 129.776 146.895 1.00 77.01  ? 572  SER B O     1 
ATOM   5752  C CB    . SER B 2 580  ? 187.386 132.227 148.600 1.00 77.01  ? 572  SER B CB    1 
ATOM   5753  O OG    . SER B 2 580  ? 187.394 133.057 149.747 1.00 77.01  ? 572  SER B OG    1 
ATOM   5754  N N     . PRO B 2 581  ? 186.564 129.271 147.581 1.00 58.26  ? 573  PRO B N     1 
ATOM   5755  C CA    . PRO B 2 581  ? 186.277 128.492 146.367 1.00 58.26  ? 573  PRO B CA    1 
ATOM   5756  C C     . PRO B 2 581  ? 185.664 129.329 145.256 1.00 58.26  ? 573  PRO B C     1 
ATOM   5757  O O     . PRO B 2 581  ? 185.104 128.792 144.299 1.00 58.26  ? 573  PRO B O     1 
ATOM   5758  C CB    . PRO B 2 581  ? 185.290 127.431 146.864 1.00 58.26  ? 573  PRO B CB    1 
ATOM   5759  C CG    . PRO B 2 581  ? 184.578 128.105 147.980 1.00 58.26  ? 573  PRO B CG    1 
ATOM   5760  C CD    . PRO B 2 581  ? 185.588 128.997 148.651 1.00 58.26  ? 573  PRO B CD    1 
ATOM   5761  N N     . SER B 2 582  ? 185.756 130.651 145.381 1.00 64.96  ? 574  SER B N     1 
ATOM   5762  C CA    . SER B 2 582  ? 185.099 131.543 144.434 1.00 64.96  ? 574  SER B CA    1 
ATOM   5763  C C     . SER B 2 582  ? 185.850 131.608 143.111 1.00 64.96  ? 574  SER B C     1 
ATOM   5764  O O     . SER B 2 582  ? 185.305 131.270 142.052 1.00 64.96  ? 574  SER B O     1 
ATOM   5765  C CB    . SER B 2 582  ? 184.985 132.937 145.046 1.00 64.96  ? 574  SER B CB    1 
ATOM   5766  N N     . VAL B 2 583  ? 187.112 132.045 143.159 1.00 75.62  ? 575  VAL B N     1 
ATOM   5767  C CA    . VAL B 2 583  ? 187.836 132.417 141.951 1.00 75.62  ? 575  VAL B CA    1 
ATOM   5768  C C     . VAL B 2 583  ? 188.250 131.211 141.121 1.00 75.62  ? 575  VAL B C     1 
ATOM   5769  O O     . VAL B 2 583  ? 188.604 131.370 139.948 1.00 75.62  ? 575  VAL B O     1 
ATOM   5770  C CB    . VAL B 2 583  ? 189.069 133.266 142.308 1.00 75.62  ? 575  VAL B CB    1 
ATOM   5771  N N     . ALA B 2 584  ? 188.224 130.008 141.693 1.00 70.73  ? 576  ALA B N     1 
ATOM   5772  C CA    . ALA B 2 584  ? 188.550 128.819 140.916 1.00 70.73  ? 576  ALA B CA    1 
ATOM   5773  C C     . ALA B 2 584  ? 187.457 128.527 139.897 1.00 70.73  ? 576  ALA B C     1 
ATOM   5774  O O     . ALA B 2 584  ? 187.709 128.520 138.686 1.00 70.73  ? 576  ALA B O     1 
ATOM   5775  C CB    . ALA B 2 584  ? 188.767 127.625 141.845 1.00 70.73  ? 576  ALA B CB    1 
ATOM   5776  N N     . PHE B 2 585  ? 186.227 128.311 140.370 1.00 71.02  ? 577  PHE B N     1 
ATOM   5777  C CA    . PHE B 2 585  ? 185.112 128.040 139.470 1.00 71.02  ? 577  PHE B CA    1 
ATOM   5778  C C     . PHE B 2 585  ? 184.747 129.281 138.667 1.00 71.02  ? 577  PHE B C     1 
ATOM   5779  O O     . PHE B 2 585  ? 184.626 129.228 137.435 1.00 71.02  ? 577  PHE B O     1 
ATOM   5780  C CB    . PHE B 2 585  ? 183.902 127.560 140.271 1.00 71.02  ? 577  PHE B CB    1 
ATOM   5781  C CG    . PHE B 2 585  ? 184.141 126.294 141.037 1.00 71.02  ? 577  PHE B CG    1 
ATOM   5782  C CD1   . PHE B 2 585  ? 184.101 125.063 140.405 1.00 71.02  ? 577  PHE B CD1   1 
ATOM   5783  C CD2   . PHE B 2 585  ? 184.392 126.338 142.400 1.00 71.02  ? 577  PHE B CD2   1 
ATOM   5784  C CE1   . PHE B 2 585  ? 184.320 123.897 141.116 1.00 71.02  ? 577  PHE B CE1   1 
ATOM   5785  C CE2   . PHE B 2 585  ? 184.609 125.179 143.117 1.00 71.02  ? 577  PHE B CE2   1 
ATOM   5786  C CZ    . PHE B 2 585  ? 184.571 123.954 142.474 1.00 71.02  ? 577  PHE B CZ    1 
ATOM   5787  N N     . ALA B 2 586  ? 184.595 130.415 139.355 1.00 70.63  ? 578  ALA B N     1 
ATOM   5788  C CA    . ALA B 2 586  ? 184.122 131.631 138.708 1.00 70.63  ? 578  ALA B CA    1 
ATOM   5789  C C     . ALA B 2 586  ? 185.193 132.236 137.814 1.00 70.63  ? 578  ALA B C     1 
ATOM   5790  O O     . ALA B 2 586  ? 184.930 132.582 136.654 1.00 70.63  ? 578  ALA B O     1 
ATOM   5791  C CB    . ALA B 2 586  ? 183.671 132.637 139.765 1.00 70.63  ? 578  ALA B CB    1 
ATOM   5792  N N     . SER B 2 587  ? 186.410 132.380 138.338 1.00 73.91  ? 579  SER B N     1 
ATOM   5793  C CA    . SER B 2 587  ? 187.467 132.966 137.528 1.00 73.91  ? 579  SER B CA    1 
ATOM   5794  C C     . SER B 2 587  ? 187.954 131.994 136.465 1.00 73.91  ? 579  SER B C     1 
ATOM   5795  O O     . SER B 2 587  ? 188.446 132.433 135.424 1.00 73.91  ? 579  SER B O     1 
ATOM   5796  C CB    . SER B 2 587  ? 188.629 133.425 138.406 1.00 73.91  ? 579  SER B CB    1 
ATOM   5797  N N     . LEU B 2 588  ? 187.737 130.695 136.621 1.00 71.72  ? 580  LEU B N     1 
ATOM   5798  C CA    . LEU B 2 588  ? 188.060 129.788 135.515 1.00 71.72  ? 580  LEU B CA    1 
ATOM   5799  C C     . LEU B 2 588  ? 187.109 130.135 134.339 1.00 71.72  ? 580  LEU B C     1 
ATOM   5800  O O     . LEU B 2 588  ? 187.496 130.196 133.147 1.00 71.72  ? 580  LEU B O     1 
ATOM   5801  C CB    . LEU B 2 588  ? 187.883 128.331 135.937 1.00 71.72  ? 580  LEU B CB    1 
ATOM   5802  N N     . SER B 2 589  ? 185.857 130.408 134.712 1.00 79.58  ? 581  SER B N     1 
ATOM   5803  C CA    . SER B 2 589  ? 184.786 130.755 133.779 1.00 79.58  ? 581  SER B CA    1 
ATOM   5804  C C     . SER B 2 589  ? 185.115 132.036 133.028 1.00 79.58  ? 581  SER B C     1 
ATOM   5805  O O     . SER B 2 589  ? 184.837 132.156 131.835 1.00 79.58  ? 581  SER B O     1 
ATOM   5806  C CB    . SER B 2 589  ? 183.458 130.907 134.523 1.00 79.58  ? 581  SER B CB    1 
ATOM   5807  N N     . LEU B 2 590  ? 185.708 132.998 133.733 1.00 81.32  ? 582  LEU B N     1 
ATOM   5808  C CA    . LEU B 2 590  ? 186.128 134.259 133.130 1.00 81.32  ? 582  LEU B CA    1 
ATOM   5809  C C     . LEU B 2 590  ? 187.195 133.989 132.067 1.00 81.32  ? 582  LEU B C     1 
ATOM   5810  O O     . LEU B 2 590  ? 187.188 134.598 130.998 1.00 81.32  ? 582  LEU B O     1 
ATOM   5811  C CB    . LEU B 2 590  ? 186.672 135.211 134.196 1.00 81.32  ? 582  LEU B CB    1 
ATOM   5812  N N     . PHE B 2 591  ? 188.108 133.066 132.372 1.00 84.71  ? 583  PHE B N     1 
ATOM   5813  C CA    . PHE B 2 591  ? 189.159 132.668 131.449 1.00 84.71  ? 583  PHE B CA    1 
ATOM   5814  C C     . PHE B 2 591  ? 188.561 132.046 130.187 1.00 84.71  ? 583  PHE B C     1 
ATOM   5815  O O     . PHE B 2 591  ? 189.072 132.273 129.090 1.00 84.71  ? 583  PHE B O     1 
ATOM   5816  C CB    . PHE B 2 591  ? 190.143 131.705 132.118 1.00 84.71  ? 583  PHE B CB    1 
ATOM   5817  N N     . HIS B 2 592  ? 187.485 131.267 130.320 1.00 59.91  ? 584  HIS B N     1 
ATOM   5818  C CA    . HIS B 2 592  ? 186.892 130.668 129.110 1.00 59.91  ? 584  HIS B CA    1 
ATOM   5819  C C     . HIS B 2 592  ? 186.424 131.745 128.105 1.00 59.91  ? 584  HIS B C     1 
ATOM   5820  O O     . HIS B 2 592  ? 186.645 131.626 126.901 1.00 59.91  ? 584  HIS B O     1 
ATOM   5821  C CB    . HIS B 2 592  ? 185.727 129.750 129.482 1.00 59.91  ? 584  HIS B CB    1 
ATOM   5822  N N     . ILE B 2 593  ? 185.783 132.787 128.627 1.00 57.85  ? 585  ILE B N     1 
ATOM   5823  C CA    . ILE B 2 593  ? 185.320 133.965 127.901 1.00 57.85  ? 585  ILE B CA    1 
ATOM   5824  C C     . ILE B 2 593  ? 186.440 134.662 127.131 1.00 57.85  ? 585  ILE B C     1 
ATOM   5825  O O     . ILE B 2 593  ? 186.245 135.128 126.008 1.00 57.85  ? 585  ILE B O     1 
ATOM   5826  C CB    . ILE B 2 593  ? 184.656 134.983 128.850 1.00 57.85  ? 585  ILE B CB    1 
ATOM   5827  N N     . LEU B 2 594  ? 187.614 134.728 127.748 1.00 71.81  ? 586  LEU B N     1 
ATOM   5828  C CA    . LEU B 2 594  ? 188.782 135.386 127.166 1.00 71.81  ? 586  LEU B CA    1 
ATOM   5829  C C     . LEU B 2 594  ? 189.303 134.778 125.861 1.00 71.81  ? 586  LEU B C     1 
ATOM   5830  O O     . LEU B 2 594  ? 189.719 135.504 124.958 1.00 71.81  ? 586  LEU B O     1 
ATOM   5831  C CB    . LEU B 2 594  ? 189.917 135.453 128.192 1.00 71.81  ? 586  LEU B CB    1 
ATOM   5832  N N     . VAL B 2 595  ? 189.280 133.454 125.763 1.00 89.65  ? 587  VAL B N     1 
ATOM   5833  C CA    . VAL B 2 595  ? 189.806 132.769 124.582 1.00 89.65  ? 587  VAL B CA    1 
ATOM   5834  C C     . VAL B 2 595  ? 189.101 133.118 123.272 1.00 89.65  ? 587  VAL B C     1 
ATOM   5835  O O     . VAL B 2 595  ? 189.754 133.284 122.241 1.00 89.65  ? 587  VAL B O     1 
ATOM   5836  C CB    . VAL B 2 595  ? 189.772 131.240 124.765 1.00 89.65  ? 587  VAL B CB    1 
ATOM   5837  N N     . THR B 2 596  ? 187.779 133.233 123.304 1.00 85.95  ? 588  THR B N     1 
ATOM   5838  C CA    . THR B 2 596  ? 187.025 133.555 122.095 1.00 85.95  ? 588  THR B CA    1 
ATOM   5839  C C     . THR B 2 596  ? 187.406 134.928 121.549 1.00 85.95  ? 588  THR B C     1 
ATOM   5840  O O     . THR B 2 596  ? 187.538 135.115 120.339 1.00 85.95  ? 588  THR B O     1 
ATOM   5841  C CB    . THR B 2 596  ? 185.507 133.518 122.353 1.00 85.95  ? 588  THR B CB    1 
ATOM   5842  N N     . PRO B 2 597  ? 187.586 135.881 122.455 1.00 98.47  ? 589  PRO B N     1 
ATOM   5843  C CA    . PRO B 2 597  ? 187.949 137.269 122.102 1.00 98.47  ? 589  PRO B CA    1 
ATOM   5844  C C     . PRO B 2 597  ? 189.425 137.480 121.812 1.00 98.47  ? 589  PRO B C     1 
ATOM   5845  O O     . PRO B 2 597  ? 189.768 138.485 121.177 1.00 98.47  ? 589  PRO B O     1 
ATOM   5846  C CB    . PRO B 2 597  ? 187.512 138.076 123.331 1.00 98.47  ? 589  PRO B CB    1 
ATOM   5847  C CG    . PRO B 2 597  ? 186.466 137.285 123.945 1.00 98.47  ? 589  PRO B CG    1 
ATOM   5848  C CD    . PRO B 2 597  ? 186.894 135.874 123.763 1.00 98.47  ? 589  PRO B CD    1 
ATOM   5849  N N     . LEU B 2 598  ? 190.308 136.579 122.243 1.00 110.39 ? 590  LEU B N     1 
ATOM   5850  C CA    . LEU B 2 598  ? 191.729 136.756 121.964 1.00 110.39 ? 590  LEU B CA    1 
ATOM   5851  C C     . LEU B 2 598  ? 192.038 136.466 120.499 1.00 110.39 ? 590  LEU B C     1 
ATOM   5852  O O     . LEU B 2 598  ? 192.459 137.356 119.746 1.00 110.39 ? 590  LEU B O     1 
ATOM   5853  C CB    . LEU B 2 598  ? 192.550 135.850 122.883 1.00 110.39 ? 590  LEU B CB    1 
ATOM   5854  N N     . PHE B 2 599  ? 191.812 135.222 120.075 1.00 113.05 ? 591  PHE B N     1 
ATOM   5855  C CA    . PHE B 2 599  ? 192.124 134.844 118.703 1.00 113.05 ? 591  PHE B CA    1 
ATOM   5856  C C     . PHE B 2 599  ? 191.121 135.435 117.722 1.00 113.05 ? 591  PHE B C     1 
ATOM   5857  O O     . PHE B 2 599  ? 191.457 135.673 116.557 1.00 113.05 ? 591  PHE B O     1 
ATOM   5858  C CB    . PHE B 2 599  ? 192.175 133.324 118.586 1.00 113.05 ? 591  PHE B CB    1 
ATOM   5859  C CG    . PHE B 2 599  ? 193.281 132.697 119.386 1.00 113.05 ? 591  PHE B CG    1 
ATOM   5860  C CD1   . PHE B 2 599  ? 194.581 132.686 118.905 1.00 113.05 ? 591  PHE B CD1   1 
ATOM   5861  C CD2   . PHE B 2 599  ? 193.024 132.128 120.623 1.00 113.05 ? 591  PHE B CD2   1 
ATOM   5862  C CE1   . PHE B 2 599  ? 195.603 132.114 119.641 1.00 113.05 ? 591  PHE B CE1   1 
ATOM   5863  C CE2   . PHE B 2 599  ? 194.041 131.552 121.364 1.00 113.05 ? 591  PHE B CE2   1 
ATOM   5864  C CZ    . PHE B 2 599  ? 195.332 131.546 120.871 1.00 113.05 ? 591  PHE B CZ    1 
ATOM   5865  N N     . LEU B 2 600  ? 189.897 135.691 118.181 1.00 96.68  ? 592  LEU B N     1 
ATOM   5866  C CA    . LEU B 2 600  ? 188.963 136.454 117.365 1.00 96.68  ? 592  LEU B CA    1 
ATOM   5867  C C     . LEU B 2 600  ? 189.366 137.920 117.289 1.00 96.68  ? 592  LEU B C     1 
ATOM   5868  O O     . LEU B 2 600  ? 189.013 138.607 116.325 1.00 96.68  ? 592  LEU B O     1 
ATOM   5869  C CB    . LEU B 2 600  ? 187.547 136.319 117.920 1.00 96.68  ? 592  LEU B CB    1 
ATOM   5870  N N     . LEU B 2 601  ? 190.094 138.416 118.291 1.00 96.07  ? 593  LEU B N     1 
ATOM   5871  C CA    . LEU B 2 601  ? 190.541 139.803 118.258 1.00 96.07  ? 593  LEU B CA    1 
ATOM   5872  C C     . LEU B 2 601  ? 191.688 139.982 117.277 1.00 96.07  ? 593  LEU B C     1 
ATOM   5873  O O     . LEU B 2 601  ? 191.684 140.920 116.469 1.00 96.07  ? 593  LEU B O     1 
ATOM   5874  C CB    . LEU B 2 601  ? 190.953 140.263 119.656 1.00 96.07  ? 593  LEU B CB    1 
ATOM   5875  N N     . SER B 2 602  ? 192.684 139.095 117.332 1.00 103.15 ? 594  SER B N     1 
ATOM   5876  C CA    . SER B 2 602  ? 193.787 139.188 116.378 1.00 103.15 ? 594  SER B CA    1 
ATOM   5877  C C     . SER B 2 602  ? 193.331 138.810 114.974 1.00 103.15 ? 594  SER B C     1 
ATOM   5878  O O     . SER B 2 602  ? 193.798 139.390 113.983 1.00 103.15 ? 594  SER B O     1 
ATOM   5879  C CB    . SER B 2 602  ? 194.946 138.298 116.826 1.00 103.15 ? 594  SER B CB    1 
ATOM   5880  N N     . SER B 2 603  ? 192.408 137.848 114.878 1.00 96.62  ? 595  SER B N     1 
ATOM   5881  C CA    . SER B 2 603  ? 191.815 137.506 113.590 1.00 96.62  ? 595  SER B CA    1 
ATOM   5882  C C     . SER B 2 603  ? 190.978 138.653 113.042 1.00 96.62  ? 595  SER B C     1 
ATOM   5883  O O     . SER B 2 603  ? 190.897 138.837 111.823 1.00 96.62  ? 595  SER B O     1 
ATOM   5884  C CB    . SER B 2 603  ? 190.967 136.240 113.725 1.00 96.62  ? 595  SER B CB    1 
ATOM   5885  N N     . VAL B 2 604  ? 190.366 139.442 113.927 1.00 74.71  ? 596  VAL B N     1 
ATOM   5886  C CA    . VAL B 2 604  ? 189.668 140.642 113.497 1.00 74.71  ? 596  VAL B CA    1 
ATOM   5887  C C     . VAL B 2 604  ? 190.648 141.740 113.126 1.00 74.71  ? 596  VAL B C     1 
ATOM   5888  O O     . VAL B 2 604  ? 190.305 142.632 112.343 1.00 74.71  ? 596  VAL B O     1 
ATOM   5889  C CB    . VAL B 2 604  ? 188.707 141.124 114.594 1.00 74.71  ? 596  VAL B CB    1 
ATOM   5890  N N     . VAL B 2 605  ? 191.860 141.704 113.679 1.00 75.73  ? 597  VAL B N     1 
ATOM   5891  C CA    . VAL B 2 605  ? 192.866 142.702 113.335 1.00 75.73  ? 597  VAL B CA    1 
ATOM   5892  C C     . VAL B 2 605  ? 193.396 142.454 111.930 1.00 75.73  ? 597  VAL B C     1 
ATOM   5893  O O     . VAL B 2 605  ? 193.451 143.369 111.098 1.00 75.73  ? 597  VAL B O     1 
ATOM   5894  C CB    . VAL B 2 605  ? 194.002 142.701 114.373 1.00 75.73  ? 597  VAL B CB    1 
ATOM   5895  N N     . ARG B 2 606  ? 193.781 141.207 111.641 1.00 68.22  ? 598  ARG B N     1 
ATOM   5896  C CA    . ARG B 2 606  ? 194.199 140.879 110.283 1.00 68.22  ? 598  ARG B CA    1 
ATOM   5897  C C     . ARG B 2 606  ? 193.025 140.926 109.315 1.00 68.22  ? 598  ARG B C     1 
ATOM   5898  O O     . ARG B 2 606  ? 193.217 141.172 108.118 1.00 68.22  ? 598  ARG B O     1 
ATOM   5899  C CB    . ARG B 2 606  ? 194.877 139.511 110.258 1.00 68.22  ? 598  ARG B CB    1 
ATOM   5900  C CG    . ARG B 2 606  ? 193.988 138.370 110.687 1.00 68.22  ? 598  ARG B CG    1 
ATOM   5901  C CD    . ARG B 2 606  ? 194.734 137.060 110.669 1.00 68.22  ? 598  ARG B CD    1 
ATOM   5902  N NE    . ARG B 2 606  ? 195.103 136.668 109.314 1.00 68.22  ? 598  ARG B NE    1 
ATOM   5903  C CZ    . ARG B 2 606  ? 194.305 136.004 108.486 1.00 68.22  ? 598  ARG B CZ    1 
ATOM   5904  N NH1   . ARG B 2 606  ? 193.087 135.653 108.873 1.00 68.22  ? 598  ARG B NH1   1 
ATOM   5905  N NH2   . ARG B 2 606  ? 194.725 135.687 107.269 1.00 68.22  ? 598  ARG B NH2   1 
ATOM   5906  N N     . SER B 2 607  ? 191.804 140.727 109.822 1.00 68.29  ? 599  SER B N     1 
ATOM   5907  C CA    . SER B 2 607  ? 190.617 140.951 109.013 1.00 68.29  ? 599  SER B CA    1 
ATOM   5908  C C     . SER B 2 607  ? 190.429 142.429 108.707 1.00 68.29  ? 599  SER B C     1 
ATOM   5909  O O     . SER B 2 607  ? 189.874 142.778 107.660 1.00 68.29  ? 599  SER B O     1 
ATOM   5910  C CB    . SER B 2 607  ? 189.386 140.396 109.728 1.00 68.29  ? 599  SER B CB    1 
ATOM   5911  N N     . THR B 2 608  ? 190.876 143.306 109.601 1.00 65.10  ? 600  THR B N     1 
ATOM   5912  C CA    . THR B 2 608  ? 190.804 144.734 109.329 1.00 65.10  ? 600  THR B CA    1 
ATOM   5913  C C     . THR B 2 608  ? 191.887 145.176 108.360 1.00 65.10  ? 600  THR B C     1 
ATOM   5914  O O     . THR B 2 608  ? 191.656 146.084 107.552 1.00 65.10  ? 600  THR B O     1 
ATOM   5915  C CB    . THR B 2 608  ? 190.914 145.527 110.630 1.00 65.10  ? 600  THR B CB    1 
ATOM   5916  N N     . VAL B 2 609  ? 193.070 144.560 108.436 1.00 67.56  ? 601  VAL B N     1 
ATOM   5917  C CA    . VAL B 2 609  ? 194.129 144.871 107.480 1.00 67.56  ? 601  VAL B CA    1 
ATOM   5918  C C     . VAL B 2 609  ? 193.741 144.398 106.088 1.00 67.56  ? 601  VAL B C     1 
ATOM   5919  O O     . VAL B 2 609  ? 193.902 145.126 105.097 1.00 67.56  ? 601  VAL B O     1 
ATOM   5920  C CB    . VAL B 2 609  ? 195.461 144.250 107.939 1.00 67.56  ? 601  VAL B CB    1 
ATOM   5921  N N     . LYS B 2 610  ? 193.192 143.184 105.993 1.00 68.63  ? 602  LYS B N     1 
ATOM   5922  C CA    . LYS B 2 610  ? 192.646 142.714 104.729 1.00 68.63  ? 602  LYS B CA    1 
ATOM   5923  C C     . LYS B 2 610  ? 191.408 143.496 104.315 1.00 68.63  ? 602  LYS B C     1 
ATOM   5924  O O     . LYS B 2 610  ? 191.085 143.536 103.124 1.00 68.63  ? 602  LYS B O     1 
ATOM   5925  C CB    . LYS B 2 610  ? 192.319 141.224 104.820 1.00 68.63  ? 602  LYS B CB    1 
ATOM   5926  N N     . ALA B 2 611  ? 190.715 144.121 105.269 1.00 68.15  ? 603  ALA B N     1 
ATOM   5927  C CA    . ALA B 2 611  ? 189.571 144.955 104.927 1.00 68.15  ? 603  ALA B CA    1 
ATOM   5928  C C     . ALA B 2 611  ? 190.017 146.255 104.276 1.00 68.15  ? 603  ALA B C     1 
ATOM   5929  O O     . ALA B 2 611  ? 189.431 146.691 103.276 1.00 68.15  ? 603  ALA B O     1 
ATOM   5930  C CB    . ALA B 2 611  ? 188.738 145.240 106.176 1.00 68.15  ? 603  ALA B CB    1 
ATOM   5931  N N     . LEU B 2 612  ? 191.054 146.888 104.828 1.00 67.78  ? 604  LEU B N     1 
ATOM   5932  C CA    . LEU B 2 612  ? 191.584 148.102 104.223 1.00 67.78  ? 604  LEU B CA    1 
ATOM   5933  C C     . LEU B 2 612  ? 192.272 147.807 102.901 1.00 67.78  ? 604  LEU B C     1 
ATOM   5934  O O     . LEU B 2 612  ? 192.234 148.639 101.985 1.00 67.78  ? 604  LEU B O     1 
ATOM   5935  C CB    . LEU B 2 612  ? 192.555 148.786 105.183 1.00 67.78  ? 604  LEU B CB    1 
ATOM   5936  N N     . VAL B 2 613  ? 192.888 146.630 102.778 1.00 75.13  ? 605  VAL B N     1 
ATOM   5937  C CA    . VAL B 2 613  ? 193.489 146.251 101.505 1.00 75.13  ? 605  VAL B CA    1 
ATOM   5938  C C     . VAL B 2 613  ? 192.415 145.951 100.466 1.00 75.13  ? 605  VAL B C     1 
ATOM   5939  O O     . VAL B 2 613  ? 192.580 146.273 99.281  1.00 75.13  ? 605  VAL B O     1 
ATOM   5940  C CB    . VAL B 2 613  ? 194.434 145.053 101.701 1.00 75.13  ? 605  VAL B CB    1 
ATOM   5941  N N     . SER B 2 614  ? 191.298 145.354 100.886 1.00 70.32  ? 606  SER B N     1 
ATOM   5942  C CA    . SER B 2 614  ? 190.233 145.022 99.945  1.00 70.32  ? 606  SER B CA    1 
ATOM   5943  C C     . SER B 2 614  ? 189.483 146.270 99.499  1.00 70.32  ? 606  SER B C     1 
ATOM   5944  O O     . SER B 2 614  ? 189.094 146.385 98.330  1.00 70.32  ? 606  SER B O     1 
ATOM   5945  C CB    . SER B 2 614  ? 189.275 144.014 100.573 1.00 70.32  ? 606  SER B CB    1 
ATOM   5946  N N     . VAL B 2 615  ? 189.275 147.218 100.414 1.00 67.47  ? 607  VAL B N     1 
ATOM   5947  C CA    . VAL B 2 615  ? 188.669 148.485 100.029 1.00 67.47  ? 607  VAL B CA    1 
ATOM   5948  C C     . VAL B 2 615  ? 189.640 149.310 99.197  1.00 67.47  ? 607  VAL B C     1 
ATOM   5949  O O     . VAL B 2 615  ? 189.220 150.116 98.358  1.00 67.47  ? 607  VAL B O     1 
ATOM   5950  C CB    . VAL B 2 615  ? 188.207 149.255 101.274 1.00 67.47  ? 607  VAL B CB    1 
ATOM   5951  N N     . GLN B 2 616  ? 190.945 149.129 99.415  1.00 66.42  ? 608  GLN B N     1 
ATOM   5952  C CA    . GLN B 2 616  ? 191.935 149.805 98.585  1.00 66.42  ? 608  GLN B CA    1 
ATOM   5953  C C     . GLN B 2 616  ? 191.923 149.258 97.163  1.00 66.42  ? 608  GLN B C     1 
ATOM   5954  O O     . GLN B 2 616  ? 192.027 150.024 96.199  1.00 66.42  ? 608  GLN B O     1 
ATOM   5955  C CB    . GLN B 2 616  ? 193.323 149.662 99.205  1.00 66.42  ? 608  GLN B CB    1 
ATOM   5956  N N     . LYS B 2 617  ? 191.789 147.938 97.014  1.00 65.66  ? 609  LYS B N     1 
ATOM   5957  C CA    . LYS B 2 617  ? 191.693 147.356 95.679  1.00 65.66  ? 609  LYS B CA    1 
ATOM   5958  C C     . LYS B 2 617  ? 190.362 147.688 95.021  1.00 65.66  ? 609  LYS B C     1 
ATOM   5959  O O     . LYS B 2 617  ? 190.291 147.800 93.791  1.00 65.66  ? 609  LYS B O     1 
ATOM   5960  C CB    . LYS B 2 617  ? 191.886 145.843 95.749  1.00 65.66  ? 609  LYS B CB    1 
ATOM   5961  N N     . LEU B 2 618  ? 189.304 147.854 95.819  1.00 73.53  ? 610  LEU B N     1 
ATOM   5962  C CA    . LEU B 2 618  ? 188.012 148.246 95.266  1.00 73.53  ? 610  LEU B CA    1 
ATOM   5963  C C     . LEU B 2 618  ? 188.042 149.687 94.777  1.00 73.53  ? 610  LEU B C     1 
ATOM   5964  O O     . LEU B 2 618  ? 187.486 150.004 93.717  1.00 73.53  ? 610  LEU B O     1 
ATOM   5965  C CB    . LEU B 2 618  ? 186.915 148.058 96.312  1.00 73.53  ? 610  LEU B CB    1 
ATOM   5966  N N     . SER B 2 619  ? 188.688 150.574 95.537  1.00 67.20  ? 611  SER B N     1 
ATOM   5967  C CA    . SER B 2 619  ? 188.849 151.951 95.091  1.00 67.20  ? 611  SER B CA    1 
ATOM   5968  C C     . SER B 2 619  ? 189.796 152.041 93.903  1.00 67.20  ? 611  SER B C     1 
ATOM   5969  O O     . SER B 2 619  ? 189.640 152.926 93.054  1.00 67.20  ? 611  SER B O     1 
ATOM   5970  C CB    . SER B 2 619  ? 189.354 152.819 96.241  1.00 67.20  ? 611  SER B CB    1 
ATOM   5971  N N     . GLU B 2 620  ? 190.777 151.138 93.827  1.00 77.02  ? 612  GLU B N     1 
ATOM   5972  C CA    . GLU B 2 620  ? 191.645 151.088 92.657  1.00 77.02  ? 612  GLU B CA    1 
ATOM   5973  C C     . GLU B 2 620  ? 190.893 150.605 91.427  1.00 77.02  ? 612  GLU B C     1 
ATOM   5974  O O     . GLU B 2 620  ? 191.188 151.040 90.308  1.00 77.02  ? 612  GLU B O     1 
ATOM   5975  C CB    . GLU B 2 620  ? 192.847 150.186 92.932  1.00 77.02  ? 612  GLU B CB    1 
ATOM   5976  N N     . PHE B 2 621  ? 189.921 149.711 91.611  1.00 72.95  ? 613  PHE B N     1 
ATOM   5977  C CA    . PHE B 2 621  ? 189.080 149.293 90.500  1.00 72.95  ? 613  PHE B CA    1 
ATOM   5978  C C     . PHE B 2 621  ? 188.034 150.340 90.149  1.00 72.95  ? 613  PHE B C     1 
ATOM   5979  O O     . PHE B 2 621  ? 187.539 150.351 89.015  1.00 72.95  ? 613  PHE B O     1 
ATOM   5980  C CB    . PHE B 2 621  ? 188.399 147.962 90.833  1.00 72.95  ? 613  PHE B CB    1 
ATOM   5981  C CG    . PHE B 2 621  ? 187.645 147.361 89.682  1.00 72.95  ? 613  PHE B CG    1 
ATOM   5982  C CD1   . PHE B 2 621  ? 188.322 146.708 88.665  1.00 72.95  ? 613  PHE B CD1   1 
ATOM   5983  C CD2   . PHE B 2 621  ? 186.264 147.461 89.610  1.00 72.95  ? 613  PHE B CD2   1 
ATOM   5984  C CE1   . PHE B 2 621  ? 187.636 146.156 87.602  1.00 72.95  ? 613  PHE B CE1   1 
ATOM   5985  C CE2   . PHE B 2 621  ? 185.573 146.915 88.547  1.00 72.95  ? 613  PHE B CE2   1 
ATOM   5986  C CZ    . PHE B 2 621  ? 186.260 146.261 87.543  1.00 72.95  ? 613  PHE B CZ    1 
ATOM   5987  N N     . LEU B 2 622  ? 187.716 151.243 91.084  1.00 67.05  ? 614  LEU B N     1 
ATOM   5988  C CA    . LEU B 2 622  ? 186.654 152.224 90.879  1.00 67.05  ? 614  LEU B CA    1 
ATOM   5989  C C     . LEU B 2 622  ? 186.996 153.262 89.817  1.00 67.05  ? 614  LEU B C     1 
ATOM   5990  O O     . LEU B 2 622  ? 186.097 153.968 89.351  1.00 67.05  ? 614  LEU B O     1 
ATOM   5991  C CB    . LEU B 2 622  ? 186.333 152.926 92.199  1.00 67.05  ? 614  LEU B CB    1 
ATOM   5992  N N     . SER B 2 623  ? 188.262 153.377 89.430  1.00 55.70  ? 615  SER B N     1 
ATOM   5993  C CA    . SER B 2 623  ? 188.651 154.278 88.359  1.00 55.70  ? 615  SER B CA    1 
ATOM   5994  C C     . SER B 2 623  ? 188.187 153.745 87.008  1.00 55.70  ? 615  SER B C     1 
ATOM   5995  O O     . SER B 2 623  ? 187.470 154.428 86.277  1.00 55.70  ? 615  SER B O     1 
ATOM   5996  C CB    . SER B 2 623  ? 190.165 154.477 88.353  1.00 55.70  ? 615  SER B CB    1 
ATOM   5997  N N     . CYS B 2 686  ? 173.908 154.962 54.156  1.00 189.53 ? 678  CYS B N     1 
ATOM   5998  C CA    . CYS B 2 686  ? 173.772 154.089 55.316  1.00 189.53 ? 678  CYS B CA    1 
ATOM   5999  C C     . CYS B 2 686  ? 174.906 154.314 56.315  1.00 189.53 ? 678  CYS B C     1 
ATOM   6000  O O     . CYS B 2 686  ? 174.714 154.199 57.526  1.00 189.53 ? 678  CYS B O     1 
ATOM   6001  C CB    . CYS B 2 686  ? 173.736 152.623 54.878  1.00 189.53 ? 678  CYS B CB    1 
ATOM   6002  N N     . VAL B 2 687  ? 176.091 154.625 55.795  1.00 193.09 ? 679  VAL B N     1 
ATOM   6003  C CA    . VAL B 2 687  ? 177.286 154.863 56.597  1.00 193.09 ? 679  VAL B CA    1 
ATOM   6004  C C     . VAL B 2 687  ? 177.854 156.213 56.193  1.00 193.09 ? 679  VAL B C     1 
ATOM   6005  O O     . VAL B 2 687  ? 177.986 156.496 54.999  1.00 193.09 ? 679  VAL B O     1 
ATOM   6006  C CB    . VAL B 2 687  ? 178.340 153.755 56.414  1.00 193.09 ? 679  VAL B CB    1 
ATOM   6007  N N     . GLN B 2 688  ? 178.138 157.065 57.175  1.00 199.94 ? 680  GLN B N     1 
ATOM   6008  C CA    . GLN B 2 688  ? 178.860 158.306 56.920  1.00 199.94 ? 680  GLN B CA    1 
ATOM   6009  C C     . GLN B 2 688  ? 180.006 158.476 57.907  1.00 199.94 ? 680  GLN B C     1 
ATOM   6010  O O     . GLN B 2 688  ? 179.778 158.531 59.120  1.00 199.94 ? 680  GLN B O     1 
ATOM   6011  C CB    . GLN B 2 688  ? 177.916 159.509 56.996  1.00 199.94 ? 680  GLN B CB    1 
ATOM   6012  N N     . ILE B 2 689  ? 181.233 158.547 57.392  1.00 166.70 ? 681  ILE B N     1 
ATOM   6013  C CA    . ILE B 2 689  ? 182.426 158.751 58.207  1.00 166.70 ? 681  ILE B CA    1 
ATOM   6014  C C     . ILE B 2 689  ? 183.126 159.990 57.666  1.00 166.70 ? 681  ILE B C     1 
ATOM   6015  O O     . ILE B 2 689  ? 183.433 160.063 56.470  1.00 166.70 ? 681  ILE B O     1 
ATOM   6016  C CB    . ILE B 2 689  ? 183.362 157.532 58.187  1.00 166.70 ? 681  ILE B CB    1 
ATOM   6017  N N     . ILE B 2 690  ? 183.389 160.950 58.548  1.00 165.22 ? 682  ILE B N     1 
ATOM   6018  C CA    . ILE B 2 690  ? 183.991 162.229 58.184  1.00 165.22 ? 682  ILE B CA    1 
ATOM   6019  C C     . ILE B 2 690  ? 185.146 162.527 59.126  1.00 165.22 ? 682  ILE B C     1 
ATOM   6020  O O     . ILE B 2 690  ? 184.924 162.688 60.331  1.00 165.22 ? 682  ILE B O     1 
ATOM   6021  C CB    . ILE B 2 690  ? 182.969 163.377 58.214  1.00 165.22 ? 682  ILE B CB    1 
ATOM   6022  N N     . GLY B 2 691  ? 186.360 162.656 58.569  1.00 162.94 ? 683  GLY B N     1 
ATOM   6023  C CA    . GLY B 2 691  ? 187.553 163.060 59.304  1.00 162.94 ? 683  GLY B CA    1 
ATOM   6024  C C     . GLY B 2 691  ? 187.854 162.372 60.622  1.00 162.94 ? 683  GLY B C     1 
ATOM   6025  O O     . GLY B 2 691  ? 188.125 163.031 61.629  1.00 162.94 ? 683  GLY B O     1 
ATOM   6026  N N     . GLY B 2 692  ? 187.823 161.046 60.614  1.00 180.73 ? 684  GLY B N     1 
ATOM   6027  C CA    . GLY B 2 692  ? 187.808 160.255 61.831  1.00 180.73 ? 684  GLY B CA    1 
ATOM   6028  C C     . GLY B 2 692  ? 189.210 159.808 62.205  1.00 180.73 ? 684  GLY B C     1 
ATOM   6029  O O     . GLY B 2 692  ? 189.987 159.361 61.360  1.00 180.73 ? 684  GLY B O     1 
ATOM   6030  N N     . PHE B 2 693  ? 189.512 159.948 63.494  1.00 171.69 ? 685  PHE B N     1 
ATOM   6031  C CA    . PHE B 2 693  ? 190.826 159.707 64.067  1.00 171.69 ? 685  PHE B CA    1 
ATOM   6032  C C     . PHE B 2 693  ? 190.723 158.665 65.167  1.00 171.69 ? 685  PHE B C     1 
ATOM   6033  O O     . PHE B 2 693  ? 189.825 158.729 66.011  1.00 171.69 ? 685  PHE B O     1 
ATOM   6034  C CB    . PHE B 2 693  ? 191.426 161.001 64.625  1.00 171.69 ? 685  PHE B CB    1 
ATOM   6035  N N     . PHE B 2 694  ? 191.644 157.700 65.154  1.00 197.67 ? 686  PHE B N     1 
ATOM   6036  C CA    . PHE B 2 694  ? 191.584 156.532 66.019  1.00 197.67 ? 686  PHE B CA    1 
ATOM   6037  C C     . PHE B 2 694  ? 192.934 156.345 66.691  1.00 197.67 ? 686  PHE B C     1 
ATOM   6038  O O     . PHE B 2 694  ? 193.985 156.529 66.072  1.00 197.67 ? 686  PHE B O     1 
ATOM   6039  C CB    . PHE B 2 694  ? 191.215 155.278 65.222  1.00 197.67 ? 686  PHE B CB    1 
ATOM   6040  N N     . THR B 2 695  ? 192.880 155.948 67.960  1.00 181.53 ? 687  THR B N     1 
ATOM   6041  C CA    . THR B 2 695  ? 194.040 155.752 68.816  1.00 181.53 ? 687  THR B CA    1 
ATOM   6042  C C     . THR B 2 695  ? 194.039 154.385 69.486  1.00 181.53 ? 687  THR B C     1 
ATOM   6043  O O     . THR B 2 695  ? 192.995 153.754 69.680  1.00 181.53 ? 687  THR B O     1 
ATOM   6044  C CB    . THR B 2 695  ? 194.118 156.838 69.898  1.00 181.53 ? 687  THR B CB    1 
ATOM   6045  N N     . TRP B 2 696  ? 195.245 153.945 69.844  1.00 179.45 ? 688  TRP B N     1 
ATOM   6046  C CA    . TRP B 2 696  ? 195.418 152.820 70.749  1.00 179.45 ? 688  TRP B CA    1 
ATOM   6047  C C     . TRP B 2 696  ? 195.412 153.272 72.199  1.00 179.45 ? 688  TRP B C     1 
ATOM   6048  O O     . TRP B 2 696  ? 195.204 152.445 73.095  1.00 179.45 ? 688  TRP B O     1 
ATOM   6049  C CB    . TRP B 2 696  ? 196.761 152.117 70.522  1.00 179.45 ? 688  TRP B CB    1 
ATOM   6050  C CG    . TRP B 2 696  ? 196.944 151.322 69.274  1.00 179.45 ? 688  TRP B CG    1 
ATOM   6051  C CD1   . TRP B 2 696  ? 197.774 151.618 68.235  1.00 179.45 ? 688  TRP B CD1   1 
ATOM   6052  C CD2   . TRP B 2 696  ? 196.343 150.058 68.962  1.00 179.45 ? 688  TRP B CD2   1 
ATOM   6053  N NE1   . TRP B 2 696  ? 197.706 150.634 67.280  1.00 179.45 ? 688  TRP B NE1   1 
ATOM   6054  C CE2   . TRP B 2 696  ? 196.835 149.664 67.703  1.00 179.45 ? 688  TRP B CE2   1 
ATOM   6055  C CE3   . TRP B 2 696  ? 195.425 149.231 69.617  1.00 179.45 ? 688  TRP B CE3   1 
ATOM   6056  C CZ2   . TRP B 2 696  ? 196.450 148.478 67.091  1.00 179.45 ? 688  TRP B CZ2   1 
ATOM   6057  C CZ3   . TRP B 2 696  ? 195.035 148.054 69.001  1.00 179.45 ? 688  TRP B CZ3   1 
ATOM   6058  C CH2   . TRP B 2 696  ? 195.544 147.693 67.747  1.00 179.45 ? 688  TRP B CH2   1 
ATOM   6059  N N     . THR B 2 697  ? 195.635 154.564 72.440  1.00 208.77 ? 689  THR B N     1 
ATOM   6060  C CA    . THR B 2 697  ? 195.903 155.164 73.739  1.00 208.77 ? 689  THR B CA    1 
ATOM   6061  C C     . THR B 2 697  ? 195.561 156.648 73.650  1.00 208.77 ? 689  THR B C     1 
ATOM   6062  O O     . THR B 2 697  ? 196.197 157.381 72.882  1.00 208.77 ? 689  THR B O     1 
ATOM   6063  C CB    . THR B 2 697  ? 197.363 154.967 74.151  1.00 208.77 ? 689  THR B CB    1 
ATOM   6064  N N     . PRO B 2 698  ? 194.558 157.128 74.397  1.00 228.28 ? 690  PRO B N     1 
ATOM   6065  C CA    . PRO B 2 698  ? 194.167 158.545 74.294  1.00 228.28 ? 690  PRO B CA    1 
ATOM   6066  C C     . PRO B 2 698  ? 195.171 159.513 74.900  1.00 228.28 ? 690  PRO B C     1 
ATOM   6067  O O     . PRO B 2 698  ? 195.053 160.722 74.663  1.00 228.28 ? 690  PRO B O     1 
ATOM   6068  C CB    . PRO B 2 698  ? 192.832 158.602 75.049  1.00 228.28 ? 690  PRO B CB    1 
ATOM   6069  C CG    . PRO B 2 698  ? 192.852 157.413 75.947  1.00 228.28 ? 690  PRO B CG    1 
ATOM   6070  C CD    . PRO B 2 698  ? 193.597 156.355 75.200  1.00 228.28 ? 690  PRO B CD    1 
ATOM   6071  N N     . ASP B 2 699  ? 196.149 159.023 75.663  1.00 263.88 ? 691  ASP B N     1 
ATOM   6072  C CA    . ASP B 2 699  ? 197.204 159.865 76.218  1.00 263.88 ? 691  ASP B CA    1 
ATOM   6073  C C     . ASP B 2 699  ? 198.198 160.327 75.159  1.00 263.88 ? 691  ASP B C     1 
ATOM   6074  O O     . ASP B 2 699  ? 198.941 161.282 75.397  1.00 263.88 ? 691  ASP B O     1 
ATOM   6075  C CB    . ASP B 2 699  ? 197.939 159.121 77.332  1.00 263.88 ? 691  ASP B CB    1 
ATOM   6076  N N     . GLY B 2 700  ? 198.222 159.664 74.002  1.00 257.95 ? 692  GLY B N     1 
ATOM   6077  C CA    . GLY B 2 700  ? 199.092 160.007 72.903  1.00 257.95 ? 692  GLY B CA    1 
ATOM   6078  C C     . GLY B 2 700  ? 198.319 160.320 71.632  1.00 257.95 ? 692  GLY B C     1 
ATOM   6079  O O     . GLY B 2 700  ? 197.086 160.259 71.593  1.00 257.95 ? 692  GLY B O     1 
ATOM   6080  N N     . ILE B 2 701  ? 199.077 160.728 70.615  1.00 248.51 ? 693  ILE B N     1 
ATOM   6081  C CA    . ILE B 2 701  ? 198.587 160.997 69.260  1.00 248.51 ? 693  ILE B CA    1 
ATOM   6082  C C     . ILE B 2 701  ? 197.830 159.786 68.721  1.00 248.51 ? 693  ILE B C     1 
ATOM   6083  O O     . ILE B 2 701  ? 198.238 158.642 68.983  1.00 248.51 ? 693  ILE B O     1 
ATOM   6084  C CB    . ILE B 2 701  ? 199.747 161.377 68.326  1.00 248.51 ? 693  ILE B CB    1 
ATOM   6085  N N     . PRO B 2 702  ? 196.671 160.000 68.080  1.00 217.57 ? 694  PRO B N     1 
ATOM   6086  C CA    . PRO B 2 702  ? 195.975 158.920 67.359  1.00 217.57 ? 694  PRO B CA    1 
ATOM   6087  C C     . PRO B 2 702  ? 196.851 158.085 66.434  1.00 217.57 ? 694  PRO B C     1 
ATOM   6088  O O     . PRO B 2 702  ? 197.753 158.589 65.762  1.00 217.57 ? 694  PRO B O     1 
ATOM   6089  C CB    . PRO B 2 702  ? 194.891 159.660 66.566  1.00 217.57 ? 694  PRO B CB    1 
ATOM   6090  C CG    . PRO B 2 702  ? 194.802 161.009 67.133  1.00 217.57 ? 694  PRO B CG    1 
ATOM   6091  C CD    . PRO B 2 702  ? 196.101 161.325 67.778  1.00 217.57 ? 694  PRO B CD    1 
ATOM   6092  N N     . THR B 2 703  ? 196.566 156.782 66.428  1.00 223.44 ? 695  THR B N     1 
ATOM   6093  C CA    . THR B 2 703  ? 197.236 155.830 65.554  1.00 223.44 ? 695  THR B CA    1 
ATOM   6094  C C     . THR B 2 703  ? 196.743 155.951 64.120  1.00 223.44 ? 695  THR B C     1 
ATOM   6095  O O     . THR B 2 703  ? 197.517 155.751 63.178  1.00 223.44 ? 695  THR B O     1 
ATOM   6096  C CB    . THR B 2 703  ? 197.020 154.405 66.063  1.00 223.44 ? 695  THR B CB    1 
ATOM   6097  N N     . LEU B 2 704  ? 195.466 156.277 63.946  1.00 192.04 ? 696  LEU B N     1 
ATOM   6098  C CA    . LEU B 2 704  ? 194.839 156.428 62.643  1.00 192.04 ? 696  LEU B CA    1 
ATOM   6099  C C     . LEU B 2 704  ? 194.343 157.856 62.511  1.00 192.04 ? 696  LEU B C     1 
ATOM   6100  O O     . LEU B 2 704  ? 193.753 158.399 63.448  1.00 192.04 ? 696  LEU B O     1 
ATOM   6101  C CB    . LEU B 2 704  ? 193.682 155.442 62.478  1.00 192.04 ? 696  LEU B CB    1 
ATOM   6102  N N     . SER B 2 705  ? 194.608 158.467 61.359  1.00 177.87 ? 697  SER B N     1 
ATOM   6103  C CA    . SER B 2 705  ? 194.349 159.882 61.145  1.00 177.87 ? 697  SER B CA    1 
ATOM   6104  C C     . SER B 2 705  ? 193.595 160.091 59.842  1.00 177.87 ? 697  SER B C     1 
ATOM   6105  O O     . SER B 2 705  ? 193.991 159.557 58.801  1.00 177.87 ? 697  SER B O     1 
ATOM   6106  C CB    . SER B 2 705  ? 195.647 160.694 61.124  1.00 177.87 ? 697  SER B CB    1 
ATOM   6107  O OG    . SER B 2 705  ? 195.402 162.025 60.704  1.00 177.87 ? 697  SER B OG    1 
ATOM   6108  N N     . ASN B 2 706  ? 192.499 160.852 59.927  1.00 173.64 ? 698  ASN B N     1 
ATOM   6109  C CA    . ASN B 2 706  ? 191.708 161.320 58.784  1.00 173.64 ? 698  ASN B CA    1 
ATOM   6110  C C     . ASN B 2 706  ? 191.150 160.179 57.936  1.00 173.64 ? 698  ASN B C     1 
ATOM   6111  O O     . ASN B 2 706  ? 191.147 160.247 56.705  1.00 173.64 ? 698  ASN B O     1 
ATOM   6112  C CB    . ASN B 2 706  ? 192.513 162.292 57.918  1.00 173.64 ? 698  ASN B CB    1 
ATOM   6113  N N     . ILE B 2 707  ? 190.714 159.108 58.599  1.00 176.65 ? 699  ILE B N     1 
ATOM   6114  C CA    . ILE B 2 707  ? 190.213 157.931 57.895  1.00 176.65 ? 699  ILE B CA    1 
ATOM   6115  C C     . ILE B 2 707  ? 188.858 158.314 57.317  1.00 176.65 ? 699  ILE B C     1 
ATOM   6116  O O     . ILE B 2 707  ? 187.956 158.736 58.048  1.00 176.65 ? 699  ILE B O     1 
ATOM   6117  C CB    . ILE B 2 707  ? 190.111 156.723 58.833  1.00 176.65 ? 699  ILE B CB    1 
ATOM   6118  N N     . THR B 2 708  ? 188.706 158.178 56.002  1.00 185.73 ? 700  THR B N     1 
ATOM   6119  C CA    . THR B 2 708  ? 187.442 158.517 55.360  1.00 185.73 ? 700  THR B CA    1 
ATOM   6120  C C     . THR B 2 708  ? 187.012 157.495 54.320  1.00 185.73 ? 700  THR B C     1 
ATOM   6121  O O     . THR B 2 708  ? 187.717 157.278 53.329  1.00 185.73 ? 700  THR B O     1 
ATOM   6122  C CB    . THR B 2 708  ? 187.524 159.904 54.714  1.00 185.73 ? 700  THR B CB    1 
ATOM   6123  N N     . ILE B 2 709  ? 185.853 156.882 54.563  1.00 194.73 ? 701  ILE B N     1 
ATOM   6124  C CA    . ILE B 2 709  ? 185.195 156.003 53.604  1.00 194.73 ? 701  ILE B CA    1 
ATOM   6125  C C     . ILE B 2 709  ? 183.751 155.897 54.063  1.00 194.73 ? 701  ILE B C     1 
ATOM   6126  O O     . ILE B 2 709  ? 183.451 156.058 55.247  1.00 194.73 ? 701  ILE B O     1 
ATOM   6127  C CB    . ILE B 2 709  ? 185.871 154.609 53.529  1.00 194.73 ? 701  ILE B CB    1 
ATOM   6128  N N     . ARG B 2 710  ? 182.856 155.611 53.124  1.00 213.85 ? 702  ARG B N     1 
ATOM   6129  C CA    . ARG B 2 710  ? 181.463 155.328 53.436  1.00 213.85 ? 702  ARG B CA    1 
ATOM   6130  C C     . ARG B 2 710  ? 180.999 154.054 52.756  1.00 213.85 ? 702  ARG B C     1 
ATOM   6131  O O     . ARG B 2 710  ? 181.371 153.790 51.608  1.00 213.85 ? 702  ARG B O     1 
ATOM   6132  C CB    . ARG B 2 710  ? 180.564 156.492 53.001  1.00 213.85 ? 702  ARG B CB    1 
ATOM   6133  C CG    . ARG B 2 710  ? 180.795 157.790 53.759  1.00 213.85 ? 702  ARG B CG    1 
ATOM   6134  C CD    . ARG B 2 710  ? 179.865 158.887 53.266  1.00 213.85 ? 702  ARG B CD    1 
ATOM   6135  N NE    . ARG B 2 710  ? 179.989 160.109 54.056  1.00 213.85 ? 702  ARG B NE    1 
ATOM   6136  C CZ    . ARG B 2 710  ? 180.877 161.068 53.817  1.00 213.85 ? 702  ARG B CZ    1 
ATOM   6137  N NH1   . ARG B 2 710  ? 180.888 162.163 54.565  1.00 213.85 ? 702  ARG B NH1   1 
ATOM   6138  N NH2   . ARG B 2 710  ? 181.736 160.945 52.814  1.00 213.85 ? 702  ARG B NH2   1 
ATOM   6139  N N     . ILE B 2 711  ? 180.189 153.262 53.451  1.00 197.57 ? 703  ILE B N     1 
ATOM   6140  C CA    . ILE B 2 711  ? 179.701 152.049 52.812  1.00 197.57 ? 703  ILE B CA    1 
ATOM   6141  C C     . ILE B 2 711  ? 178.186 152.117 52.650  1.00 197.57 ? 703  ILE B C     1 
ATOM   6142  O O     . ILE B 2 711  ? 177.465 152.154 53.659  1.00 197.57 ? 703  ILE B O     1 
ATOM   6143  C CB    . ILE B 2 711  ? 180.106 150.800 53.612  1.00 197.57 ? 703  ILE B CB    1 
ATOM   6144  N N     . PRO B 2 712  ? 177.678 152.242 51.419  1.00 200.98 ? 704  PRO B N     1 
ATOM   6145  C CA    . PRO B 2 712  ? 176.283 151.881 51.120  1.00 200.98 ? 704  PRO B CA    1 
ATOM   6146  C C     . PRO B 2 712  ? 175.868 150.546 51.728  1.00 200.98 ? 704  PRO B C     1 
ATOM   6147  O O     . PRO B 2 712  ? 176.660 149.599 51.788  1.00 200.98 ? 704  PRO B O     1 
ATOM   6148  C CB    . PRO B 2 712  ? 176.233 151.873 49.585  1.00 200.98 ? 704  PRO B CB    1 
ATOM   6149  C CG    . PRO B 2 712  ? 177.411 152.697 49.175  1.00 200.98 ? 704  PRO B CG    1 
ATOM   6150  C CD    . PRO B 2 712  ? 178.453 152.418 50.185  1.00 200.98 ? 704  PRO B CD    1 
ATOM   6151  N N     . ARG B 2 713  ? 174.632 150.501 52.220  1.00 179.88 ? 705  ARG B N     1 
ATOM   6152  C CA    . ARG B 2 713  ? 174.022 149.245 52.636  1.00 179.88 ? 705  ARG B CA    1 
ATOM   6153  C C     . ARG B 2 713  ? 174.010 148.244 51.487  1.00 179.88 ? 705  ARG B C     1 
ATOM   6154  O O     . ARG B 2 713  ? 173.556 148.547 50.380  1.00 179.88 ? 705  ARG B O     1 
ATOM   6155  C CB    . ARG B 2 713  ? 172.599 149.493 53.135  1.00 179.88 ? 705  ARG B CB    1 
ATOM   6156  N N     . GLY B 2 714  ? 174.521 147.046 51.761  1.00 187.80 ? 706  GLY B N     1 
ATOM   6157  C CA    . GLY B 2 714  ? 174.632 145.999 50.774  1.00 187.80 ? 706  GLY B CA    1 
ATOM   6158  C C     . GLY B 2 714  ? 175.914 145.952 49.969  1.00 187.80 ? 706  GLY B C     1 
ATOM   6159  O O     . GLY B 2 714  ? 176.058 145.044 49.141  1.00 187.80 ? 706  GLY B O     1 
ATOM   6160  N N     . GLN B 2 715  ? 176.846 146.890 50.161  1.00 210.44 ? 707  GLN B N     1 
ATOM   6161  C CA    . GLN B 2 715  ? 178.079 146.846 49.384  1.00 210.44 ? 707  GLN B CA    1 
ATOM   6162  C C     . GLN B 2 715  ? 178.966 145.721 49.921  1.00 210.44 ? 707  GLN B C     1 
ATOM   6163  O O     . GLN B 2 715  ? 178.959 145.419 51.117  1.00 210.44 ? 707  GLN B O     1 
ATOM   6164  C CB    . GLN B 2 715  ? 178.851 148.174 49.473  1.00 210.44 ? 707  GLN B CB    1 
ATOM   6165  C CG    . GLN B 2 715  ? 180.048 148.270 48.489  1.00 210.44 ? 707  GLN B CG    1 
ATOM   6166  C CD    . GLN B 2 715  ? 180.768 149.602 48.481  1.00 210.44 ? 707  GLN B CD    1 
ATOM   6167  O OE1   . GLN B 2 715  ? 180.729 150.343 49.453  1.00 210.44 ? 707  GLN B OE1   1 
ATOM   6168  N NE2   . GLN B 2 715  ? 181.396 149.930 47.359  1.00 210.44 ? 707  GLN B NE2   1 
ATOM   6169  N N     . LEU B 2 716  ? 179.739 145.100 49.030  1.00 213.37 ? 708  LEU B N     1 
ATOM   6170  C CA    . LEU B 2 716  ? 180.811 144.198 49.432  1.00 213.37 ? 708  LEU B CA    1 
ATOM   6171  C C     . LEU B 2 716  ? 182.120 144.974 49.347  1.00 213.37 ? 708  LEU B C     1 
ATOM   6172  O O     . LEU B 2 716  ? 182.562 145.340 48.252  1.00 213.37 ? 708  LEU B O     1 
ATOM   6173  C CB    . LEU B 2 716  ? 180.842 142.957 48.543  1.00 213.37 ? 708  LEU B CB    1 
ATOM   6174  N N     . THR B 2 717  ? 182.738 145.223 50.500  1.00 194.82 ? 709  THR B N     1 
ATOM   6175  C CA    . THR B 2 717  ? 183.889 146.114 50.601  1.00 194.82 ? 709  THR B CA    1 
ATOM   6176  C C     . THR B 2 717  ? 185.024 145.397 51.310  1.00 194.82 ? 709  THR B C     1 
ATOM   6177  O O     . THR B 2 717  ? 184.864 144.960 52.454  1.00 194.82 ? 709  THR B O     1 
ATOM   6178  C CB    . THR B 2 717  ? 183.540 147.401 51.356  1.00 194.82 ? 709  THR B CB    1 
ATOM   6179  O OG1   . THR B 2 717  ? 182.479 148.084 50.682  1.00 194.82 ? 709  THR B OG1   1 
ATOM   6180  C CG2   . THR B 2 717  ? 184.754 148.319 51.442  1.00 194.82 ? 709  THR B CG2   1 
ATOM   6181  N N     . MET B 2 718  ? 186.159 145.270 50.634  1.00 199.10 ? 710  MET B N     1 
ATOM   6182  C CA    . MET B 2 718  ? 187.338 144.682 51.248  1.00 199.10 ? 710  MET B CA    1 
ATOM   6183  C C     . MET B 2 718  ? 188.159 145.759 51.947  1.00 199.10 ? 710  MET B C     1 
ATOM   6184  O O     . MET B 2 718  ? 188.130 146.934 51.573  1.00 199.10 ? 710  MET B O     1 
ATOM   6185  C CB    . MET B 2 718  ? 188.197 143.968 50.206  1.00 199.10 ? 710  MET B CB    1 
ATOM   6186  N N     . ILE B 2 719  ? 188.897 145.341 52.968  1.00 194.08 ? 711  ILE B N     1 
ATOM   6187  C CA    . ILE B 2 719  ? 189.855 146.193 53.660  1.00 194.08 ? 711  ILE B CA    1 
ATOM   6188  C C     . ILE B 2 719  ? 191.166 145.432 53.657  1.00 194.08 ? 711  ILE B C     1 
ATOM   6189  O O     . ILE B 2 719  ? 191.232 144.320 54.190  1.00 194.08 ? 711  ILE B O     1 
ATOM   6190  C CB    . ILE B 2 719  ? 189.416 146.527 55.095  1.00 194.08 ? 711  ILE B CB    1 
ATOM   6191  N N     . VAL B 2 720  ? 192.210 146.023 53.079  1.00 215.65 ? 712  VAL B N     1 
ATOM   6192  C CA    . VAL B 2 720  ? 193.470 145.318 52.908  1.00 215.65 ? 712  VAL B CA    1 
ATOM   6193  C C     . VAL B 2 720  ? 194.648 146.204 53.283  1.00 215.65 ? 712  VAL B C     1 
ATOM   6194  O O     . VAL B 2 720  ? 194.533 147.424 53.413  1.00 215.65 ? 712  VAL B O     1 
ATOM   6195  C CB    . VAL B 2 720  ? 193.648 144.801 51.463  1.00 215.65 ? 712  VAL B CB    1 
ATOM   6196  N N     . GLY B 2 721  ? 195.783 145.553 53.460  1.00 244.79 ? 713  GLY B N     1 
ATOM   6197  C CA    . GLY B 2 721  ? 197.050 146.211 53.708  1.00 244.79 ? 713  GLY B CA    1 
ATOM   6198  C C     . GLY B 2 721  ? 197.978 145.284 54.458  1.00 244.79 ? 713  GLY B C     1 
ATOM   6199  O O     . GLY B 2 721  ? 197.578 144.220 54.931  1.00 244.79 ? 713  GLY B O     1 
ATOM   6200  N N     . GLN B 2 722  ? 199.263 145.673 54.464  1.00 265.54 ? 714  GLN B N     1 
ATOM   6201  C CA    . GLN B 2 722  ? 200.346 144.946 55.133  1.00 265.54 ? 714  GLN B CA    1 
ATOM   6202  C C     . GLN B 2 722  ? 200.002 144.577 56.575  1.00 265.54 ? 714  GLN B C     1 
ATOM   6203  O O     . GLN B 2 722  ? 199.219 145.265 57.239  1.00 265.54 ? 714  GLN B O     1 
ATOM   6204  C CB    . GLN B 2 722  ? 201.626 145.786 55.106  1.00 265.54 ? 714  GLN B CB    1 
ATOM   6205  N N     . VAL B 2 723  ? 200.502 143.416 57.011  1.00 262.85 ? 715  VAL B N     1 
ATOM   6206  C CA    . VAL B 2 723  ? 200.532 143.018 58.419  1.00 262.85 ? 715  VAL B CA    1 
ATOM   6207  C C     . VAL B 2 723  ? 201.013 144.161 59.307  1.00 262.85 ? 715  VAL B C     1 
ATOM   6208  O O     . VAL B 2 723  ? 202.093 144.719 59.085  1.00 262.85 ? 715  VAL B O     1 
ATOM   6209  C CB    . VAL B 2 723  ? 201.414 141.773 58.618  1.00 262.85 ? 715  VAL B CB    1 
ATOM   6210  N N     . GLY B 2 724  ? 200.219 144.519 60.306  1.00 255.60 ? 716  GLY B N     1 
ATOM   6211  C CA    . GLY B 2 724  ? 200.584 145.581 61.215  1.00 255.60 ? 716  GLY B CA    1 
ATOM   6212  C C     . GLY B 2 724  ? 200.260 146.985 60.753  1.00 255.60 ? 716  GLY B C     1 
ATOM   6213  O O     . GLY B 2 724  ? 200.596 147.939 61.465  1.00 255.60 ? 716  GLY B O     1 
ATOM   6214  N N     . CYS B 2 725  ? 199.624 147.153 59.589  1.00 245.01 ? 717  CYS B N     1 
ATOM   6215  C CA    . CYS B 2 725  ? 199.316 148.487 59.079  1.00 245.01 ? 717  CYS B CA    1 
ATOM   6216  C C     . CYS B 2 725  ? 198.152 149.136 59.809  1.00 245.01 ? 717  CYS B C     1 
ATOM   6217  O O     . CYS B 2 725  ? 197.897 150.329 59.604  1.00 245.01 ? 717  CYS B O     1 
ATOM   6218  C CB    . CYS B 2 725  ? 199.008 148.450 57.580  1.00 245.01 ? 717  CYS B CB    1 
ATOM   6219  N N     . GLY B 2 726  ? 197.444 148.385 60.635  1.00 197.96 ? 718  GLY B N     1 
ATOM   6220  C CA    . GLY B 2 726  ? 196.368 148.896 61.438  1.00 197.96 ? 718  GLY B CA    1 
ATOM   6221  C C     . GLY B 2 726  ? 195.019 148.376 61.024  1.00 197.96 ? 718  GLY B C     1 
ATOM   6222  O O     . GLY B 2 726  ? 194.011 148.983 61.400  1.00 197.96 ? 718  GLY B O     1 
ATOM   6223  N N     . LYS B 2 727  ? 194.977 147.298 60.230  1.00 181.29 ? 719  LYS B N     1 
ATOM   6224  C CA    . LYS B 2 727  ? 193.725 146.744 59.720  1.00 181.29 ? 719  LYS B CA    1 
ATOM   6225  C C     . LYS B 2 727  ? 192.828 146.282 60.859  1.00 181.29 ? 719  LYS B C     1 
ATOM   6226  O O     . LYS B 2 727  ? 191.619 146.542 60.854  1.00 181.29 ? 719  LYS B O     1 
ATOM   6227  C CB    . LYS B 2 727  ? 194.015 145.594 58.758  1.00 181.29 ? 719  LYS B CB    1 
ATOM   6228  N N     . SER B 2 728  ? 193.396 145.523 61.801  1.00 166.20 ? 720  SER B N     1 
ATOM   6229  C CA    . SER B 2 728  ? 192.645 145.121 62.984  1.00 166.20 ? 720  SER B CA    1 
ATOM   6230  C C     . SER B 2 728  ? 192.234 146.345 63.797  1.00 166.20 ? 720  SER B C     1 
ATOM   6231  O O     . SER B 2 728  ? 191.117 146.407 64.324  1.00 166.20 ? 720  SER B O     1 
ATOM   6232  C CB    . SER B 2 728  ? 193.476 144.156 63.828  1.00 166.20 ? 720  SER B CB    1 
ATOM   6233  N N     . SER B 2 729  ? 193.148 147.316 63.933  1.00 172.86 ? 721  SER B N     1 
ATOM   6234  C CA    . SER B 2 729  ? 192.830 148.591 64.575  1.00 172.86 ? 721  SER B CA    1 
ATOM   6235  C C     . SER B 2 729  ? 191.757 149.360 63.813  1.00 172.86 ? 721  SER B C     1 
ATOM   6236  O O     . SER B 2 729  ? 190.943 150.062 64.418  1.00 172.86 ? 721  SER B O     1 
ATOM   6237  C CB    . SER B 2 729  ? 194.087 149.446 64.689  1.00 172.86 ? 721  SER B CB    1 
ATOM   6238  N N     . LEU B 2 730  ? 191.794 149.289 62.479  1.00 171.60 ? 722  LEU B N     1 
ATOM   6239  C CA    . LEU B 2 730  ? 190.737 149.861 61.647  1.00 171.60 ? 722  LEU B CA    1 
ATOM   6240  C C     . LEU B 2 730  ? 189.393 149.208 61.930  1.00 171.60 ? 722  LEU B C     1 
ATOM   6241  O O     . LEU B 2 730  ? 188.357 149.880 61.942  1.00 171.60 ? 722  LEU B O     1 
ATOM   6242  C CB    . LEU B 2 730  ? 191.095 149.732 60.166  1.00 171.60 ? 722  LEU B CB    1 
ATOM   6243  N N     . LEU B 2 731  ? 189.390 147.887 62.120  1.00 166.57 ? 723  LEU B N     1 
ATOM   6244  C CA    . LEU B 2 731  ? 188.186 147.183 62.542  1.00 166.57 ? 723  LEU B CA    1 
ATOM   6245  C C     . LEU B 2 731  ? 187.731 147.625 63.928  1.00 166.57 ? 723  LEU B C     1 
ATOM   6246  O O     . LEU B 2 731  ? 186.526 147.699 64.194  1.00 166.57 ? 723  LEU B O     1 
ATOM   6247  C CB    . LEU B 2 731  ? 188.430 145.675 62.515  1.00 166.57 ? 723  LEU B CB    1 
ATOM   6248  N N     . LEU B 2 732  ? 188.679 147.890 64.832  1.00 178.97 ? 724  LEU B N     1 
ATOM   6249  C CA    . LEU B 2 732  ? 188.332 148.459 66.132  1.00 178.97 ? 724  LEU B CA    1 
ATOM   6250  C C     . LEU B 2 732  ? 187.724 149.855 66.002  1.00 178.97 ? 724  LEU B C     1 
ATOM   6251  O O     . LEU B 2 732  ? 186.815 150.212 66.761  1.00 178.97 ? 724  LEU B O     1 
ATOM   6252  C CB    . LEU B 2 732  ? 189.570 148.501 67.028  1.00 178.97 ? 724  LEU B CB    1 
ATOM   6253  N N     . ALA B 2 733  ? 188.232 150.661 65.067  1.00 154.03 ? 725  ALA B N     1 
ATOM   6254  C CA    . ALA B 2 733  ? 187.595 151.933 64.735  1.00 154.03 ? 725  ALA B CA    1 
ATOM   6255  C C     . ALA B 2 733  ? 186.185 151.720 64.201  1.00 154.03 ? 725  ALA B C     1 
ATOM   6256  O O     . ALA B 2 733  ? 185.262 152.467 64.546  1.00 154.03 ? 725  ALA B O     1 
ATOM   6257  C CB    . ALA B 2 733  ? 188.446 152.694 63.720  1.00 154.03 ? 725  ALA B CB    1 
ATOM   6258  N N     . THR B 2 734  ? 186.006 150.707 63.353  1.00 149.11 ? 726  THR B N     1 
ATOM   6259  C CA    . THR B 2 734  ? 184.686 150.340 62.851  1.00 149.11 ? 726  THR B CA    1 
ATOM   6260  C C     . THR B 2 734  ? 183.763 149.844 63.957  1.00 149.11 ? 726  THR B C     1 
ATOM   6261  O O     . THR B 2 734  ? 182.540 149.925 63.811  1.00 149.11 ? 726  THR B O     1 
ATOM   6262  C CB    . THR B 2 734  ? 184.817 149.270 61.768  1.00 149.11 ? 726  THR B CB    1 
ATOM   6263  N N     . LEU B 2 735  ? 184.317 149.342 65.053  1.00 148.20 ? 727  LEU B N     1 
ATOM   6264  C CA    . LEU B 2 735  ? 183.534 148.918 66.202  1.00 148.20 ? 727  LEU B CA    1 
ATOM   6265  C C     . LEU B 2 735  ? 183.323 150.022 67.229  1.00 148.20 ? 727  LEU B C     1 
ATOM   6266  O O     . LEU B 2 735  ? 182.699 149.765 68.263  1.00 148.20 ? 727  LEU B O     1 
ATOM   6267  C CB    . LEU B 2 735  ? 184.204 147.720 66.879  1.00 148.20 ? 727  LEU B CB    1 
ATOM   6268  N N     . GLY B 2 736  ? 183.796 151.239 66.969  1.00 150.71 ? 728  GLY B N     1 
ATOM   6269  C CA    . GLY B 2 736  ? 183.651 152.294 67.954  1.00 150.71 ? 728  GLY B CA    1 
ATOM   6270  C C     . GLY B 2 736  ? 184.503 152.105 69.189  1.00 150.71 ? 728  GLY B C     1 
ATOM   6271  O O     . GLY B 2 736  ? 184.140 152.583 70.269  1.00 150.71 ? 728  GLY B O     1 
ATOM   6272  N N     . GLU B 2 737  ? 185.633 151.418 69.055  1.00 153.00 ? 729  GLU B N     1 
ATOM   6273  C CA    . GLU B 2 737  ? 186.487 151.037 70.170  1.00 153.00 ? 729  GLU B CA    1 
ATOM   6274  C C     . GLU B 2 737  ? 187.707 151.935 70.320  1.00 153.00 ? 729  GLU B C     1 
ATOM   6275  O O     . GLU B 2 737  ? 188.528 151.701 71.212  1.00 153.00 ? 729  GLU B O     1 
ATOM   6276  C CB    . GLU B 2 737  ? 186.934 149.581 70.015  1.00 153.00 ? 729  GLU B CB    1 
ATOM   6277  N N     . MET B 2 738  ? 187.851 152.945 69.476  1.00 146.48 ? 730  MET B N     1 
ATOM   6278  C CA    . MET B 2 738  ? 188.879 153.961 69.621  1.00 146.48 ? 730  MET B CA    1 
ATOM   6279  C C     . MET B 2 738  ? 188.266 155.289 70.057  1.00 146.48 ? 730  MET B C     1 
ATOM   6280  O O     . MET B 2 738  ? 187.046 155.438 70.179  1.00 146.48 ? 730  MET B O     1 
ATOM   6281  C CB    . MET B 2 738  ? 189.660 154.120 68.318  1.00 146.48 ? 730  MET B CB    1 
ATOM   6282  N N     . GLN B 2 739  ? 189.144 156.260 70.296  1.00 141.17 ? 731  GLN B N     1 
ATOM   6283  C CA    . GLN B 2 739  ? 188.771 157.610 70.696  1.00 141.17 ? 731  GLN B CA    1 
ATOM   6284  C C     . GLN B 2 739  ? 188.798 158.536 69.487  1.00 141.17 ? 731  GLN B C     1 
ATOM   6285  O O     . GLN B 2 739  ? 189.863 158.788 68.912  1.00 141.17 ? 731  GLN B O     1 
ATOM   6286  C CB    . GLN B 2 739  ? 189.708 158.130 71.786  1.00 141.17 ? 731  GLN B CB    1 
ATOM   6287  N N     . LYS B 2 740  ? 187.626 159.045 69.121  1.00 141.35 ? 732  LYS B N     1 
ATOM   6288  C CA    . LYS B 2 740  ? 187.474 159.967 68.001  1.00 141.35 ? 732  LYS B CA    1 
ATOM   6289  C C     . LYS B 2 740  ? 187.926 161.350 68.446  1.00 141.35 ? 732  LYS B C     1 
ATOM   6290  O O     . LYS B 2 740  ? 187.298 161.972 69.309  1.00 141.35 ? 732  LYS B O     1 
ATOM   6291  C CB    . LYS B 2 740  ? 186.026 159.990 67.519  1.00 141.35 ? 732  LYS B CB    1 
ATOM   6292  N N     . VAL B 2 741  ? 189.040 161.814 67.874  1.00 147.05 ? 733  VAL B N     1 
ATOM   6293  C CA    . VAL B 2 741  ? 189.577 163.127 68.217  1.00 147.05 ? 733  VAL B CA    1 
ATOM   6294  C C     . VAL B 2 741  ? 188.660 164.236 67.716  1.00 147.05 ? 733  VAL B C     1 
ATOM   6295  O O     . VAL B 2 741  ? 188.345 165.174 68.457  1.00 147.05 ? 733  VAL B O     1 
ATOM   6296  C CB    . VAL B 2 741  ? 191.002 163.280 67.655  1.00 147.05 ? 733  VAL B CB    1 
ATOM   6297  N N     . SER B 2 742  ? 188.183 164.123 66.477  1.00 158.75 ? 734  SER B N     1 
ATOM   6298  C CA    . SER B 2 742  ? 187.278 165.123 65.921  1.00 158.75 ? 734  SER B CA    1 
ATOM   6299  C C     . SER B 2 742  ? 186.532 164.524 64.739  1.00 158.75 ? 734  SER B C     1 
ATOM   6300  O O     . SER B 2 742  ? 186.858 163.439 64.252  1.00 158.75 ? 734  SER B O     1 
ATOM   6301  C CB    . SER B 2 742  ? 188.029 166.388 65.481  1.00 158.75 ? 734  SER B CB    1 
ATOM   6302  N N     . GLY B 2 743  ? 185.511 165.246 64.299  1.00 174.71 ? 735  GLY B N     1 
ATOM   6303  C CA    . GLY B 2 743  ? 184.753 164.908 63.112  1.00 174.71 ? 735  GLY B CA    1 
ATOM   6304  C C     . GLY B 2 743  ? 183.404 164.319 63.469  1.00 174.71 ? 735  GLY B C     1 
ATOM   6305  O O     . GLY B 2 743  ? 183.064 164.090 64.633  1.00 174.71 ? 735  GLY B O     1 
ATOM   6306  N N     . ALA B 2 744  ? 182.622 164.064 62.429  1.00 190.44 ? 736  ALA B N     1 
ATOM   6307  C CA    . ALA B 2 744  ? 181.253 163.600 62.577  1.00 190.44 ? 736  ALA B CA    1 
ATOM   6308  C C     . ALA B 2 744  ? 181.126 162.215 61.969  1.00 190.44 ? 736  ALA B C     1 
ATOM   6309  O O     . ALA B 2 744  ? 181.679 161.941 60.900  1.00 190.44 ? 736  ALA B O     1 
ATOM   6310  C CB    . ALA B 2 744  ? 180.264 164.554 61.905  1.00 190.44 ? 736  ALA B CB    1 
ATOM   6311  N N     . VAL B 2 745  ? 180.414 161.329 62.656  1.00 201.05 ? 737  VAL B N     1 
ATOM   6312  C CA    . VAL B 2 745  ? 180.176 159.997 62.117  1.00 201.05 ? 737  VAL B CA    1 
ATOM   6313  C C     . VAL B 2 745  ? 178.740 159.595 62.411  1.00 201.05 ? 737  VAL B C     1 
ATOM   6314  O O     . VAL B 2 745  ? 178.299 159.624 63.564  1.00 201.05 ? 737  VAL B O     1 
ATOM   6315  C CB    . VAL B 2 745  ? 181.155 158.963 62.695  1.00 201.05 ? 737  VAL B CB    1 
ATOM   6316  N N     . PHE B 2 746  ? 178.011 159.233 61.360  1.00 205.17 ? 738  PHE B N     1 
ATOM   6317  C CA    . PHE B 2 746  ? 176.636 158.754 61.455  1.00 205.17 ? 738  PHE B CA    1 
ATOM   6318  C C     . PHE B 2 746  ? 176.485 157.502 60.605  1.00 205.17 ? 738  PHE B C     1 
ATOM   6319  O O     . PHE B 2 746  ? 176.714 157.531 59.389  1.00 205.17 ? 738  PHE B O     1 
ATOM   6320  C CB    . PHE B 2 746  ? 175.646 159.843 61.063  1.00 205.17 ? 738  PHE B CB    1 
ATOM   6321  C CG    . PHE B 2 746  ? 175.742 161.075 61.932  1.00 205.17 ? 738  PHE B CG    1 
ATOM   6322  C CD1   . PHE B 2 746  ? 175.247 161.059 63.224  1.00 205.17 ? 738  PHE B CD1   1 
ATOM   6323  C CD2   . PHE B 2 746  ? 176.336 162.238 61.461  1.00 205.17 ? 738  PHE B CD2   1 
ATOM   6324  C CE1   . PHE B 2 746  ? 175.339 162.175 64.041  1.00 205.17 ? 738  PHE B CE1   1 
ATOM   6325  C CE2   . PHE B 2 746  ? 176.427 163.358 62.268  1.00 205.17 ? 738  PHE B CE2   1 
ATOM   6326  C CZ    . PHE B 2 746  ? 175.929 163.328 63.557  1.00 205.17 ? 738  PHE B CZ    1 
ATOM   6327  N N     . TRP B 2 747  ? 176.112 156.403 61.254  1.00 222.85 ? 739  TRP B N     1 
ATOM   6328  C CA    . TRP B 2 747  ? 175.937 155.097 60.618  1.00 222.85 ? 739  TRP B CA    1 
ATOM   6329  C C     . TRP B 2 747  ? 174.494 154.606 60.724  1.00 222.85 ? 739  TRP B C     1 
ATOM   6330  O O     . TRP B 2 747  ? 174.250 153.387 60.697  1.00 222.85 ? 739  TRP B O     1 
ATOM   6331  C CB    . TRP B 2 747  ? 176.888 154.093 61.295  1.00 222.85 ? 739  TRP B CB    1 
ATOM   6332  C CG    . TRP B 2 747  ? 178.293 154.417 61.048  1.00 222.85 ? 739  TRP B CG    1 
ATOM   6333  C CD1   . TRP B 2 747  ? 178.863 154.674 59.829  1.00 222.85 ? 739  TRP B CD1   1 
ATOM   6334  C CD2   . TRP B 2 747  ? 179.273 154.777 62.015  1.00 222.85 ? 739  TRP B CD2   1 
ATOM   6335  N NE1   . TRP B 2 747  ? 180.175 155.009 59.967  1.00 222.85 ? 739  TRP B NE1   1 
ATOM   6336  C CE2   . TRP B 2 747  ? 180.452 155.101 61.307  1.00 222.85 ? 739  TRP B CE2   1 
ATOM   6337  C CE3   . TRP B 2 747  ? 179.303 154.797 63.417  1.00 222.85 ? 739  TRP B CE3   1 
ATOM   6338  C CZ2   . TRP B 2 747  ? 181.644 155.442 61.961  1.00 222.85 ? 739  TRP B CZ2   1 
ATOM   6339  C CZ3   . TRP B 2 747  ? 180.490 155.137 64.059  1.00 222.85 ? 739  TRP B CZ3   1 
ATOM   6340  C CH2   . TRP B 2 747  ? 181.636 155.451 63.339  1.00 222.85 ? 739  TRP B CH2   1 
ATOM   6341  N N     . ASN B 2 748  ? 173.556 155.543 60.916  1.00 226.46 ? 740  ASN B N     1 
ATOM   6342  C CA    . ASN B 2 748  ? 172.131 155.414 61.226  1.00 226.46 ? 740  ASN B CA    1 
ATOM   6343  C C     . ASN B 2 748  ? 171.877 154.900 62.642  1.00 226.46 ? 740  ASN B C     1 
ATOM   6344  O O     . ASN B 2 748  ? 170.708 154.728 63.015  1.00 226.46 ? 740  ASN B O     1 
ATOM   6345  C CB    . ASN B 2 748  ? 171.357 154.550 60.228  1.00 226.46 ? 740  ASN B CB    1 
ATOM   6346  N N     . SER B 2 749  ? 172.916 154.649 63.443  1.00 249.44 ? 741  SER B N     1 
ATOM   6347  C CA    . SER B 2 749  ? 172.747 154.132 64.793  1.00 249.44 ? 741  SER B CA    1 
ATOM   6348  C C     . SER B 2 749  ? 172.860 155.210 65.857  1.00 249.44 ? 741  SER B C     1 
ATOM   6349  O O     . SER B 2 749  ? 172.761 154.899 67.046  1.00 249.44 ? 741  SER B O     1 
ATOM   6350  C CB    . SER B 2 749  ? 173.783 153.035 65.060  1.00 249.44 ? 741  SER B CB    1 
ATOM   6351  O OG    . SER B 2 749  ? 175.106 153.530 64.947  1.00 249.44 ? 741  SER B OG    1 
ATOM   6352  N N     . ASN B 2 750  ? 173.066 156.463 65.462  1.00 258.38 ? 742  ASN B N     1 
ATOM   6353  C CA    . ASN B 2 750  ? 173.097 157.574 66.400  1.00 258.38 ? 742  ASN B CA    1 
ATOM   6354  C C     . ASN B 2 750  ? 171.772 158.318 66.441  1.00 258.38 ? 742  ASN B C     1 
ATOM   6355  O O     . ASN B 2 750  ? 171.645 159.299 67.183  1.00 258.38 ? 742  ASN B O     1 
ATOM   6356  C CB    . ASN B 2 750  ? 174.231 158.541 66.043  1.00 258.38 ? 742  ASN B CB    1 
ATOM   6357  N N     . LEU B 2 751  ? 170.806 157.893 65.628  1.00 254.17 ? 743  LEU B N     1 
ATOM   6358  C CA    . LEU B 2 751  ? 169.443 158.391 65.719  1.00 254.17 ? 743  LEU B CA    1 
ATOM   6359  C C     . LEU B 2 751  ? 168.846 158.071 67.088  1.00 254.17 ? 743  LEU B C     1 
ATOM   6360  O O     . LEU B 2 751  ? 169.011 156.955 67.594  1.00 254.17 ? 743  LEU B O     1 
ATOM   6361  C CB    . LEU B 2 751  ? 168.581 157.780 64.612  1.00 254.17 ? 743  LEU B CB    1 
ATOM   6362  N N     . PRO B 2 752  ? 168.144 159.023 67.717  1.00 252.23 ? 744  PRO B N     1 
ATOM   6363  C CA    . PRO B 2 752  ? 167.447 158.767 68.978  1.00 252.23 ? 744  PRO B CA    1 
ATOM   6364  C C     . PRO B 2 752  ? 166.107 158.069 68.768  1.00 252.23 ? 744  PRO B C     1 
ATOM   6365  O O     . PRO B 2 752  ? 165.768 157.780 67.620  1.00 252.23 ? 744  PRO B O     1 
ATOM   6366  C CB    . PRO B 2 752  ? 167.249 160.172 69.546  1.00 252.23 ? 744  PRO B CB    1 
ATOM   6367  C CG    . PRO B 2 752  ? 167.075 161.015 68.330  1.00 252.23 ? 744  PRO B CG    1 
ATOM   6368  C CD    . PRO B 2 752  ? 168.043 160.441 67.319  1.00 252.23 ? 744  PRO B CD    1 
ATOM   6369  N N     . VAL B 2 778  ? 174.245 143.976 65.622  1.00 83.08  ? 770  VAL B N     1 
ATOM   6370  C CA    . VAL B 2 778  ? 175.613 143.961 65.117  1.00 83.08  ? 770  VAL B CA    1 
ATOM   6371  C C     . VAL B 2 778  ? 176.346 142.707 65.593  1.00 83.08  ? 770  VAL B C     1 
ATOM   6372  O O     . VAL B 2 778  ? 176.352 142.403 66.785  1.00 83.08  ? 770  VAL B O     1 
ATOM   6373  C CB    . VAL B 2 778  ? 176.351 145.231 65.560  1.00 83.08  ? 770  VAL B CB    1 
ATOM   6374  C CG1   . VAL B 2 778  ? 177.772 145.250 65.023  1.00 83.08  ? 770  VAL B CG1   1 
ATOM   6375  C CG2   . VAL B 2 778  ? 175.574 146.469 65.113  1.00 83.08  ? 770  VAL B CG2   1 
ATOM   6376  N N     . ALA B 2 779  ? 176.961 141.972 64.666  1.00 105.87 ? 771  ALA B N     1 
ATOM   6377  C CA    . ALA B 2 779  ? 177.824 140.855 65.013  1.00 105.87 ? 771  ALA B CA    1 
ATOM   6378  C C     . ALA B 2 779  ? 179.280 141.165 64.686  1.00 105.87 ? 771  ALA B C     1 
ATOM   6379  O O     . ALA B 2 779  ? 179.592 141.994 63.825  1.00 105.87 ? 771  ALA B O     1 
ATOM   6380  C CB    . ALA B 2 779  ? 177.383 139.576 64.289  1.00 105.87 ? 771  ALA B CB    1 
ATOM   6381  N N     . TYR B 2 780  ? 180.166 140.436 65.367  1.00 128.89 ? 772  TYR B N     1 
ATOM   6382  C CA    . TYR B 2 780  ? 181.602 140.702 65.387  1.00 128.89 ? 772  TYR B CA    1 
ATOM   6383  C C     . TYR B 2 780  ? 182.394 139.402 65.333  1.00 128.89 ? 772  TYR B C     1 
ATOM   6384  O O     . TYR B 2 780  ? 182.140 138.482 66.115  1.00 128.89 ? 772  TYR B O     1 
ATOM   6385  C CB    . TYR B 2 780  ? 181.991 141.489 66.641  1.00 128.89 ? 772  TYR B CB    1 
ATOM   6386  C CG    . TYR B 2 780  ? 183.442 141.907 66.738  1.00 128.89 ? 772  TYR B CG    1 
ATOM   6387  C CD1   . TYR B 2 780  ? 184.151 142.345 65.620  1.00 128.89 ? 772  TYR B CD1   1 
ATOM   6388  C CD2   . TYR B 2 780  ? 184.100 141.867 67.959  1.00 128.89 ? 772  TYR B CD2   1 
ATOM   6389  C CE1   . TYR B 2 780  ? 185.473 142.722 65.715  1.00 128.89 ? 772  TYR B CE1   1 
ATOM   6390  C CE2   . TYR B 2 780  ? 185.438 142.250 68.065  1.00 128.89 ? 772  TYR B CE2   1 
ATOM   6391  C CZ    . TYR B 2 780  ? 186.112 142.679 66.943  1.00 128.89 ? 772  TYR B CZ    1 
ATOM   6392  O OH    . TYR B 2 780  ? 187.434 143.047 67.046  1.00 128.89 ? 772  TYR B OH    1 
ATOM   6393  N N     . ALA B 2 781  ? 183.380 139.340 64.446  1.00 140.50 ? 773  ALA B N     1 
ATOM   6394  C CA    . ALA B 2 781  ? 184.403 138.296 64.466  1.00 140.50 ? 773  ALA B CA    1 
ATOM   6395  C C     . ALA B 2 781  ? 185.730 138.983 64.738  1.00 140.50 ? 773  ALA B C     1 
ATOM   6396  O O     . ALA B 2 781  ? 186.267 139.668 63.861  1.00 140.50 ? 773  ALA B O     1 
ATOM   6397  C CB    . ALA B 2 781  ? 184.454 137.517 63.155  1.00 140.50 ? 773  ALA B CB    1 
ATOM   6398  N N     . SER B 2 782  ? 186.254 138.802 65.945  1.00 133.99 ? 774  SER B N     1 
ATOM   6399  C CA    . SER B 2 782  ? 187.442 139.519 66.377  1.00 133.99 ? 774  SER B CA    1 
ATOM   6400  C C     . SER B 2 782  ? 188.681 138.958 65.699  1.00 133.99 ? 774  SER B C     1 
ATOM   6401  O O     . SER B 2 782  ? 188.655 137.873 65.109  1.00 133.99 ? 774  SER B O     1 
ATOM   6402  C CB    . SER B 2 782  ? 187.619 139.423 67.890  1.00 133.99 ? 774  SER B CB    1 
ATOM   6403  N N     . GLN B 2 783  ? 189.750 139.770 65.711  1.00 146.56 ? 775  GLN B N     1 
ATOM   6404  C CA    . GLN B 2 783  ? 190.990 139.421 65.018  1.00 146.56 ? 775  GLN B CA    1 
ATOM   6405  C C     . GLN B 2 783  ? 191.576 138.143 65.604  1.00 146.56 ? 775  GLN B C     1 
ATOM   6406  O O     . GLN B 2 783  ? 192.139 137.314 64.881  1.00 146.56 ? 775  GLN B O     1 
ATOM   6407  C CB    . GLN B 2 783  ? 191.994 140.570 65.108  1.00 146.56 ? 775  GLN B CB    1 
ATOM   6408  N N     . LYS B 2 784  ? 191.430 137.968 66.914  1.00 142.80 ? 776  LYS B N     1 
ATOM   6409  C CA    . LYS B 2 784  ? 191.815 136.759 67.621  1.00 142.80 ? 776  LYS B CA    1 
ATOM   6410  C C     . LYS B 2 784  ? 190.519 136.168 68.155  1.00 142.80 ? 776  LYS B C     1 
ATOM   6411  O O     . LYS B 2 784  ? 189.826 136.829 68.948  1.00 142.80 ? 776  LYS B O     1 
ATOM   6412  C CB    . LYS B 2 784  ? 192.789 137.045 68.762  1.00 142.80 ? 776  LYS B CB    1 
ATOM   6413  N N     . PRO B 2 785  ? 190.117 134.981 67.707  1.00 128.95 ? 777  PRO B N     1 
ATOM   6414  C CA    . PRO B 2 785  ? 188.841 134.412 68.148  1.00 128.95 ? 777  PRO B CA    1 
ATOM   6415  C C     . PRO B 2 785  ? 188.858 134.005 69.612  1.00 128.95 ? 777  PRO B C     1 
ATOM   6416  O O     . PRO B 2 785  ? 189.877 133.575 70.158  1.00 128.95 ? 777  PRO B O     1 
ATOM   6417  C CB    . PRO B 2 785  ? 188.666 133.184 67.244  1.00 128.95 ? 777  PRO B CB    1 
ATOM   6418  C CG    . PRO B 2 785  ? 190.051 132.848 66.796  1.00 128.95 ? 777  PRO B CG    1 
ATOM   6419  C CD    . PRO B 2 785  ? 190.757 134.162 66.668  1.00 128.95 ? 777  PRO B CD    1 
ATOM   6420  N N     . TRP B 2 786  ? 187.699 134.153 70.246  1.00 98.26  ? 778  TRP B N     1 
ATOM   6421  C CA    . TRP B 2 786  ? 187.522 133.807 71.644  1.00 98.26  ? 778  TRP B CA    1 
ATOM   6422  C C     . TRP B 2 786  ? 186.247 132.991 71.783  1.00 98.26  ? 778  TRP B C     1 
ATOM   6423  O O     . TRP B 2 786  ? 185.336 133.070 70.956  1.00 98.26  ? 778  TRP B O     1 
ATOM   6424  C CB    . TRP B 2 786  ? 187.454 135.052 72.538  1.00 98.26  ? 778  TRP B CB    1 
ATOM   6425  N N     . LEU B 2 787  ? 186.194 132.211 72.850  1.00 91.51  ? 779  LEU B N     1 
ATOM   6426  C CA    . LEU B 2 787  ? 185.122 131.258 73.067  1.00 91.51  ? 779  LEU B CA    1 
ATOM   6427  C C     . LEU B 2 787  ? 184.472 131.519 74.411  1.00 91.51  ? 779  LEU B C     1 
ATOM   6428  O O     . LEU B 2 787  ? 185.161 131.753 75.408  1.00 91.51  ? 779  LEU B O     1 
ATOM   6429  C CB    . LEU B 2 787  ? 185.637 129.818 73.011  1.00 91.51  ? 779  LEU B CB    1 
ATOM   6430  N N     . LEU B 2 788  ? 183.148 131.478 74.440  1.00 88.58  ? 780  LEU B N     1 
ATOM   6431  C CA    . LEU B 2 788  ? 182.463 131.495 75.717  1.00 88.58  ? 780  LEU B CA    1 
ATOM   6432  C C     . LEU B 2 788  ? 182.470 130.081 76.280  1.00 88.58  ? 780  LEU B C     1 
ATOM   6433  O O     . LEU B 2 788  ? 182.464 129.095 75.538  1.00 88.58  ? 780  LEU B O     1 
ATOM   6434  C CB    . LEU B 2 788  ? 181.033 132.011 75.561  1.00 88.58  ? 780  LEU B CB    1 
ATOM   6435  N N     . ASN B 2 789  ? 182.495 129.987 77.606  1.00 107.98 ? 781  ASN B N     1 
ATOM   6436  C CA    . ASN B 2 789  ? 182.390 128.695 78.271  1.00 107.98 ? 781  ASN B CA    1 
ATOM   6437  C C     . ASN B 2 789  ? 180.983 128.114 78.246  1.00 107.98 ? 781  ASN B C     1 
ATOM   6438  O O     . ASN B 2 789  ? 180.212 128.312 79.191  1.00 107.98 ? 781  ASN B O     1 
ATOM   6439  C CB    . ASN B 2 789  ? 182.874 128.807 79.718  1.00 107.98 ? 781  ASN B CB    1 
ATOM   6440  N N     . ALA B 2 790  ? 180.654 127.385 77.182  1.00 110.35 ? 782  ALA B N     1 
ATOM   6441  C CA    . ALA B 2 790  ? 179.334 126.792 77.013  1.00 110.35 ? 782  ALA B CA    1 
ATOM   6442  C C     . ALA B 2 790  ? 179.431 125.701 75.954  1.00 110.35 ? 782  ALA B C     1 
ATOM   6443  O O     . ALA B 2 790  ? 180.504 125.434 75.407  1.00 110.35 ? 782  ALA B O     1 
ATOM   6444  C CB    . ALA B 2 790  ? 178.288 127.840 76.617  1.00 110.35 ? 782  ALA B CB    1 
ATOM   6445  N N     . THR B 2 791  ? 178.296 125.052 75.695  1.00 108.74 ? 783  THR B N     1 
ATOM   6446  C CA    . THR B 2 791  ? 178.124 124.185 74.537  1.00 108.74 ? 783  THR B CA    1 
ATOM   6447  C C     . THR B 2 791  ? 178.388 124.925 73.228  1.00 108.74 ? 783  THR B C     1 
ATOM   6448  O O     . THR B 2 791  ? 178.324 126.157 73.150  1.00 108.74 ? 783  THR B O     1 
ATOM   6449  C CB    . THR B 2 791  ? 176.714 123.598 74.511  1.00 108.74 ? 783  THR B CB    1 
ATOM   6450  N N     . VAL B 2 792  ? 178.703 124.140 72.195  1.00 96.74  ? 784  VAL B N     1 
ATOM   6451  C CA    . VAL B 2 792  ? 178.771 124.652 70.828  1.00 96.74  ? 784  VAL B CA    1 
ATOM   6452  C C     . VAL B 2 792  ? 177.433 125.254 70.425  1.00 96.74  ? 784  VAL B C     1 
ATOM   6453  O O     . VAL B 2 792  ? 177.375 126.293 69.753  1.00 96.74  ? 784  VAL B O     1 
ATOM   6454  C CB    . VAL B 2 792  ? 179.204 123.538 69.859  1.00 96.74  ? 784  VAL B CB    1 
ATOM   6455  N N     . GLU B 2 793  ? 176.346 124.556 70.771  1.00 97.44  ? 785  GLU B N     1 
ATOM   6456  C CA    . GLU B 2 793  ? 174.982 125.041 70.575  1.00 97.44  ? 785  GLU B CA    1 
ATOM   6457  C C     . GLU B 2 793  ? 174.757 126.424 71.182  1.00 97.44  ? 785  GLU B C     1 
ATOM   6458  O O     . GLU B 2 793  ? 174.264 127.330 70.508  1.00 97.44  ? 785  GLU B O     1 
ATOM   6459  C CB    . GLU B 2 793  ? 173.993 124.035 71.165  1.00 97.44  ? 785  GLU B CB    1 
ATOM   6460  N N     . GLU B 2 794  ? 175.088 126.598 72.463  1.00 113.81 ? 786  GLU B N     1 
ATOM   6461  C CA    . GLU B 2 794  ? 174.924 127.915 73.074  1.00 113.81 ? 786  GLU B CA    1 
ATOM   6462  C C     . GLU B 2 794  ? 175.949 128.934 72.590  1.00 113.81 ? 786  GLU B C     1 
ATOM   6463  O O     . GLU B 2 794  ? 175.683 130.139 72.653  1.00 113.81 ? 786  GLU B O     1 
ATOM   6464  C CB    . GLU B 2 794  ? 175.001 127.791 74.596  1.00 113.81 ? 786  GLU B CB    1 
ATOM   6465  N N     . ASN B 2 795  ? 177.104 128.483 72.095  1.00 102.18 ? 787  ASN B N     1 
ATOM   6466  C CA    . ASN B 2 795  ? 178.025 129.364 71.379  1.00 102.18 ? 787  ASN B CA    1 
ATOM   6467  C C     . ASN B 2 795  ? 177.433 129.854 70.065  1.00 102.18 ? 787  ASN B C     1 
ATOM   6468  O O     . ASN B 2 795  ? 177.771 130.944 69.594  1.00 102.18 ? 787  ASN B O     1 
ATOM   6469  C CB    . ASN B 2 795  ? 179.348 128.641 71.128  1.00 102.18 ? 787  ASN B CB    1 
ATOM   6470  N N     . ILE B 2 796  ? 176.542 129.062 69.480  1.00 100.03 ? 788  ILE B N     1 
ATOM   6471  C CA    . ILE B 2 796  ? 175.813 129.410 68.268  1.00 100.03 ? 788  ILE B CA    1 
ATOM   6472  C C     . ILE B 2 796  ? 174.610 130.305 68.553  1.00 100.03 ? 788  ILE B C     1 
ATOM   6473  O O     . ILE B 2 796  ? 174.368 131.268 67.818  1.00 100.03 ? 788  ILE B O     1 
ATOM   6474  C CB    . ILE B 2 796  ? 175.398 128.131 67.519  1.00 100.03 ? 788  ILE B CB    1 
ATOM   6475  N N     . THR B 2 797  ? 173.814 129.977 69.576  1.00 97.88  ? 789  THR B N     1 
ATOM   6476  C CA    . THR B 2 797  ? 172.602 130.737 69.871  1.00 97.88  ? 789  THR B CA    1 
ATOM   6477  C C     . THR B 2 797  ? 172.872 132.190 70.257  1.00 97.88  ? 789  THR B C     1 
ATOM   6478  O O     . THR B 2 797  ? 172.293 133.092 69.640  1.00 97.88  ? 789  THR B O     1 
ATOM   6479  C CB    . THR B 2 797  ? 171.821 130.043 70.985  1.00 97.88  ? 789  THR B CB    1 
ATOM   6480  N N     . PHE B 2 798  ? 173.804 132.443 71.189  1.00 117.93 ? 790  PHE B N     1 
ATOM   6481  C CA    . PHE B 2 798  ? 174.224 133.804 71.586  1.00 117.93 ? 790  PHE B CA    1 
ATOM   6482  C C     . PHE B 2 798  ? 173.032 134.699 71.974  1.00 117.93 ? 790  PHE B C     1 
ATOM   6483  O O     . PHE B 2 798  ? 172.736 135.706 71.335  1.00 117.93 ? 790  PHE B O     1 
ATOM   6484  C CB    . PHE B 2 798  ? 175.098 134.427 70.480  1.00 117.93 ? 790  PHE B CB    1 
ATOM   6485  C CG    . PHE B 2 798  ? 175.860 135.674 70.886  1.00 117.93 ? 790  PHE B CG    1 
ATOM   6486  C CD1   . PHE B 2 798  ? 177.097 135.589 71.506  1.00 117.93 ? 790  PHE B CD1   1 
ATOM   6487  C CD2   . PHE B 2 798  ? 175.396 136.934 70.517  1.00 117.93 ? 790  PHE B CD2   1 
ATOM   6488  C CE1   . PHE B 2 798  ? 177.800 136.741 71.841  1.00 117.93 ? 790  PHE B CE1   1 
ATOM   6489  C CE2   . PHE B 2 798  ? 176.083 138.080 70.847  1.00 117.93 ? 790  PHE B CE2   1 
ATOM   6490  C CZ    . PHE B 2 798  ? 177.290 137.987 71.503  1.00 117.93 ? 790  PHE B CZ    1 
ATOM   6491  N N     . GLU B 2 799  ? 172.273 134.216 72.964  1.00 110.69 ? 791  GLU B N     1 
ATOM   6492  C CA    . GLU B 2 799  ? 171.090 134.882 73.528  1.00 110.69 ? 791  GLU B CA    1 
ATOM   6493  C C     . GLU B 2 799  ? 169.986 135.081 72.481  1.00 110.69 ? 791  GLU B C     1 
ATOM   6494  O O     . GLU B 2 799  ? 169.645 136.194 72.076  1.00 110.69 ? 791  GLU B O     1 
ATOM   6495  C CB    . GLU B 2 799  ? 171.464 136.208 74.207  1.00 110.69 ? 791  GLU B CB    1 
ATOM   6496  N N     . SER B 2 800  ? 169.445 133.949 72.052  1.00 116.46 ? 792  SER B N     1 
ATOM   6497  C CA    . SER B 2 800  ? 168.462 133.835 70.986  1.00 116.46 ? 792  SER B CA    1 
ATOM   6498  C C     . SER B 2 800  ? 167.614 132.615 71.314  1.00 116.46 ? 792  SER B C     1 
ATOM   6499  O O     . SER B 2 800  ? 168.043 131.762 72.100  1.00 116.46 ? 792  SER B O     1 
ATOM   6500  C CB    . SER B 2 800  ? 169.123 133.709 69.607  1.00 116.46 ? 792  SER B CB    1 
ATOM   6501  O OG    . SER B 2 800  ? 169.869 132.519 69.513  1.00 116.46 ? 792  SER B OG    1 
ATOM   6502  N N     . PRO B 2 801  ? 166.415 132.494 70.746  1.00 121.30 ? 793  PRO B N     1 
ATOM   6503  C CA    . PRO B 2 801  ? 165.752 131.191 70.807  1.00 121.30 ? 793  PRO B CA    1 
ATOM   6504  C C     . PRO B 2 801  ? 166.359 130.196 69.830  1.00 121.30 ? 793  PRO B C     1 
ATOM   6505  O O     . PRO B 2 801  ? 166.862 130.542 68.758  1.00 121.30 ? 793  PRO B O     1 
ATOM   6506  C CB    . PRO B 2 801  ? 164.296 131.522 70.466  1.00 121.30 ? 793  PRO B CB    1 
ATOM   6507  C CG    . PRO B 2 801  ? 164.381 132.699 69.585  1.00 121.30 ? 793  PRO B CG    1 
ATOM   6508  C CD    . PRO B 2 801  ? 165.581 133.494 70.046  1.00 121.30 ? 793  PRO B CD    1 
ATOM   6509  N N     . PHE B 2 802  ? 166.287 128.934 70.239  1.00 138.67 ? 794  PHE B N     1 
ATOM   6510  C CA    . PHE B 2 802  ? 166.677 127.787 69.431  1.00 138.67 ? 794  PHE B CA    1 
ATOM   6511  C C     . PHE B 2 802  ? 165.713 127.403 68.317  1.00 138.67 ? 794  PHE B C     1 
ATOM   6512  O O     . PHE B 2 802  ? 164.525 127.156 68.547  1.00 138.67 ? 794  PHE B O     1 
ATOM   6513  C CB    . PHE B 2 802  ? 166.949 126.593 70.342  1.00 138.67 ? 794  PHE B CB    1 
ATOM   6514  C CG    . PHE B 2 802  ? 168.153 126.784 71.217  1.00 138.67 ? 794  PHE B CG    1 
ATOM   6515  C CD1   . PHE B 2 802  ? 169.424 126.511 70.726  1.00 138.67 ? 794  PHE B CD1   1 
ATOM   6516  C CD2   . PHE B 2 802  ? 168.023 127.280 72.506  1.00 138.67 ? 794  PHE B CD2   1 
ATOM   6517  C CE1   . PHE B 2 802  ? 170.541 126.697 71.519  1.00 138.67 ? 794  PHE B CE1   1 
ATOM   6518  C CE2   . PHE B 2 802  ? 169.137 127.473 73.302  1.00 138.67 ? 794  PHE B CE2   1 
ATOM   6519  C CZ    . PHE B 2 802  ? 170.399 127.181 72.808  1.00 138.67 ? 794  PHE B CZ    1 
ATOM   6520  N N     . ASN B 2 803  ? 166.262 127.363 67.112  1.00 110.22 ? 795  ASN B N     1 
ATOM   6521  C CA    . ASN B 2 803  ? 165.611 127.013 65.860  1.00 110.22 ? 795  ASN B CA    1 
ATOM   6522  C C     . ASN B 2 803  ? 166.516 125.927 65.298  1.00 110.22 ? 795  ASN B C     1 
ATOM   6523  O O     . ASN B 2 803  ? 167.734 126.109 65.284  1.00 110.22 ? 795  ASN B O     1 
ATOM   6524  C CB    . ASN B 2 803  ? 165.492 128.207 64.913  1.00 110.22 ? 795  ASN B CB    1 
ATOM   6525  N N     . LYS B 2 804  ? 165.952 124.805 64.849  1.00 98.34  ? 796  LYS B N     1 
ATOM   6526  C CA    . LYS B 2 804  ? 166.783 123.730 64.310  1.00 98.34  ? 796  LYS B CA    1 
ATOM   6527  C C     . LYS B 2 804  ? 166.740 123.597 62.794  1.00 98.34  ? 796  LYS B C     1 
ATOM   6528  O O     . LYS B 2 804  ? 167.567 122.866 62.230  1.00 98.34  ? 796  LYS B O     1 
ATOM   6529  C CB    . LYS B 2 804  ? 166.384 122.395 64.946  1.00 98.34  ? 796  LYS B CB    1 
ATOM   6530  N N     . GLN B 2 805  ? 165.950 124.417 62.113  1.00 80.12  ? 797  GLN B N     1 
ATOM   6531  C CA    . GLN B 2 805  ? 166.117 124.456 60.671  1.00 80.12  ? 797  GLN B CA    1 
ATOM   6532  C C     . GLN B 2 805  ? 167.156 125.510 60.383  1.00 80.12  ? 797  GLN B C     1 
ATOM   6533  O O     . GLN B 2 805  ? 167.962 125.359 59.456  1.00 80.12  ? 797  GLN B O     1 
ATOM   6534  C CB    . GLN B 2 805  ? 164.792 124.771 59.974  1.00 80.12  ? 797  GLN B CB    1 
ATOM   6535  N N     . ARG B 2 806  ? 167.086 126.600 61.146  1.00 84.38  ? 798  ARG B N     1 
ATOM   6536  C CA    . ARG B 2 806  ? 168.086 127.646 61.052  1.00 84.38  ? 798  ARG B CA    1 
ATOM   6537  C C     . ARG B 2 806  ? 169.437 127.058 61.425  1.00 84.38  ? 798  ARG B C     1 
ATOM   6538  O O     . ARG B 2 806  ? 170.460 127.393 60.827  1.00 84.38  ? 798  ARG B O     1 
ATOM   6539  C CB    . ARG B 2 806  ? 167.720 128.810 61.965  1.00 84.38  ? 798  ARG B CB    1 
ATOM   6540  C CG    . ARG B 2 806  ? 166.443 129.507 61.568  1.00 84.38  ? 798  ARG B CG    1 
ATOM   6541  C CD    . ARG B 2 806  ? 166.653 130.229 60.267  1.00 84.38  ? 798  ARG B CD    1 
ATOM   6542  N NE    . ARG B 2 806  ? 167.695 131.238 60.413  1.00 84.38  ? 798  ARG B NE    1 
ATOM   6543  C CZ    . ARG B 2 806  ? 168.321 131.817 59.398  1.00 84.38  ? 798  ARG B CZ    1 
ATOM   6544  N NH1   . ARG B 2 806  ? 168.009 131.488 58.152  1.00 84.38  ? 798  ARG B NH1   1 
ATOM   6545  N NH2   . ARG B 2 806  ? 169.260 132.724 59.627  1.00 84.38  ? 798  ARG B NH2   1 
ATOM   6546  N N     . TYR B 2 807  ? 169.448 126.236 62.483  1.00 113.83 ? 799  TYR B N     1 
ATOM   6547  C CA    . TYR B 2 807  ? 170.642 125.500 62.897  1.00 113.83 ? 799  TYR B CA    1 
ATOM   6548  C C     . TYR B 2 807  ? 171.148 124.567 61.808  1.00 113.83 ? 799  TYR B C     1 
ATOM   6549  O O     . TYR B 2 807  ? 172.360 124.426 61.634  1.00 113.83 ? 799  TYR B O     1 
ATOM   6550  C CB    . TYR B 2 807  ? 170.365 124.687 64.161  1.00 113.83 ? 799  TYR B CB    1 
ATOM   6551  C CG    . TYR B 2 807  ? 171.573 123.971 64.723  1.00 113.83 ? 799  TYR B CG    1 
ATOM   6552  C CD1   . TYR B 2 807  ? 172.567 124.665 65.401  1.00 113.83 ? 799  TYR B CD1   1 
ATOM   6553  C CD2   . TYR B 2 807  ? 171.709 122.593 64.594  1.00 113.83 ? 799  TYR B CD2   1 
ATOM   6554  C CE1   . TYR B 2 807  ? 173.698 124.019 65.864  1.00 113.83 ? 799  TYR B CE1   1 
ATOM   6555  C CE2   . TYR B 2 807  ? 172.813 121.931 65.102  1.00 113.83 ? 799  TYR B CE2   1 
ATOM   6556  C CZ    . TYR B 2 807  ? 173.810 122.653 65.723  1.00 113.83 ? 799  TYR B CZ    1 
ATOM   6557  O OH    . TYR B 2 807  ? 174.879 121.991 66.281  1.00 113.83 ? 799  TYR B OH    1 
ATOM   6558  N N     . LYS B 2 808  ? 170.245 123.809 61.170  1.00 101.16 ? 800  LYS B N     1 
ATOM   6559  C CA    . LYS B 2 808  ? 170.665 122.962 60.051  1.00 101.16 ? 800  LYS B CA    1 
ATOM   6560  C C     . LYS B 2 808  ? 171.307 123.762 58.912  1.00 101.16 ? 800  LYS B C     1 
ATOM   6561  O O     . LYS B 2 808  ? 172.382 123.399 58.411  1.00 101.16 ? 800  LYS B O     1 
ATOM   6562  C CB    . LYS B 2 808  ? 169.467 122.167 59.534  1.00 101.16 ? 800  LYS B CB    1 
ATOM   6563  N N     . MET B 2 809  ? 170.672 124.870 58.517  1.00 92.29  ? 801  MET B N     1 
ATOM   6564  C CA    . MET B 2 809  ? 171.220 125.742 57.479  1.00 92.29  ? 801  MET B CA    1 
ATOM   6565  C C     . MET B 2 809  ? 172.538 126.385 57.891  1.00 92.29  ? 801  MET B C     1 
ATOM   6566  O O     . MET B 2 809  ? 173.440 126.554 57.066  1.00 92.29  ? 801  MET B O     1 
ATOM   6567  C CB    . MET B 2 809  ? 170.200 126.819 57.116  1.00 92.29  ? 801  MET B CB    1 
ATOM   6568  N N     . VAL B 2 810  ? 172.641 126.794 59.153  1.00 98.11  ? 802  VAL B N     1 
ATOM   6569  C CA    . VAL B 2 810  ? 173.879 127.336 59.699  1.00 98.11  ? 802  VAL B CA    1 
ATOM   6570  C C     . VAL B 2 810  ? 174.984 126.292 59.737  1.00 98.11  ? 802  VAL B C     1 
ATOM   6571  O O     . VAL B 2 810  ? 176.132 126.585 59.392  1.00 98.11  ? 802  VAL B O     1 
ATOM   6572  C CB    . VAL B 2 810  ? 173.621 127.928 61.095  1.00 98.11  ? 802  VAL B CB    1 
ATOM   6573  N N     . ILE B 2 811  ? 174.661 125.073 60.181  1.00 103.90 ? 803  ILE B N     1 
ATOM   6574  C CA    . ILE B 2 811  ? 175.626 123.973 60.224  1.00 103.90 ? 803  ILE B CA    1 
ATOM   6575  C C     . ILE B 2 811  ? 176.176 123.670 58.840  1.00 103.90 ? 803  ILE B C     1 
ATOM   6576  O O     . ILE B 2 811  ? 177.384 123.465 58.672  1.00 103.90 ? 803  ILE B O     1 
ATOM   6577  C CB    . ILE B 2 811  ? 174.985 122.727 60.856  1.00 103.90 ? 803  ILE B CB    1 
ATOM   6578  N N     . GLU B 2 812  ? 175.298 123.586 57.837  1.00 120.54 ? 804  GLU B N     1 
ATOM   6579  C CA    . GLU B 2 812  ? 175.778 123.379 56.474  1.00 120.54 ? 804  GLU B CA    1 
ATOM   6580  C C     . GLU B 2 812  ? 176.575 124.579 55.965  1.00 120.54 ? 804  GLU B C     1 
ATOM   6581  O O     . GLU B 2 812  ? 177.661 124.425 55.396  1.00 120.54 ? 804  GLU B O     1 
ATOM   6582  C CB    . GLU B 2 812  ? 174.600 123.084 55.547  1.00 120.54 ? 804  GLU B CB    1 
ATOM   6583  N N     . ALA B 2 813  ? 176.034 125.786 56.156  1.00 121.50 ? 805  ALA B N     1 
ATOM   6584  C CA    . ALA B 2 813  ? 176.663 127.015 55.677  1.00 121.50 ? 805  ALA B CA    1 
ATOM   6585  C C     . ALA B 2 813  ? 177.975 127.369 56.372  1.00 121.50 ? 805  ALA B C     1 
ATOM   6586  O O     . ALA B 2 813  ? 178.825 128.025 55.762  1.00 121.50 ? 805  ALA B O     1 
ATOM   6587  C CB    . ALA B 2 813  ? 175.681 128.178 55.816  1.00 121.50 ? 805  ALA B CB    1 
ATOM   6588  N N     . CYS B 2 814  ? 178.153 127.009 57.641  1.00 121.00 ? 806  CYS B N     1 
ATOM   6589  C CA    . CYS B 2 814  ? 179.382 127.360 58.348  1.00 121.00 ? 806  CYS B CA    1 
ATOM   6590  C C     . CYS B 2 814  ? 180.446 126.274 58.336  1.00 121.00 ? 806  CYS B C     1 
ATOM   6591  O O     . CYS B 2 814  ? 181.403 126.381 59.113  1.00 121.00 ? 806  CYS B O     1 
ATOM   6592  C CB    . CYS B 2 814  ? 179.082 127.757 59.794  1.00 121.00 ? 806  CYS B CB    1 
ATOM   6593  N N     . SER B 2 815  ? 180.268 125.212 57.537  1.00 117.92 ? 807  SER B N     1 
ATOM   6594  C CA    . SER B 2 815  ? 181.262 124.141 57.354  1.00 117.92 ? 807  SER B CA    1 
ATOM   6595  C C     . SER B 2 815  ? 181.498 123.394 58.660  1.00 117.92 ? 807  SER B C     1 
ATOM   6596  O O     . SER B 2 815  ? 182.614 122.960 58.957  1.00 117.92 ? 807  SER B O     1 
ATOM   6597  C CB    . SER B 2 815  ? 182.586 124.648 56.765  1.00 117.92 ? 807  SER B CB    1 
ATOM   6598  N N     . LEU B 2 816  ? 180.440 123.254 59.450  1.00 126.22 ? 808  LEU B N     1 
ATOM   6599  C CA    . LEU B 2 816  ? 180.540 122.722 60.796  1.00 126.22 ? 808  LEU B CA    1 
ATOM   6600  C C     . LEU B 2 816  ? 180.268 121.232 60.857  1.00 126.22 ? 808  LEU B C     1 
ATOM   6601  O O     . LEU B 2 816  ? 180.384 120.649 61.939  1.00 126.22 ? 808  LEU B O     1 
ATOM   6602  C CB    . LEU B 2 816  ? 179.566 123.459 61.722  1.00 126.22 ? 808  LEU B CB    1 
ATOM   6603  N N     . GLN B 2 817  ? 179.850 120.626 59.743  1.00 121.13 ? 809  GLN B N     1 
ATOM   6604  C CA    . GLN B 2 817  ? 179.692 119.173 59.688  1.00 121.13 ? 809  GLN B CA    1 
ATOM   6605  C C     . GLN B 2 817  ? 180.981 118.405 60.009  1.00 121.13 ? 809  GLN B C     1 
ATOM   6606  O O     . GLN B 2 817  ? 180.888 117.422 60.761  1.00 121.13 ? 809  GLN B O     1 
ATOM   6607  C CB    . GLN B 2 817  ? 179.071 118.764 58.345  1.00 121.13 ? 809  GLN B CB    1 
ATOM   6608  N N     . PRO B 2 818  ? 182.169 118.702 59.421  1.00 125.72 ? 810  PRO B N     1 
ATOM   6609  C CA    . PRO B 2 818  ? 183.384 117.991 59.879  1.00 125.72 ? 810  PRO B CA    1 
ATOM   6610  C C     . PRO B 2 818  ? 183.710 118.184 61.355  1.00 125.72 ? 810  PRO B C     1 
ATOM   6611  O O     . PRO B 2 818  ? 184.197 117.244 62.006  1.00 125.72 ? 810  PRO B O     1 
ATOM   6612  C CB    . PRO B 2 818  ? 184.498 118.566 58.993  1.00 125.72 ? 810  PRO B CB    1 
ATOM   6613  C CG    . PRO B 2 818  ? 183.835 119.083 57.822  1.00 125.72 ? 810  PRO B CG    1 
ATOM   6614  C CD    . PRO B 2 818  ? 182.513 119.584 58.283  1.00 125.72 ? 810  PRO B CD    1 
ATOM   6615  N N     . ASP B 2 819  ? 183.383 119.356 61.912  1.00 131.13 ? 811  ASP B N     1 
ATOM   6616  C CA    . ASP B 2 819  ? 183.620 119.604 63.330  1.00 131.13 ? 811  ASP B CA    1 
ATOM   6617  C C     . ASP B 2 819  ? 182.687 118.764 64.185  1.00 131.13 ? 811  ASP B C     1 
ATOM   6618  O O     . ASP B 2 819  ? 183.114 118.210 65.206  1.00 131.13 ? 811  ASP B O     1 
ATOM   6619  C CB    . ASP B 2 819  ? 183.449 121.091 63.635  1.00 131.13 ? 811  ASP B CB    1 
ATOM   6620  N N     . ILE B 2 820  ? 181.392 118.753 63.843  1.00 136.71 ? 812  ILE B N     1 
ATOM   6621  C CA    . ILE B 2 820  ? 180.430 117.915 64.554  1.00 136.71 ? 812  ILE B CA    1 
ATOM   6622  C C     . ILE B 2 820  ? 180.858 116.461 64.443  1.00 136.71 ? 812  ILE B C     1 
ATOM   6623  O O     . ILE B 2 820  ? 180.772 115.690 65.407  1.00 136.71 ? 812  ILE B O     1 
ATOM   6624  C CB    . ILE B 2 820  ? 179.010 118.136 64.003  1.00 136.71 ? 812  ILE B CB    1 
ATOM   6625  N N     . ASP B 2 821  ? 181.291 116.067 63.235  1.00 135.41 ? 813  ASP B N     1 
ATOM   6626  C CA    . ASP B 2 821  ? 181.736 114.709 62.940  1.00 135.41 ? 813  ASP B CA    1 
ATOM   6627  C C     . ASP B 2 821  ? 182.923 114.305 63.803  1.00 135.41 ? 813  ASP B C     1 
ATOM   6628  O O     . ASP B 2 821  ? 183.100 113.118 64.099  1.00 135.41 ? 813  ASP B O     1 
ATOM   6629  C CB    . ASP B 2 821  ? 182.098 114.590 61.461  1.00 135.41 ? 813  ASP B CB    1 
ATOM   6630  N N     . ILE B 2 822  ? 183.739 115.272 64.223  1.00 127.96 ? 814  ILE B N     1 
ATOM   6631  C CA    . ILE B 2 822  ? 184.869 114.976 65.091  1.00 127.96 ? 814  ILE B CA    1 
ATOM   6632  C C     . ILE B 2 822  ? 184.603 115.411 66.528  1.00 127.96 ? 814  ILE B C     1 
ATOM   6633  O O     . ILE B 2 822  ? 185.507 115.349 67.367  1.00 127.96 ? 814  ILE B O     1 
ATOM   6634  C CB    . ILE B 2 822  ? 186.159 115.617 64.559  1.00 127.96 ? 814  ILE B CB    1 
ATOM   6635  N N     . LEU B 2 823  ? 183.342 115.872 66.842  1.00 126.39 ? 815  LEU B N     1 
ATOM   6636  C CA    . LEU B 2 823  ? 183.123 116.213 68.241  1.00 126.39 ? 815  LEU B CA    1 
ATOM   6637  C C     . LEU B 2 823  ? 182.512 115.018 68.966  1.00 126.39 ? 815  LEU B C     1 
ATOM   6638  O O     . LEU B 2 823  ? 181.685 114.308 68.383  1.00 126.39 ? 815  LEU B O     1 
ATOM   6639  C CB    . LEU B 2 823  ? 182.192 117.417 68.364  1.00 126.39 ? 815  LEU B CB    1 
ATOM   6640  N N     . PRO B 2 824  ? 182.943 114.758 70.210  1.00 133.75 ? 816  PRO B N     1 
ATOM   6641  C CA    . PRO B 2 824  ? 182.556 113.500 70.878  1.00 133.75 ? 816  PRO B CA    1 
ATOM   6642  C C     . PRO B 2 824  ? 181.066 113.364 71.137  1.00 133.75 ? 816  PRO B C     1 
ATOM   6643  O O     . PRO B 2 824  ? 180.544 112.244 71.126  1.00 133.75 ? 816  PRO B O     1 
ATOM   6644  C CB    . PRO B 2 824  ? 183.347 113.541 72.194  1.00 133.75 ? 816  PRO B CB    1 
ATOM   6645  C CG    . PRO B 2 824  ? 183.689 114.973 72.398  1.00 133.75 ? 816  PRO B CG    1 
ATOM   6646  C CD    . PRO B 2 824  ? 183.880 115.545 71.031  1.00 133.75 ? 816  PRO B CD    1 
ATOM   6647  N N     . HIS B 2 825  ? 180.367 114.472 71.384  1.00 131.16 ? 817  HIS B N     1 
ATOM   6648  C CA    . HIS B 2 825  ? 178.928 114.458 71.618  1.00 131.16 ? 817  HIS B CA    1 
ATOM   6649  C C     . HIS B 2 825  ? 178.190 115.455 70.735  1.00 131.16 ? 817  HIS B C     1 
ATOM   6650  O O     . HIS B 2 825  ? 177.088 115.892 71.083  1.00 131.16 ? 817  HIS B O     1 
ATOM   6651  C CB    . HIS B 2 825  ? 178.614 114.684 73.094  1.00 131.16 ? 817  HIS B CB    1 
ATOM   6652  C CG    . HIS B 2 825  ? 179.146 113.606 73.981  1.00 131.16 ? 817  HIS B CG    1 
ATOM   6653  N ND1   . HIS B 2 825  ? 178.592 112.345 74.027  1.00 131.16 ? 817  HIS B ND1   1 
ATOM   6654  C CD2   . HIS B 2 825  ? 180.190 113.591 74.841  1.00 131.16 ? 817  HIS B CD2   1 
ATOM   6655  C CE1   . HIS B 2 825  ? 179.266 111.602 74.884  1.00 131.16 ? 817  HIS B CE1   1 
ATOM   6656  N NE2   . HIS B 2 825  ? 180.242 112.333 75.393  1.00 131.16 ? 817  HIS B NE2   1 
ATOM   6657  N N     . GLY B 2 826  ? 178.757 115.785 69.576  1.00 137.56 ? 818  GLY B N     1 
ATOM   6658  C CA    . GLY B 2 826  ? 178.159 116.792 68.711  1.00 137.56 ? 818  GLY B CA    1 
ATOM   6659  C C     . GLY B 2 826  ? 178.033 118.166 69.350  1.00 137.56 ? 818  GLY B C     1 
ATOM   6660  O O     . GLY B 2 826  ? 179.002 118.728 69.871  1.00 137.56 ? 818  GLY B O     1 
ATOM   6661  N N     . ASP B 2 827  ? 176.811 118.711 69.323  1.00 123.25 ? 819  ASP B N     1 
ATOM   6662  C CA    . ASP B 2 827  ? 176.527 120.004 69.938  1.00 123.25 ? 819  ASP B CA    1 
ATOM   6663  C C     . ASP B 2 827  ? 176.515 119.968 71.460  1.00 123.25 ? 819  ASP B C     1 
ATOM   6664  O O     . ASP B 2 827  ? 176.621 121.027 72.087  1.00 123.25 ? 819  ASP B O     1 
ATOM   6665  C CB    . ASP B 2 827  ? 175.185 120.536 69.436  1.00 123.25 ? 819  ASP B CB    1 
ATOM   6666  N N     . GLN B 2 828  ? 176.396 118.795 72.073  1.00 122.51 ? 820  GLN B N     1 
ATOM   6667  C CA    . GLN B 2 828  ? 176.413 118.723 73.528  1.00 122.51 ? 820  GLN B CA    1 
ATOM   6668  C C     . GLN B 2 828  ? 177.818 118.705 74.113  1.00 122.51 ? 820  GLN B C     1 
ATOM   6669  O O     . GLN B 2 828  ? 177.954 118.595 75.336  1.00 122.51 ? 820  GLN B O     1 
ATOM   6670  C CB    . GLN B 2 828  ? 175.654 117.481 73.997  1.00 122.51 ? 820  GLN B CB    1 
ATOM   6671  N N     . THR B 2 829  ? 178.853 118.774 73.278  1.00 124.73 ? 821  THR B N     1 
ATOM   6672  C CA    . THR B 2 829  ? 180.219 118.945 73.758  1.00 124.73 ? 821  THR B CA    1 
ATOM   6673  C C     . THR B 2 829  ? 180.406 120.256 74.515  1.00 124.73 ? 821  THR B C     1 
ATOM   6674  O O     . THR B 2 829  ? 180.068 121.333 74.015  1.00 124.73 ? 821  THR B O     1 
ATOM   6675  C CB    . THR B 2 829  ? 181.195 118.883 72.585  1.00 124.73 ? 821  THR B CB    1 
ATOM   6676  N N     . GLN B 2 830  ? 180.926 120.153 75.738  1.00 135.23 ? 822  GLN B N     1 
ATOM   6677  C CA    . GLN B 2 830  ? 181.327 121.323 76.509  1.00 135.23 ? 822  GLN B CA    1 
ATOM   6678  C C     . GLN B 2 830  ? 182.526 121.993 75.848  1.00 135.23 ? 822  GLN B C     1 
ATOM   6679  O O     . GLN B 2 830  ? 183.552 121.349 75.608  1.00 135.23 ? 822  GLN B O     1 
ATOM   6680  C CB    . GLN B 2 830  ? 181.666 120.925 77.945  1.00 135.23 ? 822  GLN B CB    1 
ATOM   6681  N N     . ILE B 2 831  ? 182.404 123.283 75.553  1.00 108.11 ? 823  ILE B N     1 
ATOM   6682  C CA    . ILE B 2 831  ? 183.487 124.034 74.934  1.00 108.11 ? 823  ILE B CA    1 
ATOM   6683  C C     . ILE B 2 831  ? 183.833 125.236 75.804  1.00 108.11 ? 823  ILE B C     1 
ATOM   6684  O O     . ILE B 2 831  ? 183.170 125.534 76.798  1.00 108.11 ? 823  ILE B O     1 
ATOM   6685  C CB    . ILE B 2 831  ? 183.144 124.482 73.502  1.00 108.11 ? 823  ILE B CB    1 
ATOM   6686  N N     . GLY B 2 832  ? 184.894 125.932 75.400  1.00 123.98 ? 824  GLY B N     1 
ATOM   6687  C CA    . GLY B 2 832  ? 185.471 126.995 76.194  1.00 123.98 ? 824  GLY B CA    1 
ATOM   6688  C C     . GLY B 2 832  ? 186.444 126.490 77.248  1.00 123.98 ? 824  GLY B C     1 
ATOM   6689  O O     . GLY B 2 832  ? 187.071 125.430 77.115  1.00 123.98 ? 824  GLY B O     1 
ATOM   6690  N N     . GLU B 2 833  ? 186.602 127.315 78.284  1.00 142.09 ? 825  GLU B N     1 
ATOM   6691  C CA    . GLU B 2 833  ? 187.547 127.073 79.371  1.00 142.09 ? 825  GLU B CA    1 
ATOM   6692  C C     . GLU B 2 833  ? 187.231 125.771 80.098  1.00 142.09 ? 825  GLU B C     1 
ATOM   6693  O O     . GLU B 2 833  ? 186.065 125.500 80.406  1.00 142.09 ? 825  GLU B O     1 
ATOM   6694  C CB    . GLU B 2 833  ? 187.525 128.244 80.352  1.00 142.09 ? 825  GLU B CB    1 
ATOM   6695  N N     . ARG B 2 834  ? 188.265 124.936 80.291  1.00 146.91 ? 826  ARG B N     1 
ATOM   6696  C CA    . ARG B 2 834  ? 188.228 123.637 80.974  1.00 146.91 ? 826  ARG B CA    1 
ATOM   6697  C C     . ARG B 2 834  ? 187.448 122.578 80.205  1.00 146.91 ? 826  ARG B C     1 
ATOM   6698  O O     . ARG B 2 834  ? 187.148 121.515 80.762  1.00 146.91 ? 826  ARG B O     1 
ATOM   6699  C CB    . ARG B 2 834  ? 187.705 123.723 82.416  1.00 146.91 ? 826  ARG B CB    1 
ATOM   6700  N N     . GLY B 2 835  ? 187.106 122.835 78.941  1.00 148.31 ? 827  GLY B N     1 
ATOM   6701  C CA    . GLY B 2 835  ? 186.423 121.887 78.102  1.00 148.31 ? 827  GLY B CA    1 
ATOM   6702  C C     . GLY B 2 835  ? 187.273 121.424 76.938  1.00 148.31 ? 827  GLY B C     1 
ATOM   6703  O O     . GLY B 2 835  ? 188.510 121.417 76.998  1.00 148.31 ? 827  GLY B O     1 
ATOM   6704  N N     . ILE B 2 836  ? 186.595 120.978 75.877  1.00 127.63 ? 828  ILE B N     1 
ATOM   6705  C CA    . ILE B 2 836  ? 187.281 120.562 74.656  1.00 127.63 ? 828  ILE B CA    1 
ATOM   6706  C C     . ILE B 2 836  ? 188.010 121.742 74.029  1.00 127.63 ? 828  ILE B C     1 
ATOM   6707  O O     . ILE B 2 836  ? 187.451 122.834 73.871  1.00 127.63 ? 828  ILE B O     1 
ATOM   6708  C CB    . ILE B 2 836  ? 186.280 119.942 73.674  1.00 127.63 ? 828  ILE B CB    1 
ATOM   6709  N N     . ASN B 2 837  ? 189.277 121.518 73.675  1.00 133.73 ? 829  ASN B N     1 
ATOM   6710  C CA    . ASN B 2 837  ? 190.150 122.551 73.117  1.00 133.73 ? 829  ASN B CA    1 
ATOM   6711  C C     . ASN B 2 837  ? 189.985 122.611 71.603  1.00 133.73 ? 829  ASN B C     1 
ATOM   6712  O O     . ASN B 2 837  ? 190.577 121.816 70.867  1.00 133.73 ? 829  ASN B O     1 
ATOM   6713  C CB    . ASN B 2 837  ? 191.600 122.281 73.503  1.00 133.73 ? 829  ASN B CB    1 
ATOM   6714  N N     . LEU B 2 838  ? 189.169 123.551 71.137  1.00 121.11 ? 830  LEU B N     1 
ATOM   6715  C CA    . LEU B 2 838  ? 188.985 123.764 69.709  1.00 121.11 ? 830  LEU B CA    1 
ATOM   6716  C C     . LEU B 2 838  ? 190.214 124.436 69.107  1.00 121.11 ? 830  LEU B C     1 
ATOM   6717  O O     . LEU B 2 838  ? 190.878 125.256 69.747  1.00 121.11 ? 830  LEU B O     1 
ATOM   6718  C CB    . LEU B 2 838  ? 187.743 124.618 69.448  1.00 121.11 ? 830  LEU B CB    1 
ATOM   6719  N N     . SER B 2 839  ? 190.525 124.066 67.864  1.00 104.65 ? 831  SER B N     1 
ATOM   6720  C CA    . SER B 2 839  ? 191.573 124.746 67.117  1.00 104.65 ? 831  SER B CA    1 
ATOM   6721  C C     . SER B 2 839  ? 191.172 126.187 66.793  1.00 104.65 ? 831  SER B C     1 
ATOM   6722  O O     . SER B 2 839  ? 190.009 126.587 66.915  1.00 104.65 ? 831  SER B O     1 
ATOM   6723  C CB    . SER B 2 839  ? 191.888 123.989 65.828  1.00 104.65 ? 831  SER B CB    1 
ATOM   6724  N N     . GLY B 2 840  ? 192.180 126.968 66.386  1.00 100.21 ? 832  GLY B N     1 
ATOM   6725  C CA    . GLY B 2 840  ? 191.943 128.327 65.915  1.00 100.21 ? 832  GLY B CA    1 
ATOM   6726  C C     . GLY B 2 840  ? 191.008 128.400 64.722  1.00 100.21 ? 832  GLY B C     1 
ATOM   6727  O O     . GLY B 2 840  ? 190.203 129.327 64.606  1.00 100.21 ? 832  GLY B O     1 
ATOM   6728  N N     . GLY B 2 841  ? 191.085 127.409 63.834  1.00 102.55 ? 833  GLY B N     1 
ATOM   6729  C CA    . GLY B 2 841  ? 190.143 127.350 62.735  1.00 102.55 ? 833  GLY B CA    1 
ATOM   6730  C C     . GLY B 2 841  ? 188.748 126.976 63.192  1.00 102.55 ? 833  GLY B C     1 
ATOM   6731  O O     . GLY B 2 841  ? 187.762 127.525 62.693  1.00 102.55 ? 833  GLY B O     1 
ATOM   6732  N N     . GLN B 2 842  ? 188.644 125.996 64.097  1.00 95.43  ? 834  GLN B N     1 
ATOM   6733  C CA    . GLN B 2 842  ? 187.345 125.631 64.660  1.00 95.43  ? 834  GLN B CA    1 
ATOM   6734  C C     . GLN B 2 842  ? 186.726 126.788 65.436  1.00 95.43  ? 834  GLN B C     1 
ATOM   6735  O O     . GLN B 2 842  ? 185.510 127.009 65.366  1.00 95.43  ? 834  GLN B O     1 
ATOM   6736  C CB    . GLN B 2 842  ? 187.494 124.406 65.561  1.00 95.43  ? 834  GLN B CB    1 
ATOM   6737  N N     . ARG B 2 843  ? 187.543 127.502 66.217  1.00 88.66  ? 835  ARG B N     1 
ATOM   6738  C CA    . ARG B 2 843  ? 187.090 128.714 66.896  1.00 88.66  ? 835  ARG B CA    1 
ATOM   6739  C C     . ARG B 2 843  ? 186.609 129.774 65.911  1.00 88.66  ? 835  ARG B C     1 
ATOM   6740  O O     . ARG B 2 843  ? 185.596 130.444 66.155  1.00 88.66  ? 835  ARG B O     1 
ATOM   6741  C CB    . ARG B 2 843  ? 188.213 129.270 67.773  1.00 88.66  ? 835  ARG B CB    1 
ATOM   6742  N N     . GLN B 2 844  ? 187.344 129.958 64.810  1.00 77.28  ? 836  GLN B N     1 
ATOM   6743  C CA    . GLN B 2 844  ? 186.937 130.902 63.771  1.00 77.28  ? 836  GLN B CA    1 
ATOM   6744  C C     . GLN B 2 844  ? 185.612 130.507 63.129  1.00 77.28  ? 836  GLN B C     1 
ATOM   6745  O O     . GLN B 2 844  ? 184.753 131.359 62.886  1.00 77.28  ? 836  GLN B O     1 
ATOM   6746  C CB    . GLN B 2 844  ? 188.032 131.010 62.712  1.00 77.28  ? 836  GLN B CB    1 
ATOM   6747  N N     . ARG B 2 845  ? 185.460 129.224 62.799  1.00 78.91  ? 837  ARG B N     1 
ATOM   6748  C CA    . ARG B 2 845  ? 184.213 128.713 62.235  1.00 78.91  ? 837  ARG B CA    1 
ATOM   6749  C C     . ARG B 2 845  ? 183.038 128.860 63.194  1.00 78.91  ? 837  ARG B C     1 
ATOM   6750  O O     . ARG B 2 845  ? 181.911 129.142 62.766  1.00 78.91  ? 837  ARG B O     1 
ATOM   6751  C CB    . ARG B 2 845  ? 184.392 127.250 61.834  1.00 78.91  ? 837  ARG B CB    1 
ATOM   6752  N N     . ILE B 2 846  ? 183.272 128.635 64.488  1.00 82.55  ? 838  ILE B N     1 
ATOM   6753  C CA    . ILE B 2 846  ? 182.261 128.914 65.508  1.00 82.55  ? 838  ILE B CA    1 
ATOM   6754  C C     . ILE B 2 846  ? 181.889 130.390 65.539  1.00 82.55  ? 838  ILE B C     1 
ATOM   6755  O O     . ILE B 2 846  ? 180.713 130.738 65.683  1.00 82.55  ? 838  ILE B O     1 
ATOM   6756  C CB    . ILE B 2 846  ? 182.751 128.429 66.884  1.00 82.55  ? 838  ILE B CB    1 
ATOM   6757  N N     . SER B 2 847  ? 182.887 131.276 65.476  1.00 75.27  ? 839  SER B N     1 
ATOM   6758  C CA    . SER B 2 847  ? 182.630 132.716 65.439  1.00 75.27  ? 839  SER B CA    1 
ATOM   6759  C C     . SER B 2 847  ? 181.835 133.138 64.205  1.00 75.27  ? 839  SER B C     1 
ATOM   6760  O O     . SER B 2 847  ? 180.912 133.962 64.299  1.00 75.27  ? 839  SER B O     1 
ATOM   6761  C CB    . SER B 2 847  ? 183.954 133.477 65.500  1.00 75.27  ? 839  SER B CB    1 
ATOM   6762  N N     . VAL B 2 848  ? 182.193 132.589 63.042  1.00 78.70  ? 840  VAL B N     1 
ATOM   6763  C CA    . VAL B 2 848  ? 181.442 132.806 61.806  1.00 78.70  ? 840  VAL B CA    1 
ATOM   6764  C C     . VAL B 2 848  ? 180.006 132.318 61.945  1.00 78.70  ? 840  VAL B C     1 
ATOM   6765  O O     . VAL B 2 848  ? 179.068 132.988 61.501  1.00 78.70  ? 840  VAL B O     1 
ATOM   6766  C CB    . VAL B 2 848  ? 182.157 132.126 60.626  1.00 78.70  ? 840  VAL B CB    1 
ATOM   6767  N N     . ALA B 2 849  ? 179.821 131.116 62.498  1.00 81.90  ? 841  ALA B N     1 
ATOM   6768  C CA    . ALA B 2 849  ? 178.476 130.582 62.707  1.00 81.90  ? 841  ALA B CA    1 
ATOM   6769  C C     . ALA B 2 849  ? 177.668 131.444 63.672  1.00 81.90  ? 841  ALA B C     1 
ATOM   6770  O O     . ALA B 2 849  ? 176.453 131.599 63.508  1.00 81.90  ? 841  ALA B O     1 
ATOM   6771  C CB    . ALA B 2 849  ? 178.562 129.148 63.222  1.00 81.90  ? 841  ALA B CB    1 
ATOM   6772  N N     . ARG B 2 850  ? 178.322 131.951 64.718  1.00 80.97  ? 842  ARG B N     1 
ATOM   6773  C CA    . ARG B 2 850  ? 177.714 132.903 65.644  1.00 80.97  ? 842  ARG B CA    1 
ATOM   6774  C C     . ARG B 2 850  ? 177.227 134.163 64.936  1.00 80.97  ? 842  ARG B C     1 
ATOM   6775  O O     . ARG B 2 850  ? 176.081 134.598 65.127  1.00 80.97  ? 842  ARG B O     1 
ATOM   6776  C CB    . ARG B 2 850  ? 178.716 133.263 66.743  1.00 80.97  ? 842  ARG B CB    1 
ATOM   6777  N N     . ALA B 2 851  ? 178.070 134.728 64.069  1.00 71.80  ? 843  ALA B N     1 
ATOM   6778  C CA    . ALA B 2 851  ? 177.673 135.902 63.298  1.00 71.80  ? 843  ALA B CA    1 
ATOM   6779  C C     . ALA B 2 851  ? 176.560 135.608 62.301  1.00 71.80  ? 843  ALA B C     1 
ATOM   6780  O O     . ALA B 2 851  ? 175.636 136.417 62.155  1.00 71.80  ? 843  ALA B O     1 
ATOM   6781  C CB    . ALA B 2 851  ? 178.893 136.474 62.576  1.00 71.80  ? 843  ALA B CB    1 
ATOM   6782  N N     . LEU B 2 852  ? 176.648 134.496 61.568  1.00 75.54  ? 844  LEU B N     1 
ATOM   6783  C CA    . LEU B 2 852  ? 175.588 134.155 60.625  1.00 75.54  ? 844  LEU B CA    1 
ATOM   6784  C C     . LEU B 2 852  ? 174.263 133.876 61.327  1.00 75.54  ? 844  LEU B C     1 
ATOM   6785  O O     . LEU B 2 852  ? 173.201 134.272 60.835  1.00 75.54  ? 844  LEU B O     1 
ATOM   6786  C CB    . LEU B 2 852  ? 176.007 132.947 59.787  1.00 75.54  ? 844  LEU B CB    1 
ATOM   6787  N N     . TYR B 2 853  ? 174.305 133.176 62.467  1.00 93.96  ? 845  TYR B N     1 
ATOM   6788  C CA    . TYR B 2 853  ? 173.090 132.905 63.232  1.00 93.96  ? 845  TYR B CA    1 
ATOM   6789  C C     . TYR B 2 853  ? 172.467 134.180 63.784  1.00 93.96  ? 845  TYR B C     1 
ATOM   6790  O O     . TYR B 2 853  ? 171.238 134.277 63.885  1.00 93.96  ? 845  TYR B O     1 
ATOM   6791  C CB    . TYR B 2 853  ? 173.381 131.926 64.369  1.00 93.96  ? 845  TYR B CB    1 
ATOM   6792  C CG    . TYR B 2 853  ? 172.144 131.288 64.965  1.00 93.96  ? 845  TYR B CG    1 
ATOM   6793  C CD1   . TYR B 2 853  ? 171.507 130.248 64.301  1.00 93.96  ? 845  TYR B CD1   1 
ATOM   6794  C CD2   . TYR B 2 853  ? 171.627 131.696 66.189  1.00 93.96  ? 845  TYR B CD2   1 
ATOM   6795  C CE1   . TYR B 2 853  ? 170.376 129.648 64.817  1.00 93.96  ? 845  TYR B CE1   1 
ATOM   6796  C CE2   . TYR B 2 853  ? 170.490 131.085 66.726  1.00 93.96  ? 845  TYR B CE2   1 
ATOM   6797  C CZ    . TYR B 2 853  ? 169.872 130.062 66.027  1.00 93.96  ? 845  TYR B CZ    1 
ATOM   6798  O OH    . TYR B 2 853  ? 168.758 129.438 66.543  1.00 93.96  ? 845  TYR B OH    1 
ATOM   6799  N N     . GLN B 2 854  ? 173.296 135.157 64.170  1.00 93.48  ? 846  GLN B N     1 
ATOM   6800  C CA    . GLN B 2 854  ? 172.746 136.393 64.720  1.00 93.48  ? 846  GLN B CA    1 
ATOM   6801  C C     . GLN B 2 854  ? 171.997 137.251 63.699  1.00 93.48  ? 846  GLN B C     1 
ATOM   6802  O O     . GLN B 2 854  ? 171.169 138.070 64.119  1.00 93.48  ? 846  GLN B O     1 
ATOM   6803  C CB    . GLN B 2 854  ? 173.867 137.214 65.355  1.00 93.48  ? 846  GLN B CB    1 
ATOM   6804  N N     . GLN B 2 855  ? 172.225 137.035 62.391  1.00 91.37  ? 847  GLN B N     1 
ATOM   6805  C CA    . GLN B 2 855  ? 171.496 137.682 61.281  1.00 91.37  ? 847  GLN B CA    1 
ATOM   6806  C C     . GLN B 2 855  ? 171.496 139.207 61.400  1.00 91.37  ? 847  GLN B C     1 
ATOM   6807  O O     . GLN B 2 855  ? 170.477 139.872 61.200  1.00 91.37  ? 847  GLN B O     1 
ATOM   6808  C CB    . GLN B 2 855  ? 170.067 137.144 61.176  1.00 91.37  ? 847  GLN B CB    1 
ATOM   6809  N N     . THR B 2 856  ? 172.656 139.765 61.729  1.00 122.22 ? 848  THR B N     1 
ATOM   6810  C CA    . THR B 2 856  ? 172.820 141.198 61.911  1.00 122.22 ? 848  THR B CA    1 
ATOM   6811  C C     . THR B 2 856  ? 172.848 141.940 60.577  1.00 122.22 ? 848  THR B C     1 
ATOM   6812  O O     . THR B 2 856  ? 172.985 141.351 59.502  1.00 122.22 ? 848  THR B O     1 
ATOM   6813  C CB    . THR B 2 856  ? 174.099 141.492 62.690  1.00 122.22 ? 848  THR B CB    1 
ATOM   6814  N N     . ASN B 2 857  ? 172.713 143.265 60.664  1.00 130.45 ? 849  ASN B N     1 
ATOM   6815  C CA    . ASN B 2 857  ? 172.722 144.093 59.466  1.00 130.45 ? 849  ASN B CA    1 
ATOM   6816  C C     . ASN B 2 857  ? 174.145 144.313 58.978  1.00 130.45 ? 849  ASN B C     1 
ATOM   6817  O O     . ASN B 2 857  ? 174.361 144.518 57.778  1.00 130.45 ? 849  ASN B O     1 
ATOM   6818  C CB    . ASN B 2 857  ? 172.039 145.433 59.737  1.00 130.45 ? 849  ASN B CB    1 
ATOM   6819  N N     . VAL B 2 858  ? 175.115 144.315 59.891  1.00 139.47 ? 850  VAL B N     1 
ATOM   6820  C CA    . VAL B 2 858  ? 176.509 144.581 59.566  1.00 139.47 ? 850  VAL B CA    1 
ATOM   6821  C C     . VAL B 2 858  ? 177.353 143.438 60.113  1.00 139.47 ? 850  VAL B C     1 
ATOM   6822  O O     . VAL B 2 858  ? 177.193 143.039 61.272  1.00 139.47 ? 850  VAL B O     1 
ATOM   6823  C CB    . VAL B 2 858  ? 176.986 145.928 60.141  1.00 139.47 ? 850  VAL B CB    1 
ATOM   6824  N N     . VAL B 2 859  ? 178.250 142.915 59.281  1.00 139.31 ? 851  VAL B N     1 
ATOM   6825  C CA    . VAL B 2 859  ? 179.168 141.848 59.658  1.00 139.31 ? 851  VAL B CA    1 
ATOM   6826  C C     . VAL B 2 859  ? 180.583 142.384 59.501  1.00 139.31 ? 851  VAL B C     1 
ATOM   6827  O O     . VAL B 2 859  ? 180.926 142.931 58.447  1.00 139.31 ? 851  VAL B O     1 
ATOM   6828  C CB    . VAL B 2 859  ? 178.963 140.583 58.807  1.00 139.31 ? 851  VAL B CB    1 
ATOM   6829  N N     . PHE B 2 860  ? 181.400 142.229 60.536  1.00 161.50 ? 852  PHE B N     1 
ATOM   6830  C CA    . PHE B 2 860  ? 182.817 142.567 60.465  1.00 161.50 ? 852  PHE B CA    1 
ATOM   6831  C C     . PHE B 2 860  ? 183.626 141.281 60.551  1.00 161.50 ? 852  PHE B C     1 
ATOM   6832  O O     . PHE B 2 860  ? 183.676 140.644 61.609  1.00 161.50 ? 852  PHE B O     1 
ATOM   6833  C CB    . PHE B 2 860  ? 183.206 143.537 61.579  1.00 161.50 ? 852  PHE B CB    1 
ATOM   6834  N N     . LEU B 2 861  ? 184.262 140.905 59.447  1.00 179.76 ? 853  LEU B N     1 
ATOM   6835  C CA    . LEU B 2 861  ? 185.053 139.685 59.375  1.00 179.76 ? 853  LEU B CA    1 
ATOM   6836  C C     . LEU B 2 861  ? 186.522 140.074 59.381  1.00 179.76 ? 853  LEU B C     1 
ATOM   6837  O O     . LEU B 2 861  ? 186.990 140.738 58.451  1.00 179.76 ? 853  LEU B O     1 
ATOM   6838  C CB    . LEU B 2 861  ? 184.710 138.882 58.118  1.00 179.76 ? 853  LEU B CB    1 
ATOM   6839  N N     . ASP B 2 862  ? 187.248 139.655 60.418  1.00 210.45 ? 854  ASP B N     1 
ATOM   6840  C CA    . ASP B 2 862  ? 188.682 139.917 60.532  1.00 210.45 ? 854  ASP B CA    1 
ATOM   6841  C C     . ASP B 2 862  ? 189.452 138.686 60.065  1.00 210.45 ? 854  ASP B C     1 
ATOM   6842  O O     . ASP B 2 862  ? 189.711 137.766 60.842  1.00 210.45 ? 854  ASP B O     1 
ATOM   6843  C CB    . ASP B 2 862  ? 189.047 140.293 61.963  1.00 210.45 ? 854  ASP B CB    1 
ATOM   6844  N N     . ASP B 2 863  ? 189.806 138.680 58.768  1.00 212.09 ? 855  ASP B N     1 
ATOM   6845  C CA    . ASP B 2 863  ? 190.603 137.662 58.080  1.00 212.09 ? 855  ASP B CA    1 
ATOM   6846  C C     . ASP B 2 863  ? 190.022 136.251 58.195  1.00 212.09 ? 855  ASP B C     1 
ATOM   6847  O O     . ASP B 2 863  ? 190.749 135.340 58.610  1.00 212.09 ? 855  ASP B O     1 
ATOM   6848  C CB    . ASP B 2 863  ? 192.048 137.671 58.592  1.00 212.09 ? 855  ASP B CB    1 
ATOM   6849  N N     . PRO B 2 864  ? 188.743 136.019 57.859  1.00 198.89 ? 856  PRO B N     1 
ATOM   6850  C CA    . PRO B 2 864  ? 188.016 134.889 58.466  1.00 198.89 ? 856  PRO B CA    1 
ATOM   6851  C C     . PRO B 2 864  ? 188.436 133.530 57.935  1.00 198.89 ? 856  PRO B C     1 
ATOM   6852  O O     . PRO B 2 864  ? 188.078 132.513 58.541  1.00 198.89 ? 856  PRO B O     1 
ATOM   6853  C CB    . PRO B 2 864  ? 186.555 135.171 58.096  1.00 198.89 ? 856  PRO B CB    1 
ATOM   6854  C CG    . PRO B 2 864  ? 186.659 135.946 56.839  1.00 198.89 ? 856  PRO B CG    1 
ATOM   6855  C CD    . PRO B 2 864  ? 187.855 136.817 56.992  1.00 198.89 ? 856  PRO B CD    1 
ATOM   6856  N N     . PHE B 2 865  ? 189.191 133.480 56.839  1.00 205.39 ? 857  PHE B N     1 
ATOM   6857  C CA    . PHE B 2 865  ? 189.584 132.233 56.200  1.00 205.39 ? 857  PHE B CA    1 
ATOM   6858  C C     . PHE B 2 865  ? 191.076 131.975 56.352  1.00 205.39 ? 857  PHE B C     1 
ATOM   6859  O O     . PHE B 2 865  ? 191.602 131.048 55.727  1.00 205.39 ? 857  PHE B O     1 
ATOM   6860  C CB    . PHE B 2 865  ? 189.195 132.242 54.721  1.00 205.39 ? 857  PHE B CB    1 
ATOM   6861  N N     . SER B 2 866  ? 191.762 132.800 57.152  1.00 212.78 ? 858  SER B N     1 
ATOM   6862  C CA    . SER B 2 866  ? 193.195 132.638 57.391  1.00 212.78 ? 858  SER B CA    1 
ATOM   6863  C C     . SER B 2 866  ? 193.478 131.324 58.102  1.00 212.78 ? 858  SER B C     1 
ATOM   6864  O O     . SER B 2 866  ? 194.450 130.628 57.785  1.00 212.78 ? 858  SER B O     1 
ATOM   6865  C CB    . SER B 2 866  ? 193.728 133.817 58.208  1.00 212.78 ? 858  SER B CB    1 
ATOM   6866  N N     . ALA B 2 867  ? 192.641 130.973 59.068  1.00 204.54 ? 859  ALA B N     1 
ATOM   6867  C CA    . ALA B 2 867  ? 192.851 129.831 59.939  1.00 204.54 ? 859  ALA B CA    1 
ATOM   6868  C C     . ALA B 2 867  ? 192.183 128.575 59.398  1.00 204.54 ? 859  ALA B C     1 
ATOM   6869  O O     . ALA B 2 867  ? 192.201 127.540 60.071  1.00 204.54 ? 859  ALA B O     1 
ATOM   6870  C CB    . ALA B 2 867  ? 192.332 130.135 61.348  1.00 204.54 ? 859  ALA B CB    1 
ATOM   6871  N N     . LEU B 2 868  ? 191.598 128.646 58.206  1.00 216.30 ? 860  LEU B N     1 
ATOM   6872  C CA    . LEU B 2 868  ? 190.962 127.508 57.564  1.00 216.30 ? 860  LEU B CA    1 
ATOM   6873  C C     . LEU B 2 868  ? 191.741 127.086 56.323  1.00 216.30 ? 860  LEU B C     1 
ATOM   6874  O O     . LEU B 2 868  ? 192.453 127.887 55.710  1.00 216.30 ? 860  LEU B O     1 
ATOM   6875  C CB    . LEU B 2 868  ? 189.518 127.840 57.179  1.00 216.30 ? 860  LEU B CB    1 
ATOM   6876  N N     . ASP B 2 869  ? 191.590 125.811 55.963  1.00 187.09 ? 861  ASP B N     1 
ATOM   6877  C CA    . ASP B 2 869  ? 192.207 125.222 54.783  1.00 187.09 ? 861  ASP B CA    1 
ATOM   6878  C C     . ASP B 2 869  ? 191.606 125.775 53.489  1.00 187.09 ? 861  ASP B C     1 
ATOM   6879  O O     . ASP B 2 869  ? 190.608 126.504 53.489  1.00 187.09 ? 861  ASP B O     1 
ATOM   6880  C CB    . ASP B 2 869  ? 192.064 123.701 54.810  1.00 187.09 ? 861  ASP B CB    1 
ATOM   6881  N N     . VAL B 2 870  ? 192.277 125.434 52.381  1.00 171.68 ? 862  VAL B N     1 
ATOM   6882  C CA    . VAL B 2 870  ? 191.909 125.908 51.046  1.00 171.68 ? 862  VAL B CA    1 
ATOM   6883  C C     . VAL B 2 870  ? 190.494 125.470 50.684  1.00 171.68 ? 862  VAL B C     1 
ATOM   6884  O O     . VAL B 2 870  ? 189.725 126.234 50.091  1.00 171.68 ? 862  VAL B O     1 
ATOM   6885  C CB    . VAL B 2 870  ? 192.934 125.427 50.004  1.00 171.68 ? 862  VAL B CB    1 
ATOM   6886  N N     . HIS B 2 871  ? 190.145 124.221 51.008  1.00 169.88 ? 863  HIS B N     1 
ATOM   6887  C CA    . HIS B 2 871  ? 188.806 123.703 50.727  1.00 169.88 ? 863  HIS B CA    1 
ATOM   6888  C C     . HIS B 2 871  ? 187.760 124.420 51.573  1.00 169.88 ? 863  HIS B C     1 
ATOM   6889  O O     . HIS B 2 871  ? 186.680 124.762 51.079  1.00 169.88 ? 863  HIS B O     1 
ATOM   6890  C CB    . HIS B 2 871  ? 188.758 122.195 50.970  1.00 169.88 ? 863  HIS B CB    1 
ATOM   6891  N N     . LEU B 2 872  ? 188.051 124.609 52.859  1.00 158.10 ? 864  LEU B N     1 
ATOM   6892  C CA    . LEU B 2 872  ? 187.187 125.399 53.728  1.00 158.10 ? 864  LEU B CA    1 
ATOM   6893  C C     . LEU B 2 872  ? 187.127 126.864 53.305  1.00 158.10 ? 864  LEU B C     1 
ATOM   6894  O O     . LEU B 2 872  ? 186.097 127.515 53.500  1.00 158.10 ? 864  LEU B O     1 
ATOM   6895  C CB    . LEU B 2 872  ? 187.661 125.285 55.176  1.00 158.10 ? 864  LEU B CB    1 
ATOM   6896  N N     . SER B 2 873  ? 188.232 127.419 52.793  1.00 147.68 ? 865  SER B N     1 
ATOM   6897  C CA    . SER B 2 873  ? 188.193 128.757 52.200  1.00 147.68 ? 865  SER B CA    1 
ATOM   6898  C C     . SER B 2 873  ? 187.255 128.808 50.997  1.00 147.68 ? 865  SER B C     1 
ATOM   6899  O O     . SER B 2 873  ? 186.561 129.808 50.791  1.00 147.68 ? 865  SER B O     1 
ATOM   6900  C CB    . SER B 2 873  ? 189.592 129.212 51.794  1.00 147.68 ? 865  SER B CB    1 
ATOM   6901  O OG    . SER B 2 873  ? 190.022 128.541 50.628  1.00 147.68 ? 865  SER B OG    1 
ATOM   6902  N N     . ASP B 2 874  ? 187.271 127.763 50.166  1.00 150.48 ? 866  ASP B N     1 
ATOM   6903  C CA    . ASP B 2 874  ? 186.319 127.641 49.062  1.00 150.48 ? 866  ASP B CA    1 
ATOM   6904  C C     . ASP B 2 874  ? 184.888 127.547 49.575  1.00 150.48 ? 866  ASP B C     1 
ATOM   6905  O O     . ASP B 2 874  ? 183.957 128.080 48.952  1.00 150.48 ? 866  ASP B O     1 
ATOM   6906  C CB    . ASP B 2 874  ? 186.663 126.423 48.206  1.00 150.48 ? 866  ASP B CB    1 
ATOM   6907  N N     . HIS B 2 875  ? 184.694 126.811 50.673  1.00 135.82 ? 867  HIS B N     1 
ATOM   6908  C CA    . HIS B 2 875  ? 183.396 126.746 51.340  1.00 135.82 ? 867  HIS B CA    1 
ATOM   6909  C C     . HIS B 2 875  ? 182.950 128.140 51.763  1.00 135.82 ? 867  HIS B C     1 
ATOM   6910  O O     . HIS B 2 875  ? 181.798 128.516 51.555  1.00 135.82 ? 867  HIS B O     1 
ATOM   6911  C CB    . HIS B 2 875  ? 183.454 125.799 52.535  1.00 135.82 ? 867  HIS B CB    1 
ATOM   6912  C CG    . HIS B 2 875  ? 182.110 125.478 53.102  1.00 135.82 ? 867  HIS B CG    1 
ATOM   6913  N ND1   . HIS B 2 875  ? 181.471 126.289 54.015  1.00 135.82 ? 867  HIS B ND1   1 
ATOM   6914  C CD2   . HIS B 2 875  ? 181.276 124.436 52.876  1.00 135.82 ? 867  HIS B CD2   1 
ATOM   6915  C CE1   . HIS B 2 875  ? 180.303 125.758 54.327  1.00 135.82 ? 867  HIS B CE1   1 
ATOM   6916  N NE2   . HIS B 2 875  ? 180.161 124.632 53.652  1.00 135.82 ? 867  HIS B NE2   1 
ATOM   6917  N N     . LEU B 2 876  ? 183.826 128.872 52.454  1.00 137.17 ? 868  LEU B N     1 
ATOM   6918  C CA    . LEU B 2 876  ? 183.524 130.222 52.926  1.00 137.17 ? 868  LEU B CA    1 
ATOM   6919  C C     . LEU B 2 876  ? 183.270 131.179 51.760  1.00 137.17 ? 868  LEU B C     1 
ATOM   6920  O O     . LEU B 2 876  ? 182.554 132.171 51.915  1.00 137.17 ? 868  LEU B O     1 
ATOM   6921  C CB    . LEU B 2 876  ? 184.665 130.738 53.801  1.00 137.17 ? 868  LEU B CB    1 
ATOM   6922  N N     . MET B 2 877  ? 183.962 130.964 50.640  1.00 132.45 ? 869  MET B N     1 
ATOM   6923  C CA    . MET B 2 877  ? 183.671 131.648 49.380  1.00 132.45 ? 869  MET B CA    1 
ATOM   6924  C C     . MET B 2 877  ? 182.228 131.423 48.935  1.00 132.45 ? 869  MET B C     1 
ATOM   6925  O O     . MET B 2 877  ? 181.471 132.383 48.753  1.00 132.45 ? 869  MET B O     1 
ATOM   6926  C CB    . MET B 2 877  ? 184.649 131.198 48.295  1.00 132.45 ? 869  MET B CB    1 
ATOM   6927  N N     . GLN B 2 878  ? 181.842 130.161 48.701  1.00 140.87 ? 870  GLN B N     1 
ATOM   6928  C CA    . GLN B 2 878  ? 180.517 129.880 48.139  1.00 140.87 ? 870  GLN B CA    1 
ATOM   6929  C C     . GLN B 2 878  ? 179.410 130.151 49.152  1.00 140.87 ? 870  GLN B C     1 
ATOM   6930  O O     . GLN B 2 878  ? 178.394 130.787 48.824  1.00 140.87 ? 870  GLN B O     1 
ATOM   6931  C CB    . GLN B 2 878  ? 180.452 128.432 47.654  1.00 140.87 ? 870  GLN B CB    1 
ATOM   6932  N N     . ALA B 2 879  ? 179.617 129.759 50.404  1.00 131.68 ? 871  ALA B N     1 
ATOM   6933  C CA    . ALA B 2 879  ? 178.577 129.920 51.402  1.00 131.68 ? 871  ALA B CA    1 
ATOM   6934  C C     . ALA B 2 879  ? 178.610 131.344 51.904  1.00 131.68 ? 871  ALA B C     1 
ATOM   6935  O O     . ALA B 2 879  ? 177.617 131.830 52.460  1.00 131.68 ? 871  ALA B O     1 
ATOM   6936  C CB    . ALA B 2 879  ? 178.776 128.936 52.554  1.00 131.68 ? 871  ALA B CB    1 
ATOM   6937  N N     . GLY B 2 880  ? 179.750 132.009 51.706  1.00 133.41 ? 872  GLY B N     1 
ATOM   6938  C CA    . GLY B 2 880  ? 179.862 133.401 52.075  1.00 133.41 ? 872  GLY B CA    1 
ATOM   6939  C C     . GLY B 2 880  ? 179.046 134.166 51.062  1.00 133.41 ? 872  GLY B C     1 
ATOM   6940  O O     . GLY B 2 880  ? 178.358 135.131 51.395  1.00 133.41 ? 872  GLY B O     1 
ATOM   6941  N N     . ILE B 2 881  ? 179.180 133.782 49.785  1.00 128.06 ? 873  ILE B N     1 
ATOM   6942  C CA    . ILE B 2 881  ? 178.500 134.444 48.682  1.00 128.06 ? 873  ILE B CA    1 
ATOM   6943  C C     . ILE B 2 881  ? 177.005 134.149 48.764  1.00 128.06 ? 873  ILE B C     1 
ATOM   6944  O O     . ILE B 2 881  ? 176.182 134.939 48.274  1.00 128.06 ? 873  ILE B O     1 
ATOM   6945  C CB    . ILE B 2 881  ? 179.086 134.007 47.328  1.00 128.06 ? 873  ILE B CB    1 
ATOM   6946  N N     . LEU B 2 882  ? 176.630 133.120 49.536  1.00 128.73 ? 874  LEU B N     1 
ATOM   6947  C CA    . LEU B 2 882  ? 175.237 132.746 49.716  1.00 128.73 ? 874  LEU B CA    1 
ATOM   6948  C C     . LEU B 2 882  ? 174.826 133.022 51.148  1.00 128.73 ? 874  LEU B C     1 
ATOM   6949  O O     . LEU B 2 882  ? 173.704 132.709 51.558  1.00 128.73 ? 874  LEU B O     1 
ATOM   6950  C CB    . LEU B 2 882  ? 175.017 131.276 49.359  1.00 128.73 ? 874  LEU B CB    1 
ATOM   6951  N N     . GLU B 2 883  ? 175.626 133.851 51.798  1.00 148.35 ? 875  GLU B N     1 
ATOM   6952  C CA    . GLU B 2 883  ? 175.436 134.385 53.131  1.00 148.35 ? 875  GLU B CA    1 
ATOM   6953  C C     . GLU B 2 883  ? 175.148 135.850 52.933  1.00 148.35 ? 875  GLU B C     1 
ATOM   6954  O O     . GLU B 2 883  ? 174.221 136.392 53.535  1.00 148.35 ? 875  GLU B O     1 
ATOM   6955  C CB    . GLU B 2 883  ? 176.671 134.176 54.012  1.00 148.35 ? 875  GLU B CB    1 
ATOM   6956  N N     . LEU B 2 884  ? 175.957 136.476 52.073  1.00 156.22 ? 876  LEU B N     1 
ATOM   6957  C CA    . LEU B 2 884  ? 175.707 137.850 51.686  1.00 156.22 ? 876  LEU B CA    1 
ATOM   6958  C C     . LEU B 2 884  ? 174.495 137.816 50.773  1.00 156.22 ? 876  LEU B C     1 
ATOM   6959  O O     . LEU B 2 884  ? 173.686 138.748 50.755  1.00 156.22 ? 876  LEU B O     1 
ATOM   6960  C CB    . LEU B 2 884  ? 176.942 138.473 51.022  1.00 156.22 ? 876  LEU B CB    1 
ATOM   6961  C CG    . LEU B 2 884  ? 177.599 137.911 49.753  1.00 156.22 ? 876  LEU B CG    1 
ATOM   6962  C CD1   . LEU B 2 884  ? 177.025 138.495 48.463  1.00 156.22 ? 876  LEU B CD1   1 
ATOM   6963  C CD2   . LEU B 2 884  ? 179.113 138.085 49.798  1.00 156.22 ? 876  LEU B CD2   1 
ATOM   6964  N N     . LEU B 2 885  ? 174.428 136.780 49.919  1.00 142.84 ? 877  LEU B N     1 
ATOM   6965  C CA    . LEU B 2 885  ? 173.239 136.580 49.107  1.00 142.84 ? 877  LEU B CA    1 
ATOM   6966  C C     . LEU B 2 885  ? 172.061 136.232 50.014  1.00 142.84 ? 877  LEU B C     1 
ATOM   6967  O O     . LEU B 2 885  ? 170.936 136.691 49.785  1.00 142.84 ? 877  LEU B O     1 
ATOM   6968  C CB    . LEU B 2 885  ? 173.474 135.498 48.055  1.00 142.84 ? 877  LEU B CB    1 
ATOM   6969  N N     . ARG B 2 886  ? 172.307 135.377 51.027  1.00 141.83 ? 878  ARG B N     1 
ATOM   6970  C CA    . ARG B 2 886  ? 171.302 135.117 52.059  1.00 141.83 ? 878  ARG B CA    1 
ATOM   6971  C C     . ARG B 2 886  ? 170.921 136.394 52.801  1.00 141.83 ? 878  ARG B C     1 
ATOM   6972  O O     . ARG B 2 886  ? 169.759 136.564 53.189  1.00 141.83 ? 878  ARG B O     1 
ATOM   6973  C CB    . ARG B 2 886  ? 171.799 134.057 53.039  1.00 141.83 ? 878  ARG B CB    1 
ATOM   6974  N N     . ASP B 2 887  ? 171.906 137.266 53.066  1.00 159.10 ? 879  ASP B N     1 
ATOM   6975  C CA    . ASP B 2 887  ? 171.686 138.602 53.620  1.00 159.10 ? 879  ASP B CA    1 
ATOM   6976  C C     . ASP B 2 887  ? 170.737 139.348 52.693  1.00 159.10 ? 879  ASP B C     1 
ATOM   6977  O O     . ASP B 2 887  ? 171.084 139.689 51.558  1.00 159.10 ? 879  ASP B O     1 
ATOM   6978  C CB    . ASP B 2 887  ? 172.991 139.379 53.820  1.00 159.10 ? 879  ASP B CB    1 
ATOM   6979  N N     . ASP B 2 888  ? 169.530 139.596 53.185  1.00 181.36 ? 880  ASP B N     1 
ATOM   6980  C CA    . ASP B 2 888  ? 168.521 140.358 52.462  1.00 181.36 ? 880  ASP B CA    1 
ATOM   6981  C C     . ASP B 2 888  ? 168.821 141.854 52.507  1.00 181.36 ? 880  ASP B C     1 
ATOM   6982  O O     . ASP B 2 888  ? 168.364 142.586 53.388  1.00 181.36 ? 880  ASP B O     1 
ATOM   6983  C CB    . ASP B 2 888  ? 167.137 140.059 53.025  1.00 181.36 ? 880  ASP B CB    1 
ATOM   6984  N N     . LYS B 2 889  ? 169.683 142.270 51.567  1.00 203.92 ? 881  LYS B N     1 
ATOM   6985  C CA    . LYS B 2 889  ? 170.275 143.595 51.351  1.00 203.92 ? 881  LYS B CA    1 
ATOM   6986  C C     . LYS B 2 889  ? 171.314 144.066 52.365  1.00 203.92 ? 881  LYS B C     1 
ATOM   6987  O O     . LYS B 2 889  ? 171.747 145.221 52.237  1.00 203.92 ? 881  LYS B O     1 
ATOM   6988  C CB    . LYS B 2 889  ? 169.220 144.708 51.216  1.00 203.92 ? 881  LYS B CB    1 
ATOM   6989  N N     . ARG B 2 890  ? 171.660 143.284 53.397  1.00 187.91 ? 882  ARG B N     1 
ATOM   6990  C CA    . ARG B 2 890  ? 172.534 143.791 54.458  1.00 187.91 ? 882  ARG B CA    1 
ATOM   6991  C C     . ARG B 2 890  ? 173.921 144.181 53.937  1.00 187.91 ? 882  ARG B C     1 
ATOM   6992  O O     . ARG B 2 890  ? 174.431 143.622 52.963  1.00 187.91 ? 882  ARG B O     1 
ATOM   6993  C CB    . ARG B 2 890  ? 172.673 142.742 55.563  1.00 187.91 ? 882  ARG B CB    1 
ATOM   6994  N N     . THR B 2 891  ? 174.544 145.115 54.655  1.00 178.82 ? 883  THR B N     1 
ATOM   6995  C CA    . THR B 2 891  ? 175.941 145.507 54.484  1.00 178.82 ? 883  THR B CA    1 
ATOM   6996  C C     . THR B 2 891  ? 176.936 144.550 55.126  1.00 178.82 ? 883  THR B C     1 
ATOM   6997  O O     . THR B 2 891  ? 176.826 144.234 56.312  1.00 178.82 ? 883  THR B O     1 
ATOM   6998  C CB    . THR B 2 891  ? 176.152 146.911 55.049  1.00 178.82 ? 883  THR B CB    1 
ATOM   6999  N N     . VAL B 2 892  ? 177.914 144.091 54.347  1.00 163.65 ? 884  VAL B N     1 
ATOM   7000  C CA    . VAL B 2 892  ? 178.882 143.107 54.816  1.00 163.65 ? 884  VAL B CA    1 
ATOM   7001  C C     . VAL B 2 892  ? 180.260 143.695 54.549  1.00 163.65 ? 884  VAL B C     1 
ATOM   7002  O O     . VAL B 2 892  ? 180.603 143.983 53.396  1.00 163.65 ? 884  VAL B O     1 
ATOM   7003  C CB    . VAL B 2 892  ? 178.723 141.750 54.112  1.00 163.65 ? 884  VAL B CB    1 
ATOM   7004  N N     . VAL B 2 893  ? 181.043 143.879 55.611  1.00 172.10 ? 885  VAL B N     1 
ATOM   7005  C CA    . VAL B 2 893  ? 182.417 144.363 55.521  1.00 172.10 ? 885  VAL B CA    1 
ATOM   7006  C C     . VAL B 2 893  ? 183.392 143.227 55.804  1.00 172.10 ? 885  VAL B C     1 
ATOM   7007  O O     . VAL B 2 893  ? 183.383 142.650 56.898  1.00 172.10 ? 885  VAL B O     1 
ATOM   7008  C CB    . VAL B 2 893  ? 182.662 145.532 56.485  1.00 172.10 ? 885  VAL B CB    1 
ATOM   7009  N N     . LEU B 2 894  ? 184.241 142.919 54.828  1.00 190.91 ? 886  LEU B N     1 
ATOM   7010  C CA    . LEU B 2 894  ? 185.158 141.785 54.900  1.00 190.91 ? 886  LEU B CA    1 
ATOM   7011  C C     . LEU B 2 894  ? 186.577 142.349 54.895  1.00 190.91 ? 886  LEU B C     1 
ATOM   7012  O O     . LEU B 2 894  ? 187.132 142.621 53.827  1.00 190.91 ? 886  LEU B O     1 
ATOM   7013  C CB    . LEU B 2 894  ? 184.937 140.816 53.743  1.00 190.91 ? 886  LEU B CB    1 
ATOM   7014  N N     . VAL B 2 895  ? 187.167 142.530 56.077  1.00 189.78 ? 887  VAL B N     1 
ATOM   7015  C CA    . VAL B 2 895  ? 188.609 142.728 56.161  1.00 189.78 ? 887  VAL B CA    1 
ATOM   7016  C C     . VAL B 2 895  ? 189.316 141.438 55.773  1.00 189.78 ? 887  VAL B C     1 
ATOM   7017  O O     . VAL B 2 895  ? 188.928 140.343 56.200  1.00 189.78 ? 887  VAL B O     1 
ATOM   7018  C CB    . VAL B 2 895  ? 189.026 143.188 57.568  1.00 189.78 ? 887  VAL B CB    1 
ATOM   7019  N N     . THR B 2 896  ? 190.368 141.561 54.969  1.00 217.90 ? 888  THR B N     1 
ATOM   7020  C CA    . THR B 2 896  ? 191.202 140.417 54.643  1.00 217.90 ? 888  THR B CA    1 
ATOM   7021  C C     . THR B 2 896  ? 192.611 140.897 54.317  1.00 217.90 ? 888  THR B C     1 
ATOM   7022  O O     . THR B 2 896  ? 192.808 142.004 53.809  1.00 217.90 ? 888  THR B O     1 
ATOM   7023  C CB    . THR B 2 896  ? 190.623 139.593 53.475  1.00 217.90 ? 888  THR B CB    1 
ATOM   7024  O OG1   . THR B 2 896  ? 191.504 138.502 53.180  1.00 217.90 ? 888  THR B OG1   1 
ATOM   7025  C CG2   . THR B 2 896  ? 190.424 140.437 52.210  1.00 217.90 ? 888  THR B CG2   1 
ATOM   7026  N N     . HIS B 2 897  ? 193.592 140.047 54.617  1.00 223.21 ? 889  HIS B N     1 
ATOM   7027  C CA    . HIS B 2 897  ? 194.975 140.268 54.207  1.00 223.21 ? 889  HIS B CA    1 
ATOM   7028  C C     . HIS B 2 897  ? 195.310 139.613 52.878  1.00 223.21 ? 889  HIS B C     1 
ATOM   7029  O O     . HIS B 2 897  ? 196.436 139.767 52.399  1.00 223.21 ? 889  HIS B O     1 
ATOM   7030  C CB    . HIS B 2 897  ? 195.943 139.774 55.309  1.00 223.21 ? 889  HIS B CB    1 
ATOM   7031  C CG    . HIS B 2 897  ? 196.063 138.277 55.417  1.00 223.21 ? 889  HIS B CG    1 
ATOM   7032  N ND1   . HIS B 2 897  ? 195.491 137.570 56.453  1.00 223.21 ? 889  HIS B ND1   1 
ATOM   7033  C CD2   . HIS B 2 897  ? 196.746 137.366 54.680  1.00 223.21 ? 889  HIS B CD2   1 
ATOM   7034  C CE1   . HIS B 2 897  ? 195.769 136.285 56.318  1.00 223.21 ? 889  HIS B CE1   1 
ATOM   7035  N NE2   . HIS B 2 897  ? 196.528 136.134 55.248  1.00 223.21 ? 889  HIS B NE2   1 
ATOM   7036  N N     . LYS B 2 898  ? 194.370 138.891 52.278  1.00 224.79 ? 890  LYS B N     1 
ATOM   7037  C CA    . LYS B 2 898  ? 194.624 138.092 51.090  1.00 224.79 ? 890  LYS B CA    1 
ATOM   7038  C C     . LYS B 2 898  ? 193.980 138.727 49.865  1.00 224.79 ? 890  LYS B C     1 
ATOM   7039  O O     . LYS B 2 898  ? 192.900 139.319 49.943  1.00 224.79 ? 890  LYS B O     1 
ATOM   7040  C CB    . LYS B 2 898  ? 194.086 136.667 51.258  1.00 224.79 ? 890  LYS B CB    1 
ATOM   7041  N N     . LEU B 2 899  ? 194.658 138.586 48.729  1.00 191.87 ? 891  LEU B N     1 
ATOM   7042  C CA    . LEU B 2 899  ? 194.197 139.131 47.461  1.00 191.87 ? 891  LEU B CA    1 
ATOM   7043  C C     . LEU B 2 899  ? 193.377 138.135 46.659  1.00 191.87 ? 891  LEU B C     1 
ATOM   7044  O O     . LEU B 2 899  ? 192.938 138.476 45.556  1.00 191.87 ? 891  LEU B O     1 
ATOM   7045  C CB    . LEU B 2 899  ? 195.390 139.598 46.625  1.00 191.87 ? 891  LEU B CB    1 
ATOM   7046  N N     . GLN B 2 900  ? 193.243 136.901 47.172  1.00 182.22 ? 892  GLN B N     1 
ATOM   7047  C CA    . GLN B 2 900  ? 192.675 135.771 46.430  1.00 182.22 ? 892  GLN B CA    1 
ATOM   7048  C C     . GLN B 2 900  ? 191.268 136.068 45.918  1.00 182.22 ? 892  GLN B C     1 
ATOM   7049  O O     . GLN B 2 900  ? 190.911 135.684 44.799  1.00 182.22 ? 892  GLN B O     1 
ATOM   7050  C CB    . GLN B 2 900  ? 192.673 134.520 47.306  1.00 182.22 ? 892  GLN B CB    1 
ATOM   7051  N N     . TYR B 2 901  ? 190.459 136.756 46.725  1.00 166.63 ? 893  TYR B N     1 
ATOM   7052  C CA    . TYR B 2 901  ? 189.060 136.989 46.395  1.00 166.63 ? 893  TYR B CA    1 
ATOM   7053  C C     . TYR B 2 901  ? 188.721 138.463 46.229  1.00 166.63 ? 893  TYR B C     1 
ATOM   7054  O O     . TYR B 2 901  ? 187.530 138.799 46.205  1.00 166.63 ? 893  TYR B O     1 
ATOM   7055  C CB    . TYR B 2 901  ? 188.150 136.368 47.457  1.00 166.63 ? 893  TYR B CB    1 
ATOM   7056  C CG    . TYR B 2 901  ? 188.254 134.871 47.495  1.00 166.63 ? 893  TYR B CG    1 
ATOM   7057  C CD1   . TYR B 2 901  ? 187.609 134.090 46.547  1.00 166.63 ? 893  TYR B CD1   1 
ATOM   7058  C CD2   . TYR B 2 901  ? 189.019 134.235 48.464  1.00 166.63 ? 893  TYR B CD2   1 
ATOM   7059  C CE1   . TYR B 2 901  ? 187.671 132.715 46.594  1.00 166.63 ? 893  TYR B CE1   1 
ATOM   7060  C CE2   . TYR B 2 901  ? 189.120 132.859 48.500  1.00 166.63 ? 893  TYR B CE2   1 
ATOM   7061  C CZ    . TYR B 2 901  ? 188.436 132.103 47.567  1.00 166.63 ? 893  TYR B CZ    1 
ATOM   7062  O OH    . TYR B 2 901  ? 188.564 130.735 47.572  1.00 166.63 ? 893  TYR B OH    1 
ATOM   7063  N N     . LEU B 2 902  ? 189.717 139.351 46.173  1.00 166.33 ? 894  LEU B N     1 
ATOM   7064  C CA    . LEU B 2 902  ? 189.421 140.747 45.860  1.00 166.33 ? 894  LEU B CA    1 
ATOM   7065  C C     . LEU B 2 902  ? 188.754 140.958 44.495  1.00 166.33 ? 894  LEU B C     1 
ATOM   7066  O O     . LEU B 2 902  ? 187.985 141.929 44.385  1.00 166.33 ? 894  LEU B O     1 
ATOM   7067  C CB    . LEU B 2 902  ? 190.706 141.586 45.966  1.00 166.33 ? 894  LEU B CB    1 
ATOM   7068  N N     . PRO B 2 903  ? 188.996 140.162 43.430  1.00 171.20 ? 895  PRO B N     1 
ATOM   7069  C CA    . PRO B 2 903  ? 188.146 140.316 42.238  1.00 171.20 ? 895  PRO B CA    1 
ATOM   7070  C C     . PRO B 2 903  ? 186.719 139.853 42.481  1.00 171.20 ? 895  PRO B C     1 
ATOM   7071  O O     . PRO B 2 903  ? 185.815 140.244 41.732  1.00 171.20 ? 895  PRO B O     1 
ATOM   7072  C CB    . PRO B 2 903  ? 188.841 139.464 41.164  1.00 171.20 ? 895  PRO B CB    1 
ATOM   7073  C CG    . PRO B 2 903  ? 190.204 139.331 41.594  1.00 171.20 ? 895  PRO B CG    1 
ATOM   7074  C CD    . PRO B 2 903  ? 190.237 139.433 43.068  1.00 171.20 ? 895  PRO B CD    1 
ATOM   7075  N N     . HIS B 2 904  ? 186.491 139.054 43.529  1.00 169.69 ? 896  HIS B N     1 
ATOM   7076  C CA    . HIS B 2 904  ? 185.242 138.345 43.743  1.00 169.69 ? 896  HIS B CA    1 
ATOM   7077  C C     . HIS B 2 904  ? 184.389 138.988 44.821  1.00 169.69 ? 896  HIS B C     1 
ATOM   7078  O O     . HIS B 2 904  ? 183.377 138.412 45.229  1.00 169.69 ? 896  HIS B O     1 
ATOM   7079  C CB    . HIS B 2 904  ? 185.521 136.885 44.103  1.00 169.69 ? 896  HIS B CB    1 
ATOM   7080  N N     . ALA B 2 905  ? 184.774 140.163 45.293  1.00 197.37 ? 897  ALA B N     1 
ATOM   7081  C CA    . ALA B 2 905  ? 183.883 141.011 46.063  1.00 197.37 ? 897  ALA B CA    1 
ATOM   7082  C C     . ALA B 2 905  ? 183.530 142.189 45.162  1.00 197.37 ? 897  ALA B C     1 
ATOM   7083  O O     . ALA B 2 905  ? 184.009 142.272 44.024  1.00 197.37 ? 897  ALA B O     1 
ATOM   7084  C CB    . ALA B 2 905  ? 184.537 141.454 47.372  1.00 197.37 ? 897  ALA B CB    1 
ATOM   7085  N N     . ASP B 2 906  ? 182.707 143.117 45.656  1.00 228.94 ? 898  ASP B N     1 
ATOM   7086  C CA    . ASP B 2 906  ? 182.188 144.084 44.697  1.00 228.94 ? 898  ASP B CA    1 
ATOM   7087  C C     . ASP B 2 906  ? 183.162 145.230 44.457  1.00 228.94 ? 898  ASP B C     1 
ATOM   7088  O O     . ASP B 2 906  ? 183.474 145.558 43.312  1.00 228.94 ? 898  ASP B O     1 
ATOM   7089  C CB    . ASP B 2 906  ? 180.839 144.616 45.182  1.00 228.94 ? 898  ASP B CB    1 
ATOM   7090  N N     . TRP B 2 907  ? 183.677 145.833 45.519  1.00 248.76 ? 899  TRP B N     1 
ATOM   7091  C CA    . TRP B 2 907  ? 184.523 147.018 45.432  1.00 248.76 ? 899  TRP B CA    1 
ATOM   7092  C C     . TRP B 2 907  ? 185.565 146.903 46.539  1.00 248.76 ? 899  TRP B C     1 
ATOM   7093  O O     . TRP B 2 907  ? 185.294 146.321 47.593  1.00 248.76 ? 899  TRP B O     1 
ATOM   7094  C CB    . TRP B 2 907  ? 183.754 148.363 45.505  1.00 248.76 ? 899  TRP B CB    1 
ATOM   7095  C CG    . TRP B 2 907  ? 182.789 148.631 44.333  1.00 248.76 ? 899  TRP B CG    1 
ATOM   7096  C CD1   . TRP B 2 907  ? 181.585 148.014 44.087  1.00 248.76 ? 899  TRP B CD1   1 
ATOM   7097  C CD2   . TRP B 2 907  ? 182.995 149.531 43.227  1.00 248.76 ? 899  TRP B CD2   1 
ATOM   7098  N NE1   . TRP B 2 907  ? 181.028 148.492 42.928  1.00 248.76 ? 899  TRP B NE1   1 
ATOM   7099  C CE2   . TRP B 2 907  ? 181.870 149.422 42.379  1.00 248.76 ? 899  TRP B CE2   1 
ATOM   7100  C CE3   . TRP B 2 907  ? 184.009 150.428 42.882  1.00 248.76 ? 899  TRP B CE3   1 
ATOM   7101  C CZ2   . TRP B 2 907  ? 181.737 150.173 41.215  1.00 248.76 ? 899  TRP B CZ2   1 
ATOM   7102  C CZ3   . TRP B 2 907  ? 183.873 151.171 41.728  1.00 248.76 ? 899  TRP B CZ3   1 
ATOM   7103  C CH2   . TRP B 2 907  ? 182.743 151.038 40.908  1.00 248.76 ? 899  TRP B CH2   1 
ATOM   7104  N N     . ILE B 2 908  ? 186.757 147.455 46.305  1.00 266.96 ? 900  ILE B N     1 
ATOM   7105  C CA    . ILE B 2 908  ? 187.823 147.442 47.301  1.00 266.96 ? 900  ILE B CA    1 
ATOM   7106  C C     . ILE B 2 908  ? 188.167 148.843 47.787  1.00 266.96 ? 900  ILE B C     1 
ATOM   7107  O O     . ILE B 2 908  ? 188.216 149.800 47.003  1.00 266.96 ? 900  ILE B O     1 
ATOM   7108  C CB    . ILE B 2 908  ? 189.079 146.754 46.737  1.00 266.96 ? 900  ILE B CB    1 
ATOM   7109  N N     . ILE B 2 909  ? 188.404 148.944 49.098  1.00 247.80 ? 901  ILE B N     1 
ATOM   7110  C CA    . ILE B 2 909  ? 188.995 150.107 49.760  1.00 247.80 ? 901  ILE B CA    1 
ATOM   7111  C C     . ILE B 2 909  ? 190.355 149.663 50.289  1.00 247.80 ? 901  ILE B C     1 
ATOM   7112  O O     . ILE B 2 909  ? 190.433 148.752 51.123  1.00 247.80 ? 901  ILE B O     1 
ATOM   7113  C CB    . ILE B 2 909  ? 188.104 150.650 50.889  1.00 247.80 ? 901  ILE B CB    1 
ATOM   7114  N N     . ALA B 2 910  ? 191.424 150.308 49.823  1.00 254.39 ? 902  ALA B N     1 
ATOM   7115  C CA    . ALA B 2 910  ? 192.780 149.995 50.260  1.00 254.39 ? 902  ALA B CA    1 
ATOM   7116  C C     . ALA B 2 910  ? 193.280 150.969 51.318  1.00 254.39 ? 902  ALA B C     1 
ATOM   7117  O O     . ALA B 2 910  ? 193.238 152.188 51.124  1.00 254.39 ? 902  ALA B O     1 
ATOM   7118  C CB    . ALA B 2 910  ? 193.743 149.993 49.072  1.00 254.39 ? 902  ALA B CB    1 
ATOM   7119  N N     . MET B 2 911  ? 193.758 150.418 52.428  1.00 239.90 ? 903  MET B N     1 
ATOM   7120  C CA    . MET B 2 911  ? 194.269 151.178 53.555  1.00 239.90 ? 903  MET B CA    1 
ATOM   7121  C C     . MET B 2 911  ? 195.768 150.935 53.660  1.00 239.90 ? 903  MET B C     1 
ATOM   7122  O O     . MET B 2 911  ? 196.258 149.857 53.317  1.00 239.90 ? 903  MET B O     1 
ATOM   7123  C CB    . MET B 2 911  ? 193.573 150.782 54.860  1.00 239.90 ? 903  MET B CB    1 
ATOM   7124  N N     . LYS B 2 912  ? 196.497 151.938 54.142  1.00 258.61 ? 904  LYS B N     1 
ATOM   7125  C CA    . LYS B 2 912  ? 197.904 151.755 54.469  1.00 258.61 ? 904  LYS B CA    1 
ATOM   7126  C C     . LYS B 2 912  ? 198.322 152.685 55.599  1.00 258.61 ? 904  LYS B C     1 
ATOM   7127  O O     . LYS B 2 912  ? 197.925 153.855 55.621  1.00 258.61 ? 904  LYS B O     1 
ATOM   7128  C CB    . LYS B 2 912  ? 198.791 152.003 53.243  1.00 258.61 ? 904  LYS B CB    1 
ATOM   7129  N N     . ASP B 2 913  ? 199.121 152.139 56.530  1.00 261.11 ? 905  ASP B N     1 
ATOM   7130  C CA    . ASP B 2 913  ? 199.755 152.881 57.630  1.00 261.11 ? 905  ASP B CA    1 
ATOM   7131  C C     . ASP B 2 913  ? 198.738 153.569 58.536  1.00 261.11 ? 905  ASP B C     1 
ATOM   7132  O O     . ASP B 2 913  ? 198.984 154.665 59.047  1.00 261.11 ? 905  ASP B O     1 
ATOM   7133  C CB    . ASP B 2 913  ? 200.779 153.896 57.108  1.00 261.11 ? 905  ASP B CB    1 
ATOM   7134  N N     . GLY B 2 914  ? 197.586 152.937 58.735  1.00 245.58 ? 906  GLY B N     1 
ATOM   7135  C CA    . GLY B 2 914  ? 196.525 153.512 59.536  1.00 245.58 ? 906  GLY B CA    1 
ATOM   7136  C C     . GLY B 2 914  ? 195.729 154.588 58.836  1.00 245.58 ? 906  GLY B C     1 
ATOM   7137  O O     . GLY B 2 914  ? 194.921 155.264 59.480  1.00 245.58 ? 906  GLY B O     1 
ATOM   7138  N N     . THR B 2 915  ? 195.945 154.775 57.543  1.00 244.05 ? 907  THR B N     1 
ATOM   7139  C CA    . THR B 2 915  ? 195.247 155.753 56.732  1.00 244.05 ? 907  THR B CA    1 
ATOM   7140  C C     . THR B 2 915  ? 194.618 154.990 55.578  1.00 244.05 ? 907  THR B C     1 
ATOM   7141  O O     . THR B 2 915  ? 195.024 153.868 55.271  1.00 244.05 ? 907  THR B O     1 
ATOM   7142  C CB    . THR B 2 915  ? 196.186 156.850 56.216  1.00 244.05 ? 907  THR B CB    1 
ATOM   7143  N N     . ILE B 2 916  ? 193.624 155.585 54.935  1.00 248.70 ? 908  ILE B N     1 
ATOM   7144  C CA    . ILE B 2 916  ? 193.080 155.016 53.709  1.00 248.70 ? 908  ILE B CA    1 
ATOM   7145  C C     . ILE B 2 916  ? 193.910 155.561 52.555  1.00 248.70 ? 908  ILE B C     1 
ATOM   7146  O O     . ILE B 2 916  ? 194.025 156.780 52.387  1.00 248.70 ? 908  ILE B O     1 
ATOM   7147  C CB    . ILE B 2 916  ? 191.593 155.360 53.541  1.00 248.70 ? 908  ILE B CB    1 
ATOM   7148  N N     . GLN B 2 917  ? 194.493 154.662 51.760  1.00 274.59 ? 909  GLN B N     1 
ATOM   7149  C CA    . GLN B 2 917  ? 195.282 155.109 50.618  1.00 274.59 ? 909  GLN B CA    1 
ATOM   7150  C C     . GLN B 2 917  ? 194.448 155.353 49.366  1.00 274.59 ? 909  GLN B C     1 
ATOM   7151  O O     . GLN B 2 917  ? 194.631 156.382 48.707  1.00 274.59 ? 909  GLN B O     1 
ATOM   7152  C CB    . GLN B 2 917  ? 196.381 154.086 50.319  1.00 274.59 ? 909  GLN B CB    1 
ATOM   7153  N N     . ARG B 2 918  ? 193.520 154.451 49.041  1.00 277.10 ? 910  ARG B N     1 
ATOM   7154  C CA    . ARG B 2 918  ? 192.637 154.634 47.895  1.00 277.10 ? 910  ARG B CA    1 
ATOM   7155  C C     . ARG B 2 918  ? 191.421 153.728 48.035  1.00 277.10 ? 910  ARG B C     1 
ATOM   7156  O O     . ARG B 2 918  ? 191.494 152.650 48.627  1.00 277.10 ? 910  ARG B O     1 
ATOM   7157  C CB    . ARG B 2 918  ? 193.350 154.331 46.569  1.00 277.10 ? 910  ARG B CB    1 
ATOM   7158  N N     . GLU B 2 919  ? 190.311 154.178 47.464  1.00 271.75 ? 911  GLU B N     1 
ATOM   7159  C CA    . GLU B 2 919  ? 189.089 153.404 47.313  1.00 271.75 ? 911  GLU B CA    1 
ATOM   7160  C C     . GLU B 2 919  ? 188.652 153.544 45.865  1.00 271.75 ? 911  GLU B C     1 
ATOM   7161  O O     . GLU B 2 919  ? 188.833 154.608 45.269  1.00 271.75 ? 911  GLU B O     1 
ATOM   7162  C CB    . GLU B 2 919  ? 187.980 153.882 48.258  1.00 271.75 ? 911  GLU B CB    1 
ATOM   7163  N N     . GLY B 2 920  ? 188.080 152.498 45.282  1.00 258.06 ? 912  GLY B N     1 
ATOM   7164  C CA    . GLY B 2 920  ? 187.915 152.563 43.844  1.00 258.06 ? 912  GLY B CA    1 
ATOM   7165  C C     . GLY B 2 920  ? 187.813 151.221 43.160  1.00 258.06 ? 912  GLY B C     1 
ATOM   7166  O O     . GLY B 2 920  ? 187.934 150.154 43.764  1.00 258.06 ? 912  GLY B O     1 
ATOM   7167  N N     . THR B 2 921  ? 187.541 151.322 41.861  1.00 253.02 ? 913  THR B N     1 
ATOM   7168  C CA    . THR B 2 921  ? 187.398 150.237 40.906  1.00 253.02 ? 913  THR B CA    1 
ATOM   7169  C C     . THR B 2 921  ? 188.727 149.518 40.673  1.00 253.02 ? 913  THR B C     1 
ATOM   7170  O O     . THR B 2 921  ? 189.800 149.958 41.105  1.00 253.02 ? 913  THR B O     1 
ATOM   7171  C CB    . THR B 2 921  ? 186.854 150.758 39.577  1.00 253.02 ? 913  THR B CB    1 
ATOM   7172  N N     . LEU B 2 922  ? 188.606 148.342 40.046  1.00 271.94 ? 914  LEU B N     1 
ATOM   7173  C CA    . LEU B 2 922  ? 189.756 147.579 39.566  1.00 271.94 ? 914  LEU B CA    1 
ATOM   7174  C C     . LEU B 2 922  ? 190.653 148.422 38.663  1.00 271.94 ? 914  LEU B C     1 
ATOM   7175  O O     . LEU B 2 922  ? 191.879 148.336 38.755  1.00 271.94 ? 914  LEU B O     1 
ATOM   7176  C CB    . LEU B 2 922  ? 189.280 146.325 38.832  1.00 271.94 ? 914  LEU B CB    1 
ATOM   7177  N N     . LYS B 2 923  ? 190.062 149.160 37.716  1.00 291.19 ? 915  LYS B N     1 
ATOM   7178  C CA    . LYS B 2 923  ? 190.850 150.026 36.833  1.00 291.19 ? 915  LYS B CA    1 
ATOM   7179  C C     . LYS B 2 923  ? 191.542 151.142 37.620  1.00 291.19 ? 915  LYS B C     1 
ATOM   7180  O O     . LYS B 2 923  ? 192.691 151.500 37.330  1.00 291.19 ? 915  LYS B O     1 
ATOM   7181  C CB    . LYS B 2 923  ? 189.958 150.612 35.741  1.00 291.19 ? 915  LYS B CB    1 
ATOM   7182  N N     . ASP B 2 924  ? 190.832 151.717 38.601  1.00 273.66 ? 916  ASP B N     1 
ATOM   7183  C CA    . ASP B 2 924  ? 191.375 152.754 39.480  1.00 273.66 ? 916  ASP B CA    1 
ATOM   7184  C C     . ASP B 2 924  ? 192.584 152.241 40.258  1.00 273.66 ? 916  ASP B C     1 
ATOM   7185  O O     . ASP B 2 924  ? 193.591 152.945 40.406  1.00 273.66 ? 916  ASP B O     1 
ATOM   7186  C CB    . ASP B 2 924  ? 190.294 153.251 40.437  1.00 273.66 ? 916  ASP B CB    1 
ATOM   7187  N N     . PHE B 2 925  ? 192.517 150.991 40.710  1.00 274.97 ? 917  PHE B N     1 
ATOM   7188  C CA    . PHE B 2 925  ? 193.586 150.404 41.502  1.00 274.97 ? 917  PHE B CA    1 
ATOM   7189  C C     . PHE B 2 925  ? 194.673 149.838 40.608  1.00 274.97 ? 917  PHE B C     1 
ATOM   7190  O O     . PHE B 2 925  ? 195.799 149.625 41.072  1.00 274.97 ? 917  PHE B O     1 
ATOM   7191  C CB    . PHE B 2 925  ? 193.027 149.313 42.418  1.00 274.97 ? 917  PHE B CB    1 
ATOM   7192  N N     . GLN B 2 926  ? 194.342 149.566 39.345  1.00 289.43 ? 918  GLN B N     1 
ATOM   7193  C CA    . GLN B 2 926  ? 195.372 149.343 38.341  1.00 289.43 ? 918  GLN B CA    1 
ATOM   7194  C C     . GLN B 2 926  ? 196.176 150.620 38.152  1.00 289.43 ? 918  GLN B C     1 
ATOM   7195  O O     . GLN B 2 926  ? 197.400 150.566 37.975  1.00 289.43 ? 918  GLN B O     1 
ATOM   7196  C CB    . GLN B 2 926  ? 194.750 148.885 37.024  1.00 289.43 ? 918  GLN B CB    1 
ATOM   7197  N N     . ARG B 2 927  ? 195.499 151.782 38.152  1.00 289.77 ? 919  ARG B N     1 
ATOM   7198  C CA    . ARG B 2 927  ? 196.236 153.039 38.041  1.00 289.77 ? 919  ARG B CA    1 
ATOM   7199  C C     . ARG B 2 927  ? 197.032 153.288 39.316  1.00 289.77 ? 919  ARG B C     1 
ATOM   7200  O O     . ARG B 2 927  ? 198.070 153.961 39.284  1.00 289.77 ? 919  ARG B O     1 
ATOM   7201  C CB    . ARG B 2 927  ? 195.279 154.197 37.763  1.00 289.77 ? 919  ARG B CB    1 
ATOM   7202  N N     . SER B 2 928  ? 196.544 152.763 40.445  1.00 269.73 ? 920  SER B N     1 
ATOM   7203  C CA    . SER B 2 928  ? 197.278 152.778 41.707  1.00 269.73 ? 920  SER B CA    1 
ATOM   7204  C C     . SER B 2 928  ? 198.517 151.892 41.615  1.00 269.73 ? 920  SER B C     1 
ATOM   7205  O O     . SER B 2 928  ? 199.474 152.097 42.369  1.00 269.73 ? 920  SER B O     1 
ATOM   7206  C CB    . SER B 2 928  ? 196.391 152.338 42.870  1.00 269.73 ? 920  SER B CB    1 
ATOM   7207  N N     . GLU B 2 929  ? 198.466 150.895 40.718  1.00 244.10 ? 921  GLU B N     1 
ATOM   7208  C CA    . GLU B 2 929  ? 199.493 149.877 40.469  1.00 244.10 ? 921  GLU B CA    1 
ATOM   7209  C C     . GLU B 2 929  ? 199.756 149.038 41.713  1.00 244.10 ? 921  GLU B C     1 
ATOM   7210  O O     . GLU B 2 929  ? 200.899 148.743 42.069  1.00 244.10 ? 921  GLU B O     1 
ATOM   7211  C CB    . GLU B 2 929  ? 200.792 150.493 39.935  1.00 244.10 ? 921  GLU B CB    1 
ATOM   7212  N N     . CYS B 2 930  ? 198.667 148.645 42.372  1.00 234.68 ? 922  CYS B N     1 
ATOM   7213  C CA    . CYS B 2 930  ? 198.683 147.938 43.643  1.00 234.68 ? 922  CYS B CA    1 
ATOM   7214  C C     . CYS B 2 930  ? 197.969 146.601 43.539  1.00 234.68 ? 922  CYS B C     1 
ATOM   7215  O O     . CYS B 2 930  ? 198.534 145.567 43.918  1.00 234.68 ? 922  CYS B O     1 
ATOM   7216  C CB    . CYS B 2 930  ? 198.041 148.802 44.740  1.00 234.68 ? 922  CYS B CB    1 
ATOM   7217  N N     . GLN B 2 931  ? 196.714 146.623 43.069  1.00 237.55 ? 923  GLN B N     1 
ATOM   7218  C CA    . GLN B 2 931  ? 195.863 145.435 42.985  1.00 237.55 ? 923  GLN B CA    1 
ATOM   7219  C C     . GLN B 2 931  ? 196.457 144.355 42.087  1.00 237.55 ? 923  GLN B C     1 
ATOM   7220  O O     . GLN B 2 931  ? 196.299 143.160 42.358  1.00 237.55 ? 923  GLN B O     1 
ATOM   7221  C CB    . GLN B 2 931  ? 194.474 145.828 42.487  1.00 237.55 ? 923  GLN B CB    1 
ATOM   7222  N N     . LEU B 2 932  ? 197.092 144.756 40.984  1.00 226.99 ? 924  LEU B N     1 
ATOM   7223  C CA    . LEU B 2 932  ? 197.802 143.804 40.135  1.00 226.99 ? 924  LEU B CA    1 
ATOM   7224  C C     . LEU B 2 932  ? 198.993 143.182 40.851  1.00 226.99 ? 924  LEU B C     1 
ATOM   7225  O O     . LEU B 2 932  ? 199.253 141.982 40.699  1.00 226.99 ? 924  LEU B O     1 
ATOM   7226  C CB    . LEU B 2 932  ? 198.255 144.490 38.848  1.00 226.99 ? 924  LEU B CB    1 
ATOM   7227  N N     . PHE B 2 933  ? 199.761 143.998 41.581  1.00 222.68 ? 925  PHE B N     1 
ATOM   7228  C CA    . PHE B 2 933  ? 200.878 143.489 42.377  1.00 222.68 ? 925  PHE B CA    1 
ATOM   7229  C C     . PHE B 2 933  ? 200.413 142.491 43.434  1.00 222.68 ? 925  PHE B C     1 
ATOM   7230  O O     . PHE B 2 933  ? 201.074 141.471 43.664  1.00 222.68 ? 925  PHE B O     1 
ATOM   7231  C CB    . PHE B 2 933  ? 201.625 144.649 43.031  1.00 222.68 ? 925  PHE B CB    1 
ATOM   7232  N N     . GLU B 2 934  ? 199.296 142.783 44.106  1.00 228.85 ? 926  GLU B N     1 
ATOM   7233  C CA    . GLU B 2 934  ? 198.719 141.819 45.038  1.00 228.85 ? 926  GLU B CA    1 
ATOM   7234  C C     . GLU B 2 934  ? 198.189 140.581 44.319  1.00 228.85 ? 926  GLU B C     1 
ATOM   7235  O O     . GLU B 2 934  ? 198.251 139.472 44.861  1.00 228.85 ? 926  GLU B O     1 
ATOM   7236  C CB    . GLU B 2 934  ? 197.608 142.484 45.849  1.00 228.85 ? 926  GLU B CB    1 
ATOM   7237  N N     . HIS B 2 935  ? 197.640 140.758 43.115  1.00 225.46 ? 927  HIS B N     1 
ATOM   7238  C CA    . HIS B 2 935  ? 197.291 139.618 42.271  1.00 225.46 ? 927  HIS B CA    1 
ATOM   7239  C C     . HIS B 2 935  ? 198.525 138.818 41.867  1.00 225.46 ? 927  HIS B C     1 
ATOM   7240  O O     . HIS B 2 935  ? 198.467 137.587 41.759  1.00 225.46 ? 927  HIS B O     1 
ATOM   7241  C CB    . HIS B 2 935  ? 196.530 140.098 41.035  1.00 225.46 ? 927  HIS B CB    1 
ATOM   7242  N N     . TRP B 2 936  ? 199.643 139.499 41.630  1.00 218.23 ? 928  TRP B N     1 
ATOM   7243  C CA    . TRP B 2 936  ? 200.920 138.837 41.384  1.00 218.23 ? 928  TRP B CA    1 
ATOM   7244  C C     . TRP B 2 936  ? 201.422 138.099 42.620  1.00 218.23 ? 928  TRP B C     1 
ATOM   7245  O O     . TRP B 2 936  ? 202.384 138.525 43.257  1.00 218.23 ? 928  TRP B O     1 
ATOM   7246  C CB    . TRP B 2 936  ? 201.969 139.851 40.923  1.00 218.23 ? 928  TRP B CB    1 
ATOM   7247  N N     . ALA B 2 1008 ? 182.751 104.360 109.078 1.00 76.00  ? 1000 ALA B N     1 
ATOM   7248  C CA    . ALA B 2 1008 ? 183.287 104.577 107.741 1.00 76.00  ? 1000 ALA B CA    1 
ATOM   7249  C C     . ALA B 2 1008 ? 184.650 105.250 107.806 1.00 76.00  ? 1000 ALA B C     1 
ATOM   7250  O O     . ALA B 2 1008 ? 184.942 106.156 107.027 1.00 76.00  ? 1000 ALA B O     1 
ATOM   7251  C CB    . ALA B 2 1008 ? 182.326 105.409 106.913 1.00 76.00  ? 1000 ALA B CB    1 
ATOM   7252  N N     . CYS B 2 1009 ? 185.483 104.806 108.745 1.00 86.05  ? 1001 CYS B N     1 
ATOM   7253  C CA    . CYS B 2 1009 ? 186.821 105.350 108.921 1.00 86.05  ? 1001 CYS B CA    1 
ATOM   7254  C C     . CYS B 2 1009 ? 187.914 104.298 108.801 1.00 86.05  ? 1001 CYS B C     1 
ATOM   7255  O O     . CYS B 2 1009 ? 189.088 104.616 109.038 1.00 86.05  ? 1001 CYS B O     1 
ATOM   7256  C CB    . CYS B 2 1009 ? 186.926 106.052 110.280 1.00 86.05  ? 1001 CYS B CB    1 
ATOM   7257  N N     . THR B 2 1010 ? 187.564 103.061 108.436 1.00 90.64  ? 1002 THR B N     1 
ATOM   7258  C CA    . THR B 2 1010 ? 188.556 101.994 108.344 1.00 90.64  ? 1002 THR B CA    1 
ATOM   7259  C C     . THR B 2 1010 ? 189.519 102.212 107.187 1.00 90.64  ? 1002 THR B C     1 
ATOM   7260  O O     . THR B 2 1010 ? 190.655 101.730 107.227 1.00 90.64  ? 1002 THR B O     1 
ATOM   7261  C CB    . THR B 2 1010 ? 187.862 100.641 108.198 1.00 90.64  ? 1002 THR B CB    1 
ATOM   7262  N N     . LYS B 2 1011 ? 189.086 102.931 106.151 1.00 104.88 ? 1003 LYS B N     1 
ATOM   7263  C CA    . LYS B 2 1011 ? 190.009 103.322 105.094 1.00 104.88 ? 1003 LYS B CA    1 
ATOM   7264  C C     . LYS B 2 1011 ? 190.972 104.398 105.583 1.00 104.88 ? 1003 LYS B C     1 
ATOM   7265  O O     . LYS B 2 1011 ? 192.156 104.388 105.227 1.00 104.88 ? 1003 LYS B O     1 
ATOM   7266  C CB    . LYS B 2 1011 ? 189.230 103.810 103.874 1.00 104.88 ? 1003 LYS B CB    1 
ATOM   7267  N N     . TYR B 2 1012 ? 190.482 105.327 106.408 1.00 129.89 ? 1004 TYR B N     1 
ATOM   7268  C CA    . TYR B 2 1012 ? 191.320 106.416 106.897 1.00 129.89 ? 1004 TYR B CA    1 
ATOM   7269  C C     . TYR B 2 1012 ? 192.297 105.962 107.975 1.00 129.89 ? 1004 TYR B C     1 
ATOM   7270  O O     . TYR B 2 1012 ? 193.334 106.608 108.165 1.00 129.89 ? 1004 TYR B O     1 
ATOM   7271  C CB    . TYR B 2 1012 ? 190.439 107.548 107.428 1.00 129.89 ? 1004 TYR B CB    1 
ATOM   7272  C CG    . TYR B 2 1012 ? 191.208 108.768 107.877 1.00 129.89 ? 1004 TYR B CG    1 
ATOM   7273  C CD1   . TYR B 2 1012 ? 191.743 109.654 106.950 1.00 129.89 ? 1004 TYR B CD1   1 
ATOM   7274  C CD2   . TYR B 2 1012 ? 191.416 109.025 109.227 1.00 129.89 ? 1004 TYR B CD2   1 
ATOM   7275  C CE1   . TYR B 2 1012 ? 192.452 110.767 107.354 1.00 129.89 ? 1004 TYR B CE1   1 
ATOM   7276  C CE2   . TYR B 2 1012 ? 192.125 110.134 109.640 1.00 129.89 ? 1004 TYR B CE2   1 
ATOM   7277  C CZ    . TYR B 2 1012 ? 192.640 111.002 108.699 1.00 129.89 ? 1004 TYR B CZ    1 
ATOM   7278  O OH    . TYR B 2 1012 ? 193.346 112.111 109.107 1.00 129.89 ? 1004 TYR B OH    1 
ATOM   7279  N N     . LEU B 2 1013 ? 191.997 104.861 108.673 1.00 134.87 ? 1005 LEU B N     1 
ATOM   7280  C CA    . LEU B 2 1013 ? 192.874 104.386 109.740 1.00 134.87 ? 1005 LEU B CA    1 
ATOM   7281  C C     . LEU B 2 1013 ? 194.220 103.889 109.222 1.00 134.87 ? 1005 LEU B C     1 
ATOM   7282  O O     . LEU B 2 1013 ? 195.195 103.872 109.980 1.00 134.87 ? 1005 LEU B O     1 
ATOM   7283  C CB    . LEU B 2 1013 ? 192.185 103.272 110.529 1.00 134.87 ? 1005 LEU B CB    1 
ATOM   7284  N N     . SER B 2 1014 ? 194.300 103.500 107.952 1.00 134.91 ? 1006 SER B N     1 
ATOM   7285  C CA    . SER B 2 1014 ? 195.545 103.047 107.355 1.00 134.91 ? 1006 SER B CA    1 
ATOM   7286  C C     . SER B 2 1014 ? 196.331 104.179 106.708 1.00 134.91 ? 1006 SER B C     1 
ATOM   7287  O O     . SER B 2 1014 ? 197.397 103.930 106.137 1.00 134.91 ? 1006 SER B O     1 
ATOM   7288  C CB    . SER B 2 1014 ? 195.263 101.953 106.323 1.00 134.91 ? 1006 SER B CB    1 
ATOM   7289  N N     . SER B 2 1015 ? 195.840 105.413 106.789 1.00 131.70 ? 1007 SER B N     1 
ATOM   7290  C CA    . SER B 2 1015 ? 196.498 106.542 106.142 1.00 131.70 ? 1007 SER B CA    1 
ATOM   7291  C C     . SER B 2 1015 ? 197.650 107.037 107.008 1.00 131.70 ? 1007 SER B C     1 
ATOM   7292  O O     . SER B 2 1015 ? 197.462 107.301 108.201 1.00 131.70 ? 1007 SER B O     1 
ATOM   7293  C CB    . SER B 2 1015 ? 195.496 107.666 105.884 1.00 131.70 ? 1007 SER B CB    1 
ATOM   7294  N N     . ALA B 2 1016 ? 198.839 107.151 106.392 1.00 150.08 ? 1008 ALA B N     1 
ATOM   7295  C CA    . ALA B 2 1016 ? 200.070 107.663 107.013 1.00 150.08 ? 1008 ALA B CA    1 
ATOM   7296  C C     . ALA B 2 1016 ? 200.466 106.872 108.257 1.00 150.08 ? 1008 ALA B C     1 
ATOM   7297  O O     . ALA B 2 1016 ? 200.950 107.430 109.243 1.00 150.08 ? 1008 ALA B O     1 
ATOM   7298  C CB    . ALA B 2 1016 ? 199.961 109.157 107.332 1.00 150.08 ? 1008 ALA B CB    1 
ATOM   7299  N N     . GLY B 2 1017 ? 200.268 105.560 108.210 1.00 163.77 ? 1009 GLY B N     1 
ATOM   7300  C CA    . GLY B 2 1017 ? 200.583 104.704 109.332 1.00 163.77 ? 1009 GLY B CA    1 
ATOM   7301  C C     . GLY B 2 1017 ? 199.417 104.546 110.293 1.00 163.77 ? 1009 GLY B C     1 
ATOM   7302  O O     . GLY B 2 1017 ? 198.460 105.321 110.299 1.00 163.77 ? 1009 GLY B O     1 
ATOM   7303  N N     . ILE B 2 1018 ? 199.508 103.502 111.119 1.00 210.31 ? 1010 ILE B N     1 
ATOM   7304  C CA    . ILE B 2 1018 ? 198.484 103.184 112.104 1.00 210.31 ? 1010 ILE B CA    1 
ATOM   7305  C C     . ILE B 2 1018 ? 199.052 103.113 113.515 1.00 210.31 ? 1010 ILE B C     1 
ATOM   7306  O O     . ILE B 2 1018 ? 198.434 103.617 114.463 1.00 210.31 ? 1010 ILE B O     1 
ATOM   7307  C CB    . ILE B 2 1018 ? 197.761 101.867 111.747 1.00 210.31 ? 1010 ILE B CB    1 
ATOM   7308  N N     . LEU B 2 1019 ? 200.221 102.484 113.682 1.00 216.61 ? 1011 LEU B N     1 
ATOM   7309  C CA    . LEU B 2 1019 ? 200.750 102.208 115.015 1.00 216.61 ? 1011 LEU B CA    1 
ATOM   7310  C C     . LEU B 2 1019 ? 201.267 103.474 115.690 1.00 216.61 ? 1011 LEU B C     1 
ATOM   7311  O O     . LEU B 2 1019 ? 200.923 103.756 116.843 1.00 216.61 ? 1011 LEU B O     1 
ATOM   7312  C CB    . LEU B 2 1019 ? 201.858 101.157 114.932 1.00 216.61 ? 1011 LEU B CB    1 
ATOM   7313  N N     . LEU B 2 1020 ? 202.098 104.248 114.985 1.00 215.58 ? 1012 LEU B N     1 
ATOM   7314  C CA    . LEU B 2 1020 ? 202.665 105.458 115.576 1.00 215.58 ? 1012 LEU B CA    1 
ATOM   7315  C C     . LEU B 2 1020 ? 201.611 106.542 115.763 1.00 215.58 ? 1012 LEU B C     1 
ATOM   7316  O O     . LEU B 2 1020 ? 201.688 107.318 116.723 1.00 215.58 ? 1012 LEU B O     1 
ATOM   7317  C CB    . LEU B 2 1020 ? 203.812 105.975 114.710 1.00 215.58 ? 1012 LEU B CB    1 
ATOM   7318  N N     . LEU B 2 1021 ? 200.624 106.607 114.867 1.00 229.36 ? 1013 LEU B N     1 
ATOM   7319  C CA    . LEU B 2 1021 ? 199.526 107.550 115.044 1.00 229.36 ? 1013 LEU B CA    1 
ATOM   7320  C C     . LEU B 2 1021 ? 198.608 107.125 116.180 1.00 229.36 ? 1013 LEU B C     1 
ATOM   7321  O O     . LEU B 2 1021 ? 198.077 107.981 116.900 1.00 229.36 ? 1013 LEU B O     1 
ATOM   7322  C CB    . LEU B 2 1021 ? 198.734 107.683 113.745 1.00 229.36 ? 1013 LEU B CB    1 
ATOM   7323  N N     . SER B 2 1022 ? 198.411 105.816 116.352 1.00 240.23 ? 1014 SER B N     1 
ATOM   7324  C CA    . SER B 2 1022 ? 197.597 105.322 117.456 1.00 240.23 ? 1014 SER B CA    1 
ATOM   7325  C C     . SER B 2 1022 ? 198.281 105.543 118.801 1.00 240.23 ? 1014 SER B C     1 
ATOM   7326  O O     . SER B 2 1022 ? 197.612 105.869 119.789 1.00 240.23 ? 1014 SER B O     1 
ATOM   7327  C CB    . SER B 2 1022 ? 197.285 103.840 117.253 1.00 240.23 ? 1014 SER B CB    1 
ATOM   7328  N N     . LEU B 2 1023 ? 199.606 105.386 118.856 1.00 225.66 ? 1015 LEU B N     1 
ATOM   7329  C CA    . LEU B 2 1023 ? 200.332 105.650 120.093 1.00 225.66 ? 1015 LEU B CA    1 
ATOM   7330  C C     . LEU B 2 1023 ? 200.459 107.141 120.374 1.00 225.66 ? 1015 LEU B C     1 
ATOM   7331  O O     . LEU B 2 1023 ? 200.450 107.550 121.541 1.00 225.66 ? 1015 LEU B O     1 
ATOM   7332  C CB    . LEU B 2 1023 ? 201.716 105.003 120.032 1.00 225.66 ? 1015 LEU B CB    1 
ATOM   7333  C CG    . LEU B 2 1023 ? 201.719 103.474 120.036 1.00 225.66 ? 1015 LEU B CG    1 
ATOM   7334  C CD1   . LEU B 2 1023 ? 203.111 102.930 119.781 1.00 225.66 ? 1015 LEU B CD1   1 
ATOM   7335  C CD2   . LEU B 2 1023 ? 201.177 102.952 121.352 1.00 225.66 ? 1015 LEU B CD2   1 
ATOM   7336  N N     . LEU B 2 1024 ? 200.567 107.961 119.327 1.00 212.84 ? 1016 LEU B N     1 
ATOM   7337  C CA    . LEU B 2 1024 ? 200.688 109.402 119.521 1.00 212.84 ? 1016 LEU B CA    1 
ATOM   7338  C C     . LEU B 2 1024 ? 199.364 110.012 119.967 1.00 212.84 ? 1016 LEU B C     1 
ATOM   7339  O O     . LEU B 2 1024 ? 199.319 110.785 120.933 1.00 212.84 ? 1016 LEU B O     1 
ATOM   7340  C CB    . LEU B 2 1024 ? 201.181 110.061 118.233 1.00 212.84 ? 1016 LEU B CB    1 
ATOM   7341  N N     . VAL B 2 1025 ? 198.271 109.671 119.277 1.00 220.33 ? 1017 VAL B N     1 
ATOM   7342  C CA    . VAL B 2 1025 ? 196.959 110.183 119.666 1.00 220.33 ? 1017 VAL B CA    1 
ATOM   7343  C C     . VAL B 2 1025 ? 196.491 109.539 120.965 1.00 220.33 ? 1017 VAL B C     1 
ATOM   7344  O O     . VAL B 2 1025 ? 195.731 110.149 121.731 1.00 220.33 ? 1017 VAL B O     1 
ATOM   7345  C CB    . VAL B 2 1025 ? 195.941 109.961 118.533 1.00 220.33 ? 1017 VAL B CB    1 
ATOM   7346  N N     . PHE B 2 1026 ? 196.926 108.304 121.226 1.00 218.98 ? 1018 PHE B N     1 
ATOM   7347  C CA    . PHE B 2 1026 ? 196.665 107.669 122.512 1.00 218.98 ? 1018 PHE B CA    1 
ATOM   7348  C C     . PHE B 2 1026 ? 197.369 108.411 123.639 1.00 218.98 ? 1018 PHE B C     1 
ATOM   7349  O O     . PHE B 2 1026 ? 196.797 108.603 124.720 1.00 218.98 ? 1018 PHE B O     1 
ATOM   7350  C CB    . PHE B 2 1026 ? 197.118 106.211 122.463 1.00 218.98 ? 1018 PHE B CB    1 
ATOM   7351  C CG    . PHE B 2 1026 ? 196.875 105.454 123.731 1.00 218.98 ? 1018 PHE B CG    1 
ATOM   7352  C CD1   . PHE B 2 1026 ? 195.603 105.008 124.050 1.00 218.98 ? 1018 PHE B CD1   1 
ATOM   7353  C CD2   . PHE B 2 1026 ? 197.921 105.179 124.601 1.00 218.98 ? 1018 PHE B CD2   1 
ATOM   7354  C CE1   . PHE B 2 1026 ? 195.377 104.303 125.217 1.00 218.98 ? 1018 PHE B CE1   1 
ATOM   7355  C CE2   . PHE B 2 1026 ? 197.703 104.478 125.772 1.00 218.98 ? 1018 PHE B CE2   1 
ATOM   7356  C CZ    . PHE B 2 1026 ? 196.430 104.038 126.080 1.00 218.98 ? 1018 PHE B CZ    1 
ATOM   7357  N N     . SER B 2 1027 ? 198.609 108.844 123.396 1.00 218.27 ? 1019 SER B N     1 
ATOM   7358  C CA    . SER B 2 1027 ? 199.324 109.648 124.378 1.00 218.27 ? 1019 SER B CA    1 
ATOM   7359  C C     . SER B 2 1027 ? 198.708 111.032 124.527 1.00 218.27 ? 1019 SER B C     1 
ATOM   7360  O O     . SER B 2 1027 ? 198.804 111.637 125.599 1.00 218.27 ? 1019 SER B O     1 
ATOM   7361  C CB    . SER B 2 1027 ? 200.797 109.765 123.988 1.00 218.27 ? 1019 SER B CB    1 
ATOM   7362  N N     . GLN B 2 1028 ? 198.076 111.548 123.467 1.00 213.74 ? 1020 GLN B N     1 
ATOM   7363  C CA    . GLN B 2 1028 ? 197.360 112.813 123.583 1.00 213.74 ? 1020 GLN B CA    1 
ATOM   7364  C C     . GLN B 2 1028 ? 196.101 112.657 124.426 1.00 213.74 ? 1020 GLN B C     1 
ATOM   7365  O O     . GLN B 2 1028 ? 195.755 113.550 125.211 1.00 213.74 ? 1020 GLN B O     1 
ATOM   7366  C CB    . GLN B 2 1028 ? 197.019 113.349 122.192 1.00 213.74 ? 1020 GLN B CB    1 
ATOM   7367  N N     . LEU B 2 1029 ? 195.403 111.525 124.279 1.00 199.23 ? 1021 LEU B N     1 
ATOM   7368  C CA    . LEU B 2 1029 ? 194.225 111.265 125.099 1.00 199.23 ? 1021 LEU B CA    1 
ATOM   7369  C C     . LEU B 2 1029 ? 194.607 111.046 126.557 1.00 199.23 ? 1021 LEU B C     1 
ATOM   7370  O O     . LEU B 2 1029 ? 193.886 111.475 127.465 1.00 199.23 ? 1021 LEU B O     1 
ATOM   7371  C CB    . LEU B 2 1029 ? 193.466 110.056 124.557 1.00 199.23 ? 1021 LEU B CB    1 
ATOM   7372  N N     . LEU B 2 1030 ? 195.745 110.386 126.797 1.00 197.89 ? 1022 LEU B N     1 
ATOM   7373  C CA    . LEU B 2 1030 ? 196.239 110.243 128.162 1.00 197.89 ? 1022 LEU B CA    1 
ATOM   7374  C C     . LEU B 2 1030 ? 196.698 111.578 128.729 1.00 197.89 ? 1022 LEU B C     1 
ATOM   7375  O O     . LEU B 2 1030 ? 196.564 111.816 129.936 1.00 197.89 ? 1022 LEU B O     1 
ATOM   7376  C CB    . LEU B 2 1030 ? 197.381 109.228 128.204 1.00 197.89 ? 1022 LEU B CB    1 
ATOM   7377  N N     . LYS B 2 1031 ? 197.229 112.459 127.878 1.00 188.76 ? 1023 LYS B N     1 
ATOM   7378  C CA    . LYS B 2 1031 ? 197.614 113.789 128.328 1.00 188.76 ? 1023 LYS B CA    1 
ATOM   7379  C C     . LYS B 2 1031 ? 196.398 114.632 128.677 1.00 188.76 ? 1023 LYS B C     1 
ATOM   7380  O O     . LYS B 2 1031 ? 196.456 115.446 129.606 1.00 188.76 ? 1023 LYS B O     1 
ATOM   7381  C CB    . LYS B 2 1031 ? 198.455 114.485 127.257 1.00 188.76 ? 1023 LYS B CB    1 
ATOM   7382  N N     . HIS B 2 1032 ? 195.286 114.446 127.964 1.00 168.96 ? 1024 HIS B N     1 
ATOM   7383  C CA    . HIS B 2 1032 ? 194.074 115.165 128.333 1.00 168.96 ? 1024 HIS B CA    1 
ATOM   7384  C C     . HIS B 2 1032 ? 193.401 114.546 129.552 1.00 168.96 ? 1024 HIS B C     1 
ATOM   7385  O O     . HIS B 2 1032 ? 192.710 115.250 130.300 1.00 168.96 ? 1024 HIS B O     1 
ATOM   7386  C CB    . HIS B 2 1032 ? 193.104 115.217 127.155 1.00 168.96 ? 1024 HIS B CB    1 
ATOM   7387  C CG    . HIS B 2 1032 ? 191.877 116.024 127.434 1.00 168.96 ? 1024 HIS B CG    1 
ATOM   7388  N ND1   . HIS B 2 1032 ? 191.898 117.399 127.527 1.00 168.96 ? 1024 HIS B ND1   1 
ATOM   7389  C CD2   . HIS B 2 1032 ? 190.595 115.651 127.657 1.00 168.96 ? 1024 HIS B CD2   1 
ATOM   7390  C CE1   . HIS B 2 1032 ? 190.681 117.839 127.789 1.00 168.96 ? 1024 HIS B CE1   1 
ATOM   7391  N NE2   . HIS B 2 1032 ? 189.872 116.798 127.872 1.00 168.96 ? 1024 HIS B NE2   1 
ATOM   7392  N N     . MET B 2 1033 ? 193.590 113.242 129.775 1.00 175.33 ? 1025 MET B N     1 
ATOM   7393  C CA    . MET B 2 1033 ? 193.180 112.652 131.046 1.00 175.33 ? 1025 MET B CA    1 
ATOM   7394  C C     . MET B 2 1033 ? 194.021 113.193 132.193 1.00 175.33 ? 1025 MET B C     1 
ATOM   7395  O O     . MET B 2 1033 ? 193.528 113.333 133.319 1.00 175.33 ? 1025 MET B O     1 
ATOM   7396  C CB    . MET B 2 1033 ? 193.280 111.130 130.982 1.00 175.33 ? 1025 MET B CB    1 
ATOM   7397  N N     . VAL B 2 1034 ? 195.285 113.520 131.918 1.00 182.47 ? 1026 VAL B N     1 
ATOM   7398  C CA    . VAL B 2 1034 ? 196.092 114.229 132.902 1.00 182.47 ? 1026 VAL B CA    1 
ATOM   7399  C C     . VAL B 2 1034 ? 195.610 115.665 133.054 1.00 182.47 ? 1026 VAL B C     1 
ATOM   7400  O O     . VAL B 2 1034 ? 195.782 116.272 134.116 1.00 182.47 ? 1026 VAL B O     1 
ATOM   7401  C CB    . VAL B 2 1034 ? 197.580 114.172 132.514 1.00 182.47 ? 1026 VAL B CB    1 
ATOM   7402  N N     . LEU B 2 1035 ? 195.001 116.233 132.007 1.00 180.27 ? 1027 LEU B N     1 
ATOM   7403  C CA    . LEU B 2 1035 ? 194.477 117.592 132.109 1.00 180.27 ? 1027 LEU B CA    1 
ATOM   7404  C C     . LEU B 2 1035 ? 193.235 117.642 132.990 1.00 180.27 ? 1027 LEU B C     1 
ATOM   7405  O O     . LEU B 2 1035 ? 193.098 118.538 133.834 1.00 180.27 ? 1027 LEU B O     1 
ATOM   7406  C CB    . LEU B 2 1035 ? 194.175 118.148 130.717 1.00 180.27 ? 1027 LEU B CB    1 
ATOM   7407  N N     . VAL B 2 1036 ? 192.325 116.676 132.829 1.00 157.78 ? 1028 VAL B N     1 
ATOM   7408  C CA    . VAL B 2 1036 ? 191.180 116.616 133.725 1.00 157.78 ? 1028 VAL B CA    1 
ATOM   7409  C C     . VAL B 2 1036 ? 191.605 116.114 135.100 1.00 157.78 ? 1028 VAL B C     1 
ATOM   7410  O O     . VAL B 2 1036 ? 190.899 116.333 136.090 1.00 157.78 ? 1028 VAL B O     1 
ATOM   7411  C CB    . VAL B 2 1036 ? 190.057 115.758 133.104 1.00 157.78 ? 1028 VAL B CB    1 
ATOM   7412  C CG1   . VAL B 2 1036 ? 190.383 114.269 133.163 1.00 157.78 ? 1028 VAL B CG1   1 
ATOM   7413  C CG2   . VAL B 2 1036 ? 188.696 116.074 133.727 1.00 157.78 ? 1028 VAL B CG2   1 
ATOM   7414  N N     . ALA B 2 1037 ? 192.767 115.460 135.194 1.00 180.16 ? 1029 ALA B N     1 
ATOM   7415  C CA    . ALA B 2 1037 ? 193.338 115.167 136.503 1.00 180.16 ? 1029 ALA B CA    1 
ATOM   7416  C C     . ALA B 2 1037 ? 193.837 116.437 137.181 1.00 180.16 ? 1029 ALA B C     1 
ATOM   7417  O O     . ALA B 2 1037 ? 193.747 116.565 138.409 1.00 180.16 ? 1029 ALA B O     1 
ATOM   7418  C CB    . ALA B 2 1037 ? 194.465 114.147 136.366 1.00 180.16 ? 1029 ALA B CB    1 
ATOM   7419  N N     . ILE B 2 1038 ? 194.379 117.381 136.403 1.00 179.59 ? 1030 ILE B N     1 
ATOM   7420  C CA    . ILE B 2 1038 ? 194.715 118.697 136.941 1.00 179.59 ? 1030 ILE B CA    1 
ATOM   7421  C C     . ILE B 2 1038 ? 193.444 119.436 137.342 1.00 179.59 ? 1030 ILE B C     1 
ATOM   7422  O O     . ILE B 2 1038 ? 193.419 120.153 138.355 1.00 179.59 ? 1030 ILE B O     1 
ATOM   7423  C CB    . ILE B 2 1038 ? 195.559 119.481 135.909 1.00 179.59 ? 1030 ILE B CB    1 
ATOM   7424  C CG1   . ILE B 2 1038 ? 196.945 118.852 135.760 1.00 179.59 ? 1030 ILE B CG1   1 
ATOM   7425  C CG2   . ILE B 2 1038 ? 195.703 120.958 136.263 1.00 179.59 ? 1030 ILE B CG2   1 
ATOM   7426  C CD1   . ILE B 2 1038 ? 197.744 119.413 134.608 1.00 179.59 ? 1030 ILE B CD1   1 
ATOM   7427  N N     . ASP B 2 1039 ? 192.360 119.223 136.593 1.00 137.47 ? 1031 ASP B N     1 
ATOM   7428  C CA    . ASP B 2 1039 ? 191.075 119.827 136.924 1.00 137.47 ? 1031 ASP B CA    1 
ATOM   7429  C C     . ASP B 2 1039 ? 190.528 119.300 138.247 1.00 137.47 ? 1031 ASP B C     1 
ATOM   7430  O O     . ASP B 2 1039 ? 190.108 120.079 139.113 1.00 137.47 ? 1031 ASP B O     1 
ATOM   7431  C CB    . ASP B 2 1039 ? 190.088 119.564 135.791 1.00 137.47 ? 1031 ASP B CB    1 
ATOM   7432  N N     . TYR B 2 1040 ? 190.540 117.978 138.429 1.00 150.19 ? 1032 TYR B N     1 
ATOM   7433  C CA    . TYR B 2 1040 ? 190.010 117.401 139.660 1.00 150.19 ? 1032 TYR B CA    1 
ATOM   7434  C C     . TYR B 2 1040 ? 190.949 117.625 140.840 1.00 150.19 ? 1032 TYR B C     1 
ATOM   7435  O O     . TYR B 2 1040 ? 190.492 117.687 141.985 1.00 150.19 ? 1032 TYR B O     1 
ATOM   7436  C CB    . TYR B 2 1040 ? 189.736 115.909 139.467 1.00 150.19 ? 1032 TYR B CB    1 
ATOM   7437  C CG    . TYR B 2 1040 ? 189.202 115.230 140.706 1.00 150.19 ? 1032 TYR B CG    1 
ATOM   7438  C CD1   . TYR B 2 1040 ? 187.910 115.478 141.154 1.00 150.19 ? 1032 TYR B CD1   1 
ATOM   7439  C CD2   . TYR B 2 1040 ? 189.991 114.344 141.433 1.00 150.19 ? 1032 TYR B CD2   1 
ATOM   7440  C CE1   . TYR B 2 1040 ? 187.417 114.863 142.293 1.00 150.19 ? 1032 TYR B CE1   1 
ATOM   7441  C CE2   . TYR B 2 1040 ? 189.506 113.722 142.572 1.00 150.19 ? 1032 TYR B CE2   1 
ATOM   7442  C CZ    . TYR B 2 1040 ? 188.220 113.986 142.996 1.00 150.19 ? 1032 TYR B CZ    1 
ATOM   7443  O OH    . TYR B 2 1040 ? 187.732 113.372 144.127 1.00 150.19 ? 1032 TYR B OH    1 
ATOM   7444  N N     . TRP B 2 1041 ? 192.252 117.751 140.587 1.00 154.76 ? 1033 TRP B N     1 
ATOM   7445  C CA    . TRP B 2 1041 ? 193.182 118.029 141.678 1.00 154.76 ? 1033 TRP B CA    1 
ATOM   7446  C C     . TRP B 2 1041 ? 193.062 119.473 142.141 1.00 154.76 ? 1033 TRP B C     1 
ATOM   7447  O O     . TRP B 2 1041 ? 193.133 119.755 143.343 1.00 154.76 ? 1033 TRP B O     1 
ATOM   7448  C CB    . TRP B 2 1041 ? 194.612 117.717 141.240 1.00 154.76 ? 1033 TRP B CB    1 
ATOM   7449  N N     . LEU B 2 1042 ? 192.871 120.400 141.199 1.00 156.95 ? 1034 LEU B N     1 
ATOM   7450  C CA    . LEU B 2 1042 ? 192.593 121.781 141.567 1.00 156.95 ? 1034 LEU B CA    1 
ATOM   7451  C C     . LEU B 2 1042 ? 191.221 121.919 142.207 1.00 156.95 ? 1034 LEU B C     1 
ATOM   7452  O O     . LEU B 2 1042 ? 191.005 122.822 143.022 1.00 156.95 ? 1034 LEU B O     1 
ATOM   7453  C CB    . LEU B 2 1042 ? 192.702 122.681 140.338 1.00 156.95 ? 1034 LEU B CB    1 
ATOM   7454  N N     . ALA B 2 1043 ? 190.288 121.032 141.859 1.00 135.27 ? 1035 ALA B N     1 
ATOM   7455  C CA    . ALA B 2 1043 ? 188.971 121.051 142.485 1.00 135.27 ? 1035 ALA B CA    1 
ATOM   7456  C C     . ALA B 2 1043 ? 189.017 120.495 143.904 1.00 135.27 ? 1035 ALA B C     1 
ATOM   7457  O O     . ALA B 2 1043 ? 188.348 121.019 144.802 1.00 135.27 ? 1035 ALA B O     1 
ATOM   7458  C CB    . ALA B 2 1043 ? 187.979 120.259 141.633 1.00 135.27 ? 1035 ALA B CB    1 
ATOM   7459  N N     . LYS B 2 1044 ? 189.797 119.436 144.123 1.00 116.08 ? 1036 LYS B N     1 
ATOM   7460  C CA    . LYS B 2 1044 ? 189.882 118.838 145.450 1.00 116.08 ? 1036 LYS B CA    1 
ATOM   7461  C C     . LYS B 2 1044 ? 190.714 119.701 146.386 1.00 116.08 ? 1036 LYS B C     1 
ATOM   7462  O O     . LYS B 2 1044 ? 190.397 119.821 147.575 1.00 116.08 ? 1036 LYS B O     1 
ATOM   7463  C CB    . LYS B 2 1044 ? 190.466 117.429 145.352 1.00 116.08 ? 1036 LYS B CB    1 
ATOM   7464  N N     . TRP B 2 1045 ? 191.782 120.317 145.870 1.00 142.81 ? 1037 TRP B N     1 
ATOM   7465  C CA    . TRP B 2 1045 ? 192.513 121.290 146.670 1.00 142.81 ? 1037 TRP B CA    1 
ATOM   7466  C C     . TRP B 2 1045 ? 191.705 122.567 146.857 1.00 142.81 ? 1037 TRP B C     1 
ATOM   7467  O O     . TRP B 2 1045 ? 191.891 123.277 147.849 1.00 142.81 ? 1037 TRP B O     1 
ATOM   7468  C CB    . TRP B 2 1045 ? 193.869 121.598 146.035 1.00 142.81 ? 1037 TRP B CB    1 
ATOM   7469  C CG    . TRP B 2 1045 ? 194.685 122.567 146.835 1.00 142.81 ? 1037 TRP B CG    1 
ATOM   7470  C CD1   . TRP B 2 1045 ? 194.914 123.879 146.545 1.00 142.81 ? 1037 TRP B CD1   1 
ATOM   7471  C CD2   . TRP B 2 1045 ? 195.340 122.311 148.082 1.00 142.81 ? 1037 TRP B CD2   1 
ATOM   7472  N NE1   . TRP B 2 1045 ? 195.691 124.450 147.522 1.00 142.81 ? 1037 TRP B NE1   1 
ATOM   7473  C CE2   . TRP B 2 1045 ? 195.968 123.507 148.476 1.00 142.81 ? 1037 TRP B CE2   1 
ATOM   7474  C CE3   . TRP B 2 1045 ? 195.475 121.180 148.894 1.00 142.81 ? 1037 TRP B CE3   1 
ATOM   7475  C CZ2   . TRP B 2 1045 ? 196.710 123.609 149.647 1.00 142.81 ? 1037 TRP B CZ2   1 
ATOM   7476  C CZ3   . TRP B 2 1045 ? 196.212 121.283 150.058 1.00 142.81 ? 1037 TRP B CZ3   1 
ATOM   7477  C CH2   . TRP B 2 1045 ? 196.822 122.489 150.423 1.00 142.81 ? 1037 TRP B CH2   1 
ATOM   7478  N N     . THR B 2 1046 ? 190.804 122.870 145.918 1.00 127.16 ? 1038 THR B N     1 
ATOM   7479  C CA    . THR B 2 1046 ? 189.848 123.947 146.145 1.00 127.16 ? 1038 THR B CA    1 
ATOM   7480  C C     . THR B 2 1046 ? 188.880 123.591 147.263 1.00 127.16 ? 1038 THR B C     1 
ATOM   7481  O O     . THR B 2 1046 ? 188.447 124.476 148.011 1.00 127.16 ? 1038 THR B O     1 
ATOM   7482  C CB    . THR B 2 1046 ? 189.085 124.261 144.860 1.00 127.16 ? 1038 THR B CB    1 
ATOM   7483  N N     . ASP B 2 1047 ? 188.541 122.307 147.402 1.00 123.43 ? 1039 ASP B N     1 
ATOM   7484  C CA    . ASP B 2 1047 ? 187.777 121.871 148.563 1.00 123.43 ? 1039 ASP B CA    1 
ATOM   7485  C C     . ASP B 2 1047 ? 188.623 121.912 149.828 1.00 123.43 ? 1039 ASP B C     1 
ATOM   7486  O O     . ASP B 2 1047 ? 188.084 122.096 150.927 1.00 123.43 ? 1039 ASP B O     1 
ATOM   7487  C CB    . ASP B 2 1047 ? 187.230 120.463 148.336 1.00 123.43 ? 1039 ASP B CB    1 
ATOM   7488  N N     . SER B 2 1048 ? 189.941 121.744 149.695 1.00 125.80 ? 1040 SER B N     1 
ATOM   7489  C CA    . SER B 2 1048 ? 190.823 121.861 150.850 1.00 125.80 ? 1040 SER B CA    1 
ATOM   7490  C C     . SER B 2 1048 ? 190.931 123.307 151.313 1.00 125.80 ? 1040 SER B C     1 
ATOM   7491  O O     . SER B 2 1048 ? 190.996 123.578 152.517 1.00 125.80 ? 1040 SER B O     1 
ATOM   7492  C CB    . SER B 2 1048 ? 192.202 121.295 150.515 1.00 125.80 ? 1040 SER B CB    1 
ATOM   7493  N N     . ALA B 2 1049 ? 190.950 124.252 150.370 1.00 120.16 ? 1041 ALA B N     1 
ATOM   7494  C CA    . ALA B 2 1049 ? 190.915 125.661 150.736 1.00 120.16 ? 1041 ALA B CA    1 
ATOM   7495  C C     . ALA B 2 1049 ? 189.538 126.062 151.238 1.00 120.16 ? 1041 ALA B C     1 
ATOM   7496  O O     . ALA B 2 1049 ? 189.421 126.980 152.056 1.00 120.16 ? 1041 ALA B O     1 
ATOM   7497  C CB    . ALA B 2 1049 ? 191.319 126.527 149.546 1.00 120.16 ? 1041 ALA B CB    1 
ATOM   7498  N N     . LEU B 2 1050 ? 188.491 125.387 150.765 1.00 128.91 ? 1042 LEU B N     1 
ATOM   7499  C CA    . LEU B 2 1050 ? 187.148 125.623 151.273 1.00 128.91 ? 1042 LEU B CA    1 
ATOM   7500  C C     . LEU B 2 1050 ? 186.936 125.024 152.655 1.00 128.91 ? 1042 LEU B C     1 
ATOM   7501  O O     . LEU B 2 1050 ? 186.020 125.450 153.366 1.00 128.91 ? 1042 LEU B O     1 
ATOM   7502  C CB    . LEU B 2 1050 ? 186.110 125.058 150.302 1.00 128.91 ? 1042 LEU B CB    1 
ATOM   7503  N N     . VAL B 2 1051 ? 187.763 124.054 153.054 1.00 128.32 ? 1043 VAL B N     1 
ATOM   7504  C CA    . VAL B 2 1051 ? 187.652 123.471 154.389 1.00 128.32 ? 1043 VAL B CA    1 
ATOM   7505  C C     . VAL B 2 1051 ? 188.263 124.343 155.471 1.00 128.32 ? 1043 VAL B C     1 
ATOM   7506  O O     . VAL B 2 1051 ? 188.123 124.027 156.659 1.00 128.32 ? 1043 VAL B O     1 
ATOM   7507  C CB    . VAL B 2 1051 ? 188.312 122.081 154.439 1.00 128.32 ? 1043 VAL B CB    1 
ATOM   7508  N N     . LEU B 2 1052 ? 188.938 125.427 155.101 1.00 134.22 ? 1044 LEU B N     1 
ATOM   7509  C CA    . LEU B 2 1052 ? 189.544 126.325 156.076 1.00 134.22 ? 1044 LEU B CA    1 
ATOM   7510  C C     . LEU B 2 1052 ? 188.614 127.492 156.399 1.00 134.22 ? 1044 LEU B C     1 
ATOM   7511  O O     . LEU B 2 1052 ? 189.044 128.643 156.456 1.00 134.22 ? 1044 LEU B O     1 
ATOM   7512  C CB    . LEU B 2 1052 ? 190.884 126.848 155.560 1.00 134.22 ? 1044 LEU B CB    1 
ATOM   7513  N N     . GLN B 2 1069 ? 200.087 126.326 152.933 1.00 112.71 ? 1061 GLN B N     1 
ATOM   7514  C CA    . GLN B 2 1069 ? 199.092 125.448 153.533 1.00 112.71 ? 1061 GLN B CA    1 
ATOM   7515  C C     . GLN B 2 1069 ? 199.679 124.076 153.847 1.00 112.71 ? 1061 GLN B C     1 
ATOM   7516  O O     . GLN B 2 1069 ? 200.882 123.945 154.068 1.00 112.71 ? 1061 GLN B O     1 
ATOM   7517  C CB    . GLN B 2 1069 ? 197.883 125.303 152.611 1.00 112.71 ? 1061 GLN B CB    1 
ATOM   7518  N N     . SER B 2 1070 ? 198.820 123.054 153.862 1.00 110.32 ? 1062 SER B N     1 
ATOM   7519  C CA    . SER B 2 1070 ? 199.258 121.709 154.226 1.00 110.32 ? 1062 SER B CA    1 
ATOM   7520  C C     . SER B 2 1070 ? 200.055 121.058 153.103 1.00 110.32 ? 1062 SER B C     1 
ATOM   7521  O O     . SER B 2 1070 ? 201.207 120.657 153.301 1.00 110.32 ? 1062 SER B O     1 
ATOM   7522  C CB    . SER B 2 1070 ? 198.049 120.844 154.589 1.00 110.32 ? 1062 SER B CB    1 
ATOM   7523  N N     . VAL B 2 1071 ? 199.457 120.947 151.921 1.00 138.60 ? 1063 VAL B N     1 
ATOM   7524  C CA    . VAL B 2 1071 ? 200.104 120.322 150.774 1.00 138.60 ? 1063 VAL B CA    1 
ATOM   7525  C C     . VAL B 2 1071 ? 200.184 121.340 149.647 1.00 138.60 ? 1063 VAL B C     1 
ATOM   7526  O O     . VAL B 2 1071 ? 200.051 120.984 148.471 1.00 138.60 ? 1063 VAL B O     1 
ATOM   7527  C CB    . VAL B 2 1071 ? 199.354 119.056 150.324 1.00 138.60 ? 1063 VAL B CB    1 
ATOM   7528  N N     . TYR B 2 1072 ? 200.380 122.613 150.012 1.00 159.63 ? 1064 TYR B N     1 
ATOM   7529  C CA    . TYR B 2 1072 ? 200.306 123.709 149.047 1.00 159.63 ? 1064 TYR B CA    1 
ATOM   7530  C C     . TYR B 2 1072 ? 201.429 123.643 148.020 1.00 159.63 ? 1064 TYR B C     1 
ATOM   7531  O O     . TYR B 2 1072 ? 201.211 123.937 146.838 1.00 159.63 ? 1064 TYR B O     1 
ATOM   7532  C CB    . TYR B 2 1072 ? 200.334 125.050 149.780 1.00 159.63 ? 1064 TYR B CB    1 
ATOM   7533  N N     . ALA B 2 1073 ? 202.634 123.258 148.448 1.00 160.32 ? 1065 ALA B N     1 
ATOM   7534  C CA    . ALA B 2 1073 ? 203.713 123.038 147.491 1.00 160.32 ? 1065 ALA B CA    1 
ATOM   7535  C C     . ALA B 2 1073 ? 203.415 121.838 146.604 1.00 160.32 ? 1065 ALA B C     1 
ATOM   7536  O O     . ALA B 2 1073 ? 203.693 121.867 145.397 1.00 160.32 ? 1065 ALA B O     1 
ATOM   7537  C CB    . ALA B 2 1073 ? 205.038 122.848 148.226 1.00 160.32 ? 1065 ALA B CB    1 
ATOM   7538  N N     . MET B 2 1074 ? 202.823 120.788 147.184 1.00 167.74 ? 1066 MET B N     1 
ATOM   7539  C CA    . MET B 2 1074 ? 202.425 119.617 146.408 1.00 167.74 ? 1066 MET B CA    1 
ATOM   7540  C C     . MET B 2 1074 ? 201.293 119.952 145.445 1.00 167.74 ? 1066 MET B C     1 
ATOM   7541  O O     . MET B 2 1074 ? 201.278 119.475 144.302 1.00 167.74 ? 1066 MET B O     1 
ATOM   7542  C CB    . MET B 2 1074 ? 202.003 118.486 147.349 1.00 167.74 ? 1066 MET B CB    1 
ATOM   7543  C CG    . MET B 2 1074 ? 203.109 117.960 148.256 1.00 167.74 ? 1066 MET B CG    1 
ATOM   7544  S SD    . MET B 2 1074 ? 204.490 117.203 147.377 1.00 167.74 ? 1066 MET B SD    1 
ATOM   7545  C CE    . MET B 2 1074 ? 203.731 115.695 146.784 1.00 167.74 ? 1066 MET B CE    1 
ATOM   7546  N N     . VAL B 2 1075 ? 200.347 120.785 145.884 1.00 156.83 ? 1067 VAL B N     1 
ATOM   7547  C CA    . VAL B 2 1075 ? 199.183 121.097 145.062 1.00 156.83 ? 1067 VAL B CA    1 
ATOM   7548  C C     . VAL B 2 1075 ? 199.569 122.019 143.915 1.00 156.83 ? 1067 VAL B C     1 
ATOM   7549  O O     . VAL B 2 1075 ? 199.410 121.676 142.738 1.00 156.83 ? 1067 VAL B O     1 
ATOM   7550  C CB    . VAL B 2 1075 ? 198.065 121.712 145.918 1.00 156.83 ? 1067 VAL B CB    1 
ATOM   7551  N N     . PHE B 2 1076 ? 200.088 123.204 144.242 1.00 152.14 ? 1068 PHE B N     1 
ATOM   7552  C CA    . PHE B 2 1076 ? 200.378 124.186 143.207 1.00 152.14 ? 1068 PHE B CA    1 
ATOM   7553  C C     . PHE B 2 1076 ? 201.621 123.832 142.403 1.00 152.14 ? 1068 PHE B C     1 
ATOM   7554  O O     . PHE B 2 1076 ? 201.761 124.302 141.270 1.00 152.14 ? 1068 PHE B O     1 
ATOM   7555  C CB    . PHE B 2 1076 ? 200.526 125.574 143.828 1.00 152.14 ? 1068 PHE B CB    1 
ATOM   7556  C CG    . PHE B 2 1076 ? 199.255 126.104 144.435 1.00 152.14 ? 1068 PHE B CG    1 
ATOM   7557  C CD1   . PHE B 2 1076 ? 198.259 126.642 143.634 1.00 152.14 ? 1068 PHE B CD1   1 
ATOM   7558  C CD2   . PHE B 2 1076 ? 199.061 126.071 145.806 1.00 152.14 ? 1068 PHE B CD2   1 
ATOM   7559  C CE1   . PHE B 2 1076 ? 197.090 127.135 144.193 1.00 152.14 ? 1068 PHE B CE1   1 
ATOM   7560  C CE2   . PHE B 2 1076 ? 197.897 126.561 146.371 1.00 152.14 ? 1068 PHE B CE2   1 
ATOM   7561  C CZ    . PHE B 2 1076 ? 196.909 127.093 145.564 1.00 152.14 ? 1068 PHE B CZ    1 
ATOM   7562  N N     . THR B 2 1077 ? 202.523 123.017 142.952 1.00 153.63 ? 1069 THR B N     1 
ATOM   7563  C CA    . THR B 2 1077 ? 203.663 122.575 142.155 1.00 153.63 ? 1069 THR B CA    1 
ATOM   7564  C C     . THR B 2 1077 ? 203.302 121.376 141.287 1.00 153.63 ? 1069 THR B C     1 
ATOM   7565  O O     . THR B 2 1077 ? 203.701 121.311 140.118 1.00 153.63 ? 1069 THR B O     1 
ATOM   7566  C CB    . THR B 2 1077 ? 204.848 122.239 143.061 1.00 153.63 ? 1069 THR B CB    1 
ATOM   7567  N N     . LEU B 2 1078 ? 202.545 120.423 141.837 1.00 146.39 ? 1070 LEU B N     1 
ATOM   7568  C CA    . LEU B 2 1078 ? 202.187 119.228 141.085 1.00 146.39 ? 1070 LEU B CA    1 
ATOM   7569  C C     . LEU B 2 1078 ? 201.081 119.478 140.068 1.00 146.39 ? 1070 LEU B C     1 
ATOM   7570  O O     . LEU B 2 1078 ? 200.918 118.676 139.142 1.00 146.39 ? 1070 LEU B O     1 
ATOM   7571  C CB    . LEU B 2 1078 ? 201.757 118.112 142.041 1.00 146.39 ? 1070 LEU B CB    1 
ATOM   7572  N N     . LEU B 2 1079 ? 200.332 120.567 140.209 1.00 140.89 ? 1071 LEU B N     1 
ATOM   7573  C CA    . LEU B 2 1079 ? 199.216 120.869 139.324 1.00 140.89 ? 1071 LEU B CA    1 
ATOM   7574  C C     . LEU B 2 1079 ? 199.647 121.530 138.020 1.00 140.89 ? 1071 LEU B C     1 
ATOM   7575  O O     . LEU B 2 1079 ? 198.789 121.870 137.199 1.00 140.89 ? 1071 LEU B O     1 
ATOM   7576  C CB    . LEU B 2 1079 ? 198.203 121.760 140.044 1.00 140.89 ? 1071 LEU B CB    1 
ATOM   7577  N N     . CYS B 2 1080 ? 200.950 121.719 137.805 1.00 147.45 ? 1072 CYS B N     1 
ATOM   7578  C CA    . CYS B 2 1080 ? 201.460 122.322 136.579 1.00 147.45 ? 1072 CYS B CA    1 
ATOM   7579  C C     . CYS B 2 1080 ? 202.353 121.362 135.805 1.00 147.45 ? 1072 CYS B C     1 
ATOM   7580  O O     . CYS B 2 1080 ? 203.205 121.802 135.027 1.00 147.45 ? 1072 CYS B O     1 
ATOM   7581  C CB    . CYS B 2 1080 ? 202.220 123.611 136.894 1.00 147.45 ? 1072 CYS B CB    1 
ATOM   7582  N N     . SER B 2 1081 ? 202.168 120.056 135.997 1.00 166.54 ? 1073 SER B N     1 
ATOM   7583  C CA    . SER B 2 1081 ? 203.043 119.078 135.362 1.00 166.54 ? 1073 SER B CA    1 
ATOM   7584  C C     . SER B 2 1081 ? 202.677 118.866 133.897 1.00 166.54 ? 1073 SER B C     1 
ATOM   7585  O O     . SER B 2 1081 ? 203.529 118.996 133.011 1.00 166.54 ? 1073 SER B O     1 
ATOM   7586  C CB    . SER B 2 1081 ? 202.984 117.755 136.129 1.00 166.54 ? 1073 SER B CB    1 
ATOM   7587  N N     . LEU B 2 1082 ? 201.411 118.559 133.621 1.00 177.09 ? 1074 LEU B N     1 
ATOM   7588  C CA    . LEU B 2 1082 ? 200.965 118.215 132.278 1.00 177.09 ? 1074 LEU B CA    1 
ATOM   7589  C C     . LEU B 2 1082 ? 200.559 119.432 131.456 1.00 177.09 ? 1074 LEU B C     1 
ATOM   7590  O O     . LEU B 2 1082 ? 199.765 119.294 130.520 1.00 177.09 ? 1074 LEU B O     1 
ATOM   7591  C CB    . LEU B 2 1082 ? 199.803 117.223 132.347 1.00 177.09 ? 1074 LEU B CB    1 
ATOM   7592  N N     . GLY B 2 1083 ? 201.067 120.614 131.788 1.00 185.25 ? 1075 GLY B N     1 
ATOM   7593  C CA    . GLY B 2 1083 ? 200.769 121.796 131.004 1.00 185.25 ? 1075 GLY B CA    1 
ATOM   7594  C C     . GLY B 2 1083 ? 201.565 121.828 129.719 1.00 185.25 ? 1075 GLY B C     1 
ATOM   7595  O O     . GLY B 2 1083 ? 201.003 121.785 128.620 1.00 185.25 ? 1075 GLY B O     1 
ATOM   7596  N N     . ILE B 2 1084 ? 202.891 121.894 129.856 1.00 179.06 ? 1076 ILE B N     1 
ATOM   7597  C CA    . ILE B 2 1084 ? 203.769 121.819 128.695 1.00 179.06 ? 1076 ILE B CA    1 
ATOM   7598  C C     . ILE B 2 1084 ? 203.721 120.419 128.096 1.00 179.06 ? 1076 ILE B C     1 
ATOM   7599  O O     . ILE B 2 1084 ? 203.867 120.244 126.878 1.00 179.06 ? 1076 ILE B O     1 
ATOM   7600  C CB    . ILE B 2 1084 ? 205.192 122.242 129.110 1.00 179.06 ? 1076 ILE B CB    1 
ATOM   7601  C CG1   . ILE B 2 1084 ? 205.157 123.638 129.734 1.00 179.06 ? 1076 ILE B CG1   1 
ATOM   7602  C CG2   . ILE B 2 1084 ? 206.145 122.270 127.923 1.00 179.06 ? 1076 ILE B CG2   1 
ATOM   7603  C CD1   . ILE B 2 1084 ? 206.447 124.040 130.414 1.00 179.06 ? 1076 ILE B CD1   1 
ATOM   7604  N N     . VAL B 2 1085 ? 203.462 119.409 128.931 1.00 202.06 ? 1077 VAL B N     1 
ATOM   7605  C CA    . VAL B 2 1085 ? 203.355 118.034 128.450 1.00 202.06 ? 1077 VAL B CA    1 
ATOM   7606  C C     . VAL B 2 1085 ? 202.087 117.849 127.625 1.00 202.06 ? 1077 VAL B C     1 
ATOM   7607  O O     . VAL B 2 1085 ? 202.094 117.156 126.602 1.00 202.06 ? 1077 VAL B O     1 
ATOM   7608  C CB    . VAL B 2 1085 ? 203.406 117.053 129.633 1.00 202.06 ? 1077 VAL B CB    1 
ATOM   7609  N N     . LEU B 2 1086 ? 200.983 118.460 128.050 1.00 194.78 ? 1078 LEU B N     1 
ATOM   7610  C CA    . LEU B 2 1086 ? 199.775 118.414 127.236 1.00 194.78 ? 1078 LEU B CA    1 
ATOM   7611  C C     . LEU B 2 1086 ? 199.920 119.272 125.988 1.00 194.78 ? 1078 LEU B C     1 
ATOM   7612  O O     . LEU B 2 1086 ? 199.363 118.932 124.937 1.00 194.78 ? 1078 LEU B O     1 
ATOM   7613  C CB    . LEU B 2 1086 ? 198.570 118.863 128.060 1.00 194.78 ? 1078 LEU B CB    1 
ATOM   7614  N N     . CYS B 2 1087 ? 200.680 120.366 126.080 1.00 197.18 ? 1079 CYS B N     1 
ATOM   7615  C CA    . CYS B 2 1087 ? 200.857 121.257 124.938 1.00 197.18 ? 1079 CYS B CA    1 
ATOM   7616  C C     . CYS B 2 1087 ? 201.721 120.620 123.857 1.00 197.18 ? 1079 CYS B C     1 
ATOM   7617  O O     . CYS B 2 1087 ? 201.493 120.841 122.662 1.00 197.18 ? 1079 CYS B O     1 
ATOM   7618  C CB    . CYS B 2 1087 ? 201.476 122.577 125.398 1.00 197.18 ? 1079 CYS B CB    1 
ATOM   7619  N N     . LEU B 2 1088 ? 202.715 119.830 124.252 1.00 187.26 ? 1080 LEU B N     1 
ATOM   7620  C CA    . LEU B 2 1088 ? 203.591 119.191 123.281 1.00 187.26 ? 1080 LEU B CA    1 
ATOM   7621  C C     . LEU B 2 1088 ? 203.048 117.848 122.816 1.00 187.26 ? 1080 LEU B C     1 
ATOM   7622  O O     . LEU B 2 1088 ? 203.053 117.565 121.615 1.00 187.26 ? 1080 LEU B O     1 
ATOM   7623  C CB    . LEU B 2 1088 ? 204.990 119.012 123.873 1.00 187.26 ? 1080 LEU B CB    1 
ATOM   7624  N N     . VAL B 2 1089 ? 202.568 117.022 123.749 1.00 197.27 ? 1081 VAL B N     1 
ATOM   7625  C CA    . VAL B 2 1089 ? 202.079 115.689 123.408 1.00 197.27 ? 1081 VAL B CA    1 
ATOM   7626  C C     . VAL B 2 1089 ? 200.736 115.771 122.687 1.00 197.27 ? 1081 VAL B C     1 
ATOM   7627  O O     . VAL B 2 1089 ? 200.478 115.015 121.740 1.00 197.27 ? 1081 VAL B O     1 
ATOM   7628  C CB    . VAL B 2 1089 ? 202.015 114.824 124.684 1.00 197.27 ? 1081 VAL B CB    1 
ATOM   7629  C CG1   . VAL B 2 1089 ? 201.301 113.507 124.446 1.00 197.27 ? 1081 VAL B CG1   1 
ATOM   7630  C CG2   . VAL B 2 1089 ? 203.424 114.538 125.179 1.00 197.27 ? 1081 VAL B CG2   1 
ATOM   7631  N N     . THR B 2 1090 ? 199.880 116.719 123.089 1.00 194.80 ? 1082 THR B N     1 
ATOM   7632  C CA    . THR B 2 1090 ? 198.579 116.859 122.438 1.00 194.80 ? 1082 THR B CA    1 
ATOM   7633  C C     . THR B 2 1090 ? 198.710 117.360 121.003 1.00 194.80 ? 1082 THR B C     1 
ATOM   7634  O O     . THR B 2 1090 ? 197.856 117.057 120.165 1.00 194.80 ? 1082 THR B O     1 
ATOM   7635  C CB    . THR B 2 1090 ? 197.681 117.799 123.241 1.00 194.80 ? 1082 THR B CB    1 
ATOM   7636  N N     . SER B 2 1091 ? 199.772 118.103 120.699 1.00 176.96 ? 1083 SER B N     1 
ATOM   7637  C CA    . SER B 2 1091 ? 200.053 118.542 119.341 1.00 176.96 ? 1083 SER B CA    1 
ATOM   7638  C C     . SER B 2 1091 ? 201.103 117.679 118.657 1.00 176.96 ? 1083 SER B C     1 
ATOM   7639  O O     . SER B 2 1091 ? 201.593 118.050 117.586 1.00 176.96 ? 1083 SER B O     1 
ATOM   7640  C CB    . SER B 2 1091 ? 200.499 120.006 119.342 1.00 176.96 ? 1083 SER B CB    1 
ATOM   7641  N N     . VAL B 2 1092 ? 201.454 116.535 119.247 1.00 189.69 ? 1084 VAL B N     1 
ATOM   7642  C CA    . VAL B 2 1092 ? 202.505 115.690 118.691 1.00 189.69 ? 1084 VAL B CA    1 
ATOM   7643  C C     . VAL B 2 1092 ? 202.008 114.743 117.605 1.00 189.69 ? 1084 VAL B C     1 
ATOM   7644  O O     . VAL B 2 1092 ? 202.795 114.371 116.723 1.00 189.69 ? 1084 VAL B O     1 
ATOM   7645  C CB    . VAL B 2 1092 ? 203.189 114.853 119.788 1.00 189.69 ? 1084 VAL B CB    1 
ATOM   7646  N N     . THR B 2 1093 ? 200.736 114.336 117.650 1.00 180.05 ? 1085 THR B N     1 
ATOM   7647  C CA    . THR B 2 1093 ? 200.232 113.361 116.686 1.00 180.05 ? 1085 THR B CA    1 
ATOM   7648  C C     . THR B 2 1093 ? 200.143 113.946 115.284 1.00 180.05 ? 1085 THR B C     1 
ATOM   7649  O O     . THR B 2 1093 ? 200.245 113.210 114.299 1.00 180.05 ? 1085 THR B O     1 
ATOM   7650  C CB    . THR B 2 1093 ? 198.865 112.841 117.128 1.00 180.05 ? 1085 THR B CB    1 
ATOM   7651  N N     . VAL B 2 1094 ? 199.971 115.260 115.178 1.00 168.94 ? 1086 VAL B N     1 
ATOM   7652  C CA    . VAL B 2 1094 ? 199.941 115.928 113.885 1.00 168.94 ? 1086 VAL B CA    1 
ATOM   7653  C C     . VAL B 2 1094 ? 201.071 116.944 113.838 1.00 168.94 ? 1086 VAL B C     1 
ATOM   7654  O O     . VAL B 2 1094 ? 200.985 117.951 113.125 1.00 168.94 ? 1086 VAL B O     1 
ATOM   7655  C CB    . VAL B 2 1094 ? 198.579 116.597 113.631 1.00 168.94 ? 1086 VAL B CB    1 
ATOM   7656  N N     . GLU B 2 1095 ? 202.133 116.695 114.605 1.00 170.32 ? 1087 GLU B N     1 
ATOM   7657  C CA    . GLU B 2 1095 ? 203.293 117.580 114.570 1.00 170.32 ? 1087 GLU B CA    1 
ATOM   7658  C C     . GLU B 2 1095 ? 204.045 117.437 113.254 1.00 170.32 ? 1087 GLU B C     1 
ATOM   7659  O O     . GLU B 2 1095 ? 204.234 118.414 112.521 1.00 170.32 ? 1087 GLU B O     1 
ATOM   7660  C CB    . GLU B 2 1095 ? 204.214 117.290 115.753 1.00 170.32 ? 1087 GLU B CB    1 
ATOM   7661  N N     . TRP B 2 1096 ? 204.480 116.219 112.933 1.00 170.42 ? 1088 TRP B N     1 
ATOM   7662  C CA    . TRP B 2 1096 ? 205.103 115.942 111.644 1.00 170.42 ? 1088 TRP B CA    1 
ATOM   7663  C C     . TRP B 2 1096 ? 204.309 114.922 110.836 1.00 170.42 ? 1088 TRP B C     1 
ATOM   7664  O O     . TRP B 2 1096 ? 204.872 114.263 109.957 1.00 170.42 ? 1088 TRP B O     1 
ATOM   7665  C CB    . TRP B 2 1096 ? 206.553 115.477 111.822 1.00 170.42 ? 1088 TRP B CB    1 
ATOM   7666  C CG    . TRP B 2 1096 ? 206.732 114.234 112.649 1.00 170.42 ? 1088 TRP B CG    1 
ATOM   7667  C CD1   . TRP B 2 1096 ? 206.594 112.943 112.229 1.00 170.42 ? 1088 TRP B CD1   1 
ATOM   7668  C CD2   . TRP B 2 1096 ? 207.142 114.164 114.020 1.00 170.42 ? 1088 TRP B CD2   1 
ATOM   7669  N NE1   . TRP B 2 1096 ? 206.858 112.077 113.259 1.00 170.42 ? 1088 TRP B NE1   1 
ATOM   7670  C CE2   . TRP B 2 1096 ? 207.202 112.800 114.369 1.00 170.42 ? 1088 TRP B CE2   1 
ATOM   7671  C CE3   . TRP B 2 1096 ? 207.451 115.122 114.989 1.00 170.42 ? 1088 TRP B CE3   1 
ATOM   7672  C CZ2   . TRP B 2 1096 ? 207.557 112.370 115.645 1.00 170.42 ? 1088 TRP B CZ2   1 
ATOM   7673  C CZ3   . TRP B 2 1096 ? 207.804 114.691 116.257 1.00 170.42 ? 1088 TRP B CZ3   1 
ATOM   7674  C CH2   . TRP B 2 1096 ? 207.855 113.327 116.573 1.00 170.42 ? 1088 TRP B CH2   1 
ATOM   7675  N N     . THR B 2 1097 ? 203.006 114.785 111.109 1.00 164.02 ? 1089 THR B N     1 
ATOM   7676  C CA    . THR B 2 1097 ? 202.181 113.836 110.367 1.00 164.02 ? 1089 THR B CA    1 
ATOM   7677  C C     . THR B 2 1097 ? 201.940 114.273 108.928 1.00 164.02 ? 1089 THR B C     1 
ATOM   7678  O O     . THR B 2 1097 ? 201.616 113.431 108.082 1.00 164.02 ? 1089 THR B O     1 
ATOM   7679  C CB    . THR B 2 1097 ? 200.837 113.637 111.064 1.00 164.02 ? 1089 THR B CB    1 
ATOM   7680  N N     . GLY B 2 1098 ? 202.091 115.566 108.635 1.00 170.70 ? 1090 GLY B N     1 
ATOM   7681  C CA    . GLY B 2 1098 ? 202.003 116.028 107.265 1.00 170.70 ? 1090 GLY B CA    1 
ATOM   7682  C C     . GLY B 2 1098 ? 203.168 115.603 106.401 1.00 170.70 ? 1090 GLY B C     1 
ATOM   7683  O O     . GLY B 2 1098 ? 203.048 115.608 105.172 1.00 170.70 ? 1090 GLY B O     1 
ATOM   7684  N N     . LEU B 2 1099 ? 204.297 115.241 107.012 1.00 195.53 ? 1091 LEU B N     1 
ATOM   7685  C CA    . LEU B 2 1099 ? 205.437 114.758 106.241 1.00 195.53 ? 1091 LEU B CA    1 
ATOM   7686  C C     . LEU B 2 1099 ? 205.217 113.323 105.775 1.00 195.53 ? 1091 LEU B C     1 
ATOM   7687  O O     . LEU B 2 1099 ? 205.373 113.018 104.586 1.00 195.53 ? 1091 LEU B O     1 
ATOM   7688  C CB    . LEU B 2 1099 ? 206.714 114.864 107.073 1.00 195.53 ? 1091 LEU B CB    1 
ATOM   7689  N N     . LYS B 2 1100 ? 204.854 112.429 106.701 1.00 192.07 ? 1092 LYS B N     1 
ATOM   7690  C CA    . LYS B 2 1100 ? 204.590 111.042 106.335 1.00 192.07 ? 1092 LYS B CA    1 
ATOM   7691  C C     . LYS B 2 1100 ? 203.304 110.913 105.529 1.00 192.07 ? 1092 LYS B C     1 
ATOM   7692  O O     . LYS B 2 1100 ? 203.199 110.034 104.668 1.00 192.07 ? 1092 LYS B O     1 
ATOM   7693  C CB    . LYS B 2 1100 ? 204.522 110.170 107.586 1.00 192.07 ? 1092 LYS B CB    1 
ATOM   7694  N N     . VAL B 2 1101 ? 202.322 111.782 105.788 1.00 175.84 ? 1093 VAL B N     1 
ATOM   7695  C CA    . VAL B 2 1101 ? 201.132 111.810 104.948 1.00 175.84 ? 1093 VAL B CA    1 
ATOM   7696  C C     . VAL B 2 1101 ? 201.451 112.427 103.594 1.00 175.84 ? 1093 VAL B C     1 
ATOM   7697  O O     . VAL B 2 1101 ? 200.808 112.104 102.588 1.00 175.84 ? 1093 VAL B O     1 
ATOM   7698  C CB    . VAL B 2 1101 ? 199.995 112.565 105.659 1.00 175.84 ? 1093 VAL B CB    1 
ATOM   7699  N N     . ALA B 2 1102 ? 202.450 113.308 103.541 1.00 183.13 ? 1094 ALA B N     1 
ATOM   7700  C CA    . ALA B 2 1102 ? 202.799 113.972 102.290 1.00 183.13 ? 1094 ALA B CA    1 
ATOM   7701  C C     . ALA B 2 1102 ? 203.543 113.029 101.354 1.00 183.13 ? 1094 ALA B C     1 
ATOM   7702  O O     . ALA B 2 1102 ? 203.181 112.887 100.183 1.00 183.13 ? 1094 ALA B O     1 
ATOM   7703  C CB    . ALA B 2 1102 ? 203.637 115.217 102.572 1.00 183.13 ? 1094 ALA B CB    1 
ATOM   7704  N N     . LYS B 2 1103 ? 204.595 112.382 101.855 1.00 166.21 ? 1095 LYS B N     1 
ATOM   7705  C CA    . LYS B 2 1103 ? 205.342 111.453 101.019 1.00 166.21 ? 1095 LYS B CA    1 
ATOM   7706  C C     . LYS B 2 1103 ? 204.610 110.131 100.843 1.00 166.21 ? 1095 LYS B C     1 
ATOM   7707  O O     . LYS B 2 1103 ? 204.732 109.498 99.789  1.00 166.21 ? 1095 LYS B O     1 
ATOM   7708  C CB    . LYS B 2 1103 ? 206.730 111.211 101.615 1.00 166.21 ? 1095 LYS B CB    1 
ATOM   7709  N N     . ARG B 2 1104 ? 203.845 109.702 101.848 1.00 168.98 ? 1096 ARG B N     1 
ATOM   7710  C CA    . ARG B 2 1104 ? 203.111 108.448 101.731 1.00 168.98 ? 1096 ARG B CA    1 
ATOM   7711  C C     . ARG B 2 1104 ? 201.897 108.607 100.825 1.00 168.98 ? 1096 ARG B C     1 
ATOM   7712  O O     . ARG B 2 1104 ? 201.653 107.775 99.945  1.00 168.98 ? 1096 ARG B O     1 
ATOM   7713  C CB    . ARG B 2 1104 ? 202.691 107.953 103.115 1.00 168.98 ? 1096 ARG B CB    1 
ATOM   7714  N N     . LEU B 2 1105 ? 201.124 109.677 101.023 1.00 179.66 ? 1097 LEU B N     1 
ATOM   7715  C CA    . LEU B 2 1105 ? 199.939 109.896 100.204 1.00 179.66 ? 1097 LEU B CA    1 
ATOM   7716  C C     . LEU B 2 1105 ? 200.307 110.381 98.807  1.00 179.66 ? 1097 LEU B C     1 
ATOM   7717  O O     . LEU B 2 1105 ? 199.748 109.906 97.813  1.00 179.66 ? 1097 LEU B O     1 
ATOM   7718  C CB    . LEU B 2 1105 ? 199.012 110.900 100.883 1.00 179.66 ? 1097 LEU B CB    1 
ATOM   7719  N N     . HIS B 2 1106 ? 201.246 111.322 98.719  1.00 178.55 ? 1098 HIS B N     1 
ATOM   7720  C CA    . HIS B 2 1106 ? 201.632 111.871 97.425  1.00 178.55 ? 1098 HIS B CA    1 
ATOM   7721  C C     . HIS B 2 1106 ? 202.484 110.889 96.634  1.00 178.55 ? 1098 HIS B C     1 
ATOM   7722  O O     . HIS B 2 1106 ? 202.291 110.727 95.424  1.00 178.55 ? 1098 HIS B O     1 
ATOM   7723  C CB    . HIS B 2 1106 ? 202.375 113.189 97.623  1.00 178.55 ? 1098 HIS B CB    1 
ATOM   7724  C CG    . HIS B 2 1106 ? 202.848 113.808 96.348  1.00 178.55 ? 1098 HIS B CG    1 
ATOM   7725  N ND1   . HIS B 2 1106 ? 201.994 114.411 95.450  1.00 178.55 ? 1098 HIS B ND1   1 
ATOM   7726  C CD2   . HIS B 2 1106 ? 204.089 113.923 95.820  1.00 178.55 ? 1098 HIS B CD2   1 
ATOM   7727  C CE1   . HIS B 2 1106 ? 202.689 114.868 94.425  1.00 178.55 ? 1098 HIS B CE1   1 
ATOM   7728  N NE2   . HIS B 2 1106 ? 203.963 114.586 94.625  1.00 178.55 ? 1098 HIS B NE2   1 
ATOM   7729  N N     . ARG B 2 1107 ? 203.435 110.227 97.294  1.00 170.44 ? 1099 ARG B N     1 
ATOM   7730  C CA    . ARG B 2 1107 ? 204.289 109.278 96.591  1.00 170.44 ? 1099 ARG B CA    1 
ATOM   7731  C C     . ARG B 2 1107 ? 203.565 107.966 96.321  1.00 170.44 ? 1099 ARG B C     1 
ATOM   7732  O O     . ARG B 2 1107 ? 203.744 107.366 95.255  1.00 170.44 ? 1099 ARG B O     1 
ATOM   7733  C CB    . ARG B 2 1107 ? 205.570 109.028 97.384  1.00 170.44 ? 1099 ARG B CB    1 
ATOM   7734  N N     . SER B 2 1108 ? 202.748 107.502 97.273  1.00 176.62 ? 1100 SER B N     1 
ATOM   7735  C CA    . SER B 2 1108 ? 201.994 106.273 97.054  1.00 176.62 ? 1100 SER B CA    1 
ATOM   7736  C C     . SER B 2 1108 ? 200.855 106.486 96.067  1.00 176.62 ? 1100 SER B C     1 
ATOM   7737  O O     . SER B 2 1108 ? 200.476 105.555 95.347  1.00 176.62 ? 1100 SER B O     1 
ATOM   7738  C CB    . SER B 2 1108 ? 201.450 105.739 98.379  1.00 176.62 ? 1100 SER B CB    1 
ATOM   7739  N N     . LEU B 2 1109 ? 200.300 107.695 96.018  1.00 174.63 ? 1101 LEU B N     1 
ATOM   7740  C CA    . LEU B 2 1109 ? 199.256 107.986 95.046  1.00 174.63 ? 1101 LEU B CA    1 
ATOM   7741  C C     . LEU B 2 1109 ? 199.836 108.208 93.655  1.00 174.63 ? 1101 LEU B C     1 
ATOM   7742  O O     . LEU B 2 1109 ? 199.299 107.694 92.668  1.00 174.63 ? 1101 LEU B O     1 
ATOM   7743  C CB    . LEU B 2 1109 ? 198.455 109.209 95.490  1.00 174.63 ? 1101 LEU B CB    1 
ATOM   7744  N N     . LEU B 2 1110 ? 200.934 108.966 93.564  1.00 178.87 ? 1102 LEU B N     1 
ATOM   7745  C CA    . LEU B 2 1110 ? 201.554 109.232 92.269  1.00 178.87 ? 1102 LEU B CA    1 
ATOM   7746  C C     . LEU B 2 1110 ? 202.239 107.995 91.711  1.00 178.87 ? 1102 LEU B C     1 
ATOM   7747  O O     . LEU B 2 1110 ? 202.389 107.870 90.491  1.00 178.87 ? 1102 LEU B O     1 
ATOM   7748  C CB    . LEU B 2 1110 ? 202.553 110.382 92.389  1.00 178.87 ? 1102 LEU B CB    1 
ATOM   7749  N N     . ASN B 2 1111 ? 202.668 107.081 92.580  1.00 172.50 ? 1103 ASN B N     1 
ATOM   7750  C CA    . ASN B 2 1111 ? 203.217 105.815 92.111  1.00 172.50 ? 1103 ASN B CA    1 
ATOM   7751  C C     . ASN B 2 1111 ? 202.110 104.817 91.797  1.00 172.50 ? 1103 ASN B C     1 
ATOM   7752  O O     . ASN B 2 1111 ? 202.210 104.064 90.821  1.00 172.50 ? 1103 ASN B O     1 
ATOM   7753  C CB    . ASN B 2 1111 ? 204.178 105.240 93.153  1.00 172.50 ? 1103 ASN B CB    1 
ATOM   7754  N N     . ARG B 2 1112 ? 201.045 104.809 92.607  1.00 153.48 ? 1104 ARG B N     1 
ATOM   7755  C CA    . ARG B 2 1112 ? 199.912 103.923 92.367  1.00 153.48 ? 1104 ARG B CA    1 
ATOM   7756  C C     . ARG B 2 1112 ? 199.138 104.308 91.116  1.00 153.48 ? 1104 ARG B C     1 
ATOM   7757  O O     . ARG B 2 1112 ? 198.458 103.456 90.533  1.00 153.48 ? 1104 ARG B O     1 
ATOM   7758  C CB    . ARG B 2 1112 ? 198.977 103.924 93.576  1.00 153.48 ? 1104 ARG B CB    1 
ATOM   7759  N N     . ILE B 2 1113 ? 199.226 105.568 90.695  1.00 171.99 ? 1105 ILE B N     1 
ATOM   7760  C CA    . ILE B 2 1113 ? 198.689 105.986 89.409  1.00 171.99 ? 1105 ILE B CA    1 
ATOM   7761  C C     . ILE B 2 1113 ? 199.769 106.080 88.337  1.00 171.99 ? 1105 ILE B C     1 
ATOM   7762  O O     . ILE B 2 1113 ? 199.436 106.201 87.148  1.00 171.99 ? 1105 ILE B O     1 
ATOM   7763  C CB    . ILE B 2 1113 ? 197.947 107.334 89.535  1.00 171.99 ? 1105 ILE B CB    1 
ATOM   7764  N N     . ILE B 2 1114 ? 201.047 106.029 88.715  1.00 168.09 ? 1106 ILE B N     1 
ATOM   7765  C CA    . ILE B 2 1114 ? 202.109 106.104 87.720  1.00 168.09 ? 1106 ILE B CA    1 
ATOM   7766  C C     . ILE B 2 1114 ? 202.403 104.732 87.128  1.00 168.09 ? 1106 ILE B C     1 
ATOM   7767  O O     . ILE B 2 1114 ? 202.670 104.617 85.927  1.00 168.09 ? 1106 ILE B O     1 
ATOM   7768  C CB    . ILE B 2 1114 ? 203.373 106.729 88.331  1.00 168.09 ? 1106 ILE B CB    1 
ATOM   7769  N N     . LEU B 2 1115 ? 202.350 103.674 87.942  1.00 169.63 ? 1107 LEU B N     1 
ATOM   7770  C CA    . LEU B 2 1115 ? 202.614 102.324 87.459  1.00 169.63 ? 1107 LEU B CA    1 
ATOM   7771  C C     . LEU B 2 1115 ? 201.451 101.729 86.677  1.00 169.63 ? 1107 LEU B C     1 
ATOM   7772  O O     . LEU B 2 1115 ? 201.600 100.639 86.115  1.00 169.63 ? 1107 LEU B O     1 
ATOM   7773  C CB    . LEU B 2 1115 ? 202.965 101.406 88.631  1.00 169.63 ? 1107 LEU B CB    1 
ATOM   7774  N N     . ALA B 2 1116 ? 200.306 102.408 86.637  1.00 172.43 ? 1108 ALA B N     1 
ATOM   7775  C CA    . ALA B 2 1116 ? 199.162 101.927 85.883  1.00 172.43 ? 1108 ALA B CA    1 
ATOM   7776  C C     . ALA B 2 1116 ? 199.418 102.067 84.382  1.00 172.43 ? 1108 ALA B C     1 
ATOM   7777  O O     . ALA B 2 1116 ? 200.200 102.924 83.958  1.00 172.43 ? 1108 ALA B O     1 
ATOM   7778  C CB    . ALA B 2 1116 ? 197.907 102.706 86.273  1.00 172.43 ? 1108 ALA B CB    1 
ATOM   7779  N N     . PRO B 2 1117 ? 198.801 101.215 83.563  1.00 172.23 ? 1109 PRO B N     1 
ATOM   7780  C CA    . PRO B 2 1117 ? 198.923 101.376 82.111  1.00 172.23 ? 1109 PRO B CA    1 
ATOM   7781  C C     . PRO B 2 1117 ? 198.249 102.649 81.623  1.00 172.23 ? 1109 PRO B C     1 
ATOM   7782  O O     . PRO B 2 1117 ? 197.279 103.136 82.211  1.00 172.23 ? 1109 PRO B O     1 
ATOM   7783  C CB    . PRO B 2 1117 ? 198.221 100.131 81.555  1.00 172.23 ? 1109 PRO B CB    1 
ATOM   7784  C CG    . PRO B 2 1117 ? 198.307 99.133  82.656  1.00 172.23 ? 1109 PRO B CG    1 
ATOM   7785  C CD    . PRO B 2 1117 ? 198.177 99.926  83.916  1.00 172.23 ? 1109 PRO B CD    1 
ATOM   7786  N N     . MET B 2 1118 ? 198.786 103.192 80.530  1.00 166.29 ? 1110 MET B N     1 
ATOM   7787  C CA    . MET B 2 1118 ? 198.312 104.457 79.986  1.00 166.29 ? 1110 MET B CA    1 
ATOM   7788  C C     . MET B 2 1118 ? 197.091 104.306 79.088  1.00 166.29 ? 1110 MET B C     1 
ATOM   7789  O O     . MET B 2 1118 ? 196.584 105.318 78.594  1.00 166.29 ? 1110 MET B O     1 
ATOM   7790  C CB    . MET B 2 1118 ? 199.438 105.147 79.209  1.00 166.29 ? 1110 MET B CB    1 
ATOM   7791  N N     . ARG B 2 1119 ? 196.614 103.084 78.859  1.00 154.81 ? 1111 ARG B N     1 
ATOM   7792  C CA    . ARG B 2 1119 ? 195.421 102.898 78.042  1.00 154.81 ? 1111 ARG B CA    1 
ATOM   7793  C C     . ARG B 2 1119 ? 194.154 103.183 78.840  1.00 154.81 ? 1111 ARG B C     1 
ATOM   7794  O O     . ARG B 2 1119 ? 193.308 103.979 78.415  1.00 154.81 ? 1111 ARG B O     1 
ATOM   7795  C CB    . ARG B 2 1119 ? 195.391 101.478 77.474  1.00 154.81 ? 1111 ARG B CB    1 
ATOM   7796  N N     . PHE B 2 1120 ? 194.011 102.543 80.006  1.00 157.73 ? 1112 PHE B N     1 
ATOM   7797  C CA    . PHE B 2 1120 ? 192.841 102.776 80.847  1.00 157.73 ? 1112 PHE B CA    1 
ATOM   7798  C C     . PHE B 2 1120 ? 192.869 104.162 81.478  1.00 157.73 ? 1112 PHE B C     1 
ATOM   7799  O O     . PHE B 2 1120 ? 191.812 104.721 81.791  1.00 157.73 ? 1112 PHE B O     1 
ATOM   7800  C CB    . PHE B 2 1120 ? 192.747 101.702 81.930  1.00 157.73 ? 1112 PHE B CB    1 
ATOM   7801  N N     . PHE B 2 1121 ? 194.060 104.728 81.677  1.00 145.39 ? 1113 PHE B N     1 
ATOM   7802  C CA    . PHE B 2 1121 ? 194.153 106.122 82.084  1.00 145.39 ? 1113 PHE B CA    1 
ATOM   7803  C C     . PHE B 2 1121 ? 193.937 107.065 80.908  1.00 145.39 ? 1113 PHE B C     1 
ATOM   7804  O O     . PHE B 2 1121 ? 193.499 108.202 81.104  1.00 145.39 ? 1113 PHE B O     1 
ATOM   7805  C CB    . PHE B 2 1121 ? 195.507 106.393 82.736  1.00 145.39 ? 1113 PHE B CB    1 
ATOM   7806  N N     . GLU B 2 1122 ? 194.238 106.614 79.688  1.00 149.01 ? 1114 GLU B N     1 
ATOM   7807  C CA    . GLU B 2 1122 ? 194.022 107.430 78.499  1.00 149.01 ? 1114 GLU B CA    1 
ATOM   7808  C C     . GLU B 2 1122 ? 192.562 107.473 78.072  1.00 149.01 ? 1114 GLU B C     1 
ATOM   7809  O O     . GLU B 2 1122 ? 192.156 108.425 77.400  1.00 149.01 ? 1114 GLU B O     1 
ATOM   7810  C CB    . GLU B 2 1122 ? 194.880 106.914 77.343  1.00 149.01 ? 1114 GLU B CB    1 
ATOM   7811  N N     . THR B 2 1123 ? 191.768 106.468 78.441  1.00 142.09 ? 1115 THR B N     1 
ATOM   7812  C CA    . THR B 2 1123 ? 190.342 106.450 78.144  1.00 142.09 ? 1115 THR B CA    1 
ATOM   7813  C C     . THR B 2 1123 ? 189.501 107.018 79.282  1.00 142.09 ? 1115 THR B C     1 
ATOM   7814  O O     . THR B 2 1123 ? 188.351 106.599 79.459  1.00 142.09 ? 1115 THR B O     1 
ATOM   7815  C CB    . THR B 2 1123 ? 189.886 105.026 77.820  1.00 142.09 ? 1115 THR B CB    1 
ATOM   7816  N N     . THR B 2 1124 ? 190.044 107.958 80.053  1.00 148.18 ? 1116 THR B N     1 
ATOM   7817  C CA    . THR B 2 1124 ? 189.389 108.504 81.230  1.00 148.18 ? 1116 THR B CA    1 
ATOM   7818  C C     . THR B 2 1124 ? 189.392 110.029 81.188  1.00 148.18 ? 1116 THR B C     1 
ATOM   7819  O O     . THR B 2 1124 ? 190.312 110.634 80.628  1.00 148.18 ? 1116 THR B O     1 
ATOM   7820  C CB    . THR B 2 1124 ? 190.095 108.030 82.509  1.00 148.18 ? 1116 THR B CB    1 
ATOM   7821  N N     . PRO B 2 1125 ? 188.371 110.680 81.755  1.00 140.52 ? 1117 PRO B N     1 
ATOM   7822  C CA    . PRO B 2 1125 ? 188.392 112.149 81.833  1.00 140.52 ? 1117 PRO B CA    1 
ATOM   7823  C C     . PRO B 2 1125 ? 189.423 112.634 82.843  1.00 140.52 ? 1117 PRO B C     1 
ATOM   7824  O O     . PRO B 2 1125 ? 189.395 112.257 84.017  1.00 140.52 ? 1117 PRO B O     1 
ATOM   7825  C CB    . PRO B 2 1125 ? 186.964 112.505 82.261  1.00 140.52 ? 1117 PRO B CB    1 
ATOM   7826  C CG    . PRO B 2 1125 ? 186.455 111.284 82.943  1.00 140.52 ? 1117 PRO B CG    1 
ATOM   7827  C CD    . PRO B 2 1125 ? 187.090 110.125 82.229  1.00 140.52 ? 1117 PRO B CD    1 
ATOM   7828  N N     . LEU B 2 1126 ? 190.336 113.483 82.373  1.00 154.93 ? 1118 LEU B N     1 
ATOM   7829  C CA    . LEU B 2 1126 ? 191.429 113.974 83.202  1.00 154.93 ? 1118 LEU B CA    1 
ATOM   7830  C C     . LEU B 2 1126 ? 190.995 115.047 84.192  1.00 154.93 ? 1118 LEU B C     1 
ATOM   7831  O O     . LEU B 2 1126 ? 191.760 115.359 85.113  1.00 154.93 ? 1118 LEU B O     1 
ATOM   7832  C CB    . LEU B 2 1126 ? 192.553 114.520 82.318  1.00 154.93 ? 1118 LEU B CB    1 
ATOM   7833  N N     . GLY B 2 1127 ? 189.798 115.613 84.027  1.00 159.31 ? 1119 GLY B N     1 
ATOM   7834  C CA    . GLY B 2 1127 ? 189.347 116.648 84.940  1.00 159.31 ? 1119 GLY B CA    1 
ATOM   7835  C C     . GLY B 2 1127 ? 189.006 116.110 86.316  1.00 159.31 ? 1119 GLY B C     1 
ATOM   7836  O O     . GLY B 2 1127 ? 189.310 116.744 87.330  1.00 159.31 ? 1119 GLY B O     1 
ATOM   7837  N N     . SER B 2 1128 ? 188.372 114.936 86.371  1.00 161.01 ? 1120 SER B N     1 
ATOM   7838  C CA    . SER B 2 1128 ? 188.071 114.320 87.659  1.00 161.01 ? 1120 SER B CA    1 
ATOM   7839  C C     . SER B 2 1128 ? 189.329 113.750 88.300  1.00 161.01 ? 1120 SER B C     1 
ATOM   7840  O O     . SER B 2 1128 ? 189.483 113.791 89.528  1.00 161.01 ? 1120 SER B O     1 
ATOM   7841  C CB    . SER B 2 1128 ? 187.017 113.226 87.485  1.00 161.01 ? 1120 SER B CB    1 
ATOM   7842  N N     . ILE B 2 1129 ? 190.242 113.227 87.479  1.00 154.05 ? 1121 ILE B N     1 
ATOM   7843  C CA    . ILE B 2 1129 ? 191.462 112.614 87.994  1.00 154.05 ? 1121 ILE B CA    1 
ATOM   7844  C C     . ILE B 2 1129 ? 192.391 113.673 88.569  1.00 154.05 ? 1121 ILE B C     1 
ATOM   7845  O O     . ILE B 2 1129 ? 192.852 113.566 89.711  1.00 154.05 ? 1121 ILE B O     1 
ATOM   7846  C CB    . ILE B 2 1129 ? 192.149 111.798 86.886  1.00 154.05 ? 1121 ILE B CB    1 
ATOM   7847  C CG1   . ILE B 2 1129 ? 191.222 110.686 86.390  1.00 154.05 ? 1121 ILE B CG1   1 
ATOM   7848  C CG2   . ILE B 2 1129 ? 193.465 111.226 87.378  1.00 154.05 ? 1121 ILE B CG2   1 
ATOM   7849  C CD1   . ILE B 2 1129 ? 190.841 109.683 87.458  1.00 154.05 ? 1121 ILE B CD1   1 
ATOM   7850  N N     . LEU B 2 1130 ? 192.673 114.719 87.793  1.00 147.77 ? 1122 LEU B N     1 
ATOM   7851  C CA    . LEU B 2 1130 ? 193.555 115.773 88.277  1.00 147.77 ? 1122 LEU B CA    1 
ATOM   7852  C C     . LEU B 2 1130 ? 192.871 116.677 89.289  1.00 147.77 ? 1122 LEU B C     1 
ATOM   7853  O O     . LEU B 2 1130 ? 193.539 117.211 90.182  1.00 147.77 ? 1122 LEU B O     1 
ATOM   7854  C CB    . LEU B 2 1130 ? 194.083 116.609 87.112  1.00 147.77 ? 1122 LEU B CB    1 
ATOM   7855  C CG    . LEU B 2 1130 ? 195.337 116.106 86.390  1.00 147.77 ? 1122 LEU B CG    1 
ATOM   7856  C CD1   . LEU B 2 1130 ? 196.418 115.770 87.406  1.00 147.77 ? 1122 LEU B CD1   1 
ATOM   7857  C CD2   . LEU B 2 1130 ? 195.070 114.911 85.486  1.00 147.77 ? 1122 LEU B CD2   1 
ATOM   7858  N N     . ASN B 2 1131 ? 191.553 116.858 89.168  1.00 148.61 ? 1123 ASN B N     1 
ATOM   7859  C CA    . ASN B 2 1131 ? 190.832 117.708 90.109  1.00 148.61 ? 1123 ASN B CA    1 
ATOM   7860  C C     . ASN B 2 1131 ? 190.747 117.043 91.478  1.00 148.61 ? 1123 ASN B C     1 
ATOM   7861  O O     . ASN B 2 1131 ? 191.133 117.642 92.492  1.00 148.61 ? 1123 ASN B O     1 
ATOM   7862  C CB    . ASN B 2 1131 ? 189.436 118.018 89.566  1.00 148.61 ? 1123 ASN B CB    1 
ATOM   7863  C CG    . ASN B 2 1131 ? 188.767 119.178 90.278  1.00 148.61 ? 1123 ASN B CG    1 
ATOM   7864  O OD1   . ASN B 2 1131 ? 189.344 119.791 91.177  1.00 148.61 ? 1123 ASN B OD1   1 
ATOM   7865  N ND2   . ASN B 2 1131 ? 187.540 119.487 89.877  1.00 148.61 ? 1123 ASN B ND2   1 
ATOM   7866  N N     . ARG B 2 1132 ? 190.262 115.796 91.521  1.00 151.07 ? 1124 ARG B N     1 
ATOM   7867  C CA    . ARG B 2 1132 ? 190.185 115.064 92.781  1.00 151.07 ? 1124 ARG B CA    1 
ATOM   7868  C C     . ARG B 2 1132 ? 191.568 114.736 93.323  1.00 151.07 ? 1124 ARG B C     1 
ATOM   7869  O O     . ARG B 2 1132 ? 191.769 114.732 94.545  1.00 151.07 ? 1124 ARG B O     1 
ATOM   7870  C CB    . ARG B 2 1132 ? 189.376 113.784 92.594  1.00 151.07 ? 1124 ARG B CB    1 
ATOM   7871  N N     . PHE B 2 1133 ? 192.529 114.491 92.431  1.00 152.87 ? 1125 PHE B N     1 
ATOM   7872  C CA    . PHE B 2 1133 ? 193.886 114.151 92.843  1.00 152.87 ? 1125 PHE B CA    1 
ATOM   7873  C C     . PHE B 2 1133 ? 194.589 115.346 93.477  1.00 152.87 ? 1125 PHE B C     1 
ATOM   7874  O O     . PHE B 2 1133 ? 194.976 115.306 94.653  1.00 152.87 ? 1125 PHE B O     1 
ATOM   7875  C CB    . PHE B 2 1133 ? 194.673 113.639 91.637  1.00 152.87 ? 1125 PHE B CB    1 
ATOM   7876  C CG    . PHE B 2 1133 ? 196.078 113.226 91.956  1.00 152.87 ? 1125 PHE B CG    1 
ATOM   7877  C CD1   . PHE B 2 1133 ? 196.326 112.042 92.632  1.00 152.87 ? 1125 PHE B CD1   1 
ATOM   7878  C CD2   . PHE B 2 1133 ? 197.152 114.010 91.567  1.00 152.87 ? 1125 PHE B CD2   1 
ATOM   7879  C CE1   . PHE B 2 1133 ? 197.620 111.650 92.925  1.00 152.87 ? 1125 PHE B CE1   1 
ATOM   7880  C CE2   . PHE B 2 1133 ? 198.450 113.625 91.856  1.00 152.87 ? 1125 PHE B CE2   1 
ATOM   7881  C CZ    . PHE B 2 1133 ? 198.684 112.442 92.538  1.00 152.87 ? 1125 PHE B CZ    1 
ATOM   7882  N N     . SER B 2 1134 ? 194.746 116.426 92.709  1.00 137.08 ? 1126 SER B N     1 
ATOM   7883  C CA    . SER B 2 1134 ? 195.509 117.574 93.188  1.00 137.08 ? 1126 SER B CA    1 
ATOM   7884  C C     . SER B 2 1134 ? 194.760 118.329 94.278  1.00 137.08 ? 1126 SER B C     1 
ATOM   7885  O O     . SER B 2 1134 ? 195.373 118.787 95.252  1.00 137.08 ? 1126 SER B O     1 
ATOM   7886  C CB    . SER B 2 1134 ? 195.839 118.500 92.021  1.00 137.08 ? 1126 SER B CB    1 
ATOM   7887  O OG    . SER B 2 1134 ? 196.552 119.635 92.467  1.00 137.08 ? 1126 SER B OG    1 
ATOM   7888  N N     . SER B 2 1135 ? 193.436 118.462 94.140  1.00 141.00 ? 1127 SER B N     1 
ATOM   7889  C CA    . SER B 2 1135 ? 192.667 119.131 95.184  1.00 141.00 ? 1127 SER B CA    1 
ATOM   7890  C C     . SER B 2 1135 ? 192.586 118.280 96.443  1.00 141.00 ? 1127 SER B C     1 
ATOM   7891  O O     . SER B 2 1135 ? 192.496 118.824 97.549  1.00 141.00 ? 1127 SER B O     1 
ATOM   7892  C CB    . SER B 2 1135 ? 191.263 119.465 94.687  1.00 141.00 ? 1127 SER B CB    1 
ATOM   7893  O OG    . SER B 2 1135 ? 190.484 118.291 94.553  1.00 141.00 ? 1127 SER B OG    1 
ATOM   7894  N N     . ASP B 2 1136 ? 192.617 116.951 96.296  1.00 145.96 ? 1128 ASP B N     1 
ATOM   7895  C CA    . ASP B 2 1136 ? 192.677 116.090 97.472  1.00 145.96 ? 1128 ASP B CA    1 
ATOM   7896  C C     . ASP B 2 1136 ? 194.025 116.209 98.168  1.00 145.96 ? 1128 ASP B C     1 
ATOM   7897  O O     . ASP B 2 1136 ? 194.096 116.167 99.403  1.00 145.96 ? 1128 ASP B O     1 
ATOM   7898  C CB    . ASP B 2 1136 ? 192.405 114.637 97.082  1.00 145.96 ? 1128 ASP B CB    1 
ATOM   7899  N N     . CYS B 2 1137 ? 195.103 116.370 97.396  1.00 147.96 ? 1129 CYS B N     1 
ATOM   7900  C CA    . CYS B 2 1137 ? 196.431 116.469 97.995  1.00 147.96 ? 1129 CYS B CA    1 
ATOM   7901  C C     . CYS B 2 1137 ? 196.626 117.802 98.707  1.00 147.96 ? 1129 CYS B C     1 
ATOM   7902  O O     . CYS B 2 1137 ? 197.061 117.836 99.865  1.00 147.96 ? 1129 CYS B O     1 
ATOM   7903  C CB    . CYS B 2 1137 ? 197.512 116.265 96.932  1.00 147.96 ? 1129 CYS B CB    1 
ATOM   7904  S SG    . CYS B 2 1137 ? 197.664 114.569 96.312  1.00 147.96 ? 1129 CYS B SG    1 
ATOM   7905  N N     . ASN B 2 1138 ? 196.318 118.912 98.031  1.00 110.72 ? 1130 ASN B N     1 
ATOM   7906  C CA    . ASN B 2 1138 ? 196.518 120.217 98.655  1.00 110.72 ? 1130 ASN B CA    1 
ATOM   7907  C C     . ASN B 2 1138 ? 195.490 120.468 99.748  1.00 110.72 ? 1130 ASN B C     1 
ATOM   7908  O O     . ASN B 2 1138 ? 195.827 120.991 100.818 1.00 110.72 ? 1130 ASN B O     1 
ATOM   7909  C CB    . ASN B 2 1138 ? 196.461 121.321 97.601  1.00 110.72 ? 1130 ASN B CB    1 
ATOM   7910  N N     . THR B 2 1139 ? 194.239 120.076 99.508  1.00 112.12 ? 1131 THR B N     1 
ATOM   7911  C CA    . THR B 2 1139 ? 193.177 120.353 100.469 1.00 112.12 ? 1131 THR B CA    1 
ATOM   7912  C C     . THR B 2 1139 ? 193.277 119.437 101.681 1.00 112.12 ? 1131 THR B C     1 
ATOM   7913  O O     . THR B 2 1139 ? 193.148 119.889 102.824 1.00 112.12 ? 1131 THR B O     1 
ATOM   7914  C CB    . THR B 2 1139 ? 191.813 120.204 99.796  1.00 112.12 ? 1131 THR B CB    1 
ATOM   7915  N N     . ILE B 2 1140 ? 193.505 118.143 101.449 1.00 110.58 ? 1132 ILE B N     1 
ATOM   7916  C CA    . ILE B 2 1140 ? 193.603 117.202 102.558 1.00 110.58 ? 1132 ILE B CA    1 
ATOM   7917  C C     . ILE B 2 1140 ? 194.919 117.387 103.297 1.00 110.58 ? 1132 ILE B C     1 
ATOM   7918  O O     . ILE B 2 1140 ? 194.965 117.342 104.533 1.00 110.58 ? 1132 ILE B O     1 
ATOM   7919  C CB    . ILE B 2 1140 ? 193.437 115.760 102.048 1.00 110.58 ? 1132 ILE B CB    1 
ATOM   7920  N N     . ASP B 2 1141 ? 196.003 117.618 102.555 1.00 124.58 ? 1133 ASP B N     1 
ATOM   7921  C CA    . ASP B 2 1141 ? 197.310 117.812 103.169 1.00 124.58 ? 1133 ASP B CA    1 
ATOM   7922  C C     . ASP B 2 1141 ? 197.433 119.161 103.860 1.00 124.58 ? 1133 ASP B C     1 
ATOM   7923  O O     . ASP B 2 1141 ? 198.305 119.324 104.721 1.00 124.58 ? 1133 ASP B O     1 
ATOM   7924  C CB    . ASP B 2 1141 ? 198.411 117.670 102.118 1.00 124.58 ? 1133 ASP B CB    1 
ATOM   7925  N N     . GLN B 2 1142 ? 196.591 120.130 103.506 1.00 114.44 ? 1134 GLN B N     1 
ATOM   7926  C CA    . GLN B 2 1142 ? 196.651 121.431 104.156 1.00 114.44 ? 1134 GLN B CA    1 
ATOM   7927  C C     . GLN B 2 1142 ? 195.658 121.554 105.307 1.00 114.44 ? 1134 GLN B C     1 
ATOM   7928  O O     . GLN B 2 1142 ? 195.973 122.158 106.338 1.00 114.44 ? 1134 GLN B O     1 
ATOM   7929  C CB    . GLN B 2 1142 ? 196.404 122.541 103.130 1.00 114.44 ? 1134 GLN B CB    1 
ATOM   7930  C CG    . GLN B 2 1142 ? 196.579 123.937 103.690 1.00 114.44 ? 1134 GLN B CG    1 
ATOM   7931  C CD    . GLN B 2 1142 ? 197.997 124.186 104.152 1.00 114.44 ? 1134 GLN B CD    1 
ATOM   7932  O OE1   . GLN B 2 1142 ? 198.956 123.820 103.474 1.00 114.44 ? 1134 GLN B OE1   1 
ATOM   7933  N NE2   . GLN B 2 1142 ? 198.140 124.796 105.322 1.00 114.44 ? 1134 GLN B NE2   1 
ATOM   7934  N N     . HIS B 2 1143 ? 194.474 120.963 105.164 1.00 113.24 ? 1135 HIS B N     1 
ATOM   7935  C CA    . HIS B 2 1143 ? 193.381 121.204 106.089 1.00 113.24 ? 1135 HIS B CA    1 
ATOM   7936  C C     . HIS B 2 1143 ? 192.951 119.980 106.881 1.00 113.24 ? 1135 HIS B C     1 
ATOM   7937  O O     . HIS B 2 1143 ? 192.075 120.107 107.744 1.00 113.24 ? 1135 HIS B O     1 
ATOM   7938  C CB    . HIS B 2 1143 ? 192.170 121.756 105.325 1.00 113.24 ? 1135 HIS B CB    1 
ATOM   7939  C CG    . HIS B 2 1143 ? 192.461 123.021 104.586 1.00 113.24 ? 1135 HIS B CG    1 
ATOM   7940  N ND1   . HIS B 2 1143 ? 192.934 123.032 103.293 1.00 113.24 ? 1135 HIS B ND1   1 
ATOM   7941  C CD2   . HIS B 2 1143 ? 192.363 124.318 104.961 1.00 113.24 ? 1135 HIS B CD2   1 
ATOM   7942  C CE1   . HIS B 2 1143 ? 193.106 124.280 102.899 1.00 113.24 ? 1135 HIS B CE1   1 
ATOM   7943  N NE2   . HIS B 2 1143 ? 192.767 125.081 103.893 1.00 113.24 ? 1135 HIS B NE2   1 
ATOM   7944  N N     . ILE B 2 1144 ? 193.526 118.809 106.612 1.00 104.21 ? 1136 ILE B N     1 
ATOM   7945  C CA    . ILE B 2 1144 ? 193.160 117.610 107.373 1.00 104.21 ? 1136 ILE B CA    1 
ATOM   7946  C C     . ILE B 2 1144 ? 193.591 117.652 108.840 1.00 104.21 ? 1136 ILE B C     1 
ATOM   7947  O O     . ILE B 2 1144 ? 192.744 117.384 109.710 1.00 104.21 ? 1136 ILE B O     1 
ATOM   7948  C CB    . ILE B 2 1144 ? 193.649 116.349 106.636 1.00 104.21 ? 1136 ILE B CB    1 
ATOM   7949  N N     . PRO B 2 1145 ? 194.863 117.952 109.200 1.00 99.88  ? 1137 PRO B N     1 
ATOM   7950  C CA    . PRO B 2 1145 ? 195.238 117.778 110.617 1.00 99.88  ? 1137 PRO B CA    1 
ATOM   7951  C C     . PRO B 2 1145 ? 194.653 118.819 111.554 1.00 99.88  ? 1137 PRO B C     1 
ATOM   7952  O O     . PRO B 2 1145 ? 194.551 118.551 112.758 1.00 99.88  ? 1137 PRO B O     1 
ATOM   7953  C CB    . PRO B 2 1145 ? 196.771 117.868 110.597 1.00 99.88  ? 1137 PRO B CB    1 
ATOM   7954  C CG    . PRO B 2 1145 ? 197.161 117.659 109.206 1.00 99.88  ? 1137 PRO B CG    1 
ATOM   7955  C CD    . PRO B 2 1145 ? 196.076 118.303 108.429 1.00 99.88  ? 1137 PRO B CD    1 
ATOM   7956  N N     . SER B 2 1146 ? 194.271 119.992 111.047 1.00 101.71 ? 1138 SER B N     1 
ATOM   7957  C CA    . SER B 2 1146 ? 193.700 121.020 111.910 1.00 101.71 ? 1138 SER B CA    1 
ATOM   7958  C C     . SER B 2 1146 ? 192.324 120.607 112.412 1.00 101.71 ? 1138 SER B C     1 
ATOM   7959  O O     . SER B 2 1146 ? 192.059 120.616 113.620 1.00 101.71 ? 1138 SER B O     1 
ATOM   7960  C CB    . SER B 2 1146 ? 193.625 122.350 111.161 1.00 101.71 ? 1138 SER B CB    1 
ATOM   7961  N N     . THR B 2 1147 ? 191.439 120.221 111.494 1.00 112.04 ? 1139 THR B N     1 
ATOM   7962  C CA    . THR B 2 1147 ? 190.125 119.742 111.892 1.00 112.04 ? 1139 THR B CA    1 
ATOM   7963  C C     . THR B 2 1147 ? 190.185 118.358 112.517 1.00 112.04 ? 1139 THR B C     1 
ATOM   7964  O O     . THR B 2 1147 ? 189.280 118.000 113.276 1.00 112.04 ? 1139 THR B O     1 
ATOM   7965  C CB    . THR B 2 1147 ? 189.182 119.724 110.689 1.00 112.04 ? 1139 THR B CB    1 
ATOM   7966  N N     . LEU B 2 1148 ? 191.219 117.576 112.213 1.00 110.81 ? 1140 LEU B N     1 
ATOM   7967  C CA    . LEU B 2 1148 ? 191.352 116.266 112.840 1.00 110.81 ? 1140 LEU B CA    1 
ATOM   7968  C C     . LEU B 2 1148 ? 191.717 116.400 114.314 1.00 110.81 ? 1140 LEU B C     1 
ATOM   7969  O O     . LEU B 2 1148 ? 191.047 115.830 115.185 1.00 110.81 ? 1140 LEU B O     1 
ATOM   7970  C CB    . LEU B 2 1148 ? 192.396 115.432 112.095 1.00 110.81 ? 1140 LEU B CB    1 
ATOM   7971  N N     . GLU B 2 1149 ? 192.770 117.169 114.611 1.00 99.64  ? 1141 GLU B N     1 
ATOM   7972  C CA    . GLU B 2 1149 ? 193.175 117.378 115.997 1.00 99.64  ? 1141 GLU B CA    1 
ATOM   7973  C C     . GLU B 2 1149 ? 192.161 118.220 116.756 1.00 99.64  ? 1141 GLU B C     1 
ATOM   7974  O O     . GLU B 2 1149 ? 191.992 118.044 117.969 1.00 99.64  ? 1141 GLU B O     1 
ATOM   7975  C CB    . GLU B 2 1149 ? 194.552 118.034 116.049 1.00 99.64  ? 1141 GLU B CB    1 
ATOM   7976  N N     . CYS B 2 1150 ? 191.480 119.133 116.061 1.00 92.34  ? 1142 CYS B N     1 
ATOM   7977  C CA    . CYS B 2 1150 ? 190.384 119.865 116.682 1.00 92.34  ? 1142 CYS B CA    1 
ATOM   7978  C C     . CYS B 2 1150 ? 189.208 118.948 116.988 1.00 92.34  ? 1142 CYS B C     1 
ATOM   7979  O O     . CYS B 2 1150 ? 188.507 119.154 117.985 1.00 92.34  ? 1142 CYS B O     1 
ATOM   7980  C CB    . CYS B 2 1150 ? 189.945 121.012 115.774 1.00 92.34  ? 1142 CYS B CB    1 
ATOM   7981  N N     . LEU B 2 1151 ? 188.985 117.935 116.150 1.00 98.58  ? 1143 LEU B N     1 
ATOM   7982  C CA    . LEU B 2 1151 ? 187.905 116.986 116.398 1.00 98.58  ? 1143 LEU B CA    1 
ATOM   7983  C C     . LEU B 2 1151 ? 188.228 116.084 117.580 1.00 98.58  ? 1143 LEU B C     1 
ATOM   7984  O O     . LEU B 2 1151 ? 187.356 115.805 118.412 1.00 98.58  ? 1143 LEU B O     1 
ATOM   7985  C CB    . LEU B 2 1151 ? 187.644 116.148 115.146 1.00 98.58  ? 1143 LEU B CB    1 
ATOM   7986  N N     . SER B 2 1152 ? 189.478 115.624 117.669 1.00 104.67 ? 1144 SER B N     1 
ATOM   7987  C CA    . SER B 2 1152 ? 189.874 114.780 118.791 1.00 104.67 ? 1144 SER B CA    1 
ATOM   7988  C C     . SER B 2 1152 ? 189.905 115.571 120.092 1.00 104.67 ? 1144 SER B C     1 
ATOM   7989  O O     . SER B 2 1152 ? 189.548 115.044 121.153 1.00 104.67 ? 1144 SER B O     1 
ATOM   7990  C CB    . SER B 2 1152 ? 191.237 114.149 118.514 1.00 104.67 ? 1144 SER B CB    1 
ATOM   7991  N N     . ARG B 2 1153 ? 190.323 116.836 120.027 1.00 96.08  ? 1145 ARG B N     1 
ATOM   7992  C CA    . ARG B 2 1153 ? 190.324 117.669 121.222 1.00 96.08  ? 1145 ARG B CA    1 
ATOM   7993  C C     . ARG B 2 1153 ? 188.907 118.000 121.663 1.00 96.08  ? 1145 ARG B C     1 
ATOM   7994  O O     . ARG B 2 1153 ? 188.605 117.994 122.864 1.00 96.08  ? 1145 ARG B O     1 
ATOM   7995  C CB    . ARG B 2 1153 ? 191.117 118.950 120.965 1.00 96.08  ? 1145 ARG B CB    1 
ATOM   7996  N N     . SER B 2 1154 ? 188.021 118.268 120.702 1.00 78.18  ? 1146 SER B N     1 
ATOM   7997  C CA    . SER B 2 1154 ? 186.651 118.633 121.036 1.00 78.18  ? 1146 SER B CA    1 
ATOM   7998  C C     . SER B 2 1154 ? 185.879 117.443 121.591 1.00 78.18  ? 1146 SER B C     1 
ATOM   7999  O O     . SER B 2 1154 ? 185.149 117.578 122.581 1.00 78.18  ? 1146 SER B O     1 
ATOM   8000  C CB    . SER B 2 1154 ? 185.948 119.202 119.804 1.00 78.18  ? 1146 SER B CB    1 
ATOM   8001  N N     . THR B 2 1155 ? 186.038 116.269 120.977 1.00 75.31  ? 1147 THR B N     1 
ATOM   8002  C CA    . THR B 2 1155 ? 185.341 115.087 121.471 1.00 75.31  ? 1147 THR B CA    1 
ATOM   8003  C C     . THR B 2 1155 ? 185.936 114.610 122.786 1.00 75.31  ? 1147 THR B C     1 
ATOM   8004  O O     . THR B 2 1155 ? 185.206 114.153 123.676 1.00 75.31  ? 1147 THR B O     1 
ATOM   8005  C CB    . THR B 2 1155 ? 185.391 113.972 120.429 1.00 75.31  ? 1147 THR B CB    1 
ATOM   8006  N N     . LEU B 2 1156 ? 187.261 114.723 122.926 1.00 81.33  ? 1148 LEU B N     1 
ATOM   8007  C CA    . LEU B 2 1156 ? 187.927 114.315 124.157 1.00 81.33  ? 1148 LEU B CA    1 
ATOM   8008  C C     . LEU B 2 1156 ? 187.513 115.199 125.322 1.00 81.33  ? 1148 LEU B C     1 
ATOM   8009  O O     . LEU B 2 1156 ? 187.254 114.702 126.426 1.00 81.33  ? 1148 LEU B O     1 
ATOM   8010  C CB    . LEU B 2 1156 ? 189.442 114.356 123.966 1.00 81.33  ? 1148 LEU B CB    1 
ATOM   8011  N N     . LEU B 2 1157 ? 187.419 116.507 125.085 1.00 79.72  ? 1149 LEU B N     1 
ATOM   8012  C CA    . LEU B 2 1157 ? 186.952 117.409 126.128 1.00 79.72  ? 1149 LEU B CA    1 
ATOM   8013  C C     . LEU B 2 1157 ? 185.467 117.220 126.408 1.00 79.72  ? 1149 LEU B C     1 
ATOM   8014  O O     . LEU B 2 1157 ? 185.038 117.328 127.564 1.00 79.72  ? 1149 LEU B O     1 
ATOM   8015  C CB    . LEU B 2 1157 ? 187.251 118.850 125.728 1.00 79.72  ? 1149 LEU B CB    1 
ATOM   8016  N N     . CYS B 2 1158 ? 184.684 116.898 125.372 1.00 79.31  ? 1150 CYS B N     1 
ATOM   8017  C CA    . CYS B 2 1158 ? 183.238 116.755 125.527 1.00 79.31  ? 1150 CYS B CA    1 
ATOM   8018  C C     . CYS B 2 1158 ? 182.885 115.536 126.369 1.00 79.31  ? 1150 CYS B C     1 
ATOM   8019  O O     . CYS B 2 1158 ? 182.103 115.634 127.323 1.00 79.31  ? 1150 CYS B O     1 
ATOM   8020  C CB    . CYS B 2 1158 ? 182.576 116.667 124.152 1.00 79.31  ? 1150 CYS B CB    1 
ATOM   8021  N N     . VAL B 2 1159 ? 183.455 114.377 126.034 1.00 87.80  ? 1151 VAL B N     1 
ATOM   8022  C CA    . VAL B 2 1159 ? 183.198 113.193 126.844 1.00 87.80  ? 1151 VAL B CA    1 
ATOM   8023  C C     . VAL B 2 1159 ? 183.930 113.283 128.172 1.00 87.80  ? 1151 VAL B C     1 
ATOM   8024  O O     . VAL B 2 1159 ? 183.493 112.690 129.169 1.00 87.80  ? 1151 VAL B O     1 
ATOM   8025  C CB    . VAL B 2 1159 ? 183.590 111.921 126.073 1.00 87.80  ? 1151 VAL B CB    1 
ATOM   8026  N N     . SER B 2 1160 ? 185.038 114.028 128.212 1.00 85.93  ? 1152 SER B N     1 
ATOM   8027  C CA    . SER B 2 1160 ? 185.836 114.143 129.429 1.00 85.93  ? 1152 SER B CA    1 
ATOM   8028  C C     . SER B 2 1160 ? 185.085 114.906 130.513 1.00 85.93  ? 1152 SER B C     1 
ATOM   8029  O O     . SER B 2 1160 ? 184.836 114.378 131.604 1.00 85.93  ? 1152 SER B O     1 
ATOM   8030  C CB    . SER B 2 1160 ? 187.167 114.825 129.113 1.00 85.93  ? 1152 SER B CB    1 
ATOM   8031  N N     . ALA B 2 1161 ? 184.701 116.150 130.228 1.00 83.89  ? 1153 ALA B N     1 
ATOM   8032  C CA    . ALA B 2 1161 ? 183.906 116.893 131.197 1.00 83.89  ? 1153 ALA B CA    1 
ATOM   8033  C C     . ALA B 2 1161 ? 182.472 116.390 131.269 1.00 83.89  ? 1153 ALA B C     1 
ATOM   8034  O O     . ALA B 2 1161 ? 181.785 116.666 132.259 1.00 83.89  ? 1153 ALA B O     1 
ATOM   8035  C CB    . ALA B 2 1161 ? 183.922 118.383 130.865 1.00 83.89  ? 1153 ALA B CB    1 
ATOM   8036  N N     . LEU B 2 1162 ? 182.009 115.666 130.244 1.00 82.27  ? 1154 LEU B N     1 
ATOM   8037  C CA    . LEU B 2 1162 ? 180.673 115.077 130.281 1.00 82.27  ? 1154 LEU B CA    1 
ATOM   8038  C C     . LEU B 2 1162 ? 180.587 113.986 131.340 1.00 82.27  ? 1154 LEU B C     1 
ATOM   8039  O O     . LEU B 2 1162 ? 179.692 114.002 132.193 1.00 82.27  ? 1154 LEU B O     1 
ATOM   8040  C CB    . LEU B 2 1162 ? 180.308 114.521 128.905 1.00 82.27  ? 1154 LEU B CB    1 
ATOM   8041  N N     . THR B 2 1163 ? 181.517 113.032 131.307 1.00 77.99  ? 1155 THR B N     1 
ATOM   8042  C CA    . THR B 2 1163 ? 181.548 112.010 132.342 1.00 77.99  ? 1155 THR B CA    1 
ATOM   8043  C C     . THR B 2 1163 ? 182.074 112.548 133.665 1.00 77.99  ? 1155 THR B C     1 
ATOM   8044  O O     . THR B 2 1163 ? 181.755 111.986 134.718 1.00 77.99  ? 1155 THR B O     1 
ATOM   8045  C CB    . THR B 2 1163 ? 182.401 110.823 131.890 1.00 77.99  ? 1155 THR B CB    1 
ATOM   8046  N N     . VAL B 2 1164 ? 182.864 113.622 133.632 1.00 79.72  ? 1156 VAL B N     1 
ATOM   8047  C CA    . VAL B 2 1164 ? 183.400 114.202 134.861 1.00 79.72  ? 1156 VAL B CA    1 
ATOM   8048  C C     . VAL B 2 1164 ? 182.288 114.871 135.657 1.00 79.72  ? 1156 VAL B C     1 
ATOM   8049  O O     . VAL B 2 1164 ? 182.083 114.581 136.842 1.00 79.72  ? 1156 VAL B O     1 
ATOM   8050  C CB    . VAL B 2 1164 ? 184.532 115.192 134.539 1.00 79.72  ? 1156 VAL B CB    1 
ATOM   8051  N N     . ILE B 2 1165 ? 181.547 115.771 135.006 1.00 101.08 ? 1157 ILE B N     1 
ATOM   8052  C CA    . ILE B 2 1165 ? 180.399 116.392 135.647 1.00 101.08 ? 1157 ILE B CA    1 
ATOM   8053  C C     . ILE B 2 1165 ? 179.265 115.399 135.835 1.00 101.08 ? 1157 ILE B C     1 
ATOM   8054  O O     . ILE B 2 1165 ? 178.405 115.603 136.700 1.00 101.08 ? 1157 ILE B O     1 
ATOM   8055  C CB    . ILE B 2 1165 ? 179.923 117.610 134.835 1.00 101.08 ? 1157 ILE B CB    1 
ATOM   8056  N N     . SER B 2 1166 ? 179.237 114.323 135.043 1.00 103.64 ? 1158 SER B N     1 
ATOM   8057  C CA    . SER B 2 1166 ? 178.243 113.278 135.245 1.00 103.64 ? 1158 SER B CA    1 
ATOM   8058  C C     . SER B 2 1166 ? 178.505 112.508 136.533 1.00 103.64 ? 1158 SER B C     1 
ATOM   8059  O O     . SER B 2 1166 ? 177.567 112.184 137.270 1.00 103.64 ? 1158 SER B O     1 
ATOM   8060  C CB    . SER B 2 1166 ? 178.229 112.332 134.045 1.00 103.64 ? 1158 SER B CB    1 
ATOM   8061  N N     . TYR B 2 1167 ? 179.773 112.205 136.823 1.00 89.57  ? 1159 TYR B N     1 
ATOM   8062  C CA    . TYR B 2 1167 ? 180.093 111.584 138.103 1.00 89.57  ? 1159 TYR B CA    1 
ATOM   8063  C C     . TYR B 2 1167 ? 179.992 112.586 139.244 1.00 89.57  ? 1159 TYR B C     1 
ATOM   8064  O O     . TYR B 2 1167 ? 179.749 112.193 140.391 1.00 89.57  ? 1159 TYR B O     1 
ATOM   8065  C CB    . TYR B 2 1167 ? 181.487 110.955 138.067 1.00 89.57  ? 1159 TYR B CB    1 
ATOM   8066  C CG    . TYR B 2 1167 ? 181.853 110.256 139.359 1.00 89.57  ? 1159 TYR B CG    1 
ATOM   8067  C CD1   . TYR B 2 1167 ? 181.281 109.034 139.692 1.00 89.57  ? 1159 TYR B CD1   1 
ATOM   8068  C CD2   . TYR B 2 1167 ? 182.748 110.832 140.258 1.00 89.57  ? 1159 TYR B CD2   1 
ATOM   8069  C CE1   . TYR B 2 1167 ? 181.599 108.396 140.878 1.00 89.57  ? 1159 TYR B CE1   1 
ATOM   8070  C CE2   . TYR B 2 1167 ? 183.072 110.202 141.446 1.00 89.57  ? 1159 TYR B CE2   1 
ATOM   8071  C CZ    . TYR B 2 1167 ? 182.494 108.985 141.750 1.00 89.57  ? 1159 TYR B CZ    1 
ATOM   8072  O OH    . TYR B 2 1167 ? 182.811 108.351 142.929 1.00 89.57  ? 1159 TYR B OH    1 
ATOM   8073  N N     . VAL B 2 1168 ? 180.184 113.877 138.952 1.00 87.35  ? 1160 VAL B N     1 
ATOM   8074  C CA    . VAL B 2 1168 ? 179.941 114.914 139.952 1.00 87.35  ? 1160 VAL B CA    1 
ATOM   8075  C C     . VAL B 2 1168 ? 178.473 114.934 140.345 1.00 87.35  ? 1160 VAL B C     1 
ATOM   8076  O O     . VAL B 2 1168 ? 178.131 115.184 141.506 1.00 87.35  ? 1160 VAL B O     1 
ATOM   8077  C CB    . VAL B 2 1168 ? 180.404 116.288 139.429 1.00 87.35  ? 1160 VAL B CB    1 
ATOM   8078  N N     . THR B 2 1169 ? 177.595 114.660 139.402 1.00 98.00  ? 1161 THR B N     1 
ATOM   8079  C CA    . THR B 2 1169 ? 176.201 114.414 139.708 1.00 98.00  ? 1161 THR B CA    1 
ATOM   8080  C C     . THR B 2 1169 ? 176.040 113.025 140.317 1.00 98.00  ? 1161 THR B C     1 
ATOM   8081  O O     . THR B 2 1169 ? 176.871 112.142 140.093 1.00 98.00  ? 1161 THR B O     1 
ATOM   8082  C CB    . THR B 2 1169 ? 175.355 114.519 138.443 1.00 98.00  ? 1161 THR B CB    1 
ATOM   8083  N N     . PRO B 2 1170 ? 174.987 112.806 141.102 1.00 113.36 ? 1162 PRO B N     1 
ATOM   8084  C CA    . PRO B 2 1170 ? 174.642 111.441 141.512 1.00 113.36 ? 1162 PRO B CA    1 
ATOM   8085  C C     . PRO B 2 1170 ? 174.155 110.613 140.331 1.00 113.36 ? 1162 PRO B C     1 
ATOM   8086  O O     . PRO B 2 1170 ? 173.913 111.113 139.228 1.00 113.36 ? 1162 PRO B O     1 
ATOM   8087  C CB    . PRO B 2 1170 ? 173.533 111.649 142.545 1.00 113.36 ? 1162 PRO B CB    1 
ATOM   8088  C CG    . PRO B 2 1170 ? 173.766 113.019 143.067 1.00 113.36 ? 1162 PRO B CG    1 
ATOM   8089  C CD    . PRO B 2 1170 ? 174.260 113.811 141.897 1.00 113.36 ? 1162 PRO B CD    1 
ATOM   8090  N N     . VAL B 2 1171 ? 174.004 109.309 140.589 1.00 116.26 ? 1163 VAL B N     1 
ATOM   8091  C CA    . VAL B 2 1171 ? 173.633 108.366 139.538 1.00 116.26 ? 1163 VAL B CA    1 
ATOM   8092  C C     . VAL B 2 1171 ? 172.203 108.598 139.073 1.00 116.26 ? 1163 VAL B C     1 
ATOM   8093  O O     . VAL B 2 1171 ? 171.865 108.313 137.918 1.00 116.26 ? 1163 VAL B O     1 
ATOM   8094  C CB    . VAL B 2 1171 ? 173.838 106.918 140.024 1.00 116.26 ? 1163 VAL B CB    1 
ATOM   8095  N N     . PHE B 2 1172 ? 171.346 109.120 139.950 1.00 118.81 ? 1164 PHE B N     1 
ATOM   8096  C CA    . PHE B 2 1172 ? 170.011 109.511 139.521 1.00 118.81 ? 1164 PHE B CA    1 
ATOM   8097  C C     . PHE B 2 1172 ? 170.045 110.783 138.686 1.00 118.81 ? 1164 PHE B C     1 
ATOM   8098  O O     . PHE B 2 1172 ? 169.166 110.999 137.846 1.00 118.81 ? 1164 PHE B O     1 
ATOM   8099  C CB    . PHE B 2 1172 ? 169.104 109.696 140.735 1.00 118.81 ? 1164 PHE B CB    1 
ATOM   8100  N N     . LEU B 2 1173 ? 171.054 111.628 138.894 1.00 113.46 ? 1165 LEU B N     1 
ATOM   8101  C CA    . LEU B 2 1173 ? 171.146 112.919 138.229 1.00 113.46 ? 1165 LEU B CA    1 
ATOM   8102  C C     . LEU B 2 1173 ? 171.977 112.872 136.953 1.00 113.46 ? 1165 LEU B C     1 
ATOM   8103  O O     . LEU B 2 1173 ? 172.407 113.924 136.467 1.00 113.46 ? 1165 LEU B O     1 
ATOM   8104  C CB    . LEU B 2 1173 ? 171.718 113.962 139.188 1.00 113.46 ? 1165 LEU B CB    1 
ATOM   8105  N N     . VAL B 2 1174 ? 172.222 111.682 136.404 1.00 114.43 ? 1166 VAL B N     1 
ATOM   8106  C CA    . VAL B 2 1174 ? 172.926 111.595 135.130 1.00 114.43 ? 1166 VAL B CA    1 
ATOM   8107  C C     . VAL B 2 1174 ? 172.006 112.023 133.994 1.00 114.43 ? 1166 VAL B C     1 
ATOM   8108  O O     . VAL B 2 1174 ? 172.247 113.044 133.338 1.00 114.43 ? 1166 VAL B O     1 
ATOM   8109  C CB    . VAL B 2 1174 ? 173.469 110.173 134.909 1.00 114.43 ? 1166 VAL B CB    1 
ATOM   8110  N N     . ALA B 2 1175 ? 170.922 111.258 133.782 1.00 114.14 ? 1167 ALA B N     1 
ATOM   8111  C CA    . ALA B 2 1175 ? 169.876 111.520 132.779 1.00 114.14 ? 1167 ALA B CA    1 
ATOM   8112  C C     . ALA B 2 1175 ? 170.450 111.684 131.373 1.00 114.14 ? 1167 ALA B C     1 
ATOM   8113  O O     . ALA B 2 1175 ? 170.065 112.581 130.619 1.00 114.14 ? 1167 ALA B O     1 
ATOM   8114  C CB    . ALA B 2 1175 ? 169.026 112.732 133.168 1.00 114.14 ? 1167 ALA B CB    1 
ATOM   8115  N N     . LEU B 2 1176 ? 171.391 110.808 131.018 1.00 142.97 ? 1168 LEU B N     1 
ATOM   8116  C CA    . LEU B 2 1176 ? 172.102 110.943 129.753 1.00 142.97 ? 1168 LEU B CA    1 
ATOM   8117  C C     . LEU B 2 1176 ? 171.281 110.484 128.556 1.00 142.97 ? 1168 LEU B C     1 
ATOM   8118  O O     . LEU B 2 1176 ? 171.600 110.869 127.426 1.00 142.97 ? 1168 LEU B O     1 
ATOM   8119  C CB    . LEU B 2 1176 ? 173.413 110.159 129.806 1.00 142.97 ? 1168 LEU B CB    1 
ATOM   8120  N N     . LEU B 2 1177 ? 170.245 109.683 128.772 1.00 147.59 ? 1169 LEU B N     1 
ATOM   8121  C CA    . LEU B 2 1177 ? 169.433 109.160 127.677 1.00 147.59 ? 1169 LEU B CA    1 
ATOM   8122  C C     . LEU B 2 1177 ? 168.599 110.226 126.951 1.00 147.59 ? 1169 LEU B C     1 
ATOM   8123  O O     . LEU B 2 1177 ? 168.512 110.150 125.718 1.00 147.59 ? 1169 LEU B O     1 
ATOM   8124  C CB    . LEU B 2 1177 ? 168.543 108.015 128.178 1.00 147.59 ? 1169 LEU B CB    1 
ATOM   8125  N N     . PRO B 2 1178 ? 167.969 111.219 127.613 1.00 141.11 ? 1170 PRO B N     1 
ATOM   8126  C CA    . PRO B 2 1178 ? 167.394 112.318 126.814 1.00 141.11 ? 1170 PRO B CA    1 
ATOM   8127  C C     . PRO B 2 1178 ? 168.439 113.191 126.144 1.00 141.11 ? 1170 PRO B C     1 
ATOM   8128  O O     . PRO B 2 1178 ? 168.175 113.722 125.058 1.00 141.11 ? 1170 PRO B O     1 
ATOM   8129  C CB    . PRO B 2 1178 ? 166.572 113.114 127.838 1.00 141.11 ? 1170 PRO B CB    1 
ATOM   8130  C CG    . PRO B 2 1178 ? 166.261 112.160 128.894 1.00 141.11 ? 1170 PRO B CG    1 
ATOM   8131  C CD    . PRO B 2 1178 ? 167.473 111.304 129.006 1.00 141.11 ? 1170 PRO B CD    1 
ATOM   8132  N N     . LEU B 2 1179 ? 169.615 113.344 126.761 1.00 133.97 ? 1171 LEU B N     1 
ATOM   8133  C CA    . LEU B 2 1179 ? 170.664 114.183 126.189 1.00 133.97 ? 1171 LEU B CA    1 
ATOM   8134  C C     . LEU B 2 1179 ? 171.206 113.588 124.898 1.00 133.97 ? 1171 LEU B C     1 
ATOM   8135  O O     . LEU B 2 1179 ? 171.331 114.288 123.887 1.00 133.97 ? 1171 LEU B O     1 
ATOM   8136  C CB    . LEU B 2 1179 ? 171.787 114.376 127.206 1.00 133.97 ? 1171 LEU B CB    1 
ATOM   8137  N N     . ALA B 2 1180 ? 171.515 112.295 124.905 1.00 129.53 ? 1172 ALA B N     1 
ATOM   8138  C CA    . ALA B 2 1180 ? 171.911 111.625 123.678 1.00 129.53 ? 1172 ALA B CA    1 
ATOM   8139  C C     . ALA B 2 1180 ? 170.725 111.264 122.799 1.00 129.53 ? 1172 ALA B C     1 
ATOM   8140  O O     . ALA B 2 1180 ? 170.930 110.833 121.661 1.00 129.53 ? 1172 ALA B O     1 
ATOM   8141  C CB    . ALA B 2 1180 ? 172.718 110.367 123.997 1.00 129.53 ? 1172 ALA B CB    1 
ATOM   8142  N N     . VAL B 2 1181 ? 169.499 111.418 123.296 1.00 152.83 ? 1173 VAL B N     1 
ATOM   8143  C CA    . VAL B 2 1181 ? 168.324 111.205 122.457 1.00 152.83 ? 1173 VAL B CA    1 
ATOM   8144  C C     . VAL B 2 1181 ? 168.100 112.404 121.544 1.00 152.83 ? 1173 VAL B C     1 
ATOM   8145  O O     . VAL B 2 1181 ? 168.068 112.276 120.313 1.00 152.83 ? 1173 VAL B O     1 
ATOM   8146  C CB    . VAL B 2 1181 ? 167.086 110.922 123.324 1.00 152.83 ? 1173 VAL B CB    1 
ATOM   8147  N N     . VAL B 2 1182 ? 167.949 113.589 122.141 1.00 122.33 ? 1174 VAL B N     1 
ATOM   8148  C CA    . VAL B 2 1182 ? 167.780 114.799 121.344 1.00 122.33 ? 1174 VAL B CA    1 
ATOM   8149  C C     . VAL B 2 1182 ? 169.075 115.157 120.634 1.00 122.33 ? 1174 VAL B C     1 
ATOM   8150  O O     . VAL B 2 1182 ? 169.054 115.671 119.507 1.00 122.33 ? 1174 VAL B O     1 
ATOM   8151  C CB    . VAL B 2 1182 ? 167.287 115.955 122.232 1.00 122.33 ? 1174 VAL B CB    1 
ATOM   8152  N N     . CYS B 2 1183 ? 170.216 114.882 121.268 1.00 107.53 ? 1175 CYS B N     1 
ATOM   8153  C CA    . CYS B 2 1183 ? 171.496 115.079 120.602 1.00 107.53 ? 1175 CYS B CA    1 
ATOM   8154  C C     . CYS B 2 1183 ? 171.688 114.084 119.467 1.00 107.53 ? 1175 CYS B C     1 
ATOM   8155  O O     . CYS B 2 1183 ? 172.318 114.417 118.460 1.00 107.53 ? 1175 CYS B O     1 
ATOM   8156  C CB    . CYS B 2 1183 ? 172.634 114.965 121.615 1.00 107.53 ? 1175 CYS B CB    1 
ATOM   8157  N N     . TYR B 2 1184 ? 171.150 112.869 119.613 1.00 104.43 ? 1176 TYR B N     1 
ATOM   8158  C CA    . TYR B 2 1184 ? 171.202 111.879 118.540 1.00 104.43 ? 1176 TYR B CA    1 
ATOM   8159  C C     . TYR B 2 1184 ? 170.353 112.311 117.355 1.00 104.43 ? 1176 TYR B C     1 
ATOM   8160  O O     . TYR B 2 1184 ? 170.758 112.147 116.195 1.00 104.43 ? 1176 TYR B O     1 
ATOM   8161  C CB    . TYR B 2 1184 ? 170.734 110.524 119.071 1.00 104.43 ? 1176 TYR B CB    1 
ATOM   8162  C CG    . TYR B 2 1184 ? 170.745 109.416 118.052 1.00 104.43 ? 1176 TYR B CG    1 
ATOM   8163  C CD1   . TYR B 2 1184 ? 171.936 108.817 117.667 1.00 104.43 ? 1176 TYR B CD1   1 
ATOM   8164  C CD2   . TYR B 2 1184 ? 169.563 108.962 117.482 1.00 104.43 ? 1176 TYR B CD2   1 
ATOM   8165  C CE1   . TYR B 2 1184 ? 171.952 107.802 116.736 1.00 104.43 ? 1176 TYR B CE1   1 
ATOM   8166  C CE2   . TYR B 2 1184 ? 169.568 107.947 116.550 1.00 104.43 ? 1176 TYR B CE2   1 
ATOM   8167  C CZ    . TYR B 2 1184 ? 170.766 107.370 116.181 1.00 104.43 ? 1176 TYR B CZ    1 
ATOM   8168  O OH    . TYR B 2 1184 ? 170.779 106.356 115.253 1.00 104.43 ? 1176 TYR B OH    1 
ATOM   8169  N N     . PHE B 2 1185 ? 169.159 112.839 117.645 1.00 97.33  ? 1177 PHE B N     1 
ATOM   8170  C CA    . PHE B 2 1185 ? 168.310 113.466 116.637 1.00 97.33  ? 1177 PHE B CA    1 
ATOM   8171  C C     . PHE B 2 1185 ? 169.047 114.590 115.914 1.00 97.33  ? 1177 PHE B C     1 
ATOM   8172  O O     . PHE B 2 1185 ? 169.023 114.670 114.675 1.00 97.33  ? 1177 PHE B O     1 
ATOM   8173  C CB    . PHE B 2 1185 ? 167.054 113.989 117.338 1.00 97.33  ? 1177 PHE B CB    1 
ATOM   8174  C CG    . PHE B 2 1185 ? 166.021 114.592 116.426 1.00 97.33  ? 1177 PHE B CG    1 
ATOM   8175  C CD1   . PHE B 2 1185 ? 165.141 113.790 115.717 1.00 97.33  ? 1177 PHE B CD1   1 
ATOM   8176  C CD2   . PHE B 2 1185 ? 165.905 115.971 116.316 1.00 97.33  ? 1177 PHE B CD2   1 
ATOM   8177  C CE1   . PHE B 2 1185 ? 164.172 114.353 114.900 1.00 97.33  ? 1177 PHE B CE1   1 
ATOM   8178  C CE2   . PHE B 2 1185 ? 164.944 116.540 115.496 1.00 97.33  ? 1177 PHE B CE2   1 
ATOM   8179  C CZ    . PHE B 2 1185 ? 164.078 115.730 114.787 1.00 97.33  ? 1177 PHE B CZ    1 
ATOM   8180  N N     . ILE B 2 1186 ? 169.757 115.426 116.676 1.00 91.16  ? 1178 ILE B N     1 
ATOM   8181  C CA    . ILE B 2 1186 ? 170.411 116.605 116.116 1.00 91.16  ? 1178 ILE B CA    1 
ATOM   8182  C C     . ILE B 2 1186 ? 171.604 116.209 115.255 1.00 91.16  ? 1178 ILE B C     1 
ATOM   8183  O O     . ILE B 2 1186 ? 171.807 116.765 114.168 1.00 91.16  ? 1178 ILE B O     1 
ATOM   8184  C CB    . ILE B 2 1186 ? 170.828 117.564 117.243 1.00 91.16  ? 1178 ILE B CB    1 
ATOM   8185  N N     . GLN B 2 1187 ? 172.416 115.258 115.721 1.00 101.89 ? 1179 GLN B N     1 
ATOM   8186  C CA    . GLN B 2 1187 ? 173.588 114.866 114.948 1.00 101.89 ? 1179 GLN B CA    1 
ATOM   8187  C C     . GLN B 2 1187 ? 173.194 114.041 113.734 1.00 101.89 ? 1179 GLN B C     1 
ATOM   8188  O O     . GLN B 2 1187 ? 173.873 114.098 112.700 1.00 101.89 ? 1179 GLN B O     1 
ATOM   8189  C CB    . GLN B 2 1187 ? 174.595 114.114 115.833 1.00 101.89 ? 1179 GLN B CB    1 
ATOM   8190  C CG    . GLN B 2 1187 ? 174.168 112.747 116.374 1.00 101.89 ? 1179 GLN B CG    1 
ATOM   8191  C CD    . GLN B 2 1187 ? 174.571 111.591 115.474 1.00 101.89 ? 1179 GLN B CD    1 
ATOM   8192  O OE1   . GLN B 2 1187 ? 175.592 111.651 114.791 1.00 101.89 ? 1179 GLN B OE1   1 
ATOM   8193  N NE2   . GLN B 2 1187 ? 173.768 110.535 115.469 1.00 101.89 ? 1179 GLN B NE2   1 
ATOM   8194  N N     . LYS B 2 1188 ? 172.096 113.292 113.831 1.00 85.31  ? 1180 LYS B N     1 
ATOM   8195  C CA    . LYS B 2 1188 ? 171.630 112.518 112.690 1.00 85.31  ? 1180 LYS B CA    1 
ATOM   8196  C C     . LYS B 2 1188 ? 171.097 113.435 111.599 1.00 85.31  ? 1180 LYS B C     1 
ATOM   8197  O O     . LYS B 2 1188 ? 171.644 113.491 110.488 1.00 85.31  ? 1180 LYS B O     1 
ATOM   8198  C CB    . LYS B 2 1188 ? 170.557 111.525 113.137 1.00 85.31  ? 1180 LYS B CB    1 
ATOM   8199  N N     . TYR B 2 1189 ? 170.048 114.193 111.912 1.00 80.79  ? 1181 TYR B N     1 
ATOM   8200  C CA    . TYR B 2 1189 ? 169.404 114.955 110.851 1.00 80.79  ? 1181 TYR B CA    1 
ATOM   8201  C C     . TYR B 2 1189 ? 170.200 116.191 110.472 1.00 80.79  ? 1181 TYR B C     1 
ATOM   8202  O O     . TYR B 2 1189 ? 170.142 116.628 109.317 1.00 80.79  ? 1181 TYR B O     1 
ATOM   8203  C CB    . TYR B 2 1189 ? 167.975 115.305 111.258 1.00 80.79  ? 1181 TYR B CB    1 
ATOM   8204  C CG    . TYR B 2 1189 ? 167.049 114.110 111.180 1.00 80.79  ? 1181 TYR B CG    1 
ATOM   8205  C CD1   . TYR B 2 1189 ? 167.413 112.968 110.468 1.00 80.79  ? 1181 TYR B CD1   1 
ATOM   8206  C CD2   . TYR B 2 1189 ? 165.815 114.121 111.809 1.00 80.79  ? 1181 TYR B CD2   1 
ATOM   8207  C CE1   . TYR B 2 1189 ? 166.579 111.876 110.390 1.00 80.79  ? 1181 TYR B CE1   1 
ATOM   8208  C CE2   . TYR B 2 1189 ? 164.969 113.028 111.735 1.00 80.79  ? 1181 TYR B CE2   1 
ATOM   8209  C CZ    . TYR B 2 1189 ? 165.359 111.909 111.023 1.00 80.79  ? 1181 TYR B CZ    1 
ATOM   8210  O OH    . TYR B 2 1189 ? 164.526 110.819 110.942 1.00 80.79  ? 1181 TYR B OH    1 
ATOM   8211  N N     . PHE B 2 1190 ? 170.983 116.738 111.401 1.00 65.13  ? 1182 PHE B N     1 
ATOM   8212  C CA    . PHE B 2 1190 ? 171.898 117.797 111.007 1.00 65.13  ? 1182 PHE B CA    1 
ATOM   8213  C C     . PHE B 2 1190 ? 173.100 117.235 110.266 1.00 65.13  ? 1182 PHE B C     1 
ATOM   8214  O O     . PHE B 2 1190 ? 173.733 117.955 109.489 1.00 65.13  ? 1182 PHE B O     1 
ATOM   8215  C CB    . PHE B 2 1190 ? 172.355 118.612 112.214 1.00 65.13  ? 1182 PHE B CB    1 
ATOM   8216  C CG    . PHE B 2 1190 ? 173.215 119.780 111.843 1.00 65.13  ? 1182 PHE B CG    1 
ATOM   8217  C CD1   . PHE B 2 1190 ? 172.652 120.906 111.268 1.00 65.13  ? 1182 PHE B CD1   1 
ATOM   8218  C CD2   . PHE B 2 1190 ? 174.589 119.734 112.017 1.00 65.13  ? 1182 PHE B CD2   1 
ATOM   8219  C CE1   . PHE B 2 1190 ? 173.439 121.976 110.901 1.00 65.13  ? 1182 PHE B CE1   1 
ATOM   8220  C CE2   . PHE B 2 1190 ? 175.381 120.800 111.650 1.00 65.13  ? 1182 PHE B CE2   1 
ATOM   8221  C CZ    . PHE B 2 1190 ? 174.806 121.923 111.093 1.00 65.13  ? 1182 PHE B CZ    1 
ATOM   8222  N N     . ARG B 2 1191 ? 173.440 115.966 110.492 1.00 56.53  ? 1183 ARG B N     1 
ATOM   8223  C CA    . ARG B 2 1191 ? 174.470 115.352 109.663 1.00 56.53  ? 1183 ARG B CA    1 
ATOM   8224  C C     . ARG B 2 1191 ? 173.989 115.214 108.225 1.00 56.53  ? 1183 ARG B C     1 
ATOM   8225  O O     . ARG B 2 1191 ? 174.735 115.516 107.282 1.00 56.53  ? 1183 ARG B O     1 
ATOM   8226  C CB    . ARG B 2 1191 ? 174.874 113.997 110.236 1.00 56.53  ? 1183 ARG B CB    1 
ATOM   8227  N N     . VAL B 2 1192 ? 172.725 114.818 108.047 1.00 49.35  ? 1184 VAL B N     1 
ATOM   8228  C CA    . VAL B 2 1192 ? 172.170 114.655 106.705 1.00 49.35  ? 1184 VAL B CA    1 
ATOM   8229  C C     . VAL B 2 1192 ? 172.022 116.007 106.014 1.00 49.35  ? 1184 VAL B C     1 
ATOM   8230  O O     . VAL B 2 1192 ? 172.583 116.241 104.934 1.00 49.35  ? 1184 VAL B O     1 
ATOM   8231  C CB    . VAL B 2 1192 ? 170.824 113.912 106.769 1.00 49.35  ? 1184 VAL B CB    1 
ATOM   8232  N N     . ALA B 2 1193 ? 171.277 116.920 106.638 1.00 43.48  ? 1185 ALA B N     1 
ATOM   8233  C CA    . ALA B 2 1193 ? 170.997 118.202 106.005 1.00 43.48  ? 1185 ALA B CA    1 
ATOM   8234  C C     . ALA B 2 1193 ? 172.230 119.088 105.939 1.00 43.48  ? 1185 ALA B C     1 
ATOM   8235  O O     . ALA B 2 1193 ? 172.318 119.961 105.071 1.00 43.48  ? 1185 ALA B O     1 
ATOM   8236  C CB    . ALA B 2 1193 ? 169.872 118.920 106.748 1.00 43.48  ? 1185 ALA B CB    1 
ATOM   8237  N N     . SER B 2 1194 ? 173.189 118.886 106.841 1.00 51.55  ? 1186 SER B N     1 
ATOM   8238  C CA    . SER B 2 1194 ? 174.425 119.653 106.785 1.00 51.55  ? 1186 SER B CA    1 
ATOM   8239  C C     . SER B 2 1194 ? 175.346 119.130 105.694 1.00 51.55  ? 1186 SER B C     1 
ATOM   8240  O O     . SER B 2 1194 ? 176.061 119.914 105.057 1.00 51.55  ? 1186 SER B O     1 
ATOM   8241  C CB    . SER B 2 1194 ? 175.134 119.626 108.139 1.00 51.55  ? 1186 SER B CB    1 
ATOM   8242  N N     . ARG B 2 1195 ? 175.347 117.810 105.476 1.00 39.24  ? 1187 ARG B N     1 
ATOM   8243  C CA    . ARG B 2 1195 ? 176.077 117.262 104.338 1.00 39.24  ? 1187 ARG B CA    1 
ATOM   8244  C C     . ARG B 2 1195 ? 175.469 117.738 103.028 1.00 39.24  ? 1187 ARG B C     1 
ATOM   8245  O O     . ARG B 2 1195 ? 176.195 118.063 102.078 1.00 39.24  ? 1187 ARG B O     1 
ATOM   8246  C CB    . ARG B 2 1195 ? 176.086 115.736 104.404 1.00 39.24  ? 1187 ARG B CB    1 
ATOM   8247  N N     . ASP B 2 1196 ? 174.138 117.818 102.973 1.00 41.77  ? 1188 ASP B N     1 
ATOM   8248  C CA    . ASP B 2 1196 ? 173.477 118.307 101.767 1.00 41.77  ? 1188 ASP B CA    1 
ATOM   8249  C C     . ASP B 2 1196 ? 173.721 119.797 101.558 1.00 41.77  ? 1188 ASP B C     1 
ATOM   8250  O O     . ASP B 2 1196 ? 173.961 120.241 100.427 1.00 41.77  ? 1188 ASP B O     1 
ATOM   8251  C CB    . ASP B 2 1196 ? 171.979 118.017 101.845 1.00 41.77  ? 1188 ASP B CB    1 
ATOM   8252  N N     . LEU B 2 1197 ? 173.679 120.581 102.638 1.00 35.81  ? 1189 LEU B N     1 
ATOM   8253  C CA    . LEU B 2 1197 ? 173.812 122.030 102.524 1.00 35.81  ? 1189 LEU B CA    1 
ATOM   8254  C C     . LEU B 2 1197 ? 175.239 122.426 102.182 1.00 35.81  ? 1189 LEU B C     1 
ATOM   8255  O O     . LEU B 2 1197 ? 175.459 123.291 101.324 1.00 35.81  ? 1189 LEU B O     1 
ATOM   8256  C CB    . LEU B 2 1197 ? 173.369 122.698 103.823 1.00 35.81  ? 1189 LEU B CB    1 
ATOM   8257  N N     . GLN B 2 1198 ? 176.217 121.798 102.832 1.00 36.74  ? 1190 GLN B N     1 
ATOM   8258  C CA    . GLN B 2 1198 ? 177.606 122.046 102.473 1.00 36.74  ? 1190 GLN B CA    1 
ATOM   8259  C C     . GLN B 2 1198 ? 177.930 121.489 101.096 1.00 36.74  ? 1190 GLN B C     1 
ATOM   8260  O O     . GLN B 2 1198 ? 178.824 122.004 100.417 1.00 36.74  ? 1190 GLN B O     1 
ATOM   8261  C CB    . GLN B 2 1198 ? 178.534 121.443 103.525 1.00 36.74  ? 1190 GLN B CB    1 
ATOM   8262  N N     . GLN B 2 1199 ? 177.212 120.447 100.670 1.00 38.46  ? 1191 GLN B N     1 
ATOM   8263  C CA    . GLN B 2 1199 ? 177.405 119.912 99.328  1.00 38.46  ? 1191 GLN B CA    1 
ATOM   8264  C C     . GLN B 2 1199 ? 176.937 120.900 98.266  1.00 38.46  ? 1191 GLN B C     1 
ATOM   8265  O O     . GLN B 2 1199 ? 177.696 121.248 97.353  1.00 38.46  ? 1191 GLN B O     1 
ATOM   8266  C CB    . GLN B 2 1199 ? 176.669 118.581 99.188  1.00 38.46  ? 1191 GLN B CB    1 
ATOM   8267  N N     . LEU B 2 1200 ? 175.692 121.371 98.376  1.00 37.11  ? 1192 LEU B N     1 
ATOM   8268  C CA    . LEU B 2 1200 ? 175.134 122.242 97.343  1.00 37.11  ? 1192 LEU B CA    1 
ATOM   8269  C C     . LEU B 2 1200 ? 175.759 123.629 97.387  1.00 37.11  ? 1192 LEU B C     1 
ATOM   8270  O O     . LEU B 2 1200 ? 176.107 124.197 96.341  1.00 37.11  ? 1192 LEU B O     1 
ATOM   8271  C CB    . LEU B 2 1200 ? 173.619 122.334 97.499  1.00 37.11  ? 1192 LEU B CB    1 
ATOM   8272  N N     . ASP B 2 1201 ? 175.913 124.186 98.592  1.00 44.21  ? 1193 ASP B N     1 
ATOM   8273  C CA    . ASP B 2 1201 ? 176.555 125.485 98.735  1.00 44.21  ? 1193 ASP B CA    1 
ATOM   8274  C C     . ASP B 2 1201 ? 178.029 125.423 98.367  1.00 44.21  ? 1193 ASP B C     1 
ATOM   8275  O O     . ASP B 2 1201 ? 178.580 126.405 97.856  1.00 44.21  ? 1193 ASP B O     1 
ATOM   8276  C CB    . ASP B 2 1201 ? 176.389 125.997 100.163 1.00 44.21  ? 1193 ASP B CB    1 
ATOM   8277  N N     . ASP B 2 1202 ? 178.679 124.282 98.613  1.00 39.14  ? 1194 ASP B N     1 
ATOM   8278  C CA    . ASP B 2 1202 ? 180.052 124.111 98.159  1.00 39.14  ? 1194 ASP B CA    1 
ATOM   8279  C C     . ASP B 2 1202 ? 180.130 124.026 96.642  1.00 39.14  ? 1194 ASP B C     1 
ATOM   8280  O O     . ASP B 2 1202 ? 181.065 124.565 96.040  1.00 39.14  ? 1194 ASP B O     1 
ATOM   8281  C CB    . ASP B 2 1202 ? 180.665 122.863 98.792  1.00 39.14  ? 1194 ASP B CB    1 
ATOM   8282  N N     . THR B 2 1203 ? 179.156 123.378 96.008  1.00 31.81  ? 1195 THR B N     1 
ATOM   8283  C CA    . THR B 2 1203 ? 179.173 123.220 94.561  1.00 31.81  ? 1195 THR B CA    1 
ATOM   8284  C C     . THR B 2 1203 ? 178.674 124.450 93.816  1.00 31.81  ? 1195 THR B C     1 
ATOM   8285  O O     . THR B 2 1203 ? 178.834 124.518 92.594  1.00 31.81  ? 1195 THR B O     1 
ATOM   8286  C CB    . THR B 2 1203 ? 178.333 122.007 94.153  1.00 31.81  ? 1195 THR B CB    1 
ATOM   8287  N N     . THR B 2 1204 ? 178.086 125.419 94.511  1.00 28.79  ? 1196 THR B N     1 
ATOM   8288  C CA    . THR B 2 1204 ? 177.471 126.547 93.824  1.00 28.79  ? 1196 THR B CA    1 
ATOM   8289  C C     . THR B 2 1204 ? 178.468 127.578 93.304  1.00 28.79  ? 1196 THR B C     1 
ATOM   8290  O O     . THR B 2 1204 ? 178.085 128.410 92.476  1.00 28.79  ? 1196 THR B O     1 
ATOM   8291  C CB    . THR B 2 1204 ? 176.478 127.239 94.759  1.00 28.79  ? 1196 THR B CB    1 
ATOM   8292  N N     . GLN B 2 1205 ? 179.727 127.536 93.736  1.00 27.45  ? 1197 GLN B N     1 
ATOM   8293  C CA    . GLN B 2 1205 ? 180.618 128.678 93.554  1.00 27.45  ? 1197 GLN B CA    1 
ATOM   8294  C C     . GLN B 2 1205 ? 181.236 128.780 92.161  1.00 27.45  ? 1197 GLN B C     1 
ATOM   8295  O O     . GLN B 2 1205 ? 181.251 129.873 91.585  1.00 27.45  ? 1197 GLN B O     1 
ATOM   8296  C CB    . GLN B 2 1205 ? 181.740 128.633 94.595  1.00 27.45  ? 1197 GLN B CB    1 
ATOM   8297  N N     . LEU B 2 1206 ? 181.752 127.678 91.619  1.00 27.45  ? 1198 LEU B N     1 
ATOM   8298  C CA    . LEU B 2 1206 ? 182.537 127.633 90.380  1.00 27.45  ? 1198 LEU B CA    1 
ATOM   8299  C C     . LEU B 2 1206 ? 181.922 128.215 89.097  1.00 27.45  ? 1198 LEU B C     1 
ATOM   8300  O O     . LEU B 2 1206 ? 182.664 128.869 88.344  1.00 27.45  ? 1198 LEU B O     1 
ATOM   8301  C CB    . LEU B 2 1206 ? 182.965 126.185 90.115  1.00 27.45  ? 1198 LEU B CB    1 
ATOM   8302  N N     . PRO B 2 1207 ? 180.626 128.013 88.767  1.00 26.52  ? 1199 PRO B N     1 
ATOM   8303  C CA    . PRO B 2 1207 ? 180.117 128.609 87.517  1.00 26.52  ? 1199 PRO B CA    1 
ATOM   8304  C C     . PRO B 2 1207 ? 180.088 130.120 87.530  1.00 26.52  ? 1199 PRO B C     1 
ATOM   8305  O O     . PRO B 2 1207 ? 180.160 130.726 86.451  1.00 26.52  ? 1199 PRO B O     1 
ATOM   8306  C CB    . PRO B 2 1207 ? 178.702 128.031 87.395  1.00 26.52  ? 1199 PRO B CB    1 
ATOM   8307  C CG    . PRO B 2 1207 ? 178.714 126.822 88.206  1.00 26.52  ? 1199 PRO B CG    1 
ATOM   8308  C CD    . PRO B 2 1207 ? 179.580 127.152 89.360  1.00 26.52  ? 1199 PRO B CD    1 
ATOM   8309  N N     . LEU B 2 1208 ? 180.011 130.735 88.718  1.00 29.16  ? 1200 LEU B N     1 
ATOM   8310  C CA    . LEU B 2 1208 ? 180.104 132.186 88.837  1.00 29.16  ? 1200 LEU B CA    1 
ATOM   8311  C C     . LEU B 2 1208 ? 181.432 132.695 88.299  1.00 29.16  ? 1200 LEU B C     1 
ATOM   8312  O O     . LEU B 2 1208 ? 181.464 133.579 87.435  1.00 29.16  ? 1200 LEU B O     1 
ATOM   8313  C CB    . LEU B 2 1208 ? 179.917 132.606 90.294  1.00 29.16  ? 1200 LEU B CB    1 
ATOM   8314  N N     . VAL B 2 1209 ? 182.536 132.099 88.755  1.00 30.65  ? 1201 VAL B N     1 
ATOM   8315  C CA    . VAL B 2 1209 ? 183.853 132.472 88.257  1.00 30.65  ? 1201 VAL B CA    1 
ATOM   8316  C C     . VAL B 2 1209 ? 184.030 132.054 86.803  1.00 30.65  ? 1201 VAL B C     1 
ATOM   8317  O O     . VAL B 2 1209 ? 184.827 132.663 86.071  1.00 30.65  ? 1201 VAL B O     1 
ATOM   8318  C CB    . VAL B 2 1209 ? 184.952 131.864 89.147  1.00 30.65  ? 1201 VAL B CB    1 
ATOM   8319  N N     . SER B 2 1210 ? 183.297 131.024 86.361  1.00 30.79  ? 1202 SER B N     1 
ATOM   8320  C CA    . SER B 2 1210 ? 183.349 130.627 84.955  1.00 30.79  ? 1202 SER B CA    1 
ATOM   8321  C C     . SER B 2 1210 ? 182.801 131.724 84.048  1.00 30.79  ? 1202 SER B C     1 
ATOM   8322  O O     . SER B 2 1210 ? 183.467 132.146 83.092  1.00 30.79  ? 1202 SER B O     1 
ATOM   8323  C CB    . SER B 2 1210 ? 182.582 129.320 84.748  1.00 30.79  ? 1202 SER B CB    1 
ATOM   8324  N N     . HIS B 2 1211 ? 181.607 132.237 84.352  1.00 32.83  ? 1203 HIS B N     1 
ATOM   8325  C CA    . HIS B 2 1211 ? 181.136 133.350 83.540  1.00 32.83  ? 1203 HIS B CA    1 
ATOM   8326  C C     . HIS B 2 1211 ? 181.770 134.677 83.934  1.00 32.83  ? 1203 HIS B C     1 
ATOM   8327  O O     . HIS B 2 1211 ? 181.488 135.690 83.290  1.00 32.83  ? 1203 HIS B O     1 
ATOM   8328  C CB    . HIS B 2 1211 ? 179.607 133.479 83.576  1.00 32.83  ? 1203 HIS B CB    1 
ATOM   8329  C CG    . HIS B 2 1211 ? 179.046 133.830 84.917  1.00 32.83  ? 1203 HIS B CG    1 
ATOM   8330  N ND1   . HIS B 2 1211 ? 179.053 135.115 85.416  1.00 32.83  ? 1203 HIS B ND1   1 
ATOM   8331  C CD2   . HIS B 2 1211 ? 178.381 133.081 85.825  1.00 32.83  ? 1203 HIS B CD2   1 
ATOM   8332  C CE1   . HIS B 2 1211 ? 178.470 135.128 86.599  1.00 32.83  ? 1203 HIS B CE1   1 
ATOM   8333  N NE2   . HIS B 2 1211 ? 178.049 133.907 86.869  1.00 32.83  ? 1203 HIS B NE2   1 
ATOM   8334  N N     . PHE B 2 1212 ? 182.581 134.712 84.989  1.00 38.96  ? 1204 PHE B N     1 
ATOM   8335  C CA    . PHE B 2 1212 ? 183.420 135.884 85.201  1.00 38.96  ? 1204 PHE B CA    1 
ATOM   8336  C C     . PHE B 2 1212 ? 184.592 135.889 84.232  1.00 38.96  ? 1204 PHE B C     1 
ATOM   8337  O O     . PHE B 2 1212 ? 184.953 136.946 83.699  1.00 38.96  ? 1204 PHE B O     1 
ATOM   8338  C CB    . PHE B 2 1212 ? 183.916 135.932 86.644  1.00 38.96  ? 1204 PHE B CB    1 
ATOM   8339  C CG    . PHE B 2 1212 ? 182.846 136.273 87.638  1.00 38.96  ? 1204 PHE B CG    1 
ATOM   8340  C CD1   . PHE B 2 1212 ? 181.668 136.883 87.234  1.00 38.96  ? 1204 PHE B CD1   1 
ATOM   8341  C CD2   . PHE B 2 1212 ? 183.002 135.946 88.974  1.00 38.96  ? 1204 PHE B CD2   1 
ATOM   8342  C CE1   . PHE B 2 1212 ? 180.683 137.183 88.148  1.00 38.96  ? 1204 PHE B CE1   1 
ATOM   8343  C CE2   . PHE B 2 1212 ? 182.017 136.243 89.894  1.00 38.96  ? 1204 PHE B CE2   1 
ATOM   8344  C CZ    . PHE B 2 1212 ? 180.856 136.864 89.479  1.00 38.96  ? 1204 PHE B CZ    1 
ATOM   8345  N N     . ALA B 2 1213 ? 185.192 134.717 84.000  1.00 41.84  ? 1205 ALA B N     1 
ATOM   8346  C CA    . ALA B 2 1213 ? 186.209 134.600 82.961  1.00 41.84  ? 1205 ALA B CA    1 
ATOM   8347  C C     . ALA B 2 1213 ? 185.611 134.841 81.583  1.00 41.84  ? 1205 ALA B C     1 
ATOM   8348  O O     . ALA B 2 1213 ? 186.242 135.472 80.724  1.00 41.84  ? 1205 ALA B O     1 
ATOM   8349  C CB    . ALA B 2 1213 ? 186.870 133.225 83.025  1.00 41.84  ? 1205 ALA B CB    1 
ATOM   8350  N N     . GLU B 2 1214 ? 184.384 134.361 81.362  1.00 34.30  ? 1206 GLU B N     1 
ATOM   8351  C CA    . GLU B 2 1214 ? 183.693 134.671 80.118  1.00 34.30  ? 1206 GLU B CA    1 
ATOM   8352  C C     . GLU B 2 1214 ? 183.320 136.144 80.038  1.00 34.30  ? 1206 GLU B C     1 
ATOM   8353  O O     . GLU B 2 1214 ? 183.253 136.708 78.940  1.00 34.30  ? 1206 GLU B O     1 
ATOM   8354  C CB    . GLU B 2 1214 ? 182.448 133.800 79.980  1.00 34.30  ? 1206 GLU B CB    1 
ATOM   8355  N N     . THR B 2 1215 ? 183.083 136.780 81.184  1.00 30.82  ? 1207 THR B N     1 
ATOM   8356  C CA    . THR B 2 1215 ? 182.785 138.204 81.194  1.00 30.82  ? 1207 THR B CA    1 
ATOM   8357  C C     . THR B 2 1215 ? 184.018 139.029 80.869  1.00 30.82  ? 1207 THR B C     1 
ATOM   8358  O O     . THR B 2 1215 ? 183.912 140.085 80.237  1.00 30.82  ? 1207 THR B O     1 
ATOM   8359  C CB    . THR B 2 1215 ? 182.222 138.616 82.552  1.00 30.82  ? 1207 THR B CB    1 
ATOM   8360  N N     . VAL B 2 1216 ? 185.193 138.563 81.284  1.00 41.38  ? 1208 VAL B N     1 
ATOM   8361  C CA    . VAL B 2 1216 ? 186.418 139.279 80.964  1.00 41.38  ? 1208 VAL B CA    1 
ATOM   8362  C C     . VAL B 2 1216 ? 186.837 139.016 79.522  1.00 41.38  ? 1208 VAL B C     1 
ATOM   8363  O O     . VAL B 2 1216 ? 187.440 139.879 78.873  1.00 41.38  ? 1208 VAL B O     1 
ATOM   8364  C CB    . VAL B 2 1216 ? 187.529 138.898 81.957  1.00 41.38  ? 1208 VAL B CB    1 
ATOM   8365  N N     . GLU B 2 1217 ? 186.521 137.830 78.994  1.00 42.57  ? 1209 GLU B N     1 
ATOM   8366  C CA    . GLU B 2 1217 ? 186.984 137.477 77.655  1.00 42.57  ? 1209 GLU B CA    1 
ATOM   8367  C C     . GLU B 2 1217 ? 186.171 138.172 76.566  1.00 42.57  ? 1209 GLU B C     1 
ATOM   8368  O O     . GLU B 2 1217 ? 186.742 138.834 75.692  1.00 42.57  ? 1209 GLU B O     1 
ATOM   8369  C CB    . GLU B 2 1217 ? 186.930 135.962 77.468  1.00 42.57  ? 1209 GLU B CB    1 
ATOM   8370  N N     . GLY B 2 1218 ? 184.850 138.044 76.604  1.00 45.36  ? 1210 GLY B N     1 
ATOM   8371  C CA    . GLY B 2 1218 ? 184.016 138.590 75.553  1.00 45.36  ? 1210 GLY B CA    1 
ATOM   8372  C C     . GLY B 2 1218 ? 183.561 140.009 75.814  1.00 45.36  ? 1210 GLY B C     1 
ATOM   8373  O O     . GLY B 2 1218 ? 182.371 140.312 75.697  1.00 45.36  ? 1210 GLY B O     1 
ATOM   8374  N N     . LEU B 2 1219 ? 184.498 140.888 76.174  1.00 51.15  ? 1211 LEU B N     1 
ATOM   8375  C CA    . LEU B 2 1219 ? 184.144 142.280 76.433  1.00 51.15  ? 1211 LEU B CA    1 
ATOM   8376  C C     . LEU B 2 1219 ? 183.797 143.008 75.141  1.00 51.15  ? 1211 LEU B C     1 
ATOM   8377  O O     . LEU B 2 1219 ? 182.836 143.789 75.097  1.00 51.15  ? 1211 LEU B O     1 
ATOM   8378  C CB    . LEU B 2 1219 ? 185.287 142.982 77.161  1.00 51.15  ? 1211 LEU B CB    1 
ATOM   8379  N N     . THR B 2 1220 ? 184.563 142.765 74.076  1.00 75.16  ? 1212 THR B N     1 
ATOM   8380  C CA    . THR B 2 1220 ? 184.190 143.286 72.771  1.00 75.16  ? 1212 THR B CA    1 
ATOM   8381  C C     . THR B 2 1220 ? 182.976 142.569 72.203  1.00 75.16  ? 1212 THR B C     1 
ATOM   8382  O O     . THR B 2 1220 ? 182.303 143.114 71.324  1.00 75.16  ? 1212 THR B O     1 
ATOM   8383  C CB    . THR B 2 1220 ? 185.361 143.179 71.796  1.00 75.16  ? 1212 THR B CB    1 
ATOM   8384  N N     . THR B 2 1221 ? 182.693 141.351 72.672  1.00 78.42  ? 1213 THR B N     1 
ATOM   8385  C CA    . THR B 2 1221 ? 181.425 140.712 72.355  1.00 78.42  ? 1213 THR B CA    1 
ATOM   8386  C C     . THR B 2 1221 ? 180.282 141.336 73.138  1.00 78.42  ? 1213 THR B C     1 
ATOM   8387  O O     . THR B 2 1221 ? 179.142 141.346 72.662  1.00 78.42  ? 1213 THR B O     1 
ATOM   8388  C CB    . THR B 2 1221 ? 181.500 139.212 72.641  1.00 78.42  ? 1213 THR B CB    1 
ATOM   8389  N N     . ILE B 2 1222 ? 180.567 141.854 74.336  1.00 83.11  ? 1214 ILE B N     1 
ATOM   8390  C CA    . ILE B 2 1222 ? 179.568 142.634 75.056  1.00 83.11  ? 1214 ILE B CA    1 
ATOM   8391  C C     . ILE B 2 1222 ? 179.336 143.960 74.356  1.00 83.11  ? 1214 ILE B C     1 
ATOM   8392  O O     . ILE B 2 1222 ? 178.235 144.518 74.412  1.00 83.11  ? 1214 ILE B O     1 
ATOM   8393  C CB    . ILE B 2 1222 ? 179.993 142.837 76.522  1.00 83.11  ? 1214 ILE B CB    1 
ATOM   8394  N N     . ARG B 2 1223 ? 180.366 144.493 73.698  1.00 95.01  ? 1215 ARG B N     1 
ATOM   8395  C CA    . ARG B 2 1223 ? 180.146 145.595 72.774  1.00 95.01  ? 1215 ARG B CA    1 
ATOM   8396  C C     . ARG B 2 1223 ? 179.356 145.138 71.554  1.00 95.01  ? 1215 ARG B C     1 
ATOM   8397  O O     . ARG B 2 1223 ? 178.572 145.913 70.996  1.00 95.01  ? 1215 ARG B O     1 
ATOM   8398  C CB    . ARG B 2 1223 ? 181.483 146.199 72.350  1.00 95.01  ? 1215 ARG B CB    1 
ATOM   8399  N N     . ALA B 2 1224 ? 179.542 143.884 71.136  1.00 91.82  ? 1216 ALA B N     1 
ATOM   8400  C CA    . ALA B 2 1224 ? 178.806 143.358 69.994  1.00 91.82  ? 1216 ALA B CA    1 
ATOM   8401  C C     . ALA B 2 1224 ? 177.375 143.007 70.370  1.00 91.82  ? 1216 ALA B C     1 
ATOM   8402  O O     . ALA B 2 1224 ? 176.448 143.268 69.596  1.00 91.82  ? 1216 ALA B O     1 
ATOM   8403  C CB    . ALA B 2 1224 ? 179.521 142.131 69.428  1.00 91.82  ? 1216 ALA B CB    1 
ATOM   8404  N N     . PHE B 2 1225 ? 177.179 142.406 71.541  1.00 70.67  ? 1217 PHE B N     1 
ATOM   8405  C CA    . PHE B 2 1225 ? 175.836 142.148 72.041  1.00 70.67  ? 1217 PHE B CA    1 
ATOM   8406  C C     . PHE B 2 1225 ? 175.189 143.478 72.394  1.00 70.67  ? 1217 PHE B C     1 
ATOM   8407  O O     . PHE B 2 1225 ? 175.537 144.097 73.402  1.00 70.67  ? 1217 PHE B O     1 
ATOM   8408  C CB    . PHE B 2 1225 ? 175.883 141.224 73.252  1.00 70.67  ? 1217 PHE B CB    1 
ATOM   8409  N N     . ARG B 2 1226 ? 174.250 143.923 71.556  1.00 77.80  ? 1218 ARG B N     1 
ATOM   8410  C CA    . ARG B 2 1226 ? 173.601 145.213 71.754  1.00 77.80  ? 1218 ARG B CA    1 
ATOM   8411  C C     . ARG B 2 1226 ? 172.670 145.228 72.958  1.00 77.80  ? 1218 ARG B C     1 
ATOM   8412  O O     . ARG B 2 1226 ? 172.276 146.312 73.402  1.00 77.80  ? 1218 ARG B O     1 
ATOM   8413  C CB    . ARG B 2 1226 ? 172.828 145.610 70.496  1.00 77.80  ? 1218 ARG B CB    1 
ATOM   8414  N N     . TYR B 2 1227 ? 172.312 144.062 73.492  1.00 73.67  ? 1219 TYR B N     1 
ATOM   8415  C CA    . TYR B 2 1227 ? 171.559 143.940 74.737  1.00 73.67  ? 1219 TYR B CA    1 
ATOM   8416  C C     . TYR B 2 1227 ? 172.513 143.358 75.773  1.00 73.67  ? 1219 TYR B C     1 
ATOM   8417  O O     . TYR B 2 1227 ? 172.560 142.143 75.982  1.00 73.67  ? 1219 TYR B O     1 
ATOM   8418  C CB    . TYR B 2 1227 ? 170.321 143.066 74.556  1.00 73.67  ? 1219 TYR B CB    1 
ATOM   8419  N N     . GLU B 2 1228 ? 173.272 144.234 76.429  1.00 51.93  ? 1220 GLU B N     1 
ATOM   8420  C CA    . GLU B 2 1228 ? 174.206 143.821 77.468  1.00 51.93  ? 1220 GLU B CA    1 
ATOM   8421  C C     . GLU B 2 1228 ? 173.511 143.442 78.766  1.00 51.93  ? 1220 GLU B C     1 
ATOM   8422  O O     . GLU B 2 1228 ? 174.146 142.849 79.643  1.00 51.93  ? 1220 GLU B O     1 
ATOM   8423  C CB    . GLU B 2 1228 ? 175.221 144.935 77.734  1.00 51.93  ? 1220 GLU B CB    1 
ATOM   8424  N N     . ALA B 2 1229 ? 172.225 143.756 78.901  1.00 48.88  ? 1221 ALA B N     1 
ATOM   8425  C CA    . ALA B 2 1229 ? 171.477 143.440 80.106  1.00 48.88  ? 1221 ALA B CA    1 
ATOM   8426  C C     . ALA B 2 1229 ? 171.153 141.960 80.243  1.00 48.88  ? 1221 ALA B C     1 
ATOM   8427  O O     . ALA B 2 1229 ? 170.681 141.554 81.310  1.00 48.88  ? 1221 ALA B O     1 
ATOM   8428  C CB    . ALA B 2 1229 ? 170.182 144.254 80.148  1.00 48.88  ? 1221 ALA B CB    1 
ATOM   8429  N N     . ARG B 2 1230 ? 171.371 141.156 79.197  1.00 39.69  ? 1222 ARG B N     1 
ATOM   8430  C CA    . ARG B 2 1230 ? 171.106 139.723 79.279  1.00 39.69  ? 1222 ARG B CA    1 
ATOM   8431  C C     . ARG B 2 1230 ? 172.062 139.049 80.252  1.00 39.69  ? 1222 ARG B C     1 
ATOM   8432  O O     . ARG B 2 1230 ? 171.639 138.310 81.151  1.00 39.69  ? 1222 ARG B O     1 
ATOM   8433  C CB    . ARG B 2 1230 ? 171.215 139.091 77.892  1.00 39.69  ? 1222 ARG B CB    1 
ATOM   8434  N N     . PHE B 2 1231 ? 173.357 139.323 80.105  1.00 45.40  ? 1223 PHE B N     1 
ATOM   8435  C CA    . PHE B 2 1231 ? 174.326 138.866 81.089  1.00 45.40  ? 1223 PHE B CA    1 
ATOM   8436  C C     . PHE B 2 1231 ? 174.169 139.593 82.418  1.00 45.40  ? 1223 PHE B C     1 
ATOM   8437  O O     . PHE B 2 1231 ? 174.623 139.083 83.443  1.00 45.40  ? 1223 PHE B O     1 
ATOM   8438  C CB    . PHE B 2 1231 ? 175.747 139.041 80.541  1.00 45.40  ? 1223 PHE B CB    1 
ATOM   8439  C CG    . PHE B 2 1231 ? 176.823 138.494 81.443  1.00 45.40  ? 1223 PHE B CG    1 
ATOM   8440  C CD1   . PHE B 2 1231 ? 177.047 137.128 81.527  1.00 45.40  ? 1223 PHE B CD1   1 
ATOM   8441  C CD2   . PHE B 2 1231 ? 177.594 139.345 82.221  1.00 45.40  ? 1223 PHE B CD2   1 
ATOM   8442  C CE1   . PHE B 2 1231 ? 178.030 136.620 82.364  1.00 45.40  ? 1223 PHE B CE1   1 
ATOM   8443  C CE2   . PHE B 2 1231 ? 178.575 138.846 83.061  1.00 45.40  ? 1223 PHE B CE2   1 
ATOM   8444  C CZ    . PHE B 2 1231 ? 178.793 137.482 83.130  1.00 45.40  ? 1223 PHE B CZ    1 
ATOM   8445  N N     . GLN B 2 1232 ? 173.531 140.765 82.432  1.00 45.82  ? 1224 GLN B N     1 
ATOM   8446  C CA    . GLN B 2 1232 ? 173.317 141.465 83.694  1.00 45.82  ? 1224 GLN B CA    1 
ATOM   8447  C C     . GLN B 2 1232 ? 172.258 140.765 84.537  1.00 45.82  ? 1224 GLN B C     1 
ATOM   8448  O O     . GLN B 2 1232 ? 172.463 140.524 85.732  1.00 45.82  ? 1224 GLN B O     1 
ATOM   8449  C CB    . GLN B 2 1232 ? 172.928 142.919 83.437  1.00 45.82  ? 1224 GLN B CB    1 
ATOM   8450  N N     . GLN B 2 1233 ? 171.119 140.422 83.932  1.00 43.05  ? 1225 GLN B N     1 
ATOM   8451  C CA    . GLN B 2 1233 ? 170.078 139.745 84.693  1.00 43.05  ? 1225 GLN B CA    1 
ATOM   8452  C C     . GLN B 2 1233 ? 170.393 138.269 84.906  1.00 43.05  ? 1225 GLN B C     1 
ATOM   8453  O O     . GLN B 2 1233 ? 170.005 137.703 85.937  1.00 43.05  ? 1225 GLN B O     1 
ATOM   8454  C CB    . GLN B 2 1233 ? 168.717 139.915 84.011  1.00 43.05  ? 1225 GLN B CB    1 
ATOM   8455  C CG    . GLN B 2 1233 ? 168.615 139.326 82.621  1.00 43.05  ? 1225 GLN B CG    1 
ATOM   8456  C CD    . GLN B 2 1233 ? 167.229 139.455 82.040  1.00 43.05  ? 1225 GLN B CD    1 
ATOM   8457  O OE1   . GLN B 2 1233 ? 166.312 139.937 82.703  1.00 43.05  ? 1225 GLN B OE1   1 
ATOM   8458  N NE2   . GLN B 2 1233 ? 167.063 139.016 80.800  1.00 43.05  ? 1225 GLN B NE2   1 
ATOM   8459  N N     . LYS B 2 1234 ? 171.095 137.633 83.959  1.00 30.53  ? 1226 LYS B N     1 
ATOM   8460  C CA    . LYS B 2 1234 ? 171.536 136.261 84.177  1.00 30.53  ? 1226 LYS B CA    1 
ATOM   8461  C C     . LYS B 2 1234 ? 172.585 136.210 85.273  1.00 30.53  ? 1226 LYS B C     1 
ATOM   8462  O O     . LYS B 2 1234 ? 172.516 135.361 86.168  1.00 30.53  ? 1226 LYS B O     1 
ATOM   8463  C CB    . LYS B 2 1234 ? 172.085 135.673 82.879  1.00 30.53  ? 1226 LYS B CB    1 
ATOM   8464  N N     . LEU B 2 1235 ? 173.552 137.128 85.198  1.00 38.53  ? 1227 LEU B N     1 
ATOM   8465  C CA    . LEU B 2 1235 ? 174.515 137.407 86.260  1.00 38.53  ? 1227 LEU B CA    1 
ATOM   8466  C C     . LEU B 2 1235 ? 173.844 137.590 87.613  1.00 38.53  ? 1227 LEU B C     1 
ATOM   8467  O O     . LEU B 2 1235 ? 174.281 137.017 88.622  1.00 38.53  ? 1227 LEU B O     1 
ATOM   8468  C CB    . LEU B 2 1235 ? 175.280 138.673 85.881  1.00 38.53  ? 1227 LEU B CB    1 
ATOM   8469  C CG    . LEU B 2 1235 ? 176.338 139.352 86.741  1.00 38.53  ? 1227 LEU B CG    1 
ATOM   8470  C CD1   . LEU B 2 1235 ? 177.575 138.509 86.867  1.00 38.53  ? 1227 LEU B CD1   1 
ATOM   8471  C CD2   . LEU B 2 1235 ? 176.663 140.695 86.121  1.00 38.53  ? 1227 LEU B CD2   1 
ATOM   8472  N N     . LEU B 2 1236 ? 172.770 138.380 87.644  1.00 35.36  ? 1228 LEU B N     1 
ATOM   8473  C CA    . LEU B 2 1236 ? 172.024 138.597 88.875  1.00 35.36  ? 1228 LEU B CA    1 
ATOM   8474  C C     . LEU B 2 1236 ? 171.327 137.324 89.333  1.00 35.36  ? 1228 LEU B C     1 
ATOM   8475  O O     . LEU B 2 1236 ? 171.120 137.132 90.535  1.00 35.36  ? 1228 LEU B O     1 
ATOM   8476  C CB    . LEU B 2 1236 ? 171.021 139.730 88.666  1.00 35.36  ? 1228 LEU B CB    1 
ATOM   8477  C CG    . LEU B 2 1236 ? 170.176 140.224 89.838  1.00 35.36  ? 1228 LEU B CG    1 
ATOM   8478  C CD1   . LEU B 2 1236 ? 171.052 140.777 90.945  1.00 35.36  ? 1228 LEU B CD1   1 
ATOM   8479  C CD2   . LEU B 2 1236 ? 169.210 141.282 89.348  1.00 35.36  ? 1228 LEU B CD2   1 
ATOM   8480  N N     . GLU B 2 1237 ? 170.982 136.434 88.400  1.00 33.30  ? 1229 GLU B N     1 
ATOM   8481  C CA    . GLU B 2 1237 ? 170.439 135.144 88.808  1.00 33.30  ? 1229 GLU B CA    1 
ATOM   8482  C C     . GLU B 2 1237 ? 171.520 134.250 89.402  1.00 33.30  ? 1229 GLU B C     1 
ATOM   8483  O O     . GLU B 2 1237 ? 171.253 133.494 90.346  1.00 33.30  ? 1229 GLU B O     1 
ATOM   8484  C CB    . GLU B 2 1237 ? 169.755 134.457 87.627  1.00 33.30  ? 1229 GLU B CB    1 
ATOM   8485  N N     . TYR B 2 1238 ? 172.748 134.320 88.869  1.00 27.71  ? 1230 TYR B N     1 
ATOM   8486  C CA    . TYR B 2 1238 ? 173.841 133.520 89.416  1.00 27.71  ? 1230 TYR B CA    1 
ATOM   8487  C C     . TYR B 2 1238 ? 174.206 133.972 90.824  1.00 27.71  ? 1230 TYR B C     1 
ATOM   8488  O O     . TYR B 2 1238 ? 174.231 133.162 91.765  1.00 27.71  ? 1230 TYR B O     1 
ATOM   8489  C CB    . TYR B 2 1238 ? 175.078 133.587 88.517  1.00 27.71  ? 1230 TYR B CB    1 
ATOM   8490  C CG    . TYR B 2 1238 ? 174.987 132.831 87.213  1.00 27.71  ? 1230 TYR B CG    1 
ATOM   8491  C CD1   . TYR B 2 1238 ? 175.020 131.445 87.192  1.00 27.71  ? 1230 TYR B CD1   1 
ATOM   8492  C CD2   . TYR B 2 1238 ? 174.960 133.502 86.001  1.00 27.71  ? 1230 TYR B CD2   1 
ATOM   8493  C CE1   . TYR B 2 1238 ? 174.960 130.751 86.002  1.00 27.71  ? 1230 TYR B CE1   1 
ATOM   8494  C CE2   . TYR B 2 1238 ? 174.903 132.822 84.808  1.00 27.71  ? 1230 TYR B CE2   1 
ATOM   8495  C CZ    . TYR B 2 1238 ? 174.905 131.447 84.814  1.00 27.71  ? 1230 TYR B CZ    1 
ATOM   8496  O OH    . TYR B 2 1238 ? 174.851 130.765 83.624  1.00 27.71  ? 1230 TYR B OH    1 
ATOM   8497  N N     . THR B 2 1239 ? 174.480 135.271 90.991  1.00 26.16  ? 1231 THR B N     1 
ATOM   8498  C CA    . THR B 2 1239 ? 174.826 135.792 92.310  1.00 26.16  ? 1231 THR B CA    1 
ATOM   8499  C C     . THR B 2 1239 ? 173.640 135.732 93.261  1.00 26.16  ? 1231 THR B C     1 
ATOM   8500  O O     . THR B 2 1239 ? 173.827 135.648 94.483  1.00 26.16  ? 1231 THR B O     1 
ATOM   8501  C CB    . THR B 2 1239 ? 175.337 137.226 92.192  1.00 26.16  ? 1231 THR B CB    1 
ATOM   8502  N N     . ASP B 2 1240 ? 172.425 135.763 92.715  1.00 22.14  ? 1232 ASP B N     1 
ATOM   8503  C CA    . ASP B 2 1240 ? 171.236 135.514 93.515  1.00 22.14  ? 1232 ASP B CA    1 
ATOM   8504  C C     . ASP B 2 1240 ? 171.230 134.092 94.056  1.00 22.14  ? 1232 ASP B C     1 
ATOM   8505  O O     . ASP B 2 1240 ? 170.918 133.877 95.230  1.00 22.14  ? 1232 ASP B O     1 
ATOM   8506  C CB    . ASP B 2 1240 ? 169.984 135.776 92.681  1.00 22.14  ? 1232 ASP B CB    1 
ATOM   8507  N N     . SER B 2 1241 ? 171.595 133.117 93.220  1.00 23.68  ? 1233 SER B N     1 
ATOM   8508  C CA    . SER B 2 1241 ? 171.612 131.727 93.661  1.00 23.68  ? 1233 SER B CA    1 
ATOM   8509  C C     . SER B 2 1241 ? 172.697 131.482 94.703  1.00 23.68  ? 1233 SER B C     1 
ATOM   8510  O O     . SER B 2 1241 ? 172.481 130.732 95.668  1.00 23.68  ? 1233 SER B O     1 
ATOM   8511  C CB    . SER B 2 1241 ? 171.809 130.803 92.462  1.00 23.68  ? 1233 SER B CB    1 
ATOM   8512  O OG    . SER B 2 1241 ? 171.891 129.453 92.877  1.00 23.68  ? 1233 SER B OG    1 
ATOM   8513  N N     . ASN B 2 1242 ? 173.861 132.116 94.538  1.00 21.83  ? 1234 ASN B N     1 
ATOM   8514  C CA    . ASN B 2 1242 ? 174.893 132.007 95.563  1.00 21.83  ? 1234 ASN B CA    1 
ATOM   8515  C C     . ASN B 2 1242 ? 174.482 132.703 96.853  1.00 21.83  ? 1234 ASN B C     1 
ATOM   8516  O O     . ASN B 2 1242 ? 174.863 132.257 97.942  1.00 21.83  ? 1234 ASN B O     1 
ATOM   8517  C CB    . ASN B 2 1242 ? 176.211 132.579 95.053  1.00 21.83  ? 1234 ASN B CB    1 
ATOM   8518  C CG    . ASN B 2 1242 ? 176.849 131.712 93.994  1.00 21.83  ? 1234 ASN B CG    1 
ATOM   8519  O OD1   . ASN B 2 1242 ? 176.825 130.488 94.085  1.00 21.83  ? 1234 ASN B OD1   1 
ATOM   8520  N ND2   . ASN B 2 1242 ? 177.437 132.341 92.985  1.00 21.83  ? 1234 ASN B ND2   1 
ATOM   8521  N N     . ASN B 2 1243 ? 173.706 133.784 96.750  1.00 24.08  ? 1235 ASN B N     1 
ATOM   8522  C CA    . ASN B 2 1243 ? 173.206 134.452 97.949  1.00 24.08  ? 1235 ASN B CA    1 
ATOM   8523  C C     . ASN B 2 1243 ? 172.195 133.583 98.686  1.00 24.08  ? 1235 ASN B C     1 
ATOM   8524  O O     . ASN B 2 1243 ? 172.178 133.553 99.926  1.00 24.08  ? 1235 ASN B O     1 
ATOM   8525  C CB    . ASN B 2 1243 ? 172.584 135.794 97.576  1.00 24.08  ? 1235 ASN B CB    1 
ATOM   8526  N N     . ILE B 2 1244 ? 171.343 132.879 97.938  1.00 24.20  ? 1236 ILE B N     1 
ATOM   8527  C CA    . ILE B 2 1244 ? 170.393 131.959 98.556  1.00 24.20  ? 1236 ILE B CA    1 
ATOM   8528  C C     . ILE B 2 1244 ? 171.133 130.814 99.231  1.00 24.20  ? 1236 ILE B C     1 
ATOM   8529  O O     . ILE B 2 1244 ? 170.800 130.425 100.358 1.00 24.20  ? 1236 ILE B O     1 
ATOM   8530  C CB    . ILE B 2 1244 ? 169.375 131.464 97.512  1.00 24.20  ? 1236 ILE B CB    1 
ATOM   8531  C CG1   . ILE B 2 1244 ? 168.537 132.631 96.994  1.00 24.20  ? 1236 ILE B CG1   1 
ATOM   8532  C CG2   . ILE B 2 1244 ? 168.446 130.438 98.097  1.00 24.20  ? 1236 ILE B CG2   1 
ATOM   8533  C CD1   . ILE B 2 1244 ? 167.765 133.356 98.072  1.00 24.20  ? 1236 ILE B CD1   1 
ATOM   8534  N N     . ALA B 2 1245 ? 172.193 130.308 98.585  1.00 22.86  ? 1237 ALA B N     1 
ATOM   8535  C CA    . ALA B 2 1245 ? 173.033 129.282 99.202  1.00 22.86  ? 1237 ALA B CA    1 
ATOM   8536  C C     . ALA B 2 1245 ? 173.715 129.788 100.468 1.00 22.86  ? 1237 ALA B C     1 
ATOM   8537  O O     . ALA B 2 1245 ? 173.895 129.025 101.428 1.00 22.86  ? 1237 ALA B O     1 
ATOM   8538  C CB    . ALA B 2 1245 ? 174.077 128.795 98.199  1.00 22.86  ? 1237 ALA B CB    1 
ATOM   8539  N N     . SER B 2 1246 ? 174.085 131.072 100.490 1.00 29.20  ? 1238 SER B N     1 
ATOM   8540  C CA    . SER B 2 1246 ? 174.619 131.670 101.707 1.00 29.20  ? 1238 SER B CA    1 
ATOM   8541  C C     . SER B 2 1246 ? 173.562 131.723 102.802 1.00 29.20  ? 1238 SER B C     1 
ATOM   8542  O O     . SER B 2 1246 ? 173.874 131.544 103.987 1.00 29.20  ? 1238 SER B O     1 
ATOM   8543  C CB    . SER B 2 1246 ? 175.154 133.070 101.408 1.00 29.20  ? 1238 SER B CB    1 
ATOM   8544  N N     . LEU B 2 1247 ? 172.303 131.957 102.422 1.00 20.09  ? 1239 LEU B N     1 
ATOM   8545  C CA    . LEU B 2 1247 ? 171.229 131.887 103.405 1.00 20.09  ? 1239 LEU B CA    1 
ATOM   8546  C C     . LEU B 2 1247 ? 171.034 130.469 103.922 1.00 20.09  ? 1239 LEU B C     1 
ATOM   8547  O O     . LEU B 2 1247 ? 170.650 130.287 105.082 1.00 20.09  ? 1239 LEU B O     1 
ATOM   8548  C CB    . LEU B 2 1247 ? 169.928 132.419 102.811 1.00 20.09  ? 1239 LEU B CB    1 
ATOM   8549  N N     . PHE B 2 1248 ? 171.300 129.457 103.089 1.00 33.05  ? 1240 PHE B N     1 
ATOM   8550  C CA    . PHE B 2 1248 ? 171.300 128.086 103.591 1.00 33.05  ? 1240 PHE B CA    1 
ATOM   8551  C C     . PHE B 2 1248 ? 172.436 127.855 104.575 1.00 33.05  ? 1240 PHE B C     1 
ATOM   8552  O O     . PHE B 2 1248 ? 172.271 127.110 105.551 1.00 33.05  ? 1240 PHE B O     1 
ATOM   8553  C CB    . PHE B 2 1248 ? 171.406 127.081 102.450 1.00 33.05  ? 1240 PHE B CB    1 
ATOM   8554  C CG    . PHE B 2 1248 ? 170.244 127.093 101.511 1.00 33.05  ? 1240 PHE B CG    1 
ATOM   8555  C CD1   . PHE B 2 1248 ? 169.035 127.654 101.892 1.00 33.05  ? 1240 PHE B CD1   1 
ATOM   8556  C CD2   . PHE B 2 1248 ? 170.333 126.485 100.272 1.00 33.05  ? 1240 PHE B CD2   1 
ATOM   8557  C CE1   . PHE B 2 1248 ? 167.954 127.646 101.034 1.00 33.05  ? 1240 PHE B CE1   1 
ATOM   8558  C CE2   . PHE B 2 1248 ? 169.259 126.478 99.409  1.00 33.05  ? 1240 PHE B CE2   1 
ATOM   8559  C CZ    . PHE B 2 1248 ? 168.068 127.059 99.792  1.00 33.05  ? 1240 PHE B CZ    1 
ATOM   8560  N N     . LEU B 2 1249 ? 173.600 128.463 104.318 1.00 30.27  ? 1241 LEU B N     1 
ATOM   8561  C CA    . LEU B 2 1249 ? 174.720 128.354 105.250 1.00 30.27  ? 1241 LEU B CA    1 
ATOM   8562  C C     . LEU B 2 1249 ? 174.376 128.972 106.598 1.00 30.27  ? 1241 LEU B C     1 
ATOM   8563  O O     . LEU B 2 1249 ? 174.645 128.382 107.656 1.00 30.27  ? 1241 LEU B O     1 
ATOM   8564  C CB    . LEU B 2 1249 ? 175.957 129.023 104.657 1.00 30.27  ? 1241 LEU B CB    1 
ATOM   8565  C CG    . LEU B 2 1249 ? 177.203 129.022 105.542 1.00 30.27  ? 1241 LEU B CG    1 
ATOM   8566  C CD1   . LEU B 2 1249 ? 177.649 127.601 105.834 1.00 30.27  ? 1241 LEU B CD1   1 
ATOM   8567  C CD2   . LEU B 2 1249 ? 178.326 129.819 104.896 1.00 30.27  ? 1241 LEU B CD2   1 
ATOM   8568  N N     . THR B 2 1250 ? 173.739 130.144 106.573 1.00 34.79  ? 1242 THR B N     1 
ATOM   8569  C CA    . THR B 2 1250 ? 173.307 130.778 107.813 1.00 34.79  ? 1242 THR B CA    1 
ATOM   8570  C C     . THR B 2 1250 ? 172.180 130.001 108.481 1.00 34.79  ? 1242 THR B C     1 
ATOM   8571  O O     . THR B 2 1250 ? 172.020 130.083 109.702 1.00 34.79  ? 1242 THR B O     1 
ATOM   8572  C CB    . THR B 2 1250 ? 172.865 132.212 107.540 1.00 34.79  ? 1242 THR B CB    1 
ATOM   8573  N N     . ALA B 2 1251 ? 171.389 129.261 107.702 1.00 26.93  ? 1243 ALA B N     1 
ATOM   8574  C CA    . ALA B 2 1251 ? 170.401 128.374 108.302 1.00 26.93  ? 1243 ALA B CA    1 
ATOM   8575  C C     . ALA B 2 1251 ? 171.077 127.229 109.035 1.00 26.93  ? 1243 ALA B C     1 
ATOM   8576  O O     . ALA B 2 1251 ? 170.641 126.833 110.125 1.00 26.93  ? 1243 ALA B O     1 
ATOM   8577  C CB    . ALA B 2 1251 ? 169.455 127.838 107.230 1.00 26.93  ? 1243 ALA B CB    1 
ATOM   8578  N N     . ALA B 2 1252 ? 172.152 126.697 108.449 1.00 35.17  ? 1244 ALA B N     1 
ATOM   8579  C CA    . ALA B 2 1252 ? 172.883 125.594 109.057 1.00 35.17  ? 1244 ALA B CA    1 
ATOM   8580  C C     . ALA B 2 1252 ? 173.530 126.019 110.367 1.00 35.17  ? 1244 ALA B C     1 
ATOM   8581  O O     . ALA B 2 1252 ? 173.375 125.347 111.395 1.00 35.17  ? 1244 ALA B O     1 
ATOM   8582  C CB    . ALA B 2 1252 ? 173.936 125.069 108.084 1.00 35.17  ? 1244 ALA B CB    1 
ATOM   8583  N N     . ASN B 2 1253 ? 174.237 127.155 110.353 1.00 26.78  ? 1245 ASN B N     1 
ATOM   8584  C CA    . ASN B 2 1253 ? 174.821 127.660 111.591 1.00 26.78  ? 1245 ASN B CA    1 
ATOM   8585  C C     . ASN B 2 1253 ? 173.749 128.124 112.567 1.00 26.78  ? 1245 ASN B C     1 
ATOM   8586  O O     . ASN B 2 1253 ? 173.962 128.091 113.787 1.00 26.78  ? 1245 ASN B O     1 
ATOM   8587  C CB    . ASN B 2 1253 ? 175.794 128.798 111.289 1.00 26.78  ? 1245 ASN B CB    1 
ATOM   8588  N N     . ARG B 2 1254 ? 172.587 128.525 112.047 1.00 30.58  ? 1246 ARG B N     1 
ATOM   8589  C CA    . ARG B 2 1254 ? 171.495 129.000 112.887 1.00 30.58  ? 1246 ARG B CA    1 
ATOM   8590  C C     . ARG B 2 1254 ? 170.912 127.869 113.722 1.00 30.58  ? 1246 ARG B C     1 
ATOM   8591  O O     . ARG B 2 1254 ? 170.901 127.937 114.957 1.00 30.58  ? 1246 ARG B O     1 
ATOM   8592  C CB    . ARG B 2 1254 ? 170.415 129.644 112.018 1.00 30.58  ? 1246 ARG B CB    1 
ATOM   8593  N N     . TRP B 2 1255 ? 170.428 126.810 113.065 1.00 25.29  ? 1247 TRP B N     1 
ATOM   8594  C CA    . TRP B 2 1255 ? 169.836 125.711 113.820 1.00 25.29  ? 1247 TRP B CA    1 
ATOM   8595  C C     . TRP B 2 1255 ? 170.896 124.891 114.541 1.00 25.29  ? 1247 TRP B C     1 
ATOM   8596  O O     . TRP B 2 1255 ? 170.602 124.280 115.578 1.00 25.29  ? 1247 TRP B O     1 
ATOM   8597  C CB    . TRP B 2 1255 ? 168.996 124.824 112.906 1.00 25.29  ? 1247 TRP B CB    1 
ATOM   8598  C CG    . TRP B 2 1255 ? 168.382 123.656 113.617 1.00 25.29  ? 1247 TRP B CG    1 
ATOM   8599  C CD1   . TRP B 2 1255 ? 168.707 122.346 113.464 1.00 25.29  ? 1247 TRP B CD1   1 
ATOM   8600  C CD2   . TRP B 2 1255 ? 167.376 123.703 114.633 1.00 25.29  ? 1247 TRP B CD2   1 
ATOM   8601  N NE1   . TRP B 2 1255 ? 167.946 121.568 114.295 1.00 25.29  ? 1247 TRP B NE1   1 
ATOM   8602  C CE2   . TRP B 2 1255 ? 167.118 122.378 115.025 1.00 25.29  ? 1247 TRP B CE2   1 
ATOM   8603  C CE3   . TRP B 2 1255 ? 166.651 124.732 115.234 1.00 25.29  ? 1247 TRP B CE3   1 
ATOM   8604  C CZ2   . TRP B 2 1255 ? 166.178 122.057 115.997 1.00 25.29  ? 1247 TRP B CZ2   1 
ATOM   8605  C CZ3   . TRP B 2 1255 ? 165.717 124.411 116.197 1.00 25.29  ? 1247 TRP B CZ3   1 
ATOM   8606  C CH2   . TRP B 2 1255 ? 165.488 123.086 116.569 1.00 25.29  ? 1247 TRP B CH2   1 
ATOM   8607  N N     . LEU B 2 1256 ? 172.124 124.887 114.022 1.00 30.53  ? 1248 LEU B N     1 
ATOM   8608  C CA    . LEU B 2 1256 ? 173.227 124.237 114.718 1.00 30.53  ? 1248 LEU B CA    1 
ATOM   8609  C C     . LEU B 2 1256 ? 173.490 124.901 116.064 1.00 30.53  ? 1248 LEU B C     1 
ATOM   8610  O O     . LEU B 2 1256 ? 173.436 124.250 117.116 1.00 30.53  ? 1248 LEU B O     1 
ATOM   8611  C CB    . LEU B 2 1256 ? 174.481 124.274 113.844 1.00 30.53  ? 1248 LEU B CB    1 
ATOM   8612  N N     . GLU B 2 1257 ? 173.738 126.215 116.046 1.00 21.52  ? 1249 GLU B N     1 
ATOM   8613  C CA    . GLU B 2 1257 ? 174.085 126.926 117.273 1.00 21.52  ? 1249 GLU B CA    1 
ATOM   8614  C C     . GLU B 2 1257 ? 172.897 127.026 118.221 1.00 21.52  ? 1249 GLU B C     1 
ATOM   8615  O O     . GLU B 2 1257 ? 173.047 126.840 119.435 1.00 21.52  ? 1249 GLU B O     1 
ATOM   8616  C CB    . GLU B 2 1257 ? 174.616 128.317 116.934 1.00 21.52  ? 1249 GLU B CB    1 
ATOM   8617  N N     . VAL B 2 1258 ? 171.707 127.298 117.683 1.00 28.52  ? 1250 VAL B N     1 
ATOM   8618  C CA    . VAL B 2 1258 ? 170.540 127.504 118.533 1.00 28.52  ? 1250 VAL B CA    1 
ATOM   8619  C C     . VAL B 2 1258 ? 170.059 126.185 119.120 1.00 28.52  ? 1250 VAL B C     1 
ATOM   8620  O O     . VAL B 2 1258 ? 169.671 126.115 120.292 1.00 28.52  ? 1250 VAL B O     1 
ATOM   8621  C CB    . VAL B 2 1258 ? 169.425 128.207 117.739 1.00 28.52  ? 1250 VAL B CB    1 
ATOM   8622  N N     . CYS B 2 1259 ? 170.074 125.122 118.315 1.00 25.30  ? 1251 CYS B N     1 
ATOM   8623  C CA    . CYS B 2 1259 ? 169.635 123.822 118.805 1.00 25.30  ? 1251 CYS B CA    1 
ATOM   8624  C C     . CYS B 2 1259 ? 170.632 123.243 119.797 1.00 25.30  ? 1251 CYS B C     1 
ATOM   8625  O O     . CYS B 2 1259 ? 170.239 122.735 120.859 1.00 25.30  ? 1251 CYS B O     1 
ATOM   8626  C CB    . CYS B 2 1259 ? 169.428 122.869 117.631 1.00 25.30  ? 1251 CYS B CB    1 
ATOM   8627  N N     . MET B 2 1260 ? 171.928 123.333 119.476 1.00 26.43  ? 1252 MET B N     1 
ATOM   8628  C CA    . MET B 2 1260 ? 172.951 122.771 120.350 1.00 26.43  ? 1252 MET B CA    1 
ATOM   8629  C C     . MET B 2 1260 ? 173.047 123.540 121.660 1.00 26.43  ? 1252 MET B C     1 
ATOM   8630  O O     . MET B 2 1260 ? 173.131 122.935 122.736 1.00 26.43  ? 1252 MET B O     1 
ATOM   8631  C CB    . MET B 2 1260 ? 174.300 122.766 119.634 1.00 26.43  ? 1252 MET B CB    1 
ATOM   8632  N N     . GLU B 2 1261 ? 173.010 124.871 121.593 1.00 24.34  ? 1253 GLU B N     1 
ATOM   8633  C CA    . GLU B 2 1261 ? 173.059 125.658 122.818 1.00 24.34  ? 1253 GLU B CA    1 
ATOM   8634  C C     . GLU B 2 1261 ? 171.754 125.574 123.593 1.00 24.34  ? 1253 GLU B C     1 
ATOM   8635  O O     . GLU B 2 1261 ? 171.747 125.770 124.814 1.00 24.34  ? 1253 GLU B O     1 
ATOM   8636  C CB    . GLU B 2 1261 ? 173.390 127.113 122.494 1.00 24.34  ? 1253 GLU B CB    1 
ATOM   8637  N N     . TYR B 2 1262 ? 170.644 125.285 122.911 1.00 27.86  ? 1254 TYR B N     1 
ATOM   8638  C CA    . TYR B 2 1262 ? 169.367 125.153 123.602 1.00 27.86  ? 1254 TYR B CA    1 
ATOM   8639  C C     . TYR B 2 1262 ? 169.317 123.861 124.407 1.00 27.86  ? 1254 TYR B C     1 
ATOM   8640  O O     . TYR B 2 1262 ? 168.970 123.870 125.598 1.00 27.86  ? 1254 TYR B O     1 
ATOM   8641  C CB    . TYR B 2 1262 ? 168.221 125.207 122.592 1.00 27.86  ? 1254 TYR B CB    1 
ATOM   8642  N N     . ILE B 2 1263 ? 169.666 122.739 123.771 1.00 36.51  ? 1255 ILE B N     1 
ATOM   8643  C CA    . ILE B 2 1263 ? 169.677 121.463 124.483 1.00 36.51  ? 1255 ILE B CA    1 
ATOM   8644  C C     . ILE B 2 1263 ? 170.778 121.442 125.533 1.00 36.51  ? 1255 ILE B C     1 
ATOM   8645  O O     . ILE B 2 1263 ? 170.614 120.842 126.605 1.00 36.51  ? 1255 ILE B O     1 
ATOM   8646  C CB    . ILE B 2 1263 ? 169.824 120.300 123.487 1.00 36.51  ? 1255 ILE B CB    1 
ATOM   8647  N N     . GLY B 2 1264 ? 171.904 122.106 125.260 1.00 37.52  ? 1256 GLY B N     1 
ATOM   8648  C CA    . GLY B 2 1264 ? 172.937 122.236 126.270 1.00 37.52  ? 1256 GLY B CA    1 
ATOM   8649  C C     . GLY B 2 1264 ? 172.519 123.121 127.424 1.00 37.52  ? 1256 GLY B C     1 
ATOM   8650  O O     . GLY B 2 1264 ? 172.975 122.928 128.554 1.00 37.52  ? 1256 GLY B O     1 
ATOM   8651  N N     . ALA B 2 1265 ? 171.646 124.092 127.160 1.00 41.03  ? 1257 ALA B N     1 
ATOM   8652  C CA    . ALA B 2 1265 ? 171.083 124.891 128.241 1.00 41.03  ? 1257 ALA B CA    1 
ATOM   8653  C C     . ALA B 2 1265 ? 170.122 124.072 129.089 1.00 41.03  ? 1257 ALA B C     1 
ATOM   8654  O O     . ALA B 2 1265 ? 170.050 124.268 130.311 1.00 41.03  ? 1257 ALA B O     1 
ATOM   8655  C CB    . ALA B 2 1265 ? 170.379 126.120 127.673 1.00 41.03  ? 1257 ALA B CB    1 
ATOM   8656  N N     . CYS B 2 1266 ? 169.378 123.156 128.459 1.00 48.07  ? 1258 CYS B N     1 
ATOM   8657  C CA    . CYS B 2 1266 ? 168.589 122.197 129.225 1.00 48.07  ? 1258 CYS B CA    1 
ATOM   8658  C C     . CYS B 2 1266 ? 169.482 121.290 130.061 1.00 48.07  ? 1258 CYS B C     1 
ATOM   8659  O O     . CYS B 2 1266 ? 169.116 120.916 131.185 1.00 48.07  ? 1258 CYS B O     1 
ATOM   8660  C CB    . CYS B 2 1266 ? 167.716 121.366 128.286 1.00 48.07  ? 1258 CYS B CB    1 
ATOM   8661  N N     . VAL B 2 1267 ? 170.664 120.948 129.540 1.00 50.43  ? 1259 VAL B N     1 
ATOM   8662  C CA    . VAL B 2 1267 ? 171.639 120.205 130.329 1.00 50.43  ? 1259 VAL B CA    1 
ATOM   8663  C C     . VAL B 2 1267 ? 172.168 121.053 131.477 1.00 50.43  ? 1259 VAL B C     1 
ATOM   8664  O O     . VAL B 2 1267 ? 172.536 120.521 132.531 1.00 50.43  ? 1259 VAL B O     1 
ATOM   8665  C CB    . VAL B 2 1267 ? 172.783 119.704 129.429 1.00 50.43  ? 1259 VAL B CB    1 
ATOM   8666  N N     . VAL B 2 1268 ? 172.220 122.375 131.300 1.00 46.95  ? 1260 VAL B N     1 
ATOM   8667  C CA    . VAL B 2 1268 ? 172.651 123.248 132.385 1.00 46.95  ? 1260 VAL B CA    1 
ATOM   8668  C C     . VAL B 2 1268 ? 171.584 123.317 133.467 1.00 46.95  ? 1260 VAL B C     1 
ATOM   8669  O O     . VAL B 2 1268 ? 171.896 123.406 134.662 1.00 46.95  ? 1260 VAL B O     1 
ATOM   8670  C CB    . VAL B 2 1268 ? 172.997 124.646 131.843 1.00 46.95  ? 1260 VAL B CB    1 
ATOM   8671  N N     . LEU B 2 1269 ? 170.310 123.277 133.070 1.00 48.86  ? 1261 LEU B N     1 
ATOM   8672  C CA    . LEU B 2 1269 ? 169.236 123.265 134.058 1.00 48.86  ? 1261 LEU B CA    1 
ATOM   8673  C C     . LEU B 2 1269 ? 169.193 121.940 134.807 1.00 48.86  ? 1261 LEU B C     1 
ATOM   8674  O O     . LEU B 2 1269 ? 168.920 121.908 136.016 1.00 48.86  ? 1261 LEU B O     1 
ATOM   8675  C CB    . LEU B 2 1269 ? 167.897 123.544 133.380 1.00 48.86  ? 1261 LEU B CB    1 
ATOM   8676  N N     . ILE B 2 1270 ? 169.467 120.836 134.105 1.00 50.16  ? 1262 ILE B N     1 
ATOM   8677  C CA    . ILE B 2 1270 ? 169.568 119.541 134.768 1.00 50.16  ? 1262 ILE B CA    1 
ATOM   8678  C C     . ILE B 2 1270 ? 170.774 119.512 135.695 1.00 50.16  ? 1262 ILE B C     1 
ATOM   8679  O O     . ILE B 2 1270 ? 170.745 118.863 136.751 1.00 50.16  ? 1262 ILE B O     1 
ATOM   8680  C CB    . ILE B 2 1270 ? 169.634 118.412 133.725 1.00 50.16  ? 1262 ILE B CB    1 
ATOM   8681  N N     . ALA B 2 1271 ? 171.844 120.216 135.323 1.00 51.67  ? 1263 ALA B N     1 
ATOM   8682  C CA    . ALA B 2 1271 ? 172.983 120.377 136.215 1.00 51.67  ? 1263 ALA B CA    1 
ATOM   8683  C C     . ALA B 2 1271 ? 172.610 121.182 137.448 1.00 51.67  ? 1263 ALA B C     1 
ATOM   8684  O O     . ALA B 2 1271 ? 173.111 120.903 138.544 1.00 51.67  ? 1263 ALA B O     1 
ATOM   8685  C CB    . ALA B 2 1271 ? 174.137 121.047 135.472 1.00 51.67  ? 1263 ALA B CB    1 
ATOM   8686  N N     . ALA B 2 1272 ? 171.729 122.171 137.291 1.00 46.26  ? 1264 ALA B N     1 
ATOM   8687  C CA    . ALA B 2 1272 ? 171.245 122.913 138.447 1.00 46.26  ? 1264 ALA B CA    1 
ATOM   8688  C C     . ALA B 2 1272 ? 170.386 122.040 139.347 1.00 46.26  ? 1264 ALA B C     1 
ATOM   8689  O O     . ALA B 2 1272 ? 170.409 122.204 140.574 1.00 46.26  ? 1264 ALA B O     1 
ATOM   8690  C CB    . ALA B 2 1272 ? 170.464 124.141 137.988 1.00 46.26  ? 1264 ALA B CB    1 
ATOM   8691  N N     . ALA B 2 1273 ? 169.636 121.103 138.761 1.00 51.12  ? 1265 ALA B N     1 
ATOM   8692  C CA    . ALA B 2 1273 ? 168.897 120.142 139.573 1.00 51.12  ? 1265 ALA B CA    1 
ATOM   8693  C C     . ALA B 2 1273 ? 169.847 119.213 140.322 1.00 51.12  ? 1265 ALA B C     1 
ATOM   8694  O O     . ALA B 2 1273 ? 169.592 118.856 141.481 1.00 51.12  ? 1265 ALA B O     1 
ATOM   8695  C CB    . ALA B 2 1273 ? 167.944 119.338 138.692 1.00 51.12  ? 1265 ALA B CB    1 
ATOM   8696  N N     . THR B 2 1274 ? 170.952 118.831 139.677 1.00 50.01  ? 1266 THR B N     1 
ATOM   8697  C CA    . THR B 2 1274 ? 171.945 117.979 140.326 1.00 50.01  ? 1266 THR B CA    1 
ATOM   8698  C C     . THR B 2 1274 ? 172.637 118.706 141.471 1.00 50.01  ? 1266 THR B C     1 
ATOM   8699  O O     . THR B 2 1274 ? 172.915 118.107 142.520 1.00 50.01  ? 1266 THR B O     1 
ATOM   8700  C CB    . THR B 2 1274 ? 172.969 117.496 139.302 1.00 50.01  ? 1266 THR B CB    1 
ATOM   8701  N N     . SER B 2 1275 ? 172.908 120.000 141.300 1.00 52.16  ? 1267 SER B N     1 
ATOM   8702  C CA    . SER B 2 1275 ? 173.475 120.781 142.393 1.00 52.16  ? 1267 SER B CA    1 
ATOM   8703  C C     . SER B 2 1275 ? 172.450 121.021 143.491 1.00 52.16  ? 1267 SER B C     1 
ATOM   8704  O O     . SER B 2 1275 ? 172.825 121.226 144.650 1.00 52.16  ? 1267 SER B O     1 
ATOM   8705  C CB    . SER B 2 1275 ? 174.007 122.113 141.869 1.00 52.16  ? 1267 SER B CB    1 
ATOM   8706  N N     . ILE B 2 1276 ? 171.163 121.002 143.145 1.00 52.48  ? 1268 ILE B N     1 
ATOM   8707  C CA    . ILE B 2 1276 ? 170.120 121.178 144.149 1.00 52.48  ? 1268 ILE B CA    1 
ATOM   8708  C C     . ILE B 2 1276 ? 170.027 119.948 145.038 1.00 52.48  ? 1268 ILE B C     1 
ATOM   8709  O O     . ILE B 2 1276 ? 170.088 120.045 146.272 1.00 52.48  ? 1268 ILE B O     1 
ATOM   8710  C CB    . ILE B 2 1276 ? 168.774 121.480 143.470 1.00 52.48  ? 1268 ILE B CB    1 
ATOM   8711  N N     . SER B 2 1277 ? 169.878 118.773 144.419 1.00 61.39  ? 1269 SER B N     1 
ATOM   8712  C CA    . SER B 2 1277 ? 169.734 117.541 145.188 1.00 61.39  ? 1269 SER B CA    1 
ATOM   8713  C C     . SER B 2 1277 ? 171.027 117.186 145.910 1.00 61.39  ? 1269 SER B C     1 
ATOM   8714  O O     . SER B 2 1277 ? 170.998 116.756 147.068 1.00 61.39  ? 1269 SER B O     1 
ATOM   8715  C CB    . SER B 2 1277 ? 169.304 116.400 144.267 1.00 61.39  ? 1269 SER B CB    1 
ATOM   8716  N N     . ASN B 2 1278 ? 172.170 117.379 145.249 1.00 59.21  ? 1270 ASN B N     1 
ATOM   8717  C CA    . ASN B 2 1278 ? 173.447 117.105 145.897 1.00 59.21  ? 1270 ASN B CA    1 
ATOM   8718  C C     . ASN B 2 1278 ? 173.774 118.152 146.951 1.00 59.21  ? 1270 ASN B C     1 
ATOM   8719  O O     . ASN B 2 1278 ? 174.531 117.874 147.887 1.00 59.21  ? 1270 ASN B O     1 
ATOM   8720  C CB    . ASN B 2 1278 ? 174.560 117.038 144.853 1.00 59.21  ? 1270 ASN B CB    1 
ATOM   8721  N N     . SER B 2 1279 ? 173.214 119.353 146.819 1.00 57.60  ? 1271 SER B N     1 
ATOM   8722  C CA    . SER B 2 1279 ? 173.465 120.400 147.799 1.00 57.60  ? 1271 SER B CA    1 
ATOM   8723  C C     . SER B 2 1279 ? 172.664 120.163 149.072 1.00 57.60  ? 1271 SER B C     1 
ATOM   8724  O O     . SER B 2 1279 ? 173.233 119.985 150.154 1.00 57.60  ? 1271 SER B O     1 
ATOM   8725  C CB    . SER B 2 1279 ? 173.131 121.770 147.205 1.00 57.60  ? 1271 SER B CB    1 
ATOM   8726  N N     . LEU B 2 1280 ? 171.339 120.142 148.958 1.00 66.89  ? 1272 LEU B N     1 
ATOM   8727  C CA    . LEU B 2 1280 ? 170.497 120.118 150.146 1.00 66.89  ? 1272 LEU B CA    1 
ATOM   8728  C C     . LEU B 2 1280 ? 170.000 118.730 150.520 1.00 66.89  ? 1272 LEU B C     1 
ATOM   8729  O O     . LEU B 2 1280 ? 169.673 118.504 151.690 1.00 66.89  ? 1272 LEU B O     1 
ATOM   8730  C CB    . LEU B 2 1280 ? 169.294 121.046 149.957 1.00 66.89  ? 1272 LEU B CB    1 
ATOM   8731  N N     . HIS B 2 1281 ? 169.931 117.801 149.564 1.00 73.82  ? 1273 HIS B N     1 
ATOM   8732  C CA    . HIS B 2 1281 ? 169.355 116.489 149.838 1.00 73.82  ? 1273 HIS B CA    1 
ATOM   8733  C C     . HIS B 2 1281 ? 170.246 115.633 150.725 1.00 73.82  ? 1273 HIS B C     1 
ATOM   8734  O O     . HIS B 2 1281 ? 169.747 114.707 151.371 1.00 73.82  ? 1273 HIS B O     1 
ATOM   8735  C CB    . HIS B 2 1281 ? 169.071 115.750 148.532 1.00 73.82  ? 1273 HIS B CB    1 
ATOM   8736  N N     . ARG B 2 1282 ? 171.541 115.914 150.766 1.00 72.10  ? 1274 ARG B N     1 
ATOM   8737  C CA    . ARG B 2 1282 ? 172.467 115.185 151.620 1.00 72.10  ? 1274 ARG B CA    1 
ATOM   8738  C C     . ARG B 2 1282 ? 173.596 116.137 151.996 1.00 72.10  ? 1274 ARG B C     1 
ATOM   8739  O O     . ARG B 2 1282 ? 173.464 117.358 151.862 1.00 72.10  ? 1274 ARG B O     1 
ATOM   8740  C CB    . ARG B 2 1282 ? 172.962 113.909 150.918 1.00 72.10  ? 1274 ARG B CB    1 
ATOM   8741  N N     . GLU B 2 1283 ? 174.703 115.578 152.479 1.00 80.74  ? 1275 GLU B N     1 
ATOM   8742  C CA    . GLU B 2 1283 ? 175.885 116.370 152.799 1.00 80.74  ? 1275 GLU B CA    1 
ATOM   8743  C C     . GLU B 2 1283 ? 176.530 116.854 151.507 1.00 80.74  ? 1275 GLU B C     1 
ATOM   8744  O O     . GLU B 2 1283 ? 177.070 116.056 150.735 1.00 80.74  ? 1275 GLU B O     1 
ATOM   8745  C CB    . GLU B 2 1283 ? 176.866 115.544 153.623 1.00 80.74  ? 1275 GLU B CB    1 
ATOM   8746  N N     . LEU B 2 1284 ? 176.461 118.159 151.264 1.00 89.35  ? 1276 LEU B N     1 
ATOM   8747  C CA    . LEU B 2 1284 ? 177.104 118.734 150.093 1.00 89.35  ? 1276 LEU B CA    1 
ATOM   8748  C C     . LEU B 2 1284 ? 178.615 118.745 150.277 1.00 89.35  ? 1276 LEU B C     1 
ATOM   8749  O O     . LEU B 2 1284 ? 179.120 118.983 151.378 1.00 89.35  ? 1276 LEU B O     1 
ATOM   8750  C CB    . LEU B 2 1284 ? 176.594 120.152 149.848 1.00 89.35  ? 1276 LEU B CB    1 
ATOM   8751  N N     . SER B 2 1285 ? 179.334 118.475 149.193 1.00 89.30  ? 1277 SER B N     1 
ATOM   8752  C CA    . SER B 2 1285 ? 180.786 118.436 149.249 1.00 89.30  ? 1277 SER B CA    1 
ATOM   8753  C C     . SER B 2 1285 ? 181.357 119.843 149.391 1.00 89.30  ? 1277 SER B C     1 
ATOM   8754  O O     . SER B 2 1285 ? 180.714 120.843 149.061 1.00 89.30  ? 1277 SER B O     1 
ATOM   8755  C CB    . SER B 2 1285 ? 181.351 117.766 147.997 1.00 89.30  ? 1277 SER B CB    1 
ATOM   8756  O OG    . SER B 2 1285 ? 181.087 118.544 146.844 1.00 89.30  ? 1277 SER B OG    1 
ATOM   8757  N N     . ALA B 2 1286 ? 182.593 119.909 149.898 1.00 105.96 ? 1278 ALA B N     1 
ATOM   8758  C CA    . ALA B 2 1286 ? 183.271 121.188 150.077 1.00 105.96 ? 1278 ALA B CA    1 
ATOM   8759  C C     . ALA B 2 1286 ? 183.641 121.834 148.750 1.00 105.96 ? 1278 ALA B C     1 
ATOM   8760  O O     . ALA B 2 1286 ? 183.801 123.057 148.691 1.00 105.96 ? 1278 ALA B O     1 
ATOM   8761  C CB    . ALA B 2 1286 ? 184.525 121.008 150.932 1.00 105.96 ? 1278 ALA B CB    1 
ATOM   8762  N N     . GLY B 2 1287 ? 183.780 121.045 147.692 1.00 94.17  ? 1279 GLY B N     1 
ATOM   8763  C CA    . GLY B 2 1287 ? 184.025 121.579 146.371 1.00 94.17  ? 1279 GLY B CA    1 
ATOM   8764  C C     . GLY B 2 1287 ? 183.133 120.920 145.343 1.00 94.17  ? 1279 GLY B C     1 
ATOM   8765  O O     . GLY B 2 1287 ? 182.147 120.268 145.702 1.00 94.17  ? 1279 GLY B O     1 
ATOM   8766  N N     . LEU B 2 1288 ? 183.454 121.133 144.062 1.00 69.07  ? 1280 LEU B N     1 
ATOM   8767  C CA    . LEU B 2 1288 ? 182.811 120.512 142.899 1.00 69.07  ? 1280 LEU B CA    1 
ATOM   8768  C C     . LEU B 2 1288 ? 181.327 120.845 142.776 1.00 69.07  ? 1280 LEU B C     1 
ATOM   8769  O O     . LEU B 2 1288 ? 180.602 120.182 142.030 1.00 69.07  ? 1280 LEU B O     1 
ATOM   8770  C CB    . LEU B 2 1288 ? 183.011 118.990 142.890 1.00 69.07  ? 1280 LEU B CB    1 
ATOM   8771  N N     . VAL B 2 1289 ? 180.850 121.864 143.481 1.00 70.92  ? 1281 VAL B N     1 
ATOM   8772  C CA    . VAL B 2 1289 ? 179.471 122.302 143.333 1.00 70.92  ? 1281 VAL B CA    1 
ATOM   8773  C C     . VAL B 2 1289 ? 179.299 123.132 142.071 1.00 70.92  ? 1281 VAL B C     1 
ATOM   8774  O O     . VAL B 2 1289 ? 178.359 122.925 141.300 1.00 70.92  ? 1281 VAL B O     1 
ATOM   8775  C CB    . VAL B 2 1289 ? 179.024 123.079 144.588 1.00 70.92  ? 1281 VAL B CB    1 
ATOM   8776  N N     . GLY B 2 1290 ? 180.212 124.073 141.837 1.00 71.12  ? 1282 GLY B N     1 
ATOM   8777  C CA    . GLY B 2 1290 ? 180.205 124.833 140.605 1.00 71.12  ? 1282 GLY B CA    1 
ATOM   8778  C C     . GLY B 2 1290 ? 180.923 124.176 139.453 1.00 71.12  ? 1282 GLY B C     1 
ATOM   8779  O O     . GLY B 2 1290 ? 180.945 124.738 138.353 1.00 71.12  ? 1282 GLY B O     1 
ATOM   8780  N N     . LEU B 2 1291 ? 181.525 123.006 139.688 1.00 59.69  ? 1283 LEU B N     1 
ATOM   8781  C CA    . LEU B 2 1291 ? 182.206 122.295 138.614 1.00 59.69  ? 1283 LEU B CA    1 
ATOM   8782  C C     . LEU B 2 1291 ? 181.214 121.803 137.573 1.00 59.69  ? 1283 LEU B C     1 
ATOM   8783  O O     . LEU B 2 1291 ? 181.495 121.844 136.374 1.00 59.69  ? 1283 LEU B O     1 
ATOM   8784  C CB    . LEU B 2 1291 ? 183.012 121.129 139.186 1.00 59.69  ? 1283 LEU B CB    1 
ATOM   8785  N N     . GLY B 2 1292 ? 180.032 121.366 138.009 1.00 60.85  ? 1284 GLY B N     1 
ATOM   8786  C CA    . GLY B 2 1292 ? 178.988 121.019 137.062 1.00 60.85  ? 1284 GLY B CA    1 
ATOM   8787  C C     . GLY B 2 1292 ? 178.377 122.215 136.367 1.00 60.85  ? 1284 GLY B C     1 
ATOM   8788  O O     . GLY B 2 1292 ? 177.762 122.056 135.310 1.00 60.85  ? 1284 GLY B O     1 
ATOM   8789  N N     . LEU B 2 1293 ? 178.527 123.408 136.941 1.00 60.95  ? 1285 LEU B N     1 
ATOM   8790  C CA    . LEU B 2 1293 ? 177.976 124.609 136.326 1.00 60.95  ? 1285 LEU B CA    1 
ATOM   8791  C C     . LEU B 2 1293 ? 178.918 125.163 135.265 1.00 60.95  ? 1285 LEU B C     1 
ATOM   8792  O O     . LEU B 2 1293 ? 178.492 125.471 134.142 1.00 60.95  ? 1285 LEU B O     1 
ATOM   8793  C CB    . LEU B 2 1293 ? 177.699 125.657 137.404 1.00 60.95  ? 1285 LEU B CB    1 
ATOM   8794  N N     . THR B 2 1294 ? 180.197 125.313 135.621 1.00 60.41  ? 1286 THR B N     1 
ATOM   8795  C CA    . THR B 2 1294 ? 181.208 125.708 134.647 1.00 60.41  ? 1286 THR B CA    1 
ATOM   8796  C C     . THR B 2 1294 ? 181.350 124.651 133.566 1.00 60.41  ? 1286 THR B C     1 
ATOM   8797  O O     . THR B 2 1294 ? 181.457 124.973 132.376 1.00 60.41  ? 1286 THR B O     1 
ATOM   8798  C CB    . THR B 2 1294 ? 182.548 125.942 135.345 1.00 60.41  ? 1286 THR B CB    1 
ATOM   8799  N N     . TYR B 2 1295 ? 181.294 123.382 133.957 1.00 68.58  ? 1287 TYR B N     1 
ATOM   8800  C CA    . TYR B 2 1295 ? 181.288 122.296 132.992 1.00 68.58  ? 1287 TYR B CA    1 
ATOM   8801  C C     . TYR B 2 1295 ? 179.932 122.108 132.335 1.00 68.58  ? 1287 TYR B C     1 
ATOM   8802  O O     . TYR B 2 1295 ? 179.820 121.297 131.414 1.00 68.58  ? 1287 TYR B O     1 
ATOM   8803  C CB    . TYR B 2 1295 ? 181.725 120.986 133.653 1.00 68.58  ? 1287 TYR B CB    1 
ATOM   8804  C CG    . TYR B 2 1295 ? 183.195 120.933 134.008 1.00 68.58  ? 1287 TYR B CG    1 
ATOM   8805  C CD1   . TYR B 2 1295 ? 184.089 121.863 133.492 1.00 68.58  ? 1287 TYR B CD1   1 
ATOM   8806  C CD2   . TYR B 2 1295 ? 183.685 119.951 134.856 1.00 68.58  ? 1287 TYR B CD2   1 
ATOM   8807  C CE1   . TYR B 2 1295 ? 185.421 121.823 133.814 1.00 68.58  ? 1287 TYR B CE1   1 
ATOM   8808  C CE2   . TYR B 2 1295 ? 185.021 119.901 135.181 1.00 68.58  ? 1287 TYR B CE2   1 
ATOM   8809  C CZ    . TYR B 2 1295 ? 185.882 120.841 134.654 1.00 68.58  ? 1287 TYR B CZ    1 
ATOM   8810  O OH    . TYR B 2 1295 ? 187.212 120.806 134.968 1.00 68.58  ? 1287 TYR B OH    1 
ATOM   8811  N N     . ALA B 2 1296 ? 178.905 122.823 132.788 1.00 59.24  ? 1288 ALA B N     1 
ATOM   8812  C CA    . ALA B 2 1296 ? 177.633 122.808 132.083 1.00 59.24  ? 1288 ALA B CA    1 
ATOM   8813  C C     . ALA B 2 1296 ? 177.638 123.819 130.947 1.00 59.24  ? 1288 ALA B C     1 
ATOM   8814  O O     . ALA B 2 1296 ? 177.241 123.498 129.818 1.00 59.24  ? 1288 ALA B O     1 
ATOM   8815  C CB    . ALA B 2 1296 ? 176.485 123.087 133.055 1.00 59.24  ? 1288 ALA B CB    1 
ATOM   8816  N N     . LEU B 2 1297 ? 178.093 125.044 131.230 1.00 52.45  ? 1289 LEU B N     1 
ATOM   8817  C CA    . LEU B 2 1297 ? 178.242 126.041 130.172 1.00 52.45  ? 1289 LEU B CA    1 
ATOM   8818  C C     . LEU B 2 1297 ? 179.299 125.610 129.162 1.00 52.45  ? 1289 LEU B C     1 
ATOM   8819  O O     . LEU B 2 1297 ? 179.065 125.628 127.946 1.00 52.45  ? 1289 LEU B O     1 
ATOM   8820  C CB    . LEU B 2 1297 ? 178.593 127.399 130.778 1.00 52.45  ? 1289 LEU B CB    1 
ATOM   8821  N N     . MET B 2 1298 ? 180.460 125.172 129.654 1.00 52.57  ? 1290 MET B N     1 
ATOM   8822  C CA    . MET B 2 1298 ? 181.456 124.613 128.753 1.00 52.57  ? 1290 MET B CA    1 
ATOM   8823  C C     . MET B 2 1298 ? 181.049 123.256 128.202 1.00 52.57  ? 1290 MET B C     1 
ATOM   8824  O O     . MET B 2 1298 ? 181.638 122.817 127.216 1.00 52.57  ? 1290 MET B O     1 
ATOM   8825  C CB    . MET B 2 1298 ? 182.813 124.495 129.443 1.00 52.57  ? 1290 MET B CB    1 
ATOM   8826  C CG    . MET B 2 1298 ? 183.516 125.812 129.670 1.00 52.57  ? 1290 MET B CG    1 
ATOM   8827  S SD    . MET B 2 1298 ? 185.166 125.538 130.325 1.00 52.57  ? 1290 MET B SD    1 
ATOM   8828  C CE    . MET B 2 1298 ? 184.772 125.084 132.006 1.00 52.57  ? 1290 MET B CE    1 
ATOM   8829  N N     . VAL B 2 1299 ? 180.077 122.574 128.814 1.00 51.93  ? 1291 VAL B N     1 
ATOM   8830  C CA    . VAL B 2 1299 ? 179.544 121.363 128.199 1.00 51.93  ? 1291 VAL B CA    1 
ATOM   8831  C C     . VAL B 2 1299 ? 178.727 121.718 126.968 1.00 51.93  ? 1291 VAL B C     1 
ATOM   8832  O O     . VAL B 2 1299 ? 178.760 121.007 125.956 1.00 51.93  ? 1291 VAL B O     1 
ATOM   8833  C CB    . VAL B 2 1299 ? 178.711 120.556 129.210 1.00 51.93  ? 1291 VAL B CB    1 
ATOM   8834  N N     . SER B 2 1300 ? 177.976 122.818 127.036 1.00 50.41  ? 1292 SER B N     1 
ATOM   8835  C CA    . SER B 2 1300 ? 177.254 123.290 125.863 1.00 50.41  ? 1292 SER B CA    1 
ATOM   8836  C C     . SER B 2 1300 ? 178.205 123.833 124.808 1.00 50.41  ? 1292 SER B C     1 
ATOM   8837  O O     . SER B 2 1300 ? 177.940 123.698 123.605 1.00 50.41  ? 1292 SER B O     1 
ATOM   8838  C CB    . SER B 2 1300 ? 176.241 124.355 126.271 1.00 50.41  ? 1292 SER B CB    1 
ATOM   8839  N N     . ASN B 2 1301 ? 179.308 124.451 125.240 1.00 56.88  ? 1293 ASN B N     1 
ATOM   8840  C CA    . ASN B 2 1301 ? 180.352 124.816 124.292 1.00 56.88  ? 1293 ASN B CA    1 
ATOM   8841  C C     . ASN B 2 1301 ? 180.973 123.575 123.659 1.00 56.88  ? 1293 ASN B C     1 
ATOM   8842  O O     . ASN B 2 1301 ? 181.310 123.578 122.465 1.00 56.88  ? 1293 ASN B O     1 
ATOM   8843  C CB    . ASN B 2 1301 ? 181.415 125.667 124.983 1.00 56.88  ? 1293 ASN B CB    1 
ATOM   8844  N N     . TYR B 2 1302 ? 181.108 122.495 124.438 1.00 64.49  ? 1294 TYR B N     1 
ATOM   8845  C CA    . TYR B 2 1302 ? 181.649 121.255 123.894 1.00 64.49  ? 1294 TYR B CA    1 
ATOM   8846  C C     . TYR B 2 1302 ? 180.679 120.605 122.923 1.00 64.49  ? 1294 TYR B C     1 
ATOM   8847  O O     . TYR B 2 1302 ? 181.108 119.933 121.982 1.00 64.49  ? 1294 TYR B O     1 
ATOM   8848  C CB    . TYR B 2 1302 ? 181.991 120.273 125.012 1.00 64.49  ? 1294 TYR B CB    1 
ATOM   8849  C CG    . TYR B 2 1302 ? 183.220 120.634 125.818 1.00 64.49  ? 1294 TYR B CG    1 
ATOM   8850  C CD1   . TYR B 2 1302 ? 184.157 121.533 125.328 1.00 64.49  ? 1294 TYR B CD1   1 
ATOM   8851  C CD2   . TYR B 2 1302 ? 183.424 120.099 127.083 1.00 64.49  ? 1294 TYR B CD2   1 
ATOM   8852  C CE1   . TYR B 2 1302 ? 185.273 121.872 126.065 1.00 64.49  ? 1294 TYR B CE1   1 
ATOM   8853  C CE2   . TYR B 2 1302 ? 184.536 120.438 127.828 1.00 64.49  ? 1294 TYR B CE2   1 
ATOM   8854  C CZ    . TYR B 2 1302 ? 185.452 121.327 127.316 1.00 64.49  ? 1294 TYR B CZ    1 
ATOM   8855  O OH    . TYR B 2 1302 ? 186.565 121.661 128.047 1.00 64.49  ? 1294 TYR B OH    1 
ATOM   8856  N N     . LEU B 2 1303 ? 179.378 120.781 123.139 1.00 58.57  ? 1295 LEU B N     1 
ATOM   8857  C CA    . LEU B 2 1303 ? 178.423 120.285 122.160 1.00 58.57  ? 1295 LEU B CA    1 
ATOM   8858  C C     . LEU B 2 1303 ? 178.434 121.148 120.911 1.00 58.57  ? 1295 LEU B C     1 
ATOM   8859  O O     . LEU B 2 1303 ? 178.181 120.644 119.811 1.00 58.57  ? 1295 LEU B O     1 
ATOM   8860  C CB    . LEU B 2 1303 ? 177.023 120.232 122.766 1.00 58.57  ? 1295 LEU B CB    1 
ATOM   8861  N N     . ASN B 2 1304 ? 178.749 122.437 121.058 1.00 57.10  ? 1296 ASN B N     1 
ATOM   8862  C CA    . ASN B 2 1304 ? 178.791 123.330 119.904 1.00 57.10  ? 1296 ASN B CA    1 
ATOM   8863  C C     . ASN B 2 1304 ? 179.988 123.026 119.014 1.00 57.10  ? 1296 ASN B C     1 
ATOM   8864  O O     . ASN B 2 1304 ? 179.834 122.685 117.831 1.00 57.10  ? 1296 ASN B O     1 
ATOM   8865  C CB    . ASN B 2 1304 ? 178.821 124.784 120.374 1.00 57.10  ? 1296 ASN B CB    1 
ATOM   8866  N N     . TRP B 2 1305 ? 181.200 123.136 119.570 1.00 69.93  ? 1297 TRP B N     1 
ATOM   8867  C CA    . TRP B 2 1305 ? 182.388 122.801 118.796 1.00 69.93  ? 1297 TRP B CA    1 
ATOM   8868  C C     . TRP B 2 1305 ? 182.498 121.309 118.504 1.00 69.93  ? 1297 TRP B C     1 
ATOM   8869  O O     . TRP B 2 1305 ? 183.234 120.925 117.590 1.00 69.93  ? 1297 TRP B O     1 
ATOM   8870  C CB    . TRP B 2 1305 ? 183.661 123.277 119.499 1.00 69.93  ? 1297 TRP B CB    1 
ATOM   8871  C CG    . TRP B 2 1305 ? 183.983 124.726 119.297 1.00 69.93  ? 1297 TRP B CG    1 
ATOM   8872  C CD1   . TRP B 2 1305 ? 184.530 125.286 118.178 1.00 69.93  ? 1297 TRP B CD1   1 
ATOM   8873  C CD2   . TRP B 2 1305 ? 183.879 125.780 120.263 1.00 69.93  ? 1297 TRP B CD2   1 
ATOM   8874  N NE1   . TRP B 2 1305 ? 184.722 126.631 118.369 1.00 69.93  ? 1297 TRP B NE1   1 
ATOM   8875  C CE2   . TRP B 2 1305 ? 184.337 126.961 119.641 1.00 69.93  ? 1297 TRP B CE2   1 
ATOM   8876  C CE3   . TRP B 2 1305 ? 183.425 125.847 121.582 1.00 69.93  ? 1297 TRP B CE3   1 
ATOM   8877  C CZ2   . TRP B 2 1305 ? 184.351 128.190 120.293 1.00 69.93  ? 1297 TRP B CZ2   1 
ATOM   8878  C CZ3   . TRP B 2 1305 ? 183.441 127.071 122.223 1.00 69.93  ? 1297 TRP B CZ3   1 
ATOM   8879  C CH2   . TRP B 2 1305 ? 183.903 128.222 121.575 1.00 69.93  ? 1297 TRP B CH2   1 
ATOM   8880  N N     . MET B 2 1306 ? 181.792 120.461 119.249 1.00 63.08  ? 1298 MET B N     1 
ATOM   8881  C CA    . MET B 2 1306 ? 181.755 119.047 118.907 1.00 63.08  ? 1298 MET B CA    1 
ATOM   8882  C C     . MET B 2 1306 ? 180.833 118.785 117.728 1.00 63.08  ? 1298 MET B C     1 
ATOM   8883  O O     . MET B 2 1306 ? 181.112 117.899 116.914 1.00 63.08  ? 1298 MET B O     1 
ATOM   8884  C CB    . MET B 2 1306 ? 181.308 118.215 120.108 1.00 63.08  ? 1298 MET B CB    1 
ATOM   8885  N N     . VAL B 2 1307 ? 179.742 119.542 117.620 1.00 66.90  ? 1299 VAL B N     1 
ATOM   8886  C CA    . VAL B 2 1307 ? 178.832 119.375 116.492 1.00 66.90  ? 1299 VAL B CA    1 
ATOM   8887  C C     . VAL B 2 1307 ? 179.451 119.939 115.221 1.00 66.90  ? 1299 VAL B C     1 
ATOM   8888  O O     . VAL B 2 1307 ? 179.479 119.276 114.176 1.00 66.90  ? 1299 VAL B O     1 
ATOM   8889  C CB    . VAL B 2 1307 ? 177.475 120.033 116.796 1.00 66.90  ? 1299 VAL B CB    1 
ATOM   8890  N N     . ARG B 2 1308 ? 179.959 121.173 115.292 1.00 75.87  ? 1300 ARG B N     1 
ATOM   8891  C CA    . ARG B 2 1308 ? 180.594 121.778 114.124 1.00 75.87  ? 1300 ARG B CA    1 
ATOM   8892  C C     . ARG B 2 1308 ? 181.905 121.086 113.780 1.00 75.87  ? 1300 ARG B C     1 
ATOM   8893  O O     . ARG B 2 1308 ? 182.270 121.001 112.601 1.00 75.87  ? 1300 ARG B O     1 
ATOM   8894  C CB    . ARG B 2 1308 ? 180.826 123.269 114.366 1.00 75.87  ? 1300 ARG B CB    1 
ATOM   8895  N N     . ASN B 2 1309 ? 182.614 120.582 114.790 1.00 70.41  ? 1301 ASN B N     1 
ATOM   8896  C CA    . ASN B 2 1309 ? 183.780 119.753 114.526 1.00 70.41  ? 1301 ASN B CA    1 
ATOM   8897  C C     . ASN B 2 1309 ? 183.380 118.428 113.896 1.00 70.41  ? 1301 ASN B C     1 
ATOM   8898  O O     . ASN B 2 1309 ? 184.138 117.875 113.092 1.00 70.41  ? 1301 ASN B O     1 
ATOM   8899  C CB    . ASN B 2 1309 ? 184.563 119.518 115.815 1.00 70.41  ? 1301 ASN B CB    1 
ATOM   8900  N N     . LEU B 2 1310 ? 182.197 117.912 114.237 1.00 62.07  ? 1302 LEU B N     1 
ATOM   8901  C CA    . LEU B 2 1310 ? 181.695 116.727 113.552 1.00 62.07  ? 1302 LEU B CA    1 
ATOM   8902  C C     . LEU B 2 1310 ? 181.332 117.043 112.110 1.00 62.07  ? 1302 LEU B C     1 
ATOM   8903  O O     . LEU B 2 1310 ? 181.435 116.171 111.238 1.00 62.07  ? 1302 LEU B O     1 
ATOM   8904  C CB    . LEU B 2 1310 ? 180.488 116.158 114.294 1.00 62.07  ? 1302 LEU B CB    1 
ATOM   8905  N N     . ALA B 2 1311 ? 180.927 118.284 111.840 1.00 84.96  ? 1303 ALA B N     1 
ATOM   8906  C CA    . ALA B 2 1311 ? 180.651 118.689 110.466 1.00 84.96  ? 1303 ALA B CA    1 
ATOM   8907  C C     . ALA B 2 1311 ? 181.934 118.811 109.655 1.00 84.96  ? 1303 ALA B C     1 
ATOM   8908  O O     . ALA B 2 1311 ? 181.999 118.342 108.510 1.00 84.96  ? 1303 ALA B O     1 
ATOM   8909  C CB    . ALA B 2 1311 ? 179.883 120.009 110.460 1.00 84.96  ? 1303 ALA B CB    1 
ATOM   8910  N N     . ASP B 2 1312 ? 182.961 119.445 110.231 1.00 79.74  ? 1304 ASP B N     1 
ATOM   8911  C CA    . ASP B 2 1312 ? 184.240 119.568 109.541 1.00 79.74  ? 1304 ASP B CA    1 
ATOM   8912  C C     . ASP B 2 1312 ? 184.916 118.216 109.370 1.00 79.74  ? 1304 ASP B C     1 
ATOM   8913  O O     . ASP B 2 1312 ? 185.625 117.996 108.380 1.00 79.74  ? 1304 ASP B O     1 
ATOM   8914  C CB    . ASP B 2 1312 ? 185.155 120.527 110.303 1.00 79.74  ? 1304 ASP B CB    1 
ATOM   8915  N N     . MET B 2 1313 ? 184.696 117.296 110.311 1.00 87.38  ? 1305 MET B N     1 
ATOM   8916  C CA    . MET B 2 1313 ? 185.154 115.926 110.136 1.00 87.38  ? 1305 MET B CA    1 
ATOM   8917  C C     . MET B 2 1313 ? 184.316 115.171 109.118 1.00 87.38  ? 1305 MET B C     1 
ATOM   8918  O O     . MET B 2 1313 ? 184.800 114.195 108.540 1.00 87.38  ? 1305 MET B O     1 
ATOM   8919  C CB    . MET B 2 1313 ? 185.137 115.186 111.474 1.00 87.38  ? 1305 MET B CB    1 
ATOM   8920  N N     . GLU B 2 1314 ? 183.073 115.597 108.889 1.00 91.74  ? 1306 GLU B N     1 
ATOM   8921  C CA    . GLU B 2 1314 ? 182.256 114.953 107.867 1.00 91.74  ? 1306 GLU B CA    1 
ATOM   8922  C C     . GLU B 2 1314 ? 182.698 115.368 106.470 1.00 91.74  ? 1306 GLU B C     1 
ATOM   8923  O O     . GLU B 2 1314 ? 182.838 114.522 105.578 1.00 91.74  ? 1306 GLU B O     1 
ATOM   8924  C CB    . GLU B 2 1314 ? 180.781 115.284 108.086 1.00 91.74  ? 1306 GLU B CB    1 
ATOM   8925  N N     . ILE B 2 1315 ? 182.932 116.665 106.262 1.00 90.90  ? 1307 ILE B N     1 
ATOM   8926  C CA    . ILE B 2 1315 ? 183.344 117.131 104.942 1.00 90.90  ? 1307 ILE B CA    1 
ATOM   8927  C C     . ILE B 2 1315 ? 184.800 116.768 104.674 1.00 90.90  ? 1307 ILE B C     1 
ATOM   8928  O O     . ILE B 2 1315 ? 185.150 116.332 103.569 1.00 90.90  ? 1307 ILE B O     1 
ATOM   8929  C CB    . ILE B 2 1315 ? 183.110 118.646 104.811 1.00 90.90  ? 1307 ILE B CB    1 
ATOM   8930  N N     . GLN B 2 1316 ? 185.666 116.949 105.673 1.00 90.12  ? 1308 GLN B N     1 
ATOM   8931  C CA    . GLN B 2 1316 ? 187.067 116.572 105.520 1.00 90.12  ? 1308 GLN B CA    1 
ATOM   8932  C C     . GLN B 2 1316 ? 187.229 115.062 105.431 1.00 90.12  ? 1308 GLN B C     1 
ATOM   8933  O O     . GLN B 2 1316 ? 188.121 114.572 104.724 1.00 90.12  ? 1308 GLN B O     1 
ATOM   8934  C CB    . GLN B 2 1316 ? 187.888 117.133 106.681 1.00 90.12  ? 1308 GLN B CB    1 
ATOM   8935  N N     . LEU B 2 1317 ? 186.367 114.309 106.120 1.00 110.82 ? 1309 LEU B N     1 
ATOM   8936  C CA    . LEU B 2 1317 ? 186.304 112.869 105.907 1.00 110.82 ? 1309 LEU B CA    1 
ATOM   8937  C C     . LEU B 2 1317 ? 185.779 112.544 104.518 1.00 110.82 ? 1309 LEU B C     1 
ATOM   8938  O O     . LEU B 2 1317 ? 186.087 111.478 103.975 1.00 110.82 ? 1309 LEU B O     1 
ATOM   8939  C CB    . LEU B 2 1317 ? 185.428 112.213 106.970 1.00 110.82 ? 1309 LEU B CB    1 
ATOM   8940  N N     . GLY B 2 1318 ? 184.980 113.439 103.937 1.00 112.87 ? 1310 GLY B N     1 
ATOM   8941  C CA    . GLY B 2 1318 ? 184.657 113.319 102.528 1.00 112.87 ? 1310 GLY B CA    1 
ATOM   8942  C C     . GLY B 2 1318 ? 185.854 113.556 101.630 1.00 112.87 ? 1310 GLY B C     1 
ATOM   8943  O O     . GLY B 2 1318 ? 185.954 112.951 100.558 1.00 112.87 ? 1310 GLY B O     1 
ATOM   8944  N N     . ALA B 2 1319 ? 186.773 114.435 102.045 1.00 119.51 ? 1311 ALA B N     1 
ATOM   8945  C CA    . ALA B 2 1319 ? 187.982 114.664 101.258 1.00 119.51 ? 1311 ALA B CA    1 
ATOM   8946  C C     . ALA B 2 1319 ? 188.921 113.469 101.336 1.00 119.51 ? 1311 ALA B C     1 
ATOM   8947  O O     . ALA B 2 1319 ? 189.532 113.082 100.331 1.00 119.51 ? 1311 ALA B O     1 
ATOM   8948  C CB    . ALA B 2 1319 ? 188.689 115.932 101.732 1.00 119.51 ? 1311 ALA B CB    1 
ATOM   8949  N N     . VAL B 2 1320 ? 189.038 112.868 102.521 1.00 122.18 ? 1312 VAL B N     1 
ATOM   8950  C CA    . VAL B 2 1320 ? 189.830 111.650 102.649 1.00 122.18 ? 1312 VAL B CA    1 
ATOM   8951  C C     . VAL B 2 1320 ? 189.148 110.487 101.942 1.00 122.18 ? 1312 VAL B C     1 
ATOM   8952  O O     . VAL B 2 1320 ? 189.818 109.570 101.452 1.00 122.18 ? 1312 VAL B O     1 
ATOM   8953  C CB    . VAL B 2 1320 ? 190.084 111.334 104.134 1.00 122.18 ? 1312 VAL B CB    1 
ATOM   8954  N N     . LYS B 2 1321 ? 187.814 110.502 101.875 1.00 103.34 ? 1313 LYS B N     1 
ATOM   8955  C CA    . LYS B 2 1321 ? 187.100 109.489 101.105 1.00 103.34 ? 1313 LYS B CA    1 
ATOM   8956  C C     . LYS B 2 1321 ? 187.295 109.695 99.612  1.00 103.34 ? 1313 LYS B C     1 
ATOM   8957  O O     . LYS B 2 1321 ? 187.248 108.731 98.842  1.00 103.34 ? 1313 LYS B O     1 
ATOM   8958  C CB    . LYS B 2 1321 ? 185.613 109.513 101.456 1.00 103.34 ? 1313 LYS B CB    1 
ATOM   8959  N N     . ARG B 2 1322 ? 187.501 110.943 99.189  1.00 104.42 ? 1314 ARG B N     1 
ATOM   8960  C CA    . ARG B 2 1322 ? 187.898 111.206 97.812  1.00 104.42 ? 1314 ARG B CA    1 
ATOM   8961  C C     . ARG B 2 1322 ? 189.308 110.697 97.552  1.00 104.42 ? 1314 ARG B C     1 
ATOM   8962  O O     . ARG B 2 1322 ? 189.600 110.175 96.467  1.00 104.42 ? 1314 ARG B O     1 
ATOM   8963  C CB    . ARG B 2 1322 ? 187.802 112.701 97.526  1.00 104.42 ? 1314 ARG B CB    1 
ATOM   8964  C CG    . ARG B 2 1322 ? 188.103 113.088 96.096  1.00 104.42 ? 1314 ARG B CG    1 
ATOM   8965  C CD    . ARG B 2 1322 ? 187.977 114.583 95.919  1.00 104.42 ? 1314 ARG B CD    1 
ATOM   8966  N NE    . ARG B 2 1322 ? 186.617 115.036 96.186  1.00 104.42 ? 1314 ARG B NE    1 
ATOM   8967  C CZ    . ARG B 2 1322 ? 185.632 115.011 95.296  1.00 104.42 ? 1314 ARG B CZ    1 
ATOM   8968  N NH1   . ARG B 2 1322 ? 185.850 114.553 94.070  1.00 104.42 ? 1314 ARG B NH1   1 
ATOM   8969  N NH2   . ARG B 2 1322 ? 184.426 115.445 95.630  1.00 104.42 ? 1314 ARG B NH2   1 
ATOM   8970  N N     . ILE B 2 1323 ? 190.192 110.834 98.545  1.00 105.96 ? 1315 ILE B N     1 
ATOM   8971  C CA    . ILE B 2 1323 ? 191.550 110.317 98.413  1.00 105.96 ? 1315 ILE B CA    1 
ATOM   8972  C C     . ILE B 2 1323 ? 191.547 108.796 98.364  1.00 105.96 ? 1315 ILE B C     1 
ATOM   8973  O O     . ILE B 2 1323 ? 192.382 108.189 97.682  1.00 105.96 ? 1315 ILE B O     1 
ATOM   8974  C CB    . ILE B 2 1323 ? 192.433 110.843 99.559  1.00 105.96 ? 1315 ILE B CB    1 
ATOM   8975  N N     . HIS B 2 1324 ? 190.614 108.153 99.068  1.00 130.04 ? 1316 HIS B N     1 
ATOM   8976  C CA    . HIS B 2 1324 ? 190.482 106.707 98.958  1.00 130.04 ? 1316 HIS B CA    1 
ATOM   8977  C C     . HIS B 2 1324 ? 189.792 106.313 97.662  1.00 130.04 ? 1316 HIS B C     1 
ATOM   8978  O O     . HIS B 2 1324 ? 190.026 105.215 97.145  1.00 130.04 ? 1316 HIS B O     1 
ATOM   8979  C CB    . HIS B 2 1324 ? 189.720 106.151 100.162 1.00 130.04 ? 1316 HIS B CB    1 
ATOM   8980  C CG    . HIS B 2 1324 ? 189.639 104.655 100.186 1.00 130.04 ? 1316 HIS B CG    1 
ATOM   8981  N ND1   . HIS B 2 1324 ? 190.726 103.855 100.468 1.00 130.04 ? 1316 HIS B ND1   1 
ATOM   8982  C CD2   . HIS B 2 1324 ? 188.601 103.814 99.967  1.00 130.04 ? 1316 HIS B CD2   1 
ATOM   8983  C CE1   . HIS B 2 1324 ? 190.361 102.586 100.418 1.00 130.04 ? 1316 HIS B CE1   1 
ATOM   8984  N NE2   . HIS B 2 1324 ? 189.077 102.533 100.116 1.00 130.04 ? 1316 HIS B NE2   1 
ATOM   8985  N N     . ALA B 2 1325 ? 188.958 107.195 97.115  1.00 121.31 ? 1317 ALA B N     1 
ATOM   8986  C CA    . ALA B 2 1325 ? 188.359 106.971 95.809  1.00 121.31 ? 1317 ALA B CA    1 
ATOM   8987  C C     . ALA B 2 1325 ? 189.331 107.228 94.668  1.00 121.31 ? 1317 ALA B C     1 
ATOM   8988  O O     . ALA B 2 1325 ? 189.022 106.882 93.523  1.00 121.31 ? 1317 ALA B O     1 
ATOM   8989  C CB    . ALA B 2 1325 ? 187.121 107.851 95.640  1.00 121.31 ? 1317 ALA B CB    1 
ATOM   8990  N N     . LEU B 2 1326 ? 190.488 107.834 94.949  1.00 115.58 ? 1318 LEU B N     1 
ATOM   8991  C CA    . LEU B 2 1326 ? 191.505 108.003 93.917  1.00 115.58 ? 1318 LEU B CA    1 
ATOM   8992  C C     . LEU B 2 1326 ? 192.206 106.689 93.592  1.00 115.58 ? 1318 LEU B C     1 
ATOM   8993  O O     . LEU B 2 1326 ? 192.678 106.502 92.465  1.00 115.58 ? 1318 LEU B O     1 
ATOM   8994  C CB    . LEU B 2 1326 ? 192.525 109.053 94.355  1.00 115.58 ? 1318 LEU B CB    1 
ATOM   8995  N N     . LEU B 2 1327 ? 192.280 105.774 94.552  1.00 96.09  ? 1319 LEU B N     1 
ATOM   8996  C CA    . LEU B 2 1327 ? 192.931 104.489 94.335  1.00 96.09  ? 1319 LEU B CA    1 
ATOM   8997  C C     . LEU B 2 1327 ? 192.035 103.547 93.543  1.00 96.09  ? 1319 LEU B C     1 
ATOM   8998  O O     . LEU B 2 1327 ? 191.576 102.532 94.066  1.00 96.09  ? 1319 LEU B O     1 
ATOM   8999  C CB    . LEU B 2 1327 ? 193.311 103.849 95.669  1.00 96.09  ? 1319 LEU B CB    1 
ATOM   9000  N N     . GLY B 2 1351 ? 215.488 92.972  62.738  1.00 294.46 ? 1343 GLY B N     1 
ATOM   9001  C CA    . GLY B 2 1351 ? 214.560 93.942  62.188  1.00 294.46 ? 1343 GLY B CA    1 
ATOM   9002  C C     . GLY B 2 1351 ? 213.528 93.339  61.254  1.00 294.46 ? 1343 GLY B C     1 
ATOM   9003  O O     . GLY B 2 1351 ? 212.870 94.051  60.495  1.00 294.46 ? 1343 GLY B O     1 
ATOM   9004  N N     . LYS B 2 1352 ? 213.389 92.017  61.305  1.00 293.77 ? 1344 LYS B N     1 
ATOM   9005  C CA    . LYS B 2 1352 ? 212.395 91.309  60.511  1.00 293.77 ? 1344 LYS B CA    1 
ATOM   9006  C C     . LYS B 2 1352 ? 211.081 91.226  61.277  1.00 293.77 ? 1344 LYS B C     1 
ATOM   9007  O O     . LYS B 2 1352 ? 211.067 90.878  62.461  1.00 293.77 ? 1344 LYS B O     1 
ATOM   9008  C CB    . LYS B 2 1352 ? 212.889 89.907  60.154  1.00 293.77 ? 1344 LYS B CB    1 
ATOM   9009  N N     . ILE B 2 1353 ? 209.980 91.545  60.602  1.00 286.01 ? 1345 ILE B N     1 
ATOM   9010  C CA    . ILE B 2 1353 ? 208.667 91.617  61.233  1.00 286.01 ? 1345 ILE B CA    1 
ATOM   9011  C C     . ILE B 2 1353 ? 207.687 90.823  60.381  1.00 286.01 ? 1345 ILE B C     1 
ATOM   9012  O O     . ILE B 2 1353 ? 207.682 90.952  59.152  1.00 286.01 ? 1345 ILE B O     1 
ATOM   9013  C CB    . ILE B 2 1353 ? 208.189 93.073  61.396  1.00 286.01 ? 1345 ILE B CB    1 
ATOM   9014  N N     . GLN B 2 1354 ? 206.863 90.004  61.032  1.00 276.65 ? 1346 GLN B N     1 
ATOM   9015  C CA    . GLN B 2 1354 ? 205.754 89.335  60.367  1.00 276.65 ? 1346 GLN B CA    1 
ATOM   9016  C C     . GLN B 2 1354 ? 204.571 89.235  61.316  1.00 276.65 ? 1346 GLN B C     1 
ATOM   9017  O O     . GLN B 2 1354 ? 204.741 88.946  62.504  1.00 276.65 ? 1346 GLN B O     1 
ATOM   9018  C CB    . GLN B 2 1354 ? 206.156 87.937  59.881  1.00 276.65 ? 1346 GLN B CB    1 
ATOM   9019  N N     . ILE B 2 1355 ? 203.376 89.476  60.784  1.00 291.30 ? 1347 ILE B N     1 
ATOM   9020  C CA    . ILE B 2 1355 ? 202.121 89.248  61.490  1.00 291.30 ? 1347 ILE B CA    1 
ATOM   9021  C C     . ILE B 2 1355 ? 201.488 87.995  60.905  1.00 291.30 ? 1347 ILE B C     1 
ATOM   9022  O O     . ILE B 2 1355 ? 201.373 87.874  59.680  1.00 291.30 ? 1347 ILE B O     1 
ATOM   9023  C CB    . ILE B 2 1355 ? 201.178 90.455  61.343  1.00 291.30 ? 1347 ILE B CB    1 
ATOM   9024  C CG1   . ILE B 2 1355 ? 201.815 91.717  61.927  1.00 291.30 ? 1347 ILE B CG1   1 
ATOM   9025  C CG2   . ILE B 2 1355 ? 199.846 90.185  62.016  1.00 291.30 ? 1347 ILE B CG2   1 
ATOM   9026  C CD1   . ILE B 2 1355 ? 202.240 91.583  63.363  1.00 291.30 ? 1347 ILE B CD1   1 
ATOM   9027  N N     . GLN B 2 1356 ? 201.091 87.053  61.764  1.00 291.14 ? 1348 GLN B N     1 
ATOM   9028  C CA    . GLN B 2 1356 ? 200.402 85.855  61.295  1.00 291.14 ? 1348 GLN B CA    1 
ATOM   9029  C C     . GLN B 2 1356 ? 199.049 85.694  61.978  1.00 291.14 ? 1348 GLN B C     1 
ATOM   9030  O O     . GLN B 2 1356 ? 198.987 85.334  63.159  1.00 291.14 ? 1348 GLN B O     1 
ATOM   9031  C CB    . GLN B 2 1356 ? 201.268 84.618  61.532  1.00 291.14 ? 1348 GLN B CB    1 
ATOM   9032  N N     . ASN B 2 1357 ? 197.980 85.942  61.211  1.00 301.45 ? 1349 ASN B N     1 
ATOM   9033  C CA    . ASN B 2 1357 ? 196.579 85.688  61.581  1.00 301.45 ? 1349 ASN B CA    1 
ATOM   9034  C C     . ASN B 2 1357 ? 196.160 86.347  62.895  1.00 301.45 ? 1349 ASN B C     1 
ATOM   9035  O O     . ASN B 2 1357 ? 195.480 85.735  63.722  1.00 301.45 ? 1349 ASN B O     1 
ATOM   9036  C CB    . ASN B 2 1357 ? 196.301 84.184  61.628  1.00 301.45 ? 1349 ASN B CB    1 
ATOM   9037  N N     . LEU B 2 1358 ? 196.533 87.608  63.091  1.00 320.95 ? 1350 LEU B N     1 
ATOM   9038  C CA    . LEU B 2 1358 ? 196.341 88.219  64.399  1.00 320.95 ? 1350 LEU B CA    1 
ATOM   9039  C C     . LEU B 2 1358 ? 194.925 88.768  64.531  1.00 320.95 ? 1350 LEU B C     1 
ATOM   9040  O O     . LEU B 2 1358 ? 194.464 89.530  63.676  1.00 320.95 ? 1350 LEU B O     1 
ATOM   9041  C CB    . LEU B 2 1358 ? 197.362 89.332  64.628  1.00 320.95 ? 1350 LEU B CB    1 
ATOM   9042  N N     . SER B 2 1359 ? 194.233 88.367  65.594  1.00 342.93 ? 1351 SER B N     1 
ATOM   9043  C CA    . SER B 2 1359 ? 192.944 88.935  65.954  1.00 342.93 ? 1351 SER B CA    1 
ATOM   9044  C C     . SER B 2 1359 ? 193.006 89.566  67.339  1.00 342.93 ? 1351 SER B C     1 
ATOM   9045  O O     . SER B 2 1359 ? 193.586 88.986  68.262  1.00 342.93 ? 1351 SER B O     1 
ATOM   9046  C CB    . SER B 2 1359 ? 191.846 87.870  65.915  1.00 342.93 ? 1351 SER B CB    1 
ATOM   9047  O OG    . SER B 2 1359 ? 191.625 87.422  64.590  1.00 342.93 ? 1351 SER B OG    1 
ATOM   9048  N N     . VAL B 2 1360 ? 192.421 90.756  67.488  1.00 330.86 ? 1352 VAL B N     1 
ATOM   9049  C CA    . VAL B 2 1360 ? 192.355 91.398  68.796  1.00 330.86 ? 1352 VAL B CA    1 
ATOM   9050  C C     . VAL B 2 1360 ? 191.084 92.244  68.868  1.00 330.86 ? 1352 VAL B C     1 
ATOM   9051  O O     . VAL B 2 1360 ? 190.593 92.750  67.854  1.00 330.86 ? 1352 VAL B O     1 
ATOM   9052  C CB    . VAL B 2 1360 ? 193.649 92.228  69.057  1.00 330.86 ? 1352 VAL B CB    1 
ATOM   9053  C CG1   . VAL B 2 1360 ? 193.778 93.404  68.090  1.00 330.86 ? 1352 VAL B CG1   1 
ATOM   9054  C CG2   . VAL B 2 1360 ? 193.779 92.677  70.517  1.00 330.86 ? 1352 VAL B CG2   1 
ATOM   9055  N N     . ARG B 2 1361 ? 190.533 92.367  70.078  1.00 310.74 ? 1353 ARG B N     1 
ATOM   9056  C CA    . ARG B 2 1361 ? 189.429 93.269  70.378  1.00 310.74 ? 1353 ARG B CA    1 
ATOM   9057  C C     . ARG B 2 1361 ? 189.656 93.730  71.808  1.00 310.74 ? 1353 ARG B C     1 
ATOM   9058  O O     . ARG B 2 1361 ? 189.931 92.898  72.677  1.00 310.74 ? 1353 ARG B O     1 
ATOM   9059  C CB    . ARG B 2 1361 ? 188.070 92.579  70.226  1.00 310.74 ? 1353 ARG B CB    1 
ATOM   9060  N N     . TYR B 2 1362 ? 189.536 95.034  72.069  1.00 294.75 ? 1354 TYR B N     1 
ATOM   9061  C CA    . TYR B 2 1362 ? 189.515 95.475  73.459  1.00 294.75 ? 1354 TYR B CA    1 
ATOM   9062  C C     . TYR B 2 1362 ? 188.210 95.126  74.166  1.00 294.75 ? 1354 TYR B C     1 
ATOM   9063  O O     . TYR B 2 1362 ? 188.231 94.668  75.314  1.00 294.75 ? 1354 TYR B O     1 
ATOM   9064  C CB    . TYR B 2 1362 ? 189.793 96.975  73.519  1.00 294.75 ? 1354 TYR B CB    1 
ATOM   9065  C CG    . TYR B 2 1362 ? 191.126 97.307  72.900  1.00 294.75 ? 1354 TYR B CG    1 
ATOM   9066  C CD1   . TYR B 2 1362 ? 192.308 97.068  73.590  1.00 294.75 ? 1354 TYR B CD1   1 
ATOM   9067  C CD2   . TYR B 2 1362 ? 191.207 97.819  71.608  1.00 294.75 ? 1354 TYR B CD2   1 
ATOM   9068  C CE1   . TYR B 2 1362 ? 193.534 97.374  73.031  1.00 294.75 ? 1354 TYR B CE1   1 
ATOM   9069  C CE2   . TYR B 2 1362 ? 192.430 98.109  71.032  1.00 294.75 ? 1354 TYR B CE2   1 
ATOM   9070  C CZ    . TYR B 2 1362 ? 193.588 97.890  71.751  1.00 294.75 ? 1354 TYR B CZ    1 
ATOM   9071  O OH    . TYR B 2 1362 ? 194.806 98.158  71.172  1.00 294.75 ? 1354 TYR B OH    1 
ATOM   9072  N N     . ASP B 2 1363 ? 187.063 95.390  73.524  1.00 318.26 ? 1355 ASP B N     1 
ATOM   9073  C CA    . ASP B 2 1363 ? 185.782 95.045  74.138  1.00 318.26 ? 1355 ASP B CA    1 
ATOM   9074  C C     . ASP B 2 1363 ? 185.625 93.539  74.308  1.00 318.26 ? 1355 ASP B C     1 
ATOM   9075  O O     . ASP B 2 1363 ? 185.081 93.073  75.317  1.00 318.26 ? 1355 ASP B O     1 
ATOM   9076  C CB    . ASP B 2 1363 ? 184.635 95.612  73.299  1.00 318.26 ? 1355 ASP B CB    1 
ATOM   9077  N N     . SER B 2 1364 ? 186.069 92.784  73.294  1.00 348.92 ? 1356 SER B N     1 
ATOM   9078  C CA    . SER B 2 1364 ? 185.756 91.389  72.970  1.00 348.92 ? 1356 SER B CA    1 
ATOM   9079  C C     . SER B 2 1364 ? 184.282 91.179  72.616  1.00 348.92 ? 1356 SER B C     1 
ATOM   9080  O O     . SER B 2 1364 ? 183.818 90.033  72.582  1.00 348.92 ? 1356 SER B O     1 
ATOM   9081  C CB    . SER B 2 1364 ? 186.182 90.403  74.073  1.00 348.92 ? 1356 SER B CB    1 
ATOM   9082  N N     . SER B 2 1365 ? 183.531 92.249  72.341  1.00 373.38 ? 1357 SER B N     1 
ATOM   9083  C CA    . SER B 2 1365 ? 182.085 92.110  72.198  1.00 373.38 ? 1357 SER B CA    1 
ATOM   9084  C C     . SER B 2 1365 ? 181.526 92.724  70.921  1.00 373.38 ? 1357 SER B C     1 
ATOM   9085  O O     . SER B 2 1365 ? 180.784 92.065  70.183  1.00 373.38 ? 1357 SER B O     1 
ATOM   9086  C CB    . SER B 2 1365 ? 181.385 92.732  73.411  1.00 373.38 ? 1357 SER B CB    1 
ATOM   9087  N N     . LEU B 2 1366 ? 181.858 93.994  70.671  1.00 367.43 ? 1358 LEU B N     1 
ATOM   9088  C CA    . LEU B 2 1366 ? 181.489 94.692  69.444  1.00 367.43 ? 1358 LEU B CA    1 
ATOM   9089  C C     . LEU B 2 1366 ? 182.059 94.040  68.194  1.00 367.43 ? 1358 LEU B C     1 
ATOM   9090  O O     . LEU B 2 1366 ? 181.308 93.481  67.386  1.00 367.43 ? 1358 LEU B O     1 
ATOM   9091  C CB    . LEU B 2 1366 ? 181.941 96.152  69.515  1.00 367.43 ? 1358 LEU B CB    1 
ATOM   9092  N N     . LYS B 2 1367 ? 183.382 94.076  68.046  1.00 342.91 ? 1359 LYS B N     1 
ATOM   9093  C CA    . LYS B 2 1367 ? 184.021 93.551  66.849  1.00 342.91 ? 1359 LYS B CA    1 
ATOM   9094  C C     . LYS B 2 1367 ? 185.500 93.343  67.130  1.00 342.91 ? 1359 LYS B C     1 
ATOM   9095  O O     . LYS B 2 1367 ? 186.068 94.047  67.972  1.00 342.91 ? 1359 LYS B O     1 
ATOM   9096  C CB    . LYS B 2 1367 ? 183.839 94.511  65.663  1.00 342.91 ? 1359 LYS B CB    1 
ATOM   9097  N N     . PRO B 2 1368 ? 186.129 92.348  66.499  1.00 327.08 ? 1360 PRO B N     1 
ATOM   9098  C CA    . PRO B 2 1368 ? 187.592 92.341  66.398  1.00 327.08 ? 1360 PRO B CA    1 
ATOM   9099  C C     . PRO B 2 1368 ? 188.114 93.606  65.736  1.00 327.08 ? 1360 PRO B C     1 
ATOM   9100  O O     . PRO B 2 1368 ? 187.513 94.137  64.799  1.00 327.08 ? 1360 PRO B O     1 
ATOM   9101  C CB    . PRO B 2 1368 ? 187.897 91.088  65.566  1.00 327.08 ? 1360 PRO B CB    1 
ATOM   9102  C CG    . PRO B 2 1368 ? 186.639 90.302  65.539  1.00 327.08 ? 1360 PRO B CG    1 
ATOM   9103  C CD    . PRO B 2 1368 ? 185.521 91.264  65.707  1.00 327.08 ? 1360 PRO B CD    1 
ATOM   9104  N N     . VAL B 2 1369 ? 189.257 94.076  66.223  1.00 318.63 ? 1361 VAL B N     1 
ATOM   9105  C CA    . VAL B 2 1369 ? 189.859 95.291  65.695  1.00 318.63 ? 1361 VAL B CA    1 
ATOM   9106  C C     . VAL B 2 1369 ? 190.612 94.978  64.413  1.00 318.63 ? 1361 VAL B C     1 
ATOM   9107  O O     . VAL B 2 1369 ? 190.477 95.672  63.400  1.00 318.63 ? 1361 VAL B O     1 
ATOM   9108  C CB    . VAL B 2 1369 ? 190.776 95.935  66.751  1.00 318.63 ? 1361 VAL B CB    1 
ATOM   9109  N N     . LEU B 2 1370 ? 191.403 93.916  64.445  1.00 324.09 ? 1362 LEU B N     1 
ATOM   9110  C CA    . LEU B 2 1370 ? 192.063 93.348  63.282  1.00 324.09 ? 1362 LEU B CA    1 
ATOM   9111  C C     . LEU B 2 1370 ? 191.647 91.891  63.177  1.00 324.09 ? 1362 LEU B C     1 
ATOM   9112  O O     . LEU B 2 1370 ? 191.476 91.219  64.195  1.00 324.09 ? 1362 LEU B O     1 
ATOM   9113  C CB    . LEU B 2 1370 ? 193.581 93.445  63.391  1.00 324.09 ? 1362 LEU B CB    1 
ATOM   9114  C CG    . LEU B 2 1370 ? 194.228 94.822  63.490  1.00 324.09 ? 1362 LEU B CG    1 
ATOM   9115  C CD1   . LEU B 2 1370 ? 195.728 94.666  63.672  1.00 324.09 ? 1362 LEU B CD1   1 
ATOM   9116  C CD2   . LEU B 2 1370 ? 193.919 95.659  62.259  1.00 324.09 ? 1362 LEU B CD2   1 
ATOM   9117  N N     . LYS B 2 1371 ? 191.431 91.412  61.953  1.00 320.55 ? 1363 LYS B N     1 
ATOM   9118  C CA    . LYS B 2 1371 ? 190.995 90.034  61.736  1.00 320.55 ? 1363 LYS B CA    1 
ATOM   9119  C C     . LYS B 2 1371 ? 191.891 89.352  60.712  1.00 320.55 ? 1363 LYS B C     1 
ATOM   9120  O O     . LYS B 2 1371 ? 191.863 89.701  59.528  1.00 320.55 ? 1363 LYS B O     1 
ATOM   9121  C CB    . LYS B 2 1371 ? 189.537 89.991  61.278  1.00 320.55 ? 1363 LYS B CB    1 
ATOM   9122  N N     . HIS B 2 1372 ? 192.658 88.366  61.193  1.00 312.51 ? 1364 HIS B N     1 
ATOM   9123  C CA    . HIS B 2 1372 ? 193.502 87.467  60.398  1.00 312.51 ? 1364 HIS B CA    1 
ATOM   9124  C C     . HIS B 2 1372 ? 194.498 88.206  59.507  1.00 312.51 ? 1364 HIS B C     1 
ATOM   9125  O O     . HIS B 2 1372 ? 194.727 87.826  58.357  1.00 312.51 ? 1364 HIS B O     1 
ATOM   9126  C CB    . HIS B 2 1372 ? 192.642 86.514  59.566  1.00 312.51 ? 1364 HIS B CB    1 
ATOM   9127  N N     . VAL B 2 1373 ? 195.043 89.310  60.032  1.00 304.69 ? 1365 VAL B N     1 
ATOM   9128  C CA    . VAL B 2 1373 ? 196.028 90.113  59.310  1.00 304.69 ? 1365 VAL B CA    1 
ATOM   9129  C C     . VAL B 2 1373 ? 197.270 89.276  59.038  1.00 304.69 ? 1365 VAL B C     1 
ATOM   9130  O O     . VAL B 2 1373 ? 197.777 88.588  59.932  1.00 304.69 ? 1365 VAL B O     1 
ATOM   9131  C CB    . VAL B 2 1373 ? 196.352 91.393  60.093  1.00 304.69 ? 1365 VAL B CB    1 
ATOM   9132  C CG1   . VAL B 2 1373 ? 197.383 92.239  59.359  1.00 304.69 ? 1365 VAL B CG1   1 
ATOM   9133  C CG2   . VAL B 2 1373 ? 195.094 92.200  60.286  1.00 304.69 ? 1365 VAL B CG2   1 
ATOM   9134  N N     . ASN B 2 1374 ? 197.766 89.320  57.803  1.00 298.41 ? 1366 ASN B N     1 
ATOM   9135  C CA    . ASN B 2 1374 ? 199.002 88.624  57.480  1.00 298.41 ? 1366 ASN B CA    1 
ATOM   9136  C C     . ASN B 2 1374 ? 199.803 89.462  56.500  1.00 298.41 ? 1366 ASN B C     1 
ATOM   9137  O O     . ASN B 2 1374 ? 199.308 89.811  55.424  1.00 298.41 ? 1366 ASN B O     1 
ATOM   9138  C CB    . ASN B 2 1374 ? 198.720 87.240  56.885  1.00 298.41 ? 1366 ASN B CB    1 
ATOM   9139  N N     . THR B 2 1375 ? 201.052 89.735  56.872  1.00 287.89 ? 1367 THR B N     1 
ATOM   9140  C CA    . THR B 2 1375 ? 202.051 90.406  56.051  1.00 287.89 ? 1367 THR B CA    1 
ATOM   9141  C C     . THR B 2 1375 ? 203.410 90.213  56.706  1.00 287.89 ? 1367 THR B C     1 
ATOM   9142  O O     . THR B 2 1375 ? 203.509 89.918  57.901  1.00 287.89 ? 1367 THR B O     1 
ATOM   9143  C CB    . THR B 2 1375 ? 201.760 91.904  55.886  1.00 287.89 ? 1367 THR B CB    1 
ATOM   9144  N N     . LEU B 2 1376 ? 204.454 90.384  55.901  1.00 290.49 ? 1368 LEU B N     1 
ATOM   9145  C CA    . LEU B 2 1376 ? 205.835 90.193  56.321  1.00 290.49 ? 1368 LEU B CA    1 
ATOM   9146  C C     . LEU B 2 1376 ? 206.654 91.363  55.801  1.00 290.49 ? 1368 LEU B C     1 
ATOM   9147  O O     . LEU B 2 1376 ? 206.546 91.725  54.626  1.00 290.49 ? 1368 LEU B O     1 
ATOM   9148  C CB    . LEU B 2 1376 ? 206.403 88.868  55.803  1.00 290.49 ? 1368 LEU B CB    1 
ATOM   9149  N N     . ILE B 2 1377 ? 207.472 91.950  56.669  1.00 298.67 ? 1369 ILE B N     1 
ATOM   9150  C CA    . ILE B 2 1377 ? 208.314 93.083  56.309  1.00 298.67 ? 1369 ILE B CA    1 
ATOM   9151  C C     . ILE B 2 1377 ? 209.763 92.678  56.523  1.00 298.67 ? 1369 ILE B C     1 
ATOM   9152  O O     . ILE B 2 1377 ? 210.168 92.351  57.646  1.00 298.67 ? 1369 ILE B O     1 
ATOM   9153  C CB    . ILE B 2 1377 ? 207.967 94.336  57.128  1.00 298.67 ? 1369 ILE B CB    1 
ATOM   9154  N N     . SER B 2 1378 ? 210.537 92.719  55.447  1.00 322.18 ? 1370 SER B N     1 
ATOM   9155  C CA    . SER B 2 1378 ? 211.962 92.456  55.501  1.00 322.18 ? 1370 SER B CA    1 
ATOM   9156  C C     . SER B 2 1378 ? 212.699 93.642  56.124  1.00 322.18 ? 1370 SER B C     1 
ATOM   9157  O O     . SER B 2 1378 ? 212.168 94.756  56.137  1.00 322.18 ? 1370 SER B O     1 
ATOM   9158  C CB    . SER B 2 1378 ? 212.486 92.191  54.089  1.00 322.18 ? 1370 SER B CB    1 
ATOM   9159  N N     . PRO B 2 1379 ? 213.845 93.391  56.774  1.00 334.31 ? 1371 PRO B N     1 
ATOM   9160  C CA    . PRO B 2 1379 ? 214.716 94.488  57.237  1.00 334.31 ? 1371 PRO B CA    1 
ATOM   9161  C C     . PRO B 2 1379 ? 215.008 95.512  56.148  1.00 334.31 ? 1371 PRO B C     1 
ATOM   9162  O O     . PRO B 2 1379 ? 215.365 95.168  55.019  1.00 334.31 ? 1371 PRO B O     1 
ATOM   9163  C CB    . PRO B 2 1379 ? 215.984 93.766  57.706  1.00 334.31 ? 1371 PRO B CB    1 
ATOM   9164  C CG    . PRO B 2 1379 ? 215.526 92.402  58.047  1.00 334.31 ? 1371 PRO B CG    1 
ATOM   9165  C CD    . PRO B 2 1379 ? 214.434 92.075  57.085  1.00 334.31 ? 1371 PRO B CD    1 
ATOM   9166  N N     . GLY B 2 1380 ? 214.836 96.781  56.497  1.00 347.60 ? 1372 GLY B N     1 
ATOM   9167  C CA    . GLY B 2 1380 ? 215.132 97.888  55.620  1.00 347.60 ? 1372 GLY B CA    1 
ATOM   9168  C C     . GLY B 2 1380 ? 214.007 98.262  54.682  1.00 347.60 ? 1372 GLY B C     1 
ATOM   9169  O O     . GLY B 2 1380 ? 214.170 99.199  53.890  1.00 347.60 ? 1372 GLY B O     1 
ATOM   9170  N N     . GLN B 2 1381 ? 212.874 97.566  54.743  1.00 336.92 ? 1373 GLN B N     1 
ATOM   9171  C CA    . GLN B 2 1381 ? 211.714 97.912  53.934  1.00 336.92 ? 1373 GLN B CA    1 
ATOM   9172  C C     . GLN B 2 1381 ? 210.982 99.107  54.536  1.00 336.92 ? 1373 GLN B C     1 
ATOM   9173  O O     . GLN B 2 1381 ? 210.919 99.264  55.758  1.00 336.92 ? 1373 GLN B O     1 
ATOM   9174  C CB    . GLN B 2 1381 ? 210.764 96.719  53.816  1.00 336.92 ? 1373 GLN B CB    1 
ATOM   9175  N N     . LYS B 2 1382 ? 210.431 99.952  53.668  1.00 326.32 ? 1374 LYS B N     1 
ATOM   9176  C CA    . LYS B 2 1382 ? 209.557 101.050 54.072  1.00 326.32 ? 1374 LYS B CA    1 
ATOM   9177  C C     . LYS B 2 1382 ? 208.109 100.624 53.849  1.00 326.32 ? 1374 LYS B C     1 
ATOM   9178  O O     . LYS B 2 1382 ? 207.686 100.424 52.707  1.00 326.32 ? 1374 LYS B O     1 
ATOM   9179  C CB    . LYS B 2 1382 ? 209.884 102.323 53.295  1.00 326.32 ? 1374 LYS B CB    1 
ATOM   9180  N N     . ILE B 2 1383 ? 207.344 100.493 54.928  1.00 322.50 ? 1375 ILE B N     1 
ATOM   9181  C CA    . ILE B 2 1383 ? 206.021 99.886  54.866  1.00 322.50 ? 1375 ILE B CA    1 
ATOM   9182  C C     . ILE B 2 1383 ? 204.985 100.933 55.250  1.00 322.50 ? 1375 ILE B C     1 
ATOM   9183  O O     . ILE B 2 1383 ? 205.116 101.596 56.285  1.00 322.50 ? 1375 ILE B O     1 
ATOM   9184  C CB    . ILE B 2 1383 ? 205.917 98.655  55.786  1.00 322.50 ? 1375 ILE B CB    1 
ATOM   9185  N N     . GLY B 2 1384 ? 203.962 101.075 54.411  1.00 305.10 ? 1376 GLY B N     1 
ATOM   9186  C CA    . GLY B 2 1384 ? 202.829 101.943 54.687  1.00 305.10 ? 1376 GLY B CA    1 
ATOM   9187  C C     . GLY B 2 1384 ? 201.624 101.104 55.081  1.00 305.10 ? 1376 GLY B C     1 
ATOM   9188  O O     . GLY B 2 1384 ? 201.305 100.116 54.420  1.00 305.10 ? 1376 GLY B O     1 
ATOM   9189  N N     . ILE B 2 1385 ? 200.960 101.521 56.153  1.00 289.11 ? 1377 ILE B N     1 
ATOM   9190  C CA    . ILE B 2 1385 ? 199.697 100.928 56.581  1.00 289.11 ? 1377 ILE B CA    1 
ATOM   9191  C C     . ILE B 2 1385 ? 198.559 101.852 56.170  1.00 289.11 ? 1377 ILE B C     1 
ATOM   9192  O O     . ILE B 2 1385 ? 198.503 103.011 56.598  1.00 289.11 ? 1377 ILE B O     1 
ATOM   9193  C CB    . ILE B 2 1385 ? 199.681 100.680 58.098  1.00 289.11 ? 1377 ILE B CB    1 
ATOM   9194  N N     . CYS B 2 1386 ? 197.640 101.336 55.361  1.00 266.57 ? 1378 CYS B N     1 
ATOM   9195  C CA    . CYS B 2 1386 ? 196.511 102.114 54.879  1.00 266.57 ? 1378 CYS B CA    1 
ATOM   9196  C C     . CYS B 2 1386 ? 195.231 101.317 55.074  1.00 266.57 ? 1378 CYS B C     1 
ATOM   9197  O O     . CYS B 2 1386 ? 195.239 100.084 55.091  1.00 266.57 ? 1378 CYS B O     1 
ATOM   9198  C CB    . CYS B 2 1386 ? 196.675 102.496 53.401  1.00 266.57 ? 1378 CYS B CB    1 
ATOM   9199  N N     . GLY B 2 1387 ? 194.132 102.049 55.214  1.00 251.10 ? 1379 GLY B N     1 
ATOM   9200  C CA    . GLY B 2 1387 ? 192.807 101.513 55.446  1.00 251.10 ? 1379 GLY B CA    1 
ATOM   9201  C C     . GLY B 2 1387 ? 192.128 102.544 56.317  1.00 251.10 ? 1379 GLY B C     1 
ATOM   9202  O O     . GLY B 2 1387 ? 191.994 103.694 55.885  1.00 251.10 ? 1379 GLY B O     1 
ATOM   9203  N N     . ARG B 2 1388 ? 191.608 102.140 57.481  1.00 253.37 ? 1380 ARG B N     1 
ATOM   9204  C CA    . ARG B 2 1388 ? 191.052 103.104 58.425  1.00 253.37 ? 1380 ARG B CA    1 
ATOM   9205  C C     . ARG B 2 1388 ? 192.135 104.103 58.846  1.00 253.37 ? 1380 ARG B C     1 
ATOM   9206  O O     . ARG B 2 1388 ? 193.336 103.824 58.772  1.00 253.37 ? 1380 ARG B O     1 
ATOM   9207  C CB    . ARG B 2 1388 ? 190.478 102.390 59.643  1.00 253.37 ? 1380 ARG B CB    1 
ATOM   9208  N N     . THR B 2 1389 ? 191.708 105.264 59.338  1.00 278.09 ? 1381 THR B N     1 
ATOM   9209  C CA    . THR B 2 1389 ? 192.636 106.134 60.051  1.00 278.09 ? 1381 THR B CA    1 
ATOM   9210  C C     . THR B 2 1389 ? 193.227 105.523 61.318  1.00 278.09 ? 1381 THR B C     1 
ATOM   9211  O O     . THR B 2 1389 ? 194.381 105.066 61.333  1.00 278.09 ? 1381 THR B O     1 
ATOM   9212  C CB    . THR B 2 1389 ? 191.943 107.453 60.399  1.00 278.09 ? 1381 THR B CB    1 
ATOM   9213  N N     . GLY B 2 1390 ? 192.407 105.403 62.356  1.00 305.72 ? 1382 GLY B N     1 
ATOM   9214  C CA    . GLY B 2 1390 ? 192.956 104.944 63.605  1.00 305.72 ? 1382 GLY B CA    1 
ATOM   9215  C C     . GLY B 2 1390 ? 192.664 103.531 64.015  1.00 305.72 ? 1382 GLY B C     1 
ATOM   9216  O O     . GLY B 2 1390 ? 193.051 103.147 65.123  1.00 305.72 ? 1382 GLY B O     1 
ATOM   9217  N N     . SER B 2 1391 ? 192.019 102.721 63.172  1.00 300.85 ? 1383 SER B N     1 
ATOM   9218  C CA    . SER B 2 1391 ? 191.817 101.354 63.615  1.00 300.85 ? 1383 SER B CA    1 
ATOM   9219  C C     . SER B 2 1391 ? 193.090 100.557 63.413  1.00 300.85 ? 1383 SER B C     1 
ATOM   9220  O O     . SER B 2 1391 ? 193.333 99.587  64.137  1.00 300.85 ? 1383 SER B O     1 
ATOM   9221  C CB    . SER B 2 1391 ? 190.651 100.696 62.874  1.00 300.85 ? 1383 SER B CB    1 
ATOM   9222  N N     . GLY B 2 1392 ? 193.971 101.044 62.544  1.00 315.95 ? 1384 GLY B N     1 
ATOM   9223  C CA    . GLY B 2 1392 ? 195.228 100.380 62.326  1.00 315.95 ? 1384 GLY B CA    1 
ATOM   9224  C C     . GLY B 2 1392 ? 196.355 101.375 62.227  1.00 315.95 ? 1384 GLY B C     1 
ATOM   9225  O O     . GLY B 2 1392 ? 197.521 100.967 62.178  1.00 315.95 ? 1384 GLY B O     1 
ATOM   9226  N N     . LYS B 2 1393 ? 196.054 102.679 62.262  1.00 315.76 ? 1385 LYS B N     1 
ATOM   9227  C CA    . LYS B 2 1393 ? 196.998 103.575 62.906  1.00 315.76 ? 1385 LYS B CA    1 
ATOM   9228  C C     . LYS B 2 1393 ? 197.121 103.211 64.377  1.00 315.76 ? 1385 LYS B C     1 
ATOM   9229  O O     . LYS B 2 1393 ? 198.224 102.992 64.893  1.00 315.76 ? 1385 LYS B O     1 
ATOM   9230  C CB    . LYS B 2 1393 ? 196.563 105.029 62.736  1.00 315.76 ? 1385 LYS B CB    1 
ATOM   9231  N N     . SER B 2 1394 ? 195.974 103.104 65.061  1.00 323.52 ? 1386 SER B N     1 
ATOM   9232  C CA    . SER B 2 1394 ? 195.987 102.695 66.459  1.00 323.52 ? 1386 SER B CA    1 
ATOM   9233  C C     . SER B 2 1394 ? 196.260 101.204 66.636  1.00 323.52 ? 1386 SER B C     1 
ATOM   9234  O O     . SER B 2 1394 ? 196.853 100.812 67.644  1.00 323.52 ? 1386 SER B O     1 
ATOM   9235  C CB    . SER B 2 1394 ? 194.667 103.071 67.129  1.00 323.52 ? 1386 SER B CB    1 
ATOM   9236  N N     . SER B 2 1395 ? 195.751 100.343 65.745  1.00 317.03 ? 1387 SER B N     1 
ATOM   9237  C CA    . SER B 2 1395 ? 196.083 98.927  65.910  1.00 317.03 ? 1387 SER B CA    1 
ATOM   9238  C C     . SER B 2 1395 ? 197.545 98.632  65.575  1.00 317.03 ? 1387 SER B C     1 
ATOM   9239  O O     . SER B 2 1395 ? 198.180 97.798  66.237  1.00 317.03 ? 1387 SER B O     1 
ATOM   9240  C CB    . SER B 2 1395 ? 195.156 98.050  65.075  1.00 317.03 ? 1387 SER B CB    1 
ATOM   9241  N N     . PHE B 2 1396 ? 198.089 99.287  64.539  1.00 305.93 ? 1388 PHE B N     1 
ATOM   9242  C CA    . PHE B 2 1396 ? 199.525 99.214  64.264  1.00 305.93 ? 1388 PHE B CA    1 
ATOM   9243  C C     . PHE B 2 1396 ? 200.383 99.740  65.411  1.00 305.93 ? 1388 PHE B C     1 
ATOM   9244  O O     . PHE B 2 1396 ? 201.341 99.081  65.836  1.00 305.93 ? 1388 PHE B O     1 
ATOM   9245  C CB    . PHE B 2 1396 ? 199.840 99.973  62.974  1.00 305.93 ? 1388 PHE B CB    1 
ATOM   9246  N N     . SER B 2 1397 ? 200.061 100.937 65.917  1.00 297.46 ? 1389 SER B N     1 
ATOM   9247  C CA    . SER B 2 1397 ? 200.824 101.513 67.025  1.00 297.46 ? 1389 SER B CA    1 
ATOM   9248  C C     . SER B 2 1397 ? 200.681 100.700 68.307  1.00 297.46 ? 1389 SER B C     1 
ATOM   9249  O O     . SER B 2 1397 ? 201.675 100.397 68.977  1.00 297.46 ? 1389 SER B O     1 
ATOM   9250  C CB    . SER B 2 1397 ? 200.382 102.956 67.258  1.00 297.46 ? 1389 SER B CB    1 
ATOM   9251  N N     . LEU B 2 1398 ? 199.438 100.361 68.660  1.00 293.88 ? 1390 LEU B N     1 
ATOM   9252  C CA    . LEU B 2 1398 ? 199.134 99.528  69.821  1.00 293.88 ? 1390 LEU B CA    1 
ATOM   9253  C C     . LEU B 2 1398 ? 199.841 98.181  69.782  1.00 293.88 ? 1390 LEU B C     1 
ATOM   9254  O O     . LEU B 2 1398 ? 200.327 97.702  70.812  1.00 293.88 ? 1390 LEU B O     1 
ATOM   9255  C CB    . LEU B 2 1398 ? 197.624 99.328  69.930  1.00 293.88 ? 1390 LEU B CB    1 
ATOM   9256  N N     . ALA B 2 1399 ? 199.873 97.535  68.615  1.00 293.24 ? 1391 ALA B N     1 
ATOM   9257  C CA    . ALA B 2 1399 ? 200.668 96.320  68.493  1.00 293.24 ? 1391 ALA B CA    1 
ATOM   9258  C C     . ALA B 2 1399 ? 202.166 96.577  68.624  1.00 293.24 ? 1391 ALA B C     1 
ATOM   9259  O O     . ALA B 2 1399 ? 202.876 95.781  69.250  1.00 293.24 ? 1391 ALA B O     1 
ATOM   9260  C CB    . ALA B 2 1399 ? 200.369 95.636  67.160  1.00 293.24 ? 1391 ALA B CB    1 
ATOM   9261  N N     . PHE B 2 1400 ? 202.674 97.656  68.016  1.00 287.69 ? 1392 PHE B N     1 
ATOM   9262  C CA    . PHE B 2 1400 ? 204.082 98.004  68.209  1.00 287.69 ? 1392 PHE B CA    1 
ATOM   9263  C C     . PHE B 2 1400 ? 204.410 98.383  69.653  1.00 287.69 ? 1392 PHE B C     1 
ATOM   9264  O O     . PHE B 2 1400 ? 205.426 97.938  70.196  1.00 287.69 ? 1392 PHE B O     1 
ATOM   9265  C CB    . PHE B 2 1400 ? 204.485 99.124  67.252  1.00 287.69 ? 1392 PHE B CB    1 
ATOM   9266  C CG    . PHE B 2 1400 ? 205.964 99.392  67.227  1.00 287.69 ? 1392 PHE B CG    1 
ATOM   9267  C CD1   . PHE B 2 1400 ? 206.828 98.503  66.603  1.00 287.69 ? 1392 PHE B CD1   1 
ATOM   9268  C CD2   . PHE B 2 1400 ? 206.491 100.531 67.819  1.00 287.69 ? 1392 PHE B CD2   1 
ATOM   9269  C CE1   . PHE B 2 1400 ? 208.190 98.741  66.576  1.00 287.69 ? 1392 PHE B CE1   1 
ATOM   9270  C CE2   . PHE B 2 1400 ? 207.854 100.776 67.792  1.00 287.69 ? 1392 PHE B CE2   1 
ATOM   9271  C CZ    . PHE B 2 1400 ? 208.701 99.877  67.169  1.00 287.69 ? 1392 PHE B CZ    1 
ATOM   9272  N N     . PHE B 2 1401 ? 203.567 99.197  70.298  1.00 289.13 ? 1393 PHE B N     1 
ATOM   9273  C CA    . PHE B 2 1401 ? 203.756 99.469  71.721  1.00 289.13 ? 1393 PHE B CA    1 
ATOM   9274  C C     . PHE B 2 1401 ? 203.399 98.315  72.648  1.00 289.13 ? 1393 PHE B C     1 
ATOM   9275  O O     . PHE B 2 1401 ? 203.717 98.422  73.840  1.00 289.13 ? 1393 PHE B O     1 
ATOM   9276  C CB    . PHE B 2 1401 ? 202.954 100.700 72.150  1.00 289.13 ? 1393 PHE B CB    1 
ATOM   9277  C CG    . PHE B 2 1401 ? 203.550 102.002 71.705  1.00 289.13 ? 1393 PHE B CG    1 
ATOM   9278  C CD1   . PHE B 2 1401 ? 204.641 102.533 72.376  1.00 289.13 ? 1393 PHE B CD1   1 
ATOM   9279  C CD2   . PHE B 2 1401 ? 203.008 102.711 70.646  1.00 289.13 ? 1393 PHE B CD2   1 
ATOM   9280  C CE1   . PHE B 2 1401 ? 205.194 103.737 71.982  1.00 289.13 ? 1393 PHE B CE1   1 
ATOM   9281  C CE2   . PHE B 2 1401 ? 203.557 103.916 70.246  1.00 289.13 ? 1393 PHE B CE2   1 
ATOM   9282  C CZ    . PHE B 2 1401 ? 204.649 104.428 70.918  1.00 289.13 ? 1393 PHE B CZ    1 
ATOM   9283  N N     . ARG B 2 1402 ? 202.782 97.237  72.141  1.00 278.48 ? 1394 ARG B N     1 
ATOM   9284  C CA    . ARG B 2 1402 ? 202.273 96.115  72.952  1.00 278.48 ? 1394 ARG B CA    1 
ATOM   9285  C C     . ARG B 2 1402 ? 201.315 96.629  74.029  1.00 278.48 ? 1394 ARG B C     1 
ATOM   9286  O O     . ARG B 2 1402 ? 201.473 96.357  75.221  1.00 278.48 ? 1394 ARG B O     1 
ATOM   9287  C CB    . ARG B 2 1402 ? 203.407 95.281  73.557  1.00 278.48 ? 1394 ARG B CB    1 
ATOM   9288  N N     . MET B 2 1403 ? 200.308 97.393  73.597  1.00 282.65 ? 1395 MET B N     1 
ATOM   9289  C CA    . MET B 2 1403 ? 199.201 97.736  74.479  1.00 282.65 ? 1395 MET B CA    1 
ATOM   9290  C C     . MET B 2 1403 ? 198.205 96.606  74.683  1.00 282.65 ? 1395 MET B C     1 
ATOM   9291  O O     . MET B 2 1403 ? 197.442 96.647  75.653  1.00 282.65 ? 1395 MET B O     1 
ATOM   9292  C CB    . MET B 2 1403 ? 198.460 98.959  73.935  1.00 282.65 ? 1395 MET B CB    1 
ATOM   9293  N N     . VAL B 2 1404 ? 198.189 95.602  73.812  1.00 287.31 ? 1396 VAL B N     1 
ATOM   9294  C CA    . VAL B 2 1404 ? 197.347 94.433  74.027  1.00 287.31 ? 1396 VAL B CA    1 
ATOM   9295  C C     . VAL B 2 1404 ? 198.012 93.225  73.391  1.00 287.31 ? 1396 VAL B C     1 
ATOM   9296  O O     . VAL B 2 1404 ? 198.776 93.347  72.429  1.00 287.31 ? 1396 VAL B O     1 
ATOM   9297  C CB    . VAL B 2 1404 ? 195.923 94.636  73.459  1.00 287.31 ? 1396 VAL B CB    1 
ATOM   9298  N N     . ASP B 2 1405 ? 197.709 92.053  73.932  1.00 313.35 ? 1397 ASP B N     1 
ATOM   9299  C CA    . ASP B 2 1405 ? 198.049 90.812  73.265  1.00 313.35 ? 1397 ASP B CA    1 
ATOM   9300  C C     . ASP B 2 1405 ? 196.930 90.464  72.296  1.00 313.35 ? 1397 ASP B C     1 
ATOM   9301  O O     . ASP B 2 1405 ? 195.779 90.864  72.483  1.00 313.35 ? 1397 ASP B O     1 
ATOM   9302  C CB    . ASP B 2 1405 ? 198.251 89.680  74.273  1.00 313.35 ? 1397 ASP B CB    1 
ATOM   9303  N N     . MET B 2 1406 ? 197.286 89.735  71.245  1.00 337.35 ? 1398 MET B N     1 
ATOM   9304  C CA    . MET B 2 1406 ? 196.290 89.215  70.321  1.00 337.35 ? 1398 MET B CA    1 
ATOM   9305  C C     . MET B 2 1406 ? 195.383 88.194  70.998  1.00 337.35 ? 1398 MET B C     1 
ATOM   9306  O O     . MET B 2 1406 ? 195.782 87.488  71.928  1.00 337.35 ? 1398 MET B O     1 
ATOM   9307  C CB    . MET B 2 1406 ? 196.971 88.583  69.107  1.00 337.35 ? 1398 MET B CB    1 
ATOM   9308  N N     . PHE B 2 1407 ? 194.146 88.120  70.511  1.00 347.44 ? 1399 PHE B N     1 
ATOM   9309  C CA    . PHE B 2 1407 ? 193.238 87.075  70.964  1.00 347.44 ? 1399 PHE B CA    1 
ATOM   9310  C C     . PHE B 2 1407 ? 193.619 85.756  70.313  1.00 347.44 ? 1399 PHE B C     1 
ATOM   9311  O O     . PHE B 2 1407 ? 193.618 84.708  70.968  1.00 347.44 ? 1399 PHE B O     1 
ATOM   9312  C CB    . PHE B 2 1407 ? 191.791 87.449  70.643  1.00 347.44 ? 1399 PHE B CB    1 
ATOM   9313  N N     . GLU B 2 1408 ? 193.947 85.803  69.024  1.00 349.47 ? 1400 GLU B N     1 
ATOM   9314  C CA    . GLU B 2 1408 ? 194.375 84.641  68.263  1.00 349.47 ? 1400 GLU B CA    1 
ATOM   9315  C C     . GLU B 2 1408 ? 195.512 85.076  67.349  1.00 349.47 ? 1400 GLU B C     1 
ATOM   9316  O O     . GLU B 2 1408 ? 195.699 86.265  67.079  1.00 349.47 ? 1400 GLU B O     1 
ATOM   9317  C CB    . GLU B 2 1408 ? 193.229 84.032  67.446  1.00 349.47 ? 1400 GLU B CB    1 
ATOM   9318  N N     . GLY B 2 1409 ? 196.270 84.097  66.872  1.00 325.36 ? 1401 GLY B N     1 
ATOM   9319  C CA    . GLY B 2 1409 ? 197.415 84.375  66.029  1.00 325.36 ? 1401 GLY B CA    1 
ATOM   9320  C C     . GLY B 2 1409 ? 198.597 84.860  66.849  1.00 325.36 ? 1401 GLY B C     1 
ATOM   9321  O O     . GLY B 2 1409 ? 198.637 84.724  68.077  1.00 325.36 ? 1401 GLY B O     1 
ATOM   9322  N N     . ARG B 2 1410 ? 199.568 85.455  66.160  1.00 287.88 ? 1402 ARG B N     1 
ATOM   9323  C CA    . ARG B 2 1410 ? 200.736 85.974  66.853  1.00 287.88 ? 1402 ARG B CA    1 
ATOM   9324  C C     . ARG B 2 1410 ? 201.342 87.144  66.091  1.00 287.88 ? 1402 ARG B C     1 
ATOM   9325  O O     . ARG B 2 1410 ? 201.169 87.286  64.878  1.00 287.88 ? 1402 ARG B O     1 
ATOM   9326  C CB    . ARG B 2 1410 ? 201.796 84.883  67.054  1.00 287.88 ? 1402 ARG B CB    1 
ATOM   9327  N N     . ILE B 2 1411 ? 202.047 87.984  66.842  1.00 292.10 ? 1403 ILE B N     1 
ATOM   9328  C CA    . ILE B 2 1411 ? 202.787 89.133  66.331  1.00 292.10 ? 1403 ILE B CA    1 
ATOM   9329  C C     . ILE B 2 1411 ? 204.245 88.900  66.697  1.00 292.10 ? 1403 ILE B C     1 
ATOM   9330  O O     . ILE B 2 1411 ? 204.569 88.789  67.886  1.00 292.10 ? 1403 ILE B O     1 
ATOM   9331  C CB    . ILE B 2 1411 ? 202.274 90.456  66.915  1.00 292.10 ? 1403 ILE B CB    1 
ATOM   9332  N N     . ILE B 2 1412 ? 205.128 88.821  65.702  1.00 289.79 ? 1404 ILE B N     1 
ATOM   9333  C CA    . ILE B 2 1412 ? 206.548 88.638  65.982  1.00 289.79 ? 1404 ILE B CA    1 
ATOM   9334  C C     . ILE B 2 1412 ? 207.322 89.903  65.647  1.00 289.79 ? 1404 ILE B C     1 
ATOM   9335  O O     . ILE B 2 1412 ? 207.064 90.563  64.634  1.00 289.79 ? 1404 ILE B O     1 
ATOM   9336  C CB    . ILE B 2 1412 ? 207.118 87.436  65.203  1.00 289.79 ? 1404 ILE B CB    1 
ATOM   9337  N N     . ILE B 2 1413 ? 208.286 90.224  66.508  1.00 289.00 ? 1405 ILE B N     1 
ATOM   9338  C CA    . ILE B 2 1413 ? 209.275 91.275  66.301  1.00 289.00 ? 1405 ILE B CA    1 
ATOM   9339  C C     . ILE B 2 1413 ? 210.654 90.638  66.388  1.00 289.00 ? 1405 ILE B C     1 
ATOM   9340  O O     . ILE B 2 1413 ? 210.970 89.993  67.397  1.00 289.00 ? 1405 ILE B O     1 
ATOM   9341  C CB    . ILE B 2 1413 ? 209.133 92.411  67.324  1.00 289.00 ? 1405 ILE B CB    1 
ATOM   9342  N N     . ASP B 2 1414 ? 211.455 90.799  65.327  1.00 285.18 ? 1406 ASP B N     1 
ATOM   9343  C CA    . ASP B 2 1414 ? 212.804 90.224  65.199  1.00 285.18 ? 1406 ASP B CA    1 
ATOM   9344  C C     . ASP B 2 1414 ? 212.811 88.702  65.340  1.00 285.18 ? 1406 ASP B C     1 
ATOM   9345  O O     . ASP B 2 1414 ? 213.788 88.112  65.808  1.00 285.18 ? 1406 ASP B O     1 
ATOM   9346  C CB    . ASP B 2 1414 ? 213.793 90.861  66.186  1.00 285.18 ? 1406 ASP B CB    1 
ATOM   9347  N N     . GLY B 2 1415 ? 211.719 88.059  64.930  1.00 288.53 ? 1407 GLY B N     1 
ATOM   9348  C CA    . GLY B 2 1415 ? 211.544 86.631  65.069  1.00 288.53 ? 1407 GLY B CA    1 
ATOM   9349  C C     . GLY B 2 1415 ? 210.973 86.138  66.382  1.00 288.53 ? 1407 GLY B C     1 
ATOM   9350  O O     . GLY B 2 1415 ? 210.760 84.925  66.518  1.00 288.53 ? 1407 GLY B O     1 
ATOM   9351  N N     . ILE B 2 1416 ? 210.712 87.012  67.352  1.00 286.27 ? 1408 ILE B N     1 
ATOM   9352  C CA    . ILE B 2 1416 ? 210.223 86.586  68.660  1.00 286.27 ? 1408 ILE B CA    1 
ATOM   9353  C C     . ILE B 2 1416 ? 208.810 87.117  68.832  1.00 286.27 ? 1408 ILE B C     1 
ATOM   9354  O O     . ILE B 2 1416 ? 208.552 88.298  68.563  1.00 286.27 ? 1408 ILE B O     1 
ATOM   9355  C CB    . ILE B 2 1416 ? 211.138 87.077  69.794  1.00 286.27 ? 1408 ILE B CB    1 
ATOM   9356  N N     . ASP B 2 1417 ? 207.896 86.239  69.256  1.00 300.11 ? 1409 ASP B N     1 
ATOM   9357  C CA    . ASP B 2 1417 ? 206.541 86.629  69.637  1.00 300.11 ? 1409 ASP B CA    1 
ATOM   9358  C C     . ASP B 2 1417 ? 206.530 87.688  70.735  1.00 300.11 ? 1409 ASP B C     1 
ATOM   9359  O O     . ASP B 2 1417 ? 207.228 87.557  71.745  1.00 300.11 ? 1409 ASP B O     1 
ATOM   9360  C CB    . ASP B 2 1417 ? 205.756 85.399  70.089  1.00 300.11 ? 1409 ASP B CB    1 
ATOM   9361  N N     . ILE B 2 1418 ? 205.743 88.750  70.522  1.00 298.84 ? 1410 ILE B N     1 
ATOM   9362  C CA    . ILE B 2 1418 ? 205.709 89.869  71.461  1.00 298.84 ? 1410 ILE B CA    1 
ATOM   9363  C C     . ILE B 2 1418 ? 205.072 89.494  72.796  1.00 298.84 ? 1410 ILE B C     1 
ATOM   9364  O O     . ILE B 2 1418 ? 205.255 90.206  73.790  1.00 298.84 ? 1410 ILE B O     1 
ATOM   9365  C CB    . ILE B 2 1418 ? 204.969 91.065  70.835  1.00 298.84 ? 1410 ILE B CB    1 
ATOM   9366  N N     . ALA B 2 1419 ? 204.328 88.385  72.847  1.00 291.42 ? 1411 ALA B N     1 
ATOM   9367  C CA    . ALA B 2 1419 ? 203.811 87.825  74.089  1.00 291.42 ? 1411 ALA B CA    1 
ATOM   9368  C C     . ALA B 2 1419 ? 204.890 87.199  74.963  1.00 291.42 ? 1411 ALA B C     1 
ATOM   9369  O O     . ALA B 2 1419 ? 204.617 86.909  76.133  1.00 291.42 ? 1411 ALA B O     1 
ATOM   9370  C CB    . ALA B 2 1419 ? 202.734 86.784  73.783  1.00 291.42 ? 1411 ALA B CB    1 
ATOM   9371  N N     . LYS B 2 1420 ? 206.093 86.983  74.436  1.00 295.03 ? 1412 LYS B N     1 
ATOM   9372  C CA    . LYS B 2 1420 ? 207.194 86.424  75.206  1.00 295.03 ? 1412 LYS B CA    1 
ATOM   9373  C C     . LYS B 2 1420 ? 208.324 87.418  75.445  1.00 295.03 ? 1412 LYS B C     1 
ATOM   9374  O O     . LYS B 2 1420 ? 209.412 87.010  75.865  1.00 295.03 ? 1412 LYS B O     1 
ATOM   9375  C CB    . LYS B 2 1420 ? 207.739 85.174  74.512  1.00 295.03 ? 1412 LYS B CB    1 
ATOM   9376  N N     . LEU B 2 1421 ? 208.097 88.706  75.200  1.00 293.84 ? 1413 LEU B N     1 
ATOM   9377  C CA    . LEU B 2 1421 ? 209.148 89.646  75.536  1.00 293.84 ? 1413 LEU B CA    1 
ATOM   9378  C C     . LEU B 2 1421 ? 208.743 90.447  76.768  1.00 293.84 ? 1413 LEU B C     1 
ATOM   9379  O O     . LEU B 2 1421 ? 207.550 90.678  76.989  1.00 293.84 ? 1413 LEU B O     1 
ATOM   9380  C CB    . LEU B 2 1421 ? 209.431 90.608  74.376  1.00 293.84 ? 1413 LEU B CB    1 
ATOM   9381  N N     . PRO B 2 1422 ? 209.700 90.819  77.620  1.00 286.28 ? 1414 PRO B N     1 
ATOM   9382  C CA    . PRO B 2 1422 ? 209.428 91.819  78.667  1.00 286.28 ? 1414 PRO B CA    1 
ATOM   9383  C C     . PRO B 2 1422 ? 208.920 93.129  78.088  1.00 286.28 ? 1414 PRO B C     1 
ATOM   9384  O O     . PRO B 2 1422 ? 209.591 93.764  77.271  1.00 286.28 ? 1414 PRO B O     1 
ATOM   9385  C CB    . PRO B 2 1422 ? 210.785 91.987  79.357  1.00 286.28 ? 1414 PRO B CB    1 
ATOM   9386  C CG    . PRO B 2 1422 ? 211.529 90.729  79.051  1.00 286.28 ? 1414 PRO B CG    1 
ATOM   9387  C CD    . PRO B 2 1422 ? 211.090 90.336  77.674  1.00 286.28 ? 1414 PRO B CD    1 
ATOM   9388  N N     . LEU B 2 1423 ? 207.697 93.494  78.493  1.00 279.43 ? 1415 LEU B N     1 
ATOM   9389  C CA    . LEU B 2 1423 ? 206.981 94.609  77.880  1.00 279.43 ? 1415 LEU B CA    1 
ATOM   9390  C C     . LEU B 2 1423 ? 207.704 95.935  78.095  1.00 279.43 ? 1415 LEU B C     1 
ATOM   9391  O O     . LEU B 2 1423 ? 207.797 96.753  77.174  1.00 279.43 ? 1415 LEU B O     1 
ATOM   9392  C CB    . LEU B 2 1423 ? 205.558 94.680  78.432  1.00 279.43 ? 1415 LEU B CB    1 
ATOM   9393  N N     . HIS B 2 1424 ? 208.176 96.178  79.322  1.00 286.48 ? 1416 HIS B N     1 
ATOM   9394  C CA    . HIS B 2 1424 ? 208.953 97.380  79.616  1.00 286.48 ? 1416 HIS B CA    1 
ATOM   9395  C C     . HIS B 2 1424 ? 210.267 97.413  78.845  1.00 286.48 ? 1416 HIS B C     1 
ATOM   9396  O O     . HIS B 2 1424 ? 210.712 98.481  78.409  1.00 286.48 ? 1416 HIS B O     1 
ATOM   9397  C CB    . HIS B 2 1424 ? 209.213 97.477  81.120  1.00 286.48 ? 1416 HIS B CB    1 
ATOM   9398  N N     . THR B 2 1425 ? 210.924 96.259  78.707  1.00 293.29 ? 1417 THR B N     1 
ATOM   9399  C CA    . THR B 2 1425 ? 212.135 96.166  77.894  1.00 293.29 ? 1417 THR B CA    1 
ATOM   9400  C C     . THR B 2 1425 ? 211.849 96.396  76.415  1.00 293.29 ? 1417 THR B C     1 
ATOM   9401  O O     . THR B 2 1425 ? 212.624 97.071  75.727  1.00 293.29 ? 1417 THR B O     1 
ATOM   9402  C CB    . THR B 2 1425 ? 212.809 94.810  78.099  1.00 293.29 ? 1417 THR B CB    1 
ATOM   9403  N N     . LEU B 2 1426 ? 210.799 95.750  75.893  1.00 290.71 ? 1418 LEU B N     1 
ATOM   9404  C CA    . LEU B 2 1426 ? 210.298 96.004  74.541  1.00 290.71 ? 1418 LEU B CA    1 
ATOM   9405  C C     . LEU B 2 1426 ? 210.051 97.486  74.269  1.00 290.71 ? 1418 LEU B C     1 
ATOM   9406  O O     . LEU B 2 1426 ? 210.641 98.063  73.348  1.00 290.71 ? 1418 LEU B O     1 
ATOM   9407  C CB    . LEU B 2 1426 ? 209.016 95.201  74.312  1.00 290.71 ? 1418 LEU B CB    1 
ATOM   9408  N N     . ARG B 2 1427 ? 209.119 98.090  75.021  1.00 289.20 ? 1419 ARG B N     1 
ATOM   9409  C CA    . ARG B 2 1427 ? 208.780 99.502  74.839  1.00 289.20 ? 1419 ARG B CA    1 
ATOM   9410  C C     . ARG B 2 1427 ? 209.976 100.420 75.061  1.00 289.20 ? 1419 ARG B C     1 
ATOM   9411  O O     . ARG B 2 1427 ? 210.110 101.446 74.383  1.00 289.20 ? 1419 ARG B O     1 
ATOM   9412  C CB    . ARG B 2 1427 ? 207.636 99.883  75.778  1.00 289.20 ? 1419 ARG B CB    1 
ATOM   9413  N N     . SER B 2 1428 ? 210.840 100.087 76.029  1.00 288.01 ? 1420 SER B N     1 
ATOM   9414  C CA    . SER B 2 1428 ? 212.049 100.880 76.234  1.00 288.01 ? 1420 SER B CA    1 
ATOM   9415  C C     . SER B 2 1428 ? 213.015 100.742 75.065  1.00 288.01 ? 1420 SER B C     1 
ATOM   9416  O O     . SER B 2 1428 ? 213.777 101.673 74.779  1.00 288.01 ? 1420 SER B O     1 
ATOM   9417  C CB    . SER B 2 1428 ? 212.730 100.472 77.540  1.00 288.01 ? 1420 SER B CB    1 
ATOM   9418  N N     . ARG B 2 1429 ? 212.996 99.596  74.382  1.00 294.39 ? 1421 ARG B N     1 
ATOM   9419  C CA    . ARG B 2 1429 ? 213.844 99.350  73.225  1.00 294.39 ? 1421 ARG B CA    1 
ATOM   9420  C C     . ARG B 2 1429 ? 213.207 99.822  71.929  1.00 294.39 ? 1421 ARG B C     1 
ATOM   9421  O O     . ARG B 2 1429 ? 213.801 99.649  70.859  1.00 294.39 ? 1421 ARG B O     1 
ATOM   9422  C CB    . ARG B 2 1429 ? 214.177 97.858  73.122  1.00 294.39 ? 1421 ARG B CB    1 
ATOM   9423  N N     . LEU B 2 1430 ? 212.016 100.404 72.003  1.00 297.08 ? 1422 LEU B N     1 
ATOM   9424  C CA    . LEU B 2 1430 ? 211.304 100.924 70.848  1.00 297.08 ? 1422 LEU B CA    1 
ATOM   9425  C C     . LEU B 2 1430 ? 211.275 102.441 70.920  1.00 297.08 ? 1422 LEU B C     1 
ATOM   9426  O O     . LEU B 2 1430 ? 210.844 103.008 71.929  1.00 297.08 ? 1422 LEU B O     1 
ATOM   9427  C CB    . LEU B 2 1430 ? 209.882 100.365 70.787  1.00 297.08 ? 1422 LEU B CB    1 
ATOM   9428  N N     . SER B 2 1431 ? 211.737 103.095 69.862  1.00 304.03 ? 1423 SER B N     1 
ATOM   9429  C CA    . SER B 2 1431 ? 211.671 104.543 69.771  1.00 304.03 ? 1423 SER B CA    1 
ATOM   9430  C C     . SER B 2 1431 ? 210.435 104.936 68.976  1.00 304.03 ? 1423 SER B C     1 
ATOM   9431  O O     . SER B 2 1431 ? 210.092 104.290 67.981  1.00 304.03 ? 1423 SER B O     1 
ATOM   9432  C CB    . SER B 2 1431 ? 212.927 105.114 69.119  1.00 304.03 ? 1423 SER B CB    1 
ATOM   9433  N N     . ILE B 2 1432 ? 209.772 105.998 69.422  1.00 320.19 ? 1424 ILE B N     1 
ATOM   9434  C CA    . ILE B 2 1432 ? 208.608 106.556 68.746  1.00 320.19 ? 1424 ILE B CA    1 
ATOM   9435  C C     . ILE B 2 1432 ? 208.866 108.017 68.409  1.00 320.19 ? 1424 ILE B C     1 
ATOM   9436  O O     . ILE B 2 1432 ? 209.248 108.804 69.282  1.00 320.19 ? 1424 ILE B O     1 
ATOM   9437  C CB    . ILE B 2 1432 ? 207.339 106.422 69.604  1.00 320.19 ? 1424 ILE B CB    1 
ATOM   9438  N N     . ILE B 2 1433 ? 208.664 108.370 67.144  1.00 338.27 ? 1425 ILE B N     1 
ATOM   9439  C CA    . ILE B 2 1433 ? 208.643 109.759 66.707  1.00 338.27 ? 1425 ILE B CA    1 
ATOM   9440  C C     . ILE B 2 1433 ? 207.320 109.944 65.977  1.00 338.27 ? 1425 ILE B C     1 
ATOM   9441  O O     . ILE B 2 1433 ? 207.121 109.382 64.894  1.00 338.27 ? 1425 ILE B O     1 
ATOM   9442  C CB    . ILE B 2 1433 ? 209.830 110.110 65.801  1.00 338.27 ? 1425 ILE B CB    1 
ATOM   9443  N N     . LEU B 2 1434 ? 206.425 110.728 66.564  1.00 358.72 ? 1426 LEU B N     1 
ATOM   9444  C CA    . LEU B 2 1434 ? 205.158 111.104 65.955  1.00 358.72 ? 1426 LEU B CA    1 
ATOM   9445  C C     . LEU B 2 1434 ? 205.260 112.466 65.282  1.00 358.72 ? 1426 LEU B C     1 
ATOM   9446  O O     . LEU B 2 1434 ? 206.274 113.163 65.377  1.00 358.72 ? 1426 LEU B O     1 
ATOM   9447  C CB    . LEU B 2 1434 ? 204.040 111.115 67.004  1.00 358.72 ? 1426 LEU B CB    1 
ATOM   9448  N N     . GLN B 2 1435 ? 204.195 112.815 64.552  1.00 358.19 ? 1427 GLN B N     1 
ATOM   9449  C CA    . GLN B 2 1435 ? 204.095 114.147 63.963  1.00 358.19 ? 1427 GLN B CA    1 
ATOM   9450  C C     . GLN B 2 1435 ? 204.064 115.219 65.042  1.00 358.19 ? 1427 GLN B C     1 
ATOM   9451  O O     . GLN B 2 1435 ? 204.712 116.266 64.910  1.00 358.19 ? 1427 GLN B O     1 
ATOM   9452  C CB    . GLN B 2 1435 ? 202.850 114.246 63.083  1.00 358.19 ? 1427 GLN B CB    1 
ATOM   9453  N N     . ASP B 2 1436 ? 203.317 114.978 66.116  1.00 347.31 ? 1428 ASP B N     1 
ATOM   9454  C CA    . ASP B 2 1436 ? 203.242 115.929 67.214  1.00 347.31 ? 1428 ASP B CA    1 
ATOM   9455  C C     . ASP B 2 1436 ? 203.899 115.327 68.447  1.00 347.31 ? 1428 ASP B C     1 
ATOM   9456  O O     . ASP B 2 1436 ? 203.352 114.379 69.033  1.00 347.31 ? 1428 ASP B O     1 
ATOM   9457  C CB    . ASP B 2 1436 ? 201.787 116.297 67.512  1.00 347.31 ? 1428 ASP B CB    1 
ATOM   9458  N N     . PRO B 2 1437 ? 205.062 115.820 68.867  1.00 325.52 ? 1429 PRO B N     1 
ATOM   9459  C CA    . PRO B 2 1437 ? 205.756 115.211 70.008  1.00 325.52 ? 1429 PRO B CA    1 
ATOM   9460  C C     . PRO B 2 1437 ? 205.544 116.017 71.281  1.00 325.52 ? 1429 PRO B C     1 
ATOM   9461  O O     . PRO B 2 1437 ? 205.612 117.251 71.262  1.00 325.52 ? 1429 PRO B O     1 
ATOM   9462  C CB    . PRO B 2 1437 ? 207.225 115.203 69.566  1.00 325.52 ? 1429 PRO B CB    1 
ATOM   9463  C CG    . PRO B 2 1437 ? 207.332 116.371 68.679  1.00 325.52 ? 1429 PRO B CG    1 
ATOM   9464  C CD    . PRO B 2 1437 ? 206.011 116.487 67.958  1.00 325.52 ? 1429 PRO B CD    1 
ATOM   9465  N N     . VAL B 2 1438 ? 205.253 115.348 72.389  1.00 277.66 ? 1430 VAL B N     1 
ATOM   9466  C CA    . VAL B 2 1438 ? 205.096 116.034 73.663  1.00 277.66 ? 1430 VAL B CA    1 
ATOM   9467  C C     . VAL B 2 1438 ? 206.440 116.034 74.372  1.00 277.66 ? 1430 VAL B C     1 
ATOM   9468  O O     . VAL B 2 1438 ? 207.077 114.986 74.526  1.00 277.66 ? 1430 VAL B O     1 
ATOM   9469  C CB    . VAL B 2 1438 ? 204.017 115.357 74.525  1.00 277.66 ? 1430 VAL B CB    1 
ATOM   9470  N N     . LEU B 2 1439 ? 206.864 117.216 74.809  1.00 227.87 ? 1431 LEU B N     1 
ATOM   9471  C CA    . LEU B 2 1439 ? 208.123 117.416 75.504  1.00 227.87 ? 1431 LEU B CA    1 
ATOM   9472  C C     . LEU B 2 1439 ? 207.876 117.926 76.915  1.00 227.87 ? 1431 LEU B C     1 
ATOM   9473  O O     . LEU B 2 1439 ? 206.845 118.539 77.204  1.00 227.87 ? 1431 LEU B O     1 
ATOM   9474  C CB    . LEU B 2 1439 ? 209.024 118.404 74.750  1.00 227.87 ? 1431 LEU B CB    1 
ATOM   9475  N N     . PHE B 2 1440 ? 208.835 117.655 77.790  1.00 214.98 ? 1432 PHE B N     1 
ATOM   9476  C CA    . PHE B 2 1440 ? 208.757 118.101 79.170  1.00 214.98 ? 1432 PHE B CA    1 
ATOM   9477  C C     . PHE B 2 1440 ? 209.204 119.556 79.278  1.00 214.98 ? 1432 PHE B C     1 
ATOM   9478  O O     . PHE B 2 1440 ? 209.995 120.050 78.468  1.00 214.98 ? 1432 PHE B O     1 
ATOM   9479  C CB    . PHE B 2 1440 ? 209.616 117.217 80.073  1.00 214.98 ? 1432 PHE B CB    1 
ATOM   9480  N N     . SER B 2 1441 ? 208.684 120.244 80.297  1.00 215.31 ? 1433 SER B N     1 
ATOM   9481  C CA    . SER B 2 1441 ? 208.991 121.655 80.563  1.00 215.31 ? 1433 SER B CA    1 
ATOM   9482  C C     . SER B 2 1441 ? 210.351 121.819 81.251  1.00 215.31 ? 1433 SER B C     1 
ATOM   9483  O O     . SER B 2 1441 ? 210.481 122.412 82.322  1.00 215.31 ? 1433 SER B O     1 
ATOM   9484  C CB    . SER B 2 1441 ? 207.876 122.281 81.391  1.00 215.31 ? 1433 SER B CB    1 
ATOM   9485  N N     . GLY B 2 1442 ? 211.377 121.277 80.603  1.00 205.28 ? 1434 GLY B N     1 
ATOM   9486  C CA    . GLY B 2 1442 ? 212.738 121.254 81.095  1.00 205.28 ? 1434 GLY B CA    1 
ATOM   9487  C C     . GLY B 2 1442 ? 213.685 121.754 80.028  1.00 205.28 ? 1434 GLY B C     1 
ATOM   9488  O O     . GLY B 2 1442 ? 213.238 122.340 79.038  1.00 205.28 ? 1434 GLY B O     1 
ATOM   9489  N N     . THR B 2 1443 ? 214.989 121.579 80.246  1.00 214.05 ? 1435 THR B N     1 
ATOM   9490  C CA    . THR B 2 1443 ? 216.001 121.916 79.249  1.00 214.05 ? 1435 THR B CA    1 
ATOM   9491  C C     . THR B 2 1443 ? 215.779 121.134 77.955  1.00 214.05 ? 1435 THR B C     1 
ATOM   9492  O O     . THR B 2 1443 ? 215.163 120.063 77.955  1.00 214.05 ? 1435 THR B O     1 
ATOM   9493  C CB    . THR B 2 1443 ? 217.401 121.627 79.792  1.00 214.05 ? 1435 THR B CB    1 
ATOM   9494  N N     . ILE B 2 1444 ? 216.241 121.727 76.841  1.00 215.05 ? 1436 ILE B N     1 
ATOM   9495  C CA    . ILE B 2 1444 ? 216.311 121.027 75.554  1.00 215.05 ? 1436 ILE B CA    1 
ATOM   9496  C C     . ILE B 2 1444 ? 217.034 119.697 75.706  1.00 215.05 ? 1436 ILE B C     1 
ATOM   9497  O O     . ILE B 2 1444 ? 216.594 118.676 75.165  1.00 215.05 ? 1436 ILE B O     1 
ATOM   9498  C CB    . ILE B 2 1444 ? 216.986 121.915 74.493  1.00 215.05 ? 1436 ILE B CB    1 
ATOM   9499  N N     . ARG B 2 1445 ? 218.200 119.722 76.364  1.00 222.23 ? 1437 ARG B N     1 
ATOM   9500  C CA    . ARG B 2 1445 ? 218.949 118.498 76.648  1.00 222.23 ? 1437 ARG B CA    1 
ATOM   9501  C C     . ARG B 2 1445 ? 218.085 117.520 77.431  1.00 222.23 ? 1437 ARG B C     1 
ATOM   9502  O O     . ARG B 2 1445 ? 218.011 116.329 77.105  1.00 222.23 ? 1437 ARG B O     1 
ATOM   9503  C CB    . ARG B 2 1445 ? 220.230 118.817 77.420  1.00 222.23 ? 1437 ARG B CB    1 
ATOM   9504  N N     . PHE B 2 1446 ? 217.433 118.017 78.488  1.00 227.02 ? 1438 PHE B N     1 
ATOM   9505  C CA    . PHE B 2 1446 ? 216.555 117.189 79.302  1.00 227.02 ? 1438 PHE B CA    1 
ATOM   9506  C C     . PHE B 2 1446 ? 215.322 116.740 78.524  1.00 227.02 ? 1438 PHE B C     1 
ATOM   9507  O O     . PHE B 2 1446 ? 214.862 115.604 78.696  1.00 227.02 ? 1438 PHE B O     1 
ATOM   9508  C CB    . PHE B 2 1446 ? 216.141 117.953 80.560  1.00 227.02 ? 1438 PHE B CB    1 
ATOM   9509  N N     . ASN B 2 1447 ? 214.744 117.628 77.702  1.00 216.13 ? 1439 ASN B N     1 
ATOM   9510  C CA    . ASN B 2 1447 ? 213.667 117.208 76.807  1.00 216.13 ? 1439 ASN B CA    1 
ATOM   9511  C C     . ASN B 2 1447 ? 214.138 116.163 75.803  1.00 216.13 ? 1439 ASN B C     1 
ATOM   9512  O O     . ASN B 2 1447 ? 213.358 115.292 75.401  1.00 216.13 ? 1439 ASN B O     1 
ATOM   9513  C CB    . ASN B 2 1447 ? 213.084 118.415 76.071  1.00 216.13 ? 1439 ASN B CB    1 
ATOM   9514  N N     . LEU B 2 1448 ? 215.401 116.228 75.392  1.00 230.56 ? 1440 LEU B N     1 
ATOM   9515  C CA    . LEU B 2 1448 ? 215.987 115.222 74.523  1.00 230.56 ? 1440 LEU B CA    1 
ATOM   9516  C C     . LEU B 2 1448 ? 216.665 114.104 75.297  1.00 230.56 ? 1440 LEU B C     1 
ATOM   9517  O O     . LEU B 2 1448 ? 217.414 113.326 74.699  1.00 230.56 ? 1440 LEU B O     1 
ATOM   9518  C CB    . LEU B 2 1448 ? 216.990 115.864 73.562  1.00 230.56 ? 1440 LEU B CB    1 
ATOM   9519  N N     . ASP B 2 1449 ? 216.428 113.995 76.607  1.00 249.24 ? 1441 ASP B N     1 
ATOM   9520  C CA    . ASP B 2 1449 ? 216.770 112.742 77.272  1.00 249.24 ? 1441 ASP B CA    1 
ATOM   9521  C C     . ASP B 2 1449 ? 215.615 111.870 77.763  1.00 249.24 ? 1441 ASP B C     1 
ATOM   9522  O O     . ASP B 2 1449 ? 215.305 111.895 78.961  1.00 249.24 ? 1441 ASP B O     1 
ATOM   9523  C CB    . ASP B 2 1449 ? 217.689 113.040 78.461  1.00 249.24 ? 1441 ASP B CB    1 
ATOM   9524  N N     . PRO B 2 1450 ? 214.958 111.086 76.902  1.00 268.74 ? 1442 PRO B N     1 
ATOM   9525  C CA    . PRO B 2 1450 ? 214.247 109.894 77.383  1.00 268.74 ? 1442 PRO B CA    1 
ATOM   9526  C C     . PRO B 2 1450 ? 215.146 108.676 77.522  1.00 268.74 ? 1442 PRO B C     1 
ATOM   9527  O O     . PRO B 2 1450 ? 214.645 107.571 77.745  1.00 268.74 ? 1442 PRO B O     1 
ATOM   9528  C CB    . PRO B 2 1450 ? 213.184 109.652 76.297  1.00 268.74 ? 1442 PRO B CB    1 
ATOM   9529  C CG    . PRO B 2 1450 ? 213.031 110.924 75.593  1.00 268.74 ? 1442 PRO B CG    1 
ATOM   9530  C CD    . PRO B 2 1450 ? 214.378 111.570 75.638  1.00 268.74 ? 1442 PRO B CD    1 
ATOM   9531  N N     . GLU B 2 1451 ? 216.456 108.895 77.381  1.00 315.66 ? 1443 GLU B N     1 
ATOM   9532  C CA    . GLU B 2 1451 ? 217.537 107.913 77.467  1.00 315.66 ? 1443 GLU B CA    1 
ATOM   9533  C C     . GLU B 2 1451 ? 218.541 108.567 78.408  1.00 315.66 ? 1443 GLU B C     1 
ATOM   9534  O O     . GLU B 2 1451 ? 219.544 109.127 77.962  1.00 315.66 ? 1443 GLU B O     1 
ATOM   9535  C CB    . GLU B 2 1451 ? 218.133 107.596 76.101  1.00 315.66 ? 1443 GLU B CB    1 
ATOM   9536  N N     . LYS B 2 1452 ? 218.229 108.516 79.709  1.00 339.28 ? 1444 LYS B N     1 
ATOM   9537  C CA    . LYS B 2 1452 ? 218.860 109.336 80.743  1.00 339.28 ? 1444 LYS B CA    1 
ATOM   9538  C C     . LYS B 2 1452 ? 220.376 109.179 80.863  1.00 339.28 ? 1444 LYS B C     1 
ATOM   9539  O O     . LYS B 2 1452 ? 221.021 110.068 81.430  1.00 339.28 ? 1444 LYS B O     1 
ATOM   9540  C CB    . LYS B 2 1452 ? 218.215 109.028 82.096  1.00 339.28 ? 1444 LYS B CB    1 
ATOM   9541  N N     . LYS B 2 1453 ? 220.978 108.102 80.354  1.00 370.53 ? 1445 LYS B N     1 
ATOM   9542  C CA    . LYS B 2 1453 ? 222.428 108.008 80.471  1.00 370.53 ? 1445 LYS B CA    1 
ATOM   9543  C C     . LYS B 2 1453 ? 223.172 108.573 79.266  1.00 370.53 ? 1445 LYS B C     1 
ATOM   9544  O O     . LYS B 2 1453 ? 224.404 108.473 79.229  1.00 370.53 ? 1445 LYS B O     1 
ATOM   9545  C CB    . LYS B 2 1453 ? 222.846 106.552 80.687  1.00 370.53 ? 1445 LYS B CB    1 
ATOM   9546  N N     . CYS B 2 1454 ? 222.458 109.095 78.263  1.00 412.81 ? 1446 CYS B N     1 
ATOM   9547  C CA    . CYS B 2 1454 ? 223.087 109.703 77.094  1.00 412.81 ? 1446 CYS B CA    1 
ATOM   9548  C C     . CYS B 2 1454 ? 223.916 110.906 77.529  1.00 412.81 ? 1446 CYS B C     1 
ATOM   9549  O O     . CYS B 2 1454 ? 223.457 111.719 78.337  1.00 412.81 ? 1446 CYS B O     1 
ATOM   9550  C CB    . CYS B 2 1454 ? 222.034 110.122 76.069  1.00 412.81 ? 1446 CYS B CB    1 
ATOM   9551  N N     . SER B 2 1455 ? 225.134 111.034 77.012  1.00 493.97 ? 1447 SER B N     1 
ATOM   9552  C CA    . SER B 2 1455 ? 225.859 112.268 77.275  1.00 493.97 ? 1447 SER B CA    1 
ATOM   9553  C C     . SER B 2 1455 ? 225.352 113.388 76.372  1.00 493.97 ? 1447 SER B C     1 
ATOM   9554  O O     . SER B 2 1455 ? 224.772 113.142 75.309  1.00 493.97 ? 1447 SER B O     1 
ATOM   9555  C CB    . SER B 2 1455 ? 227.360 112.068 77.067  1.00 493.97 ? 1447 SER B CB    1 
ATOM   9556  O OG    . SER B 2 1455 ? 227.665 111.909 75.694  1.00 493.97 ? 1447 SER B OG    1 
ATOM   9557  N N     . ASP B 2 1456 ? 225.519 114.627 76.854  1.00 520.18 ? 1448 ASP B N     1 
ATOM   9558  C CA    . ASP B 2 1456 ? 225.167 115.823 76.087  1.00 520.18 ? 1448 ASP B CA    1 
ATOM   9559  C C     . ASP B 2 1456 ? 225.868 115.885 74.731  1.00 520.18 ? 1448 ASP B C     1 
ATOM   9560  O O     . ASP B 2 1456 ? 225.276 116.325 73.738  1.00 520.18 ? 1448 ASP B O     1 
ATOM   9561  C CB    . ASP B 2 1456 ? 225.487 117.072 76.907  1.00 520.18 ? 1448 ASP B CB    1 
ATOM   9562  N N     . SER B 2 1457 ? 227.141 115.478 74.683  1.00 533.23 ? 1449 SER B N     1 
ATOM   9563  C CA    . SER B 2 1457 ? 227.890 115.418 73.429  1.00 533.23 ? 1449 SER B CA    1 
ATOM   9564  C C     . SER B 2 1457 ? 227.309 114.409 72.448  1.00 533.23 ? 1449 SER B C     1 
ATOM   9565  O O     . SER B 2 1457 ? 227.208 114.686 71.248  1.00 533.23 ? 1449 SER B O     1 
ATOM   9566  C CB    . SER B 2 1457 ? 229.355 115.095 73.715  1.00 533.23 ? 1449 SER B CB    1 
ATOM   9567  N N     . THR B 2 1458 ? 226.989 113.205 72.927  1.00 534.72 ? 1450 THR B N     1 
ATOM   9568  C CA    . THR B 2 1458 ? 226.364 112.193 72.075  1.00 534.72 ? 1450 THR B CA    1 
ATOM   9569  C C     . THR B 2 1458 ? 224.983 112.619 71.586  1.00 534.72 ? 1450 THR B C     1 
ATOM   9570  O O     . THR B 2 1458 ? 224.599 112.308 70.452  1.00 534.72 ? 1450 THR B O     1 
ATOM   9571  C CB    . THR B 2 1458 ? 226.274 110.861 72.822  1.00 534.72 ? 1450 THR B CB    1 
ATOM   9572  N N     . LEU B 2 1459 ? 224.197 113.267 72.450  1.00 525.93 ? 1451 LEU B N     1 
ATOM   9573  C CA    . LEU B 2 1459 ? 222.901 113.807 72.037  1.00 525.93 ? 1451 LEU B CA    1 
ATOM   9574  C C     . LEU B 2 1459 ? 223.035 114.900 70.977  1.00 525.93 ? 1451 LEU B C     1 
ATOM   9575  O O     . LEU B 2 1459 ? 222.331 114.878 69.961  1.00 525.93 ? 1451 LEU B O     1 
ATOM   9576  C CB    . LEU B 2 1459 ? 222.155 114.337 73.261  1.00 525.93 ? 1451 LEU B CB    1 
ATOM   9577  N N     . TRP B 2 1460 ? 223.898 115.891 71.230  1.00 509.68 ? 1452 TRP B N     1 
ATOM   9578  C CA    . TRP B 2 1460 ? 224.118 116.995 70.293  1.00 509.68 ? 1452 TRP B CA    1 
ATOM   9579  C C     . TRP B 2 1460 ? 224.680 116.492 68.960  1.00 509.68 ? 1452 TRP B C     1 
ATOM   9580  O O     . TRP B 2 1460 ? 224.266 116.943 67.883  1.00 509.68 ? 1452 TRP B O     1 
ATOM   9581  C CB    . TRP B 2 1460 ? 225.044 118.010 70.965  1.00 509.68 ? 1452 TRP B CB    1 
ATOM   9582  C CG    . TRP B 2 1460 ? 225.377 119.253 70.208  1.00 509.68 ? 1452 TRP B CG    1 
ATOM   9583  C CD1   . TRP B 2 1460 ? 224.617 120.381 70.138  1.00 509.68 ? 1452 TRP B CD1   1 
ATOM   9584  C CD2   . TRP B 2 1460 ? 226.573 119.531 69.472  1.00 509.68 ? 1452 TRP B CD2   1 
ATOM   9585  N NE1   . TRP B 2 1460 ? 225.248 121.336 69.385  1.00 509.68 ? 1452 TRP B NE1   1 
ATOM   9586  C CE2   . TRP B 2 1460 ? 226.453 120.840 68.963  1.00 509.68 ? 1452 TRP B CE2   1 
ATOM   9587  C CE3   . TRP B 2 1460 ? 227.726 118.798 69.181  1.00 509.68 ? 1452 TRP B CE3   1 
ATOM   9588  C CZ2   . TRP B 2 1460 ? 227.437 121.430 68.181  1.00 509.68 ? 1452 TRP B CZ2   1 
ATOM   9589  C CZ3   . TRP B 2 1460 ? 228.708 119.387 68.403  1.00 509.68 ? 1452 TRP B CZ3   1 
ATOM   9590  C CH2   . TRP B 2 1460 ? 228.556 120.691 67.911  1.00 509.68 ? 1452 TRP B CH2   1 
ATOM   9591  N N     . GLU B 2 1461 ? 225.638 115.560 69.034  1.00 505.34 ? 1453 GLU B N     1 
ATOM   9592  C CA    . GLU B 2 1461 ? 226.187 114.873 67.865  1.00 505.34 ? 1453 GLU B CA    1 
ATOM   9593  C C     . GLU B 2 1461 ? 225.106 114.120 67.102  1.00 505.34 ? 1453 GLU B C     1 
ATOM   9594  O O     . GLU B 2 1461 ? 225.100 114.109 65.866  1.00 505.34 ? 1453 GLU B O     1 
ATOM   9595  C CB    . GLU B 2 1461 ? 227.302 113.923 68.300  1.00 505.34 ? 1453 GLU B CB    1 
ATOM   9596  N N     . ALA B 2 1462 ? 224.248 113.404 67.832  1.00 479.47 ? 1454 ALA B N     1 
ATOM   9597  C CA    . ALA B 2 1462 ? 223.101 112.712 67.247  1.00 479.47 ? 1454 ALA B CA    1 
ATOM   9598  C C     . ALA B 2 1462 ? 222.177 113.680 66.518  1.00 479.47 ? 1454 ALA B C     1 
ATOM   9599  O O     . ALA B 2 1462 ? 221.652 113.358 65.447  1.00 479.47 ? 1454 ALA B O     1 
ATOM   9600  C CB    . ALA B 2 1462 ? 222.337 111.953 68.333  1.00 479.47 ? 1454 ALA B CB    1 
ATOM   9601  N N     . LEU B 2 1463 ? 221.963 114.870 67.089  1.00 462.91 ? 1455 LEU B N     1 
ATOM   9602  C CA    . LEU B 2 1463 ? 221.208 115.912 66.400  1.00 462.91 ? 1455 LEU B CA    1 
ATOM   9603  C C     . LEU B 2 1463 ? 221.933 116.409 65.154  1.00 462.91 ? 1455 LEU B C     1 
ATOM   9604  O O     . LEU B 2 1463 ? 221.277 116.843 64.200  1.00 462.91 ? 1455 LEU B O     1 
ATOM   9605  C CB    . LEU B 2 1463 ? 220.928 117.076 67.349  1.00 462.91 ? 1455 LEU B CB    1 
ATOM   9606  N N     . GLU B 2 1464 ? 223.271 116.398 65.155  1.00 464.11 ? 1456 GLU B N     1 
ATOM   9607  C CA    . GLU B 2 1464 ? 224.004 116.705 63.925  1.00 464.11 ? 1456 GLU B CA    1 
ATOM   9608  C C     . GLU B 2 1464 ? 223.761 115.634 62.867  1.00 464.11 ? 1456 GLU B C     1 
ATOM   9609  O O     . GLU B 2 1464 ? 223.533 115.952 61.693  1.00 464.11 ? 1456 GLU B O     1 
ATOM   9610  C CB    . GLU B 2 1464 ? 225.496 116.867 64.216  1.00 464.11 ? 1456 GLU B CB    1 
ATOM   9611  N N     . ILE B 2 1465 ? 223.883 114.359 63.258  1.00 464.48 ? 1457 ILE B N     1 
ATOM   9612  C CA    . ILE B 2 1465 ? 223.588 113.233 62.371  1.00 464.48 ? 1457 ILE B CA    1 
ATOM   9613  C C     . ILE B 2 1465 ? 222.143 113.296 61.885  1.00 464.48 ? 1457 ILE B C     1 
ATOM   9614  O O     . ILE B 2 1465 ? 221.854 113.058 60.706  1.00 464.48 ? 1457 ILE B O     1 
ATOM   9615  C CB    . ILE B 2 1465 ? 223.891 111.899 63.078  1.00 464.48 ? 1457 ILE B CB    1 
ATOM   9616  N N     . ALA B 2 1466 ? 221.217 113.618 62.787  1.00 445.73 ? 1458 ALA B N     1 
ATOM   9617  C CA    . ALA B 2 1466 ? 219.788 113.746 62.505  1.00 445.73 ? 1458 ALA B CA    1 
ATOM   9618  C C     . ALA B 2 1466 ? 219.402 115.201 62.272  1.00 445.73 ? 1458 ALA B C     1 
ATOM   9619  O O     . ALA B 2 1466 ? 218.318 115.626 62.685  1.00 445.73 ? 1458 ALA B O     1 
ATOM   9620  C CB    . ALA B 2 1466 ? 218.951 113.145 63.630  1.00 445.73 ? 1458 ALA B CB    1 
ATOM   9621  N N     . GLN B 2 1467 ? 220.299 115.947 61.600  1.00 430.71 ? 1459 GLN B N     1 
ATOM   9622  C CA    . GLN B 2 1467 ? 220.094 117.240 60.932  1.00 430.71 ? 1459 GLN B CA    1 
ATOM   9623  C C     . GLN B 2 1467 ? 219.258 118.255 61.707  1.00 430.71 ? 1459 GLN B C     1 
ATOM   9624  O O     . GLN B 2 1467 ? 218.494 119.034 61.129  1.00 430.71 ? 1459 GLN B O     1 
ATOM   9625  C CB    . GLN B 2 1467 ? 219.454 117.008 59.561  1.00 430.71 ? 1459 GLN B CB    1 
ATOM   9626  N N     . LEU B 2 1468 ? 219.425 118.239 63.028  1.00 423.42 ? 1460 LEU B N     1 
ATOM   9627  C CA    . LEU B 2 1468 ? 218.702 119.079 63.968  1.00 423.42 ? 1460 LEU B CA    1 
ATOM   9628  C C     . LEU B 2 1468 ? 219.612 120.068 64.675  1.00 423.42 ? 1460 LEU B C     1 
ATOM   9629  O O     . LEU B 2 1468 ? 219.106 121.020 65.273  1.00 423.42 ? 1460 LEU B O     1 
ATOM   9630  C CB    . LEU B 2 1468 ? 217.982 118.219 65.015  1.00 423.42 ? 1460 LEU B CB    1 
ATOM   9631  N N     . LYS B 2 1469 ? 220.927 119.812 64.663  1.00 439.43 ? 1461 LYS B N     1 
ATOM   9632  C CA    . LYS B 2 1469 ? 221.938 120.627 65.341  1.00 439.43 ? 1461 LYS B CA    1 
ATOM   9633  C C     . LYS B 2 1469 ? 221.892 122.108 64.983  1.00 439.43 ? 1461 LYS B C     1 
ATOM   9634  O O     . LYS B 2 1469 ? 222.283 122.939 65.805  1.00 439.43 ? 1461 LYS B O     1 
ATOM   9635  C CB    . LYS B 2 1469 ? 223.335 120.093 65.041  1.00 439.43 ? 1461 LYS B CB    1 
ATOM   9636  N N     . LEU B 2 1470 ? 221.557 122.450 63.735  1.00 442.43 ? 1462 LEU B N     1 
ATOM   9637  C CA    . LEU B 2 1470 ? 221.461 123.858 63.346  1.00 442.43 ? 1462 LEU B CA    1 
ATOM   9638  C C     . LEU B 2 1470 ? 220.370 124.585 64.132  1.00 442.43 ? 1462 LEU B C     1 
ATOM   9639  O O     . LEU B 2 1470 ? 220.616 125.645 64.726  1.00 442.43 ? 1462 LEU B O     1 
ATOM   9640  C CB    . LEU B 2 1470 ? 221.205 123.966 61.843  1.00 442.43 ? 1462 LEU B CB    1 
ATOM   9641  N N     . VAL B 2 1471 ? 219.163 124.013 64.176  1.00 434.23 ? 1463 VAL B N     1 
ATOM   9642  C CA    . VAL B 2 1471 ? 218.085 124.668 64.909  1.00 434.23 ? 1463 VAL B CA    1 
ATOM   9643  C C     . VAL B 2 1471 ? 218.274 124.491 66.409  1.00 434.23 ? 1463 VAL B C     1 
ATOM   9644  O O     . VAL B 2 1471 ? 217.755 125.291 67.200  1.00 434.23 ? 1463 VAL B O     1 
ATOM   9645  C CB    . VAL B 2 1471 ? 216.719 124.128 64.450  1.00 434.23 ? 1463 VAL B CB    1 
ATOM   9646  N N     . VAL B 2 1472 ? 218.972 123.426 66.822  1.00 432.68 ? 1464 VAL B N     1 
ATOM   9647  C CA    . VAL B 2 1472 ? 219.364 123.263 68.221  1.00 432.68 ? 1464 VAL B CA    1 
ATOM   9648  C C     . VAL B 2 1472 ? 220.303 124.387 68.633  1.00 432.68 ? 1464 VAL B C     1 
ATOM   9649  O O     . VAL B 2 1472 ? 220.135 125.008 69.687  1.00 432.68 ? 1464 VAL B O     1 
ATOM   9650  C CB    . VAL B 2 1472 ? 220.009 121.883 68.440  1.00 432.68 ? 1464 VAL B CB    1 
ATOM   9651  N N     . LYS B 2 1473 ? 221.325 124.637 67.809  1.00 420.21 ? 1465 LYS B N     1 
ATOM   9652  C CA    . LYS B 2 1473 ? 222.286 125.705 68.050  1.00 420.21 ? 1465 LYS B CA    1 
ATOM   9653  C C     . LYS B 2 1473 ? 221.626 127.077 68.015  1.00 420.21 ? 1465 LYS B C     1 
ATOM   9654  O O     . LYS B 2 1473 ? 222.096 128.005 68.683  1.00 420.21 ? 1465 LYS B O     1 
ATOM   9655  C CB    . LYS B 2 1473 ? 223.415 125.634 67.022  1.00 420.21 ? 1465 LYS B CB    1 
ATOM   9656  N N     . ALA B 2 1474 ? 220.548 127.232 67.245  1.00 397.39 ? 1466 ALA B N     1 
ATOM   9657  C CA    . ALA B 2 1474 ? 219.882 128.523 67.165  1.00 397.39 ? 1466 ALA B CA    1 
ATOM   9658  C C     . ALA B 2 1474 ? 218.731 128.661 68.153  1.00 397.39 ? 1466 ALA B C     1 
ATOM   9659  O O     . ALA B 2 1474 ? 218.049 129.691 68.141  1.00 397.39 ? 1466 ALA B O     1 
ATOM   9660  C CB    . ALA B 2 1474 ? 219.369 128.765 65.740  1.00 397.39 ? 1466 ALA B CB    1 
ATOM   9661  N N     . LEU B 2 1475 ? 218.488 127.654 68.993  1.00 366.87 ? 1467 LEU B N     1 
ATOM   9662  C CA    . LEU B 2 1475 ? 217.757 127.875 70.231  1.00 366.87 ? 1467 LEU B CA    1 
ATOM   9663  C C     . LEU B 2 1475 ? 218.560 128.775 71.176  1.00 366.87 ? 1467 LEU B C     1 
ATOM   9664  O O     . LEU B 2 1475 ? 219.792 128.783 71.116  1.00 366.87 ? 1467 LEU B O     1 
ATOM   9665  C CB    . LEU B 2 1475 ? 217.464 126.532 70.901  1.00 366.87 ? 1467 LEU B CB    1 
ATOM   9666  N N     . PRO B 2 1476 ? 217.869 129.599 71.998  1.00 321.69 ? 1468 PRO B N     1 
ATOM   9667  C CA    . PRO B 2 1476 ? 218.565 130.629 72.810  1.00 321.69 ? 1468 PRO B CA    1 
ATOM   9668  C C     . PRO B 2 1476 ? 219.670 130.118 73.728  1.00 321.69 ? 1468 PRO B C     1 
ATOM   9669  O O     . PRO B 2 1476 ? 220.714 130.767 73.856  1.00 321.69 ? 1468 PRO B O     1 
ATOM   9670  C CB    . PRO B 2 1476 ? 217.423 131.257 73.617  1.00 321.69 ? 1468 PRO B CB    1 
ATOM   9671  C CG    . PRO B 2 1476 ? 216.230 131.077 72.774  1.00 321.69 ? 1468 PRO B CG    1 
ATOM   9672  C CD    . PRO B 2 1476 ? 216.404 129.751 72.091  1.00 321.69 ? 1468 PRO B CD    1 
ATOM   9673  N N     . GLY B 2 1477 ? 219.462 128.971 74.371  1.00 285.55 ? 1469 GLY B N     1 
ATOM   9674  C CA    . GLY B 2 1477 ? 220.482 128.355 75.200  1.00 285.55 ? 1469 GLY B CA    1 
ATOM   9675  C C     . GLY B 2 1477 ? 221.088 127.093 74.624  1.00 285.55 ? 1469 GLY B C     1 
ATOM   9676  O O     . GLY B 2 1477 ? 221.793 126.365 75.332  1.00 285.55 ? 1469 GLY B O     1 
ATOM   9677  N N     . GLY B 2 1478 ? 220.871 126.870 73.331  1.00 291.83 ? 1470 GLY B N     1 
ATOM   9678  C CA    . GLY B 2 1478 ? 221.271 125.637 72.667  1.00 291.83 ? 1470 GLY B CA    1 
ATOM   9679  C C     . GLY B 2 1478 ? 220.687 124.401 73.331  1.00 291.83 ? 1470 GLY B C     1 
ATOM   9680  O O     . GLY B 2 1478 ? 219.466 124.265 73.470  1.00 291.83 ? 1470 GLY B O     1 
ATOM   9681  N N     . LEU B 2 1479 ? 221.561 123.473 73.740  1.00 262.27 ? 1471 LEU B N     1 
ATOM   9682  C CA    . LEU B 2 1479 ? 221.115 122.289 74.470  1.00 262.27 ? 1471 LEU B CA    1 
ATOM   9683  C C     . LEU B 2 1479 ? 220.569 122.624 75.853  1.00 262.27 ? 1471 LEU B C     1 
ATOM   9684  O O     . LEU B 2 1479 ? 219.761 121.860 76.387  1.00 262.27 ? 1471 LEU B O     1 
ATOM   9685  C CB    . LEU B 2 1479 ? 222.261 121.283 74.594  1.00 262.27 ? 1471 LEU B CB    1 
ATOM   9686  N N     . ASP B 2 1480 ? 220.956 123.758 76.422  1.00 255.23 ? 1472 ASP B N     1 
ATOM   9687  C CA    . ASP B 2 1480 ? 220.517 124.148 77.752  1.00 255.23 ? 1472 ASP B CA    1 
ATOM   9688  C C     . ASP B 2 1480 ? 219.288 125.043 77.715  1.00 255.23 ? 1472 ASP B C     1 
ATOM   9689  O O     . ASP B 2 1480 ? 218.876 125.549 78.763  1.00 255.23 ? 1472 ASP B O     1 
ATOM   9690  C CB    . ASP B 2 1480 ? 221.651 124.857 78.496  1.00 255.23 ? 1472 ASP B CB    1 
ATOM   9691  N N     . ALA B 2 1481 ? 218.725 125.269 76.528  1.00 251.44 ? 1473 ALA B N     1 
ATOM   9692  C CA    . ALA B 2 1481 ? 217.478 126.006 76.386  1.00 251.44 ? 1473 ALA B CA    1 
ATOM   9693  C C     . ALA B 2 1481 ? 216.334 125.278 77.076  1.00 251.44 ? 1473 ALA B C     1 
ATOM   9694  O O     . ALA B 2 1481 ? 216.037 124.124 76.758  1.00 251.44 ? 1473 ALA B O     1 
ATOM   9695  C CB    . ALA B 2 1481 ? 217.159 126.215 74.906  1.00 251.44 ? 1473 ALA B CB    1 
ATOM   9696  N N     . ILE B 2 1482 ? 215.698 125.958 78.026  1.00 230.10 ? 1474 ILE B N     1 
ATOM   9697  C CA    . ILE B 2 1482 ? 214.527 125.417 78.701  1.00 230.10 ? 1474 ILE B CA    1 
ATOM   9698  C C     . ILE B 2 1482 ? 213.368 125.374 77.714  1.00 230.10 ? 1474 ILE B C     1 
ATOM   9699  O O     . ILE B 2 1482 ? 212.953 126.407 77.174  1.00 230.10 ? 1474 ILE B O     1 
ATOM   9700  C CB    . ILE B 2 1482 ? 214.175 126.246 79.941  1.00 230.10 ? 1474 ILE B CB    1 
ATOM   9701  N N     . ILE B 2 1483 ? 212.841 124.175 77.472  1.00 219.94 ? 1475 ILE B N     1 
ATOM   9702  C CA    . ILE B 2 1483 ? 211.639 123.995 76.665  1.00 219.94 ? 1475 ILE B CA    1 
ATOM   9703  C C     . ILE B 2 1483 ? 210.400 124.390 77.459  1.00 219.94 ? 1475 ILE B C     1 
ATOM   9704  O O     . ILE B 2 1483 ? 209.605 123.532 77.856  1.00 219.94 ? 1475 ILE B O     1 
ATOM   9705  C CB    . ILE B 2 1483 ? 211.522 122.543 76.168  1.00 219.94 ? 1475 ILE B CB    1 
ATOM   9706  N N     . THR B 2 1484 ? 210.270 125.688 77.735  1.00 212.66 ? 1476 THR B N     1 
ATOM   9707  C CA    . THR B 2 1484 ? 209.102 126.239 78.406  1.00 212.66 ? 1476 THR B CA    1 
ATOM   9708  C C     . THR B 2 1484 ? 207.835 125.988 77.599  1.00 212.66 ? 1476 THR B C     1 
ATOM   9709  O O     . THR B 2 1484 ? 207.862 125.937 76.365  1.00 212.66 ? 1476 THR B O     1 
ATOM   9710  C CB    . THR B 2 1484 ? 209.277 127.742 78.631  1.00 212.66 ? 1476 THR B CB    1 
ATOM   9711  N N     . GLU B 2 1485 ? 206.732 125.769 78.330  1.00 223.13 ? 1477 GLU B N     1 
ATOM   9712  C CA    . GLU B 2 1485 ? 205.413 125.403 77.792  1.00 223.13 ? 1477 GLU B CA    1 
ATOM   9713  C C     . GLU B 2 1485 ? 205.438 124.069 77.047  1.00 223.13 ? 1477 GLU B C     1 
ATOM   9714  O O     . GLU B 2 1485 ? 204.640 123.852 76.130  1.00 223.13 ? 1477 GLU B O     1 
ATOM   9715  C CB    . GLU B 2 1485 ? 204.811 126.510 76.913  1.00 223.13 ? 1477 GLU B CB    1 
ATOM   9716  N N     . GLY B 2 1486 ? 206.331 123.163 77.446  1.00 237.85 ? 1478 GLY B N     1 
ATOM   9717  C CA    . GLY B 2 1486 ? 206.375 121.833 76.862  1.00 237.85 ? 1478 GLY B CA    1 
ATOM   9718  C C     . GLY B 2 1486 ? 206.737 121.752 75.395  1.00 237.85 ? 1478 GLY B C     1 
ATOM   9719  O O     . GLY B 2 1486 ? 206.452 120.736 74.758  1.00 237.85 ? 1478 GLY B O     1 
ATOM   9720  N N     . GLY B 2 1487 ? 207.358 122.780 74.836  1.00 272.57 ? 1479 GLY B N     1 
ATOM   9721  C CA    . GLY B 2 1487 ? 207.880 122.713 73.493  1.00 272.57 ? 1479 GLY B CA    1 
ATOM   9722  C C     . GLY B 2 1487 ? 207.178 123.585 72.468  1.00 272.57 ? 1479 GLY B C     1 
ATOM   9723  O O     . GLY B 2 1487 ? 207.350 123.350 71.265  1.00 272.57 ? 1479 GLY B O     1 
ATOM   9724  N N     . GLU B 2 1488 ? 206.397 124.571 72.902  1.00 279.84 ? 1480 GLU B N     1 
ATOM   9725  C CA    . GLU B 2 1488 ? 205.566 125.381 72.022  1.00 279.84 ? 1480 GLU B CA    1 
ATOM   9726  C C     . GLU B 2 1488 ? 206.319 126.533 71.368  1.00 279.84 ? 1480 GLU B C     1 
ATOM   9727  O O     . GLU B 2 1488 ? 205.781 127.148 70.440  1.00 279.84 ? 1480 GLU B O     1 
ATOM   9728  C CB    . GLU B 2 1488 ? 204.368 125.933 72.798  1.00 279.84 ? 1480 GLU B CB    1 
ATOM   9729  N N     . ASN B 2 1489 ? 207.535 126.844 71.818  1.00 293.57 ? 1481 ASN B N     1 
ATOM   9730  C CA    . ASN B 2 1489 ? 208.358 127.822 71.116  1.00 293.57 ? 1481 ASN B CA    1 
ATOM   9731  C C     . ASN B 2 1489 ? 209.087 127.245 69.907  1.00 293.57 ? 1481 ASN B C     1 
ATOM   9732  O O     . ASN B 2 1489 ? 209.628 128.017 69.109  1.00 293.57 ? 1481 ASN B O     1 
ATOM   9733  C CB    . ASN B 2 1489 ? 209.377 128.440 72.078  1.00 293.57 ? 1481 ASN B CB    1 
ATOM   9734  N N     . PHE B 2 1490 ? 209.117 125.926 69.748  1.00 292.61 ? 1482 PHE B N     1 
ATOM   9735  C CA    . PHE B 2 1490 ? 209.633 125.312 68.534  1.00 292.61 ? 1482 PHE B CA    1 
ATOM   9736  C C     . PHE B 2 1490 ? 208.499 125.170 67.526  1.00 292.61 ? 1482 PHE B C     1 
ATOM   9737  O O     . PHE B 2 1490 ? 207.330 125.053 67.899  1.00 292.61 ? 1482 PHE B O     1 
ATOM   9738  C CB    . PHE B 2 1490 ? 210.254 123.945 68.829  1.00 292.61 ? 1482 PHE B CB    1 
ATOM   9739  N N     . SER B 2 1491 ? 208.848 125.194 66.240  1.00 285.35 ? 1483 SER B N     1 
ATOM   9740  C CA    . SER B 2 1491 ? 207.855 124.876 65.226  1.00 285.35 ? 1483 SER B CA    1 
ATOM   9741  C C     . SER B 2 1491 ? 207.484 123.391 65.261  1.00 285.35 ? 1483 SER B C     1 
ATOM   9742  O O     . SER B 2 1491 ? 208.135 122.570 65.918  1.00 285.35 ? 1483 SER B O     1 
ATOM   9743  C CB    . SER B 2 1491 ? 208.375 125.246 63.839  1.00 285.35 ? 1483 SER B CB    1 
ATOM   9744  O OG    . SER B 2 1491 ? 209.373 124.331 63.417  1.00 285.35 ? 1483 SER B OG    1 
ATOM   9745  N N     . GLN B 2 1492 ? 206.397 123.065 64.546  1.00 260.84 ? 1484 GLN B N     1 
ATOM   9746  C CA    . GLN B 2 1492 ? 206.013 121.671 64.326  1.00 260.84 ? 1484 GLN B CA    1 
ATOM   9747  C C     . GLN B 2 1492 ? 207.117 120.883 63.633  1.00 260.84 ? 1484 GLN B C     1 
ATOM   9748  O O     . GLN B 2 1492 ? 207.373 119.722 63.974  1.00 260.84 ? 1484 GLN B O     1 
ATOM   9749  C CB    . GLN B 2 1492 ? 204.718 121.608 63.515  1.00 260.84 ? 1484 GLN B CB    1 
ATOM   9750  N N     . GLY B 2 1493 ? 207.775 121.502 62.648  1.00 276.01 ? 1485 GLY B N     1 
ATOM   9751  C CA    . GLY B 2 1493 ? 208.867 120.837 61.954  1.00 276.01 ? 1485 GLY B CA    1 
ATOM   9752  C C     . GLY B 2 1493 ? 210.082 120.623 62.835  1.00 276.01 ? 1485 GLY B C     1 
ATOM   9753  O O     . GLY B 2 1493 ? 210.712 119.564 62.785  1.00 276.01 ? 1485 GLY B O     1 
ATOM   9754  N N     . GLN B 2 1494 ? 210.462 121.651 63.598  1.00 279.94 ? 1486 GLN B N     1 
ATOM   9755  C CA    . GLN B 2 1494 ? 211.605 121.542 64.499  1.00 279.94 ? 1486 GLN B CA    1 
ATOM   9756  C C     . GLN B 2 1494 ? 211.352 120.512 65.593  1.00 279.94 ? 1486 GLN B C     1 
ATOM   9757  O O     . GLN B 2 1494 ? 212.267 119.783 65.999  1.00 279.94 ? 1486 GLN B O     1 
ATOM   9758  C CB    . GLN B 2 1494 ? 211.920 122.907 65.111  1.00 279.94 ? 1486 GLN B CB    1 
ATOM   9759  N N     . ARG B 2 1495 ? 210.117 120.462 66.099  1.00 294.80 ? 1487 ARG B N     1 
ATOM   9760  C CA    . ARG B 2 1495 ? 209.701 119.394 67.003  1.00 294.80 ? 1487 ARG B CA    1 
ATOM   9761  C C     . ARG B 2 1495 ? 209.773 118.019 66.345  1.00 294.80 ? 1487 ARG B C     1 
ATOM   9762  O O     . ARG B 2 1495 ? 210.149 117.037 66.997  1.00 294.80 ? 1487 ARG B O     1 
ATOM   9763  C CB    . ARG B 2 1495 ? 208.285 119.677 67.504  1.00 294.80 ? 1487 ARG B CB    1 
ATOM   9764  N N     . GLN B 2 1496 ? 209.369 117.921 65.074  1.00 299.42 ? 1488 GLN B N     1 
ATOM   9765  C CA    . GLN B 2 1496 ? 209.495 116.670 64.326  1.00 299.42 ? 1488 GLN B CA    1 
ATOM   9766  C C     . GLN B 2 1496 ? 210.948 116.218 64.188  1.00 299.42 ? 1488 GLN B C     1 
ATOM   9767  O O     . GLN B 2 1496 ? 211.250 115.029 64.348  1.00 299.42 ? 1488 GLN B O     1 
ATOM   9768  C CB    . GLN B 2 1496 ? 208.849 116.818 62.951  1.00 299.42 ? 1488 GLN B CB    1 
ATOM   9769  N N     . LEU B 2 1497 ? 211.849 117.151 63.852  1.00 312.94 ? 1489 LEU B N     1 
ATOM   9770  C CA    . LEU B 2 1497 ? 213.285 116.866 63.826  1.00 312.94 ? 1489 LEU B CA    1 
ATOM   9771  C C     . LEU B 2 1497 ? 213.797 116.419 65.189  1.00 312.94 ? 1489 LEU B C     1 
ATOM   9772  O O     . LEU B 2 1497 ? 214.622 115.503 65.273  1.00 312.94 ? 1489 LEU B O     1 
ATOM   9773  C CB    . LEU B 2 1497 ? 214.055 118.094 63.341  1.00 312.94 ? 1489 LEU B CB    1 
ATOM   9774  N N     . PHE B 2 1498 ? 213.384 117.122 66.251  1.00 320.19 ? 1490 PHE B N     1 
ATOM   9775  C CA    . PHE B 2 1498 ? 213.751 116.763 67.620  1.00 320.19 ? 1490 PHE B CA    1 
ATOM   9776  C C     . PHE B 2 1498 ? 213.326 115.335 67.952  1.00 320.19 ? 1490 PHE B C     1 
ATOM   9777  O O     . PHE B 2 1498 ? 214.085 114.573 68.559  1.00 320.19 ? 1490 PHE B O     1 
ATOM   9778  C CB    . PHE B 2 1498 ? 213.129 117.755 68.604  1.00 320.19 ? 1490 PHE B CB    1 
ATOM   9779  N N     . CYS B 2 1499 ? 212.090 114.982 67.594  1.00 327.03 ? 1491 CYS B N     1 
ATOM   9780  C CA    . CYS B 2 1499 ? 211.581 113.627 67.787  1.00 327.03 ? 1491 CYS B CA    1 
ATOM   9781  C C     . CYS B 2 1499 ? 212.375 112.603 66.982  1.00 327.03 ? 1491 CYS B C     1 
ATOM   9782  O O     . CYS B 2 1499 ? 212.618 111.488 67.455  1.00 327.03 ? 1491 CYS B O     1 
ATOM   9783  C CB    . CYS B 2 1499 ? 210.101 113.570 67.408  1.00 327.03 ? 1491 CYS B CB    1 
ATOM   9784  N N     . LEU B 2 1500 ? 212.747 112.955 65.748  1.00 339.76 ? 1492 LEU B N     1 
ATOM   9785  C CA    . LEU B 2 1500 ? 213.574 112.076 64.924  1.00 339.76 ? 1492 LEU B CA    1 
ATOM   9786  C C     . LEU B 2 1500 ? 214.951 111.843 65.537  1.00 339.76 ? 1492 LEU B C     1 
ATOM   9787  O O     . LEU B 2 1500 ? 215.456 110.715 65.519  1.00 339.76 ? 1492 LEU B O     1 
ATOM   9788  C CB    . LEU B 2 1500 ? 213.710 112.659 63.520  1.00 339.76 ? 1492 LEU B CB    1 
ATOM   9789  N N     . ALA B 2 1501 ? 215.593 112.900 66.038  1.00 351.11 ? 1493 ALA B N     1 
ATOM   9790  C CA    . ALA B 2 1501 ? 216.865 112.755 66.744  1.00 351.11 ? 1493 ALA B CA    1 
ATOM   9791  C C     . ALA B 2 1501 ? 216.712 111.929 68.018  1.00 351.11 ? 1493 ALA B C     1 
ATOM   9792  O O     . ALA B 2 1501 ? 217.594 111.136 68.367  1.00 351.11 ? 1493 ALA B O     1 
ATOM   9793  C CB    . ALA B 2 1501 ? 217.448 114.131 67.060  1.00 351.11 ? 1493 ALA B CB    1 
ATOM   9794  N N     . ARG B 2 1502 ? 215.615 112.150 68.746  1.00 354.05 ? 1494 ARG B N     1 
ATOM   9795  C CA    . ARG B 2 1502 ? 215.250 111.331 69.904  1.00 354.05 ? 1494 ARG B CA    1 
ATOM   9796  C C     . ARG B 2 1502 ? 215.104 109.851 69.555  1.00 354.05 ? 1494 ARG B C     1 
ATOM   9797  O O     . ARG B 2 1502 ? 215.476 108.984 70.355  1.00 354.05 ? 1494 ARG B O     1 
ATOM   9798  C CB    . ARG B 2 1502 ? 213.959 111.863 70.523  1.00 354.05 ? 1494 ARG B CB    1 
ATOM   9799  N N     . ALA B 2 1503 ? 214.553 109.542 68.379  1.00 349.62 ? 1495 ALA B N     1 
ATOM   9800  C CA    . ALA B 2 1503 ? 214.597 108.163 67.896  1.00 349.62 ? 1495 ALA B CA    1 
ATOM   9801  C C     . ALA B 2 1503 ? 216.019 107.723 67.567  1.00 349.62 ? 1495 ALA B C     1 
ATOM   9802  O O     . ALA B 2 1503 ? 216.396 106.581 67.864  1.00 349.62 ? 1495 ALA B O     1 
ATOM   9803  C CB    . ALA B 2 1503 ? 213.694 108.009 66.672  1.00 349.62 ? 1495 ALA B CB    1 
ATOM   9804  N N     . PHE B 2 1504 ? 216.790 108.584 66.900  1.00 359.68 ? 1496 PHE B N     1 
ATOM   9805  C CA    . PHE B 2 1504 ? 218.158 108.254 66.507  1.00 359.68 ? 1496 PHE B CA    1 
ATOM   9806  C C     . PHE B 2 1504 ? 219.041 107.988 67.720  1.00 359.68 ? 1496 PHE B C     1 
ATOM   9807  O O     . PHE B 2 1504 ? 219.864 107.066 67.709  1.00 359.68 ? 1496 PHE B O     1 
ATOM   9808  C CB    . PHE B 2 1504 ? 218.750 109.379 65.659  1.00 359.68 ? 1496 PHE B CB    1 
ATOM   9809  C CG    . PHE B 2 1504 ? 220.106 109.065 65.098  1.00 359.68 ? 1496 PHE B CG    1 
ATOM   9810  C CD1   . PHE B 2 1504 ? 220.230 108.268 63.971  1.00 359.68 ? 1496 PHE B CD1   1 
ATOM   9811  C CD2   . PHE B 2 1504 ? 221.257 109.571 65.688  1.00 359.68 ? 1496 PHE B CD2   1 
ATOM   9812  C CE1   . PHE B 2 1504 ? 221.474 107.975 63.443  1.00 359.68 ? 1496 PHE B CE1   1 
ATOM   9813  C CE2   . PHE B 2 1504 ? 222.505 109.279 65.168  1.00 359.68 ? 1496 PHE B CE2   1 
ATOM   9814  C CZ    . PHE B 2 1504 ? 222.614 108.481 64.041  1.00 359.68 ? 1496 PHE B CZ    1 
ATOM   9815  N N     . VAL B 2 1505 ? 218.908 108.821 68.759  1.00 354.99 ? 1497 VAL B N     1 
ATOM   9816  C CA    . VAL B 2 1505 ? 219.668 108.667 69.999  1.00 354.99 ? 1497 VAL B CA    1 
ATOM   9817  C C     . VAL B 2 1505 ? 219.363 107.349 70.701  1.00 354.99 ? 1497 VAL B C     1 
ATOM   9818  O O     . VAL B 2 1505 ? 220.235 106.781 71.372  1.00 354.99 ? 1497 VAL B O     1 
ATOM   9819  C CB    . VAL B 2 1505 ? 219.399 109.869 70.926  1.00 354.99 ? 1497 VAL B CB    1 
ATOM   9820  N N     . ARG B 2 1506 ? 218.141 106.836 70.565  1.00 345.56 ? 1498 ARG B N     1 
ATOM   9821  C CA    . ARG B 2 1506 ? 217.777 105.590 71.229  1.00 345.56 ? 1498 ARG B CA    1 
ATOM   9822  C C     . ARG B 2 1506 ? 218.214 104.355 70.451  1.00 345.56 ? 1498 ARG B C     1 
ATOM   9823  O O     . ARG B 2 1506 ? 218.118 103.249 70.997  1.00 345.56 ? 1498 ARG B O     1 
ATOM   9824  C CB    . ARG B 2 1506 ? 216.264 105.539 71.465  1.00 345.56 ? 1498 ARG B CB    1 
ATOM   9825  N N     . LYS B 2 1507 ? 218.719 104.543 69.222  1.00 338.38 ? 1499 LYS B N     1 
ATOM   9826  C CA    . LYS B 2 1507 ? 219.313 103.502 68.368  1.00 338.38 ? 1499 LYS B CA    1 
ATOM   9827  C C     . LYS B 2 1507 ? 218.344 102.338 68.161  1.00 338.38 ? 1499 LYS B C     1 
ATOM   9828  O O     . LYS B 2 1507 ? 218.684 101.166 68.332  1.00 338.38 ? 1499 LYS B O     1 
ATOM   9829  C CB    . LYS B 2 1507 ? 220.647 103.013 68.939  1.00 338.38 ? 1499 LYS B CB    1 
ATOM   9830  N N     . THR B 2 1508 ? 217.113 102.697 67.811  1.00 310.85 ? 1500 THR B N     1 
ATOM   9831  C CA    . THR B 2 1508 ? 216.047 101.744 67.547  1.00 310.85 ? 1500 THR B CA    1 
ATOM   9832  C C     . THR B 2 1508 ? 216.355 100.842 66.358  1.00 310.85 ? 1500 THR B C     1 
ATOM   9833  O O     . THR B 2 1508 ? 217.085 101.211 65.434  1.00 310.85 ? 1500 THR B O     1 
ATOM   9834  C CB    . THR B 2 1508 ? 214.734 102.479 67.296  1.00 310.85 ? 1500 THR B CB    1 
ATOM   9835  N N     . SER B 2 1509 ? 215.779 99.647  66.397  1.00 289.67 ? 1501 SER B N     1 
ATOM   9836  C CA    . SER B 2 1509 ? 215.873 98.693  65.305  1.00 289.67 ? 1501 SER B CA    1 
ATOM   9837  C C     . SER B 2 1509 ? 214.755 98.912  64.299  1.00 289.67 ? 1501 SER B C     1 
ATOM   9838  O O     . SER B 2 1509 ? 214.857 98.455  63.155  1.00 289.67 ? 1501 SER B O     1 
ATOM   9839  C CB    . SER B 2 1509 ? 215.822 97.261  65.844  1.00 289.67 ? 1501 SER B CB    1 
ATOM   9840  O OG    . SER B 2 1509 ? 214.601 97.017  66.522  1.00 289.67 ? 1501 SER B OG    1 
ATOM   9841  N N     . ILE B 2 1510 ? 213.702 99.602  64.725  1.00 299.33 ? 1502 ILE B N     1 
ATOM   9842  C CA    . ILE B 2 1510 ? 212.447 99.765  64.006  1.00 299.33 ? 1502 ILE B CA    1 
ATOM   9843  C C     . ILE B 2 1510 ? 211.961 101.178 64.291  1.00 299.33 ? 1502 ILE B C     1 
ATOM   9844  O O     . ILE B 2 1510 ? 212.148 101.704 65.393  1.00 299.33 ? 1502 ILE B O     1 
ATOM   9845  C CB    . ILE B 2 1510 ? 211.388 98.718  64.413  1.00 299.33 ? 1502 ILE B CB    1 
ATOM   9846  N N     . PHE B 2 1511 ? 211.319 101.798 63.309  1.00 306.23 ? 1503 PHE B N     1 
ATOM   9847  C CA    . PHE B 2 1511 ? 210.781 103.136 63.491  1.00 306.23 ? 1503 PHE B CA    1 
ATOM   9848  C C     . PHE B 2 1511 ? 209.279 103.109 63.271  1.00 306.23 ? 1503 PHE B C     1 
ATOM   9849  O O     . PHE B 2 1511 ? 208.773 102.385 62.408  1.00 306.23 ? 1503 PHE B O     1 
ATOM   9850  C CB    . PHE B 2 1511 ? 211.435 104.136 62.533  1.00 306.23 ? 1503 PHE B CB    1 
ATOM   9851  N N     . ILE B 2 1512 ? 208.580 103.921 64.060  1.00 310.80 ? 1504 ILE B N     1 
ATOM   9852  C CA    . ILE B 2 1512 ? 207.156 104.192 63.903  1.00 310.80 ? 1504 ILE B CA    1 
ATOM   9853  C C     . ILE B 2 1512 ? 206.951 105.692 63.761  1.00 310.80 ? 1504 ILE B C     1 
ATOM   9854  O O     . ILE B 2 1512 ? 207.367 106.467 64.632  1.00 310.80 ? 1504 ILE B O     1 
ATOM   9855  C CB    . ILE B 2 1512 ? 206.340 103.644 65.083  1.00 310.80 ? 1504 ILE B CB    1 
ATOM   9856  N N     . MET B 2 1513 ? 206.319 106.098 62.663  1.00 304.40 ? 1505 MET B N     1 
ATOM   9857  C CA    . MET B 2 1513 ? 206.190 107.496 62.291  1.00 304.40 ? 1505 MET B CA    1 
ATOM   9858  C C     . MET B 2 1513 ? 204.710 107.776 62.082  1.00 304.40 ? 1505 MET B C     1 
ATOM   9859  O O     . MET B 2 1513 ? 204.035 107.060 61.336  1.00 304.40 ? 1505 MET B O     1 
ATOM   9860  C CB    . MET B 2 1513 ? 206.987 107.820 61.023  1.00 304.40 ? 1505 MET B CB    1 
ATOM   9861  N N     . ASP B 2 1514 ? 204.218 108.814 62.751  1.00 328.95 ? 1506 ASP B N     1 
ATOM   9862  C CA    . ASP B 2 1514 ? 202.874 109.336 62.548  1.00 328.95 ? 1506 ASP B CA    1 
ATOM   9863  C C     . ASP B 2 1514 ? 202.887 110.418 61.478  1.00 328.95 ? 1506 ASP B C     1 
ATOM   9864  O O     . ASP B 2 1514 ? 203.586 111.428 61.616  1.00 328.95 ? 1506 ASP B O     1 
ATOM   9865  C CB    . ASP B 2 1514 ? 202.305 109.886 63.855  1.00 328.95 ? 1506 ASP B CB    1 
ATOM   9866  N N     . GLU B 2 1515 ? 202.160 110.170 60.391  1.00 339.46 ? 1507 GLU B N     1 
ATOM   9867  C CA    . GLU B 2 1515 ? 202.114 111.089 59.263  1.00 339.46 ? 1507 GLU B CA    1 
ATOM   9868  C C     . GLU B 2 1515 ? 201.437 112.398 59.655  1.00 339.46 ? 1507 GLU B C     1 
ATOM   9869  O O     . GLU B 2 1515 ? 200.411 112.398 60.343  1.00 339.46 ? 1507 GLU B O     1 
ATOM   9870  C CB    . GLU B 2 1515 ? 201.377 110.446 58.089  1.00 339.46 ? 1507 GLU B CB    1 
ATOM   9871  N N     . ALA B 2 1516 ? 202.061 113.506 59.253  1.00 357.58 ? 1508 ALA B N     1 
ATOM   9872  C CA    . ALA B 2 1516 ? 201.552 114.852 59.490  1.00 357.58 ? 1508 ALA B CA    1 
ATOM   9873  C C     . ALA B 2 1516 ? 200.163 115.035 58.893  1.00 357.58 ? 1508 ALA B C     1 
ATOM   9874  O O     . ALA B 2 1516 ? 199.875 114.568 57.788  1.00 357.58 ? 1508 ALA B O     1 
ATOM   9875  C CB    . ALA B 2 1516 ? 202.511 115.893 58.908  1.00 357.58 ? 1508 ALA B CB    1 
ATOM   9876  N N     . THR B 2 1517 ? 199.303 115.723 59.634  1.00 362.83 ? 1509 THR B N     1 
ATOM   9877  C CA    . THR B 2 1517 ? 197.939 115.982 59.199  1.00 362.83 ? 1509 THR B CA    1 
ATOM   9878  C C     . THR B 2 1517 ? 197.806 117.329 58.506  1.00 362.83 ? 1509 THR B C     1 
ATOM   9879  O O     . THR B 2 1517 ? 196.696 117.717 58.132  1.00 362.83 ? 1509 THR B O     1 
ATOM   9880  C CB    . THR B 2 1517 ? 196.977 115.918 60.389  1.00 362.83 ? 1509 THR B CB    1 
ATOM   9881  N N     . ALA B 2 1518 ? 198.916 118.042 58.332  1.00 376.18 ? 1510 ALA B N     1 
ATOM   9882  C CA    . ALA B 2 1518 ? 198.926 119.380 57.767  1.00 376.18 ? 1510 ALA B CA    1 
ATOM   9883  C C     . ALA B 2 1518 ? 200.213 119.501 56.967  1.00 376.18 ? 1510 ALA B C     1 
ATOM   9884  O O     . ALA B 2 1518 ? 201.060 118.605 56.987  1.00 376.18 ? 1510 ALA B O     1 
ATOM   9885  C CB    . ALA B 2 1518 ? 198.832 120.460 58.850  1.00 376.18 ? 1510 ALA B CB    1 
ATOM   9886  N N     . SER B 2 1519 ? 200.369 120.618 56.268  1.00 371.16 ? 1511 SER B N     1 
ATOM   9887  C CA    . SER B 2 1519 ? 201.596 120.831 55.520  1.00 371.16 ? 1511 SER B CA    1 
ATOM   9888  C C     . SER B 2 1519 ? 202.555 121.708 56.310  1.00 371.16 ? 1511 SER B C     1 
ATOM   9889  O O     . SER B 2 1519 ? 202.200 122.324 57.318  1.00 371.16 ? 1511 SER B O     1 
ATOM   9890  C CB    . SER B 2 1519 ? 201.294 121.460 54.157  1.00 371.16 ? 1511 SER B CB    1 
ATOM   9891  N N     . ILE B 2 1520 ? 203.795 121.748 55.835  1.00 348.90 ? 1512 ILE B N     1 
ATOM   9892  C CA    . ILE B 2 1520 ? 204.851 122.496 56.501  1.00 348.90 ? 1512 ILE B CA    1 
ATOM   9893  C C     . ILE B 2 1520 ? 205.378 123.559 55.550  1.00 348.90 ? 1512 ILE B C     1 
ATOM   9894  O O     . ILE B 2 1520 ? 205.159 124.761 55.739  1.00 348.90 ? 1512 ILE B O     1 
ATOM   9895  C CB    . ILE B 2 1520 ? 205.983 121.566 56.970  1.00 348.90 ? 1512 ILE B CB    1 
ATOM   9896  N N     . ASP B 2 1521 ? 206.067 123.096 54.519  1.00 346.33 ? 1513 ASP B N     1 
ATOM   9897  C CA    . ASP B 2 1521 ? 206.792 123.900 53.543  1.00 346.33 ? 1513 ASP B CA    1 
ATOM   9898  C C     . ASP B 2 1521 ? 207.129 122.960 52.394  1.00 346.33 ? 1513 ASP B C     1 
ATOM   9899  O O     . ASP B 2 1521 ? 206.732 121.794 52.393  1.00 346.33 ? 1513 ASP B O     1 
ATOM   9900  C CB    . ASP B 2 1521 ? 208.039 124.551 54.144  1.00 346.33 ? 1513 ASP B CB    1 
ATOM   9901  N N     . MET B 2 1522 ? 207.811 123.484 51.384  1.00 363.52 ? 1514 MET B N     1 
ATOM   9902  C CA    . MET B 2 1522 ? 208.279 122.587 50.339  1.00 363.52 ? 1514 MET B CA    1 
ATOM   9903  C C     . MET B 2 1522 ? 209.680 122.087 50.671  1.00 363.52 ? 1514 MET B C     1 
ATOM   9904  O O     . MET B 2 1522 ? 209.944 120.879 50.608  1.00 363.52 ? 1514 MET B O     1 
ATOM   9905  C CB    . MET B 2 1522 ? 208.262 123.297 48.982  1.00 363.52 ? 1514 MET B CB    1 
ATOM   9906  N N     . ALA B 2 1523 ? 210.564 123.000 51.079  1.00 363.86 ? 1515 ALA B N     1 
ATOM   9907  C CA    . ALA B 2 1523 ? 211.919 122.629 51.470  1.00 363.86 ? 1515 ALA B CA    1 
ATOM   9908  C C     . ALA B 2 1523 ? 211.927 121.852 52.781  1.00 363.86 ? 1515 ALA B C     1 
ATOM   9909  O O     . ALA B 2 1523 ? 212.794 120.993 52.987  1.00 363.86 ? 1515 ALA B O     1 
ATOM   9910  C CB    . ALA B 2 1523 ? 212.799 123.873 51.584  1.00 363.86 ? 1515 ALA B CB    1 
ATOM   9911  N N     . THR B 2 1524 ? 210.939 122.086 53.648  1.00 352.67 ? 1516 THR B N     1 
ATOM   9912  C CA    . THR B 2 1524 ? 210.960 121.432 54.948  1.00 352.67 ? 1516 THR B CA    1 
ATOM   9913  C C     . THR B 2 1524 ? 210.220 120.105 54.912  1.00 352.67 ? 1516 THR B C     1 
ATOM   9914  O O     . THR B 2 1524 ? 210.643 119.173 55.594  1.00 352.67 ? 1516 THR B O     1 
ATOM   9915  C CB    . THR B 2 1524 ? 210.350 122.338 56.020  1.00 352.67 ? 1516 THR B CB    1 
ATOM   9916  N N     . GLU B 2 1525 ? 209.053 120.024 54.259  1.00 345.01 ? 1517 GLU B N     1 
ATOM   9917  C CA    . GLU B 2 1525 ? 208.416 118.716 54.118  1.00 345.01 ? 1517 GLU B CA    1 
ATOM   9918  C C     . GLU B 2 1525 ? 209.283 117.809 53.252  1.00 345.01 ? 1517 GLU B C     1 
ATOM   9919  O O     . GLU B 2 1525 ? 209.385 116.605 53.507  1.00 345.01 ? 1517 GLU B O     1 
ATOM   9920